4J0KA

Tannin acyl hydrolase in complex with ethyl gallate
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
470
structure length
454
Chain Sequence
SMSNRLIFDADWLVPEQVQVAGQAIQYYAARNIQYVQHPVAAIQVLNVFVPAAYLHGSSVNGYQRATAPILMPNTVGGYLPGPADDPQRVTWPTNAGTIQQALKRGYVVVAAGIRGRTTVDKSGQRVGQAPAFIVDMKAAIRYVKYNQGRLPGDANRIITNGTSAGGATSALAGASGNSAYFEPALTALGAAPATDDIFAVSAYCPIHNLEHADMAYEWQFNGINDWHRFEPVSGQLTVEEQALSLALKAQFSTYLNQLKLTASDGTHLTLNEAGMGSFRDVVRQLLISSAQTAFDQGTDIHKYAGFVVTGNQVTDLDLSAYLKSLTRMKAVPAFDQLDLTSPENNLFGDATAKAKHFTALAQTRSTVTAQLADAELIQAINPLSYLTSSQVAKHWRIRHGAADRDTSFAIPIILAIMLENHGYGIDFALPWDIPHSGDYDLGDLFSWIDGLCQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tannase
publication title Crystal structure of tannase from Lactobacillus plantarum
pubmed doi rcsb
source organism Lactobacillus plantarum
molecule tags Hydrolase
total genus 159
structure length 454
sequence length 470
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4j0kA00
1XZKA 4ZV9A 2I03A 5JAOA 5IH7A 1Q83A 2QMQA 3G0BA 1QFMA 1LPPA 5JADA 1ZGBA 4X90A 4BRZA 1YAHA 4X6UA 3O4JA 1CR6A 5JZBA 1EK2A 1UXOA 4UUQA 3ILSA 4KE6A 1T4MA 4E46A 5ALOA 1VE6A 2C58A 2PKYX 1UOOA 1K8QA 3H2JA 4OU4A 3KXPA 4AZ3A 5HKAA 5DTIA 1SCIA 1Y37A 2ZSIA 1FFDA 4NVRA 2DHDA 4W1RA 1XZGA 3H2KA 1HBJA 1IMJA 4QLOA 4N8SA 3R3WA 3TEJA 3D59A 1Y7HA 5CT8A 4UBKA 1MJ5A 1N5MA 2CEKA 1GPKA 3G9ZA 2HIHA 3LP5A 4QWWA 3H2GA 2J3DA 1ORWA 3C6YA 2V97A 3DOIA 2HA5A 2XB6A 1BCSA 2BFNA 3H2IA 3H19A 3FYUC 1EB9A 2UZ0A 3M82A 4HXEB 1XZDA 2WU3A 1AGYA 2QRUA 3IUNA 4Y2QA 3TRDA 4B0OA 2J4CA 4RE5A 3IB3A 3N2ZB 4KE7A 2YASA 3T52A 1MPXA 1E5TA 2HU5A 3H04A 4UBLA 3WK7A 6YASA 2WTMA 5LZ8A 1M33A 3EQ7A 5KWIA 2XUJA 5LKAA 4DGQA 1K5PA 1DX6A 2HRRA 2QUBA 1MX1A 3RARA 3OOSA 5FPPA 4P93A 2PL5A 4FNMA 5AI9A 1IZ8A 1IZ7A 2G63A 2XUFA 5CT9A 3WKAA 4HTAA 5ALKA 1GGVA 1W52X 3VVLA 3WWOA 4L3WA 3U1TA 1MT3A 2E3JA 3I2JA 4CG3A 1H22A 2PVSA 3QH4A 4DSAA 1QIJA 1DX4A 4EA6A 3WKEA 1NU8A 3FCXA 2OGTA 1DT5A 4G4JA 2R11A 1EDDA 3ESAA 1J2EA 2JBWA 1GZ7A 4DYHA 3A2MA 3I1YA 1YS2X 1DTEA 3O0DA 3N0TA 4UHBA 3JWEA 3IULA 3BJRA 1FFBA 5CXUA 1QTIA 1R9MA 3G0GA 3QMWA 5ALDA 4LYEA 1EB8A 3H17A 5ESRA 3WL6A 3G9XA 4MJ3A 1TQHA 4BYMA 3V9AA 5IKXA 4UBMA 4BTVA 1GXSA 1HL7A 4ARAA 2WG2A 1CQWA 1XRRA 4FWBA 3BIXA 3WKBA 3C87A 4X95A 5A71A 5JIBA 1XFDA 1XZIA 4BZWA 4X71A 2G4LA 1TCBA 2GBCA 5FDFA 2ORYA 3HZOA 4Y2YA 4J0KA 2JEZA 3WZLA 3ED1A 3WYDA 4CCWA 4G8DA 3Q0TA 4Y9SA 4Y2UA 4FBLA 1CFJA 1LPNA 5ALJA 1QE3A 5JARA 2LIPA 5AI6A 4KAAA 4W9RA 5K3DA 3ANTA 4KE8A 5A7HA 1CUEA 5CBKA 2H9YA 4E11A 3MGAA 3DLTA 1XZFA 1DWOA 3ZV7A 1ZIXA 4X97A 4K6HA 2XUAA 2ZJFA 5JD5A 2D5LA 4KAFA 2BUAA 1BN7A 2VT6A 5AM4A 2W22A 5ALQA 4ETWA 4QWMA 1JFRA 2QR5A 1THTA 4Q3KA 4KEAA 5AK4A 3WKDA 4LKOA 4FOLA 4HS9A 1Y7IA 3GZJA 1LZLA 2I3ZA 2ZJ7A 4QDOA 3HRHA 2ZYHA 2DCMA 2XLCA 3E0XA 2CJPA 4KRYA 4H7HA 4CG1A 1UWCA 4CG2A 2RGUA 3PE6A 4HVTA 5AKHA 3DOHA 5AP9A 3HI4A 3PUIA 1AMNA 2WU4A 2AJ8A 2J3QA 4K6GA 4B9AA 4FKBA 4BATA 3E3AA 3OG9A 4B7ZA 4B0PA 1EXWA 1UT6A 2WHPB 5AKXA 4BTLA 3R3VA 2DSNA 5EHNA 5FUMA 2HRQA 4EY4A 3B3QA 3K2IA 5D3KA 4KACA 1U8EA 4P92A 2OGSA 3WJ1A 1XRMA 1ODTC 3QYJA 1XQWA 2PBLA 4X94A 3O95A 5EGNA 5K3CA 1UFOA 4Y2PA 1CUHA 4TVKA 2WIJA 3EQ8A 4UBOA 4CCYA 2C0PA 1GPLA 3QZUA 3UMJA 4J0CA 1H23A 3F97A 4B82A 1XZJA 3R3UA 4A5SA 2VAVA 2XUPA 3WA7A 1CUZA 5KWJA 3WWEA 4J0DA 4U2FA 1KEZA 1G66A 1XRPA 5BWCA 2WJ4A 5ALNA 4B6GA 4OSEA 4Q3OA 4OYLA 3W9UA 3CN7A 5I9IA 2QJRA 5AM0A 1TIBA 5CW2A 1JU3A 4TGLA 5LP1A 1LNSA 2JF0A 5AJHA 1FSSA 1JI3A 5AKLA 1G4HA 4MWSA 4X7BA 4D9JA 1P0IA 2WUGA 5ALRA 2HU7A 4J7AA 1E89A 4S0XA 4DM7A 4UHHA 3BDVA 3H18A 3F98A 4HAIA 3NOXA 4I19A 4BE9A 4N5HX 5AOCA 1EHYA 2B9VA 5FKJA 4BZZA 2BAGA 1WOMA 1XKLA 5JYCA 3HACA 5AKEA 3W05A 3L1IA 3ICVA 3DS8A 4QE3A 4OU5A 1CV2A 4Q1VA 4OB7A 1K63A 2VJAA 2C0QA 5CT5A 3BF8A 2OQVA 4PSUA 4I4CA 3M3DA 4C01A 3QBJA 3GROA 4RGYA 2C5FA 3WYNA 2PU7A 1QZ3A 3G7NA 3PI6A 1R1DA 4X92A 1TAHA 3STWA 4DMHA 5AO9A 1UOPA 4HRYA 4K6KA 2XUIA 3ZLVA 4UBJA 2WFLA 1C7JA 3SC2A 5IVDA 5ALEA 1ZI6A 5AKYA 1GPNA 3VJKA 3W2TA 2PSJA 2WIFA 3IIIA 1A8UA 5SYNA 4NMWA 3C5VA 5CH5A 1XQXA 1NU6A 4ITVA 1N1MA 3D2BA 1YS1X 2XMBA 1UKAA 4BCDA 3M83A 4AO6A 4GDMA 2AJLI 4Y2TA 2IITA 4CCYB 2XUQA 3OURA 2PU5A 1AZWA 1CUIA 1CEXA 3RK4A 3UUEA 1OXMA 1QONA 2I3DA 2QTBA 4IO0A 1Z68A 1MAAA 2WG0A 3WMRA 5AIAA 3VVMA 1IUOA 2JGMA 3I6ZA 2IIVA 2B4KA 2Z3WA 4ZRDA 3HSSA 2O7VA 3DJYA 3DKRA 3MVEA 2HA4A 1JMKC 2RHTA 2WFZA 3FWHA 3SX4A 1A8QA 5F4ZA 2ACEA 3I2KA 4IH1A 3STYA 2QZPA 5LIPA 4DNPA 5C81A 3KSRA 4U2BA 2Y6VA 1UK6A 4X91A 2H1IA 3QPDA 1JJBA 4LXIA 4TPKA 3LLCA 2GZRA 5AI5A 5AKZA 4BDTA 1VXRA 1QIDA 4W63A 3W04A 2O7RA 2ONCA 2WSLA 3ICWA 2BKLA 4H7EA 2OCLA 3PDCA 2DR0A 3BE8A 1ETHA 3CCCA 1CRLA 4X85A 2BGNA 1E3QA 1CUXA 1FFCA 3HC7A 5CH8A 4FNGA 4FFWA 1BU8A 2EDAA 1XLUA 3R0VA 4U2EA 3WKCA 4YPVA 2RAUA 2XMQA 5HF8A 1TCCA 2JGKA 1MO2A 5T4EA 3RKSA 3IUMA 3K9BA 5ALPA 1VLQA 2XUOA 2C7BA 4ZV7A 1ISPA 5EIHA 1ZICA 4NZZA 3E4DA 1HPLA 2PSHA 1E8NA 2Z8ZA 3AZOA 5HZGA 3GBSA 4DMCA 4EBBA 3AJAA 3DL4A 1JJFA 5E2IA 5K3AA 4J0HA 5LZ5A 2WFLB 3G0CA 2B61A 1VJ5A 2FX5A 5AIBA 4W1PA 5HF9A 4O08A 4Y2XA 2CUTA 3FOBA 3P2MA 1LLFA 1QIKA 4OPMA 5AM1A 4GLBA 3WJ2A 3ZLTA 4BDSA 3PUHA 1U4NA 4QA9A 2XMDA 4WCVA 