1MRNA

Crystal structure of mycobacterium tuberculosis thymidylate kinase complexed with bisubstrate inhibitor (tp5a)
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
208
structure length
208
Chain Sequence
b'MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAELAGERSRGRAQRDPGRARDNYERDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate Kinase
publication title Enzymatic and structural analysis of inhibitors designed against Mycobacterium tuberculosis thymidylate kinase. New insights into the phosphoryl transfer mechanism.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 75
structure length 208
sequence length 208
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2002-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1mrnA00
2O8DA 4IDOA 4NCKA 1P4SA 4US2R 3TBKA 4ZV4A 2F9LA 3RDPA 3GLIE 3C15C 1E1RA 2H7VA 3I4LA 4A0HA 2FNAA 4YDHB 2BIFA 3TE6A 4BFXA 1QVAA 2LKCA 2GEDA 1ZM2A 1KSHA 3CBQA 3DVLA 2IYSA 4D2IA 4ZI2A 1LS6A 3I72A 2CHGA 4NP6A 3PR1A 4FCWA 4JLBA 5IT5A 3PUWA 3U7HB 4D26A 3A6PC 2ZSDA 1G291 2O8CB 4PO9A 4YXWA 3H0KA 1YZUA 4G0NA 1JJ7A 2NPFA 1RE0A 3OIYA 4Q9JA 4A9AA 4ZIRB 2D7DA 2NMVA 2GNOA 1S0UA 5IK2A 2CK3A 3K9LA 4LY6A 2KBFA 2HT1A 5FTNA 4N0EA 5JSZA 1FPMA 2OV2A 1Y63A 3CX8A 4R2IA 1E9EA 5KSOA 2QI9C 1HEIA 1GNQA 1PVOA 5JEEA 3TW4A 4E09A 3NBYC 2NIPA 3CPJB 2ORVA 1NLYA 1Y3AA 1WE2A 1ZM3A 4BRWA 2OBLA 1KK3A 3C7KA 4R71A 1E2JA 1VTKA 2QP9X 3FMFA 1W0JD 1N5IA 2QMEA 1CBUA 3A1UA 1VCNA 1FW6A 5J4KA 1YRBA 1E0SA 3QKRA 1E2EA 2ZRAA 4RY2A 3C5CA 3AVTA 4JVNA 4AY2A 2XZPA 1TF7A 1LF0A 1E3MA 1GKYA 3NBXX 5KPDA 1D9ZA 3GLIB 4QBHA 1OKKD 1F3OA 3P4YA 5EXPA 3KJEA 1ESMA 1F2UA 2WPDA 3HP1A 4PPFA 4A36A 2N1BA 2H57A 2OFOA 3ICQB 2O8FA 2RKOA 1F2TA 2QP3A 3MJRA 2E1RA 2GVDC 3W3ZB 4IXMA 4E5UA 1XTRA 4DDVA 1G4AE 1IHUA 3A36A 3RYTC 2F43B 1SVMA 2VP2A 2ZS7A 2WWWA 5AR1A 1N6RA 1GUAA 1Z22A 1G1MA 3UPUA 3UWOA 1E2LA 4B73A 1DAHA 1G7CA 2IYXA 3A58B 4UNSA 4ESVA 3ZGXA 1HH4A 2BKEA 2YOHA 3THYA 4D6PA 1GRRA 4RVCA 1Z3IX 3LQRA 2OILA 3AF1A 2CVHA 2EFEB 3PVSA 4PHHA 3SEAA 4TQUS 3EX7C 5G3ZA 2QTVB 2YV5A 3NG1A 2ORIA 5JBQA 5KDOA 3M0EA 1JI0A 2BM0A 2X8AA 5CJ2A 5JMTA 4Q00A 3DDCA 4OKSA 2ZI3A 3OFNA 5FOUA 2FE4A 4FN5A 1WP9A 1K6MA 3U3JA 2FH5B 4HAXA 1ZUNB 3T1VA 1F5NA 4ZDIA 2O8EA 4B34A 1N25A 2G88A 5H68A 3SYNA 4PZYA 3HJNA 4R2HA 4P3YA 3H4MA 3B7GA 3SYLA 1KMQA 3CNLA 4HZUB 3QG1A 4EFNA 2PZFA 2OFWA 1QVRA 1NMYA 1TQ2A 2OXRA 3WBKA 2WIAA 2C9OA 2FF7A 4PAOA 2NO1A 5BN5A 1LB1B 1M7HA 4ASUA 1T9HA 3U4QA 4TMZA 3SJCA 2JLXA 1H8EA 2RH5A 3ND9A 3MMPA 4TL9A 2FGJA 1II0A 3CH5A 4QHTA 2AHOA 1TQDA 1E1QD 3AVQA 1OFHA 2WWHA 3MD0A 1Z8FA 2JATA 1GG2A 2AD5A 1CJVC 1AKEA 1P5ZB 1UPTA 2EW1A 4NCJA 1X1SA 4EQ6B 121PA 2ZJBA 4LV6A 4Z8XA 2D3WA 2GBLC 3TLXA 1X3SA 3I5YA 4OBEA 1X8LA 2OHFA 4AK9A 1EXMA 3BFXA 4EIWA 1P73A 1LNZA 1QG2A 4TL7A 5ANRB 3JZMA 3QKTA 4M1KA 4BFZA 1RYFA 3KKPA 2J7PD 2EVWX 3PUXA 1NP6A 2J3EA 4O3MA 3BORA 3B9QA 1PLKA 4AI6A 1IXZA 1WB9A 1Z0FA 1W49A 4NE2A 3CRVA 4QHYA 4TZ0A 2IYLD 1XNJA 2WICA 2IYRA 3NHAA 3WBJA 1XEWX 3OEHD 2GBLA 4FCTA 5C46F 1RC8A 2IYUA 4NYIQ 1XJQA 1HQYE 2JDIA 1E2NA 4D4KA 1PLLA 1ZBDA 3KJGA 4Q4HA 2R6FA 4WBSA 3CNNA 3RRNA 1IONA 4MKGA 3SNHA 3NC0C 4HATA 3WMEA 1IN7A 2OO7A 2ZUDA 3GQBA 3RC3A 5F9HA 4LHYA 4JBYA 4TMVA 4ERNA 3IIJA 3KFXA 2XZLA 3NKVA 1XMVA 1UJ2A 3QJYA 1GNPA 1BOFA 2AFHE 1CLUA 2DFNA 2I1VB 3DZDA 1KJYA 3SC3A 3AF2A 1E79D 3H1TA 1N0VC 3B85A 3U44A 4KFUA 4Z1MA 3TKLA 4DEYA 1C1YA 1PLJA 1A1VA 4UXIA 1NMZA 4TZ6A 3AEZA 4Q7LA 5TARA 2CLDX 4JL8A 5DO9A 4DJTA 1M6NA 2ATVA 4TTQA 5EP2A 2QPAA 2XNDA 2IXEA 2Z6VA 1SKYE 4DB2A 1UKZA 4ZDJA 4MYUA 4WOPA 4ON9A 4PSVA 3UKDA 3U7FB 2E87A 2FG5A 4TL6A 1M8PA 2CNWA 1FP6A 1G7TA 4KVAA 1Q1EA 1HE8B 2QE7A 4ITRC 1RW4A 3DKVA 1XDBA 1RRGA 3DM5A 1I2DA 3GLHE 2GEVA 2P3SA 3EIHA 1N0UA 1D9XA 5TV2A 2IT1A 1S1MA 1VHLA 1J2JA 3U7GA 5A0FA 2CMKA 4CW7A 4YONB 3GLFB 3ZIAA 4D82A 5TB5A 5KYKA 4NDZA 1XMIA 2L0XA 4IOKA 4TSFA 2AKYA 4LDJA 2XTZA 4A2PA 4D81A 1X6VA 2FA9A 5EP4A 1RJ9A 4KFSA 4UJ3A 1BMFD 3B2EA 2ECKA 1US8A 3BWDD 3QEOA 4EUNA 2PJRA 3EARA 4H1VA 4LI0A 4M21A 4AG5A 3AGPA 3WNCA 4CT4B 2R9VA 3EPKA 4YMWA 1UDXA 2ZVPX 3QPUA 2P65A 1D5CA 1FUUA 4HDCA 4X8HA 1Z0IA 2FFHA 4QBGB 5L3QA 5GJBA 1E0JA 2J5XA 3G82C 1Z28A 5JI3E 4V03A 1J90A 4JSYA 5BN4A 1Z0JA 3I1FA 1SKYB 5DE3A 2RGEA 1R6BX 2ZANA 4B33A 5KO2A 1U94A 4OI1A 3HU3A 2ZAOA 3LBNA 5P21A 1OXXK 3MAAC 3QF4B 2ZIAA 4FMCB 3DOEA 4U02A 1TEXA 2ZJAA 4LYAA 4CYMA 1E9CA 3BBPA 2QGNA 2ZJ8A 5EZ5A 3GLHB 2F1IA 2GWHA 2ODNA 3MWYW 3RVBA 4LCBA 3GJ5A 1CF4A 5J47A 2GZHA 2IEYA 4KU4A 5CDFA 4LV8B 3LW8A 4HB3A 4Z8YA 3OEED 3W6OA 3HYTA 1Z0DA 3D6TB 4UXHA 1XD2A 2YHSA 3LY5A 1KDRA 4ZKEA 1N6OA 3ZVLA 2WAYA 4QL3A 5J4VA 2EWVA 4Q03A 1XPOA 1XTQA 1P7CA 4C7OA 4MRVA 3CUEF 4O0MA 4M9QA 1AA9A 1WCV1 1IN4A 1XJCA 5FI1B 4OQFA 4QJ3A 1W2GA 1ZCAA 2W0SA 3JZAA 4GOJA 3DEFA 1E9FA 5D3QA 3VX3A 1DPFA 3W8NA 3U3OA 1KTVA 4HUQB 5BQ5A 4GZMA 1VG8A 1YVDA 1EFCA 1KAOA 1GITA 1FQJA 4LJ6A 3K1JA 1ZRHA 3CRRA 4GMXA 3OIVA 3D3QA 4KSBA 1CKEA 1R10A 3LO5A 5FPSA 4ZCLA 3HDTA 2AL7A 3CF6R 3S1AB 1FX0A 4OHVA 4B3DA 1IXSB 1AM4D 4V02A 3VR2A 2QAGB 2RHMA 2GILA 3K0EA 4PANA 4TN1A 3MSXA 2RGNC 2XAUA 2ZR0A 3UXMA 4BECA 2BBWA 2R44A 3K0FB 5LD2B 