4J0KA

Tannin acyl hydrolase in complex with ethyl gallate
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
470
structure length
454
Chain Sequence
SMSNRLIFDADWLVPEQVQVAGQAIQYYAARNIQYVQHPVAAIQVLNVFVPAAYLHGSSVNGYQRATAPILMPNTVGGYLPGPADDPQRVTWPTNAGTIQQALKRGYVVVAAGIRGRTTVDKSGQRVGQAPAFIVDMKAAIRYVKYNQGRLPGDANRIITNGTSAGGATSALAGASGNSAYFEPALTALGAAPATDDIFAVSAYCPIHNLEHADMAYEWQFNGINDWHRFEPVSGQLTVEEQALSLALKAQFSTYLNQLKLTASDGTHLTLNEAGMGSFRDVVRQLLISSAQTAFDQGTDIHKYAGFVVTGNQVTDLDLSAYLKSLTRMKAVPAFDQLDLTSPENNLFGDATAKAKHFTALAQTRSTVTAQLADAELIQAINPLSYLTSSQVAKHWRIRHGAADRDTSFAIPIILAIMLENHGYGIDFALPWDIPHSGDYDLGDLFSWIDGLCQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of tannase from Lactobacillus plantarum
pubmed doi rcsb
source organism Lactobacillus plantarum
molecule tags Hydrolase
molecule keywords Tannase
total genus 159
structure length 454
sequence length 470
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4j0kA00
5EGNA 3QH4A 1JJFA 1LZKA 2GBGA 2PSEA 1UKCA 3O4IA 5T4FA 5EHXA 5A2GA 1UKAA 1IUOA 2WIGA 5AKEA 3WJ1A 3GROA 4QWWA 5DYWA 3DYIA 5CT9A 3H1AA 1GXSA 3OOSA 2XI4A 3N2ZB 4HAIA 1L7RA 2ZSIA 5AK5A 5HQ3B 4C4ZA 5YASA 2P8SA 2HA2A 3I2HA 3LCRA 2PSFA 4LYDA 3AFIA 3TGLA 3QMMA 4W1SA 1XQVA 5LZ2A 3I2IA 4J3JA 3GFFA 4B6GA 5ALSA 4KYVA 4QDZA 5AM5A 1X2BA 4WJLA 1I6WA 5A62A 2XUQA 1JU3A 4Y2XA 4QE3A 4QA9A 3F9CA 3S8YA 3V1LA 3YASA 3DCNA 3QMVA 4HXEB 4BCBA 1UK8A 4IH1A 4FTWA 4U2EA 1UZAA 3BXPA 2AJCA 2YYSA 2DFPA 1XRQA 4BATA 3DOIA 2PL5A 5DNUA 1O6FA 2DR0A 1UFOA 1XZGA 1FSSA 3IDAA 1MTZA 5CH3A 2DHDA 4A5SA 2WTNA 1CUDA 4PSDA 2K2QB 5HF6A 3WK5A 3H17A 1W75A 1MT3A 2JEZA 2O2GA 4XWGA 4X71A 4QNNA 3I6YA 2WU4A 3QZUA 2R11A 2RIPA 2WIFA 4CG1A 4KACA 1OXMA 3WK6A 4UHFA 4FKBA 2R8BA 2H9YA 4Y2YA 5ALLA 4H7FA 1CUYA 2XUPA 3PFCA 1GPLA 3IULA 2GYUA 1CQWA 2WTMA 1AC5A 4B0PA 2VJAA 5CT4A 5CT6A 1BN6A 1CUAA 1TCBA 3WKEA 4GW3A 3R3VA 1TAHA 3FYUC 4CI9A 2C0PA 5AK6A 5JD6A 4V2IA 4EHBA 1JI3A 4DYHA 2ECFA 3OPMA 1UXOA 1YS2X 3WK9A 2VTVA 3P2MA 1LZLA 1GKLA 1F6WA 2V96A 3HXKA 5LP1A 5AOBA 4LYEA 2XQIA 3FAKA 1BN7A 4AQDA 3C87A 3WA7A 4BDSA 4FDMA 3R41A 5DLPA 3GBSA 2WHRA 4FLFA 1MX5A 2EDAA 3QPDA 4LXHA 3QM1A 2XUIA 1X2EA 1A8SA 4K6HA 4N8EA 4PW0A 4Y9SA 1QONA 2QVBA 2AJLI 3STYA 2BUCA 3DNMA 3D7RA 4M0FA 4E14A 1EDDA 2ZVDA 3DQZA 5K3AA 2Y1KA 1SFRA 4YASA 3BIWA 2WG0A 4YK7A 1DX6A 1R1DA 2RI6A 3PDCA 1CR6A 3D5EA 3QITA 4YPVA 3ZPXA 4Y2JA 1MO2A 4J03A 3G0BA 2IX9A 2ZYSA 2XUAA 4HVTA 2JGEA 2VEOA 1QIKA 5K3BA 4EY4A 3WWCA 3A70A 2PUHA 5I7UA 5HQ3A 1CUSA 4B80A 1UOQA 4BVLA 2JGLA 4HXGA 4Y2QA 4HTAA 1QIEA 5AI8A 1A7UA 3BIXA 5ISMA 5JD5A 1XZHA 5ALNA 3FSGA 3WL5A 4I19A 1CLEA 2C0QA 3KWJA 4G8BA 5EIEA 2HM7A 3FVTA 3ZLUA 4W1PA 2E3JA 4KEAA 4CG2A 1ODSA 2Y2UA 1M33A 5HK8A 1GKKA 2H1IA 5LLSA 1Q84A 2PU7A 5DNWA 1MX9A 1ACJA 2QXTA 3UMJA 3W9BA 3X3HA 1ZD5A 2WM2A 1CUGA 3AILA 3WK7A 2WFLB 3BDVA 3KDAA 3V1MA 1R9NA 4UPDA 3WK4A 1QIJA 5FXMA 3HEAA 4KRXA 4BAGA 3IBTA 2PSDA 3WYDA 5AM2A 1QIIA 4BAUA 1Y37A 2ES4A 2PKYX 5JZBA 5ALOA 3SWWA 2Y6VA 1XZMA 2DCMA 5CH8A 1K8QA 1BS9A 3WWEA 5K3DA 2WKWA 5JAOA 5JD4A 5HKAA 1WPRA 1AZWA 5FP0A 3WIOA 1XKLA 1SCKA 4CFSA 3E1GA 2RHTA 3QYJA 5H3HA 1EHYA 4FOLA 2QJWA 3E3AA 1WCYA 1N8SA 3ZV7A 4XX1A 1TCCA 1QIMA 4HRYA 4U2CA 3CXUA 4GWLA 2X5XA 4UHHA 2CUTA 1YAHA 2OCLA 1THTA 4ZRDA 3VJKA 4G5XA 3D4LA 1GPNA 1ACLA 5AKYA 5J3JA 4J0CA 3HLKA 5JAPA 4B81A 1EDBA 1DT3A 1EI9A 5C8ZA 1LPBB 1N5MA 1CUEA 2G5TA 2QZPA 2XQKA 1DQYA 4RE5A 1CUXA 3RKSA 3D2CA 1HDEA 3RK4A 1XZFA 2WFLA 1WPXA 5AI0A 5AK4A 5SYMA 1R3DA 3IUNA 3V1NA 3I6MA 5HF5A 4BB0A 2Z8ZA 5JAHA 3JWEA 5EFZA 2EEPA 1VE6A 3WKDA 5DJ5A 2QM0A 4ZI5A 5DYYA 2XE4A 2O2IA 3VDXA 1XZIA 4K6KA 4K5QA 5T4BA 4AB1A 5ALVA 2ZSHA 3ANSA 2ZYRA 2J3QA 3FLAA 1OILA 1NU8A 4CG3A 2WJ3A 4UHDA 3ILSA 3GZJA 1Q0RA 3E0XA 2BCEA 4I4CA 4F0JA 3ANTA 4X6XA 4B84A 4C4YA 3AIOA 2XDWA 1E5TA 4OB7A 4QLOA 5ALWA 3WMRA 1BCRA 2DHCA 1K63A 4K2AA 1U4NA 4JH0A 2ZJ6A 4FWBA 4JEIA 4OU5A 1CEXA 1T2NA 4EB0A 1SCQA 5C8XA 4B7ZA 4AN1A 1ZGCA 3H2GA 5ALPA 3DD5A 5JYCA 3SC2A 5JASA 3L1HA 1FFCA 4WFIA 2OGSA 1XZEA 1Y7IA 4QDOA 2WFZA 4BP8A 4GEGA 4CIBA 4OB8A 4AZ0A 5FDFA 2QRUA 4AO8A 3PICA 4EA6A 1CFJA 3DJYA 2C5FA 4UFNA 1X70A 1QOZA 2OCIA 5K3CA 1TIBA 1H2YA 4PO3X 1FJ2A 2C7BA 1LGYA 1JMKC 4J0IA 1J07A 1CUWA 1XRMA 1A8UA 3R3WA 1UT6A 5LZ5A 3PI6A 4EZIA 5A71A 2PUJA 5BV7A 3O9VA 2XMGA 1YB7A 2H7CA 3ESCA 1E8NA 4BDTA 4BC1A 1QIFA 1L7QA 1DX4A 5C8VA 1CRLA 2O7RA 2JGMA 1KEZA 4UHCA 1HLGA 1H22A 3IUMA 5JAUA 4KE8A 2VSQA 4FFWA 4C89A 3C8HA 1GT6A 4H77A 3W04A 2XUFA 3OG9A 4KE9A 3AIKA 1QTIA 2XUKA 5EHNA 4FLMA 5EIAA 2I78A 3EQ7A 1UWCA 4F60A 2JGJA 4LHEA 2HA0A 5LKRA 5LZ8A 2HU8A 2FX5A 5FRDA 5CTAA 3N0TA 1BCSA 3I1IA 1AKNA 1F0NA 4QDTA 3UUEA 4EUSA 1E8DA 1JMYA 1P0QA 1XRRA 2V9ZA 1Q83A 4DNFA 4DTCA 3SK0A 3FLBA 5CT5A 1PFQA 3H04A 1JKMA 2CB9A 3I2KA 4IHAA 1UK6A 1A8QA 1JJIA 4DMFA 5EHZA 1B41A 5ALYA 4AO6A 2BGRA 4AO7A 1FFDA 5LZ4A 4JYMA 2JIDA 3T52A 3VJLA 2I3ZA 1N1MA 2HL6A 3G9ZA 4U2DA 4G1FA 1ZJ5A 4BCDA 4MEBA 4KJXA 2BUBA 4EY5A 4X7BA 4J7AA 3TJMA 1RP1A 5HZGA 1EVEA 3G9UA 4G4JA 3OM8A 2C4HA 1VA4A 4AXBA 3DS8A 2ORYA 1BRTA 2BKLA 5ALQA 5DTJA 2VAXA 2GYVA 1K5PA 3F98A 2CKMA 2OAEA 4LKOA 4X92A 1XLWA 5AI4A 1IMJA 1EB8A 2RHWA 3U0VA 1ZI9A 5KWJA 2VT7A 2OQVA 5JALA 