1MRNA

Crystal structure of mycobacterium tuberculosis thymidylate kinase complexed with bisubstrate inhibitor (tp5a)
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
208
structure length
208
Chain Sequence
MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAELAGERSRGRAQRDPGRARDNYERDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate Kinase
publication title Enzymatic and structural analysis of inhibitors designed against Mycobacterium tuberculosis thymidylate kinase. New insights into the phosphoryl transfer mechanism.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 75
structure length 208
sequence length 208
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2002-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1mrnA00
3UWKA 5DN6D 3UK6A 4LK2A 5JJKA 2UKDA 4IXNA 2WJYA 4TMVA 5FPSA 1VECA 2ORWA 4IKEA 4C0HA 5K8TA 1SKQA 2JJ1D 4M0LA 2O8BA 2OZEA 2G1KA 3CW2A 5HKKD 2FZLA 3IQXA 2GAOA 4O2RA 4KODA 1KNXA 3MJHA 3KJIA 1L7VC 4R2IA 2F3RA 4EPVA 2XAUA 4IJMA 1W0JA 4DLVA 2RGNA 1CF4A 2WWFA 4RZUA 3A4LA 1P2UA 1VDZA 3U3OA 3V00A 2IBMA 2ZUBA 1WQ1R 4V0ME 1M7GA 4W5WA 4EUNA 5J4VA 1IN6A 3LBHA 4CW7A 4D81A 3ZLJA 5DIFA 1VCIA 4IDQA 3HPRA 4ASUA 4TMXA 4P32A 3PUYA 4MRRA 3NTUA 4DCSA 3B6EA 1G6OA 2ZJ5A 4V0MA 5C46F 3ZVNA 3QSYA 3AF4A 1GRQA 2HDNB 1Z8FA 3LD9A 3MG9A 1RZ3A 1Z6YA 4JT4A 1C9KA 4JJKA 5KDLA 1ESMA 4B35A 4IW3B 2H57A 2CJWB 3AF0A 3QQ5A 5LD2B 2O8DA 2AKAB 2JJ8A 3MWYW 1GG2A 3TH5A 2X1VA 1CIPA 5FBQB 5KNBA 5E7MA 2OBNA 1G41A 2BCGY 3OIVA 3W6PA 3K70B 1LS1A 2GCOA 4PSVA 3ZJYA 3UMFA 1GZSA 2Z4SA 4L5BA 3MMPA 4GMXA 4HAVA 4ZPXA 1ZU4A 3AVOA 4BFUA 1SVIA 2JLUA 2OV2A 1NVXQ 4HAYA 4I1VA 3X1DA 1NBMA 3HYTA 1SVOA 1W5TA 3U3MA 4DLXA 2A2ZA 4JZKA 2A5DA 1XPUA 3PXGA 5JHGB 2YZ2A 5HZHA 4B6EA 3TNFA 1N0UA 2D2EA 4XVUA 1VIAA 4BEBA 2P5TB 3TJZA 5G3ZA 2FPLA 2BWJA 5BYJA 1OFHA 4MGYR 5JSZB 3SYLA 2F9MA 4NBSA 3B1VA 4TZ0A 4W5HA 1E4VA 1N5LA 1E98A 3QJYA 4BE7B 2EFGA 1EGAA 2YINC 5C1BA 4C9BA 2ZYWX 1XJQA 2ZEJA 1VCOA 221PA 1JEDA 1YZNA 3ZD7A 3U3RA 3RAPR 4MKIA 2VQSA 4PXAA 4DCNA 1G3QA 4QM7A 1KOFA 3L0OA 2IHYA 4MRVA 4FN5A 4ZDKA 3BB3A 4KO8A 4HI0E 2EWWA 2OCYC 5AJVB 2WJGA 2REOA 4XSHA 1EFUA 4DWJA 1R8QA 2GXQA 2ZU6A 5J47A 1EFCA 3AUXA 4DLRA 2WSSD 2QM8A 1NJGA 1P2TA 2DYKA 3A4NA 3AVTA 1XXHE 1KKMA 1Q21A 4DIEA 1W4BA 4YMSA 1IN7A 1W44A 4A6XA 1H8ED 3SYNA 5J40A 2NPIA 5KDDA 4QM6A 4JLKA 2CCJA 2O8CB 2NG1A 3BORA 2ORVA 4RFSA 3TR0A 4DHEA 4RFVA 1XXHA 1KJYA 4TLCA 3AKYA 4LBYA 4CZ2A 2QQ0A 3DEFA 1CR4A 3M0EA 4NZYA 1AS2A 2DFKB 1F48A 2F43B 1LV7A 2FGKA 4EPXA 1CULC 2FEOA 3F8TA 3HU3A 4GBMA 4Q1CA 4FMDF 3X1YA 2CK3A 4NYIR 3C7KA 4LDJA 1IN8A 1RE0A 1PV4A 2Z5FA 2EU8A 4GZMA 3V9PA 2IS2A 1SQ5A 2BIFA 5CYOA 1TMKA 2OXRA 2EYQA 4M1OA 2QG6A 1OF1A 3OFND 4TT3A 1LTQA 3UXMA 2QNRA 5E4FA 4DVGA 3I5XA 5TVKA 1U8YA 3TAHA 1FQJA 3KFXA 1X6VA 3RS4A 2DHRA 4TL8A 4L15A 1ZUHA 3A8TA 2ZAMA 5CLLA 4XOIA 1SVSA 1KI3A 2J0UB 1NKTA 4TLDA 3EW9A 1KKLA 4QNMA 4BZQA 3QXSA 4Q4HB 4XVQA 3TGPA 1TQ6A 2WKQA 3PEVA 3ZIAD 2QZ4A 4DSTA 1WMSA 3BBPA 2IXEA 1HE8B 2ZUCA 1G18A 1FOEB 1GKIA 3IIKA 4A4DA 3CH5A 2IYVA 2EVWX 3PJRA 2QORA 5DISB 2JLQA 2H1LA 3THYA 1E1QD 1FX0B 2BDTA 3BGWA 3AKEA 4BEJA 1KSGA 1ZINA 1B23P 3IEVA 2O0KA 4IEIA 4UNQA 1FZQA 2GESA 3WHLA 3CRVA 1TQDA 4TZ6A 2IW3A 3MAAC 2IYXA 4E03A 1DO2A 2C9YA 1E2JA 1G17A 2ERYA 1JAHA 2QN6A 5JRZA 2RAPA 2OT3B 2X8AA 1RYFA 3O8RA 3FMPB 1U2RA 6Q21A 3EZ7A 1XCMA 1G1MA 4XVRA 4B34A 5JLJA 3CR7A 2BMDA 1EK0A 1NVVR 4DT1B 3K0EA 3TKLA 1IXRC 4L16A 4DSUA 4EPYA 5FUVA 2GEDA 5SZKB 1L2TA 2GCPA 3REFA 4GSYA 5SZHB 4A8JC 4IOKA 2AWOA 5EUMA 4KU4A 5K8IA 1WE2A 1E3MA 1TPZA 2KSQA 4KXFB 4D2IA 4R71A 3BS4A 3ZQ6A 4TQ9A 2EFCB 3SFZA 1WB9A 1JB1A 2IUUA 1Q1QA 4OHWA 3DPUA 2ZYUX 4GOKA 3JZAA 3SC3A 2BBOA 2F6RA 1Y63A 4IFEA 3FHOA 5AUNB 4YMVA 3CNLA 3K0SA 3U4QA 1A1VA 2EW1A 4A2PA 4BASA 3D31A 4C0KA 2J5XA 2ZSFA 4JLNA 4ESHA 4I4LA 2FN4A 4C7OB 3HP1A 4WA7A 2BBTA 2CVHA 3QE0A 5EP4A 2C77A 4POAA 3NBZC 5P21A 2OFOA 4NU0A 3W8RA 3C15C 2IYZA 4AI6A 3LLUA 4Q7KA 5LB2A 4BFZA 3OAAA 3LVRE 2JLYA 1GKYA 5H68A 2YWGA 2NGRA 4NHOA 4LHWA 5A4JA 1G3UA 4ARZA 5KNDA 2W2VA 4ZKDA 3QXXA 4A8JA 1TU3A 1HY3A 3F0TA 1E9BA 4D6PA 1ZM9A 4CDGA 2F9LA 4P31A 3PFIA 4BFXA 3I92A 4LYAA 3TLXA 3GLFE 1D2MA 1O87A 1ZYUA 1MABB 1XEXB 1QHIA 3AP2A 1L4UA 4TYNA 2QRNA 2N1BA 1A4RA 1CTQA 1X86B 3CRMA 2WAYA 3GLFA 1E69A 4LZZA 4S35A 3OHMA 3R9WA 4OI0A 4PSAA 1OFUX 3B1XA 2ODEA 1KIMA 2REXB 2AX4A 3WMEA 3THWB 4GZLA 1KO7A 3AP1A 3C5HA 1AGRA 4HAUA 5C2JB 5JJLA 4AKEA 4PO8A 1G6HA 4BLOA 2H92A 3DMNA 4JVMA 4MYCA 1E9DA 4PQYA 3ND9A 2WSMA 1KI8A 1T3SA 4HYYA 1ZU5A 1Z28A 1IN4A 3C4JA 1KY2A 2F1IA 2XB2A 5KSZA 2PZFA 4TQUS 3VFDA 3CNOA 3IBYA 4V03A 1K5DA 1NN3A 1DAGA 2HCJB 4Q03A 1T0HB 1UEIA 4QRHA 5FOVA 4QOSA 4US2R 2JIZD 2ZVQX 1WCV1 3I5YA 2NO9A 1M34E 3SJCA 5BN5A 2VP6A 2OEPA 3ECCA 3Q85A 3MWJA 3T5GA 4RZ2A 2H17A 5EUQB 1R5NA 4QFMA 4XJXA 2A5GA 5JMTA 2ZR7A 2FH5B 3FDIA 1G5RA 1GNRA 1VKJA 2FSIA 3QKTA 3K0CC 3ZVLA 3UPUA 2QBYA 1NSTA 3MWLA 1NMXA 2V7QD 5TDHA 4AG5A 2PCJA 2W0MA 3WRYC 4BUJA 3K9HA 1KMHB 2QPOA 1OYYA 4QGHA 5G41A 2OO7A 2H5EA 2OXCA 3QKSA 3BFKA 2LKCA 3UMRA 3W3ZB 4A15A 2CNWA 3WP0A 1TNDA 2AXNA 2JASA 3R7WB 2CLDX 3I32A 4P33A 3GLGA 3WYFA 3VTKA 