2DWQA 1E2GA 2HJGA 2FSFA 4UKDA 4CF7A 1SULA 2GJ8A 2HUPA 2VSXA 3VR6A 2EFHB 5IRCD 3BJIC 2OBMA 2XTNA 3AP1A 2UKDA 2PEZA 3QE0A 1W2HA 3ADDA 2IYQA 1NF3A 1XD9A 4A8JB 2VP4A 1KI6B 4NYMQ 2J59A 5E7IA 2J1LA 2VIIA 3K09C 4GFDA 5FR2A 3AVUA 1NIJA 2SHKA 4OJKA 1OYWA 3GD7A 4NTZA 1T0HB 3K8YA 2RGNA 4FWIB 3R9WA 1DS6A 3WY9A 2K5UA 1R4AA 5HKKD 2WWFA 3NIBA 4I81A 1SXJE 3T61A 3UANA 4KLZA 4Q5IA 5AJVB 2F7SA 1W0KA 4D0LB 2NG1A 1AZTA 2IXFA 3CWZA 3KUCA 3ZZUA 5HR5A 4PO1A 2WTUA 1LY1A 1FOEB 2CL0X 3LLMA 2FMXA 3K09A 1NI3A 4GL2A 2B6HA 4A2WA 1LTQA 1OYYA 4NH0A 2EYUA 4EPTA 4JL5A 2BM1A 2FV8A 4LZZA 1W4CA 4RD3A 2GJAA 5FBWB 3EC2A 3IBYA 221PA 3B1ZA 4BE7B 4F92B 4LJYA 1ZD9A 1EX6A 2GESA 1E1RD 1LFDB 5FPKA 2O0KA 1VIYA 5CB6A 1Z0AA 1L7VC 4NCHA 2IYVA 2QP4A 3GEHA 4QG7A 3KQUA 4MYHA 4XWKA 3SQWA 1BH2A 2MSCB 1KK1A 1Z2AA 2MSEB 2GAAA 2IUSA 2WIBA 4YXWD 1ELOA 2GRJA 1E9AA 2GJSA 2PCLA 2KJQA 4JKIA 5IK2D 2CK3D 4X8MA 3SFZA 3T5DA 2BMFA 5AUNB 1NVXQ 2WBLC 1EFHA 2Q3FA 3C14C 1SXJB 1X8KA 3KKOA 4G3XA 3U6BA 3W6NA 2QQEA 1IXRC 4Q19A 4S2EA 2ZI9A 1KDOA 2ZREA 3CB4A 4NYIR 1P60A 5J4HA 1TTTA 2BKUA 3FYHA 1W46A 4LHVA 2VF7A 1JR3E 1KJWA 2WKQA 2UVQA 1FMLA 2A78A 3A1VA 3CONA 4LBZA 5J5CA 2HV8A 2R65A 3HWSA 4MDEA 1GZSA 4PAMA 1MR3F 4F7WA 5C2JB 1E94E 1ZJ6A 2QG6A 4NMMA 2VH5R 4QOSA 1JAHA 3UK6A 2W6JA 3CLVA 4M1OA 4XSGA 5FTJA 2GVZC 5JJLA 1KKMA 1BO6A 2H17A 2WPDD 4IOLA 4JLNA 1U0HC 1AS3A 1UBGA 2OCBA 4CEIA 6Q21A 1KI9A 3SJAA 2V6IA 4IVPA 1R5NA 1N6PA 1E4VA 3K0AB 1WBBA 4P32A 1S9DA 4RSGA 4GSYA 1QHYA 4A15A 4LPSA 4TQAA 3U5ZB 1G3MA 5H1YA 4QJ5A 1Q3TA 2V1XA 2Z43A 3LNCA 1BS1A 4DUGD 1N6KA 1N0WA 5AWFC 2GCPA 4PC6A 1P3JA 5DYIA 2QORA 1XTIA 5J4LA 4AIIA 1SQ5A 3ZLJA 2HXSA 3UG6A 2E9SA 1D8TA 2CJWB 4URXR 1VYTA 3OFND 4PAQA 3PEWA 1ZU5A 4JLKA 1IY2A 2ZRFA 3KJHA 3GJ0A 1ANKA 4EKDA 1P62B 2DFKB 4BLTA 3PUYA 3I92A 5FH9A 2ZPTX 2ZI5A 4JT4A 1Z6AA 4DT1A 3SOPA 4ACBA 5D3MA 1KY3A 4Q47A 1TAGA 2RGXA 2IYYA 1RRPA 3LBIA 4JLVA 1L4UA 2R6DA 1AZSC 1Q0UA 2BBOA 2Q3HA 1CR2A 4ASUD 3E5HA 4FCVA 1WRBA 4HLDA 1OH8A 4TQ9A 1H8ED 2GF9A 3X1DA 1CRQA 1JAIA 4OJQA 3X1WA 3CZQA 5FUWA 2OAP1 3QF7A 2G3YA 2XJ4A 5EZ6B 5B58C 5G3YA 1KDTA 2RHDA 1OXUA 5KDDA 1HE1C 2V8OA 4A2QA 1G20E 2P67A 2ZAMA 4L9SA 1M2OB 2RGCA 4M1SA 4OL0A 2R6AA 4BLRA 1O3YA 3BOSA 1XMSA 3RS4A 1P2VA 4MKFA 4FWTA 2PT7A 2VPPA 2WOJA 1SVKA 3ZDQA 1Q1BA 1XBTA 2ZJZA 2J0QA 2JJ1D 4RD2A 3V4RA 3OIWA 2GKSA 4Q4AA 4KVGA 3IPYA 3AUXA 2XXAB 1M74A 3QUSA 4C0BA 1R8SA 4BLSA 4IVQA 1TADA 2FSGA 2V3CC 2HF8A 4Q01A 1OXTA 4HAVA 1J8MF 2XJ9A 4L16A 1ZNZA 1OB2A 1GKUB 4TWZA 3L43A 1T6NA 2R62A 5E7MA 5JWHA 2IYZA 4DSTA 2F1RA 1AQYA 4UNQA 1N6IA 3T15A 2JDID 4P4SA 5JRZA 2ZSAA 3ZD7A 3TAHA 1D2MA 2CCKA 3IQWA 2D74A 4PPNA 1BYUA 2AXNA 3BH0A 1UADA 4R7ZA 1RKBA 3NEJA 1KKLA 3BFKA 2NO6A 1GNRA 1HT2E 1U9IC 2IK8A 3M1IA 1EX7A 1GTVA 2HDNB 3TSWA 3ADCA 2FSHA 2IS1A 4L4UA 3B5JA 1I4DD 5CM9C 3X1ZA 5CIQA 4HLQB 2CLSA 3VU9B 4O2RA 4JVMA 3W9YA 4Z1MD 4R98A 1GP2A 4B3XA 1CIPA 1IN5A 4M0LA 3R20A 1NBMA 2H92A 4Q1DA 3KQHA 4K8OA 1XWIA 1YU9A 3OE7A 4PC7A 4CEJA 2XNDD 1EFRD 2RMKA 1PUIA 2JCSA 3LDAA 5K8TA 1U9IA 4NYMR 3W5JA 4EPRA 3BC1A 1VYUA 3FKSA 2CNWD 3C41J 3FVQA 5CLQA 4BUJA 2JLUA 3EXAA 4ILEA 2OESA 1QRAA 2J46A 2PL3A 2QE7D 3DM9B 2F9MA 5J4YA 3FOZA 3DMDA 4IDNA 2IYTA 5F98A 3IPXA 3PEUA 5DLQC 1UF9A 3W6PA 1Z83A 1KI8A 2C96A 3E70C 2OCAA 2REXB 4KHZA 4B3FX 3EW9A 3FFBA 1Q21A 3NC1C 4N1AA 4D4MA 3ZIAD 2A5DA 1GL6A 3WYGA 2ZRDA 1U81A 2ZQ5A 3T1TA 1XEXA 1FNNA 1G17A 1Q12A 1KAGA 2WJJA 3QVVA 1R0ZA 4TSFD 4V0KA 1P9WA 3KB2A 1CR0A 3O47A 3Q72A 1GVNB 2BMEA 4RD0A 3W5IA 1D2EA 4B48A 1H8HA 1N5LA 1ZVQA 1L8QA 4MUBA 5ELXA 3ONWA 4XVQA 3THXB 3IILA 2ZI6A 4A0GA 3E1SA 4RFVA 4DDWA 2IX3A 1A7JA 5DHAA 4PO8A 2W83A 4ZDWA 1XZPA 4C0KA 1HA3A 5JCZA 3FMIA 1TUIA 2AWNA 2VHCA 1E0KA 4BZXA 2FEMA 5DN6A 3AVOA 4QC2A 2BEJA 1HTWA 3FWYA 2CXXA 2QT1A 2O5VA 2WWGA 1JR6A 1XB2A 2ERYA 3A4LA 3BERA 4LWZA 4YDSA 3UMSA 1VMAA 4Q4JA 5JZVA 5DNYB 5EP1A 3KQKA 2V7QA 3MCAA 4AYWA 2ZVQX 3QKSA 3ND8A 3EG5A 4A6PA 1HY3A 2IS2A 1IN6A 1SHZA 1X86B 2YWHA 1VHTA 3EA5A 2CVFA 1DAGA 3BK7A 2OLKA 1E2FA 3QSYA 2IHYA 2ZITA 1ZAKA 2O0JA 2KE5A 3NDBB 2YC2C 4II7A 4B35A 1JBKA 5TXGA 4C2UA 1ZUHA 2XITA 4DUGA 2H1LA 3QQ5A 1FFHA 2G83A 2WWIA 3R7WA 4DLUA 4FW9A 1OJLA 1XCMA 3CW2A 3DKPA 1OH7A 1QDEA 5HE9A 1VCIA 2YYZA 1W36B 1E69A 2CHVA 2YVUA 4IEEA 4DLYA 1P9RA 2R2AA 4KXFB 3TUIC 2PX0A 4DLTA 2YKGA 3LW7A 3RHFA 1FQKA 3KQLA 1UBCA 2ODEA 3PFIA 3BS4A 3JVUA 3CPHA 1G41A 3EIQA 3IIMA 4LYJA 3SZRA 2ZI7A 2HF9A 4QHSA 4OQLA 4URZR 3AV0B 2C5LA 5KSYA 2ZR7A 4MQBA 2ZUBA 5H70A 3SYKA 2PLFA 1LS1A 1ZP6A 2D7CA 3I5XA 4QXAA 3FHOA 1KO5A 2AD1A 2NGRA 2REBA 4HAYA 4XVUA 1AS0A 3EASA 3FE2A 1JPJA 1OE0A 2HT6A 1KSFX 2CCGA 4F91B 1G6OA 1KOFA 1UAAA 1GAJA 3SJBA 4DCUA 5L3VA 2ZM5A 4JS0A 4RD6A 2C9YA 4PQRA 2Q6TA 2OXCA 3B6EA 3R8CA 5K8LA 4W7SA 1N2CE 3OF5A 4DLVA 1N6HA 1FNMA 2JIZA 1NSTA 1NRJB 3V00A 4C0HA 1QBKC 1NJFA 1T5IA 2AWOA 3IEVA 1OSNA 2ZXUA 4P31A 3TSOA 2QM7A 3CZPA 5BWMA 2JAQA 2WM9B 1AKYA 1FZQA 3PEVA 4GBMA 4XD7A 2O8CA 1NLFA 3REGA 2GJKA 1XFAA 4ZIRA 4JBXA 4TLEA 2JJ1A 3CR7A 4TYYA 1BKDR 1W0KD 1CTQA 1W4AA 2P6RA 4C30A 3NXSA 1QG4A 3DOFA 1W47A 1A4RA 3TUZC 5DIFA 3QVUA 3PJRA 3L8YA 3SBEA 1GKIA 5JWOA 1FTSA 4JVSB 1E96A 2IL1A 2JLWA 3T1OA 