3R3YA 3A6ZA 4MYDA 3R3ZA 1H2XA 5JADA 3D59A 4W9RA 4U2FA 2HIHA 1MN6A 1USWA 3C6BA 3ESAA 2CBGA 3D2AA 4WFKA 3AZPA 1G66A 3QVMA 2BGNA 3KOOA 2FUKA 2VQ6A 5JARA 1K6EA 4Q34A 3BF7A 3PF9A 4MXDA 3STUA 1E3QA 3V9AA 2HA3A 4BZZA 2C58A 5ALEA 3KSRA 2ZYHA 5A6VA 2QKYA 4BCCA 5HK9A 2BFNA 4BBZA 1IUNA 2Z5GA 4UUQA 4W63A 3AZOA 2XMRA 1XRLA 1EX9A 3D0KA 4BE4A 3WKCA 2VJBA 3HRHA 4BZWA 5E2IA 2J4CA 1TK3A 1CUVA 3GA7A 4H7EA 4DM7A 2XQJA 2HDWA 4X6UA 5CRIA 1EK2A 3IVMA 1HL7A 4OSEA 4ZV7A 3W05A 4C4XA 2WJ6A 2JEYA 4GBGA 1IVYA 3FVRA 1ZOIA 2HA6A 1T4MA 4IO0A 1AURA 4G8CA 5JATA 4J0DA 2OGTA 3F97A 4H7DA 4H7IA 1XQWA 4UHEA 2GBFA 1HKHA 4PV7A 3ESDA 1RWQA 5IVIA 3NUZA 3B3QA 1XQYA 3LIPA 1VJ5A 3ED1A 5AH0A 1W1IA 1EB9A 1BU8A 3ZLTA 2HA5A 1LNSA 3LLCA 4H18A 1VKHA 5ALMA 3DLTA 4MJ3A 1F0PA 5E4TA 4X93A 4JUIA 5ALJA 3H2JA 1P0MA 1LPOA 4H7KA 4BYMA 5DWDA 5K3FB 4L9AA 3V48A 2QOEA 3WIBA 5IVKA 4IH4A 4BRZA 1AMNA 1XQXA 5FPPA 1TCAA 3C43A 5CXXA 3MUOA 3ZI7A 1EH5A 1IZ7A 4NVRA 5IH7A 3G0GA 4IQ4A 1ZI8A 4Q82A 3VJMA 1DU4A 5IVDA 4OYYA 2BUAA 3HYSA 2V98A 3EQ8A 4BRSA 5FLKA 1UKBA 2UZ0A 5I8PA 2ZJ7A 4MYSA 4B0OA 4OU4A 4PSUA 2PU5A 2HFKA 5CW2A 3AJAA 4WCVA 2JF0A 4UFPA 4H0CA 4Q3LA 4GLBA 4DNPA 3MGAA 1DINA 1UK7A 4ARBA 1VXRA 2RGUA 3OTQA 3G0IA 4NMWA 4TGLA 3CCBA 3JW8A 3NOXA 4MQMA 5F4ZA 1W52X 1ZI6A 1VLQA 2JGKA 4N5HX 4DSZA 2XLBA 5HFNA 3O4GA 4UBIA 1MNQA 3IB3A 2RAUA 4NZZA 5AKIA 1J06A 5CURA 2G63A 5DYTA 1EINA 3F67A 5T4HA 2VF2A 2J3DA 4KAAA 1WB4A 1XLUA 4A23A 3VVMA 1DT5A 4E11A 2GZRA 1ETHA 3T4UA 1XZJA 1VZ2A 4J0GA 1U8EA 4H7HA 3H1BA 4BP9A 1F8UA 3O9MA 1ZGBA 3IUJA 1PV1A 1ZD4A 5AI5A 4BTLA 1XFDA 3H18A 5JANA 1LLFA 1XZBA 4EY6A 1FFBA 3GELA 1H23A 4P08A 5FV4A 4PNZA 4X85A 4MWTA 4F21A 3B12A 2PBLA 4X95A 1BEEA 4XJVA 5LYYA 4G9EA 2IIVA 3L1IA 2O7VA 2WUGA 4WY5A 4UBKA 4WY8A 4QLAA 1ISPA 2AJDA 5JZSA 2XMDA 2XUDA 3H19A 3FWHA 4EY8A 4ZXFA 3CN9A 4OYLA 1UOOA 3I2FA 4OD0A 3HJUA 2XMQA 4PF1A 3DL4A 3HZOA 3IIIA 4BC0A 1LPMA 2VATA 1LPPA 1ORWA 1GQSA 5AJHA 3H0CA 1YB6A 4J0HA 4F5ZA 1E89A 3IUQA 5CXUA 4C87A 1EDEA 2IITA 2O2HA 2VAVA 3TRDA 5A7HA 3FLEA 4Y2SA 1C4XA 5ALKA 4L72A 2LIPA 2CMFA 1XRPA 4H35A 3A2NA 5D7BA 5AKKA 3DOHA 1YCDA 2B61A 2XQFA 1R88A 2OCKA 2Y6UA 1YA8A 3C8DA 2GYWA 5K3EA 3EF3A 4B85A 4DSAA 4Q3OA 3C5VA 2WHQA 1LPNA 1LBTA 1ZJ4A 4WDRA 2RONA 4N8DA 2XT0A 3JYHA 1DQZA 2ROQA 4U2GA 1YS1X 2WU3A 2HA7A 5C7YA 1MU0A 1CQZA 1WHSA 4RPCA 4B82A 1G42A 1QIHA 4XVCA 1PJAA 4ZREA 5D6OA 3BWXA 2B20A 3MVEA 5AKJA 1QGED 5EI5A 1CIJA 1DWQA 2CZQA 5DTIA 3RARA 4EBBA 4PSCA 3BF8A 4RE6A 7YASA 3HABA 5AI9A 1CUIA 4E46A 3BL8A 2PPLA 3IA2A 3PF8A 5CMLA 2XUGA 4DNQA 1R9MA 1EK1A 3W9UA 2WHPA 5AIBA 5ALHA 3W06A 2DQYA 2Z3ZA 1MPXA 3QMWA 1AQLA 3STVA 2WSLA 2QS9A 3O0DA 4LIPD 1XZKA 4Y2VA 4UBMA 3F8SA 4MWSA 3WWDA 5ALXA 2DHEA 3DL7A 1GZ7A 1TRHA 2GZSA 4KRYA 2GBIA 1O6GA 3C6YA 1EVQA 3KWFA 4G4IA 3F96A 2WFMA 1WB5A 3BE8A 1S8OA 2QT9A 3R0VA 3UUFA 1ZICA 4J0KA 3G8YA 3HSSA 4GDMA 4A16A 3ZWQA 2H7YA 3BDIA 1QIDA 3NWOA 3G02A 3STWA 3WWOA 2ACKA 3C5WP 3G7NA 3ESBA 2H7XA 1QO9A 3LP5A 5ALTA 3WQHA 1QE3A 1VA5A 2JGFA 3STXA 2G5PA 1EA5A 1CUJA 3WKAA 2HRRA 4AMZA 1XLVA 5ALRA 4BE9A 3A2MA 3M83A 3CCCA 2WQZA 3IURA 4KAJA 2XLCA 5ALGA 5AM4A 3FCXA 2HFJA 2ACEA 1DWOA 1YR2A 3CN7A 3KXPA 1WM1A 1QJ4A 3WYNA 4P93A 5ALDA 2XB6A 3BJMA 2C5GA 2AJ8A 4K6GA 1Q0ZA 2D0DA 1Y7HA 2OCGA 5KBYA 3V1KA 4N8SA 3WA6A 4LXGA 5E4YA 4UBNA 3AZQA 2HU7A 3Q0TA 3FOBA 2VJCA 4Y7DA 4Q3KA 3HACA 3LS2A 4L3WA 4LXIA 4J0JA 1QZ3A 1E8MA 4W1RA 5AKXA 4JNCA 4XIIA 5C81A 4UBOA 5AI6A 1GGVA 2CEKA 3AUKA 4P92A 1CUZA 5HFAA 4MEAA 1VE7A 4DLNA 5LZ9A 2WIDA 4C88A 1E66A 4B9EA 2DQZA 2NW6A 4X3CA 4DMKA 2QUBA 1WB6A 1NU6A 2DSNA 5LKAA 3I2JA 3FBWA 4QDUA 3WI7A 4EY7A 1P0IA 3L1JA 2WIKA 3OC0A 1BE0A 4WFJA 3R40A 5SYNA 5KREA 1XZDA 4GHWA 4TPKA 1HQDA 2XMBA 4FBMA 3DKKA 2VT6A 1SOMA 1G5FA 4P9NA 1OCEA 1WOMA 2OGZA 4CCYB 3BJRA 3QBJA 1DWPA 1MJ5A 3G9XA 5LIPA 3QPCA 2JGIA 3RLIA 4M0MA 2W6CX 4Q1VA 4FBLA 1J1IA 1CUHA 2AXEA 3GUUA 1XRNA 2PSJA 4X00A 2OPHA 3M81A 5EHQA 4G9GA 3G9TA 4OUKX 1R50A 1JFRA 2I03A 4QEKA 3E4DA 2WUEA 3C6XA 4Q05A 5ALZA 1W76A 1ODTC 2ZYIA 2W22A 2OXEA 3EIOA 4DIUA 4HRXA 2J4FA 3WJ2A 3S2ZA 5BOVA 5JZ9A 3O95A 4KR0A 3C45A 4BVKA 3U1TA 1DTEA 2EDCA 1XZCA 5A7GA 2B4KA 4KAFA 4OCZA 2FJPA 3R3XA 1CPYA 4HS9A 4I3FA 4L0CA 1GQRA 3PE6A 2WUFA 3WZLA 5AOCA 5AIAA 1B6GA 2XMSA 3VKFA 2YASA 5AP9A 2OQIA 1SCIA 1C7JA 2XQGA 3FCYA 2PX6A 5D3KA 3H2KA 4X97A 4B83A 2OAGA 1FFEA 5ALUA 5K5EA 3KD2A 2HADA 1VZ3A 2D5LA 2WILA 3C70A 1MAAA 3SX4A 3PFBA 1ZIYA 4HZGA 4QDXA 3WK8A 1U2EA 4KE7A 3O4HA 4FLEA 2VJDA 4QZVA 5CBKA 3D2BA 5K3FA 1MX1A 5AM0A 1ZD3A 1N5RA 1H2WA 4FNGA 4FNMA 1VOTA 2Z8XA 5HF9A 2QMQA 1YASA 2HA4A 3WZMA 1JU4A 4ETWA 3D3NA 4X90A 4Y2PA 2HU5A 5ESRA 1ODCA 3G0CA 3ICVA 5T4EA 4DMHA 3HI4A 1BROA 1W4LA 4B9AA 4O08A 3VISA 4ARAA 1BEZA 4TVKA 1UOPA 1WHTA 1TQHA 1TKRA 3FSGD 2WLSA 2YXPX 5AM3A 4G4GA 5AKZA 5IVHA 1ZIXA 1XZLA 5KWIA 2QUAA 5FOQA 3K2IA 2CJPA 5FPQA 1FFAA 1IUPA 4X94A 2FJ0A 2PSHA 1QFSA 3B5EA 4X91A 3H2IA 4HXFB 1L7AA 1VXOA 4ITVA 3OURA 4NS4A 1NX9A 4RGYA 1D07A 5AM1A 4X6YA 4WDQA 2WHPB 4AN0A 4UBJA 4E15A 1G4HA 2XUHA 3FNBA 1AGYA 1QLWA 6YASA 3I2GA 1KU6A 1CUFA 5FUMA 3M82A 4UHBA 3AIMA 3G0DA 1UK9A 5BWCA 1ORVA 2XUJA 4C01A 5ALIA 2AJBA 4BVJA 1Z68A 3WL7A 4CCYA 4DMCA 2B9VA 1YSCA 5HKBA 