1AQLA 2FUKA 2VEOA 3AIMA 4INZA 1EINA 1P0PA 2OGZA 4AO8A 1YA8A 2OXEA 2OLEA 4PSCA 3F9CA 3H2HA 1CVLA 1F8UA 5IVKA 3GA7A 1ACJA 4MXDA 3I28A 5ALSA 5AI4A 5IVHA 5E4JA 3VXKA 1TCAA 2QOEA 1BE0A 2PUJA 3O9VA 1LBSA 7YASA 1PJAA 5LZ2A 2PM8A 3JYHA 1J07A 1QTRA 3WI7A 3AILA 2HADA 4WDQA 5JAPA 4AXBA 1RYYA 1KU0A 4OCZA 4DNFA 2ZYIA 2X8BA 1CUJA 4C4YA 1K6EA 1YAJA 1WB5A 3ESDA 2OCGA 1HQDA 1W76A 1QGED 3STTA 2ZVDA 5JALA 5EFZA 2XDWA 4PQEA 2OCIA 4UBIA 4BCBA 4Q05A 1W6RA 1FFAA 1SCQA 2GBGA 3I6MA 3DDUA 4GHWA 2XQKA 3BL8A 3G9UA 3G02A 2WFMA 3TJMA 1EK1A 1QIFA 2HFKA 2DHCA 4AMZA 4UFOA 3STXA 3LIPA 3C6XA 1H2ZA 2K2QB 5EIAA 5CT6A 3RLIA 3WIOA 1MNQA 4AZ0A 1FJ2A 5JANA 1GKLA 4IHAA 5BV7A 1R3DA 2ECFA 3WK4A 5A62A 4PSDA 5EHXA 1WHTA 1VKHA 3W06A 3BWXA 5LLSA 5FRDA 3FNBA 3SK0A 2PSEA 4Q82A 4BC1A 5E4TA 1H2WA 2O2HA 3ZWQA 3H1BA 1ZJ5A 4U2CA 3WK5A 2QJWA 4N5IX 5FPQA 2W6CX 5JAUA 5DYTA 5KBYA 4JH0A 5IVIA 1A7UA 4EY8A 4H7FA 4KE9A 5HK8A 4UPDA 4G8BA 1C4XA 1MX5A 5LKRA 5A7FA 3CXUA 2XMSA 3DL7A 4BVJA 1DQYA 3AZQA 2JIDA 1RP1A 2BUCA 1E8MA 3PF9A 5C7YA 2GYVA 4XWGA 2Y2UA 2GZSA 5BWBA 5C8ZA 1ZGCA 2AJDA 1EI9A 1P0MA 4JEIA 1J1IA 2WJ3A 1L7AA 1VXOA 1XRLA 2JGEA 1W1IA 3F96A 1Q84A 1EX9A 3RM3A 2CZQA 4H18A 1EA5A 1AKNA 1T2NA 3WK8A 1MN6A 1QO7A 1LPSA 2HFJA 2G5PA 1WHSA 3I2FA 5K3EA 3FVTA 4WJLA 4UHDA 4U2GA 3WA6A 3W9BA 4FFVA 1B41A 2HDWA 5AK3A 1BEEA 5FXMA 4FLEA 1R4ZA 2WIDA 3F8SA 1DINA 2WIGA 2YH2A 3LIIA 3MUOA 5AICA 1D07A 2XMRA 1SCKA 5DJ5A 4CI9A 2VA9A 3C43A 3DCNA 1UK8A 4H35A 4M0MA 4EY7A 5HF6A 2HHAA 3NGMA 3V1KA 5AK6A 4E14A 3AZPA 1F0PA 4LYDA 1VE7A 1XQVA 3LCRA 1BS9A 2XUGA 4GXNA 4EUSA 5ALMA 5BOVA 2HA6A 3G0IA 5AKKA 4C4XA 1S8OA 3H0CA 5ALFA 5D7BA 3K6KA 3NUZA 1ZIYA 2WUEA 2RIPA 2GYUA 3CCBA 4P9NA 4PW0A 4BRSA 2PX6A 3LS2A 1LZKA 1ZD3A 1XLVA 3HJUA 4XJVA 5FV4A 4WFJA 5JD4A 2O2GA 3C70A 2X5XA 1LPMA 3BJMA 3IDAA 2GBFA 4W1QA 2WJ6A 4QDUA 3D2CA 4BE4A 2WILA 3A2NA 1E66A 1A88A 4E15A 3KOOA 2Y2VA 5AKJA 5HF5A 5AM3A 2J4FA 4OB8A 5EHQA 3X3HA 1P0QA 2HU8A 2ACKA 4AMYA 2PPLA 4FLMA 1LPAB 3AIOA 4Z49A 1EH5A 4WY5A 1CUVA 5AI8A 2Y1KA 1SFRA 5ALGA 4BAGA 4KAJA 1B6GA 1QIIA 3O4GA 4B84A 3WQHA 5JAHA 5AOBA 1UOQA 4ZXFA 3C5WP 2HA3A 4MYSA 1JJIA 1RWQA 2HA0A 2OQIA 3R40A 3O9MA 4H7DA 2PUHA 2WIKA 1PFQA 4HZGA 3GELA 3STUA 1DT3A 3AINA 4MEBA 3QPAA 1THGA 2XMGA 3I1IA 1DWPA 1IVYA 2I78A 2Z5GA 4PO3X 3HEAA 3EQ9A 4GBGA 4Q3LA 2DHEA 4RE6A 3D3NA 4MEAA 1QIGA 3IURA 5JZ9A 2VAXA 1NX9A 4B81A 5DLPA 4KJXA 1YB7A 3WLAA 4L72A 1MU0A 3VJMA 3FBWA 5ALUA 4L0CA 2YXPX 2VATA 2XQGA 3IUQA 2HM7A 4GECA 2QVBA 2DQZA 2H7YA 3C8DA 4AB1A 3Q8WA 4C89A 2X76A 1ZI8A 4G4GA 3I2GA 4B80A 1GQSA 1AC5A 5FOQA 1ODSA 3I2IA 4NS4A 3WWPA 2WLSA 3B5EA 2QUAA 5DTJA 5A7GA 4K5QA 2XUKA 1JKMA 1XZBA 5HFNA 2VF2A 1UKBA 5E4YA 4AX4A 2WHQA 4YK7A 3D0KA 3L1JA 4WY8A 4DLNA 4PV7A 3U0VA 4A23A 5HK9A 2HA2A 2AJBA 3M81A 2VJBA 3R3XA 1N8SA 4B83A 3I6YA 1AUOA 1OILA 2C4HA 1X70A 5CURA 5LZ9A 5I7UA 2XQIA 4MYDA 2EEPA 1W75A 2CB9A 3WL7A 2Q0XA 3KDAA 1IUNA 2WQZA 1ZD4A 2HA7A 4UFPA 4M0FA 2AJCA 2BGRA 4LIPD 2VT7A 3O4HA 4EHBA 5CMLA 5T4HA 3WL5A 4U2DA 3HXKA 5HCUA 4HXGA 3F67A 2XMZA 4F21A 2BUBA 1KU6A 2Z8XA 1SOMA 4BVLA 5YASA 1CUFA 1EDBA 2XQFA 4ZGBA 3YASA 1EVQA 1WB4A 5K5EA 3R3YA 4AN1A 1ORVA 4BBZA 3GUUA 3I2HA 4UHCA 4DNOA 1HDEA 2JEYA 4EB0A 1F0NA 4AO7A 4OUKX 4IH4A 5AOAA 1O6GA 2RHWA 2ROQA 1QIEA 5AKIA 5CXXA 3DQZA 2BJHA 4DMFA 4GWLA 1QOZA 1VZ3A 3BDIA 4EY5A 4GI1A 3ZI7A 1R50A 4B9EA 4BVKA 5C8XA 1MAHA 3D5EA 3E1GA 1MNAA 4ZWNA 5EHZA 3QVMA 1GQRA 3DNMA 1VOTA 1WPRA 5AM2A 4EZIA 1IUPA 3BIWA 1LPOA 2H7CA 5ALTA 1C7IA 4XVCA 5ALYA 1WB6A 1ZI9A 1CUCA 1QJ4A 4J03A 4BP8A 2WKWA 2V9ZA 1MTZA 3PF8A 2YYSA 4BAUA 1YCDA 2VJDA 5ISMA 3KWFA 5JD6A 4QZVA 3QMMA 4QEKA 3HYSA 3FVRA 5AH0A 1CPYA 4DIUA 4L9AA 3OC0A 4PNZA 4J3JA 2VTVA 3T4UA 1F6WA 1ODCA 4C88A 4DNQA 1YASA 2EDCA 1XZEA 4WDRA 3G8YA 3AUKA 5EI5A 3VJLA 1ZJ4A 5DNUA 2XE4A 2AXEA 3WIBA 3QMVA 1OCEA 5C8VA 2XUHA 2XUDA 1JMYA 3BXPA 3MUNA 1TK3A 1X2EA 3IA2A 5DWDA 3HABA 5HQ3A 2GYWA 2Z3ZA 4M0EA 2H7XA 2WHPA 3OPMA 4ROTA 4UFNA 3VKFA 3FLBA 4X00A 1CIJA 4FBMA 2PSFA 2OG1A 1E8DA 1Q0RA 1CUBA 4HXFB 3PFBA 1QIHA 5CRIA 4PF1A 1UK9A 4FDMA 2B20A 2O2IA 4Y2JA 1QFSA 3QPCA 3FSGA 1WCYA 1R9NA 3WK9A 1SC9A 1QO9A 2NW6A 5HFAA 2RONA 1QIMA 2JGFA 3EF3A 1XKTA 5ALXA 1YB6A 5I8PA 1VA4A 2QT9A 2QXTA 3D7RA 3CN9A 2WUDA 3TGLA 3GFFA 5H3HA 3V1MA 5FLKA 1R88A 4IQ4A 4J0GA 3V48A 4FMPA 4YASA 1ZD2P 5A2GA 2WM2A 1YR2A 3OM8A 2PSDA 4H0CA 4ARBA 1UKCA 2RI6A 4QNNA 3DKKA 1GKKA 3KWJA 1CLEA 3SWWA 3BF7A 3D4LA 5AKGA 4YX9A 4J0IA 2JGLA 3QM1A 3DEAA 5SYMA 1XRNA 3VDXA 3O4IA 4DMKA 1W4LA 4JNCA 1G5FA 5DYYA 3FYUA 1ZD5A 4G9EA 4MQLA 1UZAA 4Y2SA 1DQZA 4Y7DA 5ALHA 5DYWA 4XX1A 3S8YA 3WWDA 3DD5A 4V2IA 2VQ6A 1H2XA 3IVMA 1BCRA 3WK6A 3FLAA 2OCKA 2OAGA 2JGJA 1HKHA 3EBLA 2DQYA 5K3FA 1AURA 2JGIA 1XZCA 3G9TA 5HKBA 1X2BA 4MWTA 4F5ZA 5EIEA 1XROA 4EY6A 2V98A 4H7KA 4MQMA 1J06A 1I6WA 3ESCA 4K2AA 1USWA 4G4IA 4AQDA 4QDTA 1H2YA 3V1NA 5A6VA 1O6FA 4KYVA 2D0DA 5HQ3B 1A8SA 1PV1A 3QITA 4WFKA 4G5XA 1FFEA 3JW8A 3V1LA 5ALLA 5ALZA 1XZLA 1BROA 4G8CA 1G42A 3H1AA 2R8BA 2XLBA 3HLKA 4QDXA 2ES4A 3DYIA 4WFIA 4H77A 5CT4A 5LZ4A 1CUUA 4CIBA 4F60A 5DNWA 2CBGA 4OYYA 4C6HA 5JZSA 4C87A 4FHZA 2Y6UA 1LPBB 2OPHA 2BCEA 3C8HA 4RPCA 2XI4A 4JYPA 3EIOA 4JUIA 4A16A 5AM5A 3WWCA 2QKYA 