4J0KA

Tannin acyl hydrolase in complex with ethyl gallate
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
470
structure length
454
Chain Sequence
SMSNRLIFDADWLVPEQVQVAGQAIQYYAARNIQYVQHPVAAIQVLNVFVPAAYLHGSSVNGYQRATAPILMPNTVGGYLPGPADDPQRVTWPTNAGTIQQALKRGYVVVAAGIRGRTTVDKSGQRVGQAPAFIVDMKAAIRYVKYNQGRLPGDANRIITNGTSAGGATSALAGASGNSAYFEPALTALGAAPATDDIFAVSAYCPIHNLEHADMAYEWQFNGINDWHRFEPVSGQLTVEEQALSLALKAQFSTYLNQLKLTASDGTHLTLNEAGMGSFRDVVRQLLISSAQTAFDQGTDIHKYAGFVVTGNQVTDLDLSAYLKSLTRMKAVPAFDQLDLTSPENNLFGDATAKAKHFTALAQTRSTVTAQLADAELIQAINPLSYLTSSQVAKHWRIRHGAADRDTSFAIPIILAIMLENHGYGIDFALPWDIPHSGDYDLGDLFSWIDGLCQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tannase
publication title Crystal structure of tannase from Lactobacillus plantarum
pubmed doi rcsb
source organism Lactobacillus plantarum
molecule tags Hydrolase
total genus 159
structure length 454
sequence length 470
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4j0kA00
3WWEA 3RKSA 4BVKA 3I6YA 4QDXA 3HEAA 4KE7A 4BC0A 3D2AA 3ZLVA 4BZWA 3M81A 4Y2SA 5AIAA 1C7JA 4AN1A 5AHXA 4BE4A 5D7BA 1EDEA 4F60A 1VZ3A 3G0DA 1L7QA 2CB9A 3QPAA 5JZBA 5IVHA 3EBLA 2XMDA 4MYDA 2C0PA 1GPKA 5JYCA 2LIPA 1AZWA 4Q3OA 3OC0A 2QZPA 3CXUA 5I8PA 4OYYA 5CXXA 1AMNA 5I9IA 1LBSA 4K6HA 1XQWA 1XKLA 3D3NA 1XRNA 3HYSA 1VE6A 2QT9A 2JGFA 5JAOA 1CVLA 4Z49A 1LZKA 1YCDA 5FOQA 1XZLA 3STTA 5JD4A 3E3AA 3FYUB 3ANTA 4CG1A 3ESCA 2XMCA 3KOOA 4QE3A 2DCMA 3TJMA 2XI4A 4JUIA 5KBYA 3V1LA 2CMFA 1AURA 3WK5A 1DWQA 4C4XA 1ZI6A 1FFBA 4LXHA 4OSEA 3TGLA 1LLFA 4NVRA 3WLAA 2P8SA 1UK9A 2QR5A 1F0NA 2ZYRA 2Y6VA 2OAGA 4GWLA 1UK8A 3WWDA 1HKHA 4BTVA 5CRIA 5K3FB 3DQZA 1OCEA 1CUDA 2AJBA 2K2QB 3HXKA 5HFNA 4AB1A 4K5QA 3HLKA 4JYPA 3FYUC 4QA9A 1W52X 5E2IA 2XB6A 1J2EA 1E8MA 3STYA 3YASA 5AM5A 1WHTA 4V2IA 3HSSA 1NX9A 2PU5A 5ALIA 3W06A 4H7JA 5HCUA 5T4FA 4G5XA 4Y7DA 4RE5A 5D3ZA 5AP9A 4KJXA 1EB8A 3D2BA 4B9EA 4M0EA 1XFDA 3FOBA 2B9VA 4A5SA 5FPQA 3ZI7A 1XRLA 3WK4A 4FMPA 2UZ0A 1QFMA 4IHAA 4AMZA 4U2DA 4DMCA 