1MRNA

Crystal structure of mycobacterium tuberculosis thymidylate kinase complexed with bisubstrate inhibitor (tp5a)
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
208
structure length
208
Chain Sequence
MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAELAGERSRGRAQRDPGRARDNYERDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Enzymatic and structural analysis of inhibitors designed against Mycobacterium tuberculosis thymidylate kinase. New insights into the phosphoryl transfer mechanism.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords Thymidylate Kinase
total genus 75
structure length 208
sequence length 208
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2002-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1mrnA00
2FN4A 1U98A 4RFSB 2ZVPX 2FFHA 2G83A 1HEIA 3GEHA 4C2TA 3I72A 2H8KA 3SJBA 3GCGA 2QTVB 4PHFA 1SXJE 2DY1A 3TVTA 3U7FB 1COWA 1KDRA 2GEVA 3OE7D 5BXQC 4JJZA 4HDOB 2BM1A 3VX3A 2P5SA 5CB6A 3B1WA 1M34E 2W83A 4LJ5A 3MLEA 4DHEA 1GVNB 2V9PA 2WHXA 1VCOA 1SXJB 1NVWQ 4EDHA 4NHOA 1F2UA 1G291 4GL2A 3QEOA 2XZPA 3S1AB 1GNQA 2Z4RA 2ZR0A 5CJPA 4ZPXA 3THOA 2DWQA 3WMEA 3OAAA 4Q02A 2RGAA 2NO0A 1UJ2A 4B2LA 2L0XA 4LHWA 1NG1A 1R7RA 4S2EA 4XSGA 1VYUA 3BD9A 4XVRA 1G21E 1IXSB 4NBSA 3T12A 1RYFA 4RD1A 4B76A 5K8IA 3GPLA 4E07A 3VR5A 1L8QA 3OZXA 4A0HA 4Q4AA 5FPHA 1P2VA 1R2QA 4E03A 3TR0A 1XMSA 1QDEA 2P2LA 2ZYTX 4LJ8A 1Z29A 1KI1A 1RVDA 4A2WA 5AUOB 4WOPA 1AGPA 4LV5B 4PO1A 5JWRA 2DFKB 1X8KA 2OFXA 2ZE6A 4LK2A 1U0LA 3VU9B 2WTUA 3GLGA 4Z8XA 1KTVA 4RCZA 4TMTA 3WBJA 2VF8A 3BH7A 4EPVA 5AUNB 3AM1A 1DVRA 4O25A 4IFEA 3NDBB 1KJWA 4B2IA 1NVXQ 4QKQA 1Z6TA 2CCKA 2D7CA 2RGCA 4PO8A 1OYYA 3CF0A 2B92A 4A92A 5KDOA 2HEIA 2W6IA 4LZZA 4PAMA 2R62A 3RRNA 1E0JA 5JRZA 2FSFA 1XTKA 4ZI2A 1DO2A 3SU8A 2A2ZA 2EU8A 2OZEA 3T35A 2V7QA 2XNSA 2QAGA 1JR6A 2CHGA 1XD2B 4RD3A 3WHKA 4MGKR 2J7KA 2GA8A 1T0JB 3BWDD 4QHTA 2J45A 4G0NA 4QNRA 1PVOA 1R8QA 4NKRA 3R8CA 5AJXA 2DFLA 3BS4A 2REXB 1HA3A 1E4YA 3UKDA 3PV0A 2W6JA 2MMCA 4F92B 5J47A 3I3SR 4TL9A 1FNNA 1N6RA 4K46A 3BBPA 4MITA 4CF7A 1IXRC 4YMVA 2H1LA 4HAZA 4BWYA 1N5JA 1BO6A 2J9RA 3JVUA 1HUQA 1EFUA 3EZ7A 1H8EA 2C95A 4XJXA 5KNDA 3THXB 4EKDA 3U7GA 4IOJA 1AM4D 5AUPB 4OI0A 1XD9A 2QQ0A 2IYLD 1E2HA 5D3MA 1MABA 1VYVA 1KI6B 3PUYA 1ZJ6A 4P33A 4DDVA 1G5PA 1DE0A 4DLWA 5FOSA 1GL7A 4H1VA 4GOXA 4PO9A 2FWRA 2N42A 1KKMA 1GFIA 1NSTA 1WF3A 1T5LA 1ZNYA 2ZJAA 2CK3A 3CUEF 1UFQA 4DEYA 3GJ4A 2WAXA 3B85A 3B78A 2IEZA 2NMVA 4I81A 3FE2A 3KJGA 1J8MF 2QNRA 1F2TB 721PA 5C2JB 1JQLB 1JPJA 2BBOA 3WP1B 3CRW1 3SQWA 3EASA 5J40A 3PXGA 2BBTA 3FKSD 2WWXA 4HAYA 1N5KA 2JA1A 1NVUQ 3U3MA 2WJJA 1R4AA 1T3LA 1TQ2A 4U02A 2SHKA 1HT1E 2HYIC 3OIUA 4TTRA 1U99A 4C4PA 4MKIA 1UDXA 4FD2A 2H17A 3EZ6A 1L7VC 1AA9A 2FMXA 2W0MA 2ZSAA 2ZI3A 1N3BA 2NOAA 2WM9B 2BVNA 4RJLA 1G64A 3D3QA 2QEQA 2R6AA 5FL3A 3K0FB 5DYGA 1RW4A 4FIDA 1MOZA 2H16A 4YMSA 3CZQA 1MO5A 3O47A 3WYAA 4FWIB 1X8JA 4A15A 1CJUC 3TKLA 1W47A 3ZQ6A 3OF5A 3QVVA 4IKEA 2E1RA 3QXJA 4QHYA 1SKYE 3T1TA 4DDTA 2A5JA 1IHUA 2ZRFA 1XD8A 4YDSA 3RSLA 4AG5A 1L2TA 3CPHA 4D0GA 2AKAB 2GZDA 3X2SA 5JLJA 4IHQA 4OI1A 1F48A 5KNBA 5E7JA 1NN1A 3OE7A 1JR3D 3EPKA 1JXMA 1N0VC 4EQ6B 4PSAA 1NLZA 1ZM4A 4IOKA 4B35A 4D80A 3CNNA 4N0DA 1VCIA 3LWNA 5EP4A 5FTMA 1A2BA 2GCNA 2BOVA 1E9EA 2ZEJA 4A2QA 4OHXA 1W36B 1N6KA 3OAAD 3GLFA 2ZJBA 3ADDA 3CH5A 3CM0A 4NCJA 2QORA 2GVZC 2VHTA 2ZI7A 3U3KA 1W36D 1OFUX 3ICQB 2AWNA 1AN0A 4ZCMA 4N3NA 3T61A 4BEBA 4H9GA 1P6XA 2RGNA 2IHBA 2J87A 3PR1A 2F1RA 3AVPA 3KJHA 3MAAC 1II0A 4GOJA 3MWJA 4AYTA 2JLZA 2VL7A 3AF4A 4RY2A 3DMNA 4TL8A 1OHHD 2HLDA 4AWXA 5JHGB 4DSTA 5L8VA 4EPTA 1ZP6A 3CRQA 4KFUA 1DARA 4ZCIA 4X8LA 2JCSA 2HXSA 2C04A 4OK6A 4PAOA 1KY3A 4BUJA 4U7DA 1D2NA 2J59A 2WWWA 1IN8A 1J2JA 2J41A 3FTQA 3SJZA 1E1QD 1XRJA 1Q12A 4RSGA 3CBQA 4WAUA 3I61A 4A82A 1N6LA 2OG2A 5SZHB 3UWKA 2W6ID 1XEXA 2JLQA 3CX8A 4R98A 2H5EA 2OBNA 4WBSA 3TR5A 4O3MA 3RYTC 1DAFA 5BQ5A 2VRWA 2JLWA 3QXHA 2V7QD 4TLBA 4GI7A 3FHTA 3T15A 1TUEA 2VP2A 4QJ3A 1XP8A 3UMFA 3R9XA 3QEJA 4TQ9A 2FNAA 3ZS8A 1B23P 3QKRA 4Z8YA 3QKSB 2ZTSA 2ZRKA 4LY6A 2XOKD 4ITRC 3AVTA 1UBFA 4JVSB 1OXTA 1Z0FA 1KJZA 2YVUA 2BMJA 3CF2A 1TQ4A 4HUQA 4KCGA 1B0UA 3RS4A 5ELXA 1YRBA 3CNOA 4KYIB 2FZ4A 1F2UB 2UZIR 1FMLA 2HYDA 2KE5A 1P2UA 4KAXA 4JVMA 1D2MA 4DUGD 3MCAA 5B64A 4FINA 1ZM3A 2C9CA 4KBGA 4KVAA 4TT3D 5FBWB 2BMEA 3W5JA 4DLRA 2WOJA 4XSHA 5L3RA 4G5RA 4Z54A 2ZQ5A 4JSYA 1GRRA 2JLSA 2B7CA 3EPHA 1QF9A 2AFIE 1OPXA 3KKMA 4F7WA 4AD8A 3LH5A 2RAPA 3SHFA 1XMVA 4AK9A 5BYKA 4RFSA 3GLGE 1G3QA 2EVWX 2QMOA 2UVQA 2WJVA 4OI4A 3IPXA 5IRCD 1XX6A 4KBFA 1JPNA 4JYBA 4Q1FA 3BB1A 1N5IA 4XOIA 2ZRIA 2JEOA 1BH2A 1XCPA 3AGQA 3EZFA 3RS5A 4URVR 3LW7A 1DOAA 5FH9A 1X3SA 1T9HA 5DSZA 1W0JD 5B2ZA 5J4HA 1OXSC 1SVIA 1NJGA 1KYIA 3LRPA 4NDZA 3ADKA 1DEKA 3AVVA 1P3JA 2ZPTX 3FGNA 4BFVA 2ZJYA 1CTQA 4F4JA 2GETA 2PEYA 3DL0A 2QSYA 3W3ZB 4QM6A 1NF3A 2P3SA 4OYHA 1JECA 1U2RA 3UWOA 2JIZD 4D4MA 1FTSA 3J81k 3PCRB 1OT3A 2QG6A 5CIQA 2ZR7A 3SYLA 3AVOA 3MGCA 2CVHA 2QMHA 3P20A 4OI2A 4PZZA 3WY9A 2V6IA 4PX9A 4EFNA 1U94A 1OSNA 4OL0A 2ANCA 4G5SA 1E2PA 4ZDKA 1XBTA 5G3YA 5LBIA 4P3YA 1S3GA 1UADA 2ZS9A 