1AX9A 4G9GA 4LXGA 5ALWA 1XQYA 3IUJA 3ESBA 3KD2A 2XT0A 4GW3A 5J3JA 4FTWA 3UUFA 5AK5A 1BRTA 1CUGA 3ZPXA 5ALVA 5AHXA 2FJ0A 4H7JA 2GBIA 3A6ZA 4IH9A 1XRQA 1U2EA 1N5RA 3FYUB 4QDZA 5FP0A 2WTNA 4JYMA 2ZYRA 4FLFA 5D3ZA 3A2LA 3A70A 2CKMA 5AI0A 2ZSHA 2XQJA 3IBTA 1EDEA 1ZOIA 3D2AA 3WL8A 3FYTA 4LHEA 1DWQA 2V96A 1LBTA 4P08A 1TKRA 4N8DA 5K3FB 3NWOA 4DTCA 4N8EA 3FAKA 1JT2A 1CUDA 1JU4A 5T4BA 2G5TA 1CUSA 1Q0ZA 2HL6A 4Y2VA 1ACLA 4BP9A 1VA5A 5D6OA 2FJPA 1YA4A 3G0DA 4UBNA 5K3BA 5T4FA 4F0JA 2QS9A 4KRXA 2IX9A 4ZREA 2ZYSA 3PICA 1DU4A 1XZHA 4OD0A 4G1FA 4GEGA 4BB0A 1K4YA 1QLWA 5LYYA 5DNVA 4J0JA 1XZAA 1GT6A 4XIIA 4UHFA 3ZLUA 2OAEA 4B85A 3C6ZA 2DFPA 1WPXA 1XLWA 1U65A 3DYVA 3WZMA 2WHRA 4X6YA 3PFCA 2P8SA 4OB6A 1HLGA 5JATA 1MX9A 3VISA 5JASA 4Y2RA 1XZMA 4Q34A 1TRHA 5CTAA 4QLAA 1EVEA 1VZ2A 1CUWA 1L7RA 2QM0A 4RNCA 4CFSA 4KR0A 2VJCA 3STVA 4BCCA 4BC0A 1CUAA 4X3CA 3FSGD 4X6XA 2WUFA 4H7IA 1WM1A 4BAZA 3ANSA 2VSQA 1UK7A 3R3ZA 2WG1A 3C45A 2QXUA 2CMFA 3R41A 3S2ZA 4W1SA 3FLEA 3B12A 5ALIA 2C5GA 2XMCA 1BN6A 1CQZA 4LXHA 1LGYA 4I3FA 3C6BA 3AFIA 1BEZA 1CUYA 5LZ7A 3AIKA 4AN0A 4ZI5A 5KREA 3OTQA 1YSCA 3FCYA 2ZJ6A 1L7QA 4HRXA 4DSZA 4CIAA 4C4ZA 5CH3A 4X93A 3L1HA 4UHEA
chains in the Genus database with same CATH superfamily
1E1RD 3UGJA 2I03A 1FNBA 2GN2A 1WB9A 3FWKA 5JAOA 4GI3A 4EL0A 2OYRA 3EZ7A 4QGHA 4R68A 1D0SA 5E1DA 2YRWA 4S1TA 1YK1A 3TSOA 5JADA 1VYVA 3VNQA 3LL7A 4AY5A 3ROFA 3KDPA 1MW8X 4RV4A 3TCXB 1YAHA 1R9JA 2QP4A 3EIXA 4NNJA 3FMIA 3O4JA 1Y3DE 3R4VA 2H92A 1UPCA 1O58A 2B5VA 3G82C 2QMOA 2IYEA 2WU0A 3N0XA 5GM2A 4DWVA 1GAXA 3QI2A 3UGQA 3C3XA 2CFIA 3D4OA 4EPYA 3TLCA 4Q9JA 4ICIA 4JKOA 5IBPA 1N2CE 4HV4A 2O5VA 4QOSA 2SICE 4E46A 1VE6A 1N0IA 2AI2A 3C4JA 1XCPA 3IHLA 3OTGA 3B2NA 4Q1AA 1EM6A 1UOOA 1K8QA 3H2JA 4KGZA 4OU4A 5IULC 2PYDA 3U6BA 2ZBVA 4HYEA 3LDAA 2IYFA 4QGBA 2PNFA 4AZ3A 2IUTA 3N8IA 2FFJA 1D5WA 1RQLA 2LGJA 1R6VA 3OO1A 3WHIA 3LHDA 1RYDA 1I8TA 3M5WA 4R8RA 3SN6A 3IEMA 4C7BA 3E5RA 1JA9A 2XIQA 2FPGB 1Y6QA 1RZVA 4BQPA 4F4HA 3SI7A 1IMJA 4B5LA 4E4TA 4PX3A 3OPYI 4QFBA 3TEJA 4EUFA 1VE1A 2CFSA 4YAJA 4HY3A 3K6JA 2FN7A 2JKZA 4LS3A 3U9SA 3JZAA 2VUHB 3PNPA 4QC2A 4OHMA 1GNPA 3LX4A 4UBKA 1MJ5A 3CPHA 1ZOLA 1YZHA 4G1MB 2PR2A 3D3WA 5CA0A 1TC2A 2VF7A 4N48A 2R6AA 2OBFA 5K8LA 1T2VA 2EJWA 2F48A 1ORWA 3K70D 1UBJS 3CR7A 3DOIA 1XD8A 4I4LA 2Q2WA 5FWNA 5FL7A 1TCVA 2XB6A 5LSAA 3TLYA 5CFPA 4Q4JB 2BFNA 4M1QA 3EDMA 3FJYA 3R76A 5HSGA 1RHRA 3WLJA 5B2FA 5CXSA 3CRW1 3EGVA 3M82A 4GC5A 4XDHA 2W2KA 5IHPA 3ZTWA 1IN1A 4IGAA 3VHXB 4C1BA 2I91A 3SR0A 3IPRA 3JD3A 1TTPB 2JZOA 4NFYA 3CF0A 4MWOA 5E6SB 4PS1A 3K09A 3N2ZB 2GM3A 2YASA 1ML3A 3GUVA 2FFQA 1Z36A 1TF7A 4YCBA 3T52A 3UUWA 1PR6A 4HNUA 3ELDA 2ODNA 1PDVA 1PNRA 2R96A 1HV8A 3BTOA 3GLSA 4HCJA 1E5TA 2AN4A 2HMVA 2XXJA 2ZVJA 3OZTA 2FQXA 3K2BA 1VCOA 1XMPA 3BSSA 2FW7A 1W5FA 3AR4A 3PUXA 2Z5LA 4YY3B 1S3SA 1IZ9A 3FTDA 1HOXA 3IBFA 4KSBA 1ZHFA 3L8EA 4IHJF 5CAEB 5BN3B 3IOCA 4KBYA 3SNHA 5KWIA 2XUJA 3QPBA 1GA1A 2HN9A 1ZVJA 4NYJQ 2B1GA 3W6ZA 1DX6A 1NY6A 2FF7A 3C5EA 5JNTA 2DTEA 3GLFB 3ZQ6A 2QUBA 4Y7CA 5CLGA 2XDAA 4FX5A 4UU7A 5CLLA 2I9PA 3WRYC 3C98A 3RARA 2RGYA 1JLLB 1FTWA 2PL5A 2NUAB 1EFHA 2OFPA 3JR3A 3HL0A 1A76A 3FFXA 1BU5A 3UGKA 3TRJA 1VL5A 1ENYA 3AB3A 4WKPA 2Z56A 3JVUA 1EXVA 3IELA 5ALKA 5DSZA 2CE7A 4RANA 3E03A 5IBRA 2VP5A 1FSZA 5H02A 4BQEA 5B3KA 1Y1PA 2CDNA 4U6QA 4YJ2F 2MHCA 1J0EA 3PHLA 3QENA 1EGMB 4HDRA 4XQGA 1LTQA 2Y1XA 3A4VA 3FZQA 1E7YA 4PTLA 2EC5A 3QLTA 3UH0A 5EQTA 1OC2A 2ZJBA 3I2JA 1B0AA 4CG3A 3IEKA 3T5TA 1RRVA 3QH4A 2OHJA 1QIJA 3Q7PA 1DX4A 2QPOA 4YREA 1M2VB 5CFOA 1OYVA 1RI5A 3EJ6A 3MUEA 2ZIXB 4O4HA 5DT9A 1KIMA 1EESA 1NU8A 3K20A 5FB3A 2FRDA 3BIJA 2XXAB 1V1JA 1EDDA 3T3MB 1A9RA 2VHCA 1DAOA 1CB0A 4DYHA 2OTCA 2W58A 3T1TA 3I1YA 2VDWA 3UMRA 2LRHA 1E2QA 1YS2X 5JBNA 1RHMA 2P2YA 4IS2A 3CRNA 4RPJA 1R5NA 1TEHA 1VIMA 2O1WA 3O0DA 4KQXA 2HRDA 1WL8A 4P36A 3C3DA 5B58T 3JVDA 4AKEA 2V0CA 3L4EA 3Q7EA 3RYHB 1MC5A 2FPIB 3V2HA 3JWEA 3TI7A 3AEKA 3LUGA 2Q5CA 4PCVA 1JEQA 3RSCA 4LGYA 3WLLA 3ZCPA 2ZITA 4FDLA 4HEA1 3FGNA 3LW8A 4MJ7A 2AI3A 1R9MA 3G0GA 4HH4A 3JYPA 4BVHA 3AHCA 5C7OO 3HFJA 2P4HX 4LZWA 4PN7A 2OQRA 4FBGA 3ZCSA 3HR7A 5DX1A 5TQ0B 5TC4A 1C9MA 1KFKB 5H1YA 1VSUA 2B0JA 2J9FA 1LFDB 2VPWA 4ND6A 4TV9F 5AJVB 1T15A 4MJ3A 1TQHA 2A0XA 2O3TA 1YVUA 4JUFA 3Q2KA 3UK6A 3AEUA 3PE3A 4MUBA 1RPJA 2JK0A 5KVSA 1AKWA 1YL7A 2J3EA 4JOBA 4UBMA 4X3OA 4LC0A 3KTDA 1GXSA 1VJ0A 2AA3A 2IYOA 3DSRA 4R1PA 4FWBA 4QRDA 1AQUA 1SA0A 4MUXA 5GGYA 3WYGA 3SSAA 1RBYA 4CR7A 2PA3A 1PP4A 1LTHR 2Q6KA 2ZRFA 3SFZA 3L4JA 4ZXPA 1X80B 4B1FA 1XZIA 3JASB 2E9SA 1X3SA 2G4LA 3G8AA 4R2WA 3TIVA 5FDFA 3RVRA 4BB9A 1SKMA 4AMGA 2CXNA 5I9TA 1VL8A 4TMKA 3DV2A 2VC2B 5G1NA 5CB0A 4LPSA 1QYCA 4EX6A 3JQ7B 3AU8A 2JEZA 1ZC4A 5EJGA 3TCKA 4CCWA 5DM0A 1XPJA 2QD1A 4HDSB 4QBIA 3TIFA 1K7SN 1L7DA 3P2YA 3R24A 5ECWA 1LDGA 4JYBA 4K6FA 4F3TA 4JFRA 3AO0B 1XU4A 4GT1A 1T6BY 2AW5A 3UY4A 3RC7A 2J9GA 1Z0IA 3C7CB 3IIKA 4G4SP 4INOA 2D2FA 2D2IA 3P4YA 1QFXA 3IRVA 1L5NA 3SQNA 5C32A 5ARCA 4KAAA 5E0OA 3TTVA 5KB3A 1UMCA 4I46A 1DLIA 3RREA 3KPUA 2ZUDA 1RJFA 1W4RA 1U6KA 2YYZA 4KE8A 4LY6A 2UZ4A 1P3Y1 3W8DA 2D2XA 4MUJA 3TE7A 4BGUA 1GQ2A 2NXWA 2FPWA 2Q3DA 2EBWA 2X1LA 