1MRNA

Crystal structure of mycobacterium tuberculosis thymidylate kinase complexed with bisubstrate inhibitor (tp5a)
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
208
structure length
208
Chain Sequence
MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAELAGERSRGRAQRDPGRARDNYERDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Enzymatic and structural analysis of inhibitors designed against Mycobacterium tuberculosis thymidylate kinase. New insights into the phosphoryl transfer mechanism.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords Thymidylate Kinase
total genus 75
structure length 208
sequence length 208
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2002-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1mrnA00
3C41J 4M1KA 2P67A 3LD9A 4MQBA 1TQ6A 4MGYR 2OAP1 1VYVA 1GAJA 1GILA 3AF2A 4XWAA 2BJVA 4ZKDA 2KI5A 1FQJA 2V4ZA 2OLKA 1FTSA 1L8QA 1OF1A 3F0TA 3K0CC 1FP7A 3RDPA 1IAQA 1UF9A 2EFHB 3H2YA 1NBMA 4CT5A 1P2VA 2G3YA 3EPKA 3EA5A 1YR8A 1YZLA 1YZTA 5LD2B 4X8LA 5FTJA 5F98A 3TSZA 2MSCB 3KQHA 4URUR 1HYQA 3GJ4A 3IKJA 5C18A 1W4CA 5FH9A 4AD8A 3ZVRA 5FOTA 2XZLA 3GFOA 2J0VA 2UZ3A 3X2SA 3IEVA 3NKVA 2FE4A 2H16A 5FTMA 2NTYC 3CH4B 2PJZA 5JFGA 1EX6A 3D7MA 1J2JA 1E2NA 2Q3HA 2BMEA 4DT1A 5GADl 3LLUA 4OQXA 2GILA 1OXTA 5FR2A 3NH6A 3C5HA 3K0AA 2KJQA 1EK0A 2A5GA 2JLSA 1BO6A 2XZPA 3WMGA 1KMQA 2ZEJA 1RYHA 5GVSA 4TMVA 5CLQA 3AF1A 2FA9A 2VTKA 3P4XA 5FOWA 3GLGA 4QL3A 1AGRA 4MGKR 3LVQE 5DYIA 2ZPTX 3MSXA 5IHPA 3ADCA 3Q7PA 8OHMA 1Z0JA 2V8OA 3TRFA 4DKXA 3TSWA 4M2LA 2ODNA 2V9PA 3Q8XB 1D6JA 4DDTA 4PANA 1DBSA 3MWYW 4JLNA 1KO5A 3PEVA 5F9HA 1KJZA 1JBKA 1S1CA 4Y0AA 3GMTA 3FKSA 4LUCA 4FD2A 3B1XA 2PEYA 4ZI3A 2REBA 1OT3A 1CR2A 1QVAA 2YC2C 1TL7C 1UPTA 1UKVY 2H1LA 1WCV1 3ADKA 3G5UA 4PQFA 3AF0A 3S1AB 4DLYA 4Q4JB 3LNCA 3I73A 3CX7A 5AJWA 2F1JA 3KKMA 4KI0A 1SVIA 2MMCA 2IW3A 2QQ0A 2OBLA 3SYNA 4U5XA 4YMUA 4ZDKA 4PO8A 1T0JB 1Z2AA 1KZ7B 2FNAA 2Z83A 5KDLA 3WMFA 4XWKA 5EP4A 1HA3A 4BEJA 4LI0A 3GJ3A 2KBFA 1CJKC 1N25A 3BRWD 2QT1A 3LO5A 3RS0A 2OCPA 1HV8A 1N0UA 2V1XA 3CO5A 1R10A 3W6PA 4OI1A 4Q9IA 4NCJA 1NN0A 4KHZA 5EZ6B 2W2TA 3F8TA 2WIBA 3W6OA 3CZPA 3TGPA 2BKUA 2C8VA 1FUUA 4LYJA 2A2ZA 5AK0A 5IK2A 5JJLA 1S96A 1KYIA 5EE3A 1KO7A 2VBCA 2XX3A 5IK2D 1XMIA 1ESNA 3O8BA 4BZXA 4MDFA 1WE2A 2ZRAA 3QIAA 2BJWA 3NBYC 1JECA 4ZIRA 2NO9A 2IYTA 2HUPA 3K1JA 1QBKC 1W7AA 1AA9A 1BYUA 3CF2A 4FIDA 2AX4A 2E9SA 3KB1A 3SJZA 2NQ2C 5JI2E 1OH8A 3MWJA 4IDNA 1Q3TA 4Q9KA 4D0NA 5JCZA 3D31A 1CBUA 3EZ2A 1JJVA 2ONKA 5FOUA 2OBNA 3ZDQA 2D74A 3LW8A 1KHTA 4XD7A 4OBEA 4YMWA 1JR3E 2B92A 2I3BA 4ARZA 1N5IA 3BB3A 1R0XA 4TL6A 2GJ9A 4LPKA 4HLDA 2BBSA 2WICA 3GJ0A 4TTPA 3FDIA 1D9ZA 3K0CA 3K0AB 4Q7MB 4QGFA 1HE1C 2VP6A 3FFBA 5D3MB 3ZH9B 5IF9A 4LJ8A 4DT1B 2J0UA 2LKDA 1E94E 3A1TA 3AEZA 2QU8A 1T4GA 721PA 2V55B 2GK7A 1WMSA 4OJKA 4OHVA 2P2LA 4M1MA 3TBKA 4LJ5A 1W36D 2J59A 2R62A 2OSBA 4HB4A 2J7KA 2ORVA 1YHNA 4TMWA 3LH5A 5AUQA 2NZJA 3UMFA 2VHTA 1XJ0A 2J0SA 1CKEA 4F7WA 3U44A 4ZKEA 2OCAA 1UBFA 3B1WA 3W34A 5A5GA 1N0VC 1ZIPA 2CJWA 5GJCA 3WYAA 3GEHA 3L8YA 2ZRKA 1TUEA 2ECKA 4NTZA 1S0UA 4IDQA 4DLUA 1BIFA 3U5ZB 4C30A 4IFBA 4AYTA 1LTQA 4YQFA 4D4LA 4DRZA 1B23P 4PPNA 3ETLA 3LXRA 3KB2A 1CR1A 3T1QA 4Q4JA 3U6BA 4C0SA 3TE6A 1DVRA 2JJ1D 1KI3A 4IEEA 4LJ9A 2JAQA 2AR7A 1VMAA 4V0KA 3T1TA 5E3HA 1II0A 2ZJ2A 1VYUA 1XF9A 1G64A 4NHOA 5G40A 5J4KA 1XD2A 5L3VA 2PZFA 3SBEA 4UXHA 3TR5A 2O8FB 4TYQA 2FDCA 1XRJA 2AL7A 1DAHA 1QHSA 2ZSAA 1BKDR 3JZMA 3WNBA 4B2IA 4KSCA 1UBEA 1G9XA 1CP2A 2QUZA 5EQTA 3RC8A 2FJUA 1GTVA 2ODBA 2A9KA 3TAUA 5KDOA 2CJWB 4XIGS 5JS7A 3EW9A 1G18A 1GWNA 3UWKA 4TQAA 4A2QA 4FMDF 1SHKA 1DAKA 3GP8A 1Z08A 2BBOA 1NNEA 1KK2A 1GFIA 1KDTA 4QXAA 3SI7A 4B3BA 3WBJA 4DLSA 1KNQA 1P5ZB 4JZKA 4D81A 3QNUA 2WSSD 3LA6A 3QPWA 4L9WA 4OI2A 1KI1A 2JLZA 2P6RA 1U9IA 1Q44A 4MRVA 1E2HA 2ERYA 3Q5EA 1UKEA 2PX3A 5JJIA 1Z6YA 2ZUDA 2RHMA 1E2QA 4BFTA 5FBWB 3SQWA 2D62A 4Z54A 3A37A 4EFMA 4PXAA 1W0JD 3MLEA 2GEUA 5DSZA 1JPNA 1RRPA 1AN0A 1Q20A 2WAXA 3QI2A 1UKZA 3TJZA 3VR4A 4C0AC 4W5JA 1JPJA 1X8JA 2OO7A 5C1BA 1OXUA 4B75A 2JLVA 2YZ2A 3SR0A 1UAAA 1JR3D 3L82B 3CRQA 4QJ4A 4BQSA 2QP3A 3DEFA 3DM9B 1KZGB 1P60A 4Q4HA 2GZHA 3KXKA 3AV0B 2QNRA 5JRJA 4MRSA 3ICQB 3AVVA 3M6AA 4JLJA 2WSMA 3BH7A 5HZKA 1VHTA 4A2WA 2HT1A 1ZM7A 2B7BA 4TT3A 1KJYA 1KO1A 3QVVA 4CF7A 3EZ7A 3QF7A 1R4AA 3RC3A 1T6NA 4A1FA 1E2IA 1U81A 1I2MA 1I4TD 2IWHA 1P72A 2FV8A 4ZIRB 3FWYA 3OESA 2XB2A 2QE7D 1R6BX 4DUGA 3K0FA 3ZD7A 1XXHE 2BVNA 2JJ8A 4CEIA 5BQ5A 4P0TA 5J40A 4DUGD 3B85A 4ZV4A 2QT0A 2O8CB 1G8PA 4US1R 4A0HA 2FGJA 2Q6TA 5B64A 4Q66C 3N5CA 2ZS9A 4R98A 3DVLA 2JA1A 1OB5A 2JLYA 3O8RA 3PVSA 5DI3B 2WJVA 1IN4A 2QMEA 1XJCA 2VEDA 3CRW1 4WZAE 3OEHA 3QF4B 4F92B 2Y8EA 4NCNA 2IHYA 4GRAA 1IN6A 4P4TA 1JXMA 2QPOA 4PSKA 4AG6A 4B35A 3L0OA 4DDVA 1NN5A 121PA 2DR3A 4ILEA 3EXAA 4EIWA 2IS4A 5JJKA 3MWLA 2YWEA 3P27A 4JL5A 4S2EA 5JS8A 5SZKB 2Q21A 5EE1A 3D6TB 2V7QA 2J7PD 2CCGA 4M1TA 4ZI2A 2DFNA 1DG3A 4JLBA 1XZQA 3K70C 2WHXA 3CWQA 2AD5A 3C5CA 2Q9CA 2GZDA 2F43B 3BD9A 4RFSA 1AK2A 1MOZA 4N1AA 3KKNA 4AK9A 1Z0FA 3SFZA 3N70A 1UDWA 3CR7A 3I72A 3MFYA 5BN3A 2XJ9A 2G0TA 3IHWA 