3KXLA 3ZGXA 3SQXA 3K0FA 4XTRA 121PA 3IBGA 2JDIA 4P4UA 2IHYA 1Q44A 2VSOA 3QG5A 4C0HA 2EYQA 3MRSA 5TV2A 1F5NA 3PUWA 2G77B 2WJYA 2VHJA 1WXQA 2EFDB 1KGDA 2QPTA 3U2QA 2JATA 5TMPA 2WOOA 4C2UA 5EE0A 3EARA 3VR2A 1NBMA 3KKQA 5L3VA 1XPOA 1GL9B 2RGBA 2IC5A 4C0SA 4B33A 1XXHB 2BC9A 3LV8A 1ODFA 3EA0A 4HAXA 2VBCA 3H0KA 2R2AA 4QM7A 2BJVA 4R71A 2FA9A 1JR3A 3L0SA 2EW1A 2QE7A 2ZRMA 2DFNA 4LJ9A 4QGHA 1ZIOA 2B21A 1IONA 3BXZA 4M9SA 2B7BA 2ORVA 4LJ6A 2VHCA 5JZVA 3EIQA 4ESHA 2VHQA 1ZM2A 3WNBA 3U6BA 4XVUA 4IXMA 2OE2A 2QMEA 4HZIA 4MDEA 2BIFA 4YONB 4BECA 2CJWA 4MH0R 1IBRA 3H4MA 3X1DA 4ZKDA 2BWJA 3SHWA 1DAIA 1ZRHA 3AVXA 1TTTA 5KPDA 2PEZA 3B1VA 5HKKD 5CITA 1LY1A 4FCTA 3NBFA 1YR8A 1OHHA 2HLDD 4JLDA 2FDCA 1P61B 4IDPA 1VDZA 1WDTA 4CW7A 2GEUA 1JI0A 1S9DA 4KLZA 2IS4A 3RRMA 5DN6D 1N0UA 1Z63A 3LQRA 4LHXA 4RD4A 1RIFA 4X8HA 1UEIA 3F5FA 2ZYWX 3U3JA 4OQMA 2O8CB 4BRUA 4IJMA 4EFMA 1MH1A 5CLLA 1J90A 1MO4A 1SKQA 4JLNA 4UNQA 4TTQA 1GUAA 4OQFA 1N6IA 4S35A 1M6NA 1ZD8A 2FPLA 2XZLA 4JZKA 4FCWA 2QRNA 2DWPA 2YOGA 2Q3FA 3A4NA 4O2LA 4QGAA 2ZSDA 1S1MA 4EPWA 4PSVA 3HWSA 3TUZC 1I2DA 2YC2C 4QJ4A 1J7KA 5TVKA 1GL6A 3TAUA 4BQSA 2F43A 2FF7A 4B3DA 4KSBA 3WYFA 1RJ9A 2NO6A 3ZIAA 3L2OB 5FTKA 1A2KC 2YINC 2ZSFA 2KB0A 2W0SA 5F98A 2QBYA 4KVGA 1Y63A 3W5IA 4HYYA 1HH4A 2DHRA 2R9VA 4G5GA 1YQTA 1KZ7B 4FMBB 4OKSA 3R8FA 2PX0A 3IQWA 3LBIA 1RE0A 1ZMXA 4P4SA 3L8YA 4UJ5A 4HAVA 2XTMA 3SBEA 4Z1MA 1D5CA 2FH5B 3AEZA 4NL4H 1E2DA 3NH6A 2IF0A 1QRAA 2OLKA 4XIGS 4DCVA 2FGKA 2NZ8A 4P31A 2GJ9A 1Q1QA 2W58A 4MUAA 5L3SA 4DSUA 1IY0A 1VG8A 4TZ6A 2H92A 1P9WA 2DR3A 3NBZC 3O8CA 3DM5A 3AP2A 3EIHA 3TGPA 4C0QC 3KB1A 3IDQA 3VHXA 4KYUA 4LWZA 4RZUA 2D74A 1GG2A 4UQOA 3LXRA 1MO3A 2IYRA 2ORWA 4OHZA 1CBUA 5FPKA 2EFHB 3SYKA 4JLAA 3KXKA 4DB2A 4LBVA 2DPXA 2MMGA 4JL6A 2PLFA 2ODEA 2FOLA 4QOSA 3D31A 5CM9C 5FI0B 3NC0C 3UG6A 2CL0X 3IIMA 4NZYA 1S0UA 3EZ2A 4R9UC 4BFWA 2OESA 5KYKA 2NIPA 4FMCF 2BCGY 3ZD7A 1OXXK 3TIFA 1R0WA 3U61B 5BYJA 1WBDA 2WKRA 3QUSA 4GP7A 2GXUA 1TPZA 3B9QA 4Q7JB 4KSCA 4BLRA 2JJ2D 4D4JA 2GBLA 1HURA 6Q21A 2ERYA 1FNMA 3N2EA 2QN6A 1LB1B 1KSGA 4IOLA 5CB8A 5FBQB 2BJWA 2CJWB 1G41A 4M1SA 5CIWA 1EFRA 1K5DA 1Q3TA 1XTQA 1UBCA 1TQDA 3IQXA 1GOTA 4HLQB 4F4CA 4NE2A 2IA5A 1G7TA 2VQSA 1HE1C 2VYFA 4A8JC 3UANA 3NG1A 1NY6A 3RABA 3B1ZA 4OQLA 4W5WA 2WWIA 3F0TA 1Z2CA 2GCOA 2H18A 2QY9A 3K0EA 4DCTA 3T34A 5KOYA 4URUR 3GLIE 4MKFA 2IYUA 4O0MA 4ZCLA 4ZO4A 2OBMA 5J4VA 4HUQB 2PJZA 4Q1EA 1YJ5A 3TW8B 1VCMA 1G20E 1WQ1R 4DLUA 4MRRA 2ONJA 3NEJA 4KLNA 2IUUA 3K0CA 2C77A 2WJGA 5DO9A 3FYHA 4LSGA 1OH8A 4DLTA 1GRQA 2Q21A 3KUCA 1I4LD 1WP9A 2OCPA 3ZZUA 4QNMA 4C9BA 3RVBA 5EUQB 3Q7PA 2LCFA 4TYQA 1EESA 2P65A 4PC2A 4Q9KA 2YV5A 1YZLA 4HB3A 4LBYA 4CEHA 4JLJA 4D0NA 4EPRA 2O8EB 2C9OA 1OV4A 1MRNA 3ZJYA 3SI7A 2N46A 2C98A 1Z6GA 1G7CA 2GAOA 1UKEA 2AR7A 4PHHA 1Q3HA 3GLHB 2OFWA 4M1OA 4HEJA 5F9FA 3OIYA 3DVLA 1GNPA 1LS6A 3LNCA 4R7ZA 1CEEA 5J4KA 1Q20A 2GESA 5KDDA 1IN5A 2D4HA 1YZGA 3IIJA 4MDFA 2IUTA 1OJLA 4V0LA 2IWRA 3DPUA 1P60A 3AV0B 4DIDA 1OB5A 2A5GA 2IK8A 1CJMA 3TBKA 3D7MA 2C03A 3OEED 2GK6A 5EXPA 2ZRCA 4TTPA 1U9IC 3QQ5A 4FMDB 1UBGA 5K8LA 4P0TA 3KQHA 2IYVA 4RCYA 3W90A 4TLAA 4D4KA 3A1SA 1E1RD 1ZAKA 4QC2A 2O0KA 4PC6A 3AB3A 1ESMA 1YE8A 5BN4A 4M0LA 2G9NA 2EFEB 3WNCA 3C5CA 1CR2A 4NYMQ 1G5RA 2WVJA 3UATA 1Z0DA 3P4XA 4RD6A 1Q57A 3N5CA 4Q47A 5IF9A 3D6TB 2IWHA 1D2EA 4LPSA 4OK5A 1G4UR 2QGNA 2X2FA 4HI0E 2J3EA 4JLPA 1UBEA 3CWZA 4GZLA 4KO8A 3V9PA 2ZXUA 1F6BA 2FZLA 3GQBA 4RKFA 3CRVA 4DT1A 4IEIA 3FMIA 1SVMA 1R8SA 5FOXA 5DE3A 2XJ4A 4LRWA 4PZLA 1H8HD 5GJCA 2BBWA 1Z28A 2FSHA 2GJSA 4QBHA 2ECKA 2GCOB 2QUZA 4RVCA 5HCNA 4ABYA 1MV5A 3TUJC 2PL3A 4JJKA 1G3MA 2YWGA 4QJ5A 4V02A 5TARA 3Q8XB 2CCJA 1NVVQ 4R2IA 2O8DB 4YMTA 3VNUA 3Q7QA 3QBTA 2O8CA 2QTHA 3ND8A 3EWSA 3GJ6A 2ATVA 4PFSA 1W4RA 4XWKA 1U0HC 3EPJA 5EE3A 1UDWA 4FN5A 2V8OA 4EUNA 4I1SA 4G5OA 1G9XA 2DYKA 1QG4A 2CDNA 5E95A 2GILA 3BH6A 3ADCA 3IUYA 2AXPA 4B71A 2WWGA 3KFXA 3MSXA 4XWAA 4BFXA 2IUSA 2B8WA 2QP3A 3GJ3A 2ONKA 1KI2A 1T6NA 1U0JA 3WP0A 3KZ1E 4RFVA 3RWOA 3EX7C 5FOUA 1I2MA 1W4CA 1BS1A 5LD2C 4RD0A 3PUXA 1IJFA 1E0SA 5KHOC 4CEJA 1GILA 4RZ3A 2O8FB 1EFRD 1PJRA 3DM9B 3OFNA 4NTZA 2Z83A 3NBYC 4YMUA 4KFTA 1VHTA 4HLDA 1Z5ZA 3Q5DA 3R9WA 1GZSA 3NHAA 1NMYA 4LPKA 2BEKA 3RRZA 5FFMA 2GZHA 3HU1A 3QVUA 4M9ZA 5H1YA 4OQNA 4CEHB 2F9MA 3CPJB 2ZRNA 4HSEA 5JEEA 1S1CA 2AD1A 2HJVA 3QXCA 1Q1EA 4MKHA 4PC7A 2V1UA 3BK7A 3SE0A 1P7CA 4BASA 2AK2A 5L3QA 2J0SA 1E2FA 4IDQA 2CLDX 1E9BA 2Q9BA 1DAMA 1KO4A 3UXMA 3DOFA 2JLYA 1TAGA 1W44A 3HYRA 1KI4A 1NL3A 4IRUB 1LV7A 1UM8A 1DAEA 1QG2A 2J0VA 4W7SA 3X1WA 2ZSBA 4C30A 3HYTA 3TLXA 1FX0B 2HUPA 3ZVNA 1QHHB 2CMKA 4F38A 3CF6R 1TNDA 1XCMA 2I3BA 1RC8A 1IM2A 2FU5C 4BZXA 3FMPB 2RHDA 1E0KA 3B6EA 4CIDA 4P4SB 2PCLA 1UAAA 3HDTA 4PPGA 2HF8A 3LW8A 1WMSA 4TMXA 4B75A 4ZI3A 1OFIA 5IT5A 3NEYA 4B32A 4Q4JB 2CXXA 3PEWA 4A0GA 3KFVA 4C0BA 3VR6A 2IXFA 2IYSA 2F1JA 1SQ5A 4YXWA 2J0UB 5J5CA 1N5LA 3HP1A 4IVRA 4Q4HA 1AQUA 4TQAA 4NCIA 3M0EA 2NPFA 1E4VA 1Z0JA 2GRJA 1HY3A 3SYNA 2ZI4A 5DYIA 2XGJA 2WWFA 4EQ6A 4C0JA 5GJVC 1CJKC 3H2YA 2GAAA 4P32A 2P6UA 4NCHA 2D62A 1BMFA 1SVKA 2XSZD 4AKIA 1KOFA 2ZRDA 1G17A 1IN6A 2Q3HA 