4INPA 5TQJA 3B7GA 5B5SA 5H9WA 5J4KA 3N2YA 4DE5A 2GM9A 2QF7A 3SXUB 1Z18A 4MR7A 5E9AA 5K0EA 2IA5A 1PK7A 1ZM4A 4MR9B 1RYNA 2ZBEA 3I0MA 2QG6A 2W2QA 3JQGB 4EO4A 3PFGA 2PBRA 2CCJA 2QBYA 1H05A 2ZPAA 3NOOA 4IIHA 1IUKA 3T1VA 3K1TA 1LRJA 5BQFA 3LHFA 3GK3A 3KB6A 4X97A 5GZ3A 2IOYA 4POAA 3EXHA 4F6RA 4MARA 1QGOA 3LUHA 1KFEB 1X87A 4JFAA 2D5LA 3FVVA 2UXBB 5JWRA 1SIUA 4DANA 4RTLA 4EHAA 4DR4B 2ZSEA 1NXTA 2ZU6A 3M8KA 2C84A 1U0LA 3M5CA 3B8EA 3GDHA 1NFRA 1U8TA 2J9RA 5ALQA 4ETWA 4JELA 3FB1A 1YZFA 4FJ0A 1KI2A 4Z7NB 5BVGB 4DC9A 1J00A 2V6FA 2XGOA 2VYQA 4F85A 3ANMA 1RACA 1DRUA 5DN6A 3AJ9A 3ZIDA 5DGHA 2GJ8A 1PT8A 3A3KA 1JHPA 1UXJA 2V65A 3KO8A 4KEAA 5B37A 4D42A 4DA8A 4B7CA 4PZDA 4EX7A 1QDLB 3GZJA 2M6RA 2MINA 1I5RA 4E88A 4GLJA 4YCDA 3I04M 4LXQA 1YA6A 2AX3A 2D62A 2I3ZA 1JALA 4FE4A 1X0XA 4QDOA 5ESXA 3CRVA 1TRKA 4ZPJA 3BHMA 3L1UA 3KKQA 5FOVA 1JW9B 1E2MA 3ZK7A 2ZYHA 4CV2A 3RS3A 4EHKA 3E0XA 5H16A 3P71T 4BUJA 2NVWA 2CJPA 3IVCA 1OXVA 1U2GC 4NYMQ 4KRYA 2IYLD 3FUVA 5IAAA 3A3NA 3UNXA 4OIMA 4KPFC 3PE6A 3EFOB 4J1QA 3TNDA 4CG2A 2IU0A 5JSQA 1QP4A 1LK0A 1IAVA 3PUIA 3ZGNA 3L0DA 1KE1A 3WB1A 4PNEA 2FW1A 3MMNA 1PJQA 1AV7A 3AFGA 3DW1X 4DA6A 1FA9A 2W2NA 4F6CA 3GLGE 4GPD1 1J2YA 4OFZA 1O97C 1JDBB 3I8XA 2KM1A 4KI0A 3R6DA 4GRIA 4HFRA 4FKBA 5CJPA 1IJFA 4B9AA 1DO8A 2IP1A 2O2DA 5E1BA 4RK7A 2HQBA 4BATA 1UM9B 4BLSA 2YL2A 2V6IA 4B7ZA 3DMTA 3T3OA 1EXWA 5F51A 5AKXA 3NALA 3QYAA 3MCUA 1YDGA 5BSUA 3M9LA 4RVDA 3ABQB 3T7DA 2AWNA 3RBZA 1FVXA 2EX4A 4BMDA 5EHNA 2QXYA 5M34A 1BX3A 3JQ8B 4CM1A 1T1RA 1NJ1A 3KQSA 4EHHA 3B3QA 2JLZA 4BN0A 13PKA 3NBYC 4P92A 1SVNA 2PGIA 5LNK1 2FWRA 3EY9A 3AOEC 4ZAYA 3GR6A 1XRMA 1C8LA 4YJFB 2XCUA 5FI1B 4R51A 2X86A 1ZJZA 3HU1A 2NT3A 3CUSA 4R3UC 2HLNA 4MLDA 3TZQA 3INYA 3NU1A 4CTNA 5L7TA 1Y9EA 4EQ6B 4ZZ3A 2L0XA 1GEEA 1NKTA 1AZTA 1JJVA 1W1WA 1BJRE 2XH8A 2Q4OA 1HYEA 2DLCX 3TKYA 1CERA 3IAXA 4D80A 3A4TA 1FDOA 2W6JD 2C0PA 2HF7A 3QZUA 1W85A 1Y1QA 2OCPA 3NT5A 1L6RA 4J0CA 3AUYA 3DVAA 4RLQA 3I4CA 1X74A 2P2SA 2Z6QA 1KO7A 4JLJA 2R6ZA 4RIHA 4B82A 4NBLA 4A5SA 4YCCA 3ZCTA 4XUEA 1OZHA 1IRXA 4Y1FA 1ZNXA 1DCMA 4P98A 2A94A 4D3XA 5KWJA 3WA7A 2Q1TA 4U2FA 3MHTA 4OHOA 3D0RA 2TS1A 4PLWA 5BWCA 1UBMS 2HRCA 3U3ZA 2DM6A 4ZHQB 1V6SA 5TX7A 4XQ0A 4ZQEA 1LDBA 4ACAA 5F1PA 1DGQA 1CY7A 1V25A 4B6GA 4OSEA 1ND5A 4Q3OA 4OYLA 3KOYA 4BMVA 4KQHA 2F43B 3DXZA 3CN7A 4KUGA 4K0RA 5DE3A 3UJBA 1TEZA 1U80A 5AM0A 3I6IA 4Z9XA 3ZDEA 3ONVA 3VDNB 1A5SB 1NMZA 2EZ4A 4X8LA 4XTCS 3GQBB 3O90A 2E18A 4KB5A 4MUAA 3WRYA 1UP4A 4UAVA 3ZU3A 5AJHA 1HA3A 2R6R1 2N46A 3OBIA 1NN1A 1DIOB 2X4LA 4S1VA 4WCFA 3INRA 3FDZB 4L5BA 4GXTA 1WVMA 5FO0A 4X7BA 1VLJA 1ZJ6A 4YAWA 3VOAA 3LU1A 5AD1A 5CB4A 3ZLJA 1BO6A 3NOVA 1M6HA 4XIGS 2WWVD 1RJGA 1DPFA 2Y1WA 4MQEA 3O84A 3JU3A 2WUGA 4U00A 1XJQA 3BRCA 3NTLA 4J7AA 4TTAA 5BNZA 4QXAA 4S0XA 5F7JA 4C21A 3BDVA 3EPKA 4K3VA 4P5DA 2OD7A 2XIJA 3Q0IA 1RIFA 3ROXA 3CVVA 4UE3S 1J6UA 3LPNA 3P45A 4HAIA 2HOQA 2XDYA 3NOXA 5AJXA 3ZU6A 1B14A 1T8PA 4RA6B 4BE9A 4DSNA 1OFTA 4O3FA 3ZTYA 2LD4A 3K0EA 4JVMA 3RRXA 2QAGB 3OE7D 2OO7A 5G3ZA 4J2OA 1I1HA 5E6RA 3GJ8A 1G21A 2EP8A 4JB0A 1SKBA 2VP3A 1Q50A 2EHDA 3H87A 4QM6A 3HACA 4MPTA 5AKEA 3MJCA 2CXRA 3VH2A 2CL6X 2J31A 4DJAA 2HQ1A 1AK9A 2WOJA 3P9SA 4HDQB 2X19A 1SG0A 1NE7A 3BD7A 3ICOA 3OWOA 5F1KA 5H59A 5I3CA 1CV2A 3AX6A 5KVCA 4ZMRA 3AJRA 4MUEA 1KWKA 1NI3A 3QUQA 2EGHA 2XXBA 1G7TA 4YUAA 1UZMA 2V6BA 2WOOA 4PCLA 1K63A 4OI0A 4PLZA 1Z06A 2XECA 4EHLA 1G8YA 1NR1A 3BE6A 4IL5A 5CT5A 121PA 1X15A 3MB5A 5GONA 3FCSB 4N01A 4C0JA 4MUGA 3FOWA 3KR0A 3MS7A 2PLRA 4EUEA 1QP8A 3QBJA 5B12A 1PIWA 2C5FA 2X9LA 4H1TA 3ND5A 3Q8KA 1ZSYA 1QZ3A 2VZ8A 4DLTA 1OAKA 2P3QA 3I42A 4FOSA 1C9YA 2CNOA 4MW4A 4HF7A 5EKSA 1TAHA 3F3MA 2HYIC 1YDMA 2EQBA 3H65A 4KV7A 1E3TA 3IMEA 1HR0B 1QE5A 5ENDA 1N8KA 3V33A 1FP1D 3MT0A 2C2XA 4D02A 2ZSJA 4II2A 4P3PA 1UOPA 1AVTA 4I8XA 1HNZB 1S8AA 2YDYA 3I3OA 1MZPA 4LYJA 1QKJA 1E79D 4UBJA 1AKRA 2DKOA 1E3MA 3SC3A 2DUMA 4BLOA 3BIOA 1TO6A 2EW2A 1QQAA 4R9RA 3FR7A 4WLOA 2O8CA 4C0SA 4L9WA 1XCJA 4PQRA 3E27A 2QT1A 2CSUA 1B26A 3VC3A 3GRUA 4JS0A 1AN0A 2R1TA 2JNWA 4WBXC 1W88A 5ALEA 1KJYA 5GJVC 2MTBA 4F9TA 3GD7A 5BUQA 4V0SA 3SYRA 5GVSA 3DKPA 5IXSA 1Q95A 2JFWA 1MG5A 1UBRS 3W2TA 2PSJA 2C2ZA 3N8KA 2EBFX 5IC4A 4PN3A 4AAYA 1ODKA 1TPZA 1XYYA 2ZRBA 5E3IA 1BFUA 2ZBUA 3FSEA 4DJ5X 5FUXA 4EHNA 2PKRA 1E0SA 3VOBA 5HRCA 4RXUA 5H80A 4NMWA 3C5VA 1XQXA 4LY3A 2QDXA 4IJVA 1YS1X 4BP1A 2CLDX 4TM7A 2EL9A 2OHXA 1G5IA 3WB0A 3K0AB 4AO6A 1SQ5A 4QRHA 4UU0A 2VBIA 3NHLA 1D2GA 5GAJA 3FNRA 1GPAA 4S3MA 4BNTA 2H5JA 1O5IA 4F4JA 1PZEA 2BZGA 4OLJA 5BMOA 1TQ8A 5EZYF 1XEWY 3GBPA 4E5PA 5LXTA 1YE8A 1C8KA 4YYEA 2IYZA 2VIIA 4MKIA 3RK4A 4JCCA 1MVLA 5HGJA 3H16A 2I3DA 4Z2AA 2F9MA 3FGOA 1PNOA 4X24A 1X6VA 1YQDA 1NZFA 5GV7A 3UV3A 4AJ2A 4HAXA 4JUAA 4DREA 1MAAA 5K0GA 3QBTA 3ENVA 4FYJA 3WMRA 4D25A 3H9CA 4KDRA 1OH7A 1E1LA 3FPBA 3NIFB 3PB3A 3U4QB 2DE0X 5D8DA 4Y1RA 1N2ZA 4KPUA 3AGQA 3VV2A 4D43A 1N6PA 3FR8A 4M9SA 5EA2A 2H5LA 2E4YA 2NWQA 1DI0A 2DLDA 1BQEA 3K1AB 4LMAA 1NMSA 1RM3A 1EEHA 2NV2B 4J43A 5BXQC 2C2YA 5D2CA 1K98A 5E7JA 1PKEA 2JFQA 2XOEA 3BDAA 3HSSA 2O2YA 5DYNA 1TAUA 3DMPA 2WT4A 4PFKA 2DQSA 3AHGA 4N7MA 1OZAA 3TZ6A 2CYBA 2WFZA 3RVKA 1PX2A 