4ROTA 2ONCA 3C6ZA 1CUCA 5CT8A 2JBWA 2VA9A 4ZGBA 1HPLA 4INZA 3PUIA 5CH5A 1XKTA 5AKGA 2BAGA 1QTRA 3DYVA 1CVLA 3EQ9A 2PVSA 3HC7A 1SC9A 1CUBA 3EBLA 3K6KA 4GI1A 4BAZA 4UFOA 3LIIA 1HBJA 4Y2RA 4CIAA 1LBSA 2G4LA 2WG1A 3STTA 2WIJA 4JYPA 5EIHA 5D3ZA 2BJHA 4DGQA 4BTVA 1QIGA 3WL6A 1W6RA 4ZWNA 3NGMA 4FHZA 1IZ8A 1JJBA 2Q0XA 3VVLA 4C6HA 3A2LA 4DNOA 3DKRA 1EXWA 1LPSA 2YH2A 4N5IX 5A7FA 2QTBA 1XZAA 5IKXA 4H7JA 2OG1A 2V97A 4IH9A 2WG2A 1A88A 3VXKA 2PM8A 3I1YA 3M3DA 3TEJA 1U65A 2OLEA 1THGA 4GECA 1QO7A 2X76A 5FKJA 1GPKA 4S0XA 4FMPA 1RYYA 4OPMA 5I9IA 1C7IA 5AKLA 1QFMA 1R4ZA 2GBCA 1H2ZA 3K9BA 3R3UA 1XROA 4FFVA 2QJRA 5AK3A 4KE6A 1YA4A 4D9JA 3FYUB 3ICWA 1MAHA 2Z3WA 4CCWA 4UBLA 3I6ZA 4PQEA 2WJ4A 2QR5A 5BWBA 3PUHA 3O4JA 5AKHA 2I3DA 4Y2UA 1K4YA 5JIBA 1CUUA 5AICA 4OB6A 4MQLA 4AZ3A 5AO9A 1YAJA 1JT2A 4U2BA 1CV2A 5AOAA 4ZV9A 1KU0A 4YX9A 2HRQA 3WLAA 3DEAA 4AMYA 4QWMA 3WKBA 3RM3A 3H2HA 5ALFA 1J2EA 5DNVA 3QPAA 3W2TA 3ZLVA 3FYTA 2HHAA 3WL8A 3DDUA 4G8DA 5LZ7A 2XMCA 2XUOA 4Z49A 1LPAB 2X8BA 4RNCA 3I28A 2ZJFA 2XMZA 4GXNA 3FYUA 3Q8WA 2Y2VA 4Y2TA 4W1QA 1AUOA 5AHXA 5HCUA 5HF8A 1ZD2P 1MNAA 1AX9A 2QXUA 5E4JA 1P0PA 2WUDA 3WWPA 4AX4A 4M0EA 3AINA 3MUNA
chains in the Genus database with same CATH superfamily
1WMAA 2YRXA 4TTPA 3EXEB 3R9KA 5CEEA 2P9QA 3E58A 4M1KA 4BFWA 4KDEA 2H2IA 2NUBA 3D3WA 1XEWY 1V2GA 4Z99A 1LZKA 5CDFE 2Y1DA 1Q95A 2Q3MA 3L4BC 3OEEA 4FFBA 5A4KA 3WP1B 2R62A 1GHTA 3BZBA 2JD1A 3HO8A 4JGIA 2BYTA 1PJTA 2DF8A 2P7HA 3GT4A 4PVDA 2WIGA 4RVDA 3WOVA 4BIMA 3IL2A 4HLDA 2J59A 1USKA 5DYWA 3SI7A 3DYIA 4FR2A 3A9WA 4ETIA 4H1VA 2B6NA 1MO5A 1T8UA 1JSLA 2HCTA 3L8DA 1FFXB 3OOSA 2AZTA 4O4JA 1E2GA 3T06B 3W2GA 4ERXA 2QN2A 3PX2A 3CUKA 2Z0MA 4HQRA 4Q9AA 1JDPA 2E5LB 5FNVF 3IR5A 4JXXA 1XSEA 3NUQA 3N2ZB 1XD9A 2OR3A 1ESMA 4U7TB 4CN8A 3HPRA 2E87A 4KIUA 4S12A 5CUQA 4IRUB 4W5QA 3NBUA 1WZIA 3AW8A 2XGMA 3G6WA 3F46A 3GDHA 4KWEA 4BJ3A 3A4MA 1UBHS 2P8SA 1HSZA 5JU6A 3H3XA 1PT9A 3V80A 3I2HA 3LCRA 4Z1MD 1B2RA 5ICMA 1JDTA 2LCIA 1NVKA 1M2OA 3AFIA 1ZH2A 2KQUA 4L74A 4MAAA 3QMMA 4O4LA 4OL9A 4OP3A 1SKMA 1Z25A 4JKIA 2ADOA 4DF3A 5KU7A 5JXIA 1SXPA 3I2IA 2PVCA 4D1YA 1XFAA 1NI3A 1AB5A 1V41E 3KPVA 1VCIA 1E3JA 1TAQA 4UNPA 5LQRA 1AHIA 2H07A 2UXCB 3TOCA 1ZWKA 2C57A 4WLOA 2N3ZA 4N4AA 2ZUTA 1M72A 1CJCA 3H87A 3ROTA 4TWZA 4WJLA 3L4SO 4OQLA 1I6WA 3ZWBA 1W0CA 1RHUA 3PNBA 4WZAE 4NZNA 1DE0A 4Y2XA 4U7FA 3ZK8A 3RFFA 3WWYA 2R00A 2B4TO 3DZDA 2REXB 1A2KC 2H18A 4M9UA 4MB2A 3ETDA 4EIWA 1UWLA 4MK4A 1C3XA 1G63A 1OAKA 2EYQA 4MITA 4QQRA 2M6LA 3C3PA 4PIPA 2GRJA 3HGMA 1IY9A 3B78A 4BCBA 3KUDA 5AT1A 2FLWA 4IH1A 4WT7A 3DE2X 4ECEA 3GNLA 3IRVA 1AS0A 4FTWA 1NDQA 4U2EA 1GQOA 5ED0A 4BNDA 4CKWA 2Q1UA 1FJXA 8MHTA 1L8QA 4K86A 2H4FA 1I5EA 4IJVA 4MMYB 1ISGA 2AN4A 2IUYA 2DFPA 3QUBA 1V1RB 4PPYA 3L4EA 4QEDA 1FSPA 5TQ0A 1C1YA 1MAVA 5DNUA 4QT4A 2QHXA 2Y77A 4UUPA 1TTTA 3FPAA 5DGCA 1A5AB 5LYJA 5FFFA 2B3TA 1VQ1A 5COQA 1ZQ9A 1ZSYA 2DC1A 2QRQA 1FSSA 4OQQA 2QMZA 5AJZA 1YBHA 4AWBA 5BYAA 4OGKA 3WNDA 4D9BA 4INJA 1UMBA 4AVYA 2A9JA 1QZZA 1Z4JA 1AB6A 1W5AA 4Y18A 4N3BA 1JE1A 2VC2B 1GRVA 3UJ7A 1FMLA 3L7YA 1D2NA 4QPNA 4UHJA 1PWHA 2DLNA 4F71A 4R16A 3LBFA 1KYQA 3NT2A 4PSDA 1RNLA 2K2QB 2OPBA 1XJ5A 1Z0IA 3AHIA 4FVTA 3LC1O 4LEIA 3HXLA 1QKJA 5HF6A 5LA6A 4DUYB 3ZU2A 2JEZA 1QGUB 2ZLBA 1LW6E 2O2GA 3GN2A 3IQXA 4GSKA 3VR1A 4EJ0A 5KYXA 2ALJA 2EEZA 1Z56C 1NVUQ 2AFVA 1VDMA 1DC7A 2JJQA 1C14A 2LNDA 4NSNA 1LJ8A 2G9RA 3WC4A 1ZR4A 2O8VA 1KMIY 4PSKA 4QNNA 1TVEA 5I9NA 2I99A 4YRZA 2H17A 1DXHA 1Y8QB 5T41A 4TYNA 1KDTA 2Z04A 4WJKB 3RVBA 4UCQA 2WIFA 4CT4B 4CG1A 1K92A 4ZVQA 1J8FA 3TPFA 2X15A 4MW1A 4FKBA 2DPYA 3ME5A 2H9YA 1V6CA 2WV7A 4Y2YA 4J4TA 5FTNA 3NQ41 2Y3IA 1DAPA 2YXBA 4R8RA 1T4CB 4UUOA 2J3HA 1T5BA 3OZAA 2W2XA 2IYUA 4Z5XA 4DT1A 2QTTA 4Z86A 3M9WA 3I23A 3IULA 1ZUNA 4V0NA 5JDCC 3DZBA 1DO8A 3GIWA 3WR5A 1AS3A 2IEYA 2BGKA 1JXAA 4DA6A 3AHGA 2FQXA 1OBOA 1JQAA 3WIVA 3IP6A 5DCYA 4OG2A 3WB9A 1PP4A 1AC5A 1IOWA 2EAUA 2VJAA 4LY9A 4J2TA 3FWKA 5CT6A 2Y1CA 4ZQHA 3PEUA 3TLGB 3TXXA 1J8DA 5JW6A 5EUMA 4BLOA 3I6BA 4C6TB 5K2OA 3DG9A 3PYXA 3VJMA 2CUZA 1WU8A 3A7DA 2O8BA 1KY2A 1XALA 1T5IA 2G9ZA 3DFMA 5JS1A 4RTQA 2C0PA 5G0WA 4A2CA 2J6IA 3AY0A 1TO6A 2RGAA 4BUCA 3GLIB 2H1RA 3TWOA 2X3FA 1KQPA 4P3PA 5CEJA 3MUFA 1D2AA 2P67A 4V2IA 4BLTA 3MNFA 4L8GA 3GJ7A 3MHPA 3OPMA 2IU0A 4X61A 5LUBA 1T5HX 1C3EA 3DXXA 1EIZA 1ZK1A 5DNYB 4QOIA 4LVOA 3N8HA 5JSUA 4N41A 3OJLA 3PTZA 1HDCA 2VTVA 2HF7A 4JGBA 4M38A 1FVFA 2PXAA 2C1EA 5A9RA 3PZBA 1W8DA 3QWBA 3WBKA 4BMVA 4CQLB 1ZOLA 2ZIVB 1C3LA 3K6JA 1DBPA 1BKYA 1MIOA 2E4WA 4HN9A 4R2HA 1G2OA 3OX2A 5EKSA 1HT0A 2HIMA 1Z13A 3HXKA 4JJ8A 5CYGA 5LP1A 4TS4A 1ZU4A 1C9NA 1FDOA 1XJ0A 1TA0A 5K8TA 2XQIA 1SZDA 3FOCA 1E9BA 2QW1A 1K0UA 1BMQA 1T1RA 1I2BA 1OF1A 1TZKA 3IHTA 4IHJF 5TF0A 1HK7A 1XIVA 3MCUA 5F7XA 3FMGA 3WA7A 1ZA1A 1MRZA 3QU4A 3R41A 1JECA 1KI9A 4HNAB 4ITRC 4Q03A 4Q66C 4YAWA 3QXGA 5DLPA 1KA9H 1W1UA 4FLFA 3DT9A 3QPDA 3T12A 1OFUX 2ZBRA 1A8SA 4R0VA 1BJKA 3R8CA 4OGFA 2A57A 1FYXA 1JWLA 3PXCX 1TJ5A 5JAZA 5CCBA 3H5OA 1I36A 4FU0A 4WADA 1KZGB 2QVBA 4V38A 2AJLI 4RF5A 2QX6A 1U2QA 1B0ZA 2X8AA 3BKWA 3STYA 4KXFB 4W8GA 4YECA 2W0MA 2E85A 2WC1A 4GXRA 3RC2A 3AKEA 4F72A 5F9MA 6ADHA 2EQ5A 