3QBVA 5EP3A 1R6BX 2FE4A 2CEAA 2UZ3A 1D9XA 1G16A 1TU3A 2W2XA 2GKSA 2QAGB 1NP6A 3REFA 1WBBA 2D3WA 3UG7A 4DVGA 1XXHA 3MWLA 5H70A 3OIWA 2WPDA 4D82A 5C4GB 3SFVA 1RRCA 2C2HA 1KHTA 2R6CA 2ZETA 3GLFE 4UNNA 3CR8A 3DZ8A 1T4GA 2ATXA 5GJWC 1P2SA 1AKEA 1JBKA 4MYTA 3NKVA 1E1RA 4B74A 1G8FA 3DEFA 1OH6A 1ZW6A 1G7SA 1HQYE 3TW4A 4TLEA 4DKXA 4M1WA 3GEIA 3VKHA 1M7BA 3G0HA 2HDNB 2F55A 1M7GA 4YQFA 1GSIA 2J0QA 2LKDA 3I8SA 3PUZA 3DKPA 4OHVA 4ASUA 1CU1A 2TMKA 1AS2A 1D8TA 1TX4B 2VHUA 3SDZA 1CJVC 1FFHA 1V5WA 2QM7A 1U8YA 2ZRJA 3SZRA 3QF7A 4CEJB 4BEJA 2P67A 2YNMA 2C99A 3WHLA 4UXIA 1KY2A 3IO5A 2R6FA 2BV3A 5FR2A 3ZVMA 1OKKD 1E3MA 3RC3A 1MR3F 1T91A 1Z0AA 5D3MB 3WRXC 5KSZA 1TL7C 1W7AA 2QSZA 4ZDWA 1DBSA 5KO2A 1MO6A 2J46A 4QBIA 1X8LA 1EG7A 1C4OA 4W5HA 4WA7A 3VAAA 1OXUA 1XU4A 3OEHD 1KI3A 5SZJA 3B5JA 2CLSA 1NN5A 3KQNA 5FL7D 3B13B 3K0AA 3T1VA 1US8A 1Z07A 3K0AB 1W49A 1NI3A 1NRJB 2ZAOA 3K09A 4IDOA 4CT5A 4KHZA 2V55B 4TMWA 2WICA 5KSOA 1FZQA 4ON9A 1M8PA 2NO1A 4ZIRB 2FG5A 3E2IA 1N25A 1TF5A 4Q4LA 1ZNWA 3W8RA 5HR5A 5CYOA 1NN3A 1UF9A 3JVVA 4NONA 1GKUB 3LVRE 4L9WA 1IOZA 3ASYA 4LC1A 5FOWA 1TEXA 3A4LA 4L4UA 1KI8A 1GAJA 4HB2A 3AF3A 1IY1A 3V4RA 1R5NA 1O87A 1G3IA 2EWWA 3B8HA 5L3SB 1G19A 4IFBA 4DZZA 3K9NA 4EAQA 1VIAA 3CX7A 3AP1A 3D8BA 4Q4HB 1F60A 3IIKA 5FUVA 5IK2D 2ZRLA 4A36A 2OXCA 2OFOA 2WKQA 4M8NE 5EE1A 2RGDA 1YZUA 4TSFD 5FI1B 1HTWA 4LGMA 5DI3B 3E5HA 1XF9A 2A9KA 3IHLA 1D6JA 1YU9A 5C46F 1KAGA 2ZS8A 4I99A 4U5XA 521PA 3I62A 4C0AC 4GMXA 3QY0A 4UNPA 4Q4JA 3AUYA 4PTLA 1SVWA 3NC1C 2XTNA 2I1QA 3HR7A 5HCIA 1AS0A 2XXAB 1ZUNB 1HYQA 3NVAA 3CH4B 1OFTA 2E87A 2WKPA 1VPLA 2OCYC 2H7VA 3LVQE 1XTIA 3K0SA 2A5FA 4KXFB 1QBKC 3FOZA 3CZPA 2H57A 1N6OA 2I1VB 3DMDA 3QNUA 3Q72A 1OE0A 1R5OA 1WA5A 3I8XA 3W9YA 5B30A 1ZNXA 1FX0A 4XWOA 1COWD 2Q0HA 4Q9JA 1Z8FA 2PT7A 4AKGA 4LUCA 4ACBA 2CNWD 4DWJA 2WSSD 4GPTA 1NLFA 4PHTA 1NKTA 1E2IA 2A7QA 4JKYA 3VU9A 2FSGA 2QAGC 3DO6A 2ZYUX 2XNDA 1E79A 2CBZA 2GTPA 4GDFA 5F2EA 4LYFA 2CCGA 4A0RA 4D26A 4OJQA 2VP5A 3O8DA 3QXXA 3BAFA 2G6BA 2C8VA 4NP6A 3TQFA 1JAHA 2N1BA 1G8YA 3ZVRA 2OUKA 4FMDF 4ERNA 5KU1A 4GRAA 4NU0A 4QFMA 4TLDA 2ZI9A 4C7OA 3GD7A 4RZXA 2RKOA 1YHNA 4C7OB 2Z0MA 2C5LA 4HB0A 3HR8A 4YDHB 2VLIA 1NBME 1T5IA 4OHYA 2J7PA 3QG1A 1PUIA 1VMAA 2A3RA 2V6JA 2YWEA 5KDLA 3T5GA 2O8DA 5E3HA 3AF0A 3V00A 3DZDA 1DAHA 3AGPA 3B7GA 1KO7A 1S8FA 4HLUA 5A4JA 4GFDA 2OEPA 4AKEA 4EPXA 4DDWA 2XJ9A 3ADBA 1ZNZA 1NVVR 4OJKA 4I1UA 1K6MA 1G5TA 3KQKA 4MRSA 5JSZB 2Z6VA 4URZR 1BOFA 4LDJA 4PPQA 4V0KA 3SBDA 3X1YA 3VQTA 4DC9A 2GZAA 3LD9A 2WBLC 1RRFA 2F43B 3PEUA 3TSZA 2OHFA 3CLVA 3AH8A 1S96A 3L43A 2F1IA 3AP3A 4QGGA 1E2QA 1UPTA 1YKSA 4JVNA 1Z2AA 5SZKB 4WIAA 4U00A 2GHIA 1EX6A 4LC0A 1GIAA 1Q22A 3GLHA 3WYGA 3EPLA 1SKYB 3FHOA 4JYCA 1E9RA 2ZJ2A 5C4MA 4LX0A 3PITA 4TYPA 2OAQ1 1X1RA 1OKKA 1ZVQA 4Q19A 2X8AA 3P27A 4BPBA 2IS1A 4CZ2A 4MRVA 3EC2A 4NYIR 1RZ3A 3PQCA 3K1JA 3QSYA 3H84A 3QE0A 2EFGA 4W9MC 4MA4A 3CRMA 4N0EA 4Q03A 3M4YA 2C96A 3TK1A 4BLQA 3W3AA 1I4TD 1NG9A 1Z06A 4KFRA 3PJRA 3B2EA 3Q3JB 4D81A 1XMJA 3MD0A 4IDNA 3U4QB 1KNXA 1VYTA 4Q9IA 1QHHA 5FL7A 4ZKEA 1Z6AA 1O3YA 1KDOA 5DH9A 4ARZB 3KKNA 2BDTA 1R0YA 2ZU0C 3VX4A 4DRZA 1KMHA 3U3RA 2VSXA 3T1QA 3PIRA 1EWRA 1LS1A 3EZ9A 4B2PA 4KU4A 2A5DA 3GFTA 2FEOA 4TZ0A 4IEEA 3A36A 3I5YA 1JJ7A 3I5XA 1KK1A 4M4SA 4O2RA 1II8B 2XAUA 1QVRA 4Q4AB 4ACAA 4DJTA 4Q01A 1E2MA 1E9SA 5KSPA 3QPVA 3SEAA 3ICEA 1MKYA 3A58B 1GKYA 3I73A 4LJ4A 1U8ZA 4ZDJA 2R8RA 2QGZA 3X1XA 1F3OA 1VKJA 2HJGA 1S9HA 4Q1DA 4NCKA 3BOSA 4GNKA 2ZUBA 3BC1A 4TSFA 1I4DD 3AKYA 1BKDR 2RGGA 4C0KA 3B60A 4URWR 1SXJA 3GEEA 1ZD9A 2ASEA 2IS2A 4LYHA 3P32A 1JR3E 5LB4A 1UKVY 3GLIB 4MRPA 2PZGA 3KXIA 5FUYA 2FFAA 5JSZA 1QZXA 3KX2A 3MWYW 1ZINA 5FUXA 3U7EB 1JQJC 2QPOA 4GBMA 1SVLA 4AY2A 2VTKA 3P26A 2IYXA 2K5UA 3C14C 3R7WB 2YKGA 4JL8A 3IILA 3W6OA 1XPRA 2BHRA 3VNVA 3TMKA 5FBVB 3X1ZA 1GTVA 5EQTA 4Z51A 1QHSA 2WAYA 2XZOA 2NO9A 1U90A 3P4YA 3NTUA 2JGNA 3UIEA 2CK3D 4V0MA 1N0WA 1OB2A 3ZZ0A 2PLRA 3GLGB 1KKLA 4QHSA 4BFZA 1FUKA 1PLLA 2XNDD 3E1SA 3NHBA 4CVNA 8OHMA 5HZKA 2O8FA 3C15C 1EX7A 4MGIR 2GBLC 4D25A 4DT1B 2XTZA 2WZQA 2ZJ8A 3I1FA 3FKSA 1P4SA 1T0HB 1W2GA 1JB1A 2J5XA 4L16A 4DIEA 1EGAA 1W2HA 2RGEA 4A2PA 3WNDA 1CIPA 1KK2A 2JAQA 2V1XA 2AWOA 1TF7A 5EZ6B 2OV2A 3L82B 4HAUA 3BORA 2F3TA 1E9CA 3QPWA 2J1LA 4POAA 5CDFA 2BKUA 1CR4A 2DB3A 3A4MA 3CB4A 5TXGA 1IXZA 1ZM9A 3H1TA 3A37A 2KI5A 1HQCA 4JVLA 1E2GA 1E1QA 3L0PA 2O0HA 1DO0A 2KBFA 3FHCB 1SVOA 3IBYA 4TWZA 3R20A 2PJRA 1XNJA 2NQ2C 2IF2A 2ZITA 3BB4A 3WBKA 2CLCX 4Q18A 1KDTA 4FW9A 2P5TB 4A4DA 5JEDA 5JCZA 1YZKA 4H1UA 1MRSA 5E7IA 2O8EA 1E0AA 3C7KA 1R0XA 3R9IA 1ZD1A 1XTJA 4NYMR 5CM8B 1A82A 2G88A 1L4YA 1E9DA 4PSKA 3GMTA 4B73A 1XMIA 2XOKA 4RD2A 3PVSA 1KAOA 3T06B 1KNQA 3LBNA 3Q85A 4BLSA 4EIWA 1PUJA 4BFTA 1GWNA 3L8ZA 1EWQA 3NDPA 3CONA 3AF2A 4US1R 1S4QA 2WIAA 2YWFA 5A0FA 4OBEA 5DISB 3U44A 1J99A 2IYQA 1RYHA 2QT0A 1ZCBA 3P1JA 1YVDA 4LOAA 1SXJC 4FI3C 4DUGA 4CGZA 2FPKA 4TT3A 1Z0KA 3ECCA 2KBEA 3S1AA 1BYIA 2QQEA 1KIMA 2IYZA 4TMZA 4ILEA 4WXRA 1G4AE 2D06A 1SHZA 3PG5A 1W36C 3Q9LA 1RRGA 4QG7A 2QP9X 1XZQA 5SZIA 2ZIAA 4HATA 5BW8A 2ZE7A 4JMPA 3KDSE 2PX3A 3CIOA 4RKEA 1TADA 5E7MA 5JS8A 