5F4ZA 2ACEA 2YIVX 2F90A 3ODGA 4I66A 4S1WA 4I1SA 3HY3A 1WSAA 4BXOA 2NZ2A 3A06A 3FFAA 4HGRA 3SYKA 4HDCA 3VYRB 3C1OA 3U7RA 1Z38A 3FHCB 4J49A 3HR8A 1ZC3A 1T5OA 3GYBA 4Q4CA 1PD1A 1ORDA 1U7WA 3PLAE 4KLCA 2GFQA 4XVHA 1AKUA 4BWFB 4NDZA 2PQ0A 3Q12A 1HNXB 1U8UA 1NPDA 1IPHA 4PGMA 4U2BA 2VXOA 4X91A 1EAYA 3SSNA 2JARA 2H1IA 1NXPA 2RC6A 3DLHA 1SVSA 4ZYYA 3F4LA 5DZSA 3C8ZA 5C1OA 5AKZA 2CEAA 1LBIA 3TEMA 4U6NA 2VPXA 1VXRA 1HDZA 3NORA 1X1RA 2FPXA 3ZD8A 1THMA 1WSWA 3DFKA 3ONDA 4G85A 4W63A 3IDQA 2VDMB 3AV3A 4FDTA 3M0EA 3V6LA 3OSUA 1UM8A 4MVJI 4DMRA 1WQ4A 3OCZA 2E5LB 4NCIA 4M0DA 2BW0A 3ABIA 5C37A 3UENA 1YVDA 2ZE7A 3D6AA 4FFPA 4R4JA 3FFBA 5CVVA 2HCRA 2X7JA 4JD5A 3SMVA 1EUYA 4BGIA 3L0ZA 4J9VA 1U2RA 2CNLA 4MGKR 1OGIA 4DJTA 3BE8A 4ZYXA 5JVDF 2BEWA 5KYGA 1MGOA 2BFMA 5I9BA 1CRLA 4Z2YA 2GFIA 1P4AA 4QPJC 2PX8A 1GNTA 1RMQA 3ZGZA 3UMBA 4QO7A 4Z0HO 4FFWA 4FUQA 3GB9A 2I2BA 4K05A 4OHBA 4FCTA 2WTBA 4FFLA 1WDKA 1Z4JA 3FAZA 3R0VA 4FZ3A 1YJ5A 2BFDB 2RAUA 3U3MA 1XCBA 1MO2A 1PLKA 4GE0A 5T4EA 1EX6A 3I64A 4HMOA 3OU2A 4A8JA 3FPFA 5ALPA 3N2GA 3DOFA 4JKYA 4O5AA 1VLQA 1NUUA 5KTPA 4HH1A 1IZ0A 2QG9A 2OECA 4M60A 1CR1A 2TMGA 2YZ7A 4D79A 3LW7A 2PANA 3Q3CA 4J7XA 1G59A 3MCTA 4KXXA 4HQRA 2D0IA 2P68A 3ZHSA 1ZICA 3P0RA 4C5BA 1Q44A 1VHJA 3U9LA 1KAGA 2Y76A 1F51E 4KQFA 4GRDA 3RVQA 4D6YA 1U94A 3TX2A 4EBBA 1PSDA 3R9XB 4O4LF 1ADCA 3AZOA 2IOFA 5HZGA 3MLAA 1GHTA 4DMCA 5A4FS 4LHVA 4QOJA 3AJAA 4C0WA 4GPAA 2SCUB 2XYVA 1JJFA 2B92A 3AGPA 3CW9A 5EMKA 3G5UA 4K9KA 4L1KA 3OEYA 3KVVA 2VTEA 5LZ5A 2WFLB 4YJ3B 1F8GA 5JHHB 2DKNA 2EIHA 3REFA 2B61A 5TMEA 4BU0A 3TO5A 2J0EA 3BHIA 3T06B 4F11A 1YJBA 1X8XA 2JKVA 3F6PA 1XBTA 3PQFA 3LC1O 3EWAA 4QQKA 1L8OA 2QTZA 2BTQB 3AL3A 5AOVA 1E2EA 1TZBA 4N9WA 1B3RA 3BTSA 3N28A 4L15A 3VO2A 3FKSD 4O08A 3U2QA 2HHHB 5EIOA 5HBGA 1G3RA 1QFJA 3HEBA 1W46A 7MHTA 3LVBA 4Y2XA 1QGUB 2QSUA 3FOBA 3HEMA 3P2MA 2H08A 3PC2A 4KXUA 4Q6BA 5GPBA 3EIEA 4AU1A 1NR5A 2FDRA 1QIKA 5AM1A 1SUIA 1MEEA 4Q02A 1I4LD 3EJWA 1CNEA 1W5TA 3TOXA 1U4NA 4IM7A 1TL7C 1LWNA 3DFIA 2IYXA 1IQ0A 1NLUA 4U0KA 2ZYDA 1NBAA 2QNRA 2QAGC 3X44A 5BXYA 3AIMA 4ZQFA 1S9HA 3PTZA 3T0GA 1P0PA 1NP6A 2JIQA 1RQPA 3QRWA 3VDMA 1IHOA 4XE5A 4CE6A 5CD1A 3IEVA 2XOXA 2VF4X 1RC0A 1AN9A 2NNWB 2PFKA 2RBKA 4A8HA 5LP6B 1V16B 2YHBA 3B1WA 2OXEA 3MMPA 4GPEA 1BXZA 5KQRA 2NMVA 4JJ7A 1NVDA 2Q07A 4PSCA 4RX1A 1I6LA 3A1DA 2X8WA 1EHIA 4NEHB 2EG9A 2IUSA 3KUUA 3EE6A 1O1YA 3VGPA 4DJJA 3L77A 1OAOA 3C6MA 3I28A 5I7EA 1V9SA 4PYKA 5ALSA 5AI4A 2NXNA 3TKLA 4UM9B 3WYCA 4L2IA 1TU0A 1ZW6A 1Y89A 4MKRA 1DEHA 2RD2A 5J5CA 5E4JA 4GUDA 1TCAA 3W3AD 1PWXA 1BE0A 1X8LA 3VXKA 2E87A 5KC8A 1WXDA 3CB4A 1VMDA 4M86A 1T9KA 1D2HA 1GYQA 3GJSA 4F4DA 3ZNPA 3EXFA 3T4EA 1XA3A 3JQAB 4K6OA 1I36A 3KLOA 4EAAA 1RM5A 2BPOA 3HA2A 3P52A 4A4DA 1ATIA 2NYAA 1J07A 1J39A 3PCRB 4NIMA 4ALKA 2IIQA 4M37A 4DS3A 2RB4A 4CT0A 1PU2A 3P97A 4WDQA 5H4HA 4D6PA 2GCPA 4MKFA 1ORTA 3H9GA 1WF6A 1DUIA 1WCIB 4EJSB 5I7VA 1AF7A 4KMRA 4EP1A 1OAAA 2Q21A 2R5NA 2ZB2A 2X8BA 1V1RB 1JPVA 3UHJA 2IYAA 1E60A 3HDGA 3SE0A 5KMGA 2A1IA 1JEJA 1PK8A 3ESDA 1CJVC 3TLXA 1ESZA 3OX2A 5INTA 3STTA 1V3QE 4BBJA 4XD7D 1LWOA 4MYRA 4MW9A 4NL4H 3VC1A 1O6ZA 3FFWA 2W2PA 3AF6A 1ZMTA 2IZ7A 2G28A 3RIMA 4P4SB 2BV3A 4BCBA 4MRMB 4DLWA 4D45A 3S0JA 4Y6GB 3L7AA 2XITA 2I4MA 1TVCA 1MH9A 1N5KA 2HWXA 2Q1YA 2ZOSA 3V55A 1W6RA 1M3SA 2GA8A 3AUAA 3Q9LA 3I61A 1QF9A 2DR2A 4KIUA 2ZAMA 4X1IB 4E1BA 4COOA 2QMZA 3DDUA 1LS1A 1NPTO 1HE5A 1NWHA 4LXYA 3PYLA 3PITA 3BL8A 4FEYA 3WL8A 2OHIA 4OHFA 5JJIA 4TSRA 3G9UA 2V7BA 3LBIA 4R7TA 3DNFA 2VAPA 2C1EA 1HRDA 2B78A 2PFSA 2PV7A 2PQ2A 2HFKA 4M8SA 4RJIA 4WNAB 1K2VN 4UFOA 3WXMA 2R85A 3OU7A 5K8UA 1EWRA 4KOEC 1JH8A 2NU6A 1D04A 3PFIA 1B8VA 4JDPA 1QQBA 1BE1A 1C41A 3BGOS 3W1WA 1MNQA 3BSYA 3MRVA 4F92B 3IPCA 1X1EA 4AZ0A 3EIUA 1AGXA 1T5LA 1O2DA 1MEOA 3PLNA 1GKLA 2O8NA 4HFMA 4PIVA 4LI0A 2UUAB 1E20A 1XO1A 2WZQA 3EZFA 5C1IA 4U8HA 3WK4A 1Z5WA 2IV7A 1EE9A 4NOJA 4RK0A 1Q3TA 3E3LA 2ZI7A 3H5AA 1C3OA 3Q85A 4QYIB 1B16A 1BDJA 4EVSA 5KSOA 4DRXA 4BEWA 2XCQA 3QVKA 4Z9AA 1VKHA 3GMSA 3VPFA 5JFGA 3AVUA 2A5DA 1C1XA 3SJZA 1KAQA 3BWXA 4ETMA 3MD0A 1H1DA 3JQQA 5B6PA 5LQUA 5FRDA 4KTVE 4X1YA 1E59A 3IHTA 4D8WA 1FEZA 3B2EA 4GMKA 4E22A 4HWGA 3TD9A 2DPLA 1WMAA 2RJOA 3DOJA 4Q5IA 4MGIR 5FJJA 1PDOA 1NI4B 3N6XA 4MDEA 3C24A 2I55A 4FDUA 2ZSFA 4GXRA 2H16A 4ILEA 5L4SA 4YPFA 3MRSA 4LHYA 4J0FA 1FS6A 4J90A 1WV0A 1OX6A 3UT5A 4CM9D 1GRNA 4N5IX 5B2ZA 3K92A 2W6CX 1NKVA 5FNVF 4WN9B 4HDAA 1R74A 2BT4A 1OTXA 2A5YB 1DJNA 3AOGA 4I9HA 4JH0A 5IVIA 1FE8A 1E2DA 1CQJB 4LNHA 4UMFA 3NMUF 4LMPA 1IRIA 5EOVA 5AVUA 4UPDA 3TQHA 1UMKA 1XK7A 2XVAA 4L6AA 3GJZA 2G06A 2CLMB 2OV4A 3AXSA 3AEYA 2YW9A 3HCCA 3UXHA 2X6RA 1FU8A 1EM8A 4BFLA 1VIVA 4MVJF 3QE0A 1H3FA 2F8MA 3RUHA 4Z0PA 3VPXA 3CC8A 1I7NA 2PH5A 1SHJA 4V0KA 4BVJA 5BQ3A 1FX0B 3NZEA 4RHCA 4H16A 1OH8A 1XJCA 1C5KA 1VTKA 2WYUA 4GQAA 1Q0SA 4HTFA 3PF9A 5C7YA 3SIRA 1OLXB 3U7IA 1I13A 4ZYWA 5AVZA 5LQRA 3R6TA 4G24A 4H6XA 1MFZA 4EJMA 2X0NA 1W9MA 1CLUA 2NUBA 1JG6A 1RAGA 2H4XA 3BFKA 4YRBA 2WKPA 4ZYVA 1T0UA 4NH0A 4YHHB 5DEIA 4JEIA 1J1IA 3QVOA 1EZ1A 2RK3A 2WJ3A 2H1CA 1JV2B 4EM6A 4ND1A 4G0NA 2O07A 2F3QA 5JC1A 3FPHA 2VTKA 2QTRA 3DZGA 3ITDA 2MSWA 2Q4BA 1RE0A 