3R4VA 2G08A 1N2OA 3E8XA 4LE1A 4BGIA 5JYDA 2HY7A 4YASA 3FROA 3BIWA 4H3VA 3CLUC 5EMNA 1ZRHA 2RC5A 4BMYA 1ZN7A 4LDRA 2RI6A 4KLNA 3BTSA 4MWCA 1JG4A 3QITA 4FXPA 4YPVA 1OFGA 1X1AA 3DT6A 3QWIA 4X65B 4BE7B 2FVYA 5JV5A 4Q47A 3S0JA 1CJUC 1MO2A 1QO0A 4JLKA 3NHLA 3JRXA 1PVOA 1HH4A 1YBFA 2IX9A 4XYBA 4ENWA 5DXFA 5CLFA 3RU9A 5JRDS 3CVVA 3INRA 5HJ5A 1COWD 1WW2A 3M49A 2C54A 1RMQA 2P41A 1GZVA 5ICCA 1B4DA 4GH5A 4GPD1 4R6XA 3WP0A 2HF8A 5M29A 2PJDA 3A3YA 2NO6A 2O2JA 1U0NA 3QI2A 4UMFA 3SEZA 4CMIB 1Z7BA 3JAKB 3K5PA 4Q4HA 2H4YA 3HKBA 4BO2A 5HXAA 3QYAA 5JY6A 2C29D 4OOFA 2VPXA 1IIRA 3KAJA 4RK6A 4EJMA 2C5HA 1WCIA 2QM8A 1E9RA 2VDJA 3GJ0A 4LZPA 5JCJD 2PRZA 2V3VA 2H5JA 5KX5F 4Z8YA 4DVJA 4B80A 3KSAC 4F1JA 3PDHA 5DLDA 4I8XA 3OCYA 3SVZA 3W3AH 1RPZA 1G8FA 3FOWA 3PGJA 5CLIA 2P9ZA 4ECAA 4UUAA 5JCZA 4X60A 4EHFA 2YWXA 4LS3A 3SJBA 5H8WA 4RH1A 1YZHA 1NUHA 3QNMA 4RZ2A 3TB6A 2V1UA 1YUNA 1QIEA 1A7UA 3ECCA 1Z73A 4M6WA 4P6VF 1Y1QA 5AI8A 4A8HA 1PR2A 4TRJA 1TM5E 5CA0A 4L8VA 4OBXA 4NENA 2HLNA 4JC0A 1LBIA 3MTEA 4KWIA 1UJ2A 3FUCA 2ODAA 4JSRA 4E1AA 4AMUA 2C0QA 4RKQA 4G8BA 3RSOA 3AXTA 4UJ3A 1SKYB 4AJ1A 4PNEA 1T0UA 1NJGA 1NUTA 1R3UA 5DNAA 2QMEA 4W1PA 2WD9A 1ZMTA 2FZVA 2F59A 3FTCA 3K1YA 3TUJC 2Y1WA 5GM2A 3X2FA 3SQWA 2BR5A 4CDMA 4EVQA 1LLDA 5KIAA 5BSGA 2ERYA 1IRXA 1N1EA 1RR6A 5T6BA 3G2HA 4L9SA 3RC3A 3RVNA 3ZKWA 4A8JB 2GJ4A 4YMSA 2RJNA 3MG9A 4HL6A 4M8LA 2OO7A 3RREA 1Q84A 2PU7A 3LWBA 1UADA 3IVRA 3OJFA 1MX9A 3KSZO 4RH0A 3KJFA 4ZMSA 1ACJA 2TS1A 1GO2A 1F06A 2QXYA 4M0LA 5BQXA 1CUGA 4IJKA 3VPDA 3BDVA 1KTVA 3GMDA 5LQAA 2B21A 1XI2A 4M8IA 1CF4A 3TX2A 1AMUA 4R3NA 2FN4A 3VTKA 4RZQA 3ZBQA 2OV1A 5JFTA 2IEGA 2XITA 1ID1A 1I4TD 1YRQA 3HCPA 3O3NB 1LA2A 4LA4A 1QZUA 2Q4TA 4PIMA 3O1IC 3B2NA 1I2DA 4CHTA 4KRXA 3JV7A 3COWA 4DIBA 3OHSX 1P2DA 1OFTA 3G7SA 4JFAA 2FW9A 3IAS6 4FCTA 2G06A 3PFGA 5K0SA 5AM2A 1QIIA 3ASYA 1FUKA 2ZAMA 1VPEA 2UVDA 1M54A 1DLJA 1QLJA 3BCRA 1YL6A 3FCOA 4CETA 3EUAA 3V1TC 1RHRA 2FPMA 3PLAE 2QZSA 3NNDA 1XZMA 4QXRA 5J5AA 3IAAA 5EXSA 3B85A 1K2VN 3E9MA 1FUUA 2DCMA 2AHRA 2JI8A 3B7WA 3LUGA 4KQWA 4M53A 4NFSA 5J2TF 3H8VA 2XGGA 3AUFA 4IIEA 3KFXA 4PBRA 3VHXB 5ILOA 4CNBA 4GKVA 4ER3A 1KVRA 4KYIB 1KH1A 2O8NA 2XWPA 5DHPA 3L05A 2FVXA 1R9JA 5FP0A 4YRAA 1E6WA 5LYJF 1SCKA 3KL4A 1KP2A 1M1YE 1M2GA 4HGZA 4DN6A 3K1TA 2O3JA 4CFSA 1G21E 3GEDA 1C0KA 2RHTA 3QYJA 2NT3A 4XFDA 3QPBA 1OFIA 5H3HA 4B46A 5I5EA 3ILYA 1NDUA 5IJ0A 1K89A 2OY0A 2ZWOA 2WTAA 3IUEA 1TCCA 3TW4A 2VDMB 1PFWA 5FHQA 3CSUA 4HRYA 4U2CA 5DTMA 3S99A 1WMEA 2B7LA 2EP7A 2XGOA 4JEMA 5A9SB 1GUFA 5KKNB 2WR8A 4DT1B 1CNEA 5K0EA 1CWUA 2WB4A 3A8TA 4KQ9A 1XJCA 2FRDC 5DNEA 2C9ZA 2P4UA 1E5VA 3KJZA 1N0UA 3ND7A 3O3CA 4BLPA 4ZRDA 3F4BA 2R3SA 1MEJA 1YOBA 4QFCA 4F4UA 3P45A 5EIWA 3JVVA 2A1UB 2HRZA 2PGAA 1W2WB 3GEHA 5EXDA 1GU0A 1ACLA 2AG8A 5AKYA 5CFRA 1W34A 1OLXB 5BMOA 5J3JA 3HLKA 4GUAA 5ENZA 1P73A 3HBAA 3PPWA 4G6ZA 4LK2A 4F11A 5TVKA 3VOBA 4B81A 5JYEA 1I0IA 1E58A 3OF3A 2F9FA 1VMAA 4XB6B 5AUPB 4OJQA 4OJTA 4PG4A 1VMDA 4E21A 4G0WA 2ZUFA 1KK3A 3HR4A 4AJEA 5FTLA 1CS4C 3ZY2A 4DXHA 3BZWA 1TF5A 3IHLA 4O2BF 3AWDA 5KKAA 3WQSB 3RUFA 3OESA 1AT1A 1L5NA 1U3TA 3T3MB 4A6EA 2W37A 2P3OA 3GVHA 1E1CB 4XEHA 5C8YA 1ZNYA 2XQKA 1GZ6A 4EGCB 4BXOB 2HC9A 5J9FA 1B8UA 3WDLA 3AR6A 3CZQA 3D2CA 4MARA 4YXWA 3HP1A 3OX3A 3RK4A 4B7UA 1OLSB 2IKSA 1JAZA 2CF5A 4DWWA 1WMDA 2EHDA 1TF7A 3TJRA 5DK6A 3VHRA 4E5DA 1WPXA 5AI0A 4D2IA 4E13A 5DE3A 2MIIA 5K3OA 1UPUA 4DHWA 2PIDA 4J43A 4PPQA 4TS1A 3EFOB 3RIEA 1I80A 5ECYA 3TTUA 3LX6A 5F98A 3D6MA 3GDFA 1M34B 2UYCA 1GJRA 3KKNA 3R6LA 4IXNA 4G0QA 4R51A 3TDNA 4F97A 5BMVB 4NQZA 1MT0A 3E22A 4RKFA 4IOMA 2K5UA 4IUDS 1D9ZA 3G17A 2QY6A 5IJ9B 1VE6A 1RAGA 2KPOA 4KGDA 5JSKA 3T35A 2DFLA 3GGCA 4B6SA 5I7RA 4C22A 5JWRA 5BYJA 3ZCTA 3QQPA 1XB2A 3AR7A 5DYYA 1ZUIA 3PXEA 3ZDZB 3E3NA 2O7SA 3OH8A 4PPGA 2OSVA 3USES 4J9UE 3ZGNA 3WRYA 3CJTA 3OEED 4KQ6A 3U49A 3HCBA 2GZAA 4YUZA 2AVNA 3ZXSA 3NIWA 4KXUA 4TMFA 2EWWA 3WHKA 4DKXA 4DB2A 1EP1B 3D3KA 3Q7SA 4IVQA 1LVGA 1JIVA 1IDN1 4AICA 2P9CA 4K5QA 4B6OA 3WOHA 5T4BA 5TXGA 2Q49A 4DFDA 5BW8A 1FZTA 3ZK9A 3OLVA 4Z7JA 1PJBA 1ZH0A 5KYUA 4O2BB 5J63A 1GV1A 1EUCA 2GEBA 3MINA 2P6NA 2ZYRA 1XXHB 3UM9A 4M9ZA 2J3QA 3FLAA 1ES9A 4KPFC 4E5PA 3QVLA 3RYTC 4CG3A 2OQRA 1SU6A 4UU8A 3RH0A 5IUKC 3TLJA 1V47A 2XIQA 4EX6A 2BM0A 4N9QA 2JAOA 5P21A 3RRJA 2XE6A 3DC2A 4ZYVA 5K0CA 3LTNC 2Q28A 1Q0RA 1QOPB 2SKCA 3LQ4A 3CG0A 4OBBA 2BCEA 2WEKA 1USVA 4I4CA 3TCKA 4F0JA 1CZNA 3GF4A 4HX2A 3UYLA 4DQKA 4U7DA 5B7NA 3DLBA 1L5HB 2IYTA 2IW3A 4YUAA 4GLFA 1W85B 1ZK3A 2A0UA 2PQ0A 3MAAC 4JBLA 4MRPA 3EYAA 5G02A 4OV6B 5TPZD 3C24A 1U3DA 3N0XA 5EIOA 4PONA 5EERA 4M0PA 4NBRA 1DVRA 4ZANA 5JO9A 4IIJB 1FU7A 3ZWYA 4JB0A 4A8JA 1MB2A 2H4HA 1AKYA 1SCQA 2I4MA 3WGTA 4B7ZA 1NBEA 3G0OA 4RSGA 3JQPA 4LYYA 3O7WA 5H4HA 3HA5A 2IBSA 3OCJA 5JASA 3N6VA 4RSMA 4ZTBA 2G4VA 3AUAA 1W581 4LZOA 4BO8A 2OGSA 3A4IA 3TOXA 3WLQA 4XASA 1DS6A 1CJTC 1LCIA 3IVGA 1MO6A 2FH5B 5BSRA 4KU4A 2GSDA 1YZ3A 2Q5OA 4GEGA 1XDWA 3E9ZA 1ZPDA 2PMEA 5FOUA 4A8PA 4AJNA 4OB8A 5AXCA 1FXWF 1TK2A 1FYWA 4UQPA 4AZ0A 4CFYA 4CYMA 3R9XA 1IZYA 4C4YA 1L5OA 4LI3X 4ZHQF 3GJ8A 1JEOA 1L7XA 4IXDA 3W79A 3H1GA 4NCNA 2NU8B 5A9TA 4AO8A 8ADHA 5LOVF 4MSUA 