4W7SA 3GQBA 4HLUC 4GPTA 3ZVLA 2VSOA 2GRJA 3OHMA 1VECA 1E2JA 5CDFA 2R44A 4R2IA 2QGZA 1BMFA 3LRPA 1M7HA 2DFLA 5F3WB 1KGDA 1Q21A 2R9VA 4OQLA 4CW7A 5CB8A 4L8GA 3GJ8A 4MUAA 4IVQA 4WA7A 4YDSA 1NKTA 1ZD1A 3GLIA 4BFYA 1I2DA 3W5IA 3AF4A 3RWMB 4QBGB 1Z06A 1NRJB 1Y63A 1ZU4A 2IYVA 3AGPA 3QF4A 4JIMA 4KU4A 5FOXA 3EPHA 1MH1A 1QHHA 4LHXA 3U3MA 4RKFA 4D4MA 2WWHA 1II8B 4Q9JA 2WOOA 1SVSA 3CB4A 1E69A 4OL0A 2WZQA 3EPLA 2QPAA 3EPJA 1DAMA 4XH9B 2PLRA 5TV2A 2HYDA 2CLCX 1SVMA 1U99A 1GSIA 3WY9A 4V0OA 2Z4RA 4MUBA 1EXMA 3N2EA 5CYPA 5KSZA 3OIVA 3SJAA 4PSVA 3GEEA 1SZPA 3A1UA 1ZIOA 2J0UB 1ZNXA 2IBMA 4Q4HB 4ASUD 2BEJA 1MRSA 3IPYA 4RFVA 3THWA 3AH8A 2OHFA 2V1UA 1SKYB 2VP9A 5FPTA 3K9HA 1TNDA 2HCBA 5C4GB 1N0WA 3R9WA 1ZUIA 1U8YA 1COWD 2ATVA 1XEXB 1G1MA 4BRUA 2BEKA 3PJRA 1KSHA 1VPLA 3THXA 1P2UA 2JEOA 2ZTSA 2NPIA 1GNRA 1NMXA 2JJ1A 1NBME 2G83A 3BORA 3TAHA 4V0MA 3I1FA 3ICEA 3PR1A 3HDTA 5EXTA 5FI0B 1I4DD 3JZAA 3ONWA 1FQKA 1KJWA 2DY1A 4X8OA 3SNHA 2Z6VA 3CM0A 4JJKA 4TQ9A 2FN4A 3FOZA 3UWOA 3RS5A 4RVCA 5J5CA 3F3YA 2FX3A 3B82A 2FZLA 2QE7A 1WRBA 1OPXA 1XX6A 4D25A 5AJVB 1G4AE 3UPUA 2CXXA 2NO7A 3QXJA 4BLQA 4KVGA 1KI8A 1O87A 5KPJA 3LX8A 1W0KD 1D8TA 2IUUA 1OKKD 4YMSA 1TAGA 4B43A 4JKYA 4LV8B 4M21A 4BECA 1FW6A 2YOHA 4F91B 3EX7C 4D4KA 3TNFA 2PMDA 1UADA 4PTLA 2X1VA 2HJGA 2D2EA 1OB2A 3VMFA 3FTQA 3OF5A 1LF0A 4QBIA 4EQ6A 4E22A 4LYFA 4Y0VA 3FYHA 3PUZA 1RJ9B 5CYOA 4CEIB 1IXSB 5LB2A 2A3RA 1H8HA 2CK3A 2AHOA 2PLFA 2K5UA 2QROA 1FNNA 2WAYA 2BBWA 2BM1A 2VHCA 2VO1A 1H8ED 2GESA 1KOFA 1LNZA 4LJ6A 2IXGA 5DE3A 4M22A 5JZVA 1RIFA 1CULC 1ZBDA 3MG9A 4GMDA 4IFEA 3X1ZA 1W4BA 1G6OA 4IOMA 1R8QA 2XTNA 2ZRNA 1GOTA 2QY9A 1HY3A 1F48A 1E9RA 1XZPA 4YXWA 3RS7A 4C2TA 3E5HA 1E2EA 3VR6A 2OEPA 3EARA 1P9WA 1ANKA 2VP0A 2VSXA 1AS2A 3B6EA 2ZANA 1EG7A 4A6XA 2RKOA 3R9IA 1G5TA 4Q21A 1PLJA 4DLWA 4CEHA 2EQBA 4EFNA 4TYPA 4KCGA 3KJGA 5G3ZA 3AUYA 4XVQA 2J7PA 3HWSA 4KJZA 2J3EA 4PQRA 4XVRA 3OAAD 1E98A 2HJVA 4LHVA 1I4LD 3RS2A 4AC9A 3TUZC 4URWR 2LKCA 1DAFA 3WNDA 2HCJB 1K8RA 3IUYA 2IYQA 3QXCA 4B74A 3B2EA 5ANRB 1N5JA 1EWQA 4JL6A 3DMDA 4JBYA 4Q02A 4Z51A 5HR5A 1L4UA 5HKKD 2IHBA 2WJYA 4XTRA 2CLDX 1ZJ6A 5JHGB 1UDXA 3E1SA 3ZS9A 5CM9C 3QBVA 2GA8A 3BFKA 4HLUA 1XTSA 3BXZA 3GJXC 3IBYA 5EP3A 5EXPA 2HEIA 4C4PA 3GLHB 1QHHB 4DSOA 3IO3A 3GPLA 1DAEA 1OHHA 2XB4A 3CRVA 2KBEA 2QMUA 4GBMA 4DEYA 4A2PA 5A4JA 5K8LA 4HSEA 2GCOB 4MGZR 3T1OA 1YR6A 1LS6A 2GXAA 2W6JD 2DBYA 3W6NA 3FPAA 4HZUA 1GL7A 3IIJA 1G6HA 1GIAA 1A2BA 2OM2A 3QVUA 1NIPA 2PT5A 3VHXA 1P62B 1RRFA 2WMOB 1HUQA 1CR0A 2KB0A 1SKQA 3DZ8A 1A5TA 5FPHA 1G41A 1OFHA 1F2TB 3GEIA 3QY0A 1XTQA 3BOSA 1LVGA 5L3QB 2IF0A 5E4FA 1Z8FA 3OE7D 2ZAMA 1U94A 2AWOA 5DNYB 1J7KA 2GETA 1E79D 3C8UA 3WYFA 4GDFA 1TF7A 2FFQA 3HYRA 4RD2A 2ZYWX 4IOKA 4XD7D 4Z1MD 1DEKA 3VTKA 3QEOA 4WW0A 2G6BA 1LS1A 3G0HA 1MR3F 2ZR9A 3PCRB 4UXJA 2DFKB 2IUTA 1Z0IA 3RRNA 1A1VA 3B13B 4AWXA 1D2NA 2FPLA 4KYIB 1W5SA 4EJSA 1P75A 3GLGB 4B6FA 3L0IB 5KNBA 4FMDB 1XMSA 2ZM5A 3EIEA 2ZU0C 3IGFA 521PA 4D6PA 4DVGA 5E7MA 3BH6A 1F5NA 4A8JC 2RAPA 1KNXA 2XNDA 1G17A 2O8BB 1Z63A 4JT4A 1JNYA 4DWJA 1US8B 2O8EB 5G53C 4QBHA 4BE7B 3IPXA 4DSTA 1SXJA 1KIMA 4JLVA 2P3SA 4A0RA 2HLDD 4JLMA 5EZ5A 2VYFA 3UG6A 1J99A 5HE8A 2QMHA 3HR7A 1H65A 2D3WA 1OH5A 1KMHB 4LJ4A 4V0ME 4DIDA 3P32A 2XTMA 4HI0E 4M9SA 4JBXA 4OK6A 5H1YA 5HTKA 1MO6A 2DPXA 2IT1A 3FVQA 3LVRE 4EUNA 5BN5A 4V02A 5EP1A 3MRSA 1KMHA 1P9RA 2JGNA 3U4QB 1CJVC 3SHWA 2ZSDA 3IIKA 3NDPA 1ZNYA 3QKTA 4HLQB 1COWA 3QQ5A 5FL3A 2QSYA 4KYUA 4UQOA 4A92A 5HZHA 3D3QA 3DOEA 4GSYA 2CVHA 3SE0A 2VLIA 3X1WA 2FSGA 1KSGA 1XPOA 1E1QA 1ELOA 4P4SB 3AKCA 2YOGA 4XSHA 2GWHA 2O8DB 4NKRA 3V4RA 3ZS8A 4PPQA 1N2CE 2QQEA 4QOSA 1W4RA 4U02A 3A8TA 4BRWA 1Y3AA 3GCGA 2EYQA 2R6GA 1YVDA 3WNCA 4II7A 1XWIA 3K53A 1KSJA 5JHHB 4L9SA 3NHBA 2UKDA 2XOKA 4NYIR 1NN1A 4OQNA 1XMJA 1DPFA 4Q4LA 3FMPB 3CZQA 3N2IA 1K6MA 3PEWA 2W0SA 1XPRA 3OEED 1Z29A 3R8FA 5CJPA 1G5RA 4F4JA 3GJ5A 1CU1A 4LV5B 5DI9A 1G16A 1TTTA 3I5YA 2W0MA 1VCOA 2QAJA 1M2OB 2VPPA 3VU9A 2EYUA 1AJEA 4AYXA 2JJ2D 2ZRFA 1ZD9A 1Z47A 4KXFB 5K8IA 3QXXA 3ZZTA 3Q7QA 1P6XA 4BWYA 5DN6A 4OQFA 1P61B 4M0LA 4GZLA 2XITA 4RZUA 4B33A 3WXMA 1RKBA 2HF9A 4S35A 5C4MA 3FMOB 2HYIC 2J0QA 2H57A 2C96A 5CB6A 3ZZ0A 4LGMA 1YE8A 1D9XA 1Z0AA 2O8FA 2QP4A 1WBBA 1N6IA 4ARZB 4PZZA 4LY6A 2WJIA 3FHTA 1E2GA 4V03A 1K5DA 4WAUA 2GJAA 1XB2A 3U3KA 1UBCA 3PQCA 5F9FA 3W5JA 1KDOA 4Q1EA 3WHKA 1X1SA 2WWWA 1KKMA 2GEVA 4XVUA 4A36A 1N6HA 1IHUA 1NVWQ 2OUKA 3VNUA 2O0KA 2EFCB 4PFSA 3EZ9A 3TKLA 4Q9LA 2Q9AA 4FN5A 3AF3A 4JLOA 4Q47A 3Q9LA 4ZDJA 4TZ6A 1SXJB 1KK3A 3W9YA 2O8EA 3HYTA 2EW1A 4C0QC 3BIFA 1S3SA 1US8A 5HKKA 4F38A 5AWFC 4ESVA 1EESA 1LY1A 1W1WA 4RD1A 3WHLA 3VHLB 2ZREA 4CIDA 5IT5A 3BE4A 3LWNA 5DIFA 4LYAA 1TQDA 2ODEA 3LY5A 4JJZA 2ZJ8A 1XPUA 2PH1A 2GHIA 5JWRA 2W58A 1ZAKA 2XJ4A 2XOKD 4IEIA 4MITA 4NE2A 3TLXA 4WVFA 3VX4A 2RCNA 2ZJAA 4DXAA 2RGNC 2FSHA 2H8KA 3NEJA 4IOLA 2CHQA 3O47A 2ZRGA 2ANCA 1EFRA 3U6KA 1J70A 4IVRA 3HPQA 4NH0A 5E7IA 1YR7A 2C9CA 2ZRJA 3P26A 4CT4B 4R71A 4DDUA 4GT1A 3R8CA 2V6JA 2X8AA 3V9PA 5FUWA 1G4UR 1U8AA 2V7QD 2YV5A 4M1YA 3BJIC 1EFHA 1E4YA 4HAYA 1W48A 4I1SA 4NZYA 3TUJC 4L15A 2FPKA 3TW4A 1E6CA 