4HLUC 1RRFA 4G01B 3VKHA 2WAXA 1W46A 3K0AA 1KY3A 3QG1A 3W8NA 3ADDA 5CIQA 2FA9A 2Q3HA 2ZIAA 3BFVA 1VG8A 4QGGA 2O0HA 1ZM3A 3CF0A 5IK2A 5JS7A 2IEZA 2ZTSA 1RVDA 2UZIR 5L3QA 1SXJB 5EP2A 2KJQA 4M9ZA 3AVUA 4AYWA 5H8WA 3B82A 8OHMA 3EWSA 2WMNB 1E9CA 1WP9A 2QAJA 3DZDA 1W0JD 3I8SA 2OE2A 2QAGA 3KQHA 1OV4A 3T34A 2DPXA 4C0JA 4Q4AA 2C04A 4DLWA 3M1IA 4OK3A 1XMJA 1IY2A 4KYUA 3EASA 2ZE8A 2GF0A 3NEYA 2WJHA 4F7WA 4AK9A 4N0EA 2D7CA 2HXYA 5HE9A 4X8LA 3QXHA 5KPJA 1G7CA 2V9PA 5JWOA 2FX3A 1NG9A 3W34A 2GTPA 1DE0A 3I73A 4HLUA 3W6NA 1P7CA 2V8OA 3D6TB 4G5SA 1E2EA 4M9QA 1UBEA 4HB3A 1XB2A 3C16C 1ZJ6A 2BMEA 2JCSA 3E5HA 3WP1B 1Z6XA 3UKDA 4NPHA 4PAQA 4IDHA 2ODNA 2ZYTX 3BB1A 4I1SA 4Q4LA 4XTCS 3SYKA 3T35A 2WWHA 4UXJA 5FTMA 1NBMD 1F2TB 3CF6R 2QGZA 3LDAA 1WDTA 3NH6A 2GXUA 2FFAA 4LJ5A 1VCNA 3PR1A 2V6JA 1XEFA 1N0WA 4TTRA 2A5JA 3THOA 1NVUQ 1JJVA 2NO1A 1XJ0A 3ADCA 3D8BA 1SGWA 4NL4H 2B21A 4ZDIA 4PHTA 3SU8A 1SVKA 4LBZA 2R8RA 3DMDA 1BS1A 3BAFA 3KKPA 3P26A 2PMKA 4PPGA 2NPFA 1FP6A 5JFGA 5CIWA 1W36C 3T1OA 4YMUA 2OG2A 5GJWC 3AF1A 4B33A 4HDCA 2OCAA 4XWAA 3U3JA 1JEEA 3WNBA 1W7AA 2WOOA 3QF4A 1Z2AA 3SS8A 4HUQA 1BMFD 1AQYA 3FTQA 2C9OA 4KVAA 3B1ZA 3QXJA 4B74A 3HU1A 4TYYA 3FGNA 3LLMA 4ZCMA 4BLTA 3CWQA 2VPPA 4EPTA 2PJRA 2C78A 3TQFA 4US0R 2ATXA 2G3YA 3CRRA 2YV5A 4I81A 4WZ6A 4CEIB 2BOVA 1TQ4A 2KI5A 2QTFA 2D06A 1W2GA 3RS3A 3QBTA 4EFMA 3U5ZB 2IHBA 3GLIB 4URZR 3U44A 2EQBA 2JDIA 4CEJB 1EFHA 1XBTA 3KZ1E 4DSOA 3TUZC 2QY9A 1X1RA 1TF2A 4AYTA 4D4KA 4MKHA 2IYLD 2YKGA 4PQFA 3EA5A 3RRZA 4AKGA 3LW7A 3A1UA 1VHLA 1E9EA 2JLXA 4B3CA 1W1WA 2IK8A 5L3SA 5FTKA 1S3GA 1UPTA 3VAAA 2QROA 1T5IA 1TTTA 5CK4A 1NNEA 4TT3D 4PO1A 1Q22A 3PUWA 3RLFA 1W0KA 2NMVA 4NONA 4KSBA 2VH5R 4H1VA 3UG6A 2TMKA 1UBCA 3RDPA 4DKXA 4CEHB 2FG5A 3RHFA 1JI0A 2J1LA 1DTSA 4QXAA 3SBEA 1G21E 3FE2A 5HTKA 3RC8A 4IXMA 4JIMA 2YVUA 4OQLA 2GXAA 5JI3E 4ILEA 3FFAA 1GL7A 1E4YA 1GRRA 3QXCA 4DIDA 3PQCA 1XNJA 2GBLC 1ZP6A 4QHYA 1ONBA 4EQ6A 1JJ7A 2GK6A 3RS0A 5KDOA 3LQRA 3BE4A 1LVGA 4KFUA 3I62A 1OH5A 2ZQ5A 3Q5DA 1YQTA 4BFWA 4URXR 4EJSA 3PUXA 5FTJA 3PEYA 2GZHA 2BJWA 1OH6A 4UNRA 2FGJA 4TLBA 4DBLC 4HAXA 4AKIA 1E79A 1II9A 2QE7A 4G5RA 4QBFA 2J7KA 4NDZA 1RIFA 2NO6A 2AD1A 2AK3A 4UXHA 4M1TA 3ZZUA 2Q3FA 5FL7A 3AM1A 4NCJA 2VF8A 1MO4A 3ZVRA 2JJ2A 4JLOA 4Y0AA 3R8CA 3FMFA 3IO5A 3RRMA 1JALA 1JPNA 1QHYA 3KUDA 1KDOA 4PPNA 5BW8A 1IXZA 3IDQA 4M1WA 1VYTA 1E6CA 3A36A 4JMPA 3X2SA 1CR0A 4OHXA 5KNCA 4GNKA 4LHXA 3H1TA 3KUCA 4M21A 3B85A 1D2NA 2P3SA 4LBVA 4MKGA 5EP1A 3O8CA 2HJGA 3AVQA 5FPHA 4Q01A 2ZI6A 3QG5A 1OXSC 1VIYA 2GBLA 3SOPA 2GDJA 4TSFA 4P4TA 1IHUA 1Z0IA 3LWNA 2AFHE 4N1AA 5ELXA 3L8ZA 1UFQA 1E2QA 3CX6A 3U7GA 5KUTA 1H8HA 3CPJB 4FCVA 4M53A 3EA0A 1N5JA 1QVRA 3DOFA 4TL6A 3AVWA 2J0QA 1OH8A 2BBSA 4QL3A 5K8UA 1UKZA 5GVSA 1NP6A 4Q4JB 1N6OA 4IVRA 3SZRA 3L0SA 2WWGA 1OXVA 3C5CA 2XXAB 2GKSA 4M1MA 3T1VA 2R6DA 3OAAD 1E2PA 3IGFA 3EAQA 4B2LA 1NMYA 1LS6A 3MJRA 2FSHA 3GJ0A 1V43A 5M04A 1KZGB 1KMQA 2IUSA 2E87A 1MH1A 4URUR 1MOZA 3I61A 4QBIA 1ZCBA 4BFYA 2D62A 1NLYA 3AH8A 1DAKA 2YNMA 4E09A 1YR9A 2WIBA 2RB4A 4Q66C 2VF7A 4WVFA 2GILA 2HYIC 1UKEA 2WMOB 5DI9A 2VHQA 2DB3A 2GA8A 3CF2A 3PCRB 5GJVC 3K9NA 4YXWA 4ACAA 1NI3A 1ZNXA 4ZIRB 4UNPA 4A92A 3CX8A 2B6HA 1SVMA 4EFNA 3THXA 4RKFA 3UIEA 4L9SA 2RH5A 1OHHD 5F2EA 3KJEA 2J59A 3B5JA 4D0NA 1CRQA 2LKDA 3LVQE 3QY0A 4M1SA 1AA9A 3K1JA 1ZM7A 2CHVA 2CVFA 3C8UA 2WPDA 1W49A 3NHBA 1AZTA 3QPVA 3TQCA 2V4ZA 4GOJA 2X77A 3TR5A 4Q9IA 3RWOA 1A2BA 3AQ4A 3G82C 3GEHA 2FFQA 1W5SA 5D3MA 5FTLA 1Q1EA 1E9AA 1PLKA 2ZE6A 4AC9A 1N6LA 4ERNA 1M6NA 4CVNA 1ZMXA 2E9SA 4I1OA 2XX3A 3K8YA 5JWHA 3W6OA 3B1WA 1T9HA 3PEWA 3CBQA 2QSYA 5B30A 1N6RA 1OSNA 4AG6A 3PIRA 3P32A 3PG5A 2XNDA 1Z0JA 1NF3A 3OESA 3VU9B 4DCTA 5B57C 2IYRA 4RY2A 3BWDD 4B48A 3QUSA 1S96A 4HZUA 4C2TA 5IDVA 4PQRA 1VYVA 4NYMR 4B6FA 3BOSA 2BBWA 4BLQA 1U0HC 3PENA 2CHGA 5CK5A 1IJFA 1QRAA 4EFLA 2JLVA 1I4LD 1GSIA 4B75A 4CYMA 5CB8A 1F3OA 5JEEA 1ZM4A 1GKUB 1R2QA 2AHOA 1UADA 2MMGA 2GJAA 1CR2A 1GDDA 2VP9A 2XJ4A 2VHCA 2QP9X 3SJZA 2BEKA 2HT6A 2OAP1 121PA 1N6NA 1H65A 2VA8A 3BD9A 3MCAA 1WRBA 2CNWD 3F3YA 1NN5A 2F1HA 1NJFA 3BC1A 3QKRB 2SHKA 3LH5A 1ZNZA 4QJ5A 2I3BA 3SJAA 3UG7A 4G3XA 4OJQA 3ADKA 1A7JA 2ZRPA 5FR1A 3UANA 1TAGA 3QVVA 3IO3A 2JLWA 4WXRA 1T4GA 1EXMA 5IK2D 1N6PA 5DI3A 1QHNA 2ZRBA 4TMWA 3REGA 4B44A 1EFTA 3ZQJA 1Q3HA 2J3EA 2W6IA 2GWHA 4GOXA 1X8LA 1SVLA 1G8PA 2ZVPX 3GFPA 3KX2A 1UF9A 4NCHA 3T1TA 3EIEA 3H0KA 2GK7A 2YC4C 4PO9A 2XGJA 2QSZA 4C0AC 3ZZTA 2RCNA 1XTSA 1DG3A 3Q7PA 4YQFA 1F5NA 5AJYA 1YZGA 1P6XA 2IT1A 1Z6AA 2Q6TA 1IQPA 4R7ZA 1A2KC 2ZJBA 4JLDA 4YONB 1PUIA 3SEAA 4Q9LA 3T06B 2BM1A 4NTZA 1U0JA 1Z0KA 2QGNA 1G5TA 2G6BA 2O8FB 2Z6VA 1G20E 3BIFA 2OBMA 3EX7C 1FMJA 4LHZA 3T5DA 3CO5A 1OB2A 1NSFA 5J4KA 3S1AA 4LYFA 1A5TA 3Q3JB 4P4SA 1QHHA 3GLHE 5DYIA 1YVDA 2XOKA 1SXJC 2QT1A 5HR5A 4KFTA 2Q9AA 4PPQA 3VR1A 2CDNA 3L0IB 1KZ7B 1GNPA 5JECA 4U5XA 1RRGA 3GLHA 3NG1A 4BGDA 3CRQA 4B76A 2BMJA 3AEZA 4PC3A 3N70A 2XTNA 1R6BX 3EZ2A 4OL0A 5FOXA 1S4QA 2FV8A 2AXPA 1KK2A 1XTJA 3B9PA 3ZDQA 3PUVA 2O8BB 2OUKA 3AKCA 3N5CA 3FKSD 2IYSA 1E2GA 1ZD8A 2A7QA 1B0UA 5DLQC 3B7GA 5EXTA 2HEIA 2Q9CA 1G64A 3R7WA 3CB4A 1I4DD 