3PICA 3LQYA 1S8FA 1CFJA 4O59O 1X14A 2FRVA 5F3DA 1I01A 4EITA 3BEOA 4MGIR 1QOZA 1X70A 1U2PA 1R12A 5K3CA 3S7ZA 4A2QA 1UODA 4IVRA 1TIBA 1BA3A 1Y9DA 3V32A 2XZOA 1Y1SA 1IN5A 3AERB 4GVPA 2G40A 4PO3X 2BZ1A 2C7BA 3OE4A 4YREA 5BOSA 4HEHA 2AX4A 1TU0A 3E9EA 3LPCA 4JVNA 2BC9A 4AROA 1Y9JA 2PMBA 3AQIA 5EYPA 5JH7A 3L6RA 2MCFA 1QTQA 3PYLA 4EKDA 1KP9A 1A8UA 1XRMA 2PS3A 2B8NA 3N7TA 5L9AA 3WAJA 2X40A 3BK2A 4MAMA 2VOEA 4KXXA 3PLRA 2N42A 1E5QA 3U7FB 1J8QA 4UU0A 3ZU5A 1AD2A 4JJZA 2FW6A 4CVNA 1JQJC 1WEHA 3BXGA 3N87A 3IT3A 4D99A 1AQ6A 5BV7A 3WJAA 3C4VA 2WJZB 5FUXA 3FFAA 3RAFC 4YYZA 3KTAB 5EWJB 1G8JA 1QIFA 1L7QA 2CSXA 3IEMA 2AFRA 1VE9A 1CY0A 3DUWA 3LT0A 5C8VA 1IMOA 1CRLA 3UWKA 1JXOA 3ZGXA 2CJWB 2P2CA 2PQ6A 2OO3A 1RZUA 4TTSA 2QVYX 3F6CA 3RD5A 3G1UA 1NULA 4MV8A 2B92A 4CV0A 4EYEA 1TZJA 2G04A 3JYPA 2O2SA 4R31A 4Q1DA 3T41A 4KUHA 4RQUA 2R7MA 4J0QA 4F2DA 2X5KO 1MXHA 3HWSA 1P7CA 1U0SY 1TQ2A 3PGMA 4EHAA 1UIRA 2IFTA 1CNFA 1MDBA 2H2HA 4UAJA 1GZSA 1XPUA 1P29A 4D9MA 1AZTA 1MIOB 2O5VA 1N7JA 2NVUB 3TTXA 1XNJA 4UDNA 3TQSA 4EI7A 2WMNB 5AJVB 2DY0A 2J9GA 3NWBA 1LI4A 3AIKA 3D3QA 5LMNB 1QTIA 2H59A 2EWVA 3S55A 4K9RA 2ZTHA 1ZIPA 1IHPA 1EEXB 3ET4A 4FGZA 5EHNA 4OQMA 1FW6A 2A4MA 4OA8A 4EY3A 1VDZA 5IDVA 5HSGA 4NYJQ 4DKJA 2YHIA 2KS6A 4Y8VA 5ITZB 1IYZA 4LHEA 2XTMA 2O3SA 2HA0A 2Q9AA 1P3Y1 1NIPA 1IWBB 1UZMA 1Z5GA 2CWWA 1OPXA 2QVLA 4XQ9A 3BERA 2R48A 4JR1A 5CTAA 3WRXC 4E51A 1QYXA 3RYFB 1NZFA 5DCWA 1DXOA 1F0NA 4TLMB 1A8HA 5HJEA 1GUAA 1QYDA 1VHLA 2ECOA 1JMYA 3AWIA 3T94A 1XRRA 3QMPA 4RTMA 1MOPA 3B5IA 5FTJA 4EI9A 1GCOA 2LPMA 2PE5A 1VSVA 2YN4A 1Q83A 1IBLB 1TM1E 3SK0A 3FLBA 5CT5A 1PFQA 1ZLYA 1QZXA 4KZPA 1QCCA 2PX0A 2VUIB 1KAOA 2I0FA 4LJ6A 4NZMA 3WE7A 2HMAA 4OX9Y 3Q9SA 4IMJB 4M99A 3EOZA 3I42A 4PYQA 2G80A 4BO7A 3MOSA 1Z0AA 2EJUA 4D9KA 4AWAA 2DT8A 3S2EA 1XVLA 5DOZA 1A8QA 3NIBA 3QX9A 4XARA 4MYHA 4W99A 1Y5MA 2A78A 3CPHA 4RTOA 3ZK7A 2J33A 2RH5A 3IBFA 3SNHA 3S2IA 3QXXA 4MUFA 2ZB7A 1G19A 1WUHS 3LBIA 4CWAA 5EHZA 4CM6A 3T5BA 4DTIA 1B41A 1GNLA 1Q1QA 4GZMA 3FZNA 1OBVA 4DQUA 3T5PA 2BGRA 5KJ6A 2Q6TA 2NVWA 1ULTA 2HNBA 4DCUA 3Q3IA 4QUEA 3FDZA 4LF5B 4ZO8A 4PYMA 2O2YA 4M7WA 1KYWA 4JYMA 5JZOA 5LZ4A 3DR3A 1VLLA 5TEWA 4RFSA 4WASA 3VJLA 2WMYA 3VU1A 3IJ5A 4DDVA 4MKRA 4S2UA 4NYMR 4L4YA 1BA2A 1ULUA 2ZI7A 3RAGA 1IXYA 3TDKA 2ZUCA 4XJXA 3BXFA 4G1FA 3RVRA 1NUSA 2RGEA 1R5BA 3T1VA 3FHCB 1F4PA 2CJYA 1C4KA 1JHYA 4YLYA 5EMLA 1NDHA 1AGPA 2BUBA 2ZUDA 3DFZA 3KEOA 5HTOA 4OHUA 2OYSA 4UE2A 2ZSJA 5KYGA 3TJMA 1RLJA 3TI9A 1QH1A 5JC8A 1NF3A 2VK1A 4GRAA 1EVKA 4S24A 3WO0A 2ATEA 4CU5A 2LIVA 2WJIA 1PT6A 4QFDA 2X4LA 1C30A 1JKJA 3K72B 2RDMA 2ZZKA 4P58A 5U9CA 1FMJA 5FFNA 1E6CA 3DS8A 3EW9A 3R7DA 1ZM3A 5C7IO 1V5IA 1V1RA 2PWYA 3HUDA 1R0KA 2PTHA 4LPKA 4RKYA 3FTEA 3HYNA 2J67A 4BBJA 1I7SB 4F9TA 1XEXB 1KDPA 4G24A 4RAOA 4BBPA 4PR3A 4F91B 1ULHA 1A5SB 3UMSA 1R27A 4DW8A 3ZYZA 3F98A 4RJLA 1L5QA 3TD6A 3U3MA 2IUTA 2OAEA 2XKAA 4MWBA 4R8VA 3AJ8A 3DLCA 1AGNA 3LHSA 1IMJA 5ELXA 3JWIA 2QEQA 3AHJA 3BRCA 4KMMA 1EVYA 2QL6A 4FR0A 3EPKA 2JJ2A 4RAQA 5L3ZA 3AVVA 1DAOA 3R3YA 4H3KB 4KG7A 4MLPA 4RWZA 3A6ZA 1LDMA 3O31A 3BN3A 5BR1A 1Q3KA 1WMSA 2JD0A 2OFOA 4OHCA 3U3OA 1H2XA 5AVQA 5IKMA 5AUOB 2JBAB 2QTWB 3VR3A 3QF4B 5EQFA 3A1DA 2C59A 4RA9B 4DQDA 4HRVA 1ETUA 1EM6A 1MN6A 4G97A 1USWA 3BSWA 3JR3A 2VP5A 2VPIA 3QVUA 4FMDB 5FEMA 2WYVA 2Y68A 3C6BA 2BMVA 3NHYA 1ZCZA 3PCRB 4L8LA 3L4KA 3DPIA 2CBGA 5EYPB 4J3NA 4WFKA 5KI6A 4JZKA 1XUOA 2QRKA 1U0OC 3K94A 4I1IA 4IKEA 1OTYA 2WB2A 3LC7O 4EW2A 1SD1A 3BMQA 4LDJA 2FWMX 1CU1A 1IH8A 2EFDB 1CR1A 4JC4A 3SZRA 3Q7TA 4CLDA 5KYYA 4CEJB 4HWRA 2DJ5A 3STUA 2XIJA 1WEKA 2IOQA 4M49A 2LZ0A 2C58A 3LW8A 4G0VA 1HDIA 2OBXA 1NJ2A 3RVQA 5A6VA 4ZJYA 2WT9A 5IAGA 1T5OA 4ZOBA 2H4WA 1LK7A 4NAVA 4RPLA 2EW2A 4DQ0A 4UUQA 4R41A 3IQHX 3E9NA 1M66A 2MINA 5FI3A 1OV6A 4TOIA 1VG1A 2GPSA 3I9KA 5TX7A 4INOA 2R9VA 4C0QC 1E1YA 1T8SA 5KSZA 4YJGB 4C4AA 1GM5A 1N2XA 2BFEA 3O8QB 5UKDA 3WJ7A 5HZKA 4N6OA 2NU9B 3UHAA 4OXYA 1DPFA 1ORTA 1Q22A 1TK3A 1UZUA 2HX1A 2VHCA 3KL2A 5CCDA 2B5WA 3LT5A 1VGQA 3GA7A 4H17A 4C4PA 2FW8A 1QC5B 4EB8A 3AR5A 3OA0A 5EWMB 5ELMA 2GEJA 3HVJA 4Z7QB 2XYVA 4B3SB 4YIHA 3BGVA 3L5KA 3VH3A 3W05A 1LDGA 1A82A 2XECA 3A1UA 3JVIA 3QLUA 3QU5A 4KQJA 1QV7A 2I4RA 2VF8A 2GNAA 4GBGA 1XVTA 1IVYA 4QQ8A 3ZCXA 2P3LA 2X9GA 3E5NA 1WUYA 3FVRA 4EW6A 3DMHA 3HXOA 1G2QA 2HA6A 1T4MA 3CHYA 2XX3A 1YMUA 5HCNA 4B3CA 5CB8A 4ZHQA 5JMOA 4FYIA 3VYTB 3L8EA 4ND3A 5BUSA 2YUTA 2O0JA 1XTPA 1MGOA 2H51A 1KEEB 2F00A 1UKEA 2JCXA 4QOEA 1A95A 4FJ0A 1RYNA 4JS0A 1U9JA 4RVCA 5IPFA 1TJPB 2QGZA 3HB5X 2JZOA 5JATA 4J0DA 4J75A 4ARCA 3CX6A 1YHYA 1RAAA 2GILA 3L7CA 2OV2A 2VZEA 1OROA 4KYTA 5FPKA 4H7IA 2P1ZA 1Y3DE 2V5VA 3M4YA 4KXLA 1QAQA 3ZV3A 3CB4A 3N39C 2GBFA 5JH7B 2KHZA 3HVHA 1HKHA 2WTBA 1QRAA 4OTZA 4PV7A 2OORC 5FQNA 3LQFA 3KQLA 5LQDA 1EIWA 2AMYA 4LDAA 3FWZA 3DCYA 5IVIA 3NUZA 4BN5A 1BE6A 4FHFA 3UKDA 1XQYA 3ESXA 3WLHA 4OBEA 1X0XA 2W2TA 3RI3A 4B4WA 2HRCA 3FDJA 1G9TA 1CK4A 1O6CA 1VJ5A 3ED1A 3R24A 2X8LA 3DHWC 4HNGA 4UAGA 4UQOA 1L4HA 2C9OA 4XSGA 4Q9DA 4TUYA 4UOZA 4Q4LA 2VSOA 2W8BB 4I1SA 1LNSA 4Z53A 5KINB 4OHZA 1FBNA 5K8JB 1OGJA 1Z3CA 1SURA 3LLCA 2PNJA 5IJ9A 4CR7A 2IH2A 3UWDA 1MXFA 2F3PA 2PL3A 