4GP6A 2ZSFA 3CPHA 2JDIA 2GJ8A 2FFHA 4M4SA 3QKUA 4QHYA 2NO6A 1ZC4A 2D2FA 3CW2A 3K0SA 1WQ1R 3WP1B 4J0QA 3DKPA 5KOYA 1N5KA 3L0SA 4MYTA 1R7RA 4OJQA 3MAAC 2WV9A 2JLWA 3NH9A 2CHGA 3TW8B 2GXQA 1CLUA 3U4QA 2O5VA 5BW8A 2QP9X 4GOJA 4NCIA 4QG7A 221PA 4X8MA 5H70A 4JVLA 5EXSA 4DLZA 2I1VB 2ZI6A 4G5OA 4JS0A 4Q7JB 1YZQA 3K09A 4ZCLA 2YNMA 4D80A 2IS1A 1N6KA 3RLFA 2R6AA 4G5RA 2OG2A 4TSFA 2F55A 2A5FA 4DBLC 2ZAOA 4ZDWA 4CZ2A 4ERNA 5AJYA 1QRAA 4JL8A 2I1QA 2WWGA 2FU5C 1D5CA 3SDZA 4D0GA 3CKLA 5GVRA 3LXXA 4JSTA 4DLRA 2OFXA 1FP6A 3NC0C 2P6NA 1OJLA 5SZJA 4AKEA 5C46F 3E70C 5KNCA 5G3YA 2PJRA 4HB3A 4OK5A 1H8EA 4PC1A 2JCSA 1S3GA 3KUCA 5CIWA 2QTFA 2W6IA 3A4LA 4IDHA 4EPRA 1VG1A 5KUTA 1HURA 1KI2A 3EG5A 1GDDA 2E87A 4C7OA 1TX4B 4NP6A 3NWJA 2EWVA 4AIIA 4TL8A 1E4VA 5TARA 2DFTA 1FX0B 5FBLB 3GFTA 4JLPA 4CEHB 2WMNB 4BFZA 4DJTA 3GLIB 4A0FA 2QI9C 4YMVA 3EIHA 5J4LA 5FPSA 1KO4A 3EWAA 2C78A 4B32A 3X1XA 1YR9A 3FGNA 2RGNA 4YDHB 2REXB 4QHTA 1FTNA 2A30A 5K8UA 4WZBE 1CJTC 2YWGA 3ASZA 5D3QA 2F3TA 4ZCIA 1EFUA 3RSLA 3PV0A 1JR6A 2ZR7A 1QHGA 4ITRC 1VG0B 5TY0A 4BLPA 3SS8A 2CL6X 2C99A 1OLOA 3AUXA 3CBQA 4LDJA 5JI3E 4H1UA 4QHSA 4HUTA 5FBVB 3UANA 3QXSA 2EFDB 1H8HD 2CK3D 4FMBB 4MKFA 1E79A 2G0NA 4A15A 4UNPA 1TUIA 1YKSA 6Q21A 1EFTA 1RJ9A 2AFIE 3CF0A 1KKLA 1XCMA 2ZJOA 5LB4A 4MDEA 2YVUA 4YMTA 4TYNA 1VCNA 2OXRA 2NOAA 4JT2A 1C4OA 4KLZA 4B73A 5BXQC 3LAWA 3QPVA 2DHRA 4FCTA 4G0NA 1GRQA 2ZROA 3EWSA 4PPFA 4QBFA 1OIVA 2ONJA 3V00A 1NVUQ 2F3RA 2P0EA 4NDZA 3U7GA 4Q18A 5TXGA 1Z83A 3RS3A 3QG1A 2ZVPX 1KDRA 2J45A 4IOJA 1NL3A 3BB1A 2GVZC 5CK4A 4BGDA 1G8HA 4Z1MA 5JWHA 3KQLA 2RHDA 1U2RA 3Q72A 2AWNA 3U3OA 3T1VA 4LC1A 4BFVA 4OI0A 4A9AA 2ZYVX 4OHYA 4KV9A 2ZE5A 5FL7D 2PZEA 3KDSE 3UMRA 3FMFA 1Z6GA 3KJIA 1ZM2A 4U00A 4DCSA 5KTYA 1IBRA 4WZ6A 1E2LA 1S9HA 3NIBA 1OYWA 3NTUA 3T12A 5EP2A 1VCIA 2XSZA 4IJMA 2KSQA 3ZVMA 4BUJA 3NDBB 4AKGA 1AIPA 3LV8A 1C9KA 4TLEA 2X19A 3U2QA 4HLCA 2VHQA 3K70B 3QPUA 1ZVQA 2ZRIA 1ZM4A 2VQSA 1FMLA 3TQFA 2IK8A 2CDNA 4POAA 2D06A 1DELA 821PA 1NLZA 1LF5A 1XTRA 3I61A 3BAFA 3LBHA 4AG5A 2IF2A 4TL7A 2QBYA 1NIJA 2NO0A 3A1VA 3CIOA 3OFND 1SHZA 2WPDA 3H4MA 1P2TA 3THWB 2D7CA 2R2AA 2ZI4A 3QE0A 2QM7A 2AXPA 2LWIA 3LQRA 2NO1A 3ZIAD 1HT1E 2C9OA 1NY6A 2QBYB 1GKUB 2DWPA 2WIAA 3LLMA 4LBWA 5JEDA 2QGNA 3LBNA 3PENA 4KFTA 1G21E 3CF6R 4IDPA 3DPUA 3I4LA 3CNLA 4L5BA 5LBIA 4KITB 1FFHA 2IUSA 3IDQA 2SHKA 2IA5A 3RHFA 1YU9A 2DWQA 1G3UA 1W0KA 3TSOA 4W5HA 5LD2C 1G20E 4GI7A 5CDFE 1PUJA 2WKPA 4AKIA 2AK2A 3OE7A 3K9LA 2IYRA 2XAUA 3B8HA 3WMEA 4LHWA 5JCPA 2XSZD 3ZQJA 2VHUA 1F2TA 3J81k 1PV4A 1S2MA 1ZD8A 4OQMA 4XSGA 4LYHA 3AQ4A 4F4IA 4KLNA 3RABA 1GKYA 4PAQA 421PA 4EPYA 2FG5A 2BMFA 2N42A 1KI7A 4N0EA 2WVJA 1XD9A 4HB0A 1PJRA 3ZIAA 1E9EA 5C2JB 2OE2A 3QG5A 4PR0A 4Q1CA 5FPKA 3DOFA 4HDQB 2GJSA 4JYBA 4BFXA 1IONA 3G82C 2R6FA 1SXJE 4NYJQ 5JECA 3DHWC 3LX5A 3MUFA 5TDHA 2ZRLA 2ZE7A 2QRZA 4Q1FA 3SU8A 3AVXA 3A36A 4TMTA 4FW9A 4Q48A 2ANBA 1E0KA 1JEDA 1W2GA 2AN9A 3QENA 3BK7A 5FTNA 3T5GA 1Z6TA 3ND9A 5DGXA 3C16C 1VKJA 3RNLA 3U44B 3H1TA 1N6NA 1R0WA 4OHWA 1KY2A 1F6BA 2CNWA 4D2IA 1AGPA 2IXEA 2B21A 2E1RA 1XBTA 5CK5A 2OLJA 3PEUA 3ZYCA 1F2UB 4ABYA 5H8WA 4Q4AB 2JASA 4FMCF 2ZVQX 3KQNA 4AI6A 3IQXA 1T3HA 3SYKA 2X2FA 1DARA 4M1WA 1ZUNB 4WBSA 1B0UA 1CF4A 3B60A 2C9YA 4HATA 3SJCA 3OFNA 4NMMA 4HAXA 1FPMA 2F1IA 1G7SA 4MYHA 3CUEF 2ORWA 4DCNA 3AGQA 2MMGA 2WKQA 2AFHE 2O0JA 2IS6A 3ZZUA 1U0JA 2QAGB 2QMOA 3NBXX 1C1YA 4MRPA 1L2TA 3ZQ6A 1SXJD 4Z8XA 3NHAA 1G291 2ZUBA 2RGBA 4QGGA 4WXRA 2QL6A 3NBZC 3LFUA 5AUNB 4EPWA 1XTJA 1QDEA 2FPMA 1BMFD 4LHYA 1U90A 2PCLA 1N3BA 1SVOA 1YZNA 4NCKA 4P4SA 4B3DA 1ONBA 5BWMA 3QUSA 2HT6A 4RD3A 3H84A 2D4HA 3P4YA 2ZYTX 2ZS7A 2YKGA 2A5DA 2ZETA 3FHOA 4Q7LA 1MO4A 4BLOA 4OHXA 3DDCA 2N1BA 4M8NE 5K8TA 1OXXK 2VRWA 4TLCA 4C0BA 3B1ZA 2VL7A 4PSAA 2BDTA 3K8YA 1OXSC 3I3SR 1UEIA 1ZUHA 4LV6A 3U3JA 1VDZA 1FX0A 2P5SA 4UNRA 4KAXA 4F93B 4TMZA 3W90A 3UK6A 4CEJB 4KBFA 2TMKA 2BCJQ 3VKHA 4P32A 2WJHA 1IM2A 4RCYA 1TMKA 4M9XA 1HT2E 2IYXA 4PO1A 3B1YA 4TSFD 1RC8A 3OEHD 4PX9A 4BZQA 1CJUC 1GNPA 1PLLA 3FHCB 1IJEA 3SQXA 3EC1A 5F2EA 1WXQA 3PUYA 2ASEA 2F7SA 2JLQA 3PUVA 2WJGA 1OV4A 2C03A 2IYUA 1HEIA 2VSFA 2ZRCA 2ZXUA 1NLYA 3THOA 2ZJ5A 2JJ2A 5FPYA 5IRCD 3FB4A 1E99A 5FTKA 3SHFA 3U7EB 5JEEA 4G5QA 1RW4A 3QBTA 3HJNA 3SEAA 3K09C 1Z28A 2QM8A 1G5PA 1W49A 5FBQB 2EFEB 2HXSA 4Q00A 3JVUA 1K5GA 4C0KA 1E2FA 1GM5A 4HZUB 1E2DA 3MJHA 4E07A 3Q3JB 4DCTA 1VCMA 2OILA 3HU3A 4M9ZA 2WWFA 3DKVA 1AS3A 2L0XA 2REOA 3PUWA 4JLDA 4P31A 2BMJA 1FNMA 1ZM3A 5JRZA 1D2EA 5AUOB 3AM1A 3ND8A 1AQYA 2PL3A 5DI3A 3IBGA 2XGJA 3ZLJA 4FCVA 2A5JA 1Q1EA 4QM7A 1WDTA 5M04A 1Q1BA 4U7DA 1KSFX 1T5IA 1GKIA 2W2VA 2VP2A 1M1YE 2GXSA 1P9NA 2WOJA 5CJ2A 4DCUA 4FI3C 4HYYA 2IYYA 1CRQA 2HV8A 4US2R 3DL0A 3SBDA 4JMPA 1BH2A 3L43A 4KSBA 2ZRBA 1YRBA 4O2RA 1KI6A 2EFGA 2ERXA 2IEZA 4NCHA 4MKIA 1KDPA 4PAMA 4CYMA 2UVQA 1T9HA 1E96A 4LX0A 4MKHA 3PIRA 3CNOA 2H7VA 1Z6AA 1G8GA 4EJSB 4PC3A 4B3GA 3DMNA 4QNMA 5DYGA 3SZRA 3EZ6A 3RSOA 2Q3MA 3IIMA 4XWOA 1EFCA 4NYMR 4ESHA 1YZUA 1OSNA 3W3AA 4MRRA 3VR5A 4GZMA 4TL9A 4P3YA 2OAQ1 3I32A 4K81B 3QEJA 4IXMA 4UJ5A 3RAPR 4IKEA 2BCGY 2ZS8A 3AP1A 1SVLA 2ZITA 2C2HA 3WRXC 