3PUIA 2WJ3A 5JANA 1HL7A 2V97A 2QRUA 3T52A 5CURA 3HJUA 4B9AA 1FSSA 1EINA 2DFPA 4B6GA 4G9GA 5E4JA 4BYMA 3I2GA 2QM0A 4ZV9A 2B61A 1ZJ4A 5ALJA 1K5PA 4PF1A 1G5FA 5AKXA 4DYHA 2WTNA 2GYUA 3CCCA 3F8SA 5HQ3B 1J1IA 1PV1A 2HFJA 2HA0A 1LPAB 4IQ4A 4DSAA 2CZQA 4N5HX 4J7AA 2CKMA 2HU8A 3F9CA 3FYUA 4ARBA 1QIIA 4CFSA 4K2AA 4KR0A 5EFZA 2ES4A 4DSZA 2HM7A 5CW2A 4IO0A 3CN7A 4XVCA 5JAPA 4BRSA 2WIGA 5AI4A 3R0VA 3WI7A 1A8QA 1P0IA 4F5ZA 4N8DA 5JASA 4QDZA 5AK5A 4UFPA 3E4DA 3W04A 3KXPA 1CLEA 2WHRA 4RGYA 5AK4A 5ALTA 5K3FA 4IH9A 3DLTA 1CQWA 2JGMA 5AO9A 2VA9A 4J03A 2X76A 5ALGA 2C5GA 3DYIA 4J0JA 3DOIA 3CCBA 1D07A 5LZ2A 3DYVA 3C6ZA 4UHBA 2C58A 2HIHA 3W9UA 4ETWA 5C7YA 1XKTA 2OG1A 4L9AA 4P08A 1MU0A 5A7FA 3H04A 3H1BA 1Q83A 5DYYA 2XLCA 1SFRA 1U2EA 3STUA 3STXA 2WU3A 5HF9A 3O95A 4FFWA 4W9RA 3I2HA 2JGEA 5C81A 2ZJ6A 2AJDA 3DJYA 3K2IA 4BCBA 3OPMA 3C45A 1WOMA 3F67A 5FXMA 2VJDA 3WJ2A 1AQLA 4X92A 5AOAA 5ALQA 1QIGA 3V1MA 1ZOIA 2RI6A 4BZZA 3GZJA 2WG0A 1UOQA 5ALEA 2WKWA 5A7HA 4F21A 4P9NA 1C4XA 4HXFB 3A2MA 5ALMA 1MPXA 4QDOA 5DTJA 3D59A 4DNQA 3JWEA 1SOMA 2HDWA 4C6HA 2OLEA 4BCCA 1M33A 1QIJA 1WB5A 2OQVA 2OGZA 5AM0A 1IUPA 5HQ3A 2XMZA 3FLBA 1LPPA 4PW0A 3ED1A 1BS9A 4Q34A 4WFJA 4PSUA 4Y2RA 3FNBA 2BGNA 4DNPA 4HRYA 4UHHA 2H7YA 4DLNA 3NOXA 4JEIA 1A8SA 2RAUA 1TIBA 4Q3KA 2WG2A 2FJPA 4XX1A 2O2IA 4Q82A 3WK6A 3PI6A 1K63A 4YPVA 2BUCA 1LPNA 5FDFA 2PKYX 1EVEA 1E5TA 1ZIYA 1XZAA 5AOBA 6YASA 2DQZA 1TCCA 1UOPA 1K4YA 2YH2A 4DMKA 1MTZA 4MQLA 3T4UA 2ZVDA 1QFSA 3BJMA 1YSCA 1ACLA 1GPLA 3W05A 3WL7A 5AKEA 1TKRA 2PVSA 1U65A 4FFVA 3I2FA 1XRPA 3DKRA 2ECFA 5EIAA 4RPCA 1QIEA 4FOLA 5ALPA 5ALKA 3AIMA 4P92A 5JAHA 4AO6A 4MJ3A 2QJWA 3RARA 3DKKA 1JKMA 2WUDA 1F8UA 4E46A 4GHWA 2HL6A 2CBGA 2OCLA 2D5LA 4GBGA 1W1IA 1QGED 1A8UA 1FFEA 1YB7A 3MUNA 3I6ZA 2DSNA 3LCRA 1MX5A 2RONA 2HA5A 2XMGA 4H7FA 2BUBA 2VAVA 1IUNA 3L1HA 3R3ZA 3WZMA 3VJKA 1XZBA 4KAFA 1G4HA 1CUJA 1VOTA 1P0QA 1WB6A 2WFZA 2D0DA 3R40A 2VAXA 4FHZA 4X3CA 3ZV7A 1IZ8A 2XUIA 1RP1A 2Z8ZA 3O9VA 5AH0A 4X90A 1ODSA 3P2MA 