3I72A 2Q9BA 2BEJA 1G8HA 4B3FX 2W83A 1GOTA 1SXJE 3U7EB 1TADA 1PUJA 3IILA 1EFRA 1A82A 1EESA 2P6RA 4PSKA 5GJCA 1KI9A 3VNVA 3OEEA 4A36A 3GCGA 5GJBA 4JL5A 4R2HA 1HE1C 4Q9KA 4FI3C 1EWRA 4BFTA 3ADBA 1OH7A 4BWYA 1SXJA 2PBRA 5F3WB 4PC1A 3K0FA 1E32A 3BERA 1U8ZA 2YWHA 1P2SA 2W2XA 4LOAA 1E1RA 1J2JA 2VP5A 4IFBA 4RD6A 2ZAOA 3NC1C 4D0LB 1VMAA 3KTAA 4QHSA 3C14C 2X2FA 3KQNA 4D4MA 1FQKA 2PZEA 4TMKA 4UKDA 1XEWX 2JDID 1I2DA 1PLJA 4IOJA 2J7PA 5AUPB 1OE0A 1VG9B 4P0TA 4Q1FA 1CXZA 3IHWA 2GCOB 5K8LA 5EE1A 1W47A 1P4SA 1QHXA 4O2LA 2OFWA 4MYUA 5BXQC 1JR3E 1W36D 3LX8A 3B78A 4AKHA 3AKDA 1KDTA 2H18A 1RRCA 4CRWB 4XWOA 4XWKA 2C5LA 1KK3A 3X1ZA 3A1VA 4KHZA 1N0VC 4IVQA 1GILA 1U0LA 1W0KD 2EWVA 2OCPA 2K5UA 4Q5IA 2VHJA 2D3WA 2Y8EA 2VRWA 4B71A 1O3YA 3LXRA 2C96A 3NDBB 4AURA 2ZRFA 3EPLA 2GVDC 2CL7X 1JECA 1J8YF 2Q0HA 4AD8A 2WVJA 1AIPA 2AD5A 2PEZA 3HR7A 2FE4A 3KFVA 4C0QC 1YZQA 4DDWA 3QBVA 3FMOB 1KJWA 2B8TA 3SJBA 3A37A 1BOFA 1X3SA 4E5UA 1US8A 2HF8A 2VYFA 2G0TA 4F91B 1RFLA 4F92B 2J0SA 3RSLA 1KDPA 2PCLA 4JSYA 3WRXC 4CT5A 1GIAA 2PT7A 5HKKA 2QP4A 1CJUC 2CBZA 5TXGA 5LPNA 3B8HA 4WW0A 3W3AA 3CR8A 1NN0A 1UEJA 3CNNA 2YWEA 1R0ZA 1E2FA 3EPHA 3MD0A 2EFEB 1QG4A 1OIVA 1ZNWA 4JLMA 2B7BA 4C2UA 2J46A 4Q47A 3ZS8A 5TB5A 4C30A 2FDCA 1G9XA 3A6PC 1E79D 2MSCB 4HAZA 5E95A 3CRW1 2FNAA 4RFSB 2VP0A 4PHFA 3ZVMA 3MWKA 4YDHB 1J99A 5FI0B 1P2VA 5LDDC 4R98A 2YWFA 2JJ2D 1XD2A 2XTMA 3A1TA 5TV2A 1CR1A 4LJ4A 1E2MA 2BKUA 3VKWA 2G0NA 1N6KA 2YHSA 3DL0A 4FD2A 5DO9A 4US1R 2F7SA 1RRPA 3BH7A 2PMDA 3EARA 4CEIA 5FOWA 4TL7A 1D9XA 2GJSA 1X8JA 5FBWB 3W90A 3CWZA 1NIJA 3VR2A 4TSFD 4KVGA 2WWXA 3KKOA 1RJ9B 2P65A 4Q1AA 1SHKA 2IF0A 2WWYA 1Z3IX 1DBSA 1IY1A 3TIFA 3IBGA 2YJTD 2FF7A 2CE2X 1FFHA 5C4GB 1H8HD 4MDEA 4PAMA 1KHTA 4W7SA 2Z83A 2V54A 4LJ6A 4P3YA 4A0HA 1V5WA 2IA5A 1N6HA 5JCZA 3RS5A 1GTVA 2XEXA 3N2IA 2IWRA 3NDPA 4OQFA 1XPRA 521PA 1FNMA 1ZAKA 4HB4A 2ZITA 2ANBA 2R62A 2IEYA 4Q7MB 2AR7A 1IM2A 4CF7A 4XD7A 4I99A 4JS0A 4FW9A 3WNDA 2QTVB 4LV8B 3W5JA 4BFVA 4TTPA 3D3QA 3G5UA 4JBXA 1E0KA 3CPEA 1G291 1SKYB 3RVBA 2H16A 3THYB 4X8MA 4M2LA 5AK0A 1I4TD 1XF9A 3EIHA 4HB0A 4M4SA 3LV8A 4NP6A 1VG0B 3K9LA 4B3BA 3AF3A 3A4MA 3CKLA 4TWZA 1R0XA 2JEOA 2WKPA 1Z5ZA 2D74A 4ESVA 3Q7QA 4E22A 2P2LA 4YXWD 2ORIA 3K0CA 3B1YA 3BFXA 1OT3A 2NIPA 2ZJ8A 3OEHA 3SBDA 4BQSA 5FFMA 1J7KA 3B9QA 4RSGA 1KI6A 2OBLA 2UVQA 4LX0A 821PA 3FHTA 1W4RA 3SQWA 5AJWA 1P60A 4ASUD 1XZPA 5HZKA 2C8VA 1NLZA 2GVZC 5A0FA 2WPDD 3FWYA 2OCBA 1UKYA 1II0A 3I4LA 3MGCA 4DCVA 4B3GA 3B60A 5FUXA 1DVRA 1U94A 1QHSA 1ZIOA 4HB2A 4U02A 5J4YA 5JCPA 2PX0A 4OI1A 3WNCA 2ZR9A 4TLEA 4JKYA 1U8AA 2VTKA 1M1YE 2B7CA 2CLSA 2ZRLA 2AN9A 4A9AA 3QIAA 3IPYA 1YR7A 3WHKA 2O8EA 1T3HA 3ICQB 2OFXA 3OIUA 1COWA 2ZYVX 5EXSA 2UZ3A 4LC0A 3LO5A 3LRPA 3HJNA 3F5FA 2G88A 4RZXA 2KBFA 1IJEA 2XNDD 4DSNA 2GNOA 1S3SA 2C03A 5IHPA 2BC9A 3OFNA 2DBYA 4TN1A 4PTLA 4QJ4A 5LBIA 1G4UR 1ZNYA 1UAAA 1KI2A 3DOEA 1IN5A 4KAXA 1YZTA 4GFDA 4KI0A 3GJ7A 4ARZB 2B92A 3IPXA 2BVNA 3CZPA 1YHNA 3GJ5A 2QMEA 3EG5A 3TK1A 4A8JB 4R9UC 421PA 4V02A 3PV0A 4XH9B 5FPYA 3U6KA 4NCIA 5J4LA 3QNUA 3ZIAA 3LQQA 4JL8A 1HUQA 2VEDA 5TARA 1S0UA 3KKQA 4PZLA 4QGFA 4WXPA 4BRWA 3TW8B 4LHVA 5LD2C 4PX9A 4UXIA 5EE0A 2MSDB 1HTWA 1R5BA 1OIXA 3IEUA 1C1YA 2Q21A 4FWIB 2KBEA 3HYRA 4NH0A 3K70C 2RHDA 5TMPA 4FMDB 1EX7A 4URYR 1IAQA 5FTNA 1XJCA 2RGAA 4P4UA 1Q3TA 1LB1B 1QDEA 4KBFA 4U7DA 3NKVA 1ZD1A 1FNNA 1T3LA 3NIBA 5JRJA 5KOYA 3SI7A 4C3ZA 4Z8YA 3EIQA 3IQWA 3NH9A 1R4AA 2IS4A 3VX3A 1W48A 2LWIA 3NWJA 2W6ID 2YOGA 4HZIA 1JXOA 4DB4A 2WJJA 1JAIA 2V55B 4NYIQ 1KAGA 4TMTA 5H70A 4ZIRA 5B58C 1OW3B 2W6JA 4Q18A 3V4FA 1YR6A 4Q02A 2G77B 3Q9LA 4KLZA 3ICEA 1AN0A 2OLJA 3X1WA 1E9RA 3K53A 1KSFX 1NL3A 4AYXA 4KFSA 3GJ8A 4D80A 5E3HA 4NCKA 3DO6A 5UKDA 1XMSA 4WAUA 3ASYA 2QMHA 2PJZA 2RGXA 1AK2A 4MRPA 5DH9A 3HPQA 2VSOA 2YOFA 2C98A 2CK3D 4GRAA 3CONA 2N46A 4AIIA 2XZPA 2ODWA 3QI2A 2CJWA 2GXSA 2H8KA 1FMLA 1P9RA 5KSPA 1LF5A 4JYBA 4LWZA 2CEAA 1TUIA 4C4PA 3FOZA 3UMSA 3O47A 4IRUB 1E2DA 5CYPA 1JPJA 4JSTA 4WBSA 1AM4D 1C4OA 1UBGA 4TYWA 4LSGA 1WBBA 3N2EA 3B2EA 1GUAA 1QF9A 2B8WA 2ZRDA 2QBYB 4LJ9A 5FUWA 5IRCD 1DAIA 5F9HA 3H2YA 1T5LA 4HDOB 4AWXA 3LNCA 1UDXA 5JS8A 2XOKD 5LB4A 1G7SA 4CT4B 3NBXX 4DUGA 1QG2A 4HLCA 2ZJOA 2W00A 1Z63A 3GJ3A 1BIFA 5JZVA 3GJ4A 5CLQA 4UJ3A 5G3YA 4Z1MA 4RJLA 2HF9A 4W5JA 1XPOA 4G5OA 2V3CC 3RC3A 1S1MA 4D4JA 3GLGB 3QKUA 1OKKA 3KJGA 3VNUA 1XDBA 1CJVC 3TUIC 4JLAA 5JSZA 1FUUA 2VIIA 3MSXA 2AFIE 1L8QA 4GI7A 3SFVA 4D82A 4ZCIA 2J0VA 1Q1BA 1OXXK 1AQUA 1ZIPA 4PZYA 1TUEA 4DC9A 4A2WA 1NVVQ 1BYUA 1KK1A 4V0OA 4TTQA 5L3QB 3W5IA 5HCNA 2OM2A 4A0GA 2XZLA 2GAAA 2AK2A 1II8B 3NC0C 2AKYA 3DKPA 1FTNA 1U99A 2QAGB 4M9XA 4QC2A 1EFRD 4GP6A 4N0DA 3CH4B 4NKRA 4Q4AB 5KSYA 1U98A 2WM9B 1SXJD 2VHTA 3OF5A 2ZJ2A 4LYHA 1P72A 2ODBA 4A1FA 2O8CA 2FFHA 1OYWA 2O52A 1MO3A 1E1RD 2ZSDA 3OZXA 4KITB 1DEKA 2HV8A 3ZD6A 2REBA 3TUJC 1P62B 3V4RA 4Q48A 1GAJA 2WOJA 4ZV4A 1S9DA 2RGDA 4XSGA 1E96A 1TU4A 2J7PD 2F43A 2F55A 2ZSAA 3W9YA 2ZM5A 2QA5A 2QMOA 3VHXA 4WZBE 3QPUA 5BWMA 1G3MA 2RGBA 2V1UA 2W0SA 1G19A 4LY6A 1XD8A 4OK6A 4OQMA 1YU9A 1DELA 1XCGB 2HCBA 5FBVB 1G16A 2IUTA 2PLFA 1X8KA 3P20A 2O8FA 2EYUA 2W58A 