4HEA6 1XRLA 2ID7A 2JBAA 4LK2A 4N7JA 4NC9A 1W1IA 3RVDA 4JJ6A 1RTTA 4LHXA 3T38A 4MGZR 1R0LA 1Q84A 1EX9A 5HR5A 3SQMA 2N75A 1IHXA 1Z0AA 1UIRA 2AG8A 4AP6A 4CQNA 1EA5A 5JMPA 5CDHA 4DCCA 4YLGA 1TM7E 2M32A 3ZV4A 5C8YA 1ZITA 2QQGA 2OM2A 2G0TA 2RHJA 1YQWA 1QCCA 1Z8NA 2EV9A 2FGJA 4Y6OA 3TZEA 3PQEA 3CWQA 3GFOA 4ATNA 1CBUA 1BDMA 1LPSA 1OBCA 4B6JA 4DZZA 3BK2A 1E9DA 3WOVA 4FHGA 4OHPA 3VZCA 2YJ4A 1BVUA 1W5AA 2ZRIA 4Z8XA 1LI5A 1AQJA 1MT0A 1C0PA 4JVLA 4OFBA 1YR3A 3PJDA 2KHZA 1RM4A 1W19A 1XDSA 4G5HA 1WTCA 5FFNA 3TDNA 2QROA 5LD2B 4U2GA 2BFOA 3PEVA 3W9BA 1ODIA 2NYUA 4TKZA 3NHUA 4FFVA 2ZRNA 4TT8A 3JSXA 1JLRA 1FUUA 2O52A 1RJ9B 4XYGA 3V4RA 3RS7A 4WX2B 5AK3A 1LNZA 5G53C 3ENNA 4EFMA 4UUPA 3T0FA 4ARSA 1EQ2A 5DP2A 5LBTA 4Q21A 1R4ZA 3FBTA 2DY1A 4JQYA 5EYPB 1DB3A 4ZU1X 2C82A 3NHYA 3Q6IA 1KFCB 4I4TB 5SICE 2O48X 3T7AA 2VJOA 5CA1A 4DV3B 2Z2YA 1D07A 3RYIA 4MYTA 5JCZA 2XMRA 3KVOA 2VK1A 3FSRA 3G68A 4DQVA 1H1TA 1EJ0A 1HTWA 4MCIA 4DLAA 5DJ5A 1SXJB 1QX3A 2RHLA 5EXXA 4GF5A 2ONJA 1DBWA 3GVHA 3DCNA 4M0MA 2HW8A 2XYHA 1YIDA 4FYKA 5CYGA 3KXKA 4Q9IA 3BMOB 2FPRA 2OOKA 3MWEB 5H3LA 2JI8A 3MCZA 1N7HA 3VPDA 4LJ7A 4QQRA 1WPGA 3D0OA 3EDCA 5C3UA 2B69A 1DCKA 3V1KA 1SJ9A 1Y6RA 3S2YA 1WMSA 1OXBB 2ZE6A 4FCCA 5K6AC 2I6SA 2ZYTX 5JG7A 3CONA 1XDGA 2ZTSA 4LYDA 1EDOA 4HEHA 1S4QA 1U8CB 2YVUA 2R9VA 4PBRA 1AQNA 1JQ5A 4C7OA 4QPNA 4XIYA 1VCMA 2HK8A 2ZJ5A 5TS3A 3E82A 1XQVA 2BJVA 2I71A 5HQTA 1E92A 1QYIA 1ANKA 1TYAE 3F71A 2LIVA 1SC4A 3CINA 1P4SA 2D59A 4I2NA 4KN9S 2QVYX 4E5DA 3OFJA 4ZZ0A 1XJ5A 3ZCVA 3AESA 4XLTA 3LNTA 4TQ9A 2NUTA 1E1YA 3L0OA 4O1MA 4ITRC 1CEYA 3H0CA 2ERCA 4ZD6A 4EGJA 4OQNA 5D7BA 4DR5B 1N1EA 1GAWA 1UMDB 1F20A 2H0AA 3E1SA 1N1DA 2FQ1A 4M0KA 5HTOA 1NUAA 1UJMA 2C4KA 4DMGA 4CMHA 2GYYA 1RFLA 2FK7A 3HB7A 4CF5A 4EJSC 4D9EA 2XVYA 2D0OB 1VE5A 3JYNA 4FI3C 4ZJPA 1F12A 5L7WA 2ZUTA 4O2AA 2GYUA 4XR9A 4EVQA 2FEXA 4PZZA 4AX8A 3CCBA 4P9NA 5JW6A 2YWEA 1QO0D 3IEIA 4DZTA 1IBSA 1VGVA 1LBHA 1QKKA 5JYEA 1O0CA 1Z28A 1Z39A 4O33A 1NBWB 1IXSB 2H2GA 3E9YA 2BBSA 1ZU5A 1XLVA 2WDZA 3IH5A 1WXQA 3C7KA 3DBRB 1WW8A 3CRQA 3C70A 2ZIWB 1X8JA 4CQJA 1UANA 2J33A 1MH1A 5FTNA 2B6NA 2VVTA 2YWJA 1D4AA 2Q5OA 3TECE 2NPIA 4POOA 1YB1A 4UVIA 5CA0F 1AHIA 1P7ZA 4W1PA 2QZSA 2IH2A 3DAFA 2QBYB 3AF2A 4QJIA 1U2TA 2BP7B 2LZ0A 2WILA 3A2NA 4BNMA 1A88A 5AVYA 2JVIA 2R97A 1KNQA 1YOVA 3DWGA 4ALJA 3K0HA 4IR7A 3FWNA 4DBLC 1M2OB 4GX5A 5EHQA 4TKVB 1FUKA 1VCHA 2R25B 4GYYA 1Z0UA 1IOVA 3Q2IA 4G26A 4HC4A 1KDTA 1ESMA 1CR4A 3KPWA 5KJCA 1N0WA 3PNLA 4IDQA 3JQDA 4AMYA 2H1WA 3H5WA 5E1MA 3X43A 4BB6A 4KIWA 2FPPB 2ODPA 4D4IA 3BB3A 1LPAB 1CQIB 1JAXA 1H8ED 2AL7A 3QVTA 4N5DA 1CYEA 3CUVA 3X0DA 5HM6A 4FE7A 3HV0A 3WGHA 5FAKA 1AA9A 5AUOB 9ABPA 5ALGA 2H4FA 1R6XA 1E3WA 3TZCA 5KSWB 1IHUA 4BAGA 4KAJA 4W7IA 1BDBA 1B6GA 2JB9A 2P9CA 4TLEA 4XB2A 5F77A 5LNK6 1CJTC 2QTNA 2VJQA 3AHEA 1A5TA 3CGWA 4GX0A 4TYMA 1EP9A 5C4IA 4N5MA 1E2GA 3EVBA 4AMBA 4JUDX 4H4DA 3HYRA 2HA3A 3ZHQA 5ERYA 1SCJA 5BORA 1VB3A 1P39A 1Q0HA 3TBFA 2VRWA 2HA0A 5CGZA 3KQVA 2OQIA 2H2WA 3IAM1 1X0VA 1L5RA 3C8UA 1ZONA 2PFGA 1WHSB 4Y8VA 4YGYA 5L53A 3U37A 2OPBA 1JFTA 3EGXA 4O8CA 3VVBA 1ODFA 5FYQA 4FN4A 2A9VA 1PNVA 3AINA 4G1BA 3ZBTA 4OQDA 1ZNWA 3KCNA 3NBXX 1WQ1R 5IKMA 3NBUA 4IBOA 3I1IA 5DHSA 5BWLA 1H2HA 1RS0A 4QPCA 4M0CA 4M98A 2XSZD 2JHPA 3TF5A 4P3KA 7GPBA 3MLEA 5JH7A 2Z5GA 1SN7A 3A2KA 1UIMA 1A69A 1RVV1 4LOHA 3O9ZA 2DHEA 4RE6A 1QIGA 4WKOA 5TQ2B 1NX9A 1YE5A 3RTGA 3S5UA 3WSWA 2VA8A 1NG9A 4RGQA 1GILA 1ONNA 2QK4A 2WWFA 3OMLA 4KJXA 5DLPA 5AMXA 3UCXA 1F1BA 2P9YA 1EIWA 2Q4DA 3C16C 3KR2A 3GJ3A 4MWGA 4O4HF 3FPSA 4CKWB 4UNRA 1UFRA 3LPDA 4NZYA 2EG5A 5TEWA 1L5KA 3RTEA 4RM2A 3K4PA 3PUYA 2A86A 3DDNA 5DHAA 1OLSA 4DYDA 3MMZA 1FFGA 1HLFA 1M7BA 5L6MB 2XWBF 5J2UA 1NQVA 1Y9JA 3CX3A 5EJ8A 2VATA 3THOA 5LIRA 2HM7A 3JAKB 4MJLA 4FW9A 1ZK0A 4GECA 4P7JA 3F1KA 4ALIA 2HV9A 1Y98A 3NC4A 4TROA 3W9SA 1QCYA 3C8DA 1X7GA 5IUNC 1V9LA 4HYQA 4AB1A 3FFTA 5K4HA 1SUEA 2HCFA 3JYLA 2VZEA 3F8TA 3LH5A 3P20A 2X76A 1ZI8A 1WBJB 1KEPA 2I2CA 4IJQA 2BKEA 1S1MA 2NN3C 2J0VA 2YNMD 1GFSA 1GQSA 1Q12A 3DLPX 1ODSA 1Z2PX 3RJ9A 5FOQA 3T5AA 5I7RA 2BRUC 3WWPA 2E49A 4D9GA 1BW9B 1CQXA 1GNRA 3DTVD 3S68A 3ZE6A 2Q0QA 3B5EA 1CE8B 4ENPA 1YJQA 5DTJA 4PQFA 1KK1A 1GKYA 2ZUBA 3KE9A 4ERXA 5LU9A 1ZUHA 2DUUA 4MDHA 4P38A 4PLHA 4D6XA 2V0GA 3ZV6A 4D8XA 3KVRA 4XAQA 2O7QA 3VM6A 1NBMD 4KP7A 2AOUA 1UJ2A 2VYFA 3C4VA 5AXDA 4DILA 3AW8A 3HM2A 1IOLA 3VKWA 5I9MA 4DLNA 4JSTA 4QL3A 5HK9A 3M1AA 4J29A 3QEMA 3V4VB 1KS9A 2VJBA 1TK9A 5TPZA 5JZMA 2Z8YA 3TOZA 1NR7A 1OWMA 1ZA1A 2WV7A 1MA0A 4LBZA 3H1PA 5FLEX 3FTCA 1LLDA 3RFVA 1PVOA 3C48A 4K0KB 4MWEA 1RLJA 3G5MA 3OIWA 1KJWA 1SU4A 1USGA 3EA4A 3I32A 3IVXA 1G2OA 1G16A 2FRDC 4GR5A 4PC3A 4D2IA 3VGJA 3F7TA 5LD2C 2D06A 3BPSA 4ZMSA 3C5CA 2P5SA 1QKIA 2COKA 2XQIA 4Y0AA 4Z7QB 1ZGJA 2EEPA 5CM9C 3L6OO 4AYXA 1MJGM 3TS1A 1U7OA 2NO6A 5FADA 4WOBA 2ABWA 4LN1A 1EQAA 3WL7A 5BW5A 2I1LA 3ORYA 3G2KA 1IUNA 1ULUA 4I1VA 3GFRA 2Y1LA 1GTZA 1B8NA 2FG7C 2GR9A 4FS3A 4YO8A 4CL3A 2AJCA 1NUQA 4YJGA 4O2BB 4MHOA 3L7JA 1FQOA 4DUGD 3OLXA 1WO8A 3V8EA 4PTYA 2EKBA 1ICEA 4CVNA 5DGXA 4YWHA 1UDRA 4YV1A 3OLCX 4PCAA 4KUEA 4RACA 2IUYA 1RXYA 3IB6A 1SXJC 3U4CA 4GL4A 4J3FA 5CM2Z 4G0PA 