2DR0A 5ALYA 1XRRA 1XZJA 4X85A 1VZ2A 1W6RA 2OGTA 1LPBB 4BDTA 3BE8A 4AN0A 4OPMA 4J0IA 1B6GA 4KEAA 4U2GA 1EDBA 4EZIA 5CT8A 2ZYIA 3G0GA 3WKDA 4H7EA 3R3VA 3QBJA 4XJVA 5CTAA 2HA7A 5EHQA 3SK0A 4Y2YA 5DLPA 2JGIA 2WHQA 3C8HA 4H35A 5LKRA 5JZ9A 3NGMA 3OTQA 1YASA 2VSQA 1J07A 3F96A 5ISMA 5T4HA 5J3JA 4EBBA 3LLCA 5LZ5A 5JARA 1YA4A 1JI3A 2DHDA 2ZJ7A 1THGA 1FJ2A 3C6YA 3O4HA 4A16A 3C5VA 1KEZA 2JF0A 4K6KA 1FFDA 5CT4A 1UT6A 3AZPA 3MGAA 1LGYA 3QYJA 1JU4A 1H2YA 1XRQA 4XIIA 4FLEA 1VKHA 1DT5A 4W1PA 2XUQA 3ZPXA 3BDIA 4I19A 5IVIA 4BCDA 4WDQA 4DIUA 1MNAA 4Y2XA 5HZGA 2J3DA 4U2BA 5JAUA 4INZA 1G42A 4LHEA 4HAIA 1BN7A 1J06A 5AK6A 4BRZA 1GZ7A 4DGQA 4PSCA 5DWDA 2O7VA 2GBGA 3ILSA 1JJBA 4BP9A 5AM1A 2G5PA 3C8DA 5BWBA 3HABA 5AICA 2HU5A 2WUEA 1IUOA 2XQFA 1GPNA 1Z68A 4NMWA 4X6YA 3IDAA 5FUMA 3V1KA 1WCYA 3H0CA 1H2ZA 4Y2JA 3ZLTA 1H22A 3SC2A 4GI1A 1JFRA 4ZI5A 3LIPA 1JMYA 4M0MA 1ZI9A 4L0CA 1EHYA 2ONCA 5IVDA 1L7AA 3N2ZB 3I6MA 2XUJA 1YA8A 2BFNA 1CEXA 2GBCA 5EIEA 1Q0RA 2RIPA 3N0TA 1TAHA 2Y6UA 2QJRA 1DT3A 4RNCA 2O7RA 4N8EA 1QOZA 4F0JA 1O6FA 1IVYA 2WJ6A 3BWXA 1PJAA 3H2IA 3U0VA 5AKYA 2YXPX 1YAHA 1QTRA 5FV4A 1CUUA 3GUUA 1WB4A 4KAAA 3PICA 1WM1A 4QNNA 3VISA 2WIFA 3QZUA 2QXUA 3LIIA 4PNZA 4E14A 4P93A 2OCGA 3V9AA 4B85A 2VF2A 5ALSA 1QIDA 3PFCA 4AX4A 5CH8A 1TRHA 2WFMA 3H2HA 2ORYA 4KAJA 2Z3ZA 3FLAA 4CI9A 5SYMA 5JD5A 4G9EA 4Q3LA 5BOVA 5K5EA 4FLMA 5HKAA 3A6ZA 1AC5A 2VJBA 4ZRDA 1XLWA 3U1TA 3IUQA 1CUVA 1EI9A 4FNMA 2GYVA 3ICVA 1CUYA 1JJIA 1E66A 2JEZA 3H18A 3D7RA 5H3HA 1THTA 4G1FA 1OILA 1N8SA 2GYWA 2QXTA 3L1IA 4YX9A 4HZGA 2WHPB 2QVBA 4Q05A 3NUZA 3BXPA 4AZ0A 3GROA 3VKFA 3PF8A 3Q0TA 1BRTA 4CCWA 4KRYA 2PUHA 4PQEA 3WIBA 5EGNA 1GT6A 3WA6A 4Y2QA 5LYYA 4U2CA 2PBLA 5AI5A 1CFJA 2ZSIA 3DD5A 2VQ6A 2PUJA 2XUGA 3G7NA 2QOEA 3WL6A 1ORWA 3EF3A 2ZJFA 3IUMA 5LZ4A 1BE0A 3HI4A 1BU8A 1LBTA 1CV2A 2WTMA 2QKYA 3K6KA 4KE6A 2HHAA 4Y9SA 5KWIA 2WFLB 1T2NA 5AM4A 3I28A 4KE9A 3AUKA 3OM8A 4TPKA 4MWTA 2V9ZA 5DYTA 1HQDA 4FKBA 1JMKC 3EIOA 4B80A 1Y37A 1N1MA 5IH7A 4X93A 3O4GA 4ITVA 