4JL6A 2VP0A 3ZJYA 2V54A 2ZEJA 2FGKA 4LC0A 1U8AA 3GP8A 4WAUA 5GADl 1A2BA 2YOGA 2BJWA 4RZUA 1E32A 1IAQA 2WJYA 3FMOB 2ZSBA 1ZUIA 1A5TA 2GXSA 3L0OA 5EE3A 3SHFA 1NMXA 3GLIA 5C4MA 1N6NA 3KTAB 3VKGA 3VNVA 1CJMA 1Q3HA 5BW8A 2GDJA 3B9PA 3BD9A 3LLUA 2ANCA 4LYFA 1NIPA 1J70A 1KY2A 2ERXA 2QMHA 1E2IA 3U61B 2JJ2A 3MWLA 2GCNA 1Z29A 1QHHB 3PIRA 3SU8A 2F43A 1K5GA 3B78A 4UNNA 1IJEA 2VF8A 2X1VA 3NWJA 2BJVA 1SVSA 3BAFA 2QBYB 2ZE5A 4D0GA 1EFRA 2J87A 2N42A 3MG9A 2X2FA 4BEJA 1ZC4A 1W44A 1G8YA 5EUMA 2HCJB 5FL7A 4B3GA 3L82B 1E9BA 1KJZA 2FWRA 2PCJA 4GOXA 3W8RA 3UMFA 1E2KA 1CRPA 1PZNA 2BBSA 1SVOA 2QY9A 3CF2A 2BEKA 1OHHA 3U60B 4AKEA 4AKGA 4OK3A 4BLQA 2C78A 3ETLA 3QKUA 4MH0R 4WXPA 2W6JD 4G01B 5KNDA 1OXSC 2GJ9A 3QNUA 4OHYA 4RKFA 1ZNYA 2JEOA 4LGMA 4PPQA 2J0UB 2KBEA 5BXQC 5FTKA 3GEIA 1HYQA 3K9HA 3I8XA 4IVRA 3DO6A 4OK6A 5FFMA 2DB3A 3FMPB 3IHLA 4MKIA 4DLRA 2RGAA 3GJ6A 2JLRA 4ARZB 4HZUA 1YJ5A 1Z6TA 3D8BA 2VA8A 3IDQA 4KBGA 2MSDB 1OB5A 1E9DA 3THWB 2QTFA 4CEHB 4C9BA 5CJPA 1E9RA 2ZRJA 2FEOA 4GDFA 4B43A 1CR4A 1CR1A 1ZCBA 5EE5B 4V0LA 5F9FA 1VECA 3GFPA 3HYRA 2A5JA 3CH4B 4M2LA 4GI7A 1NSFA 1MO5A 4JIMA 1XEWY 3VR4A 4PSAA 2XOKA 4B47A 4F4JA 4WVFA 1KMHB 4BFYA 2OCPA 4IFBA 3EIEA 1RYHA 2Z0MA 1KO1A 2QENA 5FR1A 4EQ6A 4LJ9A 2ZRNA 4MGYR 3MRSA 3AF0A 5HCIA 4IXNA 4TL8A 4DKXA 5CLLA 4WZ6A 1X8JA 1CULC 3AKEA 4DC9A 4M9XA 5FBVB 4V0ME 2GAOA 4PQYA 3RRMA 4GOKA 1DELA 3QBTA 4J0QA 2O8BB 1Z0KA 4U7DA 1CJTC 4OI2A 3AVVA 1G3RA 3H84A 4CT5A 1WF3A 2NTYC 1E99A 2YNMA 1AN0A 1E2PA 2A30A 4QJ4A 3O8CA 5L8VA 3LA6A 4TTRA 4FIDA 3ZH9B 4M9SA 3VMFA 4B2LA 4UNRA 3ZD6A 2Z4SA 4B2PA 2XGJA 1P72A 4NKRA 5BYJA 1J8YF 4JLAA 3SHWA 4ESHA 1D2NA 1SGWA 1W1WA 4QNRA 2GCOB 4JYBA 1XXHE 3MGCA 4U00A 1E2DA 3C5HA 2HJVA 3RWOA 1R0WA 2W6IA 3VR5A 3RWMB 2V55B 1Q20A 4AG6A 2X2EA 1X1RA 3QXXA 1G4UR 1XEFA 3I73A 4DCVA 2ONJA 1DEKA 4DLZA 5DISB 2ZRGA 3WP0A 4BLOA 4IHQA 5FL3A 2GZDA 4C3ZA 2AKAB 3U6KA 3CX6A 1RVDA 2AFIE 2CCJA 3VAAA 1E98A 3AVPA 2H16A 4OQNA 3DZ8A 4LHXA 4HAZA 5M04A 2EFCB 1II8B 3Q8XB 4JJZA 4NHOA 4DCNA 3NEYA 4GP6A 2VP5A 1QF9A 5L3SB 1OXVA 4DRZA 1KYIA 4NCNA 2KWIA 3U3MA 3H86A 3QBVA 4Q7KA 4UNPA 4FINA 4XH9B 1II9A 4PQFA 4A6XA 2QA5A 2IHBA 3ZVRA 2WMOB 1ZIPA 5DSZA 2V4ZA 1SVLA 2ZRBA 4XSHA 4W5JA 2V9PA 5JHHB 4W5WA 2QUZA 3AKYA 4NYJR 4DSOA 2B21A 4QGGA 4EFLA 4Q7JB 1VYVA 2FU5C 2FX3A 4I1SA 4NZYA 1TNDA 5C4GB 2J0VA 3LRPA 1YKSA 3GLFA 2P6UA 2RCNA 4B71A 1Q44A 2OLJA 2VYFA 1XXHB 2CBZA 1QZXA 2A5YB 3QXCA 4HB2A 4AYXA 2D2EA 1Z6XA 3CRQA 2IYWA 4WZAE 4DCSA 4E07A 4TMKA 5E95A 3RAPR 4Q9LA 2PMKA 4Q1CA 1T8UA 4G1UC 3W90A 1NBMD 2EQBA 1MO6A 2DWOA 1NVVQ 4V0OA 3I62A 3GMTA 2AK3A 3VR1A 3OE7D 5DI3B 3ZYCA 3K0CA 1T3HA 4K46A 2WKPA 3V4FA 5J40A 5HPYB 1XTKA 2VSOA 4ZDKA 3FKSD 2FN4A 4RZ2A 4RJLA 4Q02A 5LDDC 2F3RA 3GLGE 1XPUA 1QHSA 3LBHA 4AKIA 2G0NA 4URVR 4G5RA 1G7SA 1TQ6A 3EZ7A 4GT1A 5DGXA 2QM8A 3QF4A 4MDFA 1KSJA 1UDWA 2WMNB 4JT2A 4EJSB 1OH6A 4TMTA 1DVRA 2GXAA 2WJGA 4HZIA 4UQOA 3GLHA 4DLWA 4TLCA 5JWRA 4B6FA 4DDUA 1P75A 4MRSA 5EP3A 1XCGB 2IA5A 1XTJA 1MKYA 4GZLA 4RD4A 1QHIA 2PMDA 3G5UA 3TH5A 4GNKA 1VIAA 1H8HD 4JLPA 4MGZR 3WP1B 4YMVA 1E0AA 2IWRA 1W4BA 3KKMA 1L2TA 3AM1A 2OT3B 4LJ8A 2ZRCA 3KKNA 4OQXA 1XP8A 2VHQA 5E3HA 1CJUC 3QG5A 1BYIA 1G5RA 3K70D 4I1VA 1U99A 1PJRA 2QRNA 2QAGC 1Z6YA 1YHNA 3MFYA 3X2SA 2EWWA 2ZE8A 2EYQA 1JXOA 4DDTA 5DN6D 3LH5A 2BDTA 4TLDA 5JECA 4HUQA 3T1QA 1R8QA 1JEEA 5GJCA 5K8IA 4IEIA 3KL4A 1KNXA 4TYQA 4NONA 3RLFA 2Z5FA 2WZQA 3GLGB 1KI4A 2BBTA 1IOZA 5IF9A 4ZI3A 2YWEA 2V7QD 3S1AA 5FBRB 2WKRA 3QEJA 1K5DA 1DO0A 4A8JC 4FXPA 2W0MA 1MOZA 4P4TA 2QAGA 3ASZA 2F1JA 2B8TA 2XX3A 1V43A 2XSZA 3SR0A 4Q66C 3TSZA 3WYFA 3RRZA 3K0FA 2PZEA 1IQPA 3EC1A 2VHTA 1IY0A 1JB1A 1MABB 4JBWA 1COWA 4C0SA 1KHTA 3QY0A 4DIEA 1XJ0A 2RGBA 3UMRA 4RD1A 1C9KA 4N3NA 4RFSB 3D31A 2W00A 4A8JA 1KI6A 2VP6A 1ZU4A 2YOFA 4HYYA 4C0AC 3GLFE 1NY6A 1LV7A 1ZYUA 1DAIA 2O8DB 1MRNA 4PC3A 3SJZA 3FB4A 2XTMA 3NVAA 3CNOA 4MGKR 5EJEA 3HU1A 2ZUCA 2J0SA 4TT3A 3TQCA 4JZKA 2VLIA 3A8TA 1VG1A 4HAUA 4JJKA 3LQQA 1FUKA 3MWKA 5AJWA 4BASA 4M1MA 3RS7A 2A5FA 3FGNA 3GJ7A 3NBFA 3DHWC 3C8UA 4YC7A 4O25A 1G8HA 1S1CA 2ASEA 4X8OA 4OHZA 2ZRKA 2VHJA 1H65A 4H1UA 4F93B 1ZINA 2X77A 4P33A 1G8GA 3EZ2A 3ECCA 3R9IA 3SE0A 4A82A 4QM6A 4POAA 1OPXA 1C4OA 3OZXA 2QNRA 3J81k 3IO5A 5JSZB 5K8UA 1OF1A 1XU4A 3KXKA 5G41A 3Q7QA 2JASA 4RCYA 3P1JA 4PZZA 3F0TA 5B30A 2JIZD 4YMTA 4UXJA 1DBSA 2ATXA 3U3RA 4C0JA 5CK5A 4BFVA 4IFEA 3KZ1E 3TGPA 1NVUQ 1E4YA 4AKHA 1CS4C 1NG9A 1NKTA 3BB3A 5F2EA 1JQLB 4XD7D 5JHGB 2ZS9A 3QKRB 4XOIA 4E22A 1HUQA 1WBDA 4BZQA 3X1YA 1RPZA 3U7EB 3OESA 4PPGA 3TVDA 1SZPA 3FDIA 1OIXA 3EWSA 3UATA 1J7KA 3B60A 3NHBA 4NCIA 1SXJA 2DPXA 2NO0A 4NPHA 5SZJA 1T0JB 4QBFA 2UZ3A 3CF0A 3CM0A 1F2UB 3SBDA 5E4FA 2O8FB 3W34A 1XCPA 621PA 1F2TB 2WSSA 2Q9AA 2FDCA 4OI4A 3AVWA 1M7GA 1ZW6A 2WWXA 3AKDA 3VFDA 4FMCF 3VX4A 3OHMA 1F60A 4JSTA 4PSKA 4HB0A 4OHXA 2KB0A 4MRRA 4B76A 4EPYA 2ZYWX 3TR5A 4EPWA 2HLDA 5JS7A 2XB2A 3RS3A 3B13B 1F48A 3THYB 3PUZA 1TEVA 3C4JA 4N0DA 1UBEA 2GEUA 4B44A 2IF0A 3RSOA 5AJZA 4KJZA 3EWAA 3SQXA 4Z51A 2DR3A 2P2LA 3PXGA 2BCJQ 1DARA 3P27A 4GP7A 2G9NA 3KXIA 1OFIA 3FHTA 4MUAA 2JJ2D 1Z5ZA 3FKQA 4M1TA 1KI2A 2FZ4A 2DHRA 