4X8MA 2NTYC 2ZM5A 2YYZA 3TUIC 3TQCA 5JJKA 3IO3A 4PQYA 1DELA 2AD5A 5CK4A 5TY0A 1G8HA 1OF1A 4JT2A 1FUUA 1G3UA 2RH5A 3W6PA 2CVFA 2X19A 3C41J 4Q48A 1D9ZA 4US2R 3KQUA 5KPJA 4B3BA 1VG1A 3KJIA 3SN6A 1II8A 1N2CE 4KODA 4LV6A 4URXR 1BIFA 1WRBA 3V4FA 1OYWA 4WZBE 2DBYA 1KMQA 3K9GA 2RGNC 3KJEA 3TNFA 1NKSA 2W00A 4X8OA 3UK6A 4TQUS 3ND9A 5GVSA 2YHSA 3FDIA 3G82C 5UKDA 2C78A 4K81B 2XB2A 3C4JA 3NWJA 1Z22A 1SXJD 1CJTC 2GJAA 2ZUCA 1XEWY 3DOEA 1ZU5A 2A5YB 3AKCA 3DKVA 4TMKA 4ESVA 4HLCA 5C1BA 1NMXA 1Z83A 4PHGA 5GADl 5F3WB 3OESA 4ZIRA 2CL7X 2G3YA 1NBMD 1ZU4A 1G8PA 1T3HA 4Q7KA 4JS0A 4EJSA 1Q1ZA 4MRNA 2DFTA 1CR1A 4TYWA 1IAQA 1QHYA 4DCNA 3SJCA 1ZBDA 2FJUA 4DLSA 2PT5A 3RAPR 4JLBA 1P9NA 1ZC4A 1MABB 2VSFA 2BCJQ 5FBLB 3K8YA 1W0JA 3U60B 5F9HA 2IBMA 2AXNA 2ZJZA 4DSOA 2G1KA 1IJEA 4Q5IA 3KTAA 2OAP1 2OLJA 2VO1A 4IVQA 1W4BA 1IY2A 4FMCB 1GDDA 4DLXA 5JWHA 2CHVA 4JBWA 3RANA 4OHWA 2JIZA 3TH5A 3W6NA 1N6NA 2CL6X 2R44A 4JLOA 1M7HA 1GM5A 2O8BB 4AI6A 3TVDA 3HU3A 3AKEA 1S2MA 1N6HA 3B1YA 5TB5A 1QHNA 2F6RA 1JAIA 4GT1A 1P62B 2V3CC 5HKKA 2ERXA 1VCNA 3I4LA 5FPTA 5JI2E 1XJ0A 1ZUHA 1A5TA 2FX3A 5AUQA 1YR9A 1FPMA 2ZJ5A 2CHQA 3C5HA 4MQBA 2ZREA 2JDID 5DN6A 2Q9AA 2Q9CA 2FSIA 1XJCA 1TEVA 3U44B 3C16C 1FQKA 4ARZA 2VP9A 4B3GA 1E98A 5JJIA 1P73A 2QBYB 1KMHB 3BGWA 3F8TA 2BEJA 4M1MA 5JI3E 3VKGA 1AQYA 1TMKA 3SC3A 1JEEA 2ZANA 2HXYA 2E9SA 5DHAA 4Q21A 4A6PA 3SNHA 5IHPA 1DG3A 3EG5A 1Z0IA 4AKHA 2JASA 4W5JA 1NLYA 1XFAA 1X1SA 4PC1A 4UXJA 2X1VA 2IXEA 3MUFA 4LHZA 2QE7D 3A1UA 1ZYUA 4GSYA 3ZIAD 1A1VA 2YC4C 5IDVA 1LFDB 3QF4B 5G3ZA 3TAHA 1MT0A 1EFTA 3QF4A 4CT4B 1OLOA 5HPYB 4EFLA 3M6AA 2WWHA 2GK7A 1KO5A 3I92A 3T1OA 3WRYC 4NYIQ 3LFUA 3LO5A 1FTNA 3GLIA 4UJ3A 5EP1A 1VIYA 1W0KD 5EXSA 4A9AA 5H8WA 4ZDIA 4AYXA 2JJ1D 3QPUA 3GJ8A 1TUIA 4IDHA 2REBA 4M22A 1LTQA 2IEYA 1L4UA 4G1UC 3MJHA 2VH5R 2VF7A 2KJQA 2PH1A 5EXTA 3CWQA 3R7WA 4UKDA 3VHLB 3JZMA 4JIMA 4CRWB 3PEYA 1Z6YA 2OILA 1P9RA 5AR1A 1QHIA 2HV8A 4GOKA 1E2NA 2GJ8A 3THYA 2P6RA 3GFPA 1EXMA 3L0OA 3ZZTA 1EFHA 2REOA 2FFBA 5BN3A 3AVQA 3W8NA 4BLTA 3EIEA 1IN7A 1US8B 4I1VA 1NIPA 4BLPA 4EPYA 3ZD6A 2RGXA 3ETLA 2ODBA 1T3SA 1VG9B 2YZ2A 3EWAA 2FGJA 5AJZA 1E6CA 4DCSA 4NH0A 1P75A 2B8TA 1AIPA 3HU2A 4KITB 5A5GA 2PZEA 4PC3A 4XD7D 3QKUA 1Q1BA 1HE8B 5DLQC 2IS6A 4LI0A 4B3XA 4F91B 5K8TA 4KJZA 3BFXA 4GP6A 5AJWA 5BWMA 4D2IA 5GVRA 1KDPA 2AHOA 2BKEA 2NPIA 3EXAA 1E9AA 1QHGA 4C0LA 3U7HB 3RLFA 5M04A 4CEIA 3GJ0A 4B3FX 2NO7A 5LD2B 3QKRB 2GWHA 3EAQA 5AK0A 3FPAA 5JJLA 1E99A 1P72A 3IEVA 4Q9LA 1FP7A 1KSFX 2IW3A 4J0QA 3RS7A 1P2TA 3K09C 4V0OA 1OIWA 3A6PC 3BJIC 5KUTA 1BYUA 4JBYA 1DAGA 4NCNA 5FR1A 3NXSA 4I1OA 4QL3A 5KSYA 2ODNA 2O8BA 3IKJA 2QZ4A 3QOFA 4WZ6A 3U3OA 4QGFA 2G0TA 4Z1MD 1X86B 3H86A 5E4FA 2ZE8A 1LW7A 2WIBA 4UXHA 2GXQA 1RJ9B 2XEXA 1CKEA 1UEJA 2QPAA 2ZE5A 3FFBA 3HJNA 2ODWA 4L9SA 5EZ5A 1P5ZB 4Q7MB 1XEWX 3OIVA 4Q1BA 2QENA 1KO1A 3AKDA 3KQLA 2GNOA 4YMWA 1Q21A 4N1AA 1GRNA 3K70B 4PR0A 1II9A 5P21A 1CXZA 2QP4A 4BFUA 1XB2A 3FMOB 4JT4A 3HPRA 1KI7A 1TQ6A 4M1KA 2VPPA 3RS2A 4BRWA 1HV8A 5DI3A 4UNRA 3B1XA 4PANA 2ZRAA 5AWFC 5CLQA 2GDJA 2F7SA 3LDAA 2R6GA 4QXAA 2ZYVX 5BN5A 421PA 3O8RA 4Y0AA 1FOEB 2YWHA 4NMMA 1DADA 2IL1A 1OH5A 3VR3A 3CX6A 1LF0A 3WXMA 2J0UA 2WMOB 4GZMA 4B34A 4HDCA 4ZV4A 2DWOA 3LA6A 1U9IA 3ONWA 4OK3A 1NY5A 4DXAA 1LNZA 4PAQA 1NSFA 3WMGA 2GVDC 4L15A 2JJ2A 2AKYA 2XB4A 4KV9A 4HUTA 4M1TA 4D4LA 1AZTA 2Q3MA 1TU4A 2HCBA 3DHWC 4US0R 2OCAA 4FCVA 3G5UA 4G3XA 1PV4A 4LHVA 4NYJQ 821PA 3K70C 3QXSA 3TRFA 4QBFA 2OXRA 1OH7A 1WE2A 3AQ4A 3JZAA 4YLGA 1ZC3A 4M9QA 5C18A 4TLCA 4K8OA 1ONBA 2PCJA 2AL7A 4NPHA 3SR0A 3BFKA 1SVSA 3KB2A 5JS7A 2Z4SA 1NNEA 3TSWA 4TL6A 3RS3A 4L8GA 4P4TA 1G6OA 2F1HA 3IGFA 3ZDQA 4KFSA 4FWTA 3EA5A 3THXA 1VG0B 2FEMA 4LCBA 1SGWA 2KSQA 1A7JA 4TMVA 5FPYA 4QRHA 4QBGB 2HF9A 4GMDA 4TYNA 5CK5A 2VP6A 4B47A 1KI6A 1GP2A 2WV9A 3LX8A 3GJXC 2FPMA 2BMDA 2HT6A 3KTAB 3LXXA 3RS0A 2X2EA 4E09A 3EC1A 1FQJA 1RRPA 3QIAA 5FOVA 2ANBA 2ORIA 2VIIA 1AK2A 1W0KA 1FP6A 3KL4A 1GNRA 2HCJB 3CR7A 2JJ1A 2ZAMA 2PMKA 4AG6A 3I32A 2ZI6A 5DNYB 3RNLA 3U6KA 3THYB 5G40A 2D7DA 3FKQA 1AGRA 5FPSA 3VFDA 2GF9A 1E2EA 3K53A 3QKSA 1XDBA 1H8HA 3IPYA 4CYMA 2IT1A 1VHLA 3LAWA 4IXNA 3O8BA 4I4LA 1CR0A 2LWIA 2BBSA 2QROA 1CRPA 4LV8B 4B48A 3PENA 1M74A 4F93B 3A1TA 4MGZR 3ZQJA 1VECA 1N6PA 4IVPA 5EJEA 1ELOA 2LKCA 4Y0VA 1OW3B 1G6HA 3M1IA 4HAWA 2HT1A 4C3ZA 4RZ2A 4XD7A 2WJHA 3QENA 621PA 4L5BA 1E2KA 3PUVA 4XH9B 2Z43A 3GLHE 4V03A 3OEEA 4B44A 1U8AA 2VP4A 5KTYA 1G18A 4BFYA 3MG9A 3VR4A 2X77A 3B9PA 1IN4A 4BZPA 2MSDB 2AX4A 3GJ7A 2VP0A 2ZVQX 1A4RA 2O0JA 4M2LA 5DGXA 3TE6A 4A1FA 4HZUB 4PQRA 1JJVA 5L3QB 3KUDA 4HZUA 2QL6A 1JEDA 4JLMA 3E70C 3WMFA 5ANRB 3ZH9B 3THWA 4WXPA 4LBZA 1XXHE 2BMFA 1YR7A 2JJ8A 1CF4A 5EUMA 2JLVA 3VR1A 2W2TA 3A1VA 1RKBA 2JLXA 3BB3A 2AK3A 2PMDA 3HPQA 4BE7B 3OFND 1S3SA 4DLYA 3LBHA 2D2FA 3FMFA 1OXVA 3RDPA 4PPFA 3IEUA 1AKYA 1ZM7A 2GCPA 2VA8A 1KK3A 4CDGA 2RHMA 1FMJA 1JNYA 2ZJOA 4JBXA 4LJ7A 4PXAA 5H68A 1AS3A 1G1MA 4DB4A 2BM0A 3BRWD 1Q0UA 1DS6A 3PFIA 4IOMA 2ZRHA 3IHWA 4FXPA 2ZU6A 5EE9A 4F4IA 3ASZA 1JALA 4OQXA 2RCNA 1Z47A 2ZSEA 4Q66C 2IYTA 2R6DA 2YJTD 3K9HA 3SOPA 2NZJA 1XWIA 3RWMB 1K8RA 2IYWA 2IXGA 