3DZCA 3SSMA 3U4IA 1ODJA 4P4NA 1EX7A 2GO1A 2QJOA 5TV2A 2UYQA 2NYRA 3EAFA 4B31A 1KI7A 3ETCA 1Y3BE 5B3LA 1TFUA 1MJGA 1ZL0A 3A4YA 4X93A 1KPHA 3H2JA 4BEJA 1P0MA 3PR3A 4GQBA 4OXXA 1Z2OX 2YJ5A 4YJ3B 3TG8A 1IAVA 2QI9F 3AX6A 3DMDA 4L02A 4EVRA 2FWAA 3QPWA 4BRZA 1AMNA 4D25A 2BHNA 1PL7A 4RY0A 4UD6A 5CXXA 1XE3A 1Q7GA 3W7AA 1ADGA 3IEXA 1PJ3A 4BWVA 2IELA 3C98A 3TH5A 4E5NA 1KVUA 4JI6B 5KU1A 1N3IA 3R20A 2J3MA 2BBSA 4NVRA 5IH7A 3M0EA 3G0GA 3RFVA 2NUTB 1SUCA 4R98A 1FSGA 3U2QA 4EYGA 3R3HA 5T64A 1DKQA 4JXJA 4LY3A 2PT5A 1OT3A 1YVDA 4B33A 3UY4A 2F1HA 4KC0A 3T7KA 3OMXA 4A26A 4WXYB 4C3OB 3KJQA 5BSFA 1XTUA 3HYSA 1Z0JA 3I4CA 4NEGA 1O08A 2CVQA 5JNSA 3HM9A 1SVLA 3OE7D 1FP6A 3R0ZA 4DG5A 2PUDA 1HNWB 4P7GA 2PL9A 3ACCA 2ZJ7A 3DMGA 3RF7A 4MLCA 1DEXA 2CK3A 3A4NA 1GQYA 4GMFA 1Y34E 4KUGA 2QORA 2FR0A 1E69A 2P5UA 2PU5A 2ZJ2A 2XKJE 1KJ9A 3AJAA 3OEWA 5CW2A 1BE1A 3HXMA 2QRNA 1ECJA 4EYSA 4P4UA 2Z1MA 2A9PA 3WB2A 1U2GA 3DBRA 5M3BA 3V2HA 5IK2D 2EC5A 2YOGA 2J41A 4ARBA 1PSWA 2RGUA 2FG7C 2XH8A 4IV0A 3IOMA 5CDYA 1ZD1A 3DEZA 3IXQA 4N7BA 3CCBA 1ML3A 2ENWA 2ASVA 3I9V6 4FFBB 4N47A 3UAVA 4MQMA 3VKHA 4EB3A 4A0FA 4B3DA 1EXMA 1VLQA 2FFHA 4P8RA 1Z4IA 3D8HA 2BRUA 3EXEA 3NBYC 4C4TA 1L7MA 2XB2A 4NPHA 2EBHX 1ADYA 4DSZA 2X6TA 3ECAA 3HKEA 3ND9A 2QX9A 2D59A 1TUGA 2XYQA 2CCGA 2RAVA 1MP0A 3BAFA 1ENPA 1MNQA 2JLSA 1FS5A 1I3KA 1MUUA 1OC4A 3ACBA 4KKVA 3EDYA 4LYGA 3MF4A 2RAUA 2JIZA 2ADFA 2BJWA 3OIGA 3VNSA 1UEXC 5AKIA 5FOWA 1W7AA 2GHRA 5CURA 1I7NA 2I4LA 1AMOA 5TY0A 2E9SA 1LK5A 1U8FO 2OV4A 4M36A 1EINA 2C1ZA 2QDXA 1CHNA 4E5SA 3NALA 3K9LA 4EYQA 3QLUC 4Y30A 5HKOA 2XYGA 5DSXA 1MCZA 1Z0UA 1Z6TA 1XAGA 1WB4A 1XLUA 3BEDA 1JXQA 4LE2A 3VZPA 2DWCA 1KY4A 4OQYA 5FADA 1ZGJA 1QWSA 1WUJS 3H5AA 2P5YA 4M88A 2B0CA 4A23A 3RU7A 3BTOA 4BFUA 1PR3A 3D8UA 2DQ4A 1ZGHA 4E11A 2UYHA 5LR6A 4NMXB 4GOOD 4F4IA 3EZXA 1PV2A 3A7EA 3EGDB 2PKQP 4K26A 4BQNA 3I5XA 5E2AA 1IXZA 1U8EA 2NZ8A 2MSLA 4XWWA 1TCVA 1L2TA 1SUBA 1KEVA 2XWQA 4FFRA 2R4UA 5KAMA 1ESNA 3V8MA 4HADA 1GLGA 3O9MA 4H6XA 4UKDA 5E6UB 1VSBA 4C0SA 4PZDA 4YJHA 5T7BA 1TO2E 2GX6A 2H6EA 2CD7A 3IUJA 4DXAA 2XNHA 2EZ8A 2FUNB 3FPFA 1PV1A 2A0XA 1U4OA 3HBNA 3C8UA 3LTEA 2Q5IA 2POCA 5EVJA 3GLGB 2E55A 1M6EX 5U4QA 1XFDA 3CT6A 1SUPA 4Z9XA 2AG1A 1BGVA 2NP7A 1SUIA 1XZBA 4X24A 1E1QA 1SAYA 2W4MA 3KEMA 3KYIB 4I4LA 2XCSB 3A2KA 1JQBA 2G3YA 3TIFA 3W4KA 2P4SA 1HI9A 4AI6A 3KC2A 3T7EA 1G2IA 1X1RA 1J5EB 1F8FA 2NU7B 4RPHA 5L45A 1K1EA 5B2ZA 2XY4A 2HJHA 3LPDA 5JVDB 2PZMA 1IBMB 4YRPA 4PNZA 2C20A 3TSZA 1TOAA 2VK2A 5AJUA 5GIPE 4F21A 1RCTE 5TIIA 1AF4A 4RIIA 1A9SA 1FRQA 5HKKD 1RC1A 3U1VA 3GLFE 1V8DA 5L3RA 5ECGC 1HZZA 2DETA 1RJWA 5HTKA 3RT9A 4DWJA 3M9XA 1GPBA 2HF9A 1HDGO 1EE2A 1V3VA 5J59A 4MA0A 1RKQA 5L6LB 3W3ZB 2J48A 3ER8A 3JAWB 4LJKA 4JOCA 4Q39A 3SXUB 4XM1A 2W6MA 1IU9A 4IO1A 3MBIA 4JX8A 3BIOA 1G0OA 5B36A 5BNWA 1QHNA 3L1IA 3NOQA 2AQKA 2O7VA 3TMAA 1JFFB 2WJWA 3B6MA 2ZR0A 3TM5A 4PU0A 1W2HA 3CSDA 3I32A 1ISPA 1JHOA 1KO4A 2QROA 3H8SA 1L6IA 2R8RA 3EMBA 4PNPA 4J3FA 3V4LA 1AKRA 3FWHA 3TEMA 4WBNF 2G1KA 2GRUA 3AI3A 1GAXA 1GZHB 4OD0A 4KPGA 2WABA 2P7IA 4HDRA 1EJ2A 1CY2A 1W96A 2A3NA 2D1QA 3C3BA 3H1FA 5FOXA 4ZTZB 1D03A 3RJTA 4PF1A 3DO8A 1VCMA 3HZOA 5FJJA 3ZWPA 4XWTA 3IIIA 1R5JA 5FD8A 2ID4A 4AP5A 3VNAA 5AVZA 3S44A 4OOEA 4C0JA 1CQJA 4OHRA 1H1LB 1TYCA 3ACDA 4P3NA 4WJZA 1AS2A 4K03A 4C06A 4Y1RB 3KT3A 4JSTA 3EUWA 2AE1A 5AJHA 5K6RA 3UQYS 1YB6A 4J49A 1W4BA 5F4BA 4J0HA 4F5ZA 1JKJB 3IUQA 3BMCB 4GF5A 4R1TA 4UZFA 1AF7A 5EUBA 2J08A 4BVBA 1P19A 4ZEWA 1IWOA 1EDEA 2IITA 4R81A 2J9ZB 4C07A 4MLDA 1IPFA 2QB5A 3FLEA 1C4XA 3FH0A 3NHPA 2ZJ4A 4MW7A 5C1PA 3KR0A 4KO4S 1L1EA 1XAIA 2GO7A 4U02A 4WCFC 3CLHA 1SIUA 3RYHA 3A3OA 4L51A 2JIBA 2QU7A 3N2KB 4KOEC 1JHVA 2IVZA 4LRSB 5TRTA 1Z6XA 2HKIA 2VWHA 3QVKA 1X3SA 3IR6A 5HGJA 4ESOA 3DOHA 3JTEA 1TXGA 3B9RA 1YRAA 2QNIA 4QARA 1FNNA 1P1JA 1TX4B 2VEDA 3FYCA 3LHFA 2ERXA 3L7OA 3N5KA 4AY5A 5FBKA 1DADA 2H8KA 1DZIA 4TWRA 2DUMA 2FW1A 4QJ5A 5HM6A 3ZDDA 2QUZA 1QGAA 2ONZA 2V1XA 1WDKA 2GARA 1GA4A 1LS1A 3GJSA 2GYWA 5LSAA 4KR2A 1NVWQ 1MH9A 2IIQA 2RBKA 2VNSA 5K99A 3NPMA 1ZMBA 4Q3OA 2C2ZA 2CNNA 2VDQB 3H4MA 4DLYA 2ID7A 1EP3B 3TKAA 5B4UA 1GWNA 2QT1A 3DXYA 1DKRA 3ZNOA 2BF7A 1PVDA 2CNWD 2FCRA 3PHLA 4KHZA 4N8DA 4L6IA 1UL1X 2D06A 5HEKA 2YVQA 3AP1A 4Z0NA 1R4NA 3E9QA 3T7JA 2QUHA 3U56A 1FFYA 2BFDB 1RLOA 4X8MA 3L01A 4DLKA 3SHVA 2HA7A 1J6UA 1T5TA 1B6RA 2VJKA 1MO4A 2DJIA 2HMUA 4QU8A 5C7YA 3BULA 5KYYB 1BVRA 2EKLA 1V8BA 4RD3A 3H83A 5FULA 1EUQA 1H6DA 2JATA 4B3GA 2GD2A 4B82A 1J97A 4Y6SA 4MCAA 3V8EA 3U9SA 1SMKA 2ETVA 3D1JA 3FCSB 4XVCA 4ABYA 3HCWA 5B57C 1X74A 2IHJA 2GCOA 5LB4A 4OSOA 4BO9A 1U7WA 2W42A 4Z6KA 4MWGA 3PQFA 1K7FB 2ZCVA 2BE9A 2IPOA 2ZOSA 4N5NA 3Q6MA 3FKJA 4OLFA 1CIJA 1WXGA 2W2PA 2CZQA 5EI5A 1M2NA 4Q01A 3RARA 2Q3EA 4RE6A 4B3TB 5IJ0B 4EW3A 1P2SA 4HWKA 3K6SB 4DUZB 1QU3A 5B53A 3GCDA 1DJMA 3M8KA 3KALA 5AI9A 4NJMA 3INGA 1D09A 2IDKA 2WF6A 2Q21A 5F7ZA 1Z08A 1CUIA 2AQ8A 4TTJA 2PPLA 3PF8A 2G0NA 3NBAA 4JC8A 3A6DA 1ZJ6A 4PLCA 5CMLA 4OXRA 4UE3S 2D7DA 1VSQA 1PT5A 1L5ZA 3N75A 1U2RA 1K86A 2QYHA 4DNQA 1AQNA 1P2GA 1R9MA 5EP2A 1EK1A 2QTMA 3C8MA 5DV9A 2XNKA 1U0EA 5AXAA 4DQXA 4RSRA 1BJTA 2WHPA 2XTJA 2IXEA 4LVNA 4NONA 5BVGA 3W06A 