2G1JA 2IBMA 1R5BA 5HZHA 4OQMA 4D4JA 1YR8A 2ZU0C 3K0AA 4TMXA 2IUUA 1IN8A 3GJ3A 2O8EB 4NU0A 4LX0A 1YZNA 2BOVA 3VKWA 3N2IA 3WNBA 1K8RA 1AIPA 5DHFA 1WXQA 5FOWA 1OFTA 3DPUA 4DEXA 2IW3A 4KFTA 4QKQA 1W7AA 1KI3A 2C95A 2ZTSA 5CITA 2PH1A 5FL7D 5IHPA 4DIDA 3CPEA 5TDHA 1KK0A 1AQUA 1A2KC 4DWJA 4I1UA 1Z47A 5FPYA 1W36D 4Q9HA 2BHRA 1OHHD 2ZYUX 2CJWA 4F4CA 1JR3A 5SZIA 2G1KA 3U4QB 5EE0A 2V6JA 5A4JA 2VSFA 1GL9B 4H9GA 3K70C 1G3UA 5AUQA 4CVNA 5HCNA 1KDPA 2PX3A 2QQ0A 2ZJ5A 4KYIB 1M7BA 4JLMA 3RANA 1P6XA 4EPVA 1JALA 1ZD1A 3PEYA 1EGAA 1NVVR 3TIFA 4MITA 3EZ9A 1W5SA 4LJ5A 3LAWA 3Q9LA 521PA 2AX4A 5C1BA 2NO9A 3FHCB 2ZRHA 1G9XA 4A0RA 4Y0AA 1Z63A 4KO8A 1KO8A 3OAAA 2ZRIA 4BFWA 1GSIA 5JEDA 2J7KA 1KZGB 4C2TA 3TW8B 2FFBA 4LOAA 4CDGA 1ONBA 4IKEA 3ADKA 2VHUA 1GDDA 2XOKD 4HDOB 3CKLA 1I4TD 3GJ8A 4QNMA 4FMDF 1S8FA 3EPHA 2GK7A 2DFLA 1VCOA 4JVLA 3A37A 2OCYC 3AF4A 4LBYA 3D7MA 2QTHA 1S9HA 3GJXC 4Q4HB 1G7RA 3KUDA 1MRSA 4PC1A 2RB4A 4TYNA 1NLZA 5KSPA 3PENA 1ZM9A 2XXAA 1VKJA 3NDPA 4W5HA 3QXHA 5KTYA 2BC9A 4DCTA 4P0TA 1FTNA 4D80A 2QRZA 1U90A 2RGDA 4TLAA 4V0NA 3U44B 4LBWA 3R8FA 2AR7A 1RIFA 2ZSEA 2WOOA 1LW7A 1NG1A 3A4NA 1DTSA 1NY5A 1JEDA 3FFAA 1KZ7B 3RNLA 4Q9KA 3RSLA 3DMNA 1WA5A 2CE7A 3L2OB 4LPKA 3L0PA 1R7RA 4GMDA 3VKHA 4HLUC 4YQFA 3B1VA 1TX4B 3B1WA 1KNQA 4NYJQ 2W6ID 1DE0A 4JLJA 3SDZA 3SI7A 4B3CA 1CEEA 4US0R 2R6CA 4UJ5A 1CJKC 4Y0VA 5G40A 3BRWD 4LUCA 2CE2X 1P9NA 3PITA 3REFA 3AQ4A 3TVTA 2C2HA 3VU9A 1S4QA 3BXZA 3QPWA 2QAJA 2Z83A 4PTLA 5EE1A 2IWHA 1GIAA 4IW3B 1XTSA 2ZRMA 5CDFE 5LB2A 3BIFA 4DLSA 4HLUA 2AK2A 5CIWA 5TY0A 1NN0A 1EFUA 2ZRLA 4BEBA 2C99A 4Q48A 4LSGA 3T12A 2MMCA 3Q7PA 4A4DA 1RJ9B 2H8KA 3C16C 4R9UC 1Z07A 2IC5A 1US8B 4PHFA 5FOTA 4A92A 4LJ4A 1N3BA 2ZJYA 3N5CA 3PG5A 3IIKA 5EXSA 4LHZA 1FP7A 2NQ2C 3CX7A 3RS2A 5L3QB 5CB8A 1RFLA 1QHGA 2X19A 2WJHA 3WYAA 4BFSA 5SZHB 4B6EA 3AKCA 5KHOC 2P5SA 2WHXA 4QGFA 5AJXA 2GHIA 2EFGA 4MKHA 2VRWA 4XTCS 5JS8A 4LJ7A 2ZJOA 3Q5EA 4MYTA 2QSZA 1T4GA 3PQCA 2ZS8A 3QI2A 3TR0A 5KNCA 3GPLA 3T34A 4L15A 1ETUA 2LWIA 1Q22A 3ZQ6A 4L5BA 5CYOA 5AK0A 4W9MC 1R5OA 1SKQA 3KB1A 3THXA 3QXJA 1G8PA 5KSZA 4S35A 2DYKA 1TF5A 2JLVA 4Q1BA 1P2UA 4ZCMA 5KDLA 3IEUA 3KDSE 4TYPA 2GA8A 4F38A 4GRAA 3KKQA 4NL4H 3UIEA 1GOTA 3RS5A 2IS4A 2A9KA 2OBNA 1E2QA 2CL6X 2QMUA 3EAQA 4QGAA 4CIDA 3MWJA 2CDNA 1XD2B 2VL7A 3H2YA 4PC2A 3SFVA 5IDVA 4WZBE 2HEIA 3U3KA 1N5KA 1OFUX 1YQTA 1SVIA 2FFQA 2QMOA 3E2IA 2NOAA 3K9GA 5HZKA 2QSYA 2HXYA 2GF0A 2O0HA 2Z4RA 3BB1A 4C7OB 4IDPA 1AGPA 4PHGA 3LVQE 1U98A 4XWOA 2PZGA 2BMJA 3L0IB 2PEYA 5F3WB 4G5OA 2WV9A 1W36C 1TL7C 5EXXA 3QPVA 2F6RA 2I1QA 2NPIA 1N6LA 2DCUA 3EPJA 1E9SA 1VG0B 3F8TA 4Q4LA 5SZKB 2I3BA 3P32A 3LWNA 1W4RA 1TUEA 1GL7A 5FPHA 3WNDA 1OT3A 1XMJA 2QU8A 1JQJC 3AP2A 1FX0B 3IUYA 3Q3JB 1YZGA 3RRYA 4HSEA 5JLJA 2Q0HA 3QXSA 3KXLA 1KIMA 1T91A 4PR0A 3PUVA 3K9NA 4NBSA 1OIWA 4A0FA 1EWRA 4BZPA 4OHWA 4M8NE 1UEJA 2WSMA 5FUVA 4B32A 3Q85A 5GVRA 1TMKA 3EPLA 2N46A 3AVYA 4KAXA 4DBLC 2ANBA 1L4YA 1P61B 2P6NA 4I99A 3WHKA 1Z2CA 5LB4A 1HQCA 2ONKA 4IJMA 2C9CA 2VP9A 4LBVA 4Q1AA 2DWPA 4DLXA 2D62A 4MRPA 1GWNA 3V9PA 3HR7A 2ZI4A 3ZQJA 2H5EA 2XSZD 3IBGA 2OG2A 1RRCA 4KSCA 3ZS8A 2QGZA 3TJZA 1OH5A 2PJZA 4OI0A 1AJEA 1TU3A 1COWD 2F1HA 1G3QA 3TRFA 1EWQA 3OIUA 1MT0A 2B8WA 3LXXA 4TYWA 3RABA 4AD8A 4DHEA 4L8GA 1GILA 1MO4A 2C77A 2PT5A 4AC9A 3X1XA 1YZKA 1M34E 1W0JA 4TT3D 4LV5B 1VG9B 2HYDA 2W2TA 1YZTA 1Z08A 1GRNA 1MV5A 4E03A 2FPMA 4C0LA 5FUXA 3WXMA 3PCRB 2VO1A 1E2MA 2RGGA 2HYIC 4LJAA 1W5TA 1G21E 3WMFA 1CU1A 2GZAA 4WW0A 1OKKA 3RC8A 1AS2A 1DAKA 4XVRA 2JLZA 3VTKA 3GFOA 4DVGA 3N70A 4WXRA 4Q7MB 1XX6A 2ZYVX 3MLEA 3GEEA 1G6HA 2YWFA 2DY1A 2ZETA 5AUPB 1ZM7A 1T3LA 1S3GA 2ZE6A 3HPRA 3B1XA 1NN5A 3SS8A 5GVSA 1LVGA 5EQTA 4IRUB 3LD9A 2CHQA 1FMJA 2HCBA 3NTUA 5B2ZA 3B82A 1DO2A 2GETA 4KI0A 1U0JA 3TAUA 1B23P 3HU2A 3CO5A 721PA 1UBFA 1T8TA 3KTAA 1UKVY 3LX5A 5KU1A 1UKEA 3TMKA 4M22A 4Q18A 2ZYTX 1OLOA 1NN1A 2B7CA 1ZIOA 2D06A 5FBLB 4XTRA 2GTPA 3O8RA 5EUQB 5CK4A 2G6BA 1KI1A 1QHHA 1JNYA 5B57C 1R0YA 2CL7X 2F55A 3HR8A 1SXJD 3FTQA 3T5GA 2D4HA 4AYTA 1RRFA 2KSQA 5FTMA 2QBYA 3PV0A 1OIVA 4CEIB 4A1FA 4RZ3A 1NVWQ 4OYHA 1OW3B 2GXQA 5DI9A 2XB4A 4DB4A 1QHNA 1TU4A 1T5LA 2ZU6A 4PFSA 4Q1EA 1KI7A 2WSSD 3EZ6A 3F5FA 2EFDB 2XZOA 5FPTA 4GPTA 4QFMA 5CM8B 1WDTA 3BGWA 2ZSFA 3UWKA 3BB4A 2R8RA 1GM5A 2ZR9A 1XRJA 1NNEA 4QBIA 2D2FA 4HUTA 4BGDA 4YMSA 2UZIR 4CRWB 4DXAA 4MRNA 2HLDD 2LKDA 4FD2A 1U8ZA 5JCPA 1Q1QA 3K0CC 1XD8A 2JGNA 5TMPA 3AP3A 2IEZA 2WWYA 4ZO4A 1U8YA 1O87A 2GXUA 1G18A 2G0TA 4BFTA 1Q57A 1E1QA 2J0UA 4YLGA 2A2ZA 1WQ1R 4TMWA 2VTKA 821PA 4KODA 2A7QA 3IGFA 1CXZA 4Q9IA 1YR6A 1BIFA 1TPZA 2AN9A 4XJXA 3W3AA 3WMGA 4G5SA 4DSNA 5C18A 1KO7A 1HT1E 4D25A 2ZJ2A 3LX8A 3VQTA 4PXAA 4ARZA 5JI2E 4Q1FA 5KOYA 4B2IA 2F3TA 4BRUA 2NZJA 5FI0B 3EZFA 1YZQA 2C8VA 3THWA 4CEHA 2OEPA 2YZ2A 2OSBA 3IO3A 4IOMA 3O8BA 1Q1ZA 1ZNWA 1G3IA 1JJVA 1KGDA 2ZRPA 3P4XA 2QT0A 3MUFA 4DT1B 2J7PA 5D3MB 1G19A 4M9ZA 2XNSA 4FMDB 4BLPA 3WHLA 5FOVA 1LF5A 1W48A 1FL9A 3EA0A 4BFUA 5H8WA 1JR3D 2Q21A 1YRAA 5HE8A 1KMHA 1ODFA 4JKYA 2ODBA 1B0UA 3OEHA 2FPKA 4LK2A 3ICEA 2P5TB 5KUTA 2W58A 1DG3A 1F6BA 3B8HA 3Q5DA 1I4LD 2BCGY 1VCMA 3LFUA 3AF3A 