3WXMA 2J87A 1SULA 1Z29A 2RGNC 3LFUA 2RHMA 2LCFA 1W4CA 2VP4A 4MH0R 2BHRA 2WIAA 1Z6TA 5FOSA 1GM5A 3I1FA 3KXKA 2ZE5A 4KV9A 5KO2A 4HEJA 5JHHB 3OIYA 5DE3A 1NIPA 4DLSA 2QP3A 2ZI9A 2J0UA 5EZ5A 2A78A 4WZAE 4QHTA 4Q4HA 2GEUA 4GMDA 3WMFA 2DCUA 4Q9HA 2ASEA 1E2LA 2BJVA 3FMIA 5DNYB 4DDUA 2P5SA 1R8SA 1G3RA 4B3DA 1Q0UA 4Y0VA 4IEEA 4OHYA 1S8FA 2WTUA 3GP8A 1OLOA 3QF4B 1FX0A 2GETA 2HXSA 2P6UA 4OBEA 2JAQA 4NCNA 4HUQB 1HQCA 1IY0A 1UJ2A 1HA3A 1YRBA 1DARA 1J70A 1XWIA 2JGNA 4BLPA 4F4JA 3QF7A 1KNQA 4Q7LA 5IT5A 1ZD9A 1RKBA 2PLRA 4FIDA 4JBWA 2WJIA 4FXPA 5A5GA 2OILA 1Q12A 2IS1A 2GJ8A 3GFOA 3NVAA 1IBRA 2PH1A 4A0FA 5F9FA 1DAMA 4DT1A 2ZRKA 4Q1DA 4M8NE 2ZUDA 4IOMA 3U44B 2QUZA 2FU5C 3E70C 3IIMA 2YC2C 5J4HA 5FI1B 5KSOA 5GADl 4LBWA 3T1QA 3R8FA 1WXQA 5BN3A 1W36B 3ETLA 1Q44A 3I8XA 3M6AA 1N5KA 1XTRA 2ZI3A 4JLPA 5L3SB 3B13B 2A5FA 1KK0A 3AUYA 3KL4A 1HURA 2CL0X 2PEYA 3AP3A 1KI1A 3R9IA 5BN4A 4TLAA 2P6NA 1K5GA 3CM0A 4LGMA 1XZQA 4MKFA 3SNHA 1GWNA 3TE6A 1OB5A 1CBUA 1JBKA 1NBME 1T6NA 3SE0A 1XTIA 4QJ3A 1F2UB 4X8HA 5FPTA 4RVCA 4C7OA 3ZYCA 4CIDA 2PZGA 3TSWA 4E07A 5AUOB 5G40A 1OIWA 1TL7C 2CCGA 3IHLA 5EXPA 3SQXA 2WWWA 4G5QA 1D8TA 4URWR 3RRYA 5CITA 1FP7A 4LYJA 1E2KA 4G0NA 2N42A 5DHFA 4XD7D 3FKQA 1KSJA 4BPBA 3OE7A 4L8GA 2WKRA 1CP2A 4DDTA 3RS2A 4EQ6B 5KTYA 1T8TA 3BH0A 4IDPA 1N25A 4ZDWA 4LUCA 2FWRA 3LBNA 1XTQA 4MUAA 5AJZA 2QT0A 4EJSB 1MABA 1XEXA 4OJKA 1N3BA 3AF2A 1MRNA 2FMXA 2RGEA 4ZI3A 1T91A 1KAOA 5J5CA 2ZRGA 2QI9C 2VL7A 4DCUA 5G53C 4RKEA 5FR2A 1CS4C 1BMFA 2G1JA 3AGPA 4BLSA 2GZDA 1ETUA 2ZRNA 3QENA 1XMIA 1ZUNB 2IS6A 1JR6A 3THWA 4JVSB 1KO8A 2PX3A 3OEHD 4OYHA 2QL6A 2Z4RA 2C2HA 1JXMA 4O0MA 2DFLA 1FTSA 3AVYA 3WBKA 1Q20A 4Q1BA 4DDVA 1JQJC 4AY2A 1Z0FA 4G5GA 3CX7A 2HLDA 3HR8A 4KBGA 1KO5A 1R10A 3UWOA 3VQTA 1E9FA 2O5VA 2EFHB 2F1RA 3MFYA 2F3TA 1WA5A 3SHWA 1GITA 1AS0A 4M22A 4KLNA 2D4HA 1KJZA 1N2CE 4ON9A 1M74A 4K46A 1RYHA 5FPKA 2ERXA 1VG1A 4YC7A 4URVR 3EZFA 1EG7A 1XTKA 2RGGA 1COWD 1Z06A 2DY1A 1G7RA 2IL1A 2XTZA 3FVQA 4HSEA 3KQUA 1DG1G 2O0JA 4TL9A 4ZO4A 4HLDA 3QOFA 2XSZA 3NXSA 2NO7A 4IOLA 2OSBA 1RJ9A 4MGKR 2RGCA 4U00A 3MRSA 2NZ8A 4QG7A 2A3RA 3D7MA 3MUFA 4JVLA 4RD2A 4GT1A 5EXXA 3IKJA 1HT1E 4IHQA 5DSZA 3ZH9B 5E7JA 2Z43A 1E99A 3BJIC 4G1UC 1LNZA 1E2IA 3R9XA 1KMHA 1E2HA 2J41A 3ONWA 4LV5B 4O3MA 2JATA 3GEEA 3P4XA 1NRJB 5EE5B 1SKYE 2CCKA 4QNRA 2ZRHA 4Q00A 4LV6A 4UNNA 4HAWA 2AL7A 2FEMA 1WF3A 4L9WA 1DAEA 3VR4A 1QHGA 1KDRA 2MMCA 2ZROA 3JZMA 1W2HA 3GD7A 4HUTA 4O25A 1TF5A 2A30A 3L8YA 4Q19A 4Z54A 3THXB 5KYKA 4YMWA 2C99A 3NBYC 4MYTA 1PLLA 1ZC3A 1M7BA 4OQNA 2HYDA 4DEYA 5C4MA 4BRUA 3GJXC 5FL3A 3BK7A 2C95A 2CHQA 1YZLA 4YMTA 2W6JD 1NKSA 2O8DB 1N5IA 1ZBDA 1IONA 2CXXA 2OESA 4F93B 5D3MB 1NY6A 4ZI2A 2ZR0A 1XEWY 2R44A 4RD0A 3E2IA 2ZXUA 3E1SA 3OIWA 4RZ3A 2ZRAA 3GEIA 4JVNA 1YKSA 1MT0A 2PL3A 5L8VA 2GJ9A 2ZRJA 5B64A 1JR3A 2DWPA 2VO1A 3I3SR 1YR8A 4PHHA 4F4IA 2CL6X 4HZUB 3K70D 3T15A 2L0XA 2MSEB 3EXAA 4M1YA 4S2EA 1E0AA 4IVPA 2I1VB 2CMKA 1Z0AA 4FMCB 4MGIR 4YLGA 2JLSA 2V1XA 4BFSA 1Q57A 2NZJA 1MO6A 2DWQA 5HE8A 4Q7JB 1SZPA 2ZRMA 5L3RA 3R20A 1X1SA 4LRWA 4PAOA 1F2TA 3GMTA 1P5ZB 2BKEA 1Z83A 4K8OA 4ABYA 4DUGD 2QENA 5CJ2A 2XZOA 1ODFA 3RWMB 4D4LA 4LJ8A 5DN6A 3RABA 1FUKA 2RKOA 2QRZA 4Z1MD 4ITRC 4J0QA 1NMZA 3EZ6A 4LJYA 1GRNA 1OKKD 3RANA 3TSZA 3GPLA 2JJ1A 3IUYA 2ZSBA 3L82B 1DAFA 3NBFA 1M2OB 1G7TA 3U61B 4DLTA 2IXGA 1FPMA 1BO6A 3L2OB 4EIWA 2R6GA 3VMFA 3KQLA 2KE5A 2DFNA 2R6FA 3DM5A 4PZZA 2IX3A 3DHWC 3H4MA 1ZW6A 2I4IA 5DI3B 4MRSA 1ESNA 1LF0A 4UJ5A 1J8MF 1RC8A 3U3KA 1R5OA 2R65A 4BZPA 2QE7D 5BYKA 2HT1A 3VX4A 3TSOA 3WY9A 3CZQA 1XX6A 4B47A 1TF7A 1XXHB 3KB2A 4Q1EA 5EZ6B 1VHTA 3AV0B 5BQ5A 4GPTA 4UQOA 5FL7D 4QKQA 3M4YA 5L3VA 2BV3A 1QVAA 4JLBA 2ZSEA 3L43A 4NE2A 1Y3AA 4ZDJA 4C0BA 1OHHA 4MUBA 4EAQA 1FL9A 4NYJQ 3GLIE 4Q9JA 2YYZA 5B2ZA 4H9GA 4PPFA 3KXLA 4II7A 3MLEA 4PHGA 4LPSA 5GVRA 3KKMA 2WHXA 5KU1A 1GVNB 3UATA 3GLIA 1OFTA 3A1WA 3FFBA 3T12A 2C9CA 1PZNA 3EPKA 4CEJA 3PEUA 4DLYA 1CJTC 3K9GA 1ZCAA 1JNYA 2KWIA 4MYHA 1FW6A 2YOHA 1N6IA 2ONKA 1G8GA 4KJZA 2KB0A 3Q8XB 2ZJZA 1OFIA 2ZS7A 3S1AB 2OHFA 3LA6A 2G9NA 4MRNA 4P4SB 1QHHB 2A9KA 2CLCX 3NEJA 2XB4A 1AGPA 2RMKA 2ZJAA 4OK5A 1QZXA 3ZS9A 4OKSA 1Z47A 1KTVA 2WICA 5KPDA 3O8DA 1EX6A 3GLHB 2R2AA 1U9IC 2QAGC 2DFTA 2WBLC 2Z0MA 4D25A 3RRNA 4CEHA 3IIJA 3DKVA 1S2MA 2J9RA 1OJLA 2QQEA 3U7HB 1GNQA 1TX4B 1KI4A 2VHUA 1YZKA 1OPXA 1R0YA 1S9HA 5FUYA 4EDHA 5C18A 4D26A 4GP7A 5EQTA 3GLGE 3CUEF 5AR1A 4F38A 2ZREA 1TEXA 1G4AE 1P3JA 1OXUA 5FOTA 1R0WA 1U90A 1XU4A 1BYIA 2R9VA 2BMFA 2ZRCA 4D0GA 3U6BA 1ZM2A 4F4CA 4DXAA 2FSFA 4DLUA 1RW4A 1CLUA 1L4YA 1PJRA 2A5YB 3Q72A 5SZIA 3H84A 2ZI7A 5JJIA 3BB4A 2G83A 3DM9B 4PC2A 3FPAA 1UDWA 2WSSA 3KDSE 5TY0A 4A0RA 3SN6A 4DEXA 2VSFA 4HLQB 621PA 5DGXA 1D5CA 3CIOA 4TYPA 4RCYA 3VR5A 2GEVA 4QBHA 5JI2E 1E2NA 1H8EA 2VLIA 5H1YA 4BZXA 1XFAA 1II8A 3K0FB 4V0NA 1AKEA 4LC1A 4PR0A 4EPWA 2P0EA 1U9IA 2IXFA 1K6MA 4KFRA 4N3NA 2QU8A 3KTAB 1SVWA 2IYYA 3QEJA 2NTYC 1F6BA 3SHFA 4DZZA 3LY5A 2IYQA 4JBYA 1KO1A 5ANRB 3P27A 1DOAA 1YRAA 2QPAA 3U4QB 4NYMQ 2I1QA 3RYTC 4B32A 4Z51A 4JT2A 3PVSA 3AGQA 4B2IA 3HWSA 1XMVA 3A1SA 2W2TA 4PANA 2GHIA 1M8PA 1R7RA 1KSHA 1G3IA 4MDFA 