4A8JA 5J4LA 2GXSA 4WZAE 3OHMA 3GP8A 4Q1AA 3ZS9A 2EWVA 4WW0A 1EFCA 3AVUA 1ZUIA 5HZHA 2F9LA 3TJZA 2ZRGA 1VTKA 3K9LA 3U5ZB 1OFHA 1RFLA 2AFHE 2ZRBA 4HB4A 4A6XA 4A0FA 1KZGB 2OO7A 5HE9A 4XVQA 2XITA 1J8YF 1YRAA 1E9FA 2QRZA 5JBQA 3SS8A 4JLKA 4BZQA 3SJAA 5DIFA 1G8GA 3N70A 2A78A 3NH9A 4Q1CA 2PZFA 4MYCA 3LY5A 4CEIB 4TL7A 4WVFA 3UMRA 4G01B 3ZVLA 1QHXA 2Y8EA 2ZROA 4MGYR 2EYUA 5LB2A 4Q7LA 1R5BA 1X6VA 4M21A 4PZYA 3DDCA 2FFQA 1ESNA 1E94E 3GLFB 2ZUDA 2OT3B 2JLUA 1CP2A 1KSHA 2MSEB 3QJYA 1M2OB 4DDUA 1PLKA 1ZCAA 1SHKA 3GFOA 1E2JA 5K8UA 1CRQA 1E96A 1Y3AA 1XEXB 1OIXA 4DLZA 2QA5A 1NN0A 4MUBA 2YOFA 4JL5A 2XX3A 1AJEA 5B57C 3FWYA 1QVAA 1K5GA 3CPEA 1FW6A 2V4ZA 3ZLJA 3FB4A 3MWKA 2QTFA 2EQBA 5B58C 3ZYCA 1PLJA 1H65A 1KSJA 4B6EA 3BIFA 5JWOA 1UKYA 1FL9A 2A30A 2C9YA 2OSBA 2WMNB 3PEVA 1XPUA 3CW2A 1LVGA 1Z08A 4TN1A 4ASUD 2AN9A 1F2TA 3L0IB 1J70A 4MKGA 4AURA 5EP2A 3RRYA 3F3YA 1G7RA 5CDFE 1IQPA 1GKIA 1U81A 2VEDA 5DI9A 4EJSB 2QI9C 5JRJA 2RB4A 1W5SA 2O5VA 3BFVA 1HT2E 2GXAA 2IYYA 4Q9HA 1EK0A 4YXWD 1W4AA 2D2EA 4B6FA 5JCPA 3RSOA 2P0EA 1W46A 1AZSC 2QAJA 5KNCA 3CO5A 3AVWA 1R0ZA 1NIJA 1KJYA 1SZPA 1XTSA 2EFCB 3OEHA 4II7A 4G5QA 5DHFA 5GJBA 4LHYA 3UMSA 4B43A 1BMFD 2GJKA 2QU8A 2XSZA 4IW3B 1DPFA 5FBRB 2ZR9A 2OBLA 4MYUA 4XTCS 2ZS7A 1JXOA 1UKZA 1XTRA 1DAKA 1YZQA 5FTLA 1ANKA 3VKWA 2WSMA 2Z5FA 3QI2A 2GEDA 2I4IA 1CULC 2QM8A 3GJ5A 4R2HA 4AYWA 2WWYA 3RC8A 4PQFA 4NYJR 4M9XA 1E2LA 2WPDD 4BLOA 5FUWA 2R65A 5JHHB 2WJIA 1TF2A 4LBWA 2IX3A 1WB9A 3MFYA 2B6HA 5HE8A 1E32A 1PZNA 1YZTA 3LLUA 3VMFA 1ZIPA 5CJ2A 221PA 3C8UA 1DTSA 2XXAA 2G0NA 1SULA 1XCGB 3K70D 1M1YE 3FVQA 3AUXA 3LX5A 4LYJA 5FTNA 4DBLC 1RPZA 4B3CA 3REGA 3FFAA 5D3QA 5IK2A 1T8UA 3A8TA 2YOHA 3KKOA 2OCBA 3A1WA 4A8JB 1XEFA 4HLUC 4KI0A 3LQQA 5AJVB 2W6JD 3NIBA 5FTJA 1WCV1 1YZNA 1NMZA 1Z6XA 2GF0A 1YR6A 3KKPA 2Q6TA 4UNSA 2NGRA 3AF1A 3Q5EA 3AVYA 5LDDC 4JSTA 2ZRPA 1H8ED 1C9KA 1G3RA 2UKDA 4DEXA 3CNLA 1T8TA 4D0LB 1DG1G 2PBRA 4URYR 3B82A 1C1YA 3T5DA 4V0ME 2KWIA 1NJFA 3BE4A 5AJYA 4MYHA 5JECA 4LYAA 2V54A 4YC7A 4D6PA 1R10A 2RMKA 2F3RA 3NBXX 2NG1A 2DCUA 4AC9A 5FOTA 4HDQB 5LPNA 4DSNA 1GITA 5G41A 2CNWA 3MJRA 2WSSA 3QKTA 2QT1A 1CS4C 1E79D 1LF5A 3TSOA 4LJAA 3VTKA 4AIIA 3CRRA 3BERA 3BH0A 5EE5B 5G53C 1V43A 4V0NA 2G1JA 1XD2A 5CYPA 4PPNA 1OIVA 2P6NA 3N2IA 3K0CC 4JLVA 3MMPA 4DLVA 4E22A 1XJQA 2JLRA 1CLUA 4BFSA 1W48A 1W1WA 2W2VA 4TYYA 3U4QA 4BGDA 5TDHA 5HTKA 2QMUA 4JKIA 1XZPA 2J7PD 2MSCB 1KI9A 5JMTA 3UPUA 3THWB 2CE7A 2FV8A 4M1YA 3CKLA 1ETUA 1KO8A 5EXXA 4M53A 2O52A 2CE2X 3RHFA 4LJYA 4EJSC 2OM2A 3EW9A 4Q00A 5J4YA 5JFGA 4E5UA 1E69A 1W5TA 4DCUA 1Z3IX 3W34A 2ZI5A 3SFZA 1KK0A 3LLMA
chains in the Genus database with same CATH superfamily
4O4IB 1NT4A 2YIMA 5CLGA 1A95A 2OPHA 4CM3A 3C0KA 1XZNA 2FFHA 1HEIA 4OJYA 5I8ZA 1YDFA 2B94A 4A73A 3QFCA 3GCGA 2QTVB 5T6BA 4ZJUA 3IAHA 1OBFO 5CBPA 4PZCA 3H6KA 1LPNA 1COWA 1KDRA 2GEVA 3H1AA 4MVJH 2C2ZA 4LK3A 1K8YB 3KD2A 4UDYX 4QGAA 5KJEA 1C3OB 4HDOB 4ZRDA 2P5SA 3FRIA 3B1WA 1M34E 2W83A 4LJ5A 4RH3A 5DTEA 4DHEA 1GVNB 1GARA 3KEQA 1SXJB 2E4XA 5CEJA 4H17A 2XZPA 1Z36A 1HLFA 4IGKA 4ER0A 5I3CA 1DPGA 4ZPXA 1VL2A 3LZDA 5T41A 2DWQA 1NU6A 1N1MA 4Q02A 4PZ9A 3UKJA 2BKLA 4R1NA 3VU0A 4LHWA 4XSGA 3BQ9A 1C1HA 2GLUA 5DM2A 2WRZA 1IXSB 3VR4H 3OJLA 3T12A 1U7WA 1RYFA 1DC5A 4JBHA 4RD1A 5K8IA 3UJNA 3GPLA 3FX2A 3T52A 4G0QA 4HX9A 3QSGA 4FNMA 4Y2VA 4X66B 1P2VA 3TR0A 4A2WA 2XY4A 3P19A 1KI1A 1OQAA 4HHEA 1JPUA 1MC5A 2H3HA 3DOHA 4LV5B 5DWVA 3SKVA 1VKHA 1OI3A 4BVBA 3G8AA 3P94A 3T4XA 3SM3A 2WTUA 2VLBA 1U3UA 1QSGA 2JFWA 4QUJA 5JCOC 4PX2A 1EBBA 2ON6A 1C80A 1AZWA 1YB5A 2WABA 1QIJA 3AONB 3NVMB 4UVDA 1OUMA 3AM1A 2RC6A 3NDBB 3IB6A 3KQPA 1CQIA 4M9UA 5CW2A 2OORC 1OYYA 4JR2A 4A92A 5ARBA 1E1YA 3DONA 4O33A 5KDOA 1F17A 3FBWA 3HCDA 1YULA 1LI4A 2R62A 4ES6A 3V4PB 1TMGE 1E0JA 3J81A 2OQIA 1H1TA 4DR3B 3P9RA 2OZEA 3T35A 1C1XB 2V7QA 2QAGA 3RC7A 5JMWA 1JR6A 2N47A 4DMUB 1Z88A 4LKOA 4PSUA 3WHKA 1MW8X 4QHTA 4G0NA 3W05A 2FKAA 3W2TA 1ZZEA 4GBGA 1PS0A 1C5KA 3ZXSA 2OGWA 3VHXB 4FMPA 4XGKA 4B4DA 5AJXA 2DFLA 3ONFA 3PC8A 3BS4A 1Q0QA 4XGNA 1ISIA 1Y3FE 5CMLA 2VRNA 4EBBA 5FNVB 5IBRA 3ZW7A 1PR9A 5J47A 5JNWA 4I9HA 4K46A 4CF7A 4C4OA 1UBOS 1SA0B 5JYDA 1IXRC 5IDYA 3C3BA 2H1LA 2V4UA 4BWYA 4CG1A 5DEIA 4GKKB 1H2RS 5J2UB 1LDMA 1ZA1A 4G0XA 3OFKA 1F1JA 4QUHA 3BMNB 3EXHC 1H8EA 2NZXA 3WE7A 2Y6UA 3C2QA 3THXB 4P54A 1TEZA 3IV6A 3PYMA 1P17A 2ZPAA 5F3RA 1AM4D 3U7GA 4KL8S 1GCGA 2JGKA 1HNWB 3NXKA 4DCOA 4GYWA 3IAS1 4Y0NA 2FPGB 2VNSA 2IYLD 2YV1A 2ZDGA 3HDJA 1VYVA 3W3AD 3QXXA 4BGVA 1KI6B 4N6NA 1RP1A 3EXG1 3H75A 5IJ0B 5EJ9A 2NTNA 2WG0A 4KX5A 3K1AB 3OA0A 5JH7F 5K4HA 4G0VA 4CU5A 3BFJA 4YQYA 1G5PA 3O4HA 1XVVA 5IH3A 3SVZA 2B4KA 5FOSA 4RTJA 4OJMX 4PO9A 2FWRA 3RYCB 3U0BA 3WGUA 5PNTA 1V1MB 1WF3A 2QLLA 2ZJAA 4UCFA 3WWOA 3P9NA 1GVHA 4ZC8A 1OX6A 4DJ5X 5JZ9A 2PWYA 2NMVA 5DZSA 2EGGA 2QRVB 1QPBA 3CLTD 3RLIA 4ZRMA 3HCPA 5C2JB 1JQLB 3CH6A 1NQUA 4ZHSA 2A84A 1L4BA 3WP1B 2Q2WA 3OZUA 5J40A 4IY1A 2IBSA 4FM9A 2UYYA 3JQ8B 3M6MD 4BJ5A 2WWXA 4HAYA 1UWCA 3CEJA 4DC1A 4EY5A 3TLJA 2C3PA 7AT1A 1H9CA 4TLMB 4CQLA 4MIKA 1AH2A 2OC9A 3H11A 2HYIC 2GO1A 3SQLA 1L6IA 2PH3A 1FA9A 2WKSA 4BGIA 1OI4A 