5B64A 1R2QA 5TVKA 5JJIA 2B92A 2YC4C 1P2SA 4M1WA 1AGRA 4DZZA 1V5WA 8OHMA 2O8BA 5FOXA 2FFAA 2VEDA 1TF2A 3ZVMA 4QGHA 1UFQA 1TQ4A 1E79A 2WAXA 3A1TA 4B75A 1NBME 1GRQA 3P26A 4JLDA 3QIAA 3OAAD 3AH8A 3GJ4A 4HEJA 3O8DA 3KJIA 4Q4AB 4RCZA 4KV9A 1Z6GA 4IDHA 5AJYA 2G77B 2H18A 1EG7A 3SN6A 2FOLA 2R6GA 2V1UA 5LD2C 2WVJA 4DSUA 1I2MA 3THOA 3GFTA 1IJFA 1DG1G 2GCOA 4IOJA 1JECA 2FSIA 4B74A 1EFTA 4G5GA 3CRW1 1U0LA 2A5GA 4KBFA 2VQSA 3AVXA 4HLCA 2P0EA 4MGIR 5DH9A 5AUOB 2OZEA 2JLQA 2NO7A 1M1YE 1EK0A 3RS0A 2WJVA 2W2VA 4P4SB 4JLOA 1UEIA 4CZ2A 4L9WA 3TNFA 3HPQA 1DOAA 3LV8A 4FMBB 3IQXA 3M6AA 1YR7A 2PBRA 3IKJA 2YWGA 3NBZC 4EAQA 2PLRA 3A1WA 3A4MA 4URWR 5GJWC 4RZXA 3WRYC 3KQNA 1OV4A 1N5JA 1U2RA 1KO4A 1JXMA 1II8A 1S96A 5CYPA 2OE2A 4KFRA 2Q9BA 5KNBA 3ZVNA 1J99A 2NZ8A 4QRHA 5L3SA 2RAPA 4X8LA 5A5GA 4D4LA 4V0MA 3CIOA 2MMGA 5LPNA 3A1SA 2REOA 2J41A 3BE4A 4US1R 1BMFA 2OUKA 1YE8A 2EU8A 4MA4A 3VHLB 2Q9CA 1MO3A 4HDQB 3UG7A 3ADBA 2DBYA 1NN3A 3I3SR 1ZC3A 2QEQA 4CEJB 3JVVA 2ZE7A 1HURA 4OK5A 3LVRE 5BYKA 4I1OA 4LRWA 1SVWA 3TQFA 5JFGA 1E2HA 3M4YA 2FPLA 3N2EA 1ZM4A 1G5TA 1EESA 1Z06A 4FI3C 1IBRA 1KK2A 3BH6A 3KX2A 5EXTA 5FUYA 1XXHA 4F4IA 4Q21A 2AXPA 3ZZTA 2BVNA 1RZ3A 2XEXA 2C03A 1QHXA 4BWYA 1VDZA 5G53C 3QENA 2QL6A 4QM7A 1AK2A 2QPTA 1KSGA 5L3RA 4LC1A 4ZPXA 4JMPA 4ABYA 4AWXA 4K81B 2Q3MA 4EJSC 5FTLA 5DI3A 3VNUA 1XEXB 3T35A 2LCFA 1T3SA 2IXGA 2O52A 4WA7A 2IUTA 3QOFA 1IY1A 5BN3A 3NH6A 3CR8A 3OEEA 1UKYA 2BMDA 4URUR 1G64A 1SXJC 3IHWA 4M4SA 2VBCA 4KITB 1ESNA 2DFTA 3GCGA 1UM8A 2J45A 4G5QA 3U2QA 4D0NA 3VR3A 3AB3A 2ORWA 3ASYA 3TK1A 4BPBA 4ACAA 3ZS9A 5FOSA 3K70B 4KLNA 5HTKA 1D6JA 4LYHA 2TMKA 4EJSA 3T06B 1XZQA 2CLCX 2J9RA 3P20A 3KFVA 3CRMA 4HI0E 3AUYA 2C04A 4JYCA 4XWAA 2QN6A 3TUJC 3DL0A 3F3YA 4KYUA 1R0XA 1XF9A 1NJGA 4PZLA 5EE9A 3R9XA 1A82A 3I32A 5JRJA 4Q4JB 4TTPA 2BV3A 2C98A 4C0QC 1PUJA 4TLBA 4I4LA 1YR9A 2JLYA 2A3RA 1S2MA 3QKSB 1G16A 3I8SA 1CP2A 4MYCA 2JA1A 1XPRA 2KI5A 3K53A 5JJKA 3L0SA 4URYR 1GFIA 2BWJA 3ZZ0A 4KCGA 2JLSA 2OFXA 1YZLA 2ZROA 1PV4A 5FBQB 2W2XA 5DYGA 4ZKDA 3BH7A 3NH9A 1MH1A 2OAQ1 4ZCIA 3FPAA 2QROA 2IF2A 1VPLA 1ZNXA 3R7WB 1HV8A 3LXRA 1WMSA 2JJ8A 2WJIA 1DAFA 4U5XA 3GLGA 3I61A 4C4PA 4PHTA 1ZD8A 5E7JA 1DADA 3B1YA 3MJHA 5UKDA 2YJTD 2I4IA 4LHWA 2GK6A 4XIGS 4CGZA 421PA 4EPXA 2ODWA 1S3SA 5KPJA 1DAEA 4P4UA 4RKEA 4M53A 5GJVC 3G0HA 1NKSA 5LBIA 4AURA 3K0SA 2FZLA 5HKKA 3AGQA 4HAWA 2B7BA 2CEAA 1G8FA 1ZMXA 3L8ZA 1MABA 4IDQA 4O2LA 4WIAA 2QZ4A 4YMUA 1JPNA 2QPOA 4B3BA 1SHKA 3WRXC 1G5PA 4RFSA 2Y8EA 4EDHA 1DAMA 4HB4A 1IM2A 4Z54A 2FJUA 2OM2A 2YINC 1P2TA 3BFVA 2IS6A 4M1YA 1NL3A 3CWQA 4PX9A 1E6CA 4BQSA 3VHXA 4EFMA
chains in the Genus database with same CATH superfamily
2O8DA 2C82A 4IDOA 3N87A 2P0YA 1P4SA 4O4JF 4ZV4A 4R9VA 1JQDA 3F3SA 1HOXA 4UM7A 4HQFA 1GNSA 1RTKA 3C0KA 3HJUA 4YRRA 3VYUB 4YDHB 4A0HA 2YJNA 1ST3A 4Q05A 1K68A 2FZVA 2GEDA 2LKCA 5K8LA 4EHIA 2COUA 1ZKDA 2IYSA 3D5QA 4NJMB 4FFLA 3EE6A 3NAQA 2HZ7A 1GGNA 1TC1A 4KXMA 5TQVA 4L0MA 3ZU4A 2A67A 4HNTA 5JAZA 4GLJA 5LQNA 1A8HA 2MSLA 3BXGA 3A6PC 1YD7A 1Q6ZA 1XC7A 4JP3A 5BR4A 1G291 4PO9A 3O31A 4G0NA 1JJ7A 1MUUA 2FSVC 3OIYA 4TOIA 2NPFA 2NMVA 1E3LA 5ALFA 1RU3A 2JBAA 3K9LA 4NMWA 2KBFA 4YLYA 5LFAA 3CG0A 5A6SB 2M9MA 4N0EA 2DFVA 1FPMA 1Y63A 1G42A 3HO8A 4RUKA 4KFCA 1E9EA 1ABBA 1TAUA 4FFWA 1TM3E 1ZL2A 2QI9C 2YJZA 3D43A 4F46A 1TT5A 5CT4A 2CL5A 4YAWA 2NIPA 3O26A 2Y1EA 3KQPA 2HUNA 4K3VA 4DQUA 4UQLA 4KXQA 2QJFA 1Y3AA 1E6UA 5TEVA 4PLFA 3VU0A 3CVWA 1Z4JA 2QGFA 4ZYYA 2WNIA 2C5SA 5B55A 5FUQA 4FM9A 2A9JA 1L6IA 2VDWA 4PXYA 2C7VA 1JU4A 3S99A 2ZTHA 3I6MA 3AQIA 3O93A 1YRBA 3PNOA 3QKRA 1R0BA 1E2EA 4RY2A 4X6XA 3C5CA 4AY2A 3BWMA 1ADYA 1TF7A 1LF0A 1EFPA 2XZPA 3N5KA 4ZANA 1D9ZA 4MJ3A 4F8JA 5KPDA 1E3MA 1UAGA 1SZDA 2RH4A 1OKKD 3F6CA 3PE3A 4BV8A 2PKQO 1KEUA 1W6RA 3P4YA 4EF4A 2AMVA 2WPDA 4KO3S 1TIBA 4PPFA 4A36A 2N1BA 2H57A 2B99A 1DKNA 5DYYA 3GG2A 5E8RA 5HFAA 2R25B 4Y2TA 3VMMA 4KR7A 3WGNA 3WYDA 3W3ZB 4IXMA 4OHMA 4R2JA 1IHUA 2F43B 1NT4A 4Q3CA 3WQSB 3DFKA 1M8JA 1R12A 2NU7B 2WWWA 1GUAA 2FEAA 3JPWA 2PUEA 1LU9A 1GDHA 5KJCA 4AS1A 1I32A 3OJWA 4LYDA 3UWOA 3GI1A 5GZ6A 5CGQB 1RWNA 3A58B 3JRXA 3PDWA 3JQQA 4WK0B 3COJA 1RXWA 5F64A 3F78A 4RVCA 5F9MA 5JS2A 3LQRA 3OPYI 5ALEA 3T3DA 1CUZA 4KN6A 2Q5EA 3AF1A 1N9KA 3IR5A 4UVEA 3ESZA 3PVSA 4D9HA 2IFTA 1Z3CA 3BXFA 3G1UA 2BEVA 2ST1A 4WADA 4Y6RA 5DRTA 5G3ZA 4ZD6A 1U2QA 2DTEA 3UCFA 3V8MA 2HXGA 5AO9A 3PHLA 4GM0A 1WY7A 3M5WA 4NEGA 1KE2A 4DR1B 5JMTA 4Q00A 2FPPB 1BU8A 2EJBA 3OFNA 1DCTA 2Q49A 3DD5A 3IUPA 4XLLA 4PR3A 3V34A 4ZEXA 4FN5A 4JK3A 3VYSB 3WVNA 3LQ2A 3JALB 4O5OA 1PS8A 3KE9A 3T1VA 3DOCA 3D6FA 4DV4B 2O8EA 3JYQA 2Q3DA 3P9XA 1QIJA 5EG5A 3MT0A 2X9NA 3WIVA 1GPAA 3RBVA 3TW0A 3LS2A 3SYNA 2PA3A 3F7NA 1KJJA 4ID3A 5I48A 4W5RA 3UGQA 1FBTA 1WW2A 1RIIA 3RUCA 1JDSA 4BO0A 3AR9A 4QDXA 5J1SB 2HA4A 1UXHA 4OGGA 1VIMA 5DHQA 4OU5A 2QUJA 1USUA 3WC4A 1KMQA 3N0WA 4B3HA 1HDCA 5B1YA 2Q4RA 4QOFA 3ZKAA 1G0NA 3HK2A 1N8TA 3FCOA 4Q3BA 1FS5A 2WIAA 2C9OA 5EQJB 1CS0B 5BN5A 3EK2A 2C5GA 3K0KA 4KKVA 3PI6A 3DEJA 1AXEA 4TMZA 1EHYA 1QO9A 3MWFA 4FGJA 2X0DA 1XRQA 3ND9A 3H9BA 1M10A 4JCCA 2XVYA 1H4VB 3KJFA 1Z7BA 3L5KA 1TQDA 2CLLB 2JCGA 