5EI5A 5AKHA 4MQMA 1P0MA 4G4JA 1SCKA 2EEPA 1VA4A 2OGSA 2VJAA 4OU4A 4EY7A 4MXDA 3FSGD 2I03A 3KDAA 3X3HA 4ZGBA 4HRXA 1YS2X 3O4IA 4KRXA 1CRLA 4WY8A 4U2EA 3BL8A 4A23A 1UK7A 4RE6A 2WJ4A 3G0IA 3HZOA 3RM3A 4C4YA 3AIOA 5AM3A 5ALHA 4D9JA 2OXEA 4WDRA 4FBLA 1CUBA 3BJRA 3DL4A 4UPDA 1XZKA 1HBJA 1XLUA 4HTAA 2IITA 1MT3A 4G8DA 3UUFA 1A7UA 3QH4A 5ALDA 2B4KA 2GBIA 1UK6A 1XZHA 1JT2A 4W63A 4TGLA 2QUAA 1YB6A 1JU3A 3DNMA 5ALWA 4BAUA 4C89A 1FFCA 3EQ9A 4UHFA 4W1RA 1CUWA 2XMSA 2H7CA 1QO9A 3FBWA 5ALVA 2QS9A 3R3XA 4LYEA 1EX9A 4LXGA 3DL7A 5FPPA 3OURA 5K3DA 1TQHA 3DDUA 1ZGCA 3F98A 3QPDA 1N5RA 4FBMA 3PUHA 4KYVA 4ZREA 1QO7A 1BROA 5C8VA 1MAAA 2PM8A 4QZVA 3PF9A 2XUDA 3ESAA 1N5MA 3M3DA 2W6CX 2XQGA 1YAJA 5IVKA 2RGUA 5AI8A 2WSLA 2IX9A 4E11A 3O9MA 2AJCA 1TCAA 1DU4A 3IA2A 2PSEA 4GXNA 4CIBA 1ZJ5A 3PE6A 1I6WA 3WYDA 1CPYA 1R1DA 1ZD4A 5AKZA 1MJ5A 5CBKA 3A2LA 5JIBA 2AJLI 1VJ5A 3WK8A 4G4GA 2WFLA 2DHCA 3DS8A 2XMRA 1EVQA 4UUQA 4J0CA 4X00A 3H2GA 4S0XA 1XQVA 1K8QA 4O08A 1DTEA 1QIHA 3QPCA 4E15A 4KE8A 1BEZA 2VEOA 2V98A 3WMRA 3QVMA 4B84A 1LNSA 1EB9A 4MEBA 1U8EA 2PSDA 3H1AA 4LXIA 1DQZA 3H17A 2IIVA 3C6BA 2H9YA 2BUAA 3HRHA 1LZLA 4L3WA 4EHBA 5ALLA 5EHZA 1CIJA 1Q0ZA 3GELA 1BEEA 1R88A 4OCZA 4C01A 2OQIA 3WIOA 4ROTA 2XLBA 3FCYA 2XE4A 2XMQA 4QDUA 4HXGA 1OXMA 4G4IA 1DINA 5LLSA 2J4CA 2AXEA 5AKKA 5AI0A 1GGVA 3A70A 1Y7IA 4BVJA 1WPXA 1ZI8A 5E4TA 2XUKA 5AJHA 1E8NA 1UKBA 3FCXA 3O0DA 3W9BA 1E89A 1R50A 1DX4A 5CMLA 4K6GA 3IURA 4BB0A 1GQRA 4X6XA 3WKBA 1UXOA 2JBWA 4JH0A 4EY4A 3KSRA 5EIHA 1CUGA 3WZLA 1XZGA 3VJMA 3R3WA 3AJAA 3FSGA 4FNGA 4QLOA 5K3EA 2NW6A 4CG2A 2HA4A 4H7HA 3VVMA 1H2WA 1MNQA 1SCIA 2JGLA 2YASA 3RLIA 4QWMA 3VVLA 3SX4A 3I2IA 4Y2PA 3WL5A 4WFKA 3WK7A 3BIWA 4DNOA 5EHXA 3IVMA 2XQKA 1W75A 3LP5A 1EK1A 3WYNA 5ALOA 1MX1A 3LS2A 4GECA 1CUIA 2QTBA 3S2ZA 2ZYHA 4EB0A 2CJPA 3A2NA 3FVRA 1HDEA 3BIXA 5A2GA 2RHTA 4J3JA 4B0PA 3IB3A 1ZD2P 2C5FA 4EY6A 3QMVA 2C4HA 4PV7A 3V1NA 2BJHA 5DNVA 3WWCA 3ANSA 3FLEA 1EK2A 3TEJA 1ORVA 2XUOA 3E1GA 3PFBA 1FFAA 5HK9A 5I7UA 