4CMAA 3LYHA 4DLYA 1ZK2A 4P7JA 1XG5A 1ZHHA 1U99A 1VBKA 2DQSA 2SCUB 3LP6A 3BZUA 4C4PA 3WYDA 4G65A 2H17A 2MSKA 4ITUA 3JQ9C 2HCFA 4IHJA 2FMXA 3SMQA 2W0MA 3C7TA 5DASA 1AURA 3CUTA 2WM9B 2NOAA 3ROZA 3S5JA 4RJLA 5FI5A 3D3QA 4RAQA 4OQYA 5DYGA 2PGOA 3ZD9A 1N1GA 2DP4E 3BIXA 4IQ0A 4RCVA 4D9CA 4FIDA 1Z0UA 2HI0A 4EA7A 5KU7A 3O47A 4FWIB 1W47A 4I5EA 3L7JA 3ZQ6A 4F45A 5J3JA 4IKEA 2CSXA 3QXJA 4R0MA 3F1KA 5KQLA 1N0IA 3D6VA 3R4VA 4LY9A 4PYIA 2D00A 1A88A 3T1TA 4U6QA 3RSLA 1G0OA 2ZRFA 3A2KA 3EZYA 1IBLB 2IU0A 1TU0A 1YGYA 4GO1A 3SBOA 2AKAB 4JC0A 5JLJA 4WNCA 4R1QA 3MGGA 1I1HA 3ANLA 3H3JA 3FSGD 3WMWA 1NN1A 3F8SA 2Z3VA 3DDHA 4LRTB 4YMLA 1JR3D 2VJCA 1HETA 2Q99A 1E8MA 1WTCA 2B30A 1JEQA 1RM4A 3AESA 3IAXA 3WZ2A 4CM9A 1A8IA 5JZSA 3WRWA 1K66A 3JU3A 1GAEO 5FTMA 5NULA 4LX8A 4WXHA 4NXMB 4JJGA 4OMCA 4GAEA 4OHXA 1K9SA 1N6KA 2ET6A 3CH5A 4NCJA 5BV8A 2CXTA 3KPYA 2GVZC 2E18A 2YWBA 4KO1S 2QRJA 1OFUX 1SUFA 4WXMA 2AWNA 3ICQB 2B3TA 1M2VB 1O95C 1TFRA 2J32A 4BEBA 1QTNA 1P6XA 4FFWA 4LRYA 3AVPA 1ZH4A 1II0A 4LJSA 1XVUA 2VL7A 4CF6A 5F64A 3UXEA 3DMNA 4OXIA 1OHHD 2HLDA 4TL8A 5JHGB 3L84A 5H80A 1UBUS 3TZLA 5L8VA 4LAFA 1ODSA 3MA0A 5DM1A 1OAOA 2R85A 2VSYA 4BZWA 1QOQB 2G76A 3CZAA 4X8LA 4ZCIA 3B6ZA 5AHWA 4H6PA 2AC4A 3PPYA 4OK6A 3RSZA 3WNVA 1T36B 4BUJA 2OVFA 2VJAA 1KZ9A 2WWWA 1J2JA 1GZ6A 2BCEA 2J41A 3FTDA 3FTQA 4WJKB 4Y1EA 1FJHA 1PT5A 2YVAA 1BX1A 3ADPA 3BSYA 3MOSA 3ZOKA 4WAUA 4EG5A 3I61A 1P9LA 1YFZA 2BUCA 2MOKA 5DYWA 2V9ZA 3UWKA 2I29A 1XEXA 2VNHA 4R98A 4YIKA 3IMCA 3R6WA 4L4XA 4WBSA 1JTFA 2IKSA 2Q0XA 2Z8YM 3LG2A 3AY7A 4YLYA 2V5AA 3BWXA 1GZUA 3H1GA 4GI7A 3T15A 5EMKA 4P53A 1YC5A 2G72A 4MUIA 5F2OA 3UMFA 1JSRA 4YCBA 4OEHA 4TQ9A 4EHNA 3R9XA 1PQPA 1RCUA 1WMBA 4GPBA 2XBUA 2XI4A 3C6XA 3TKAA 3T7AA 3QKRA 1YVEI 3FNGA 4Z8YA 4IF6A 1P0IA 1QIDA 2ZRKA 3O3CA 2OKGA 1C0LA 1Z33A 4GMKA 1DUIA 2XOXA 1UBFA 4R1PA 4ARUA 5C8YB 1Z0FA 3AR2A 2VVTA 1PV1A 1D6NA 2YVUA 3R75A 5IH7A 4HRYA 3TW8A 3DFIA 3CF2A 1TQ4A 3RS4A 4DF3A 1B0UA 3R41A 5ELXA 3KQTA 4KYIB 3I6MA 2FZ4A 1DCFA 2UZIR 1HI9A 1OTXA 3A31A 1J0XO 3NZEA 2HYDA 2Q07A 3K5WA 5K3FA 4ZK2A 1J20A 1WM1A 1D2MA 2PAAA 3MCAA 3L02A 1MGPA 4OA5A 5AYVA 4DUGD 5JOQA 5FJJA 1YFJA 2O3UA 2XE8A 3HSYA 3DMTA 2WOJA 3E53A 4XSHA 4DG5A 1IOLA 1GRRA 2NX2A 3G8DA 1QV6A 4OGGA 4KGZA 2B7CA 5ALDA 4EAAA 3EPHA 2WFZA 4LNHA 4PLZA 2P8JA 1ZIDA 2AV6A 4BWFB 4Q93A 3LH5A 5CH5A 1H4VB 1YXMA 3LFTA 3IPXA 1FNCA 1JPNA 3BA6A 4JQSA 4JYBA 4LVNA 4UHCA 1DV2A 4QDOA 3UMBA 1N5IA 4ERXA 4URVR 3EYAA 1XCPA 3AGQA 3EZFA 2HN9A 1DOAA 3LW7A 4C88A 1VJ5A 2FP4A 1HYBA 4LI3X 3WGMA 5B2ZA 3FKJA 4BDTA 4NI5A 3RT7A 1SVIA 5ETJA 2YUIA 1DEKA 2CHUA 4XFDA 4DIBA 4RIFA 1RMYA 3EDQA 1RYDA 5IM4A 2PEYA 2VK2A 3LWDA 1BROA 1JHYA 1TI7A 3FLMA 4K6MA 4WCFA 1NF3A 4OYHA 2A9OA 4C3VA 4C6HA 1XK7A 5FWXB 3O0TA 2X5XA 1YTLA 2J4CA 3L07A 5IAEA 3LS2A 3K9FC 4O4LB 4BNKA 2IX9A 1TD9A 2GO7A 3UKOA 1CVLA 3OI7A 4NVRA 3IRUA 5G3YA 2QD1A 4P3YA 2VUTA 1ZFNA 3DE0X 5LBIA 1S3GA 1BKSB 2AG1A 4DCPA 3LBAA 2J6HA 2ZS9A 1UBHS 4XTRA 4EUFA 1P0QA 3IBGA 4ZYLA 1HPLA 1Q44A 3EFOA 3E81A 4IIEA 3FVRA 4UZSA 3JRNA 2ZAYA 3KLNA 4H7DA 5A3SA 5TV2A 3DEJA 2G77B 2Q5EA 3QVKA 2VHJA 1YQXA 2JBAB 3DE6X 4FHCA 4J0HA 2B1JA 4AROA 4DY6A 1CUEA 2VNAA 1UK6A 2JATA 4IG4A 1HL3A 4C2UA 2PFSA 5EE0A 4H7KA 2PBFA 4EQZA 1NBMA 1WQ4A 2QDKA 3DXYA 3KKQA 1V6AA 4X65B 3HDGA 4N40A 4IXWA 1Z18A 3WKEA 4QTTB 3RPEA 1JLLA 4DUYB 3FPEA 2H3EA 3I9OA 5CCBA 3HB4X 1XXHB 2BC9A 3DH0A 4J4TA 2VBCA 3CXUA 2WU0A 3RJMA 2BJVA 1SBTA 4ZTUB 2PUDA 4MQ4A 3IFSA 1EIWA 5TIIA 1WAMA 2QD4A 4MLZA 3MCTA 4G5XA 1ZIOA 3FXAA 4RH1A 3BXZA 4XW2A 3EVCA 3OIGA 4M9SA 4OQDA 5FADA 1YQWA 2OR3A 1EHIA 4BKQA 5JAQA 1O77A 3EIQA 4BU1A 2VHQA 1CF2O 5F1KA 2Y6VA 2JAPA 2F17A 4IXMA 1CLEA 1H5QA 2BFMA 3T5CA 4M1EA 5F51A 3GUCA 1GTSA 2FN9A 4F2PA 1VL8A 3IJEB 1GRCA 2E1PA 1IBRA 3X1DA 2AF4C 3SHWA 3WK4A 3U13A 4QTXA 3OSUA 5C1IA 3MUOA 3VA7A 2HSJA 3ETEA 1IZ9A 1KJ9A 3L49A 2J3KA 2J4DA 3G0BA 3B1VA 4P3KA 4B8ZA 4NU8X 4RJIA 4EH1A 1WXXA 3BQMB 4WBNB 3LWBA 1YR8A 3AV3A 4Q3KA 1M6YA 1M2JA 3HJUA 4JLDA 5H3CA 2FDCA 1WDTA 4CW7A 4HDKB 4WZBA 1VLVA 4IFIA 4YAKA 2FZ5A 3LHDA 3RRMA 1VLQA 3MK31 2PRZA 3QH4A 5A04A 5DN6D 4LHXA 5HFNA 1Z63A 4ENUA 2DPLA 2Y9PB 3PX3A 4RD4A 2QF7A 1RIFA 1L4FA 3G68A 4IIYA 3UMGA 1A27A 1U80A 1WV0A 4BO7A 5BN5B 3UJ7A 4W7HA 2HBRA 2I55A 2Z95A 3BE5A 3IOCA 3RIYA 5EJ8A 3U3JA 1B6SA 3RIXA 4HNGA 3HG7A 4IJMA 4IUCS 3R5SA 4YUXA 4E5NA 1I5OA 4WADA 5J63A 2JC3A 3DAYA 2ISCA 5COBA 1SKQA 5I9IA 3BCUA 4TTQA 2P6PA 1N6IA 2PKYX 2GX6A 2WJZB 1JFFB 16PKA 3FW1A 4KRYA 4PQEA 2QZJA 3C48A 1FQOA 2YOGA 3EEIA 3FPCA 4YQZA 4FYMA 5ALFA 2E3JA 4PSVA 2I0FA 2VF4X 1NP3A 4RKRA 4L3WA 3IDFA 4RTLA 4UNIA 4H08A 4BQSA 2ENUA 2NO6A 3F73A 3ZIAA 3I64A 5IVKA 1YB4A 2VJNA 5G4LA 1QOPB 3JD2A 4YT2A 2ZSFA 2DTDA 2VAPA 3FUTA 3ND7A 3ENZA 3O1JC 2DM6A 5F98A 1HFEL 1WLYA 4CR6A 1GG5A 5EJAA 4CTNA 2JZNA 1ECGA 1Y63A 3W5IA 2I7CA 2VF5X 2NU6A 2Z3WA 1OC2A 4G5GA 2Q7OE 1YQTA 1RRVA 3GXOA 3O74A 4FMBB 5H9VA 3F5MA 1IATA 2CLOB 3IQWA 4MV7A 3GFRA 4MW4A 1L1QA 4JSRA 3V4VB 1YKGA 4P4SA 1FXWF 1TE2A 3IVMA 3L8YA 4DWVA 3KT6A 4EW3A 1TCUA 1P8JA 3FJYA 4S05A 4J0IA 2J07A 4Z1MA 2JGIA 1MB9A 2V6MA 3PJFA 2YDYA 3CLTC 1TYZA 5REQA 4QZVA 5C34B 1DL5A 1X7YB 2E82A 