4Z8XA 4LI0A 4M1KA 2BM0A 5KHOC 3AVVA 1JQLB 4BLRA 1AS3A 2FJUA 2H7VA 2P67A 2ATVA 2FSGA 1LW7A 4B2PA 3FHCB 2QPTA 1CRPA 2NQ2C 4TQAA 1MO5A 1VPLA 4I1UA 3EZ9A 4TMZA 3CPHA 5CJPA 3RS7A 2FFBA 5DHAA 3ZGXA 3RNLA 2D7DA 1XCPA 4JJZA 4Q4JA 2FZ4A 3WBJA 2D2FA 2ECKA 1CKEA 4B43A 4RD3A 3SDZA 1UBFA 4JL6A 1GFIA 2XXAA 3H86A 1TQ2A 4DLZA 3AVXA 5HPYB 1ZVQA 1LY1A 5CB6A 3BH6A 3VHLB 1ZUIA 4OI4A 1US8B 5CM9C 4B3XA 3GLFB 2GJKA 1KGDA 1S1CA 3OE7D 3PUZA 1E1QA 2FOLA 4KSCA 3LBIA 5EP3A 5FBLB 2CE7A 4A82A 4EKDA 1AZSC 2IYUA 1J90A 3K09C 3PITA 4LHYA 3HU2A 3FKSA 4NMMA 5AWFC 4RD4A 721PA 1MR3F 4GDFA 1I2MA 5AJXA 4V0LA 5CM8B 2EFDB 1KI7A 2ZRIA 1XRJA 4XTRA 2ZS9A 3VR6A 4FCWA 3CLVA 4RCZA 1D9ZA 4IDOA 3AVPA 4WOPA 2IF2A 4PC6A 1HEIA 1VTKA 1GL9B 1P9WA 2IYTA 3WMGA 2GZAA 3JVUA 4MGZR 2OAQ1 3U2QA 2ZJYA 5SZJA 2NO0A 1Z07A 1NVWQ 1LFDB 1GP2A 2XNSA 4JYCA 1DS6A 1BKDR 3TBKA 5EJEA 2ZS8A 1XD2B 1QBKC 2ZETA 3EC2A 4FINA 2GF9A 3WYAA 5CDFE 1DAHA 1P9NA 4OHVA 2WZQA 2ZI4A 2VBCA 3KB1A 2Q3MA 2GRJA 4K81B 3KXIA 4MQBA 4Q21A 4XIGS 3J81k 4MA4A 2PT5A 4ZCLA 3GFTA 3VR3A 2HLDD 2ONJA 4A6PA 3TW4A 1T0JB 5CDFA 1YJ5A 4JKIA 4C0SA 2FPMA 1ZRHA 1KYIA 3DVLA 3LAWA 4V0KA 5IF9A 3U60B 2QM7A 2BCJQ 1TEVA 1YE8A 1SHZA 2JA1A 2J45A 5E7IA 3ZZ0A 2IYWA 3DDCA 3K09A 1GL6A 1NN1A 1D6JA 4FMBB 3TVTA 3Q5EA 2JLZA 2OLKA 1D2EA 1XP8A 2ZE7A 4HDQB 4EJSC 1HQYE 1Z08A 1AKYA 1P61B 1VYUA 3KKNA 1MRSA 1YZUA 1BH2A 3VU9A 1Z2CA 5EE3A 4ACBA 2XSZD 3QKSB 3LW8A 4RD1A 2FPKA 2NOAA 3JVVA 2HJVA 3LX5A 4B73A 4FWTA 5F98A 3HDTA 4L4UA 4X8OA 1OXTA 1W4AA 3TVDA 4OQXA 5AUQA 2V6IA 1U81A 4DJTA 1F2UA 1G5PA 4OI2A 5JWRA 3LXXA 4KCGA 2WWIA 4ZKEA 2IC5A 3EPJA 2R6AA 3K0AB 3FYHA 3P4YA 3QEOA 4QBGB 2ZANA 3TRFA 3AB3A 3SR0A 1ZC4A 3TMKA 1CEEA 3WYGA 2GCNA 2WJVA 5JEDA 1XD9A 4C0LA 1Q1ZA 2JLRA 1F60A 3EC1A 4DRZA 3QKRA 3ND8A 4OHZA 2ZI5A 1UM8A 1AJEA 5D3QA 4YDSA 1G8FA 1K8RA 3FB4A 4M9SA 4DB2A 3G0HA 4LJAA 2VP2A 1MKYA 4FCTA 3NHAA 2WV9A 4PC7A 3OEED 4GL2A 1CJMA 1VCMA 1E94E 2VSXA 3GJ6A 4FMCF 2ZPTX 3O8BA 5DYGA 1KI6B 4IDNA 4LCBA 4LPKA 3QPWA 2X19A 4UNSA 1NY5A 1HYQA 3DZ8A 4H1UA 1EWQA 2QMUA 2R6CA 2ZU0C 4WIAA 4MITA 5JBQA 1P75A 2E1RA 1M7HA 1PVOA 3RSOA 1UKVY 1ANKA 1Z22A 2IWHA 1T8UA 2HUPA 1CU1A 1DPFA 1NLFA 4LJ7A 3EWAA 4KYIB 1WBDA 1E9SA 5FOUA 2X2EA 4A2QA 2DR3A 4PFSA 2XITA 4CGZA 1MV5A 3GQBA 1CJKC 2JIZA 4HATA 1HT2E 1RPZA 4BECA 2O8EB 1KO4A 3C41J 1NG1A 2F1JA 3P1JA 1E0SA 3VKGA 1IXSB 3L0PA 4QGAA 1HH4A 4EPRA 5FH9A 3U7FB 3ASZA 1JR3D 5EE9A 2QEQA 4NYJR 5FBRB 4JLVA 3TAUA 3QVUA 3BRWD 1IOZA 1Z0DA 3KJHA 2V7QA 2ANCA 2XJ9A 2AWNA 1Z6GA 3BXZA 1DADA 4JLJA 3X1XA 4TYQA 1G8YA 1ELOA 3T61A 1DO0A 1E0JA 2QTHA 1P73A 4W9MC 1HV8A 3KQKA 2DWOA 3A58B 5HCIA
chains in the Genus database with same CATH superfamily
2L18A 3T7SA 4WJLA 2O5EA 3EXHA 2WHPA 2VH1A 3O4GA 3QX8A 3UK6A 2QI9F 4N6GA 1PWEA 4IXNA 2WJYA 3D1LA 5BYBA 5K8TA 4C0HA 2WQZA 3JARB 4IEFB 4OY3A 1YS4A 1MORA 3YASA 5EL0A 2AT1A 4IQ0A 4GO1A 5HMLA 4EF4A 4O4HB 3FNGA 4Y98A 4UHDA 3OPYA 4R05A 4KODA 3DBLA 2I2WA 3V7WA 2C8KA 3VI3B 1S8AA 5F64A 4EX6A 4XLZA 2FEWB 1C50A 2F3RA 2QYOA 3KD3A 4GZ6A 2HGSA 4O5AA 2CSXA 3VNAA 3NHMA 4YI5A 2YCBA 1CDOA 4F1JA 2W6NA 4DLVA 1CF4A 4MV9A 1M2JA 1Z73A 3A4LA 3EOZA 3O8QA 3IPCA 4QECA 5ALPA 5CAEB 2CJYA 3EGCA 4B17A 3FOAA 4XWTA 3S4YA 3QUTA 4XWWA 4EKGA 1UPAA 1Q15A 4W5WA 3E8XA 2X6TA 1IN6A 3LBHA 5DNDA 1WNFA 4E5VA 3ZLJA 2OHJA 4AKSA 2H4YA 3AZOA 3K4HA 2ZWPA 4HNQA 4LG1A 4LY0A 1PJ2A 3ZVNA 3LHFA 3IVAA 3QSYA 1XMQB 3AF4A 3DQPA 3HZZA 1RKVA 2HDNB 1JMYA 3LD9A 4PG7A 3V80A 4BN0A 4X7RA 3L4BA 4F96A 5ALDA 3FNEA 5LD2B 1JHAA 1T2NA 3QQ5A 2Y0CA 2AKAB 2JJ8A 3CUYA 2X1VA 5E2AA 4PYNA 4AN0A 4DQ0A 1G41A 1KZ9A 1F0PA 3R3SA 3WZMA 1PN3A 1LS1A 2C0PA 4DQDA 4HGPA 4MYSA 1YQUA 3GF4A 1GZSA 2Z4SA 4L5BA 3MMPA 4HAVA 4ZPXA 1O1YA 4J75A 3UJDA 3WIVA 5ED4A 1H3EA 1A0OA 4BFUA 1MB9A 2J09A 3RUDA 5CB4A 4DV3B 1LI4A 4Y6RA 3SVZA 4B3RB 3X1DA 4J4HA 5EJ6A 3VOTA 5FX2A 3OBBA 4C7MA 1NDHA 4JZKA 1I33A 1KC1A 2I6SA 1V1MB 4AY3A 5C80A 1E3SA 5JHGB 5F1OA 3KJNA 3TNFA 1N0UA 2MYUA 2D2EA 2HDWA 3JTEA 3ZWVA 4BEBA 1HLFA 1GTMA 1UM9B 5CTAA 1OFHA 2MOKA 5BMVB 4MGYR 4G07A 4AQDA 2OL4A 4W5HA 1OWPA 3VPBA 4BE7B 2AF3C 1IBKB 4MCIA 1FDRA 2WUFA 3MILA 2DETA 2P2ZA 2ZEJA 4BCDA 4RO0A 1YZNA 2WKSA 1C9EA 2UZ0A 5LIRA 4AP5A 5JZMA 3ENKA 4HDSA 2VQFB 2XDYA 3W2TA 4PXAA 4XM2A 1KOFA 1XF1A 3LHIA 2FCAA 4FN5A 1ONOA 3BB3A 4IWYA 4ZDKA 4RJIA 4Z3KA 4MPRA 5JALA 1CJCA 4EKNB 1TKAA 3LP8A 3OPQA 2VK8A 5CPBA 4DXHA 4MIOA 1XU9A 4QGGA 4N4AA 4DWJA 2QUAA 3AUXA 2WSSD 4MRAA 1RFGE 4XR4A 3FSGD 3NVMB 3A4NA 3K05A 3U9LA 3ZGNA 1KKMA 5I8PA 3ZNPA 4FR5A 3W5UA 1BJRE 1DKOA 4IXTA 2NPIA 4ZVPA 1USGA 1FU8A 2D1SA 3ED1A 2C94A 5E1DA 4MR7A 3T4PA 1KBQA 2ORVA 3ZBPA 4D8XA 4E5NA 2XKKA 3CG4A 4RFVA 1G59A 2X41A 2C4UA 2OR3A 4XIIA 3CZ5A 2VXOA 3AOEA 1FRNA 5FA8A 1KJYA 1Z25A 3AKYA 4P98A 4TLCA 5EN4A 3ZX5A 1U5BB 3DEFA 2ZZKA 1UXKA 4NZYA 1AO0A 3P2EA 1JG3A 4K6KA 5AK5A 2FGKA 4MW7A 2V8BA 1CULC 1Z34A 3UN1A 2LUOA 4Q1CA 2AFHB 3ORQA 4FMDF 4NMXB 4WJKB 3C7KA 1RE0A 4ZICA 1PV4A 2EV9A 1SCIA 2MT9A 3FSRA 2LP4Y 1N5MA 1QM5A 4BFLA 1HPLA 3OCXA 2OECA 2OUIA 2Y2UA 1LUAA 3FBGA 2BIFA 4II2A 2VPYA 3HE3A 4RK6A 4F4HA 4JLUA 1OF1A 2DSTA 3UFXB 1LTQA 2QNRA 4HX2A 4RTKA 3I5XA 1L7QA 3TAHA 1FQJA 4BAUA 2L19A 