2CUTA 4B82A 5KWJA 1QIMA 3JYHA 2HADA 3C43A 4Y2VA 1VLQA 5C8ZA 2OAEA 4J0DA 3BF7A 5KREA 2OPHA 1EDDA 2VTVA 3ZLUA 1NU8A 1GQSA 3D2CA 3MUOA 2JEYA 3G9ZA 2HRRA 2QUBA 1UZAA 3B12A 4AXBA 4QLAA 1HPLA 5YASA 4MYSA 1VXOA 4W1SA 1EA5A 3PDCA 3GFFA 4H18A 5JADA 2ACKA 1YR2A 4UHDA 4LKOA 3R3YA 1GKKA 3G9XA 4EUSA 4HS9A 1KU6A 4UBNA 2FJ0A 7YASA 4C88A 1VXRA 1QLWA 2GBFA 3WWPA 1MN6A 1F0PA 5LIPA 3FAKA 5HF6A 5SYNA 1AX9A 3D5EA 3UMJA 1VE7A 5E4YA 3R3UA 3VDXA 1QIKA 4WY5A 3KWJA 3G0CA 1S8OA 2EDCA 5AKLA 1DWOA 4U2FA 3STWA 3QM1A 3I2JA 4AZ3A 1AKNA 3AILA 3B3QA 2I3ZA 2XDWA 3HC7A 4X6UA 3AZQA 1SC9A 2XUFA 5A62A 3C5WP 4I3FA 1XQYA 1P0PA 3H19A 1ZICA 5A71A 2WUGA 4B83A 4B81A 1Q84A 2V96A 2W22A 3H2JA 2B20A 2WILA 4X97A 1AGYA 4BDSA 2AJ8A 3DOHA 5ALRA 4WFIA 5JATA 3AZOA 4DTCA 4FLFA 2PSFA 3BDVA 2E3JA 4BBZA 3AINA 1DWPA 4IH4A 4N5IX 1BCSA 3IUNA 5FLKA 5FKJA 2XT0A 3ICWA 2HA3A 5JZSA 2G4LA 1UKAA 4BAZA 4PSDA 5AKIA 4FWBA 5DJ5A 5K3CA 5AI6A 1CUXA 4X91A 1NU6A 4XWGA 4NZZA 1CUSA 1R4ZA 2DHEA 2QMQA 2VT6A 1R3DA 5BWCA 2VATA 5ALNA 4L72A 4BE9A 4EY8A 4ARAA 4UBMA 3WKCA 4UBJA 2JGJA 2C0QA 4H7DA 3C6XA 2XQJA 1IZ7A 4HXEB 5FRDA 2BCEA 2Y2VA 5AKGA 4UBLA 1DX6A 3FYTA 3HACA 3W2TA 2Y2UA 3S8YA 1C7IA 3R41A 4PO3X 4X95A 4WCVA 3IBTA 5HKBA 1RWQA 3QITA 4J0HA 2R8BA 5LZ8A 3G8YA 4HVTA 4DNFA 2Q0XA 3STVA 5AI9A 5K3BA 1WPRA 2Y1KA 1O6GA 5AK3A 4BP8A 1UOOA 1PFQA 3WKAA 5DTIA 2C7BA 2XQIA 1QE3A 4LYDA 4X7BA 4NS4A 2I3DA 1T4MA 1TK3A 2WIKA 2H1IA 1YS1X 5DNUA 3D0KA 4IH1A 4CIAA 1E3QA 2WM2A 4AQDA 3QMWA 4YK7A 1UKCA 4H77A 1ZIXA 5IKXA 3GBSA 1A88A 3G02A 3WL8A 3I1YA 2HA6A 1W4LA 2VJCA 2WQZA 4DMFA 2WIDA 1XZMA 1CUCA 5CT9A 2BAGA 1JJFA 3RK4A 5LZ7A 5T4EA 2O2GA 3MVEA 1VA5A 3C87A 2G5TA 2PU7A 5A7GA 3EQ7A 4AMYA 1QZ3A 2FX5A 4UBOA 1ZGBA 4OU5A 2XUPA 1HLGA 2GZRA 4UBKA 1E8DA 1XZCA 3Q8WA 4H7KA 1IMJA 2ZSHA 2BKLA 3C70A 1XZDA 2O2HA 5AIBA 4C87A 5CT6A 4UHCA 5LZ9A 2WHPA 4J0KA 3I1IA 3BF8A 2WIJA 1B41A 1USWA 4B7ZA 4J0GA 1L7RA 3M83A 2Z5GA 3CN9A 4JNCA 4QEKA 1R9NA 5FP0A 2RHWA 2OCKA 2Z8XA 4EY5A 2WLSA 4QDTA 3WJ1A 2X5XA 3H2KA 3WK9A 