4HG2A 4M7OA 4MRVA 5D3MA 4BGEA 4E1AA 1UWLA 3KOZA 3WJ7A 4CEIB 4EHBA 2ZRMA 1HY3A 2CNWA 1Z4QA 4X20A 5FULA 1Y8RA 3G2QA 3HXKA 1MQ9A 4Q3CA 4RXMA 3ZDFA 4CTJA 1K86A 1OXUA 4BMPB 4BNNA 3W6PA 5KTKA 1KKUA 3ONEA 4V3BA 4MVJE 3F67A 1TO2E 2ZZMA 2WSBA 2XMZA 3G8CA 4NJMA 3RIYA 2AUNA 2BUBA 4LSMA 3OQBA 4Q3EA 3HUEA 1YJCA 1IEVA 5HMMA 4DABA 3OEHD 4KWHA 1PLJA 2G04A 2VWHA 4QT0A 5HUQA 4HUTA 3KPVA 4EKEA 1U2QA 2VSFA 3Q3VA 4K6CA 5ULLA 3VTAA 4QM7A 2XBMA 4J8PA 4LJKA 1A82A 5JDCC 3D9QX 1BKDR 3OPNA 3HCNA 1HDCA 2ZJOA 1X7HA 3O03A 4QULA 5K5EA 3R3YA 2E1PA 4RFSA 4XPZA 1C30A 5A9SA 2N42A 3RADC 2IHBA 1U0GA 1TQ4A 1E3EA 2GWRA 4LDPA 2O1SA 2Q3CA 4LJ4A 4ML3A 5DCYA 1UR5A 2CFRA 4O63O 4MUMA 2CD7A 1NW9B 3HY4A 3KSBC 2VJMB 2GJAA 4RZHA 1UFKA 2Q3LA 2XZDA 4WWHA 2NZYA 2P27A 5AOAA 2FE1A 1Q1ZA 1HETA 3IAHA 4RZUA 1RQXA 1Y80A 3A10A 3RDPA 2VYCA 1NULA 3MEQA 2IZOA 4L85A 4TV8A 3PT5A 3JRWA 1KZ7B 4EB6A 5BT8A 6PFKA 2ROQA 3H5OA 2RSLA 3W77A 5KKAA 2IE8A 1XL1A 5AKIA 2VP9A 5FA6A 4OMUA 2BJHA 2NQ2C 3FCOA 4Y6PA 3FDFA 1JEEA 1NUSA 2BD0A 2R48A 3GXBA 4GWLA 3H7AA 4UZFA 3UFXA 2J3LA 4EY5A 1JAYA 2E4ZA 2F3TA 4GI1A 4IQ0A 1WZUA 4XWAA 4Q1DA 2GTHA 1V4BA 2C97A 3GUZA 5F76A 3T3IA 4WTOA 3QX9A 3RAGA 1HLDA 3WFJA 2EZ9A 5JY1A 4R1TA 3D64A 3LGSA 3HP7A 1Y1LA 3THRA 4CM6A 1PWEA 1AH2A 2E2WA 1O96A 3E1GA 3EW9A 3GBVA 5KWVA 3FMVA 1V7CA 2YWHA 2GRJA 4XA8A 1R5BA 1WPRA 2Q3HA 1IUPA 2REOA 3KV1A 4RH3A 2I6TA 4JQZA 5AR1A 3F6BX 3AG6A 1DC7A 4Z1MA 4EECA 2XX3A 5HUJA 4NI5A 4G5GA 2DCUA 1WB6A 4JYZA 1KGDA 1TF5A 3IEXA 1X42A 1T5DX 4HX5A 4I4NA 5HYVA 3SS9X 2JANA 2VK8A 2FRXA 5EZQA 5FBRB 3N6VA 3KC2A 3PSAA 2ZIZA 4PYOA 5ILQA 1QV6A 3BORA 1WUKS 1NM5C 3CBQA 3CX6A 3ZCRA 1PQ4A 2GNOA 3DMGA 3DLBA 3TMKA 1MTZA 5B3JC 2O1XA 4RH0A 1A9TA 2JIPA 3AKDA 3IJEB 4A6XA 5IYZB 3PF8A 1BH6A 2VRCA 1TJ4A 3CZPA 5HNKA 2FX2A 1VECA 4ZQIA 1VLVA 1UAGA 1AKMA 1J70A 2QB5A 3DHNA 1OOEA 1Q21A 3GIWA 3N3AC 4AF8A 2UYCA 3UATA 4LF9B 3VSCA 1Y5NA 3TR6A 4PPNA 1C3LA 1Y3FE 3RRBA 4LG1A 3FCEA 2X5NA 3QMMA 3RSLA 2YJ3A 2ZFUA 4L0DA 4MW0A 2AEMA 3E2PA 4HDMA 1CJUC 2JA2A 3MWKA 4DIUA 1X7XA 4MYHA 1W1UA 4Z7JA 3SLRA 3G8BA 5FBQB 2NU7B 3BT7A 2P6OA 1GLNA 1YIAA 1P6UA 1PFWA 3E5HA 2VTVA 3FMGA 4FGKA 2I3GA 3QKIA 2WD7A 3TIIA 4BLRA 4QYWA 1K92A 5EIWA 1CULC 4LHZA 1SKAA 3C4QA 4LSGA 5DW0A 5DXFA 1Z73A 1L4EA 1UEJA 1UZNA 4O1IA 4JB2A 2Y0CA 4IIVA 2EJTA 4V0LA 3SIXA 2R4UA 3S40A 3MUFA 4PAQA 1JYSA 1DEKA 2CKDA 1PHPA 1H2FA 2EJVA 2PD6A 1CVIA 3KJGA 2XUZA 1QZXA 2AMYA 2EDCA 3NWPA 2E4AA 2FHSA 4KN6A 1XHFA 2KBFA 3W4KA 3LYUA 1OI4A 3KL2A 4H59A 1Y42X 2AN9A 1Z3IX 5FNZA 3DLAA 3RHZA 1SQGA 1VL0A 2IXAA 1IM8A 2N9UA 3T5CA 4F93B 1U8XX 4MS3A 3HVRA 5LMUB 2O3QA 4QICA 3I9MA 3DOCA 4K1XA 3KKPA 4GKVA 5FUWA 2HZBA 4B3IA 5B7PA 2H1OA 4MROA 1Z34A 3A04A 2QY6A 3NRJA 4KLZA 1M1NA 1ZKMA 2O20A 5ITSA 3AL0C 1LF5A 1CP3A 4GZ3A 5HOQA 3OJCA 1ZJ4A 1K0FA 4Y30A 5J59A 4CTMA 2AXEA 2X2EA 4CQMB 2FQQA 5DNUA 3O1HB 4QTYA 2VBFA 4PLFA 1OCEA 2X8JA 1C29B 3GGPA 3S1AB 1FBNA 1Z0ZA 5EZ6B 2BMFA 3X1KA 1P9LA 1VLZA 3EGWA 4X60A 2C77A 3BXPA 5EVCA 4JENA 1IBCA 1D1TA 2LDXA 1ULHA 2H1FA 2UUOA 3RUIA 1NF3A 4D98A 5HQ3A 2J08A 1NF9A 3Q72A 2H7XA 5DBEX 1Q0LA 1G6OA 2C5HA 2WHPA 3OPMA 3NHSA 3R3JA 4TKMA 3ZE9A 2GPJA 2X8LA 3DXXA 1OT3A 4GQIA 5JDIC 4JI8B 5EE1A 4OI1A 1MIOA 3N8HA 2B83A 2Q3MA 3DDZX 1GRQA 1O9GA 2DLNA 3LQKA 3GNQA 1ISFA 3N2GB 4EGFA 4AWXA 3D3QA 4TXMA 3GP3A 4CTKA 1E8DA 1BJKA 1YZKA 1N0UA 3QQ5A 1T5TA 6ADHA 1A5BB 1R6DA 2GDJA 3F74A 3WE7A 1IZZA 5CRIA 4BX0A 1IHYA 2CW5A 2QVZX 4EG3A 3OAAA 3RSZA 4OP2A 4RBNA 4GOKA 3UAZA 1QG2A 2DPXA 2QLTA 1OXXK 3Q9UA 4GMXA 3NHMA 2JGRA 4IXDA 2F1RA 3MPUA 3QPCA 3U3DA 1XLTC 5CEEA 1JEOA 5FEUA 3DCIA 3GPIA 3OT5A 4WESA 2Y1GA 3LQ4A 1GG5A 4X7PA 3CEAA 2FP4B 2BEVA 3SS8A 5GONF 4NBTA 1H0SA 3LQRA 1PJTA 1BSVA 1EAMA 5TXGA 1SC9A 3GT4A 4CLHA 4OBEA 6GPBA 3BJIC 2QM7A 1TM4E 2QTAA 4KMSA 1QIMA 3EF3A 2WKRA 3DOOA 4WN3A 4ESOA 3QVXA 1DXOA 1RAFA 3C41J 3EQ2A 5L4NA 4LF8B 2QJFA 5F7ZA 4O5OA 3SJBA 3LKZA 3KBOA 3T5GA 3MTGA 4BHTA 5CU7A 1NF2A 2WUDA 2QL7A 2P9BA 4IW3B 4JCOA 5CVCA 3O2QB 2F1JA 3PIDA 3QELB 5H3HA 3V1MA 1I5EA 1Y7LA 1FFYA 1XC7A 3RHTA 4P86A 4KIJA 2PRKA 3V48A 5COBA 5IUJC 3PV0A 5D86A 1QG0A 2AW3A 1KYVA 4K9QA 5HS6A 2QUZA 2KLBA 4CDNA 3FH0A 4P35A 2YICA 2VYVA 4RFVA 4BQRA 1VIDA 1BJTA 1WAMA 2L42A 3M33A 1A9OA 5LWHA 3R7DA 3ZWXA 1NYQA 1L4KA 4IX1A 4LBYA 4IEFB 4M54A 1L9KA 1LY1A 2UDPA 2PT9A 1RWKA 3C15C 3LLUA 4PSAA 3GMIA 4L5AA 1UKCA 2RI6A 3ZR4B 2HWKA 3TZLA 3HWSA 1K89A 1M2FA 3IODA 3AUTA 4NU0A 3EF0A 3A6GA 1H0HA 1JBEA 1XTSA 2HY7A 1YC2A 1ZMXA 2P11A 2WBLC 3B20A 1AMUA 3UCFA 2QMEA 1EUCB 3KT3A 2YOFA 4WK2B 3V34A 4HVLA 1F2TB 3B3AA 5BY2A 1DQPA 3DEAA 1XF9A 1YI8A 4AMUA 3H1GA 4KSYA 1XRNA 4ZV4A 1AGRA 3IUPA 4XQ9A 2BI7A 3HWRA 1ZSNA 3RCBA 2G1PA 4PC6A 5SY4A 3L8HA 2PXAA 1I2AA 4N5NA 2BMVA 4W5WA 1M0EA 4JNCA 4FN5A 1NV8A 4LSWA 2RI0A 4YBZA 4YXWA 2FAXA 3FYUA 3NNDA 3DE4X 4X54A 3V5NA 3LBAA 1VJTA 1R00A 1U3TA 5LXTF 2OUIA 2VHYA 4CMEC 4CMAA 2DKFA 3BMCA 5BN5B 3WYFA 5ESDA 5F52A 2AZDA 4IJKA 5J47A 4U7HA 2IKSA 1XIVA 4F4IA 3EXFB 4HNVA 4DV6B 3PXAA 4J1NA 5HW0A 1P0FA 1W0JD 3O8RA 3CLTC 3TZKA 4ZCTA 4UQOA 1U0BB 4HGYA 3BWBA 3KXDA 3KAQA 4Q24A 4V2IA 3X1JA 1VPEA 2B98A 4F1KA 1E6KA 1JR3E 5F7OA 1RHUA 4MV4A 4MI3A 3WK6A 3U4IA 1KSJA 2AFHB 1P5JA 2PMBA 4B4OA 