4OA5A 5KAPA 3H7IA 5AM2A 5ARDA 4I3FA 1G4HA 3DMHA 2ZAMA 3UT0A 4YY3B 2SCUB 3QYPA 4JBIA 1VCHA 2FHSA 2JK0A 5CLLA 4DS3A 1EXVA 3PE3A 4HJXA 2J0UB 3N86A 4CFYA 3L07A 1O4WA 1P5FA 3WWCA 4BZQA 2HU8A 4OUDA 5DNVA 1Z0SA 2AEFA 3LC0A 3GROA 2E49A 2J4DA 3PS9A 3ZIAD 2CXHA 3NRJA 3JYQA 2VI5A 3BBPA 5G4KA 4JVOA 2BFDA 5T5QA 2QZ9A 5DZSA 5CX1B 4DSTA 3Q8LA 4K6HA 1RI5A 2ZUCA 2H7YA 1FOEB 3D6AA 3H5WA 5FPQA 3V1TC 4HQKA 3IHTA 1CRLA 5DISB 2BF7A 5CMLA 1E1QD 3OUZA 1RQGA 3KB6A 5ULLA 3T9FA 4XCXA 2CLFB 1X1AA 4LF9B 3AM5A 4IEIA 4UNQA 3VDQA 2H63A 1Z26A 4MX8A 4IJKA 1TQDA 4O2AB 5J58A 3NVKI 3SEFA 4TZ6A 2IW3A 4LYDA 2ZB2A 4ZMBA 1XDSA 1CCWA 1JR4A 1SUSA 1G17A 2HL6A 2RAPA 4J2TA 3KZXA 2OT3B 2XUJA 1RYFA 3O8RA 4ZT5A 1SBQA 4V3CA 1U2RA 3K4QA 4W1QA 5LYJF 1D7OA 1VA5A 3A7EA 3ESDA 2COUA 3OSUA 4KDFA 4TMFA 3SC4A 1PT6A 3QWIA 3S27A 4IDCA 2WAOA 1VBNA 2BMDA 2PSSA 1NVVR 2C61A 2DLNA 3ELDA 2I2XB 4GXTA 1VPDA 4DANA 4DSUA 4WQMA 2Q28A 1RQ7A 1I9CA 1RWPA 5FUVA 3FG9A 3REFA 4NAHA 3ICCA 5SZHB 4ZEOA 3VV2A 4A8JC 5FNZA 3VNRA 2IELA 5KI6A 4CM6A 1TZKA 1UODA 4KXFB 2XUKA 3ZQ6A 1BNCA 2IY9A 1D3AA 2EFCB 2RG7A 4KGXA 3CG0A 4DIUA 5E9QA 3VR3D 3LZCA 1JB1A 3F47A 1Q1QA 1WEHA 3HBFA 3O4JA 4LRSB 4M37A 1WXDA 4OHWA 4QUJA 3DEKA 4WK0B 4YACA 4GOKA 3WSVA 1GKLA 3JZAA 4LAFA 3ZR4B 1RYDA 4FLMA 1J0XO 4NENA 5AVOA 3AEUA 3MEQA 6NULA 5BN4B 3F3KA 4IFEA 5AUNB 1LQUA 2JLCA 3GT3A 5BPFA 3K0SA 5CGQB 2FN9A 2GYYA 2HR1A 3QLTA 3UTCA 2J5XA 1HDRA 2ZSFA 1H0SA 4FZ3A 4Y7CA 1PX2A 1LLQA 2GHRA 2XWJI 2R6JA 3HP1A 4QIHA 2CVHA 3AONB 2ID9A 2AF4C 3GLVA 4OBBA 4QU5A 2D5CA 3K1AB 4POAA 3NBZC 3FN4A 3TZQA 3MW8A 2QUBA 2ZBQA 2IYZA 4AI6A 4KRGA 3DFMA 4Q7KA 2PRZA 3OX2A 3QSGA 4FYYA 4V1CB 4UFOA 3TB6A 3LVRE 1ZEJA 1U7DA 2JLBA 3MMNA 2X4IA 4EUKA 4AWAA 3I9OA 5HF5A 1G3UA 3V34A 2J3JA 3T9EA 4P3PA 4HGRA 2O8NA 1N9GA 2Q8PA 1O9HA 4ZKDA 3RT1A 3RYIB 1EVJA 3LS2A 5L45A 1C3EA 5EWLB 1XK6A 3LVFO 3PHJA 3TLXA 2IP1A 1QFZA 1D2MA 3ACCA 3ROXA 3NIGB 4YAFA 1ZYUA 1V1RB 3ELUA 4Y67A 1USUA 3V8BA 3PR2B 1C5KA 4MR9A 5DNWA 1O6BA 3TW8A 1L4UA 3MRVA 2ZIUB 4EX7A 1A4RA 1MUUA 1P3DA 2B8EA 2AJBA 3CRMA 1SZCA 2WAYA 3FWZA 3L8FA 3GLFA 3NYWA 3R9WA 5IBRA 1WS6A 1X74A 3QW2A 5YASA 3SBOA 2Q62A 3HDHA 4LK3A 3RF7A 5B6JA 2OHVA 2ODEA 1KIMA 2REXB 2VWGA 4TMYA 5TT1A 3VZBA 3WMEA 3L4KA 2JGLA 3KOYA 4GZLA 2HJ9A 3E7PA 4FYWA 3E5NA 3PIIA 4C43A 5C2JB 5JJLA 2R7KA 3N7UA 4J4BA 4AKEA 3DKRA 4EYGA 2BTQA 3O0DA 4L5YA 4OQZA 5CTJA 1TKBA 3PQ2A 4JH0A 4RHTA 4JB2A 4JVMA 4XQ9A 4ZV9A 1TW2A 3JYLA 1DQYA 1W76A 2JGDA 4PQYA 2ZPUA 5DCUA 2BSXA 3T54A 1Y1SA 3RRXA 1KI8A 3PDJA 3T9AA 1T3SA 5A4MS 5I9IA 4OGGA 1QH1A 3KD2A 1UC5B 2INGX 2F1IA 2VSNA 3K7EA 3FWHA 1UZAA 1QUEA 2GLTA 2XB2A 5FO1A 2YWCA 3OT4A 3T95A 1Z2DA 2C2ZA 1VPVA 4TV9B 3VFDA 3Q2OA 4B6OA 4ENTA 4LWPA 4V03A 1NN3A 1U8FO 5DLPA 2FZEA 3GLTA 2ZQZA 4OHOA 4US2R 4QOSA 4D9EA 1NC1A 2ZUVA 4YDRA 3C6KA 1M34E 1WD7A 2VP6A 3EXFB 3L18A 4EATA 1MEJA 4JP3A 1NMQA 3MWJA 4O4IB 4RZ2A 2H17A 2G9RA 2J33A 3HUEA 3Q7IA 4QFMA 4XJXA 3QVMA 3HP4A 5DKFA 3UGKA 5D01A 5JMTA 3KOWA 1E4OA 1PYOA 1FLAA 1GNRA 1EVKA 1RHUA 2FSIA 4MWOA 3GCDA 2OV8A 2DHDA 3IBTA 4C4XA 1M5UA 3W1WA 1ODTC 1NMXA 3ZBUA 5EA2A 3TI7A 4FYKA 2HO5A 3R9XB 1E5DA 1R0KA 1KMHB 2FZGA 1CY8A 2ONZA 3QHAA 4DUZB 2J4FA 3NM6B 3V4OA 3WK9A 4QGHA 5T6MA 3NWBA 1E6MA 1BDMA 1U2ZA 3QKSA 3IVMA 3K16A 3EDOA 3RIYA 4UE2A 3OM8A 1FYVA 5CFMA 1TNDA 4LDZA 1HRDA 1ZR4A 3GX1A 3QFTA 4WY8A 1AA6A 1U3DA 4BKOA 1XVLA 1OVGA 2XUGA 3K0AA 4GX5A 4CNBA 2FOXA 2GZRA 1H2RS 5HXAA 2OQRA 5CIQA 2YIJA 3BFVA 4LGYA 2JAUA 4QVKA 2F1KA 5HNKA 4EITA 1CS0A 1RWBA 1IQRA 1JPUA 1SXJB 1UIMA 2UZIR 2Z1MA 3OCYA 4HMQA 4LIPD 5EP2A 2I65A 4YROA 1N34B 5DXFA 4OJTA 5H8WA 3AVUA 4X85A 1YWGO 2AVDA 2PGLA 3HJRA 5JH7F 2DHEA 2VEOA 2EERA 4DSZA 2W2KB 4ZI5A 2LVBA 2VK2A 1P18A 2VYNA 4RL6A 3T34A 2R8ZA 1JR2A 2FB9A 4PYRA 3VTFA 1Y8ZA 3JRXA 2VWPA 3P0HA 1BE1A 4EGSA 3M1IA 4RADA 5GY7A 4YP0A 5KCZA 3NAGA 4IYRA 3EASA 4YWJA 4DMGA 4NICA 3C1OA 5KC8A 2WJHA 1T8YA 1AKUA 1BCSA 3DZJA 4AK9A 2QRKA 1FNDA 1EUDB 2D7CA 4N0EA 4X1YB 5BP7A 3KL2A 3PLRA 4KPUA 4NJMB 4TZTA 1KJIA 2DWCA 2ZUSA 4ZAWA 2V9PA 3QX3A 1I0IA 2FX3A 3DWFA 3W34A 2YIMA 2CMDA 4B6SA 1B7GO 3ROFA 3SQDA 3ETNA 3WKAA 1P7CA 2V8OA 4G5SA 4TUYB 1GN8A 2XEDA 4YV7A 2GTHA 4UMEA 1NW4A 1QOZA 4ZVQA 1BH6A 2VT6A 3G9QA 1YASA 1XB2A 1F14A 3HCWA 3KYBA 3VISA 5KNBD 2JCSA 3WP1B 3QVLA 3MWEB 3TDMA 2H9AA 2VUIB 1NW5A 3PXAA 2GMWA 3L9WA 1SFRA 4X1KA 3WB2A 3UKDA 3NU1A 2QZPA 3SZGA 3L7LA 3WGKA 3BB1A 4RSRA 2H4XA 1CDZA 1Y3BE 2Q3DA 3K72B 2YJNA 3AETA 2WWHA 4CKXA 5FTMA 4AULA 3MBKA 2ZJ4A 5JC8A 3EIFA 4LJ5A 2GXUA 2FFAA 3CLRD 1BRMA 4NZNA 3D5EA 2JJMA 3TD6A 1BD3A 4BE4A 2BHTA 3THOA 3I9NA 2ZWIA 4IIHA 4XGQA 4JI1B 2IHZA 2M1XA 2XF2A 3NPMA 3V1KA 2Q1UA 3ICVA 1JHYA 1JI3A 3EIOA 3ZX4A 1SA0A 1OBOA 1UWCA 2BKVA 2H4FA 3K94A 4LHSA 5JZSA 4NMHA 3FPJA 3A28A 4X66B 1O9BA 3KKPA 3U1VA 2GKOA 4PPGA 4NY1A 4OHKA 4PYMA 5CIWA 1GNLA 2I3ZA 2EZTA 3FUCA 2GUWA 3JQPA 4B33A 1P4JA 2OCAA 3U3JA 2E85A 2OQ2A 5DVZA 1CWUA 1HFWA 2FN3A 4HUQA 4FC7A 2WJ3A 4F5DA 4KVAA 4MB6A 3O2QB 3QXJA 1XKTA 4IM7A 5K8CA 1SIOA 3HU1A 2R79A 1YBVA 2C3YA 2OCLA 2LGJA 3EIXA 4E51A 4ZCMA 2Q7OE 3A3OA 1DCTA 3WLTA 1DJMA 1TAQA 4R8RA 1K92A 3CWQA 1XAGA 2VPPA 3HYSA 2YHBA 3Q9NA 4TX1A 4EGFA 3BZUA 