3OOSA 1ZD3A 3FVTA 3DEAA 4B0OA 5ESRA 5F4ZA 1QIFA 1CUAA 4Y2UA 2HU7A 4BAGA 1LPMA 4OD0A 4Q1VA 1QONA 4AO8A 3JW8A 1QJ4A 2ACEA 1LPOA 2PL5A 4UFOA 1H2XA 1X70A 4OB7A 4GDMA 5DNWA 4GEGA 4X94A 1WHSA 1ISPA 5T4BA 1CUZA 2G63A 2J3QA 2BGRA 5D3KA 3F97A 5HF8A 4CCYB 2I78A 5A6VA 4BTLA 1QTIA 4KACA 3E0XA 5ALXA 2WU4A 1XQXA 3AFIA 4ZV7A 1CUEA 1KU0A 3D4LA 1G66A 5CT5A 5JALA 3G9TA 4C4ZA 1ACJA 4FTWA 5CH3A 3VXKA 4MEAA 1XLVA 3ESDA 4WJLA 2HRQA 1K6EA 3FWHA 5K3AA 5BV7A 3WWOA 4JYMA 4OUKX 3G9UA 5HF5A 4CG3A 1UWCA 3NWOA 3V48A 1ODTC 1SCQA 3WKEA 4G8CA 4N8SA 5DYWA 3ZWQA 5ALZA 1MO2A 1X2BA 2PPLA 2EDAA 4GLBA 4TVKA 3ESBA 1XZEA 4ZWNA 1TCBA 1X2EA 2ROQA 3G0BA 1CUFA 1H23A 4ZXFA 1EXWA 3GA7A 1CQZA 2J4FA 2WUFA 4MWSA 1XROA 4YASA 2R11A 1CUHA 1RYYA 1U4NA 1BCRA 1R9MA 4LIPD 1UFOA 3DCNA 1CR6A 3IULA 4W1QA 3IIIA 5LKAA 3AIKA 2XMBA 5ALUA 3EQ8A 2Z3WA 3QMMA 4X71A 5HFAA 3WQHA 3L1JA 4EA6A 4H7IA 4UBIA 3SWWA 1ZD5A 2PSHA 3K9BA 5CH5A 3M82A 5LP1A 3TRDA 2X8BA 1BN6A 1AUOA 4OYLA 5HK8A 2YYSA 4GW3A 1Y7HA 2WG1A 1LPSA 3WA7A 4QWWA 1DQYA 4BATA 1ODCA 2DQYA 2XUHA 4DMHA 5EHNA 5AOCA 1ETHA 3I2KA 2ZYSA 4M0FA 4I4CA 3O4JA 4OB6A 1XZIA 3UUEA 2FUKA 3VJLA 4UFNA 2GZSA 2JGKA 1GXSA 2HFKA 2PX6A 2PSJA 4DM7A 5C8XA 1MX9A 1GKLA 5JD6A 4H0CA 1W76A 1MAHA 2HA2A 4BVLA 5ALFA 4BC1A 4OB8A 1EH5A 1XRMA 4CCYA 5AM2A 5AKJA 3KD2A 4G8BA 2JIDA 4UHEA 3KWFA 4Y2TA 2VT7A 2OCIA 2H7XA 3B5EA 1XZFA 3OG9A 4FDMA 1F6WA 2CEKA 5CXUA 4AO7A 5D6OA 3IUJA 2XUAA
chains in the Genus database with same CATH superfamily
5F9MA 3WLOA 3WWEA 4C2UA 1M2VA 3SS9X 4DDVA 1E2DA 2JLXA 3O8DA 4RDHA 3AIIA 3OPYI 4QRDA 2WT9A 3HEAA 4KE7A 2PIAA 5JJIA 3P9NA 3ZLVA 4BZWA 3EGVA 1L4LA 1RYDA 1U8YA 4C1NA 3LWNA 3V8VA 3HA7A 4YRIA 3UJAA 4NCAA 1IBSA 4U0KA 2W0SA 5IJZA 4LF9B 5AHXA 3OTGA 3EEBA 3DVAA 3V3KA 1TOAA 3A58B 1KK3A 1PWZA 2AVNA 3N8KA 3QPBA 4PR3A 2EGGA 5LNK6 2GPNA 3M4NA 3ZHOA 2D1SA 2BMFA 1U7UA 3UWOA 2GTIA 4LSWA 1RT9A 2NPFA 4NF2A 1BX3A 1X9HA 1NL3A 1VLJA 1VZ3A 2MWMA 4R1NA 4RY8A 5LQSA 4BBAA 1V8DA 5J43A 1BVRA 2X2OA 3K1JA 4A8TA 5IVHA 3CNLA 3EBLA 