4A8JB 3M4YA 3HU1A 3EASA 1RYFA 2R8RA 1HQYE 3NEYA 1VTKA 1M7GA 1E1RA 1GP2A 2BMDA 1QHYA 4HUQB 4KO8A 1WBDA 4O3MA 4XOIA 5SZIA 2IYWA 4E09A 4URXR 2GJKA 1G3RA 1P7CA 2PZGA 5FUXA 1QG4A 4BFSA 5BYKA 4HEJA 4B48A 1SKYE 1WP9A 2XTZA 4DB2A 1NY5A 1XTIA 3BS4A 4RD0A 4B71A 2AKYA 3C4JA 4UXIA 3LDAA 2VF8A 4MKGA 4O25A 1BS1A 2VP5A 3VU9B 5JSZB 5LPNA 2IYLD 1JJ7A 1YZKA 1ZNZA 4PO9A 5BYJA 4ACAA 4B44A 1Z07A 1HE8B 1X6VA 1U0HC 2QSZA 4TN1A 5KSYA 4JLKA 2ZRHA 1X3SA 3GJ6A 1XCGB 1A7JA 4PZLA 4FWIB 3OZXA 1WA5A 1XP8A 1E9BA 1E0AA 5FUYA 3QXHA 3PG5A 3MMPA 1JXOA 4RKEA 3I5XA 4MA4A 3BBPA 3HP1A 3O8CA 3CR8A 1M8PA 2BC9A 4RZXA 1LW7A 2WBLC 4Q01A 2QTHA 1T3SA 2IC5A 5EXXA 1DAGA 2IL1A 3CX8A 2C98A 5CLLA 1W36B 3T15A 1MABB 4LCBA 5JLJA 1JAIA 1IQPA 3LBIA 4D4JA 3UXMA 2BM0A 5DN6D 4JLAA 2J5XA 4TT3D 1MO5A 3RRZA 1JEEA 3BH0A 3AKEA 4EKDA 2VHJA 2J1LA 2DYKA 2GAOA 5HPYB 3AP3A 5L3QA 4DCVA 2JLUA 1ZC3A 5TVKA 3Q85A 4A82A 3SC3A 1VIYA 4GOKA 2F1RA 1SVKA 3EIQA 1HH4A 1CTQA 1TU3A 3CRMA 4HAWA 4I1UA 4IXNA 3VR3A 2Q0HA 4R7ZA 1MV5A 4TMXA 2O0HA 3KXIA 4C3ZA 2QN6A 4H9GA 4TTQA 3T35A 5CITA 1XEXA 5CM8B 4GP7A 1OKKA 1Q3HA 4TYYA 4LWZA 3TUIC 5DLQC 1AM4D 1E2MA 2B8TA 5IDVA 3UG7A 2WJJA 3I8XA 4EFLA 1N6OA 1W47A 1TADA 4YONB 3RRYA 4KODA 4BPBA 2FFBA 1Q12A 4KBGA 3EAQA 5L3SB 4I1VA 1QG2A 3EC2A 1KI6B 3RWOA 4GL2A 1IN7A 2YINC 1Q1QA 3KL4A 3THYB 1EWRA 3OIWA 1D2MA 3NBFA 1ZINA 4WOPA 2KE5A 1NG9A 2Z0MA 1FUKA 1UEJA 4DDWA 4TYWA 4M9QA 2O8CA 3CPEA 1IOZA 4NBSA 1JALA 1GG2A 2OBMA 1X86B 4UNNA 4WXPA 5JMTA 5ELXA 3AVTA 3WBKA 2CVFA 1P3JA 4LJYA 4UNQA 1S8FA 4H1VA 4A8JA 4C0HA 4N0DA 1T8UA 2GCPA 3UKDA 3CNNA 4PHGA 1U9IC 4L4UA 3IQWA 2ZJZA 4IW3B 4LBZA 2OFOA 3WP0A 3AB3A 3GLHE 4NYMQ 4LZZA 3QKRB 1NMZA 3RRMA 4A0GA 4MYUA 4DLTA 2ZSBA 3KFXA 4EAQA 1LB1B 4HAZA 3X1YA 5KO2A 4G01B 1N6RA 3B9QA 1UFQA 1KY3A 1E1QD 3A58B 4URYR 1XTKA 3DZDA 5EJEA 2CE7A 5B30A 3KQUA 4CRWB 5E7JA 3ZD6A 4DIEA 3FKSD 2UZIR 2ZE6A 1PLKA 2QAGA 4BFWA 2GK6A 4P4UA 2F43A 4CGZA 3K9GA 1S4QA 4NPHA 3ZGXA 1GVNB 3MJRA 3GLFB 2B7CA 3IEUA 3ZJYA 2BHRA 1NVXQ 3PUXA 3W3ZB 2GCNA 4XJXA 2YJTD 4LPSA 4AURA 1NSTA 2RGAA 2YWHA 3CONA 4AY2A 1T91A 3C7KA 4PHHA 3ECCA 3MWKA 4OI4A 3R20A 5AJZA 2JLXA 5KSPA 4EDHA 3BB4A 1OFUX 5FOSA 1ZU5A 2VA8A 1IN8A 3C14C 2FEMA 4QRHA 2I4IA 1R2QA 5EE9A 5B2ZA 2GCOA 4HB2A 1GRRA 4ZDIA 1NKSA 3A1SA 5B57C 1X1RA 3HPRA 1KAGA 4I81A 2J87A 3OIUA 2WPDD 4KFUA 3UMSA 3AKYA 3L2OB 1RZ3A 3FFAA 2JDID 5TMPA 2BWJA 4LBVA 5FR1A 2OZEA 3QKSB 3M1IA 3K70D 2FEOA 4OKSA 4LJ7A 3U3RA 4EPTA 1J8MF 2PMKA 2FWRA 2WM9B 3KKQA 3VKGA 1R5BA 3P1JA 2H17A 4W5WA 3ADDA 2CCKA 3GFPA 4BZPA 1W44A 3CX6A 1UM8A 1IY2A 3NC1C 1JI0A 1ZRHA 5GJVC 1XEWX 5J47A 2R65A 4UKDA 3T34A 2EU8A 4FXPA 4X8HA 1II9A 1DO0A 2C5LA 4WIAA 5B58C 5AUPB 3GLFA 2NZ8A 3KX2A 1QVRA 2VF7A 5FUVA 3P20A 4YXWD 2QG6A 3I92A 1KK0A 4GFDA 3ADBA 1RVDA 2VP4A 2MSEB 2NPFA 2OCBA 3Q5DA 1W5TA 3M0EA 4EJSC 3QOFA 3IHLA 1GITA 2JATA 4E03A 1TQ2A 1IXZA 3TMKA 5GJWC 2AKAB 5TB5A 2Z43A 1M34E 1RE0A 5DH9A 2ZIAA 2QZ4A 3E2IA 3GD7A 2EWWA 1W4AA 2C77A 4MRNA 5E95A 1AZTA 3FMIA 3OAAA 4Q7KA 2RGXA 2BV3A 3GJ7A 3A6PC 2IX3A 2Q3FA 2G77B 2ZI7A 1R5NA 1P2SA 3RS4A 4D82A 4QKQA 3U60B 1NJFA 4BASA 1SVWA 4DLXA 1F2UA 4KFRA 4A4DA 2XZOA 4RJLA 2GVDC 4US0R 1NLFA 2ATXA 1DS6A 3FKQA 2FOLA 2PX0A 5D3MA 2FZ4A 5EUQB 4DZZA 1R0YA 2C95A 3H86A 2A5YB 2NMVA 2CNWD 1CJMA 4I1OA 2ZJBA 4TLDA 3H0KA 3DM5A 2YC4C 4B47A 3B5JA 4QFMA 5KHOC 1VG9B 1N6LA 1Z6XA 2B6HA 2CL7X 2VIIA 2G1JA 2ZI9A 2G1KA 4EQ6B 4PAOA 2CL0X 4JVNA 5AJXA 3VKWA 2HF8A 3UATA 1G7RA 2XNDD 4CVNA 3BFVA 4HAVA 4A6PA 1XFAA 1E0JA 4CDGA 1XD2B 4QM6A 5FTLA 2RH5A 5KU1A 1CRPA 1XJQA 3AKDA 1NI3A 5LDDC 3U7FB 1RRCA 1LFDB 2O8DA 3AVWA 3EZFA 2AK3A 2GKSA 5A0FA 1DAIA 2N46A 4TQUS 3KKOA 3D8BA 4G5SA 4RZ2A 3VX3A 2QRNA 2GEDA 2RGEA 2C04A 4M53A 4LC0A 4RSGA 4Z8YA 4ASUA 2IXFA 5G41A 5FI1B 2FGKA 2ZUCA 3VFDA 1TPZA 1DOAA 3TIFA 2J41A 2RMKA 1YJ5A 1QHXA 5J4HA 4TMKA 4C0JA 1JQLB 1NJGA 4BLTA 4LHZA 1A4RA 1A2KC 2KWIA 2V3CC 2BBTA 1DTSA 5L8VA 1WB9A 1U8ZA 1E9FA 1ZM9A 3VR2A 4DSNA 4Q5IA 4HDCA 4DC9A 1XEWY 3B1VA 4M1SA 3I62A 3SYLA 3T06B 3BERA 1T8TA 4TLBA 1T0HB 1E32A 1ZMXA 2CHVA 4PC7A 4C0LA 2GZAA 1W0JA 2RGDA 2ODWA 1EX7A 2VH5R 1Q22A 2BOVA 4B34A 2QA5A 2IYZA 1EFRD 1VHLA 3UIEA 3THYA 2GNOA 2ZI3A 4QJ5A 2OESA 1OIWA 5KNDA 3A1WA 3I8SA 3TR0A 3B7GA 4NONA 1G7CA 4HUQA 4ACBA 4KVAA 1F60A 4FCWA 1XD8A 3W8NA 1L7VC 1T5LA 4PC2A 1U0LA 3TVDA 3QSYA 2GF9A 3U7HB 2HDNB 4GNKA 4HZIA 1WF3A 3KUDA 3LQQA 1XMVA 4OK3A 1W46A 4PZYA 4EPVA 2J9RA 1TEXA 4C9BA 4C7OB 1G3QA 1GZSA 2EVWX 3KZ1E 5EE0A 3X1DA 2W83A 2YOFA 2W6JA 1N6PA 1ESMA 2PCJA 4XTCS 1SGWA 1ETUA 2CLSA 3CLVA 4ZPXA 3REFA 3SJBA 3QJYA 1CXZA 4LRWA 2W6ID 4TWZA 2GAAA 1NF3A 3KJHA 1XXHB 2DCUA 4Q03A 2HXYA 4AYWA 2XXAB 1Z22A 3CH5A 2H92A 2O8BA 4LSGA 4JVMA 3T5DA 1G3MA 1W36C 1E9DA 3NVAA 4Q4AA 1M6NA 5DHAA 2ZQ5A 5UKDA 1HTWA 4I99A 2ZSEA 4RCZA 1BYIA 2QENA 4LOAA 3EA0A 3AVOA 3O8DA 3KQKA 5KPDA 3W8RA 4Q1AA 3RANA 2X2EA 5FBRB 5JBQA 1FZQA 2OV2A 1SULA 1JR3A 1XEFA 1FMJA 4HAUA 3TK1A 4JKIA 5HE9A 1Z2CA 4PQYA 3PEYA 1MT0A 1IXRC 1AS0A 1R5OA 1V43A 3NXSA 4B3XA 4NL4H 5GJBA 5AR1A 5BN4A 1KI9A 2QTVB 1GUAA 3TVTA 5DISB 2CCJA 1E2KA 3CRRA 4JVSB 3R7WB 2JIZA 1FOEB 1MO3A 1TU4A 1CIPA 4LK2A 1QHIA 4G1UC 5FOVA 1NVVQ 1Z3IX 