2IIBA 4IGAA 2CVPA 4G1BA 2HA0A 3CRRA 5HEKA 4I81A 2NXJA 4WZ6A 4NFLA 1G38A 2BOVA 4CEIB 1TQ4A 2KI5A 2QTFA 1ST3A 2QTBA 1W2GA 4NBKA 4N18A 5FLEX 3TR6A 3QBTA 4EFMA 5CFQA 3U5ZB 1G8JA 1XZNA 2CXUA 4Q12A 4URZR 2UAGA 2EJBA 4IXDA 1U0FA 5CXSA 4CEJB 1P74A 3Q8WA 1XZEA 4GZ3A 1SIBE 3ZHZA 1VMIA 2JGJA 5GWXA 1H2ZA 2R8XA 4IUYA 3GZNA 3PQ4A 1ZK4A 1UC9A 2C58A 2FETA 3SLRA 5HQTA 1BXGB 4TTVA 4I9NA 2ZVDA 4BX0A 2Y92A 4LE0A 3FTFA 3HXMA 1AVTA 4O2AF 2G1AA 1VHDA 4DA9A 1YIDA 4B3CA 1Q5PA 4JEIA 1XALA 4UTXA 3VAAA 1GCIA 2WUEA 3AEKA 3MIIA 3BE5A 1TTTA 1YNSA 2OGUA 4G1VA 2HCFA 1T2CA 3L79A 3U4HA 3O3MB 1NE7A 2P9QA 2LW7A 3JY6A 3PUWA 3SS9X 1M0EA 5H59A 1QRDA 4KSBA 5HF9A 4H1VA 2TMKA 4RESA 3DCJA 4KRFA 1IK6A 1NQAO 3BRCA 1OV6A 3H5RA 4CMAA 5GPBA 1GEGA 2A1TR 2ZB3A 2Z3WA 1JEJA 3GRZA 3BD8A 2PXAA 4DG9A 2XBMA 3DD1A 4FC6A 1XTPA 1YQGA 2J1LA 4JT9A 3ETGA 3LY8A 5FEUA 5JH7A 1AMNA 3SBEA 5LLDA 2BH9A 1UBHS 5LJIA 4DUPA 1FFSA 2ZT6A 4WK2B 3VHRA 1KP2A 2QUHA 2GXAA 1HE4A 3VYRB 3ZGVA 5JI3E 2J08A 3NWOA 5LIPA 3RW9A 2CLKB 2GM3A 1GL7A 1OWMA 1E4YA 3QXCA 4DR1B 1XNJA 4ZEXA 1SN7A 1UM9A 4YJKA 1JJ7A 3PDIA 4PE5B 4RKRA 3LQRA 4LDQA 1V26A 4RMHA 1TFRA 4UVHA 1LVGA 4KFUA 2VLBA 1U4NA 3LTNC 2ACVA 1PJ8A 1EH5A 5LQUA 1IG3A 4Z9BA 3UGTA 3F78A 1ZOPA 4PSDA 4CF4A 3PXUA 1F8GA 5IH3A 1SOMA 3T5PA 4KWIA 5HBGA 2ZYRA 4TLBA 1JH8A 3WOHA 1LEHA 4DBLC 2Q07A 1Y4SA 4PG5A 1II9A 3F7TA 4BN5A 4E2YA 2J7KA 2CUZA 2AZ4A 3FJYA 3N2KB 1RIFA 1Q95A 3I0MA 2AK3A 1YIOA 4GU5A 4HS9A 4YJGB 4BPRA 2JFVA 4ETNA 1T2EA 3KV1A 1RWQA 5EWJB 4B7XA 3KT0A 3R8CA 4F6RA 3RRMA 5LSAA 1JALA 3V2IA 1TM1E 1IXZA 2PMBA 4F7DA 1CY6A 4K3UA 2Q5FA 4IZ6A 5JSHA 2DQ4A 4UPEA 1MQSA 2Q4BA 5KNCA 5LU9A 3ZDCA 3KUCA 2Q1WA 3B85A 4LBVA 4M21A 5EP1A 3ZTWA 1T5DX 2GSWA 3O8CA 3DBIA 3AVQA 2MJLA 5D84A 4CMEA 1ILWA 3OX1A 3QG5A 3TQRA 1WDWB 4BBJA 1K88A 1E3LA 4DVJA 3N6XA 1VIYA 1IULA 1XDDA 3ABSB 1IHUA 3FPLA 4UW9A 2WWVD 5BQ3A 1UFQA 4H0CA 5BXYA 2HMYB 5T4FA 3I2KA 1DL5A 1EJ2A 1RWVA 4JJEA 3V3KA 4B09A 1DJNA 3RT7A 4FCVA 4M53A 4IKPA 4WKOA 4CIWA 3EA0A 2P9BA 3R3ZA 4GYKA 3A9SA 4AUMA 5JDIC 2J0QA 2FW1A 3Q4GA 4WKPA 4JNCA 4KSYA 4YMLA 5K8UA 2C7OA 4CTOA 2RGUA 3LFTA 1LD3A 3AWDA 4XIYA 4Q4JB 3REQB 4TS4A 4JJIA 1ZJZA 3SZRA 3DC7A 3LHDA 1JXQA 1O95C 5F77A 4QT4A 2XXAB 2H9IA 3T1VA 2WSIA 3MPUA 3C43A 3TN7A 3L1HA 3W78A 3G8CA 1LS6A 5TQ0B 2FSHA 3HNOA 1V43A 3GLRA 4ZGGA 1O94A 2HRDA 4CR6A 5CDUA 5KNDD 5DHPA 2SCUA 4URUR 2FXVA 3ZU5A 1MOZA 3BSFA 3QX7A 3TE7A 2VA9A 2PGDA 3H3FA 4BP8A 2PS9A 2R60A 3NLLA 5BV0A 1DAKA 4Y1GA 4CLEA 5C8VA 3VZSA 5FWYA 2JIQA 4FZRA 4X6LA 1RRVA 3CV3A 5B3AA 1TYEB 4E3ZA 2PWYA 1WUTA 2AGVA 3FPBA 4BDTA 2VHQA 4O4IF 5GJVC 4ACAA 1NI3A 4UULA 1U0OC 3BDIA 3UENA 4ZIRB 2VNSA 5DASA 4MDYA 2NZ2A 1GSOA 1QC5B 3KEFA 4QO7A 1K27A 5ALSA 2CKDA 3IEXA 3C97A 4A92A 4KE7A 3FX2A 3HBMA 1SVMA 5CA1B 4ANFA 3RUFA 1B76A 1P91A 4L9SA 2J3MA 4NLLA 1X7WA 4D4IA 5F2EA 5IVIA 5EWMB 5DRTA 3D8NA 4IIJA 1L5FA 1YQWA 4AG3A 2E5FA 4KIGA 1AA9A 2CHVA 3OMLA 2QG9A 1MIOB 4JR2A 4O8CA 4MKZA 1QYWA 1GPBA 2V4ZA 3DKKA 1ZGAA 2X77A 3JQEA 5K3AA 2B4AA 1TM7E 2QVYX 3C3BA 3LUAA 4MQMA 4DC0A 4IH4A 1YUMA 3TLGB 2DTDA 2CT8A 2FPSA 2PGAA 4G0PA 4BNZA 3T3NA 4RSHA 1N57A 4H17A 4PWYA 5EG5A 3BK1A 5FTLA 2IU3A 2XIJA 3RJ9A 1PLKA 4NNOA 5DYNA 4CVNA 2VUUA 1YA6A 1ABFA 3B6MA 3FETA 2JCBA 2YJ5A 2O06A 4K9MA 1OAAA 5JWHA 2NUTA 2VTBA 3AR3A 3CBQA 3H05A 4H4CA 4M0UA 5BNWA 3FOCA 4W9NC 3PEWA 1GPUA 1IHOA 2PD3A 2ATIA 1VL5A 4H0NA 3TLJA 4D1YA 4DQLA 1KP3A 1CZNA 2VDKB 5K6TA 2J48A 1NF3A 2WF6A 4B82A 5E6RB 2Q9UA 2UYOA 3E0XA 3PC8C 1CUAA 4HZUA 1D4AA 1IE3A 4C2TA 5IDVA 1LK0A 4PQRA 4OGLA 2QNIA 4B6FA 2RHBA 3BOSA 3D7RA 3DVSX 5KJ6A 2ZDQA 3T5BA 3EQ9A 3ZWWA 4BLQA 4L2IA 4RVGA 4ZYYA 5HIMA 3V6LA 1HEYA 2HWUA 2Q49A 3DUFB 4JC0A 1PZHA 2JLVA 3RK1A 1AOXA 1I4LD 1PR4A 3LECA 3WQHA 1F3OA 5JEEA 3D2AA 4MA5A 5F76A 1GKUB 3QQPA 2AHOA 1BJKA 1RRKA 1UADA 2MMGA 2GJAA 1CR2A 3ILVA 2XJ4A 2XT6A 4UZFA 5EIBC 1REQB 2OAP1 1UPBA 1H65A 2VA8A 2HQBA 1WW8A 3KLMX 1QGOA 1BRTA 1YD7A 1EP3B 2F1HA 2TECE 1SK9A 1BQ4A 5B2EA 5JZ9A 3W4JA 4OP2A 4N12A 2P6PA 4N39A 3O3CA 1R6AA 4CMIB 4GPAA 4D56A 5ALWA 4C7JA 1BA2A 3TNDA 4ZOLF 3B12A 3OY2A 3RYIA 4J7UA 1QIKA 1RWXA 2EWMA 4N49A 1HLGA 1TAGA 3QVVA 1QCYA 3IDOA 4O2BB 1H9CA 1SMKA 4C7BA 1EUYA 2I4MA 4AICA 4YRGA 5BUCA 3EQ7A 1Z16A 2J3EA 2GWHA 4GOXA 4TS3A 4A2CA 3AZPA 1CE8A 4FDTA 3EIEA 3KPUA 4KW7A 3P9PA 1CUGA 4IJWA 3MCWA 3JQGA 3QLVA 3DKIA 1T8SA 1GV1A 2QSZA 1A8PA 4M9CA 1GCGA 1XTSA 1Z2NX 3Q7PA 5DWVA 1VYHA 1YZGA 4FTWA 4OHCA 4L5CA 1IQPA 4YONB 5B36A 2ZJBA 1PUIA 3ELYA 4Q9LA 2WYWA 1M1NB 3NASA 4P5PA 4PSCA 4NTZA 3KQYA 1C4XA 5GZ3A 5B1YA 4WECA 3RYFB 5JS2A 1C8KA 5ALYA 2A0YA 2FG6C 3PYLA 3DFFA 1Z12A 4RTMA 2OBMA 3EEBA 3SR4A 1FMJA 1ZK1A 3EX7C 1UP7A 2ZM6B 1JA0A 2VUSA 1B2RA 1HZZC 1U28A 1BAPA 4ZCRA 4GWGA 3HB1A 3UHFA 4LYFA 1H42A 3S6JA 4EG3A 3Q3JB 1B26A 1RBQA 1D4OA 2B9EA 3EH1A 4E21A 2PVPA 3EXFA 3FF1A 5HR5A 2DUMA 1RBYA 4KFTA 2QB5A 5TF4A 1UJ5A 1AV7A 3V8MA 1TE2A 3PPWA 1AQNA 3CVOA 3VR1A 1F2DA 4ZRMA 3L0IB 1SU6A 3FYUB 1VB5A 1FQWA 1RRGA 3GLHA 2FR8C 1JFRA 4H6WA 3UCFA 1NUUA 1H2AS 2H59A 4B40A 3SIWA 1L3CA 4C7KA 4KMRA 1R6BX 1SWVA 1P2DA 3EZ2A 3FI9A 4R8VA 5IARA 3L3BA 1AQLA 1KK2A 4KUGA 5A5VA 1NUPA 3ETEA 3B6JA 3GELA 4KO1S 1IY9A 