5FUQA 3U44A 1BC5A 3D9QX 2DQYA 1J09A 4B73A 1Y6RA 5KSWB 3DLIA 4NXMB 3PV0A 5JJ5A 1VLZA 1AQLA 1JB1A 3DCIA 3KLBA 3HU3A 2UUBB 3GK3A 4W5TA 2DPHA 1TQDA 4L4ZA 5IDXA 1FFWA 4QJ4A 3NIDB 3I2YX 4LIPD 1M7BA 2UZ3A 3TECE 1QUFA 3IDZA 3DTNA 3H5VA 1XZKA 2X5JO 5KQSA 1RQRA 4MO9A 3THYA 3EWAA 3NRJA 2HO5A 3BBLA 4IY1A 2JJ1A 1FP2A 2PUWA 3FMVA 1X15A 2P9EA 3MJHA 1PS8A 1K98A 3H9BA 3R0QA 2GN0A 1NMEA 4WXRA 3TBFA 1DNPA 4NE7A 4KITB 4RVSA 3VBEA 3LD9A 2RI1A 3A6LA 5BR8B 2O5CA 4LJ9A 2XDYA 3NR2A 2DWOA 1O6GA 1L4MA 1W59A 2C8JA 2Q6IA 1FXSA 1YFKA 3KWFA 3M6VA 4KXWA 4RLFA 4ZAWA 4KR9A 2MT9A 3QWFA 2A1TS 2ACWA 1ZICA 3O1LA 5AJYA 1WVGA 3V34A 1QF9A 4E03A 1ONNA 3FPEA 4GVXA 4F2WA 1EVZA 2BEWB 1ZW1A 3WL4A 3RHSA 1PHPA 4NXNB 3W8EA 3GPCA 1KQFA 1WJGA 4W4TA 2OCYC 3THSA 1EUZA 2J6HA 4TRMA 1YO6A 4G0UA 4DUGD 3E7WA 5FX2A 4EG3A 5JJKA 2J8ZA 4QXMA 3GAZA 1YUBA 2ZYGA 4KDCA 2FPWA 3ODPA 1BXRB 1VB5A 1EFPA 1OXVA 3NBMA 3E15A 4YGYA 3SJ7A 2XWBF 3K71B 4L0MA 1U3UA 4ZVMA 1VA5A 4RUKA 3STXA 5FQOA 3FVWA 3I72A 2QL5A 2VF7A 3PRKE 2R8EA 2VBGA 3EXIA 2EERA 4CM7A 5CFOA 1G8GA 5CA0F 3H11A 3GLQA 1J0EA 2EFYA 1E3IA 5FYQA 4AMZA 1XLVA 2R47A 5U1PA 4UTZA 2HHHB 3MXTA 3PDWA 4B87A 4B09A 4ZN6A 3IURA 1GZ5A 2VCEA 5ALGA 3CWCA 2B4AA 3ZEIA 4QBGB 1X42A 2YQZA 3PUYA 1CYEA 1Z4QA 2WMDA 1KTIA 3D3EA 4C7OA 1LSSA 1S2NA 2HTFA 3FCXA 4WXHA 2OLKA 3QNWA 4ISCA 3AUXA 3LJKA 1N2CE 4HUTA 3CN7A 4A7PA 5C2JB 3UH1A 1OLOA 3GRAA 4P4LA 1X1EA 2VTEA 4TSFA 3KXPA 4BNXA 3C16C 5KSOA 2Z57A 3IIMA 3L0SA 1PBTA 3WYNA 1LBEA 1J0AA 1AGXA 2DPXA 2WZCA 2G5GX 4LG1A 5DIZA 2V4MA 2XB6A 4BQSA 4HKTA 4LYJA 1RM5A 1HRKA 4W7IA 3U09A 5L4SA 4ZOLB 3KJNA 3RUPA 2AJ8A 1L4UA 4S0ZA 4K6GA 2VTBA 2QN1A 3TLKA 1RXIA 2GI4A 1I4DD 2RHHA 1EJ0A 2NAFA 5IZCC 3BORA 3VPBA 1HEIA 4UXIA 2CWDA 3LY8A 4MS4B 4WOCA 3FHTA 5JLAA 3QKTA 4KSBA 3RFTA 2Z6VA 5FHRA 1E1RD 3F5MA 3L5OA 3JQ8A 5JVDA 4KREA 3ZGYA 1RRPA 3JWHA 4DZRA 3AM4A 1C3OA 2J1LA 5JXWA 3IODA 2GEFA 5K8CA 1H6AA 5CEFA 2KMLA 2A0KA 3LUBA 4AQ7A 4KYUA 4BUJA 4I36A 2JVJA 2ZR7A 3FOBA 1QFJA 3LUKA 2RMKA 3LV8A 1FVHA 3O26A 3PI7A 4QGGA 5FWYB 5HIAA 5KNDA 4DJFC 3UT6A 3O92A 1E9AA 3HACA 1Z0FA 4RC9A 3H0EA 1IK4A 4GP9A 4L3WA 1L8XA 3PIRA 1QVRA 3FNHA 1O87A 4Q9HA 4YT5A 4BJHB 1YK1A 6AT1A 2RI0A 2FN3A 4J0JA 2HTEA 3A1VA 4H1HA 4P84A 4OF4A 4PX2A 1NW7A 4BEVA 2V55B 1QZ3A 3G89A 4TXHA 1Q16A 2ZATA 1Z4LA 5CFNA 4RNDB 4Q3CA 3NTXA 4EJ2A 1TVKB 3H9CA 3AEKA 3CFYA 4XIIA 3FDIA 4BP3A 4KSYA 1TA4A 5BQOA 2O1XA 4UBOA 4G1EB 5AI6A 3QX8A 1Q12A 4ISBA 4AC9A 2HXSA 4TWBA 1GTRA 2GPAA 2YZNA 3D8RA 1TT5A 5KX5A 2FV8A 4P92A 3H8WA 4YWHA 3KSBC 2C03A 4CM8B 2JH8A 4MINA 2GVNA 4G1BA 4MJLA 5HWSA 5HFAA 4MI6A 4DPMA 3O8NA 4RO0A 2G9VA 3ZQKA 3EPJA 2JAPA 4TT3D 4MKGA 2R7NA 4C88A 5JS6A 4TXMA 1UP7A 2F1KA 2N0SA 2KBEA 2A0FA 1Y7PA 3GRZA 3LCJA 4XFKA 1TQ8A 3M6MD 4JLJA 5BSTA 3OFKA 4FMCB 3WNZA 3U16A 3BMNB 3CV3A 4ZJUA 2NW6A 3ZQUA 4X3CA 3L7MA 1M8PA 5JHHB 4E5UA 3GZNB 1GNSA 3CEAA 5GVRA 4AKIA 1DDOA 4Q9IA 5LKAA 1TQ4A 4G36A 4LJ8A 3LHDA 3WI7A 4QULA 5H68A 4ZQIA 3OQNA 4HB2A 1E9FA 1N6IA 3NUGA 3RUAA 1AUQA 2YV5A 3L0OA 1YZUA 2B1GA 2P40A 1BE0A 1TVMA 5SYNA 3H9EO 3PVSA 3GZTB 1DKOA 1P7ZA 1XZDA 4DLSA 2H4JA 4OREX 4WBXC 4YC7A 1HQDA 2XMBA 1BEUB 4V1CA 2WJGA 3OZ7A 1KP3A 2JLCA 5LIRA 2GASA 2V7TA 2XNCA 2PBFA 3DBHB 3EASA 4E12A 2HK6A 1P9WA 1JVNA 5BSHA 1Z0ZA 2DWPA 4DC9A 3O73A 2YXNA 4R1UA 3DL2A 1PJ2A 2H2AA 2PUCA 2AN5A 3NIGB 1S0UA 1PK8A 2FQWA 3KJIA 1H6BA 2X8JA 4WNCA 4B32A 5HZHA 4JKOA 4W5RA 2OGZA 5U4XA 1B43A 3MLBA 7REQB 5I7VA 3BJRA 5MFPA 3PA6A 1M10A 1EP2B 5IKOA 1WXDA 2YVLA 1DWPA 3C6MA 1T8WA 1TKAA 4M8KA 3TNLA 2FZWA 3NGXA 2P6MA 2D54A 5JNWA 3CR3C 5ICGA 3U7HB 3ZHQA 5K6AC 2XR1A 4A0SA 4N48A 2DSTA 2WU0A 4PR0A 3GJRA 5JT1A 4LJ7A 3SYNA 1AE1A 3ENWA 4BWFB 3PB3A 1KE2A 2ZSFA 4Q1VA 3TGPA 3WLIA 2AXEA 3BQMB 3O8OB 4FYXA 3UG6A 3ZI4A 1WETA 1YJXA 4CEJA 4D9NA 1WV0A 2LKDA 3BE5A 5EHQA 3TQTA 4G9GA 1KH2A 1T1IA 1D8TA 4EG8A 1WBBA 2ZRIA 1VE1A 1OBFO 2PRIA 5T8KC 4IINA 1U6IA 3E61A 1PG5A 4UNQA 5E9QA 3SHOA 4N7RA 4EYOA 5HQTA 3K0AA 1JFRA 2FTKE 5HNKA 4GSLA 3LY7A 4DCVA 2R86A 3Q88A 1Q91A 2WAOA 4LHWA 1Z5NA 4Q05A 5IW8A 3C5HA 2VZ0A 3ZGZA 3FPKA 4AW9A 1Z17A 1GNRA 1SQ6A 1NUUA 1GILA 3ROQA 3K20A 4KL8S 5ELLA 2OEPA 2R7AA 1RMYA 1T8RA 2W22A 4R84A 5JC1A 1FLNA 3G1TA 4AS2A 2QP4A 3OOWA 1PVVA 4PEVA 3VPXA 1RWXA 3M6WA 3QBTA 2Z5FA 4DZTA 1TUBB 1V9SA 4DIUA 4POOA 2QLMA 3MGKA 1GSHA 1SHLA 2B7CA 2BDEA 2NVBA 2BWJA 3S2ZA 3B1YA 5JJBA 2CLSA 4CBVA 4ZFNA 1T3ZA 4TWIA 1FTWA 1KAHA 3IMEA 4WY2A 3ONWA 3EDQA 1PLJA 3DVAB 4QO7A 1IHOA 1Q0PA 3AEUA 1NLUA 3ORYA 2BGIA 3PFKA 4UUNA 1G60A 3Q2OA 4MYTA 1Q6YA 5DOVA 4G26A 4KAFA 1ISRA 4OI2A 2ANCA 1SBCA 2VCYA 1TT5B 3KQQA 4OMDA 5D87A 4LCEA 3X1ZA 3L41A 2FPLA 2XB8A 2B35A 3RIYA 5EIXA 1I5RA 4W9MC 3NYRA 3PNKA 2EX4A 5KCMA 3T9CA 3W0LB 4QKQA 1YJ8A 3OHMA 4RZXA 3RS2A 2V8BA 2W6OA 1GQRA 3EIXA 1W9MA 3EFEA 5AIAA 4ZPJA 1R0ZA 3OFSA 4DSTA 2EFGA 2JFFA 4X7MA 4CF3A 3PTAA 2HXGA 4AWXA 4ZDJA 1VIVA 4KVGA 3Q72A 3V4OA 1NVFA 1RQPA 3IT2A 3NKLA 1KBQA 4FSDA 4KWHA 4QJIA 5J5VA 3RV4A 3VPSA 5F77A 3W8FA 1SKYE 3E03A 1LXCA 1RXEA 2DKNA 3N5CA 4L08A 3L7JA 4D3SA 1UKZA 3ELYA 3PP8A 2YYYA 5D3KA 3TG2A 4QD3A 3A58B 2VSFA 4W82A 4CKYA 3K0FA 4FOTA 1IONA 1LFAA 2RKWA 3CX4A 4D8XA 1TMOA 1TUBA 3IBGA 3ENVA 1GUYA 4B7AA 4WD3A 3OSUA 1JG3A 