4JLWA 2GRUA 3ABQB 1EVEA 3AVQA 2II6A 3P5BA 4B79A 4YJ3B 4NCAA 1F0YA 1Z8FA 2R1TB 2JATA 4OHPA 4GE3A 1VPWA 4EM6A 3T7TA 1B76A 5SYAA 1MN6A 4QDZA 1HDZA 1RPTA 3U4GA 3OQOA 4B46A 5FUMA 2ZKIA 3T3PB 3CMCO 5GV7A 3LCVB 1TJ3A 1V9CA 3BXXA 3DZHA 4UD2A 2ZJBA 5CT9A 5H3LA 4EQ6B 4Z8XA 1FXSA 2P5YA 3I5YA 2EFJA 5KCZA 2IXAA 4OL9A 1X8LA 1T13A 2OHFA 2DPGA 2QKYA 3E81A 3UM9A 1HDIA 4EIWA 1LNZA 3W5BA 4I3GA 1E7YA 2A58A 4XQ0A 1T1SA 1Z0SA 2YDXA 4GKJB 2CVPA 4LGVA 4EVIA 5REQB 1GN9A 1Y8AA 1EK5A 1K2WA 1M6EX 4LRQA 3EIFA 4RPKA 1VXOA 1PLKA 4Q7EA 3NM5A 2QW1A 1IXZA 1FC0A 3FMVA 3ZK8A 1Z0FA 5EFZA 1LBQA 3P0FA 2HIGA 3CRVA 3TL3A 1O97C 3PT9A 1QM5A 4WTOA 1XA3A 1N1GA 1IVNA 1S01A 1HXHA 1JV2B 2VR1A 4L4ZA 3SMQA 2GN6A 4KR2A 5J3JA 3SFTA 1ZBDA 3KJGA 2R6FA 4MKGA 4I9UA 1Z75A 3NC0C 3HN6A 3WYNA 3JQ6A 3GQBA 2H54A 4NEQA 3P0HA 5A2GA 1PT8A 1T4DA 4JBYA 3IIJA 3KFXA 1ZMTA 1Z5VA 1CYDA 1XMVA 3V3TA 1HLPA 1UJ2A 1PHRA 1FDIA 1M1NB 1OXBB 2W6CX 3OLYA 1PFUA 3QJYA 3FGPA 3QZUA 3NEPX 3E4CA 2IOYA 2NZVG 3SC3A 1E79D 1AQLA 1OTHA 3MTGA 4LQLA 3B85A 4IQ0A 2X9VA 3Q1LA 2Q4DA 3CGWA 4UXIA 1NMZA 2GPYA 3PUKA 3TPCA 3Q0IA 2C4HA 5DO9A 3SBXA 1E1CB 5F21A 2ATVA 1M6NA 2VAVA 5DOZA 3DKIA 4ZQEA 4PNZA 3B5IA 3AYXB 3GLSA 4JP8A 4LVCA 4P3XA 3S2IA 2VDPB 1MQAA 3WKCA 5JH7F 3WWCA 1UKZA 2IBTA 1B3RA 4Q1VA 4DG8A 4MI9A 4KO4S 2C7OA 4CM4A 3L8MA 4WOPA 2WM8A 3S68A 2CNWA 2FLKA 1LK7A 4IHKA 4MK4A 5KNDH 5KYXB 2PAAA 3NNSA 4KVAA 1HE8B 2QE7A 4PICA 4QWMA 1XVIA 2VJMA 3OHPA 4RPHA 3GLHE 2A1UB 1P6UA 1PR4A 3Q87B 1N0UA 1D9XA 2JGRA 4NZNA 1K6EA 1BVYF 2IT1A 2VHZA 1AKUA 2CMKA 3H7AA 5FFNA 4Z2YA 3UAOA 3I1JA 2HU2A 5ARDA 1NBWB 2QYTA 3CH7A 2F8SA 1DOZA 2BHSA 1XMIA 4X3PA 2DH5A 4FJ0A 4KR0A 3TOCA 3SDBA 2AKYA 4OFXA 4LDJA 1BEEA 4A2PA 4D81A 3KD2A 2ZVDA 4PHCA 3B2EA 2ECKA 2NO4A 3R2JA 4TKVB 4G2NA 1ZCFA 3VNSA 4AG5A 4H1VA 1NUAA 3AGPA 1NUHA 5JNVA 2ZVPX 2I7CA 2P65A 3V6LA 1Z0IA 2H00A 4RDXA 3MMXA 4RIGA 3GGSA 2J5XA 1GJRA 4HPWA 3RU9A 4EKEA 4PYMA 4XIIA 1MRZA 1Z28A 5JI3E 3I09A 1J90A 4JSYA 2BFFB 1N3IA 1Z0JA 2BFCB 1N92A 1U9ZA 5K0JA 1SKYB 1XCOA 1YMUA 1GEEA 2NZ2A 1WHSB 3AL3A 1YDFA 4TXNA 5EPOA 4B33A 5KO2A 1DJNA 1AF4A 1J9ZA 4AJIA 3PRJA 4P3KA 1N4DA 1J0BA 3FX2A 3LBNA 3GIDA 3D1VA 4QDTA 5JU6A 2D59A 3PQ3A 1OXXK 1UBLS 3MAAC 4L0QA 3QF4B 4EQZA 2ZIAA 1L4LA 2RAVA 2FMKA 1AURA 2YMLA 3DOEA 3WLKX 1Y4DE 4XGKA 1F8UA 3F71A 3HS3A 3B20A 3K6RA 2PZAA 3EVAA 2ZW9A 2E6KA 3E8MA 3MOIA 1XTBA 3PQ7A 4RPGA 4HGZA 4CM8B 1AHHA 2GPBA 3I2FA 2IEYA 3LQYA 4MQFB 5CX1B 4N82A 2F00A 3IMCA 4YJ2F 1W5EA 4LV8B 2F3SA 3HKCB 4HB3A 5HKLA 5CDFA 1UMBA 3D8UA 3HYTA 5FXMA 1Z0DA 4PO3X 4WN9B 1OLUB 1EWVA 1XD2A 1IOVA 3DLPX 3DNFA 1A8IA 3BE5A 2QRVA 4FDVA 2WAYA 2WKSA 3E5RA 3GROA 4QL3A 2GHRA 2IIBA 2RK4A 3ROEA 4Q7QA 1SCUA 3KDPA 1XTQA 1C29B 4C7OA 5C1PA 3CUEF 2B8EA 3HU5A 2ERCA 1WCV1 1XJCA 2QV0A 3IAAA 4K8RB 1VB3A 3N2KB 4KREA 5MGBA 1ZZEA 1CX9B 5BMVF 7ABPA 3FCEA 5IAEA 3SYMA 3W8NA 4P38A 5GGYA 4WZZA 2VJCA 5M7EA 1GNTA 3WHIA 1VG8A 1YVDA 1EFCA 1KAOA 1GITA 4EKYA 1BCRB 2PIAA 1E7RA 1U04A 1ZRHA 3K1JA 4GMXA 3OIVA 5TGZA 4ETWA 5KX5F 3Q2KA 2BGRA 3CY6A 3AFGA 3FMGA 1KPHA 2VP3A 3HDTA 4GM1A 5ES3A 3UN1A 5HHTA 4ZEMA 1D2RA 1J4AA 3M2TA 4J16A 2A1TR 1CK4A 4M7PA 1FYDA 2LCIA 4YRMA 4OQDA 4QUEA 3DTYA 2IDJA 2IHZA 3V8VA 2C4UA 3I5MA 3MSXA 4AMZA 4ZT3A 4FT4A 2BBWA 4HDRB 2DBZA 4XW2A 5LD2B 1ORTA 1BFUA 3C6ZA 3F7OA 4EHNA 5BUZA 3NORA 3NTQA 4GPZA 4PSUA 3A1EA 3DWFA 3Q88A 3WNVA 3ZKWA 4AULA 4KNVA 2PL9A 2XTNA 1NWCA 2PEZA 3QE0A 1XD9A 2VP4A 3KUXA 1ZVKA 1EYZA 4NYMQ 1UOEA 2BFPA 2J1LA 4M6WA 2O2GA 1CUUA 3EWNA 3AVUA 2HNAA 1NIJA 4GO1A 2RCYA 1OYWA 2VNJA 3GFFA 5KJEA 2JPDA 2PXHA 5A3QA 2VZ8A 3FPKA 3K8YA 3KM0A 5IYZB 3R9WA 1A9QA 3TQTA 1LLUA 3HBLA 1ZRSA 4GX5A 1OD6A 3LIIA 5CD9A 1B1CA 4DIKA 2DFPA 2JC3A 3NIBA 4J0IA 3W3AH 3GT3A 3N8DA 4I81A 1SXJE 5C8YB 1G6Q1 1AT1A 4UBLA 3E2MA 1F2DA 4JU9A 1W0KA 4LOKA 4D0LB 1O0BA 2NG1A 4N6GA 4XLTA 3RYIA 3KUCA 4BB0A 3DXFA 2HHJA 1NXQA 3PNQA 4E11A 3LLMA 2FYTA 1LPAB 1M6HA 3PCXA 3RT7A 4IFTA 3BMOA 2NACA 1NI3A 1LSOA 2YBEA 1Z37A 3UNXA 5DWVA 2B6HA 5JLAA 4YCBA 1OYYA 1K7FB 2QR5A 1U7HA 4KH1A 3FCXA 5J5AA 3RSFA 3RVNA 3AUFA 2QX6A 4GVPA 5JY1A 2BM1A 1AF7A 1E3DA 1NUSA 4PSDA 5FBWB 1X7WB 4RKFA 3IBYA 4BX2A 2GPTA 3W8FA 4BGVA 1PR2A 1GAEO 1RI4A 2O1XA 1B41A 2EAUA 2RHOA 2YXEA 2GESA 1LFDB 4UARA 3VKVA 4CLOA 3CUTA 2O0KA 5FPKA 5EMHA 4JC0A 4ZYUA 3T4EA 3FUVA 5E3IA 5CUQA 1NVFA 2F3QA 1VRVA 5EIXA 3LPNA 1E4EA 2FB9A 2OHOA 2CUKA 3SQWA 3U1VA 1G2OA 4HFMA 4BVFA 3H2SA 2BEWA 1BH2A 2MSCB 5BT9A 1ZK0A 5KJFA 2H63A 3JAWA 3WJ1A 2MSEB 1Y4SA 1CJBA 2IUSA 2DP4E 2QTLA 4IS2A 5AVYA 3L1KA 2I22A 1ELOA 2GRJA 1LLQA 4WFJA 4V0QA 3RLIA 1XZHA 4CV0A 4BKUA 3SFZA 5EJFA 2WTNA 3FYUA 3PK0A 2XB8A 1W19A 3FGZA 2IIVA 5JZ9A 3F5MA 3D2LA 3DF7A 4R2LA 2G06A 1PKEA 1IXRC 4MWDA 2QYSA 3ONEA 1KDOA 2ZREA 4NYIR 1P60A 1Q0LA 5J4HA 1EVYA 2ZPAA 5BVGA 1GT91 1TTTA 4I55B 4LHVA 1MAUA 2V97A 4BIMA 3OKFA 2UVQA 4P7FA 5H4HA 3ZQUA 1M6YA 1H1LA 3CONA 4LBZA 4Q37A 4X66B 2HV8A 4KO1S 4Z0HO 1D04A 4OXRA 1QH1A 1V45E 2WP8J 4HWOA 5BYAA 4LXTA 4DS3A 3N86A 4L4RA 2QG6A 4RA9A 4X1KB 1E92A 3VNRA 3CLVA 1DV1A 2PBLA 1GV1A 2QK4A 4QOEA 4XSGA 5FTJA 1S5PA 3E3OA 2AMJA 1CY0A 3OZVA 1ZJJA 4IOLA 1N5DA 4JLNA 2IHTA 2JKZA 1PDVA 2OCBA 5AVUA 4HG2A 