5IN5A 3PD7A 2GQ0A 4QUEA 5D5PA 1HKHA 1JA0A 4RQUA 2VFAA 4X41A 3AKEA 1RJEA 3Q98A 2H1RA 3W5BA 4HWTA 1AURA 1KSHA 1A98A 5A02A 3PYXA 4OM8A 2OYCA 1SPBS 3H05A 3VU8A 4CR8A 3DNPA 2CJWA 5F7XA 3CX4A 2O8FA 1LK5A 4LCEA 3QU9A 5IAOA 3O1JC 3PE4A 4DIFA 4F5ZA 2GN4A 4LDNA 5IASA 1AQYA 1GDHA 5EIEA 4DA7A 2J85A 1XROA 5H5JA 3L7BA 2ZWOA 4X8MA 4H7KA 3SGLA 3UB4A 3UA3A 2ADFA 3CLRD 1RRKA 3HVHA 4RIGA 4DHWA 3KHKA 1BVYF 1BH2A 2GF2A 1XDUA 2WJWA 4ZMBA 3M6LA 2WIBA 5E7IA 1T1GA 3E9ZA 3P19A 3L8FA 4WBNA 4QDTA 1YVPA 1G9XA 1H2YA 1YI0A 1KGSA 2ZYGA 4ZGGA 4MUHA 1KI9A 1O6FA 5A6VA 5DBFA 5SY6A 3ZE0B 3P8ZA 3GJTA 4IY1A 4OK3A 1A8SA 1PV1A 5CNMA 3NBKA 2EIXA 1KFBB 4K1LA 1TM2A 1OTYA 2XEDA 2Z95A 4MAAA 1FRNA 2YV4A 2CZGA 4GX1A 3GPLA 4MYCA 2CLHB 2AVNA 5DHRA 5IUKC 2YWDA 4DCPA 4WFKA 3THXA 2EKQA 4Y1GA 2XGMA 4AICA 2C1XA 1XAJA 2FYTA 3G79A 4MWDA 1F8XA 2O5RA 3GJQA 1LNQA 5K8JB 1XNJA 3NC1C 5KPJA 3MERA 3M1LA 1XZLA 5ITZB 1L7XA 4TRJA 5ENZA 3QI7A 2YIJA 4ZAVA 3MW8A 1L3IA 3GLIE 4EF4A 2FY8A 2OO3A 4G8CA 2IYUA 3H1AA 4PG4A 2G36A 1CDOA 3GCGA 4BUZA 5KTYA 4LSZA 2XCLA 3TRFA 3B3JA 4AVYA 4B3XA 3MINB 1VKNA 3UV7A 1C3OB 4XTRA 2A57A 1X7ZB 5DX8A 3K6SB 4JC0A 2WWHA 4ZO7A 3K73O 3M6FA 3ON5A 4GGPA 4I50A 4QDXA 5IJXA 3TQRA 3ZGLA 5BSWA 3UXEA 1K8ZB 1M6EX 2PN1A 3D6HA 1V1MA 3RROA 1GTL1 3OZ7A 3W0LB 3HBNA 1F06A 1U0EA 3KTFA 4ZI3A 1KETA 3ANYB 3GWZA 3PQ4A 3CZAA 5K9ZA 5CT4A 4GE3A 2B7LA 3D1VA 3DR3A 2W6MA 4XD2A 4BNJA 4CF3A 5LZ4A 4NBRA 3IFSA 1MR3F 3N86A 1BHQ1 1LH0A 3SBXA 3IKTA 3P94A 5B2EA 1GG2A 1SY7A 4DMLA 3QWBA 3I0NA 5JCXA 4E2YA 3LOQA 5JZSA 1A71A 3AT1A 4IIJB 2G08A 2IS1A 1FMLA 3GA5A 2IS6A 4O4JB 2BLNA 1ZGHA 2Y0BA 2ZB8A 5DCUA 1P1HA 1UPBA 1J56A 4H1VA 4B75A 1Y63A 3URMA 2EZTA 1E7QA 2F64A 4MI6A 4CIYA 4GKAA 5IKPA 5BYBA 6ABPA 3DAPA 3TLKA 2BN4A 1MABB 2YMLA 2GESA 3MTDA 2QZ4A 2DH5A 2J3IA 4G5OA 4C7XA 5CLJA 1JL3A 4JYPA 2XZTA 3VHRA 4DZRA 4A16A 3BBPA 4MO2A 4D0RA 3VRHA 2GD2A 2YYYA 4M6WB 1N9GB 3INTA 5A04A 3P9QA 2Q46A 1XTTA 3QHPA 4KQ2A 2R0QC 2XRZA 1XN4A 2BHSA 3KT0A 3P5SA 4MRNA 2QKYA 3GRCA 3K6RA 3AR9A 3USZA 5CXQA 4GZ6A 6NULA 1FQWA 3ONWA 5C8DA 3KL4A 1YI1A 4NH4A 5AW7A 1GZHB 1IXRC 4LDAA 1Z0SA 1ECFA 1UFVA 1ZIPA 1L8QA 2C2KA 2IPOA 4H6PA 4I8IA 2XT0A 3VI4B 4GW3A 1AUQA 2HWYA 1GPMA 3SEAA 3VZSA 3PEUA 2HQRA 2XTZA 1YCFA 2J30A 1YC5A 3WB2A 4IDCA 5AK5A 4FQ7A 2C5BA 4LJ9A 5EE0A 3ZWPA 1O8BA 3F46A 5J23A 3ZDCA 4R01A 2FJ0A 2FUEA 2W6QA 4H7JA 4FFSA 2VZLA 3LM8A 4K9DA 3TL2A 3REQA 1RAIA 2P75A 2QTMA 1GTVA 4IH9A 4QO8A 1SVMA 1U2EA 4GOMD 2OA0A 3OA2A 3N74A 2XT6A 3HHEA 5GADl 2G88A 3ETHA 2ZJ2A 4FGZA 4G0XA 4PZLA 1R8QA 2OY0A 3A6PC 1K0UA 3WLFA 1ZAKA 4MV8A 1WABA 3SY8A 1OLUA 3T3PB 2WTNA 4WPGA 1O7JA 3SKVA 4IYJA 3T9AA 1R15A 5L3QA 2ZYRA 3CUTA 4KOAA 4UNIA 3MNFA 5D3ZA 4G23A 1XG5A 3WOHA 2PL1A 5TIIA 1ZBQA 4URWR 2CKMA 2QUIA 3GFBA 3H75A 1U8FO 5AI0A 4CKBB 2QRGA 5FR1A 1K3TA 1X7WB 2Q4RA 3LDFA 2WSSD 2MCFA 3DB2A 1E6MA 1BCRB 2ZSHA 2JFYA 4MR8A 3B6KA 3V8PA 2C7RA 1C4KA 3KLBA 4EI7A 1P1JA 2OBLA 1TLTA 2DQKA 1M10A 3DO6A 1YVEI 4MYUA 1KI3A 4BS9A 2GS9A 4NYJR 3Q0EA 2VJPA 4P08A 1CW2B 2BBTA 1ZIOA 5FOUA 4RD0A 1NMQA 4N8DA 5K3FB 3KYDB 3GJYA 1FLAA 1Z5NA 2WPDA 3AR2A 3G2MA 3TW6A 5K03A 3I01A 4EHDA 3VC2A 1W48A 1Y1TA 2MJLA 2X5KO 3MWYW 2FSFA 2G5TA 1CUSA 4R1SA 4R5HA 4ZOBA 4D9NA 3V1TC 1Y82A 2HL6A 3MRXA 2YV3A 3RYTC 4ARZB 2QRMA 3ET4A 3I9JA 4H3HB 4TYYA 2WNSA 2VR1A 4Y2VA 4BMSA 4BP9A 1GRVA 5F1OA 1X7YA 2FB9A 2VYND 1JB9A 3L82B 3ZU5A 5CLHA 1JSCA 1VA5A 1PEYA 1ZS9A 1O0BA 2VWPA 2R60A 9MHTA 5JXHA 4UVDA 3AYXB 2Z83A 4C3VA 1D1SA 4MQBA 5BOSA 1SXPA 3FUCA 4YDSA 3TTWA 5CA1B 3I09A 1DG1G 3D8BA 1Y3HA 3K70B 5C5EA 1P61B 2ZYSA 5FLYA 1C8VB 3OHPA 3PICA 1E2PA 4JLAA 2HIGA 4NBKA 4PRZA 1TYEB 5AKLA 1JKXA 4GEGA 3M6IA 3B82A 4XIFA 2OCYC 1YZ3A 1K4YA 1QYRA 4IRXA 3BKXA 2GNPA 3ZKAA 2CVOA 3UG7A 3RU3A 3HNOA 1EVJA 3IJ5A 4J0JA 4IFTA 2R00A 3L02A 1YHNA 4XIIA 4TVOA 2GAAA 1FRFS 5IP5A 1BWSA 1QRTA 3W5SA 2PMCA 2ZUVA 3C6ZA 2DFPA 3AEQA 3GH3A 3QPUA 4P34A 5FFFA 5G40A 1V4VA 1WPXA 3KQKA 4KV9A 2JHCA 5REQA 1B1AA 3GZ4A 3JD4A 2JD0A 2GZMA 1ZQ9A 5BN4B 4NKRA 4PSKA 1H2BA 3ZW9A 3RSOA 1KH2A 5DNCA 5JR3A 3E0QA 5G0WA 1FIUA 4WLEA 3ZHUA 3CKKA 4R8KA 1OV4A 3I12A 1T1SA 5DLEA 5CDFE 1MDFA 1Z5VA 2ZR8A 4FDVA 5EMJA 4BX2A 3U81A 3EG9A 1XXLA 4UQLA 1SKQA 4Y2RA 5DYIA 4HADA 1EGHA 3SVTA 1UBHS 2HWUA 4PZYA 4AJPA 1E1QD 3G1TA 2HNBA 2AJTA 3GF4A 3IAAA 3LYLA 4GNRA 3RJZA 4E5NA 3QTLA 1T36B 3AVYA 2VF8A 2VDUE 1DC6A 1N2CA 3PQCA 4QLAA 1CUWA 1H6BA 4PO9A 5HKKA 4FZ5A 3CO0S 4CFSA 3LNCA 1G21E 1MTOA 3ZHXA 4RVCA 4EEZA 1ID8A 4FKMA 1T8UA 2C4MA 3RSQA 4R69A 4QU8A 3H8VA 4XFJA 5JQGA 4BCCA 5JAZA 2IHKA 3A4LA 2WAXA 3X1YA 2ESRA 4FHDA 4D8VA 5IZCC 2GF9A 2ZJYA 3W5DA 3SXJA 3OPQA 2PUTA 3UQYS 4BJ3A 3MOSA 4PG8A 2B37A 2IODA 3D8NA 2CLIB 3JALB 4BAZA 2VH5R 3QE3A 1KZGB 3UEOA 1BX1A 2JHFA 2ZWVA 3INNA 4JR0A 1E7RA 2AC4A 4L8LA 4S1PA 3TLBA 2IXGA 1W36D 3IAM6 1YTUA 1OFUX 4OHUA 3R3ZA 3NYIA 4UOZA 1VKJA 1KZ4A 1SXIA 4L4XA 1TIKA 2WG1A 2QXUA 3KJZA 4TX1A 4ARVA 4CM4A 4W1SA 4CV0A 5IJZA 1UPXA 2A84A 2MMGA 3FLEA 4MQFB 5A0FA 3WGGA 5I7SA 5ALIA 4MVJG 3AUJB 4WXEA 2DGDA 4QYSA 2C5GA 1TQDA 1IN7A 3FF4A 2CB0A 1QCZA 4NV0A 4TVBA 3MZ0A 4YFYA 4BFTA 1GDTA 1S2LA 2Q2NA 4DM3A 1RQ7A 1KP2A 3PG5A 2DBRA 2VHQA 4JA2A 3R4CA 3COSA 2P2GA 1TYDE 2FSUA 1JQBA 1LGYA 1K3UB