4NK4A 1RLIA 3H3JA 2WILA 3NJ4A 3BRWD 4JQSA 5IDWA 3DBLA 3SX4A 2R5NA 3NYQA 4GI5A 4RFSB 4XXHA 4FFSA 4L2IA 2ORIA 4TV9A 3H4IA 3KEQA 4FCWA 4JB8A 3CU5A 1SQ0A 4HR7A 3KB8A 3W1WA 4M1OA 3TR6A 2GERA 5L3QA 2CHGA 3DONA 1NNI1 2ZBEA 3IQFA 3NASA 1M2OB 3O4HA 2FKAA 1Y80A 1X92A 4J1TA 3S68A 4NWIA 3TLEA 1T1SA 2FEMA 2E6UX 3HI6A 1L4KA 1CD5A 3WRXA 4FLEA 3AJDA 2VJDA 4GFDA 4AYTA 2UVPB 1W94A 1F12A 1RBQA 3A14A 3DPSA 3E6AA 3QVVA 4LZLA 4RPGA 1P5HA 3CEMA 3SQXA 4UCWA 5HGXA 5AM0A 1ZD3A 2MYUA 4EPXA 4BX8A 1YMQA 4OQEA 4LY6A 3R5XA 5JSFA 1D6NA 1JILA 2L0XA 3HBFA 1Z2DA 1NT2A 3VDRA 1WABA 2XF2A 2XXJA 3OEHA 1P61B 2QAIA 5LA6F 3W1VA 1O4VA 1H69A 1U0BB 1G5HA 2Y1FA 1A4RA 1NIJA 1CJBA 2HWKA 2QQGA 1M9NA 4L3VA 1XTKA 3H11B 4MPTA 1Z6ZA 2QG4A 3GUCA 3LP8A 4UREA 3ZE0B 3D3NA 4X90A 1N78A 4EKGA 3X44A 3KOUA 4M83A 3VZBA 2A30A 2WHYA 3Q11A 4CDNA 5IFKA 2VXYA 3DEHA 2EIHA 3JVDA 4UAVA 5ESRA 4X63A 3IO5A 3O8CA 2XUZA 4ILKA 3CX7A 5HIIA 5F35A 1IOZA 1IB6A 2AWNA 2FE1A 3IPYA 1UC4B 3HDJA 3ICVA 3HY4A 3JARB 4DCCA 3U7GA 1G21B 3HI4A 5I45A 2F3QA 3L7KA 3OM0A 2WW8A 1NVBA 1RRVA 1D5CA 4L9WA 3SZGA 4ARAA 3TRFA 2KI5A 3F78A 4XPIB 3RS5A 3ERCA 2OYRA 3AU9A 3N9IA 4ZGGA 1FDRA 1Q14A 3HL4A 1V6AA 2JS7A 1JA9A 1P45A 4I81A 3K0SA 2WIBA 1V0JA 3D7MA 1W4CA 1SELA 1G7CA 2JFOA 3WL3A 4ALIA 3Q3EA 4EG1A 3UO8B 2V4ZA 4EEKA 2RK6A 3OY2A 3K15A 2MSWA 6NULA 2E49A 4IOJA 3DV2A 4O5AA 5IVHA 4AECA 2GZHA 5CX1A 1XZLA 1MX3A 3PA8A 4EP1A 3B9BA 2Q1TA 2EJVA 1SBNE 2NN3C 5FPQA 3RKRA 3RVDA 3VOAA 4V24A 1NR1A 2IS1A 3R6DA 1AIPA 5D84A 3K8OE 2YFQA 1TLLA 4DR1B 3DBOB 3UA4A 1MJHA 3EBPA 2G0AA 3B5EA 4HWOA 4WKNA 1NV8A 1PHRA 4X91A 4E09A 1WSBA 4ZI3A 3EA0A 4HXFB 3ROKA 1PCXA 3GBPA 1L7AA 1HT3A 1T0HB 1U7ZA 4OHKA 2IP2A 4MW2A 2IW1A 3EZFA 3PC2A 3N05A 2ZJ1A 3ZU4A 1V16A 2ZJOA 4LZNA 3M4ZA 3TM4A 3EVBA 1G3RA 2OZVA 3OJ0A 1PIWA 1CY8A 3WLLA 3L6OO 3WGVA 1N2JA 1D07A 4DCGA 4ERNA 2PNFA 4YCCA 2JGDB 2Q8QA 1N0IA 4BFSA 1S2GA 1GCIA 2P2GA 2D8AA 1T35A 4IIJF 2WHPB 2H2GA 2Z9DA 4IZIA 4MEJA 3U44B 1TD9A 4QYIB 3OIWA 3FMOB 4TV8A 2B0JA 2COEA 4UBJA 3RS0A 1KOGA 3V2IA 5JFOA 4QXAA 1LWOA 2P77A 3GPDG 4ZQFA 1SN7A 1YBAA 4LHXA 2X0EA 2B1RA 4MRMB 2BGGA 5IFLA 5ADHA 2ZSDA 3QTTA 1XMQB 1PBNA 1QLWA 5G2OA 3I2GA 1E7SA 2Q3JA 4ZVNA 2GPTA 1KU6A 4X0EA 1E5DA 2I7TA 1DXYA 4P80A 2AD5A 3P5SA 1IIBA 1HETA 2BIFA 4B7CA 2CZGA 2P6PA 3GT3A 4CTJA 4E2FA 5BWCA 1G17A 1XZNA 3QV1A 4I1VA 5BN5B 1BGWA 1A5ZA 4AMGA 1A77A 5CFQA 3M89A 1CQXA 2DBYA 5LBTA 3TZHA 1G9XA 5F7OA 3A28A 1OTHA 2HJ9A 4F6RA 2WWVD 4CCYA 3PR2B 4N6NA 4PZYA 2REQB 4NK5A 1KZHA 1YSCA 1D04A 4DJTA 1FDIA 4BEWA 1UM9A 3FHLA 3S8EA 2M1XA 2PDAA 3RROA 4EUHA 5JJIA 1GG2A 3C6ZA 5JCXA 1BDIA 1YZQA 2CBXA 1QHHB 3T9DA 2OCPA 1QTNA 3RC9A 1PQ4A 4ON9A 2JBWA 2V03A 4MQBA 1JRLA 2X7JA 2VA9A 1HPLA 5LDGA 4PANA 4PFJA 4RFLA 3K0EA 2PGLA 5CH5A 3NEAA 1NMZA 5AKGA 5BR7A 5C80A 1EQUA 2BAGA 2WF5A 4FUTA 1E4EB 3SC6A 1UDWA 5JH7F 2BFCB 4FP9A 1AOXA 2P6OA 4DJJA 1NBMA 2C7PA 2L2QA 1XG5A 2AWOA 1EK0A 3IQDB 1CUBA 3UOAB 1G38A 1BFDA 1C9KA 1YKGA 2AFIB 2QE6A 3EBLA 3K6KA 1YCFA 2QQFA 3GN1A 4N03A 5JISA 4Z9BA 2P2NA 1M8JA 1RAEA 4KR3A 4YP1A 3EGEA 4QGSA 1U3VA 3IFSA 1JDVA 1RXSA 1N8NA 1UBTS 1Y8AA 3CH4B 4MRAA 1KPIA 7ADHA 4UFOA 3UJ6A 1VIDA 3IBCA 3QBDA 4LWQA 3WLOA 4EKIA 4FZRA 4EMUA 4G0XA 1LBSA 4BJ6A 4H3SA 4QUHA 1O03A 3KJHA 1HOXA 4CMBA 2ZB2A 4G1VA 2W90A 5TNXA 2NXCA 1SUDA 3BXHA 4NCJA 4JYPA 1G3QA 4EF4A 2VJNA 5EIHA 4BO6A 1AK2A 1Q2UA 2NUAB 1W0KA 4NNOA 2COUA 4WZAA 4Q93A 5F1KA 2OVBA 4DRXA 3IPCA 3W5CA 4MTLA 3CLRC 3WL6A 4REQB 3RYIB 2ISSD 3FPSA 1W6RA 3DZKA 1SBYA 3QVTA 3PFIA 1FUIA 4R54A 3NGMA 5TVGA 3MSCA 1E2IA 4J2OA 4N12A 1QB8A 1SR8A 2VP4A 5IAOA 1EXNA 2JGDA 1KR2A 2HRDA 4XAQA 5D85A 1RRFA 3W6PA 1KJNA 4P86A 3TW8A 3WSVA 5BN3A 3W9SA 4EDFA 3T1OA 1EXWA 1RKVA 1GA1A 1U9ZA 2QU8A 3LL4A 4G1MB 1L3BA 2B8WA 4DABA 4BNDB 3KVRA 1A71A 3KXLA 1U28A 2WG2A 2BE7A 4X54A 3BFKA 3IE1A 3IP1A 5B55A 3I1YA 3L6DA 1DQPA 5KYTA 4QQFA 3CO5A 2R66A 3AHDA 2MR5A 5LMUB 3RRMA 1LKZA 1OSNA 2AF4C 3R9WA 2L42A 2YHUA 3NRBA 1KERA 2BM1A 3KLOA 3Q3JB 1QO7A 1VL6A 2NZWA 2X76A 4LXQA 3SHTA 5FKJA 3V7FA 1TVKA 3CH6A 4F12A 3LUPA 1JHMA 4TMTA 5LQCA 3MUEA 5L4LA 3A9RA 2PY6A 1QJCA 4FGUA 4WX2B 1GG8A 5MHTA 1JEQB 1BU5A 2X2EA 2AH5A 4WLVA 2VRNA 3K9BA 3LMKA 4G0PA 3D4IA 4FFVA 2QAGC 2QM3A 3M1IA 3QSYA 5SICE 2JFWA 1VCOA 4LK3A 4OIFA 2J0UB 1LVUA 2ZRMA 4WKPA 1I33A 1Q1BA 2YINC 4H7PA 1MAHA 2BTQB 4Q4AB 2JJ1D 4FOPA 4YBRA 5AYVA 2P30A 4RZUA 2ODPA 5CGZA 5B3AA 3OP1A 2JA1A 1INLA 1QK4A 2O57A 2PYZA 2Q6OA 1NT4A 2BKXA 3ESRA 3LE8A 1CQIA 1C8KA 2QR5A 3AF2A 3IDSA 1A50B 3H1TA 4CM1A 2J3LA 5DX8A 2AIRA 4IF6A 5AKHA 2I3DA 4LTMA 1K4YA 1PWXA 1CUUA 4GBMA 1CF2O 1KPGA 4LCBA 2DWUA 4HJRA 1JIUA 2JRCA 1XN1A 3A31A 5DGHA 5FL7D 1NQUA 3SEQA 5CNKA 4ZV4A 1YAJA 5F7JA 2DULA 2DXIA 5JWOA 4BNVA 4IAOA 2CFRA 2JBHA 3K16A 5BW6B 1C7FA 1GLVA 5HZMA 2HRQA 4K05A 3WLAA 2AUTA 5H16A 4ENVA 4IF4A 3BSSA 3USCS 4RA9A 4NBTA 1XNQB 2DPGA 3DHVA 3K9CA 3I58A 4OGLA 1DKMA 3WKBA 4B8WA 3QE4A 3CUEF 3H2HA 4L27A 3WDKA 1OYVA 4AJOA 1M2EA 1OYOA 2NT4A 2ZKLA 4PHGA 3DE0X 2VKQA 5DNVA 3W2TA 2DR2A 1IBSA 1RWPA 1MQSA 1WSDA 2IBMA 3CPSA 3FYTA 4K40A 4K8OA 2UVPA 5KDOA 3KS9A 3TIVA 5LZ7A 3LPLA 3ZD9A 1SZJG 1K2WA 2XUOA 3B36A 4Z49A 2OBMA 2JFYA 2X8BA 1KIFA 2VPZA 1FX1A 3I28A 3R3JA 1TJ3A 2O8BB