1L4YA 1E9CA 1E2PA 2F6RA 3K9NA 4B6EA 2Z5FA 2ZU6A 3S1AA 1AKEA 1QF9A 1XXHA 3B9PA 2IS2A 3BWDD 2ZYUX 4QGHA 1BOFA 3L8ZA 4LBYA 1PUIA 1JQJC 2P5TB 3ZVNA 1XDBA 3NG1A 4CEJA 2GBLA 2IWRA 2A78A 1DO2A 3FE2A 3MD0A 2YHSA 4RY2A 4L16A 1XCPA 3QKRA 5FFMA 2F9MA 2GDJA 1TF5A 4FINA 3OIYA 4MGIR 5KDDA 1JAHA 1Q0UA 3BGWA 4B3FX 1ZP6A 4ZCMA 1G7TA 3LW7A 621PA 2Q9BA 2XEXA 4ON9A 4RZ3A 4D26A 2IYSA 2RB4A 3T61A 1OE0A 1OH7A 1CR4A 2JLRA 1NMYA 1HQCA 4DHEA 3GLFE 3WYGA 4RD4A 1OH6A 1TF2A 3AP2A 1GL9B 2QORA 1AQUA 1RFLA 1KI4A 4MH0R 1IJFA 2RGCA 2MSDB 2WWIA 3VNVA 5KSOA 4B2PA 4DEXA 5J4VA 3R7WA 2FSFA 1UKYA 2CBZA 1II8A 1ZCBA 3BFXA 4JYCA 5L3SA 1DG1G 2CMKA 1RRGA 1F3OA 4NYIQ 1ZYUA 3KXLA 1E9AA 1MRNA 1VIAA 1PVOA 2W2XA 1S1MA 4KFSA 3REGA 2OT3B 1XU4A 1GNQA 2HLDA 3TQCA 2V54A 3F5FA 1SXJC 4DSUA 1FL9A 1NBMD 2DWOA 1GRNA 3VR1A 2XNSA 4R2HA 5JSZA 1NSFA 1TQ4A 4W9MC 3CWZA 1SQ5A 2RGGA 1T3LA 2B8WA 4D0LB 1E1RD 3AVQA 1ZNWA 2WWYA 2FH5B 1R0ZA 1QZXA 2WWXA 1KTVA 2WSSA 3HR8A 1QHNA 4G5GA 2FFAA 4URVR 4PHTA 4HDOB 2OFWA 1M7BA 4P33A 4K46A 4N3NA 3SN6A 4UNSA 2W00A 2G88A 2P65A 2R6DA 4PPGA 1N5LA 3THXB 2YWFA 3RYTC 4RFSB 4TLAA 2BKEA 4GMXA 4TZ0A 3B78A 1YRAA 2CE2X 4OHZA 3VQTA 5EUMA 2NGRA 4BLRA 1X8LA 4B3CA 4UJ3A 2R6CA 2AD1A 1DADA 2PBRA 2PT7A 4DB4A 1JB1A 1G19A 5JWOA 3CPJB 5DHFA 2ZRMA 5EE5B 1X8KA 2A7QA 3ASYA 5SZHB 4F4CA 2GXUA 4ZO4A 1E3MA 2ZRPA 3L0PA 2DB3A 5L3RA 4V0NA 2ZI5A 2QAGC 4B2LA 4M1OA 5P21A 2IEYA 3DO6A 4R9UC 4AKHA 2F9LA 3GLHA 2LCFA 2YYZA 4BEBA 3MCAA 4LJAA 1G3IA 5J4YA 1AKYA 4Q1DA 2ZR0A 4IRUB 1J8YF 3K0FB 5H68A 1ZCAA 4EPXA 3GLIE 3K0EA 2F1HA 4PC6A 4Q19A 1OYYA 4JSYA 4QGAA 1UJ2A 1P4SA 2NIPA 1P73A 2JIZD 2GF0A 1E9SA 4Q1BA 1AZSC 1CS4C 1DE0A 1ODFA 3PITA 3AVYA 1VG8A 3C15C 3BC1A 1NVVR 1OXVA 5CIQA 4OYHA 2FF7A 3KKPA 2O52A 2J46A 3PFIA 4MYCA 4URZR 4BFUA 2X77A 3U61B 3A4NA 3SFVA 2QPTA 5DO9A 1IY0A 2CEAA 1KO8A 3OEEA 2D7DA 2H5EA 4B76A 1Q57A 1EGAA 2BIFA 1Z0KA 5HCNA 3AVPA 4RD6A 1YZGA 3IILA 3AVUA 1NN3A 1U98A 5FL7A 1Q1ZA 4K8OA 1A82A 2ZJYA 3MGCA 1Z0DA 1KAOA 1G8FA 1TEVA 3KTAA 3VAAA 4C2UA 1CEEA 2Z4SA 4FMCB 1OW3B 4JBWA 4DLVA 2GBLC 1OFTA 4QJ3A 3KFVA 1XNJA 4I4LA 2P6UA 1PZNA 3HU2A 4E5UA 2AXNA 3A4MA 4QC2A 2WTUA 1IN5A 4GOXA 3QKSA 1V5WA 1UBGA 1NG1A 5KYKA 1Z5ZA 4YC7A 2ZRDA 4IVPA 1J90A 1E0SA 4NU0A 3KJEA 2G9NA 1RPZA 4BLSA 2H18A 4QNRA 1G8YA 4YLGA 1OFIA 2XXAA 1VYTA 3IO5A 5HCIA 2ORIA 2QEQA 3WRYC 3R9XA 4G3XA 4TTRA 1OHHD 1IY1A 3SOPA 3RVBA 1W2HA 4O0MA 2PEZA 2NG1A 3PXGA 1R8SA 1KK1A 1YQTA 3JVVA 1GL6A 1S9DA 2WKRA 4FWTA 1M74A 1OIXA 2ZE8A 4NYJR 3TH5A 2GTPA 1NP6A 1LV7A 2FMXA 1MKYA 2OCYC 2FSIA 4V0LA 4IDOA 4IHQA 4O2LA 4PHFA 4Q9HA 3GLGE 1MABA 1O3YA 2V6IA 3KTAB 3V4FA 2OXCA 1ZW6A
chains in the Genus database with same CATH superfamily
4ND8A 3ZNOA 2GEJA 5BR7A 4N3AA 1XALA 4KAFA 4L8WB 1HL7A 1VYVA 1GAJA 1IEVA 2PS3A 3GDGA 3GT0A 4IF4A 3RT7A 1K0UA 1X1EA 2BJVA 4UU7A 3HYSA 4WFKA 1PK8A 1EEHA 1FTSA 3K0CC 5B2ZA 3F0TA 3KFLA 2XWBF 5ALMA 4BEVA 1UF9A 3H2YA 1YQQA 1NBMA 1Z5WA 3UWMA 2NT3A 2W93A 2G3YA 3HWX1 3DXFA 3NHSA 3EPKA 4LC9A 4OJYA 5FTJA 2IY8A 2BDEA 4BCBA 3ILVA 2PUJA 3EVCA 4WE3A 2MSCB 3I2JA 1P81A 3KQHA 1QTIA 4URUR 5FT9A 1R1DA 3DLPX 5FX2A 3I04A 1Q7CA 3CKKA 4OFZA 4HH3C 5FOTA 4UTNA 1JKMA 5JVDA 1O96B 3DLIA 2FE4A 2H16A 2HA3A 5ALLA 5FTMA 2NTYC 3CH4B 3U9LA 3A10A 3GJZA 3D7MA 1J2JA 1E2NA 2I4LA 4RHFA 1HO3A 5GADl 4G8CA 4OQXA 3RK0A 3ZE0B 2GHQA 4S1VA 1M2EA 2VNJA 2P3QA 1QYDA 4BGVA 1Z2EA 5G0UA 3UJNA 1EK0A 2DF8A 1O0SA 1QYRA 3KE8A 3O91A 1XQWA 2ZEJA 2CMGA 1RYHA 4TWIA 3UQYS 3GAZA 1QMGA 4KN9S 2C3YA 3RSSA 1MC8A 2F62A 3ET4A 2I7CA 4HRAA 4CDRA 2CXTA 2FA9A 3P4XA 3GLGA 1DV1A 5JCOC 4QL3A 4AQYB 1AGRA 4MGKR 5H80A 2OM6A 2ZPTX 2XTJA 3ADCA 2WNIA 2V59A 3Q7PA 5EIAA 8OHMA 3UJCA 4DUPA 2QUKA 2O20A 2WYHA 3DCNA 3HJGA 2X13A 4DABA 1FSFA 4PANA 1DBSA 1RCUA 1HBJA 1E4EA 5KOJA 4A0QA 3H7IA 1UMDB 4JLNA 3DULA 4H35A 1U9YA 4COKA 3CT4A 5F9HA 4GZ6A 4KTVE 3H1PA 4C4OA 1ECPA 4LKRA 2IVFA 3FKSA 3ONFA 4ZI3A 4FD2A 4MVJG 2REBA 3QJGA 1QVAA 5BQOA 4UAUA 2DTEA 4IGEA 4NG5A 1TL7C 3PYMA 5EJIA 2IH5A 4HVTA 1YASA 3G5UA 1WCV1 1ODIA 4NZ9A 4B3SB 3LNCA 1R9MA 4EY3A 4WLUA 3IKLA 3CX7A 3ZE7A 3ZU2A 2F1JA 2I2XB 2V7BA 4JDPA 4TYMA 4BDTA 2RHBA 3Q3HA 4E5SA 2MMCA 1P19A 3WMWA 3DEZA 2OBLA 3SYRA 3S6JA 4AB1A 4U5XA 1G9TA 1XKQA 3UJ7A 1VZ3A 4YMUA 1YS1X 2O3SA 4KP7A 3OQPA 2PKEA 3ODGA 1E8DA 3E7XA 4KO4S 1M2GA 4OHPA 5DT2A 5KDLA 3T7DA 3WMFA 5BR1A 2TYSB 1HA3A 4LI0A 5KAMA 3HYNA 3AUAA 2GHRA 4IF6A 2Y92A 3M4ZA 4HWOA 3T3NA 2HDHA 4ALKA 3I2FA 4RA6B 4AN4A 3PC4A 2ICAA 1Z9BA 2OCPA 5JC1A 1HV8A 1Z33A 3DD5A 1RNLA 3O2NA 1R10A 4FUTA 2C7QA 1JLMA 2CDAA 2C5BA 4NCJA 3LWDA 2ZXFA 5M3BA 1ZCFA 4UHFA 3D8RA 4QDJA 3GGGA 3N2GA 4RF3A 3CZPA 3CG4A 4F2WA 2D0OB 5AK0A 5JJLA 4D44A 5EE3A 1U8UA 2VBCA 3MW8A 1UK6A 3MINA 1ESNA 3O8BA 4BZXA 1WE2A 1RSZA 1HNWB 3CA8A 1OBOA 1EJ0A 3PUIA 1ML4A 2Z2KA 4MW5A 4XA8A 3FFXA 5ARBA 2UXBB 2OHXA 2P2SA 3PGA1 2W8ZA 3O4HA 3WJ1A 1NVEA 3R7AA 4UATA 4G5FA 3BCHA 5EJ2A 4XX0B 1V5FA 3NKFA 4FIDA 4R1LA 4RMGA 1WZNA 3H4VA 5IBQA 5T4HA 3BJMA 3O8OB 4DS3A 3SJZA 1LZKA 3VNAA 4ENUA 2SICE 2VBFA 1QZZA 1ZXXA 5JCZA 3D31A 1GG8A 1K9SA 1CBUA 1CDEA 1YKGA 3NO4A 1YRQA 5DEOA 4YAIA 2OBNA 4ML3A 2AJTA 2CXNA 1KHTA 3LW8A 3Q7SA 1U7UA 4YMWA 3AILA 1L4GA 