3H2SA 4WOBA 4UXJA 1EFDN 1C8BA 4MYDA 2G06A 1PLLA 2GXUA 1GPKA 5IEJA 4MCHA 4PINA 5IN4A 3ENWA 1W4AA 1QANA 2Y05A 3I0ZA 2LIPA 4FKZA 3BEOA 4PO9A 3ROZA 4B09A 3FNFA 3D7MA 3L8YA 5BSMA 1IRXA 2C95A 4Q3OA 4IDQA 4I1UA 1YO6A 2X58A 3L6RA 1PWXA 4ICIA 5AVQA 1A0OA 2IF0A 4ZIRA 2VUIB 4F3RA 2QU7A 4KXLA 4E2XA 1P4JA 3NHBA 5HKKA 1O87A 3HB0A 2H8KA 2HMAA 3IPCA 1GLVA 1PNTA 4IM7A 5I9IA 1LBSA 1MC4A 4GR9A 4UE2A 1ORIA 3L0PA 3N86A 3RWMB 3DH0A 4X20B 4HYQA 1Y4UA 3FZGA 3WGZA 4F2HA 2QRQA 4O4IB 4POOA 3GFRA 4ACAA 3I5XA 2MSWA 3MLEA 3T54A 1GUZA 2IPNA 1CVLA 4ZU6X 1ANKA 3NTVA 1YCDA 2AX3A 5FOQA 4LI3X 4E33A 4YRFA 5CLFA 1HWYA 3LC7O 3OIWA 3AI3A 3PIDA 1T4CA 2FPPA 3CTPA 1G8AA 5AOVA 4XFDA 3TLMA 4MHTA 3A9SA 3UAVA 4NCBA 1VG0B 4KKVA 3KOOA 4C0XA 3JWGA 4QE3A 3OQPA 4MICA 3TCNA 3BSSA 5AUPB 4DR7B 2VYQA 3ILXA 1N2OA 4F56A 2N75A 4B3FX 5KBYA 3I8OA 3O93A 2OUIA 3OZBA 3OFVA 1QFYA 3P1JA 5E6UB 1C3JA 2MYNA 3RK0A 2PGJA 4KWIA 5AW3A 1O0CA 1FFBA 4GVLA 3TW6A 5FTNA 2I2WA 2OFPA 2HGSA 4KQGA 2Q1UA 4OGWA 1YRAA 2HBZA 1ZQ1A 2IHZA 3D31A 1EJBA 1RIFA 4JYCA 2XVZA 4UDXX 2QG9A 1C7RA 4U7HA 1SXPA 3DP9A 4NVRA 1VI2A 5DKFA 3L7OA 1IXRC 3RODA 1ZRMA 1UK9A 1W48A 2JZCA 1PEYA 3IHLA 2PK3A 3GV0A 2Q6KA 1N2EA 3QRWA 3WFIA 2P68A 3IYLW 1RXVA 1IMOA 2HSZA 1G3RA 4RF4A 5EMHA 4V0RA 4W9MC 4J3FA 2CHVA 2HLDA 1WDWB 3HKBB 1Q1NA 5B1SA 1ZEMA 1QBKC 1ORDA 1ZJZA 4PZZA 2RDMA 5KNDA 5EWLB 2NXCA 1TPYA 2G07A 2OSBA 2Q1SA 3D3EA 3GARA 3SFTA 3R6DA 3WNQA 2Y77A 1CUDA 4I4TF 3WDSA 4MWOA 3CCFA 2K2QB 2WQ6A 1WDKA 3RKRA 1XK6A 5BN5B 5C8DA 3W8DA 4QU0A 2R44A 3VA7A 4HGPA 3ZBQA 4ZCRA 1RAFA 3Q5DA 4LGVA 4AB1A 3MCTA 4YIHA 2NUTB 1JIXA 1CKEA 2OORC 3HLKA 4DCNA 2OV6A 2F43B 3FZNA 4E09A 1UKEA 3LV8A 1UANA 3D7LA 3EEIA 1W52X 5JY6A 4R1LA 1BWRA 1SQ0A 4LNUB 1KZ6A 5AM5A 3RIGA 2I91A 1PVOA 3RRNA 1GSOA 1HDRA 2B1RA 2GN1A 4BFCA 5L45A 2W9XA 1XF9A 3CB2A 4Q24A 5B1HA 3W8EA 2PR7A 1Y3CE 4V2IA 3KTOA 1FFYA 4RK4A 1IN6A 1UH5A 1NXTA 2PU5A 2EG5A 4OM8A 5ALIA 4J3NA 3UK2A 3W6UA 3BHNA 3SC4A 1TZBA 2CVFA 1OZAA 1SVUA 3KOWA 3KOYA 4H7JA 1H6CA 1JQJC 1RQ7A 