2A1TR 2J5BA 2NZ8A 4BQFA 1V8BA 2GJ9A 4MUAA 1R0LA 3FFXA 2PK3A 2WYOA 1H0KA 4L3VA 3I23A 3CCBA 3DM5A 2QLBA 1JE0A 5EQJB 3EIHA 4L50A 3C3EA 4QPZA 1ZRSA 3TGPA 1PZMA 1O58A 1AMUA 2XNHA 3VHXA 1O9HA 3LRTA 3X1KA 2PPVA 4JLWA 4LWZA 2DC1A 1IIBA 4RVOA 1YNOA 5I9NA 2R7LA 1YBFA 3K1ZA 3MQFA 3CN7A 5KOJA 3EBPA 4OHZA 3T7EA 3JYOA 4V39A 3E3OA 5GONF 3WOVA 1YZFA 5H7XA 4BJHB 3KXKA 3GDGA 1C0EA 3YASA 4B82A 4RK7A 1UPUA 3M6IA 4HQ0A 3H9JA 3LPDA 1RYEA 4JI3B 4JL6A 5B7GA 2PLFA 5AVUA 1ZKMA 4QOSA 4ZTZB 1PNOA 2D2XA 4C07A 3LC0A 5TR9A 4ZFNA 3JXEA 3ZTWA 2P9HA 1FFAA 3IIMA 1IMJA 4WE3A 1FSFA 5I9TA 5T4EA 1QKKA 2F90A 4FGKA 1TK9A 2NIPA 1H0SA 3L1VA 4MVJD 4C4RA 3LC2O 3QX8A 3TBHA 5BYJA 3TIFA 4BL5A 5BPHA 1DGQA 2I9KA 5GZ1A 2IZ7A 5KCMA 3L8DA 3N75A 4MI9A 4TM7A 5DCUA 2H2IA 1L4MA 4KSCA 2W22A 1X80B 2BHNA 1HURA 4JASB 5FA8A 1S7GA 3ETJA 1LB1B 5D2CA 3VDQA 5C8ZA 4BKMA 3FB1A 4JP3A 1VZ3A 4G84A 1GGVA 5FBQB 2BJWA 1VKRA 3CLUD 4IIGA 4L95C 2YJ3A 4LDZA 4FYVA 3U4GA 4NXNB 4K3VA 3IIIA 2R8YA 1H85A 4PGHA 1G41A 4WOJA 1QMPA 3PC6A 1TXGA 1Q3TA 3V46A 5JNUA 1X2EA 2GFQA 4YO8A 1X92A 4C22A 3V8PA 4F4CA 4NE2A 2VQSA 2TECE 2C8LA 1EGHA 1L5ZA 2VYFA 4URHA 3DE1X 2O2GA 4O63O 3UANA 3NG1A 3ZY6A 4ZT5A 3INTA 3RABA 4K6OA 3B1ZA 4G6ZA 1Y48E 1PTJC 4R68A 5KVQA 1NFFA 1E1KA 3F0TA 3N59A 1RAIA 4G9EA 4NFHA 4ED9A 5A2QA 3AFHA 2I4TA 3A6LA 1M2KA 3DZJA 4D3FA 4DCTA 3ESDA 3KZMA 4URUR 4MKFA 2ADMA 2JAUA 3DL4A 2AX3A 2G8LA 4ZCLA 1U04A 3C8HA 4BX9A 2QY6A 2JH8A 2ZUFA 2I2BA 3H1FA 2Q6VA 1GTRA 4KC0A 2UZ0A 3K9WA 4YAFA 5KYUA 1LK5A 5J43A 1U28A 1UJBA 2WHQA 1OYVA 2BFFA 3A6HA 3NEJA 4KQJA 1L7OA 3K0CA 1EKXA 4DUZB 3EZXA 1GD1O 2WJGA 1S2NA 1UJ6A 3CXRA 3OWXA 2DHEA 4B3HA 3FYHA 4YCSA 2VXBA 1GRQA 2C2KA 2Q21A 2W8BB 5AI6A 3A27A 3UY4A 3VZCA 5LNK1 1UZMA 4BDSA 1SUCA 3RVBA 4KLAA 3BL6A 3PE4A 2C9MA 3CBGA 4YK7A 2A57A 4LVCA 2FRXA 3K3PA 5FWNA 4I2NA 2WUVA 1YIAA 3BWBA 4HB3A 1YZLA 2CVOA 3ODGA 1XRLA 4HXFB 1RWVA 1UXHA 4LSWA 4BGUA 2PZKA 3IRVA 5JDIC 4CEHA 2C9OA 3D0OA 3QRWA 1MRNA 1YZHA 4TTJA 4MRAA 2WZBA 5T57A 3TLMA 4CQMD 2N46A 2C98A 4RTNA 1O94A 2KPOA 3BXEA 1CFZA 2G17A 1UKEA 1NM5A 2YWDA 1Q3HA 3GLHB 5LC1A 4QYIB 4M1OA 3IDAA 3UUFA 1A8UA 2VDVE 3QEMA 1IFXA 1TZJA 3LNCA 1CEEA 3SZ3A 3PGKA 3FZYA 2I6FA 3ORYA 2GESA 1MN6A 2QLMA 5IS2A 2D4HA 3M8KA 3H9BA 1RC1A 2IUTA 2DECA 1A0OA 1I3KA 4FX2A 4V0LA 2IWRA 3M6LA 4QPJC 3E9MA 3KSAC 4ETWA 4XX0A 2A5GA 2FSVC 4LVOA 2IK8A 1G60A 1CJMA 1RJEA 4M54A 3UK7A 3D7MA 4MLPA 3MB8A 1RSZA 2GK6A 1ZMTA 2REQB 4F2HA 3CISA 3VMMA 3JTMA 5EMMA 3UMCA 2ZT7A 4BQEA 2YXEA 4TTPA 4QU0A 1GQFA 5IDWA 1UBGA 3NHUA 2BGNA 4IQ8A 4L08A 3ZWKA 4DTCA 3W90A 4TLAA 2NTVA 1MQ8B 1ZAKA 1BHQ1 4QC2A 1JKJA 1E9VA 3PFCA 4PC6A 3TTSA 1ESMA 5BN4A 3G7UA 4M0LA 1T2VA 3GZTB 1ZD4A 4KXVA 1I3OA 4UEWA 2FAXA 4NYMQ 1P6UA 3FCCA 3B52X 4F8YA 3OOHA 4IIDA 1WDWB 1NI4B 3A25A 4ILKA 4X61A 3IBTA 3Q11A 1YDEA 2TRSB 3E9CA 1QCDA 5LN1A 5I8PA 5HF9A 3O73A 4R8LA 5LWHA 1BQ3A 1VOTA 3D6TB 3DAPA 4FYYA 1COZA 1NSYA 2I6TA 4LPSA 4MVYA 4X95A 1W35A 5T3UA 4JLPA 2ZXUA 3H42B 3AJ8A 3GQBB 3BMQB 4KN8A 3V9PA 1I1NA 2BYTA 2FZLA 1NQVA 1AHNA 5D86A 1QGUA 2PIAA 3IYLW 2X8JA 4IEIA 4X7PA 3O3OB 4L72A 3ZXIA 2WTEA 3D4IA 4NNPA 4PX3A 2YVQA 5DE3A 1RYYA 4A5SA 1QIGA 5GJCA 1V11B 1KMIY 4C1NA 5EMNA 3SF0A 4CGYA 4BMZA 1IK6A 2W42A 4RVCA 3TLZA 4B84A 3H2BA 3TUJC 5F1PA 1L4HA 1ZW1A 3R6TA 3RGWS 2XUFA 2PL3A 4MJ7A 3ZE7A 1RTKA 3AR9A 4YLEA 3E27A 3HWRA 4FKBA 2CCJA 4R2IA 3DW3X 1SRQA 4YAIA 1CY2A 3HCBA 4O8CA 3QBTA 4Y9DA 2WYHA 3JS5A 3GJ6A 3JYNA 3QU5A 4PFSA 4AP6A 2BGLA 5L4SA 5LZ4A 4DMKA 4ZOAA 4AULA 1C7JA 3DJYA 3KEFA 2GZ1A 3PUIA 1V6SA 1DJOA 4FJ1A 4ZALA 1ZCZA 3C1OA 2V8OA 3PPXA 4EUNA 3PX7A 2EV9A 5CDUA 4G26A 4XYEA 1G9XA 1ZK0A 3RS9A 1H94A 1QG4A 2CDNA 2F8LA 2I99A 3EZGA 4GOOD 3JY6A 4J1TC 2CEKA 5E95A 3IUYA 2AXPA 2WF8A 2X0NA 5ESRA 1GAQA 1D1QA 3GJ3A 2QP3A 4KMSA 1NUQA 4INZA 4OM7A 4PBRA 4BFXA 4GE0A 1IXYA 4TYWA 5AQ1A 3GYGA 4J0JA 1I2MA 3IXLA 1NXPA 5FOUA 2Y0CA 1BS1A 3DT9A 5LD2C 2BEVA 1IJFA 4CEJA 5KHOC 3L8MA 1XTTA 3T9CA 4CKBB 1N2HA 2VYVA 4EKYA 2O8FB 2ADFA 1PJRA 2EBWA 4R0NA 1QIHA 5CVVA 3GFFA 3B36A 1VHTA 2BGUA 3DYVA 2WA1A 4HLDA 4J7UA 4NMWA 1BS9A 1RXUA 4JHLA 3VSCA 3RREA 2D3TA 2YYYA 3R0VA 3S55A 1CQPA 5MN5A 3FTFA 1SY7A 3FWNA 3QVUA 2JGLA 4JGBA 4P4GA 4LYYA 3DOIA 4A6EA 1WD7A 5DV9A 3ZXXA 3QXCA 4KE7A 4PN3A 4PC7A 3ROMA 3VO2A 3BK7A 3H9EO 1GYQA 1P7CA 1V26A 2LIVA 1D0SA 3F1LA 1E2FA 2G63A 4QJBA 4XVHA 1MEOA 2CLDX 1E9BA 1OZGA 4ZOLA 3VV2A 2PUCA 3QU2A 4D6PA 2TMYA 2XKKA 1LV7A 1UM8A 3IV7A 2ZSBA 1L4NA 4C30A 3HYTA 4G1MB 4IJVA 4DAEA 5G0SA 4CLOA 1FX0B 3H5AA 3FRJA 4L8VA 1EFVA 1NC3A 4RVUA 1EYZA 2ODQA 3AM4A 1NVKA 3GO4A 4HY3A 1IM2A 4UOZA 1NQXA 2FU5C 2GTHA 4BZXA 2NSJA 4MVWA 4FSDA 4CIDA 4BS9A 3CZ5A 3KC2A 1E1CB 1L8LA 4P7GA 2W5UA 4E51A 1WMSA 1P2FA 1PT7A 3G0DA 1OFIA 5JE8A 4EGAA 1EGMB 2NW6A 3NEYA 1CHDA 4B32A 4A0GA 3FM9A 3JASB 2WJ4A 3VTFA 4YUYA 5F76A 3VR6A 5ESXA 1RC0A 2IYSA 4M37A 4CKXA 4CQMA 1FRFS 5J5CA 4EB3A 4X6YA 1N5LA 1SB8A 3HP1A 4WLEA 4NCIA 4BVEA 1Z0JA 3P9QA 3SYNA 3PXUA 1VHQA 4OXQA 3V8BA 2H11A 1RCTE 3C5WP 4IDBA 5ALJA 3K9BA 3NAMA 4JUAA 4OLJA 5GJVC 2D1RA 3HXMA 2OYRA 3H2YA 2GAAA 4GMHA 4MWDA 1CUDA 2D62A 5EWLA 4H4EA 4A6DA 4RPHA 2ZRDA 1PNTA 1G17A 4CMKA 2UV8A 5EP3A 1VJ0A 3NHJA 