2W6NA 2AQ8A 4E3ZA 2GN4A 1R0XA 4TL6A 2GJ9A 3BT7A 6YASA 2XBMA 1KJIA 1LPOA 1O5OA 2NO4A 4Q7MB 1LU9A 2F64A 2MINB 1EZZA 1HE1C 3FFBA 4MGHA 1U28A 3ZH9B 5IF9A 2JCYA 3ME5A 5BW4A 3FR8A 3RASA 3IUBA 4L1KA 3FOFC 1T4GA 5D86A 5BP7A 1ZS9A 2GK7A 1PZHA 3INYA 2CLEB 4OJKA 3ED5A 4RE6A 4EGQA 1V9SA 5A4IS 3EMKA 3JQQA 1W36D 4YREA 2QJFA 3O95A 2R62A 1I94B 4NECA 5GIPE 3FLBA 1WNTA 2ZQZA 1YHNA 4TMWA 4RTSA 3VR6D 1NJ8A 5AUQA 5LBUA 4WNIA 3S1SA 3DZGA 1XJ0A 3NWBA 4QTZA 1ATIA 4WFJA 4YAOA 4YRQA 3U4CA 3UENA 5L7WA 1PZMA 2PH5A 4Y9RA 5ECWA 1UBFA 3W34A 3DXZA 4MEAA 1N0VC 3DMPA 1GT91 2OOKA 3FDZA 3LVBA 3WYAA 2Y67A 3V55A 2D1TA 3GEHA 3IVAA 4Q4DA 2Y99A 4ZT7A 5TC4A 2NLOA 2WVGA 2ECKA 4DWVA 1SXQA 1JILA 2V0GA 1EDOA 2FJ0A 1GPJA 1DRJA 4IDQA 5ALEA 1KEEB 4RY0A 3L7AA 3BMCA 4TSKA 5CXXA 3U5ZB 2OKCA 3VU8A 2R7AA 4IFBA 1VI2A 1ISIA 2Q4TA 4FDUA 2QJTA 4PPNA 5ALVA 2DWCA 3KB2A 1PR0A 3DT6A 1C7ZA 4MP6A 2O3UA 1Z2OX 1Z4PX 1QP4A 3Q9NA 3KHSA 3QVGB 4JI3B 5BOVA 3E1KA 3GVCA 3GZNB 4MWTA 4V0KA 3T1TA 2J9FB 5FWYA 3NHUA 4DYVA 1A9RA 1VYUA 2W2LA 5L3VA 2DFVA 2H2IA 3QLUC 3SBEA 1L4KA 2AIRA 2O8FB 5TX7A 5A0TA 4UM5A 4EW1A 4KPYA 5M34A 3ASUA 3JSAA 1BKDR 1UBEA 1G9XA 3V4OA 4BQIA 4RPCA 3V4LA 3UAXA 3ZCVA 2E3JA 2Z3VA 5ALZA 3ZE6A 3KKLA 1XF1A 3EW9A 3UWKA 4TQAA 3QYAA 2W70A 1UP6A 4FONA 5MN5A 1WUJS 2KW5A 1N36B 1Z08A 2BBOA 1XEAA 1NNEA 4Z0NA 1NJSA 4GLOA 4QQ8A 3PWTA 1MCZA 2XUIA 3KUXA 4I1PA 3N6VA 4BOYA 1ZJZA 3V2HA 3WBJA 1KNQA 1P5ZB 4OI2A 3O4VA 2QUIA 1GCUA 5GAJA 3RBXA 4C3VA 2CFRA 2DKOA 1ZGHA 3P5BA 1ECBA 2X22A 2ZPAA 1E2HA 4CLRB 3Q5EA 1B93A 4FXOA 1DQRA 1UL1X 1XDGA 1DWQA 4AJNA 1E2QA 5A5EA 3HU5A 2D62A 1PFUA 3IFSA 3P96A 1I80A 3H5NA 4HQRA 4GBGA 4EFMA 1G1AA 1VJ1A 2HWUA 3LCMA 2QZSA 5FHRA 3L4KA 2WAXA 1LBTA 4IYJA 1ENZA 5I7OA 1CDDA 2GBCA 3KWMA 1SCIA 3O31A 4B75A 2NT4A 3ND6A 4P4GA 2AZ4A 3ZQUA 1UAAA 2BH2A 1JR3D 1XNGA 2BFCB 3CRQA 1F8YA 3LFHA 1VE5A 4BQSA 5JATA 3DM9B 1YE3A 5ARDA 2RK4A 4TXHA 4HYQA 3DZFA 4QU8A 3H05A 4O4HB 4MR8A 1UP4A 2PUVA 2QNRA 4DE5A 4NI5A 2AQHA 1GSOA 3QVLA 1MQAA 4WKNA 4C4SA 1QONA 1WMDA 3AVVA 5H81A 1Y34E 4MPJA 3U1TA 5JV5A 4NR0A 2G09A 1KJYA 1KO1A 3CUTA 4TT3A 3MJCA 5C80A 2WIKA 4RYLA 3ET5A 3L04A 3RC3A 2IWHA 2HU5A 1I2MA 3OU2A 3OOYA 4F6LA 4ZIRB 1JHAA 2F17A 3EDOA 4IJ5A 4OYLA 4X61A 5IYZA 4QUAA 3CVOA 3IPAA 3N8NA 1A9XB 1WY7A 2XB2A 1DZIA 2GK4A 3ZD7A 1XXHE 2GBPA 2DPGA 2UYYA 2IDZA 3NJ8A 4AQDA 1T3TA 1XOIA 4JUDX 1JHDA 1G8PA 2YRFA 1TKRA 3OQJA 4US1R 1OC4A 2H52A 4KMMA 2X23A 1JDBB 2XRFA 4R2MA 1C2YA 5EL0A 2JA1A 1L3BA 4PVCA 2OQVA 1OB5A 4OXIA 5EY5B 5DI3B 3WOHA 4UHCA 1IULA 2PTGA 5JCJA 4L57A 3LOPA 4WZAE 2VEDA 3CRW1 3STTA 4F92B 1OOEA 5HK9A 4P4TA 4GRAA 2R0QC 4B35A 3TTYA 2NXWA 1XZDA 1NN5A 4P3PA 1EFPA 1RBZA 4ILEA 1ZMBA 3ANYB 1AOXA 3BMQB 3H99A 4OQPA 5E7QA 4HDKA 5DULA 2I3ZA 1N9GB 3MWLA 4ZCPA 4S2EA 3WK6A 3R3SA 4JSRA 3V8VA 3FYSA 4IIYA 4HUJA 3L93A 4A7PA 3D6TB 3MJ4A 4OQYA 1PHRA 4CKZA 1DG3A 1KERA 3FCEA 3I5AA 1U2DC 2WHXA 3AOEC 2JRLA 3C5CA 3K35A 4HC4A 4IO0A 3ZWAA 4XWWA 1MOQA 3PQ5A 3EJ6A 4KQGA 3KUKA 2R87A 4IS2A 4AK9A 3SFZA 1U6JA 2Z95A 1GGFA 3FGZA 5BN3A 5BXYA 2XJ9A 4GPIB 5H83A 4TQGA 4W7SA 1N2GA 1NE2A 2OG1A 5BVHB 4P34A 2E4ZA 4LQ4A 2GRJA 1VLJA 1YJAA 1A9XA 3OHMA 1VECA 3UJDA 4DR4B 1UMCB 1E2JA 1AY0A 3T7AA 2R44A 1CEQA 2H2GA 2OZVA 4M8SA 2XUZA 4FC7A 2A1TR 3KLOA 1M7HA 2Q27A 3FPBA 1XMPA 2OXIA 5ISMA 2WTXA 4OQLA 1YQEA 4C29A 5HM6A 4XYBA 2AOTA 3NZEA 1IDOA 2Q49A 4MUAA 5T57A 5C1DA 1NKTA 5ITWA 5CX1A 1W29A 2AG6A 4BFYA 1I2DA 4FYYA 1BRTA 1DKOA 3RWMB 4AX4A 1QZUA 5FOXA 1CVRA 4AZ0A 3TOXA 3A04A 1L7EA 1CUWA 4KXWA 3CFYA 1MH1A 4TXJA 1QHEA 3WRXA 1QHHA 4LHXA 2Y93A 1JIJA 3HBJA 1X9GA 2DKFA 5ALTA 5D2CA 4I36A 5BWCA 1KFBB 1Y4DE 1SVSA 1IFXA 4OL0A 5BT9A 2WZQA 2HMYB 3ZHZA 5JT1A 3EPJA 2I2AA 2HYDA 2FF5A 3GU3A 1B43A 4QXQA 4UQPA 4V0OA 5IW8A 1K4MA 1KOGA 1EXMA 3N2EA 2N9UA 3G02A 2B1QA 1A5BB 2XLBA 4ZFNA 4AROA 2Q0SA 2O2GA 3OF3A 4EM6A 4R8RA 1NW8A 4M7PA 3SQLA 4EL0A 1ZNXA 3QEMB 2VC2B 4MV7A 4C0XA 1U5AA 4BLVA 4NBRA 1L5HA 3GAMA 3IPYA 2O59A 3KZOA 3AH8A 3IODA 3ONNA 3GCXA 4EARA 1H0RA 1ZXLA 2PN1A 4XB6B 5C4GB 1MIOA 5DM4A 2BTQB 2CF6A 5F78A 5A9SA 1U8YA 4AS1A 2FAXA 2ATVA 2ZBDA 4BRUA 4NENB 1KSHA 4RMJA 1NM5A 1R9GA 1VFPA 3O03A 3IALA 1GNRA 3L6DA 1NMXA 3TIGA 2IYOA 1DRUA 2WUFA 5C0OE 4B3MB 3TAHA 3OC6A 3BORA 3WO1A 5BOSA 3I1FA 5DHQA 1RT9A 2XMRA 1I4DD 2BFEB 3ZY3A 3VA7A 4CG3A 3WGOA 2H00A 3SNHA 5KYUB 1IBMB 2EJCA 5IVKA 4UREA 5EWLA 1F2DA 1QRUA 3IR5A 3ELBA 5J5CA 4UEWA 3F3YA 3B82A 3P9KA 3FPKA 1BHJA 3OURA 4M0PA 1WRBA 1YUNA 5JXWA 1W581 4KLRA 4LVOA 1IPHA 1G6Q1 4KB5A 1PQUA 3CLUC 1ACMA 2CL5A 2RI6A 4BLQA 3VVMA 1ACLA 1KI8A 1LJ8A 2SNIE 4N3CA 4DG9A 4ESEA 4L3OA 4AJJA 1OKKD 4O4HF 1TAGA 3SK0A 1N9ZA 2Z09A 4HDRB 3QM1A 4JKYA 2C97A 5E1BA 4B43A 1FW6A 1V5EA 4F91B 4KWHA 4D4KA 1FUEA 1OLUB 1T1RA 1U3WA 1GPMA 1V6CA 1YE5A 2AW5A 2PMDA 2Y3IA 2Z9DA 3AL2A 1JQ3A 1Y4ZA 3E48A 5JAHA 1QS0B 1ABBA 4DR1B 4DM3A 2XGOA 3VMFA 3BXHA 1X1BA 4FYVA 3HVRA 3AT1A 3AEKB 5ALIA 7MDHA 5I8WA 3FYHA 1A5AB 1T1GA 3IP6A 1RPJA 5K0LA 4LY0A 5LL6P 1NOJA 4CEIB 5JG7A 3OFVA 5LB2A 2FEXA 4V1CB 5IG2A 2PLFA 1NM5C 4ZC1A 3IEMA 4RPJA 1TZJA 3AR9A 2W6QA 2QROA 3CZ9A 3KTOA 2IYPA 4KFCA 2R1TB 5CXUA 2HUNA 2GTHA 2VO1A 4K9QA 1M75A 2QV7A 2BTOA 4KGZA 1PD1A 