3SJAA 1R4ZA 5SYMA 3QVWA 2MHCA 2G4LA 1R5NA 3KYCB 3HXLA 4GW3A 2M2IA 1GQYA 1P4AA 1ZPDA 5CPFA 2ECPA 3MJFA 1C0KA 1L6RA 3O4JA 5BQPA 4LRYA 3LUJA 3RKUA 4AWBA 3C8DA 3INYA 3MTBA 1Z6ZA 4UEJA 4XIYA 4XZ3A 3A6DA 5K3SA 4ITUA 2V1XA 2Z43A 5K99A 2DR2A 4BVHA 4DMHA 4Y8VA 1LK0A 2QZZA 3EF3A 2JFFA 1SG0A 2WA2A 1P3JA 5DYIA 3ZD8A 5AVQA 2QORA 1P1HA 3O1HB 4DMFA 4GAEA 3X3HA 3R0VA 1OBFO 2ECQA 2XUDA 2WT8A 1YTLA 3DJYA 3KAKA 2CJWB 3M6XA 3F8SA 5FJIA 2QYHA 4PLHA 5JMPA 3UJDA 4BU1A 4DWOA 4AUNA 4QTYA 3LY9A 1XDGA 2ZRFA 2V0NA 1PFKA 1O03A 2B78A 1Q0RA 4FHDA 4IF4A 1J0CA 1PR1A 2RI1A 1U8FO 2Y0PA 5BSTA 1XAJA 4HYQA 4DJFC 2IY9A 4FZJA 4WVLA 1Y81A 1T1JA 1K98A 2RFLA 1OH5A 2JVJA 3JQBC 1SK9A 2QRUA 3PQDA 4Q3AA 1P7WA 1DTEA 3CW8X 3PL5A 4JQZA 2PM8A 1BU5A 1V35A 3IAS6 4XGRA 4YP7A 3S29A 1B93A 4B8ZA 4DT1A 2RONA 3IELA 2YN2A 3U4HA 4KPYA 2EC5A 2I3GA 5CLIA 1TAGA 1L5QA 2D54A 4PZPA 2IYYA 4A3SA 3R74A 1WDKA 2R48A 2BBOA 4WBNF 5ICCA 4D3YA 2Q3HA 1Z2NX 2C5BA 4Z5XA 3A9CA 4C7JA 5JQGA 4EYKA 2GF9A 4EFDA 1CRQA 3X1WA 2V96A 3BGSA 2G36A 4D7AA 1TYAE 5EZ6B 1CQIA 4QUJA 1RWPA 3BPSA 3JQBA 1H6BA 1KDTA 3FM9A 3RYFB 2ZP1A 4LA4A 4A2QA 4L9SA 5A5EA 2Z1DA 1NW8A 4HFJA 3WIOA 4U6SA 1F5SA 2DTXA 4U63A 4HJRA 5ALWA 5JD3A 3LT5A 4AMBA 2BGMA 4LAFA 3GRZA 4DYHA 1ZSNA 4MKFA 2VPPA 4AJKA 5K8VA 3N6RA 4NJEB 3URMA 3GXOA 3PGA1 2VYVD 2YIVX 4K05A 3OE5A 4RSRA 4DJEC 4LOJA 4RD2A 4ADSG 3V4RA 2J0QA 3JSAA 1A8UA 4J6FA 4R8VA 2G07A 3AUXA 5ECWA 5AD1A 5K4HA 4WDQA 4OAOA 4OMCA 1KZHA 4C0BA 2X58A 4ZREA 4CCYA 1B7GO 1S3FA 2V7PA 2UZ4A 4FHZA 4P82A 2JGDB 1YV9A 2HF8A 1VJRA 3V2GA 4Z4CA 1PQWA 3AKZA 5AM2A 1J8MF 2HNKA 2XJ9A 3C85A 4R1MA 4U7GA 1E5QA 1VSVA 2OUIA 3COVA 1JHYA 2VUSA 4QOGA 4TWZA 3WGLA 3R7FA 3DCYA 3M4XA 1FXUA 1GZ4A 1JIJA 3Q7RA 3IEXA 3FAZA 5E7MA 1W5AA 2B8JA 3DS8A 4I5IA 1NI4A 3FLAA 4L7QA 4DSTA 1WM1A 3A28A 1BHO1 1SRQA 4MVJD 4UNQA 2QNIA 3AUUA 3FF4A 3TX2A 1U7WA 2CCKA 5FF9A 4KRFA 1HBJA 1BYUA 4J2TA 4R7ZA 4IJWA 3U09A 5JS1A 1JKMA 3GAAA 4FC7A 3RAJA 1E7QA 4WRRA 5E38A 4IIJF 2IK8A 2QL9A 1EX7A 1RT9A 2VF2A 2NVWA 1UQUA 3B5JA 1I4DD 5CM9C 1H2ZA 3I4CA 4HQ6A 5EKDA 1TLLA 1ZGJA 4RMNA 2A0FA 1QONA 5CEJA 2OB1A 4CDMA 1KZ6A 3E5MA 2CLSA 3MQ4A 5I9TA 4DAEA 3K4PA 1M66A 3I42A 4FCCA 4B3XA 1IN5A 4AZ3A 3VUEA 1C3OB 4M0LA 3JD2A 3JWEA 1ZO8A 2DUJA 1M0TA 1X87A 3PQ4A 3H3XA 3VGPA 1RACA 2O6HA 3DLAA 3OE7A 5GIPE 2YQZA 2I62A 2XNDD 5KKAA 4CM3A 2CYCA 4AQYB 2VZLA 4UVDA 4WCDA 4COOA 3OCCA 1L8AA 1E18A 3UJPA 4KSYA 4PX3A 2C9BA 1P7PA 3GRFA 4OHBA 3FKSA 1O6BA 1V0JA 5I4CA 4ILEA 2OESA 2I2DA 1N5MA 4NU5A 5EIOA 4BVGA 3OKPA 2J32A 3HH8A 5KINB 5DLQC 3W6UA 1Z83A 3L01A 4IO1A 5KYUA 4BV9A 1HTBA 3BJMA 4A1OA 4KHZA 5AIBA 2G8LA 3VKGA 3ROKA 3FFBA 1UPUA 1PFWA 1OROA 3ZJUA 1QCCA 1C8VB 2L82A 1XHFA 1DCFA 4AF6A 1RP1A 3C5WP 3KR1A 1QGUB 2BISA 2ZRDA 2I4NA 2JAXA 3OPXA 3ZX4A 4D5GA 5CB4A 1IXYA 1FNNA 1ISHA 1G17A 1RWXA 3IULA 1R0ZA 2B0CA 2FMFA 2H1IA 4IRMA 4PQEA 1P9WA 3KB2A 1GPKA 3B6MA 3O47A 3Q72A 2WM3A 2NSLA 3LK7A 3R3JA 2R1VA 1UM9B 3W5IA 2YVQA 1XRMA 4B9AA 3M3PA 5LYJF 2HRDA 3TQRA 5IMSA 3AJ9A 3EYWA 4GICA 4Q16A 1U0NA 5A2QA 4YRKA 3IVXA 2Z56A 2M6SA 1QTQA 4FIZA 4RLHA 3V1KA 5TQ0A 4BNLA 1HLFA 2XUQA 1MX1A 2DULA 3VO2A 1A2OA 1EFLA 1ZOIA 5TMDA 3TFOA 4C0KA 4D6XA 4ANFA 3FMIA 4TMYA 3WSTA 5ILGA 3RG2A 2VHCA 3HN2A 1GZ7A 3K31A 4BZXA 2FEMA 1P74A 3GUYA 3OQJA 1CNFA 1DKRA 1JMVA 1ACLA 2CXXA 3BXHA 1KYWA 1L5ZA 2FEWB 2O5VA 1WOMA 4FUQA 4EHLA 4BKRA 2ERYA 3QWFA 3BERA 4YDSA 4LWZA 1EBUA 3UMSA 3JD0A 4BV2A 2WAMA 5FWNA 3TIIA 1E3SA 3ORSA 4Q4JA 4AAYA 4UOEA 4JXJA 3VC1A 5JZVA 5KNLA 2E7ZA 2NNWB 3BMCA 4GOLD 4ZRNA 4CUZA 2ZVQX 3WLLA 1U3CA 3QKSA 4WOBA 3EG5A 2IS2A 1HY3A 1KR2A 3LY8A 3JATA 4Y98A 4CN9A 4YUWA 1L3BA 3A7DA 5E6RA 1DBVO 1CG6A 3OIFA 1TO2E 2O0JA 2WILA 2YC2C 4II7A 1VBKA 1JBKA 2B4AA 3PGVA 4TV9B 1ZUHA 3DOUA 5TXGA 2RSLA 1EUCA 3E15A 3VV2A 4BNDB 4DUGA 2H1LA 2IH5A 1YCHA 5B2EA 2EERA 1U3TA 2EFYA 4G1FA 3LT4A 4O4HB 3K8OE 1U11A 4OD0A 4FSHA 3R7WA 4D3FA 3O84A 5B6JA 1INLA 5HM6A 3WV5A 1Q84A 3CW2A 1T9CA 3H11A 1W36B 4KIFA 5HE9A 2IE0A 4FYMA 2FPGB 3W78A 3DEYX 2W2MA 4DDHA 4PFQA 2LZ0A 5DSTA 3RIGA 1UK6A 5BMVA 4IHJA 3WYBA 3ZU6A 4DLYA 3VSCA 4KXFB 4JITA 3A3NA 2ZIWB 4R51A 1ISMA 2HB6A 3B3FA 3RTDA 4DLTA 1P2BA 2AOTA 1FQKA 1UBCA 1DJPA 3CRNA 3BS4A 3PFIA 3CPHA 3EIQA 3SQMA 1GQ2A 2ZI7A 3HKBA 3WHPA 4FFBB 5E9QA 1WZCA 2QLLA 4MWCA 2ZR7A 3EG9B 4MQBA 3VR2D 4FS3A 1F8GA 2OO3A 1LS1A 2BDUA 2HRBA 2DUWA 4X61A 4OLAA 3ASVA 2AD1A 4EY6A 1XL0A 3EASA 4AL4A 1O95C 1IUNA 1T8SA 2HT6A 2ZWVA 3A1DA 5FQOA 2CCGA 4F91B 5LMZA 1G6OA 1KOFA 1L4HA 1ISFA 1DC8A 1GAJA 1Q91A 3DBRB 1W9HA 3FB1A 1ZGAA 3LRXA 5IJ0A 5EIHA 2OZLA 4MV6A 3GVXA 3CW9A 2IP2A 4HLNA 4K9LA 3KT3A 4YFVA 5IN5A 5A3RA 1IDOA 2OXCA 5HGXA 4W7SA 3T41A 2J09A 1N6HA 2QZJA 2WIKA 3E3MA 1YSCA 2B6NA 1NSTA 2JIZA 3V00A 4F1WA 3C24A 3ZLTA 1NJFA 4CKCB 1AHPA 2WF6A 1HMYA 2VRBA 1GA1A 1Z8DA 2JB9A 3O8QA 4Z4HA 2A57A 3L0BA 4JP5A 3QFSA 3CZPA 2ZXUA 5BWMA 3IQHX 4D3SA 3BWYA 4C88A 1T8RA 1O95A 5LKAA 1U3DA 2H2IA 3ELUA 1YC5A 4L9AA 4BUZA 3OZUA 2ZIXA 5KNCH 3ADOA 1Z88A 5I01A 2O8CA 2CFTA 3REGA 4FOOA 1XFAA 2J3MA 2JGFA 4QPZA 5IJAA 1FUIA 3MHPA 3DBLA 5EWMB 4O3FA 2P6RA 1Z4PX 3NP7A 5EVCA 5BSHA 4ER0A 1ULAA 2G9UA 3DOOA 1XLWA 1C9JA 2B1IA 4R8RA 4FGWA 5DGHA 