4M7OA 4L8WB 2XMZA 3N5CA 4AZSA 4DE5A 4G36A 4FGUA 1YL7A 1XQWA 3BXXA 3K2EA 2MHCA 4YJDA 1ZD8A 2A7QA 4QDJA 3KAJA 1KVSA 3PNSA 3Q88A 5HGJA 3ZTYA 3I2JA 4ALIA 4ZK6A 1CY1A 1SHUX 5HOQA 3HJHA 2OPBA 5IJ0A 4MVXA 5FWDA 3CB4A 4LNUB 3ZLVA 4DAEA 4HHEA 3TCXB 4AJIA 4AXBA 1PFQA 4TRMA 2R85A 4C3UA 1GOTA 1BWSA 1MOQA 2FVYA 5JUWA 3BCHA 2XCSB 3IILA 2CV1A 1A82A 1FJXA 2KPOA 1MVLA 2ZB7A 2HIMA 4PSKA 2GF2A 3FHJA 4B0OA 2ZCJA 3OEEA 5DMXA 4A36A 5GJBA 4ZI7A 4EEKA 3DR3A 1HQKA 1V8OA 1VDMA 4M0FA 3V46A 4YUXA 5I4BA 2LD4A 2XTAA 5LBUA 1SXJA 5FEMA 4JI5B 3ENVA 2QR3A 1P17A 2HA7A 3TEJA 4HGZA 4DILA 1PG0A 3AYZB 1PQYA 2FR0A 1U8ZA 3BERA 3BK2A 2HW8A 2FLKA 2DVMA 2CHUA 4MVJI 2VP5A 1AC5A 1M67A 4IFBA 4MWGA 3T0IA 3TIIA 2N75A 3HWX1 4FU0A 4BKQA 3SHVA 1VMAA 3VPXA 4BLVA 2OOSA 3DL4A 3H17A 5DK6A 3U7IA 2X2FA 1KAMA 2GLUA 4TMKA 2EJUA 1JMVA 1X19A 1YOBA 4EENA 1V7ZA 2I3DA 2O6HA 1KF0A 2IUEA 3D6NB 3O90A 3VSCA 1OE0A 5AUPB 1ZJ5A 1DCMA 2R86A 1KA9H 2VJMB 3I1IA 2QLTA 3LT4A 4LE2A 4FP9A 4QU8A 5JMWA 4UM9B 1I94B 1XA0A 3HDJA 4O2LA 1U7HA 5FLXA 2IHKA 1K68A 1L7XA 1A5SB 1G98A 3G0BA 1W36D 3WZ2A 4AKHA 2RK4A 3UJ6A 4QVIA 3AFNA 4P8RA 4UQPA 1VJ5A 4EA6A 1RRCA 4CRWB 1C9NA 1CD5A 3FW1A 1HDGO 3VDMA 3WTBA 4OQDA 1ACLA 4YFYA 4UNIA 4XWOA 4XWKA 1CLEA 3CZ9A 4ZOLA 3X1ZA 3IQFA 3V6MA 1V9LA 3QTBA 1RYMA 1E1YA 3FNRA 2RC6A 1Y98A 3PFWO 1GILA 4GVXA 4IVQA 3D4LA 1RQPA 3O2NA 3AM4A 3SHOA 1ZK0A 4WKBA 1GAQA 3ZY3A 4Q5IA 5E6UA 2VHJA 1QANA 2D3WA 1H2WA 2PLWA 1TJNA 2HGZA 4YRLA 1CB7A 3S8YA 2X8JB 2IZ0A 2XVZA 1L8XA 3LXRA 2C96A 1OX6A 2JVJA 3NDBB 2IZ5A 2GVDC 2CL7X 1JECA 1J8YF 1Y89A 3WWEA 2PKRA 1W0CA 3L77A 4AD8A 5CVCA 1H1LA 2H1FA 4B87A 1ADYA 1KQFA 3AY7A 3SJBA 5HP4A 2RB5A 2FQ1A 3H18A 5D86A 2BLNA 2G0TA 3OZEA 1WTCA 2JIBA 2DKOA 2J0SA 3GNLA 3OF3A 4R8KA 5EIAA 4ZO7A 1QV6A 2K7ZA 5F52A 1GIAA 1THZA 3H5LA 4CT5A 4JR0A 2PT7A 4P0QB 3CSUA 4PICA 1K1EA 1JJIA 1YI1A 3OLWA 4WW0A 3SEQA 3ZHXA 1GAXA 1IXYA 3CNNA 1HSZA 4BNGA 3FUTA 1K3UB 1Y8QA 4RY9A 4WWHA 1YJBA 3FCEA 2X7HA 1E2FA 3MD0A 4PYOA 1OIVA 1T6BY 4JLMA 4PNZA 4R81A 3VOAA 2B7BA 1D0VA 4Q47A 4C30A 1IUNA 1G9XA 1H94A 1E79D 3BCSA 4PN3A 3QVTA 3GL9A 5E95A 3CRW1 3Q8MA 4MTLA 3T7AA 4A8HA 4MUGA 2QRLA 3MWKA 4YDHB 3L41A 4TTSA 3K1YA 2GFIA 4R98A 5DX0A 4MV1A 3RG2A 3SC2A 2WYOA 1BJTA 2JJ2D 2XTMA 1FQOA 4UZSA 1KETA 1E2MA 2ECFA 4ITUA 2BGLA 1ZS9A 1VIMA 3W7AA 3M8KA 8GPBA 3DBHB 2YHSA 1WIWA 3DF7A 3KHSA 2E18A 4FD2A 5JG7A 4YRIA 3WISA 5ADUS 3UY4A 3KKZA 1SBYA 3DAFA 3A05A 3EARA 1TEZA 4PTYA 5FOWA 4NEHB 1X7YA 4CEIA 3U4DA 1ZI8A 3WI7A 4NXNB 1X8JA 1TEHA 3W90A 3D7KA 3SM3A 4OXQA 1NIJA 5AW3A 1QTRA 1V2GA 3GWGA 3KKOA 1RJ9B 4KX3A 1WR8A 2P65A 4CM4B 2IF0A 2VRCD 4X3CA 4QZVA 3GIWA 3NTXA 2NAFA 1BXGA 2YJTD 4MROA 4RYLA 4UAGA 4R1PA 3TTSA 2I91A 3I9KA 3P9CA 4D3SA 3LC2O 1POXA 5KVAA 4A0HA 2B0JA 5FBKA 2JVKA 2IA5A 2I8AA 3K30A 1O4VA 4TV8F 2ZT7A 3E81A 2X8WA 1B93A 1WP4A 3V97A 3HJAA 4NZZA 1W4LA 5DIZA 3ZIDA 5AKLA 3R6WA 4HB4A 2HMSA 4I0WB 2POCA 2ZITA 4CF7A 3C8ZA 3RBAA 2NTVA 4G65A 1KS9A 2GPBA 4M8SA 4OL9A 3FCAA 3S2IA 5IM4A 2FPOA 1WQ4A 5FWXA 2P4SA 1S3IA 2VN8A 3B20A 4LV8B 4BFVA 5F7JA 2VT3A 3M4ZA 4B6GA 4X90A 4CI9A 4Z53A 1LVHA 5BVHB 1G291 1XRLA 1QP8A 3U49A 1G8MA 1M0WA 5KYWA 1E1LA 4PVDA 5AK0A 3F3SA 3UKOA 3F9RA 4HNVA 1U1GA 1UOEA 4ML3A 1HNWB 4P4GA 3TAXA 4AZTA 3RLIA 1VG0B 3H83A 4JI6B 1L7BA 2R3SA 3A4MA 1JIUA 3KEQA 4TWZA 1QDLB 4I14A 2I55A 3JYNA 3F67A 4RTSA 2WKPA 3X1MA 5TS2A 3R77A 3PX2A 4OHUA 5AESA 4AY6A 2YDXA 5AKXA 1JG2A 3X43A 1RSZA 2P2LA 1PCXA 2ORIA 3K0CA 5F51A 2AJ8A 4GD3Q 4LYYA 2DTEA 2ZJ8A 3KNZA 3OEHA 2H29A 3N0XA 1BX0A 3EFOA 3G2LA 1J5XA 4LX0A 3K1ZA 3BMNA 2B4TO 3FYDA 3PC7A 5AJWA 3PC2A 4BO7A 3SQWA 1VOTA 5AHRA 2QL7A 2IP2A 2PFGA 1GGFA 5NLLA 2ECPA 4ROSA 3BGVA 4XW2A 1NLZA 2I6GA 5B7GA 2GBCA 4EY5A 4CE6A 1MBZA 1UKYA 1II0A 3ZD8A 1SPXA 4ZVMA 1DVRA 1U94A 1U7PA 4WGGA 5EWJA 5J4YA 2EX0A 4PLZA 4B85A 2J3LA 1EFKA 2PX0A 3G8DA 1EWVA 2C2XA 4OI1A 3S81A 1A9XA 1WCXA 1ZH4A 4JKYA 3K32A 1BS2A 4LOJA 5KTTA 5CCEA 1W6RA 2ZRLA 3ITKA 4BTVA 2AN9A 2WFAA 3QIAA 1RKUA 3HBJA 1YR7A 1F0NA 3AX6A 3SF0A 4CM3A 4OVKA 1T3HA 4WASA 2OFXA 3ZV3A 5C52B 3TW0A 1F1BA 1IDOA 2ZYVX 3HCOA 5CDGA 1NU8A 1Z45A 4O2BF 1LWOA 4F1KA 2ZIEA 4RZXA 1M1YA 1IQ0A 1N3YA 5IJ9B 3Q5GA 4W6ZA 2XNDD 4UHEA 1YACA 1SG9A 3W05A 5L4LA 3SVLA 2HKIA 3OFNA 5BT9A 1H4SA 1K8XB 1G4UR 1QE5A 1J1IA 4H1HA 2DEUA 2WT4A 1ECJA 1KI2A 1MAUA 3DA8A 1YDGA 3IP8A 3T7CA 1ISGA 4KAXA 2VQDA 4MUKA 1KL7A 5HTOA 5AD1A 2W8BB 1N2OA 4XRGA 1CZRA 3GJ5A 3P9ZA 4QYIB 2FSUA 1C41A 3TK1A 1W88B 3IS3A 4A8JB 3WLSA 4X71A 4RDCA 4JUBA 3REQA 4NR0A 2R7LA 1EUCB 5J4LA 1A8QA 3DS8A 1G8KA 1PK7A 1TZJA 2BP7B 1HUQA 3LQQA 3QNUA 4FZJA 3U80A 1AH2A 4QGFA 3KKQA 1M2FA 4C3OB 5A7HA 4D4HA 4LHVA 4U6QA 2Y1EA 9ATCA 5EE0A 4MS1B 5AVWA 4DZTA 4GX1A 3PUHA 3JWJA 3QUBA 4IIBA 3ZE6A 2ACKA 1YH3A 1IYZA 3IDZA 2W90A 2E4WA 4S0XA 4R1MA 3K70C 1Q3KA 1Q0TA 3HVHA 3GEMA 4LMRA 5BQXA 5TMPA 1EX7A 1QORA 1S5PA 4JQZA 3WLPA 1IAQA 2QDKA 4JUCA 1P81A 4TM7A 1I9GA 2TMYA 2D1FA 1Q3TA 4CJXA 2CV0A 4OGFA 5GOZA 5JXHA 2FSSA 4HNUA 4QUEA 2BFCB 3NKVA 4EA7A 2GD2A 2Q4OA 4A10A 4C3ZA 5FADA 3LHSA 1R4AA 1EGMB 4JROA 1PT7A 4JCCA 5C8XA 2IS4A 2YOGA 3ETHA 4HZIA 2IPAB 4ZIRA 3BKXA 1CUYA 1OQAA 5B58C 3ETJA 2BMVA 2K2QB 3V4FA 2NVUA 3BHNA