1Z4OA 2FX5A 1GZ6A 2NUPA 3ESAA 4N54A 4L78A 4YALA 2I29A 3CO0S 1X7DA 3WLHA 5LMZA 1W4BA 1ZOPA 5AP9A 1C1XA 1VOTA 1SD1A 3FX2A 5AJUA 1QX3A 2QY9A 4CODB 1F48A 2EZ9A 1C5KA 4YXWA 4PCAA 2Y68A 3EJWA 3FI0A 1AMNA 4X95A 3WLOA 1Q0LA 1UR5A 3CSDA 5AW8A 1ECLA 3VR6A 4UVIA 2C57A 8MHTA 2LGJA 2OEPA 2B34A 3EARA 2PUAA 3D8SA 3G85A 5AVUA 2VP0A 3LQ4A 3MS2A 1GG9A 2ZANA 2WF8A 4ZTBA 3QX3A 3DDSA 1NR5A 2I4OA 1D4AA 1G5TA 1BXRB 3H97A 1UODA 3RFCA 2WRZA 2EQBA 3HY3A 2QDXA 3I23A 3K4HA 4G86A 3KJGA 1U2EA 1Q16A 4KCGA 1ITZA 2V9ZA 2PQMA 3TXXA 5L53A 3DLHA 3AUYA 3VSAA 1KEKA 4EEZA 3E3MA 5F2KA 3HWSA 4KJZA 2J3EA 3NR2A 3O93A 4PQRA 3ED1A 3RJ5A 4JC5A 1G2IA 2DZDA 4RCVA 5LQUA 5FADA 3RS2A 4LDAA 4Y2VA 3DAGA 3CLKA 4IUYA 4DDKA 1Z7BA 4AFNA 3UB4A 1VE3A 4OHCA 3UW3A 2IYQA 3QXCA 4YJGB 3JYPA 3L7YA 1M5TA 3AESB 4KH0A 2BEWB 3O1HB 1XZMA 2H1HA 3QH4A 4HVAA 5U4XA 3RFTA 3BQNB 4JB2A 4CCSA 4D4IA 1SUBA 5FNVB 3DMDA 1YB1A 3C3JA 4U7HA 4Z51A 5HR5A 4MVJM 1L4UA 4ZQBA 3DV0B 3C43A 1RXCA 3IEIA 4OKNA 5D1NA 1KDVA 3ZTWA 1Z6QA 5EMKA 3GLTA 4B6GA 4ZOQI 3D7NA 1H2ZA 3PNBA 3UJ6A 1EGHA 1XTZA 3E1SA 1A9OA 3K1YA 2JFFA 1MAWA 3V48A 4EQZA 1U2GC 2ZB3A 3BXZA 3GHYA 3QFRA 4B81A 2FW7A 2HEIA 5CP8A 5ICEA 3EULA 3E9QA 4L8YA 3GPLA 1DAEA 4JBNA 3TZLA 3CRVA 3SY8A 2QMUA 3HFJA 3MTAA 4GBMA 1U9ZA 1W34A 3L6CA 3OHPA 4M55A 3RPEA 4B4VA 5FO1A 3QITA 2JG3A 1YR6A 3GPCA 3GYGA 2J67A 3NT2A 4XQ0A 2W6JD 3R6GA 4ZCSA 4KSYA 1R0LA 1UQUA 2BFEA 4OJNA 1V45E 1E63A 1OI4A 1Y80A 1I13A 2IXAA 4S1OA 4WESA 2V6BA 3W6NA 5LFAA 1GIAA 2Z4TA 1A2BA 1ISRA 3QU5A 4BGEA 4ZVRA 4FR0A 1VL0A 4CMJA 2PGJA 1NBIA 1P62B 3A9UA 3FUTA 1HUQA 1CR0A 4LXXA 4XJVA 3TAXA 1PBTA 2B2CA 3AR5A 3DZ8A 1G41A 2VJYA 3KSUA 4JC4A 5U1PA 5AHWA 1LI4A 3WGIA 2QRMA 3BSWA 4L0DA 4HWPA 3FNBA 1LVGA 5L3QB 1QGDA 2IF0A 3QWBA 1O4VA 1CY8A 4JLUA 2JI4A 5B12A 4IQ4A 1X1DA 2AWOA 3MJEA 4FEYA 4ZGBA 3A31A 3DAOA 1E79D 3E03A 4M3NA 1Q92A 1EIZA 1J8QA 4PG6A 4DLLA 3KZCA 2FFQA 3RBAA 4ARBA 4U0KA 1RPTA 3LCVB 4RANA 4XD7D 5FORA 2XT9A 4U63A 4Z1MD 2CHFA 4B3IA 3VTKA 2AZTA 1WSBA 2DAPA 3IEPA 4P0PB 3KT8A 4CM5A 3G0HA 4UTZA 1MR3F 2ZR9A 4CHGA 1SCBA 2FW9A 3KAPA 1KPGA 3OA2A 4N9WA 3T5PA 2IUTA 1GQ2A 1H9AA 4AWXA 4KYIB 4NG4A 1W5SA 2X86A 3ENWA 1PSWA 1X74A 2WE8A 4XRRA 3FYUC 5K0FA 3FZQA 3RR2A 1YIDA 4O4IA 3I2HA 4DN6A 4E5KA 3BH6A 1DJNA 1TVEA 2HRQA 4YIHA 1G17A 1IJKA 2AC2A 1D2GA 4MWSA 1ONNA 4LN1A 4TKMA 2AI3A 1JNYA 3IRUA 1US8B 1V7CA 3IBFA 4OXYA 4BKMA 4BE7B 1P7WA 1SXJA 4BQQA 4A0RA 4KQKA 2QTCA 2VYFA 1RHQA 1JU9A 2GSDA 3HR7A 1H65A 5HE8A 4FGSA 2CZQA 4UD6A 2H2WA 3EHDA 3PNPA 2YXPX 4QIHA 4V0ME 1AMOA 2P91A 3TEJA 2BGJA 3P32A 1XZFA 5IBRA 2JGMA 3G59A 4H3HB 5G4KA 5TGTA 4ZMBA 2VPYA 4I9UA 4M9SA 3LLCA 2L18A 4JBXA 4KN6A 2WDZA 1K6IA 4H7JA 5HTKA 3OZAA 4Z7QB 1NX9A 4RK0A 3IOEA 3OJFA 1FFYA 1FYVA 1W0CA 3LHKA 1CY6A 1R8YA 3PD0A 4J3NA 3INNA 5JALA 7MHTA 2ZSDA 5B1SA 4HLQB 1ZNYA 3WYDA 4WL0A 3U0VA 5JZSA 3N3AC 4KYUA 2OV3A 3WGJA 1L7BA 3SE0A 1T9KA 1YI8A 3PLRA 1E1QA 4N6OA 3TIXB 1PSZA 3PB3A 4YP9A 2C58A 3AKCA 3MF4A 5B3LA 2NUAA 2O8DB 4H3SA 1UBMS 3ONVA 4WZAA 5AKKA 2XHEA 3IEXA 4G36A 3W2GA 4A1FA 4F72A 2QX6A 5IJ9A 4ZMSA 3CE6A 1CVLA 4DJJA 2CB9A 4QXMA 3LA8A 1P44A 4Y6PA 4ALJA 4EZBA 4II7A 1XWIA 4A8TA 5KYGA 4XLTA 1RWVA 2GLXA 4HD8A 4IIUA 3RU9A 4OQNA 2P7HA 1NX6A 1P2GA 1P5RA 1U5CA 1XMJA 3GOQA 3U4DA 3O90A 3KCNA 3UT5A 3KXPA 4BYGA 3FMPB 4EY6A 3L7IA 2X1HA 3JSXA 2JH3A 3ST7A 3BBLA 3OEED 1Z29A 3R8FA 5ALRA 5FLYA 4GECA 5IXSA 2OHOA 1TTTA 4YRIA 2W0MA 2R85A 1VCOA 2QAJA 1M2OB 3B1FA 3WRWA 1CUAA 4JJ8A 2BZ0A 2EYUA 2VPZA 4KGDA 3HXPA 4GXTA 5JAUA 3AR8A 1AJEA 4BN0A 5JAPA 2DVMA 2XI4A 4KXFB 1EHYA 4FYHA 3NNSA 2YJ3A 4FZ5A 3JAKA 4ZYVA 1NC3A 3JVIA 2YRXA 2IJGX 4M8LA 5DN6A 4OQFA 4REQA 1ZUD1 5C5IA 1CERA 4PR3A 4Z4IA 1RKBA 4JP5A 1H2RS 3FMOB 3IXLA 4KI7A 2GF2A 1UUFA 2C96A 4YR9A 5I51A 3ZZ0A 5K5EA 2HYIC 1D9XA 2ZDQA 3PICA 1I3LA 2Q6OA 5IAJA 2VSYA 2O8FA 2QP4A 2H2DA 1T1SA 5IM4A 3WFJA 3G5MA 5KYXA 2BE9A 5EJ4A 1B00A 1TIPA 4WGFA 1OFUA 3QHAA 4LY6A 5JDCA 2NUAB 4CL8A 2JGIA 3DA8A 3NTVA 3JAMA 5L51A 1BCRB 3QPCA 1DBPA 3O3NB 5ERXA 3FHTA 4YCLA 3ZR4B 1YRWA 4V03A 1K5DA 3PXEA 2GJAA 4GR5A 3FOAA 5IAEA 3L07A 2K2WA 4DLKA 3AO0B 4JOCA 4XVUA 1WZUA 5HMMA 5B3AA 4H3KB 4MUYA 2OUKA 3MBIA 4IGFA 2Z56A 1TAQA 3NP7A 4PFSA 2JAXA 1YZYA 4YYEA 4KQXA 4NFYA 4Q9LA 3G49A 1SK8A 3LIPA 2PL1A 2WFLA 4HMOA 3A28A 2HPAA 4PPYA 4A03A 4TZ6A 4OFWA 1SXJB 2PO5A 5CTJA 2ZOSA 1IY8A 1NW3A 4KXQA 5L45A 4U2KA 2O8EA 1N5DA 2EW1A 4C0QC 5E2BA 4XYEA 2VYVA 1US8A 1FNCA 3KIPA 2NTEA 3OZWA 1ADBA 3H87A 3NTRA 1SQ6A 4B80A 1IUKA 5JROA 4ESVA 1EESA 4R0MA 1MRZA 4B3JA 4G23A 2NZWA 4XAQA 5DIFA 3V1LA 2FPIB 3WLNA 2ZJ8A 2C94A 1OXBB 4IIFA 1DLJA 1WCIB 3BDVA 2XOKD 1ZAKA 2XJ4A 4WVFA 5GONF 1J06A 5HK8A 4OGLA 3RAJA 4D42A 2RGNC 3I1IA 3SEQA 1JDPA 2ACEA 1N0HA 2H8KA 1X2BA 3V97A 2CHQA 4KIWA 4WUTA 4M7OA 2ZRGA 4F21A 1QCCA 3O83A 4DGSA 1J70A 1J9GA 2HHCA 1GPH1 3JQPA 3PI6A 5DHRA 1WOMA 2IPNA 3HPQA 5E7IA 1YR7A 2GHTA 4CT4B 4R71A 3LUJA 5KVCA 1PVDA 1NOKA 1M6VB 1FYWA 1NBWB 3N59A 2YH2A 5FUWA 1AKWA 2X4GA 4GBJA 2V7QD 2YV5A 3AETA 3T7SA 5IARA 2OV6A 3BJIC 1E4YA 3DEKA 3TUJC 4B3HA 1E6CA 3JATB 4DRYA 3PC3A 1UPAA 2ZSFA 1IVSA 2WTAA 2GJ8A 3C3AA 4DA9A 2QTVA 4JELA 1JZQA 4WADA 1UJCA 4A2CA 4DSZA 3C1AA 