2AZ4A 1D9XA 1TU3A 1UP7A 2W2XA 5DK4A 1G8KA 3AT1A 3M9XA 5K0SA 3QBJA 4Z9BA 2B34A 4BRSA 1XXHA 3OX1A 4JJIA 1XKXA 4U7WA 1WZ2A 2WPDA 2JFUA 5AM2A 4EWLA 2M9MA 1U6KA 3L1JA 4OOFA 3SFVA 3V3TA 3VHRA 1RRCA 1S4MA 4O4HF 4AJLA 2R6CA 1K8ZB 3HMKA 3WLNA 4KREA 2FW6A 1KZ4A 1JBKA 4RHFA 2JFYA 2DFVA 3HJCA 1H23A 1E1RA 3ONEA 4B7CA 3WGQA 1A9ZA 4B74A 5MHTA 2CUKA 1ZW6A 4PFKA 3AR8A 4JT8A 5K51A 2EP5A 2ILTA 5SY6A 4M1WA 1AHPA 4S24A 3VKHA 2ZCUA 4XFKA 1TPYA 5BPFA 3I8SA 4ZVLA 3F5DA 2GM5A 4TN5A 3DKPA 4RIHA 4OHVA 1QYDA 1DQPA 5B3KA 4Z4HA 1MDFA 4TV8A 1DBPA 4JJFA 4BU0A 4J6EA 1QNLA 1R6AA 4JBGA 2P67A 2YNMA 3IO5A 2L69A 4KXMA 4DV2B 2R6FA 5K99A 1IM5A 1HDOA 4QXQA 5EZYF 1E3MA 3DB1A 1MR3F 5KHLB 1T91A 1Z0AA 5KB3A 3IT3A 3WRXC 2O1SA 2Q9UA 3ZTTA 4PN7A 1NGSA 3PI6A 3FOFC 3MMZA 2O48X 3DNFA 2GFIA 1RBMA 2ODAA 4LWQA 3FYTA 1FSZA 1XU9A 3DWFA 1X8LA 2V7PA 2VJMB 2W2KB 3KVNA 3PICA 5IDQA 1U0EA 5G1OA 1AQNA 1OXUA 1XU4A 1N1DA 3RTDA 4U2DA 5DP2A 5SZJA 1IIRA 2BD0A 3CWCA 1TYEB 1NN5A 3GVHA 1W1IA 5H81A 1CYEA 1OFUA 2MWMA 4BMVA 1B2LA 4AO6A 4L0QA 4F9FA 4ZYXA 2ZAOA 2GNPA 3KOXA 4CT5A 4KHZA 2V55B 2WHEA 5KZMB 2WICA 4C7JA 3JQ8A 4ZIRB 3H2HA 4RADA 2JFPA 3T3PB 3UYLA 3O8LA 1KH3A 1J2TA 2NU8B 5DGCA 2UYOA 4LFCB 3D0QA 1P39A 3ENKA 3PKZA 4NONA 1AKWA 1J0AA 1QV9A 5ES3A 4GLFA 1GJRA 3CB2A 3ER9A 3EH2A 1ZLYA 3FGZA 5DNEA 3C3JA 4MKRA 1JDPA 1P2DA 3JQQA 3A2LA 5A71A 3V4RA 2D2VA 1O5OA 4JELA 1V16B 5BQ3A 5FLKA 2IZ1A 2VT7A 3AP1A 4HNQA 1F60A 2ZG6A 1Q17A 3CMCO 5B37A 3S3TA 1Y3DE 5CX4A 3GMSA 4J43A 3U9LA 5B1DA 5FI1B 1HTWA 3M7IA 4FC6A 1SU4A 3RKUA 4DW8A 3PQ3A 3N76A 4BNHA 2W70A 4KDRA 2V7BA 4ZVVA 5C46F 1KAGA 4I99A 2AH5A 4MA0A 1JFFA 1SEVA 5E6UB 2JCBA 3QY0A 3IJPA 2Q41A 4YRZA 2YY6A 4PTLA 4XEHA 3NC1C 2XTNA 3QNWA 1F6DA 2IOFA 2I4RA 1TA4A 5HCIA 1CQXA 1FBTA 1DQSA 3BL8A 5DP1A 3CH4B 4X92A 1ZGGA 2HPHA 2E87A 1ZDMA 2CXQA 3UC9A 3WWCA 3Q3HA 5A5VA 2J48A 1W52X 3DMDA 2I1VB 2B37A 3Q8WA 5B30A 5AW8A 1NATA 1HYEA 1FX0A 1ZNXA 1K4YA 2VZ9A 2OO3A 4E5VA 4ABTA 4RKWA 2Y67A 4KW7A 1Z8FA 4KPUB 2FEAA 2PT7A 4Q9JA 2ZT6A 3SBXA 1N8KA 4FGLA 4PYKA 2WSSD 2YN4A 3W06A 2FDXA 1NLFA 3RRJA 2A7QA 1ECLA 2JGMA 4X6XA 2HMSA 4JKYA 2I2CA 4AP5A 1JWAB 2QNIA 3G9ZA 2C88A 2FF5A 4QECA 1AF4A 2X4LA 2C3UA 3GMDA 2QHXA 1QRRA 4D26A 5HUHA 3V7UA 3ZKWB 4LXTA 4EHDA 2PX8A 4C87A 1O5TA 2JVIA 1KRWA 2OUKA 3INYA 1OI2A 4FMDF 4PICA 5B3JC 2R5FA 2RHJA 2ZI9A 2VUIB 5HZMA 4RZXA 1GDHA 3NONA 3EVFA 4PG6A 5IM4F 2Y4NA 1DIGA 5CCEA 2JANA 3RYHB 1GG9A 4V1CB 4AN1A 4DQUA 1VMAA 5JZBA 4XYBA 4L5IA 3HN7A 1GZHB 3M3PA 3O8OB 3T5GA 1J39A 5E3HA 1JQ3A 3AF0A 3GBVA 2V0CA 1FP4B 1GPBA 1GNVA 3I42A 5BWOA 1DAHA 2W6NA 5LMCA 2PFKA 4PFJA 1E63A 1S8FA 1ODCA 1B15A 2Q7DA 1UJ4A 3K20A 3Q1KA 4EGQA 4R8RA 4JI5B 1JIIA 4OO3A 1NVVR 1U1FA 2CVQA 1HKHA 1K6MA 3A7DA 3QYPA 3CVUA 4I4CA 4NG5A 2FY8A 5EHQA 2KX7A 4AW9A 1J06A 7REQB 5CNMA 4V0KA 3SBDA 4BZZA 3GAFA 4QFDA 2ZAIA 3FI9A 1GDTA 4CKWB 2W6MA 3DT8A 2PMBA 3HWX1 3JARB 3UT5A 2A1UB 4PLFA 2NSYA 2XWBF 2ZDHA 3QK7A 4QO8A 2C4VA 1AK1A 1CIJA 1MF7A 2OHFA 2FEWB 3DV9A 3OQ1A 3PFFA 5ALYA 1N7HA 4UM7A 4ID3A 3T6KA 1S96A 5TPWA 3S8EA 3C85A 4EHBA 4BQNA 2NPOA 5LBTA 4KUEA 1Q0PA 3K2BA 5SZKB 3PGLA 4PCUA 1TGYA 3VKFA 4L02A 2DX7A 3I6YA 3OOYA 3OZFA 5M2QA 1XNRB 1GIAA 2YXNA 1U3VA 3GLHA 2POQX 4HPXB 1X13A 1GG8A 4JU8A 2NQ8A 4PU0A 3NGLA 3IVGA 2BEVB 1XRQA 5F35A 2ZIGA 3QVJA 4JYCA 4C5AA 4CLEA 3TNJA 1PYGA 4H6XA 4IHAA 1DQNA 1IWPB 2YIDA 4LX0A 1C7QA 3PITA 4UVIA 5D01A 1QH0A 3H5IA 3QLEA 5AJHA 5AXAA 2OMEA 4Q19A 2H54A 3AERB 1FFEA 3WFIA 3P27A 4BJ1A 4I9GA 1F0YA 1FS5A 4MQMA 3SIPA 1NFQA 1RZ3A 4EW6A 4BMYA 3PQCA 2J3DA 3G2LA 2NUTA 4EL0A 2CMDA 3CH7A 3EPPA 1FFSA 2EFGA 2IHKA 3M5PA 5ALHA 4OOEA 4W9MC 2AW3A 3IMKA 4Q03A 3TK1A 1JR4A 4KVFA 4BLQA 3W3AA 3LTNC 4Y2QA 3JAWA 2G5TA 3NW9A 3NBUA 1E3IA 4KFRA 3PJRA 4HNAB 1A3CA 4D81A 2XA2A 3JWHA 5I7VA 1JL3A 1KNXA 4LTNA 1X77A 1TIPA 4GR9A 2VJPA 4ZKEA 4WN3A 4HXGA 1KDOA 1UZNA 2RH9B 3QMVA 4KR0A 4P82A 1L5HA 4ARZB 2BDTA 2ZUEA 3VDXA 2UYHA 4NFYA 3S0JA 5EWMA 2JCVA 5J5AA 3DXFA 2RGYA 3F3SA 3OZ7A 4CTJA 4J94A 4DSZA 5MFPA 5BSFA 1U2TA 2GAIA 4W63A 2A5DA 2WNSA 2FEOA 1Y6RA 1I3CA 4NS4A 3TSYA 3ILXA 1WO8A 4OU4A 3H2GA 4WNAB 4JV5B 3BCHA 3DTYA 1KK1A 1E7SA 2XAUA 2C31A 3WLIA 3HN2A 4IDFA 4XPZA 4C5CA 3IXMA 4HWSA 1DEXA 2A94A 4P7KA 1M1ZA 1XLTC 1CB0A 3KZXA 3OZRA 1E9SA 5K0TA 1LJLA 1MKYA 1Y5IA 4C4SA 3HKDA 4IIVA 3KOZA 4G4JA 3Q40A 2JRCA 2M32A 2QDXA 3RUPA 1UXKA 2A1TS 2QRPA 1XXLA 3C3CA 3QTLA 4YI5A 3RVPA 3RAFC 1FRQA 3MT0A 2JZOA 4KXYA 5TLSA 1EP3B 1S9HA 4DQKA 1EK5A 1BXRB 4NCKA 2EKDA 3LNTA 4LNUA 3QFSA 2C07A 3H87A 2P4EA 4GNKA 4DADA 3BC1A 2HQ1A 3GHHA 1EP9A 3K8OE 4R83A 2RGGA 4RXUA 2C54A 2R4TA 2I7XA 4R8KA 4B45A 2YMQA 2WF5A 2H48A 4TXMA 1EHCA 1CB7A 4IGFA 2DR2A 5KHAA 2GKGA 2I54A 2GHQA 2I4NA 4GM4A 4KHPB 2W6PA 4N47A 2IS2A 4C08A 3MWDB 4HNSA 4XEUA 2V74B 2R8OA 3KAJA 4KK3A 1W5FA 2QYTA 3ZYZA 1G55A 5TF0A 2XNJA 4DDMA 1AKUA 1HLDA 3GFGA 3KXIA 3FBTA 3IBSA 4J1NA 1EDOA 1FX1A 2FFAA 3MWYW 1QPGA 4CM8B 3K2IA 4GBMA 1TECE 1QGED 3MTAA 3P26A 2JFZA 1DHTA 4HKTA 3ZGYA 2K5UA 3OPYI 3R7WB 1VSTA 2AUTA 4A1OA 2VJQA 3W6OA 2FMHA 2BHRA 1XPRA 5AW0A 5KYTA 3ZE2B 1XZAA 2ZTVA 4GU5A 3WAGA 4Z51A 1ZI6A 2WHYA 3AUKA 4MPDA 2LGJA 4PAGA 2QN9A 3WJ1A 3HYCA 4FKZA 3T7IA 2JGNA