1W47A 2FPWA 1A4RA 2ETVA 4MVYA 3MMZA 3FSEA 3UHJA 1GKIA 4UCQA 1RJWA 3G9QA 2Q50A 3EIWA 5JWOA 2FG6C 1Q11A 2WWRA 3NHFA 3RE1A 2GZSA 4ECEA 3ZJYA 4R6XA 1LX6A 2FGKA 2ZEJA 3WFIA 1OZGA 4JXZA 3K30A 4Q4DA 2OXTA 4RHFA 3CVOA 5FWXB 1S02A 3U31A 6ADHA 4GYWA 1RQGA 1ZUIA 3IFSA 4UASA 3WNZA 5TLSA 4Q3LA 3SHFA 1T0PA 3A9VA 3ELBA 2BYTA 3PFBA 1B15A 3KSRA 5FLXA 1L7BA 1UPCA 3UYKA 1TFRA 3GBSA 4MV0A 4BMCA 4ABTA 4ZN6A 3P9RA 3KOWA 4LYFA 4LFBB 1RWMA 2Y1XA 1TECE 4NIMA 2CD7A 4TSKA 3NX4A 4FYWA 4WCVA 4JJ6A 1BQ3A 1QHHB 2I7DA 3OCVA 4ZV7A 4C20A 1IJEA 4BLUA 1Z2PX 4DVJA 1J2YA 1SVSA 3B6JA 4GKAA 2ZE5A 5IH7A 1Z4IA 1EFRA 4Q6WA 1DEOA 3BQMB 2Y67A 3MG9A 2X2FA 1ZC4A 5EUMA 1CZRA 3Q11A 5GM2A 4D9IA 4HMQA 4S1VA 5IARA 2ONZA 1DV2A 2IY8A 2ZTUA 1JEQA 2HRRA 1L7PA 2DZDA 2FWRA 3VBEA 4QJIA 3SS7X 2BSQA 4BNMA 1E2KA 1E3WB 1QS0B 4F8YA 1X7XA 1P0MA 1ZQ1A 3EDMA 3SQNA 4AJ4A 2BUCA 1CIVA 3ZDYB 4QDUA 1OHHA 1GXSA 2HJSA 2R8ZA 4IJ5A 1GG5A 3U60B 3DFIA 1MOPA 3WLFA 5JCOC 2YVKA 2HA2A 4HDAA 5IFLA 1NGSA 4U0KA 3G23A 2BE9A 2JW5A 1BXRA 1NSYA 1OXSC 4UBNA 4S2UA 5EMNA 3ZWOA 5KNDA 1W6UA 1TJYA 3W5DA 3DE1X 2Q3LA 4HGYA 3L4SO 3UT5A 2J0UB 5BXQC 2YFKA 5FTKA 3GEIA 4BVAA 3L06A 2BY4A 4OK6A 2P1ZA 2YW9A 2IOHA 2YVLA 4JELA 3ZR4B 3V4PB 4B09A 4EABA 3P0JA 1MC8A 4GVLA 4MGEA 2C2BA 5IKOA 3SICE 3AEKB 3A6JA 4PLWA 3CPSA 1J23A 2RGAA 3L6BA 3R7DA 1ZITA 4CKBB 2JLRA 4HEHA 1OCEA 2P4EA 4A5SA 4EI9A 5GIOE 5JCOA 2VA8A 2P7HA 5IKXA 4KBGA 4D96A 3GNQA 3VDRA 3PGJA 2PPLA 4C08A 2V3WA 3THWB 1ZOOA 1U65A 2QTFA 4C9BA 3CB2A 2ZT6A 2FEOA 1CR4A 3QU5A 1Z82A 1BVRA 1M6VB 3HYRA 3DYVA 2EARA 1XE3A 1P0IA 2H4XA 3R9KA 4GI7A 1MO5A 2OAEA 5DHTA 4K5QA 1DL5A 1L7XA 3AY7A 3U19A 1KAEA 1M5UA 5JTTA 5EIBD 3N8NA 4F4JA 4KE8A 2D4AA 2C3MA 2OCPA 2HT1A 4WINA 5JFOA 4HF7A 1KO1A 1P0FA 3PEFA 5FR1A 2PUVA 3GA5A 2ZDGA 3NHMA 5KHAA 4C1NA 1N1DA 5BUCA 2G1UA 2JRLA 3UJAA 4UATA 4URHA 2Z2KA 4CMIA 1C7ZA 1PQUA 4IXNA 2JIBA 3MGAA 4KRYA 1BAPA 4FGLA 2IOQA 4KDFA 1CULC 4RKYA 4EATA 4HN2A 1UFOA 2GFIA 3BREA 5EHGA 1AKVA 1EUDA 3BBLA 5AXCA 1IUOA 3TD9A 1DELA 1UCFA 2O8BB 4KX3A 3A3OA 2WJ3A 1A9RA 2P6MA 1XQ9A 3H84A 2WUFA 5CRIA 1WF3A 2A9FA 3B6IA 3H75A 3E23A 4GYYA 4QJ4A 1Z38A 3G49A 2X5JO 5L8VA 1MG5A 2UYHA 3IUEA 4TTRA 3V8RA 4NQZA 4HS4A 4B2PA 4NKRA 1FP2A 1SVNA 4JLAA 1KMMA 1SGWA 1W1WA 2JLBA 1HFWA 3KBBA 2GCOB 3ZXYA 4FS8A 1XXHE 3PUHA 4R7GA 1EGMB 3H1AA 4I36A 3AW9A 4LXGA 1EAYA 3SM3A 4TTTS 3RWOA 2QWXA 3IVAA 4DUPA 1YDHA 3D6VA 1N7GA 3GRPA 1Q20A 1E2UA 3EBOA 5EN4A 4AG6A 5DM70 4K9DA 4HD8A 2TECE 1LBEA 1V26A 5A05A 1TJPB 2XF8A 4FR5A 4OCZA 3ZHSA 4DCVA 4MINA 4DLZA 1T5OA 5CNKA 1L7EA 2VDKB 4UHFA 4BMNA 5A3VA 2O59A 4C3ZA 3LQ1A 3U6KA 1RVDA 3FJOA 3T3HA 1C9NA 1THGA 2Q07A 2JD2A 1V8ZA 2OV1A 3DZ8A 4O4JB 4OQNA 5CHYA 5M04A 1II8B 4JJZA 2UUCB 4WLNA 1Q7EA 4GP6A 4NOJA 1QQ5A 4S1TA 4OU4A 3RIEA 3BWEA 4E2WA 5AHXA 1NQ5A 2C29D 4J1NA 5FV7A 4DRZA 3WGOA 1JLHA 2KWIA 1A3CA 3H86A 3NCHA 3QBVA 4Q7KA 5FO1A 3U3MA 4R83A 1U5CA 4O4LA 1RKVA 3UT6A 1O4VA 1SQSA 1MW8X 2QA5A 1R5JA 3OD1A 1DFGA 3NV7A 2IU3A 1ZIPA 3D1LA 2ZRBA 1B8VA 4XSHA 4J91A 4W5JA 4U2DA 1FSGA 3F47A 4O29A 2QUZA 3ZY3A 4NXNB 2MSKA 3DH0A 5ALYA 3P9ZA 1WQ3A 1E5LA 2FU5C 1L5VA 1IK6A 2FX3A 2LD4A 3AIIA 3BE8A 2P3QA 4GX2A 2JKVA 4NZYA 4I5FA 2J0VA 3LRPA 1U4NA 3ZWMA 4FVTA 1YKSA 2ZT7A 2X3UA 4L4XA 3NWEA 3PWSA 2R5WA 1YCGA 3TI9A 3CVYA 4HB2A 2C61A 2HF7A 2PMCA 2MJLA 2P3OA 2R6HA 3AUSA 4BQOA 1Z6XA 3LL7A 4OXYA 5BV2P 3CRQA 1EIZA 2GFQA 4WLOA 1IIRA 2E89A 2AC4A 3ZK7A 2PX4A 4Q9LA 4Q1CA 3HWWA 3ONDA 2HADA 5KHLB 6PFKA 2NYUA 1VMKA 2OK7A 3BSFA 2J07A 4JYMA 1NBMD 2EQBA 2QMQA 3P71T 3D4PA 3F6YA 1NVVQ 4LZOA 4RESA 1ZNQO 3NHLA 2ZZMA 1U2SA 2JCVA 2XKBA 1NBIA 1T3HA 4M0MA 5ECDA 2XUKA 4NG4A 2P6OA 3V4FA 5HPYB 3BSSA 1MOSA 1FVXA 1TK3A 3DZIA 3O3OB 5EXDA 4P83A 4EVRA 4W6QA 5I8WA 3I9KA 1LPOA 2FCRA 3NOVA 4MV8A 4RVSA 4XUEA 3QVXA 5JYDA 1BE1A 1HDRA 4KQJA 3U37A 4H7HA 3GLGE 1XPUA 3E7DA 3H4TA 1SRRA 4DIOA 4G5RA 3EZ7A 3L0YA 1LVUA 4GT1A 1TVKB 5DGXA 4Y2UA 3MA0A 3KPUA 2IPAB 2WMNB 1DIRA 3CEJA 1ZD4A 4HWKA 2ODAA 4JT2A 5FHQA 1FIUA 2R6JA 2GXAA 3ETEA 4UQOA 2VZEA 1FTQA 2OZPA 3I6QA 4DLWA 3RVJA 1ZXLA 5JWRA 4RHCA 1YIDA 1IU9A 3EGVA 5EJ6A 3BDIA 4MRSA 4CMKA 2ZIEA 1XCGB 3LC7O 2IA5A 4FD3A 5CBPB 1OAOA 2OGTA 3RKRA 2PMDA 2MYUA 2W8BB 4RC9A 3G5UA 3TH5A 4D02A 2RE8A 1VQ1A 2A1IA 4MGZR 1KJQA 3WP1B 4YMVA 5JBIA 3DV0A 2PZJA 2XE7A 5FV4A 1L2TA 1M2HA 4WZAB 3AM1A 2IZ7A 2XYPA 1JUDA 2Z8YA 4L02A 5AKLA 1B73A 4KPUA 3BQ9A 5EWJB 3QG5A 4P1ZA 1AK1A 2YQ4A 1G5RA 1Z7YA 4OVKA 1PJRA 5LA6B 2BH9A 1O0CA 1X15A 4KN9S 5F7OA 2C2XA 1YHNA 4Q12A 2X0KA 3TD6A 3GN2A 3JQRA 4GLOA 5D1HA 3HDHA 2ZE8A 4LX8A 3WI7A 5KQLA 4HFNA 1ENYA 2X7XA 1K97A 1N2HA 4EO9A 1DLIA 5BOVA 1R8QA 2R8XA 3WK4A 4LJRA 4QUHA 4I0WB 5T8KC 2GI4A 1V8DA 2F67A 2JEZA 2OHIA 1A98A 4NONA 4TYQA 2Z5FA 2WZQA 3RLFA 3I6IA 3HSYA 4ZCQA 1IRIA 4ZI3A 3C6MA 1AMOA 5CU7A 3QEJA 5BWBA 1YIOA 5H7XA 2IZ0A 1BWQA 4A8JC 4FXPA 5MF6A 3PBKA 4DGSA 1N33B 1MOZA 4P4TA 4D44A 4QVGA 4YS6A 2VNKA 4FYJA 4ARBA 1WBJB 2F1JA 3DHNA 5LL6P 1DPGA 1KH3A 4MS3A 2HQBA 3DBHB 4Q66C 2PR7A 3WYFA 1P0CA 2G76A 3RRZA 3K0FA 1E64A 4H16A 2PZEA 4X1OA 2R751 1ORHA 1WV1A 2RAUA 4C0SA 3A3PA 2OYCA 4DIEA 3MNFA 1IJBA 1IG0A 5K0NA 1KFCB 3U17A 2RGBA 2W2NA 3DTVB 1GV0A 1XMXA 1M3SA