1NFFA 3QKUA 3TW8A 3UJAA 1EB9A 5TT1A 1ZC4A 3CW2A 3HNRA 5I7SA 5KOHB 1WQ1R 4EYEA 1PU2A 3AHJA 3OZ7A 3QELA 4JA0A 1M76A 1NT2A 3L0SA 4K7JA 2NWQA 3UAZA 4EOGA 3IAAA 3LY7A 4MLZA 1GGVA 3BGDA 3MAAC 4OJQA 2XVXA 2WV9A 3ZV3A 1SG0A 2PUHA 3TMYA 4D4HA 2GXQA 4RTMA 4RTNA 3U4QA 2O5VA 3HC7A 3FTFA 2QP9X 3SE7A 1NMQA 1YZVA 1HE4A 1WSAA 4NK5A 4JVLA 1KYXA 4X20A 2I1VB 4C07A 4JS0A 2DBRA 3GELA 1GZ3A 3C48A 1N6KA 3ZWWA 2HNBA 4G5RA 3RLFA 4AP9A 2F55A 3HBAA 2A5FA 4BY9E 1SQ0A 3PGKA 3L4BA 1T13A 2ZAOA 5FB3A 2AMJA 4ZDWA 2XNJA 1EK2A 4TPKA 4FNOA 1YOBA 3DE7X 2I4TA 1D5CA 1J0DA 1P91A 3B48A 4HZGA 5EIBD 2R00A 3QI7A 2HIMA 4YCCA 2JGEA 3I28A 5DM70 3AEQA 4KQ6A 3NC0C 1OJLA 1M6EX 5CLGA 4JB3A 2GPYA 4KWCA 3OTGA 3KEGA 5KNCA 3H18A 5G3YA 3WGZA 4CQLB 2CYBA 4OK5A 2R60A 1H8EA 4OMUA 4PC1A 1U0EA 4CG1A 7YASA 4H7FA 1HURA 3AWDA 4EYOA 3EG5A 3SQMA 3JQRA 1ES9A 3U17A 2V7XA 1TX4B 1VCHA 2X1MA 4N82A 3OBBA 1Y1SA 2EWVA 1UM9B 1A9SA 1M2WA 3RS9A 1FLDA 3GFTA 4BFZA 1C0LA 1NBOA 3NOVA 3IUEA 3WO0A 4Y9UA 3NHLA 4A0FA 3M9WA 3ZBUA 3EIHA 2RJ3A 3OH8A 4PIMA 4TS1A 3MWDA 1Q17A 3B6IA 4B84A 2C78A 3X1XA 1TVMA 3VDRA 1A8IA 1E7SA 1QGYA 3EVAA 4KIJA 3NEAA 4QHTA 4XXHA 4YDHB 4KQIA 2FEPA 2A30A 3TO5A 4IIGA 4D02A 3MMZA 1OFVA 2F3TA 4BO0A 3UW1A 4ZCIA 4L85A 3PV0A 3TZCA 2R8YA 1PAUA 2ZJFA 3FUWA 5DNAA 5TY0A 1L7NA 1XGKA 3C5EA 1MP0A 2G8LA 2Q2NA 4UU8A 3ZGOA 2PSDA 5LP1A 4ZVSA 3UJ3X 2DECA 2W98A 2F8MA 4Z4GA 5FBVB 3E58A 3EUWA 3QXSA 1H8HD 3PT9A 1QYWA 3I42A 3QVSA 4DRXB 2ORYA 1ZEMA 4A15A 3H2SA 4MKFA 1M1YA 1QGUA 2PKYX 3HDJA 1KP3A 1YKSA 5DT9A 5J23A 4X65B 1EFTA 4JU8A 5BW6B 4BVAA 5LB4A 2CHUA 3AEKA 2QTMA 4KN8A 3SKVA 2E2WA 2R25B 3N39C 2VAWA 4MHOA 2ZJ1A 3G5LA 3O7MA 4FCTA 1GRQA 5H5JA 2FW6A 2C00A 1TEZA 1Z12A 4MUHA 3K9CA 1I7PA 4GR9A 3SSNA 4NDZA 3WWEA 3U7GA 1Z4LA 3VYRB 1H3EA 4NBLA 5E2AA 2WG0A 1PZEA 4Q18A 3V1NA 5KX5A 3OY7A 4J3JA 4EJ2A 3EIFA 2J45A 1BXKA 1C9DB 3IAS6 4J7AA 4UHBA 4YMGA 5KQSA 4Z1MA 1L8LA 3JQ9A 4MEBA 2ZWAA 4L74A 1DKUA 3IOYA 2QRLA 1ZQ9A 4G0UA 1E4OA 5CGZA 1IK6A 3BZWA 4BFVA 4HMPA 2LTAA 1TVKA 2KM1A 3NAMA 3N74A 2ZE5A 3EQ9A 3ADPA 3HCDA 3ESDA 5FL7D 3UMRA 1VL6A 4H6PA 1RWBA 3FFWA 3FMFA 3G2PA 3MLAA 4U7TB 4L0MA 2WABA 2TECE 3DHYA 4CG0A 4G09A 3N6XA 1IBRA 4MV4A 4CM1A 5E3IA 2AA3A 1X14A 1OYWA 1EUCB 3A1FA 1TLLA 3QSGA 1AC5A 5KTPA 4LJRA 2UZAA 4YASA 4AKGA 4BUJA 1DDGA 1O6GA 2P2CA 2WVAA 3C39A 4F5DA 1C9KA 2DY0A 3QPUA 1R8JA 3L1JA 4JCCA 1G21A 1ZHHA 2ZRIA 2GN2A 3GFVA 4MWOA 2C83A 4G0QA 4UNIA 3I1JA 1LVUA 2IK8A 3H16A 3I9JA 2HR1A 4MP8A 1F1JA 821PA 2Q7DA 2R1UA 3P45A 3ENQA 3P9RA 3QYPA 1DPGA 4MWCA 1SOAA 3RADC 1XZCA 1Y3IA 2ZVJA 3CNHA 1AV7A 4OUDB 1DBRA 2VRCD 3A1VA 3DEIA 4ZT3A 5IWAB 1QPZA 1KH2A 4P5DA 4I46A 1GR0A 3GDWA 1CUIA 3LVFO 3O5AA 1B26A 1QORA 3AYXB 3L77A 5DYWA 3W2FA 2G9ZA 3WLSA 4B6JA 3VOSA 1P2DA 4LX8A 4QYTA 1NZFA 3JASB 1QK4A 2AXPA 6PFKA 3HABA 3KS9A 3SD7A 3AZPA 3ZXXA 2OA0A 4URHA 1EVYA 4O3FA 5D3ZA 1XKLA 1GKUB 2DWPA 2NYRA 3DMFA 2EKPA 2D1YA 3PENA 3R5FA 5A4AA 1G21E 4FLMA 3PZBA 3I4LA 3CNLA 2PZKA 4GS5A 3RHFA 1F1BA 1YU9A 1G3UA 1W0KA 1FXWF 2HSEA 1EKXA 3Q41A 1GYPA 2OFFA 4KWEA 5LD2C 3VPXA 2YJNA 4Q7EA 4C03A 4AKIA 2AKEA 1MOSA 3OE7A 2VRBA 4RHCA 4ERXA 1KVUA 4CFSA 3FTPA 5JCPA 1Y81A 3EVBA 2FLKA 2EG5A 4JOBA 2VHUA 1UXGA 4MMXB 2HF2A 2W22A 3GO4A 3UC5A 3ZQJA 1SQSA 4OQMA 2BGUA 1J2EA 3BE6A 3FYUA 3G8DA 2HMVA 4I6EA 1GKYA 1HL3A 1TIBA 4PAQA 3RABA 2ZG6A 3OLZA 4EPYA 5D6NA 3ICOA 1KI7A 1YV9A 4XPZA 5E38A 5JO9A 7REQA 4HB0A 4XX1A 4N47A 4RK6A 1T3ZA 2BMAA 1I6LA 4HS4A 2H65A 1KU6A 4PGHA 1Y6ZA 1AB5A 1RJWA 1REQA 4HDQB 4TKVB 4JYBA 3G82C 2R6FA 3UK7A 3OQMA 5A7HA 5T4EA 1AG9A 4EFKA 2AS0A 4FYKA 1Y9EA 2CVPA 5IZ4A 3DHWC 1FIUA 3EXEB 2XVZA 1EVEA 2WF6A 4I8XA 3VXKA 2ZE7A 2H3EA 1VSQA 3GXBA 4Q1FA 4QAQA 3KU1A 2C84A 3FVWA 3AVXA 1KY5A 3A36A 5HP4A 1CX9B 3KSMA 1A3CA 2FUG6 2ANBA 1E0KA 3ADOA 3QENA 2AN9A 4FW9A 4GZ3A 4C89A 5KJCA 3WAJA 2L2QA 3GDOA 5AVOA 3UMCA 3ND9A 5AKHA 1Z26A 1VKJA 3COVA 3VR3D 1PKEA 3WLMA 1R0WA 3MS4A 4OHFA 4JKOA 3HZZA 1V3TA 1M33A 1F6BA 1J2UA 2WJAA 1PGJA 4FEAA 4MUNA 5DM0A 2WZDA 2XZDA 4Q3AA 2NU6A 4BKOA 3TD9A 4EHBA 2JASA 4KX5A 1WHSB 3KQNA 1QLJA 4FDTA 1OQAA 4AI6A 3IQXA 4XGRA 2F1KA 2CWDA 3ZZMA 2OV8A 1H66A 4F06A 2JIBA 3R0IA 5F12A 1ZUNB 4WBSA 3L46A 5GGYA 5BWNA 4HATA 1LGYA 3T3DA 4HAXA 3ZE2B 5HFAA 3F1LA 1T9ZA 3GRYA 4MK4A 2QHXA 1G7SA 4MYHA 2G1UA 1IHPA 2ZBUA 5EJFA 5JMPA 3W5VA 3BGSA 2AFHE 2O0JA 1V11B 3ZZUA 1IH8A 5JSYA 4MRPA 3I37X 4NZNA 5J9FA 2JNWA 2MR6A 4Q3BA 3H8WA 1G291 2ZUBA 4QGGA 1ZMTA 4WXRA 4Z8XA 3RSCA 4UBIA 3VV3A 3QLVC 4B2YA 4DANA 2PLNA 1QDEA 4LHYA 1BMFD 3PVZA 5JDIA 1NVTA 2NZUG 4ZO7A 4NCKA 1Y7LA 4XDHA 3ZWBA 1ONBA 4CM7A 2HSDA 3QUSA 2HT6A 1DHTA 4RD3A 4ZT4A 3H84A 4B7XA 4KLCA 2RAUA 1UXJA 1JT9A 3R6WA 2REQA 1YUBA 3T9FA 2X4DA 2A5DA 2ONYA 3TTTA 4BLOA 1MO4A 1F4PA 2P90A 3IBCA 4M8NE 1L8AA 2D54A 1ODKA 2EHDA 2VF2A 4RVSA 3GA5A 3RUHA 3VJMA 3J80A 4U9UA 4G41A 1SBYA 1Z68A 4IHKA 2BDTA 2HWWA 1PJTA 4UU1A 1OXSC 1R4NA 1UEIA 3OHSX 4ANFA 3U3JA 1VDZA 3IQIX 1FX0A 3K31A 2WHRA 3KM0A 4UC0A 4D43A 4UNRA 3IJEB 5I47A 2BFNA 3C3XA 4XGKA 4UUAA 5KEIA 4TWAA 1BCSA 2YXEA 1ENYA 4U8GA 1QE0A 3VH2A 4YRSA 3LF1A 4EHAA 2WJHA 1UJ5A 1X7ZB 4H18A 4H7HA 2FX2A 5G0TA 3EGXA 4W82A 1B76A 1CZLA 1SN7A 2J6HA 3V9AA 1IM2A