5T4FA 4P35A 4KQCA 2BI7A 5IBPA 3QOWA 2Y0EA 3E5NA 2PZ8A 1EB8A 3D2BA 3P0IA 3M33A 4M0EA 4RVGA 5D5QA 3QNUA 5LU8A 2GAJA 4G67A 4RIIA 5AXAA 3LQQA 3F7MA 4IDGA 3W7VA 2B9VA 3U7HB 1DEXA 2V6MA 4ID9A 1BZYA 3K1AA 1CQPA 1TVKB 2PSSA 3H1FA 3TPZA 2XDYA 3S4YA 1M34B 3DKIA 3IHTA 2CYCA 3GCXA 4EFMA 1N5DA 1JLLA 1DJOA 2O1EA 4I1VA 5IKMA 3AM5A 3SZOA 2ZRLA 3ZK7A 2F9LA 5EZYF 1GRRA 1F5SA 2AH5A 2IS6A 5IK2A 1R0WA 2ZAOA 4XX0A 2OK8A 3UB4A 1HTWA 1ND6A 5JANA 2WJ3A 3G79A 4BY9E 5K01A 3OCZA 1A76A 1PJCA 1EGMB 1QF6A 1B43A 3GEGA 4H3VA 1VDMA 3LP8A 3NGLA 4ER7A 2DFKB 4XWTA 2ATVA 1OBCA 3FYHA 4UCWA 5EEHA 2GCOA 1R8SA 1WEHA 3EMVA 3JYOA 4Q48A 4QYIA 3OZWA 2BZSA 2PGLA 4RMNA 3DDCA 4HKTA 2I3BA 4C78A 4CT5A 5B57C 2HY7A 5E4JA 2VKTA 3OX4A 3Q7QA 3SXUA 2VCYA 3ER9A 1H0KA 2R62A 1PTKA 5ECYA 2P4QA 2QM0A 4EJFA 3A4VA 5F12A 5KYWA 2H17A 3EY4A 4WQMA 1L4GA 2QW0X 4ZV9A 2WMNB 1PWHA 2C9MA 1D7AA 1GCIA 4BQPA 4NXNB 3R9KA 3F7OA 4NMMA 2Y1DA 5A3SA 1V7PC 1Y63A 2OC4A 1K5PA 2ZU6A 5ALJA 4PTLA 3TOCA 4D26A 3PKIA 3BXZA 2WTUA 3MMXA 4DYHA 1GG9A 5H59A 1Y1RA 1TJ3A 5JXGA 5IJ0B 4EGFA 4EUEA 1KO8A 3LOPA 4OFWA 4Q12A 3HCPA 4U39A 2AOXA 4C0BA 1BVYF 2MSNA 5L6MB 3SHFA 3BAFA 3EPJA 4FWIB 4XM2A 4N6GA 2Z56A 1JZQA 3MWKA 4PAWA 4QARA 2HXGA 3N2EA 1U3VA 2Z0MA 3E3LA 1SVMA 1X80B 2JBAA 3L0IB 4S0ZA 2QLNA 4J7AA 4GP7A 3EXFB 4NH0A 3F9CA 4D8YA 2EVWX 2EJCA 1Q92A 2EJWA 3RADC 1Q91A 1QIIA 3EXHA 3ZVLA 3O91A 4K2AA 3ZHRA 3GL9A 4MB0A 1Q7CA 4E07A 3OLYA 1XC7A 1JPUA 3ZZNA 1WV0A 3QQ5A 1GKYA 1BRMA 5AW8A 3ROKA 3T0GA 3PEWA 4KVGA 2HM7A 2I4MA 4JU9A 1SC3A 3AY7A 2GAIA 2IY7A 2WINI 3B36A 4N54A 3RVDA 3TIFA 4P31A 2CXRA 3CN7A 2ATCA 2I5PO 5HP4A 2P9FA 4GX0A 1QF7A 5FFMA 3H3XA 5EE1A 4IDOA 1N6KA 3COYA 5GZ6A 1C0KA 1IU9A 5H4GA 2P41A 3PHIA 3CPJB 3N8GA 4UCFA 1CE8B 1JTEA 2GBLC 1HYGA 2YQ5A 4HAWA 1HGXA 2CVZA 5TMDA 3T5BA 3HGMA 2NN3C 1H2FA 3AHCA 3IJ5A 3WI7A 1H5NA 1A8QA 5I7WA 2HK7A 3T7TA 4GKJB 1RIIA 5C2JB 3LT1A 4N8DA 1GAXA 4QDZA 5SICE 4C76A 5JROA 2KB0A 1MW9X 4GZ5A 5AK5A 1QNLA 2LNDA 2V6FA 1KK0A 2I6SA 2IXFA 2QRPA 2ASEA 2R4UA 3E4DA 3S27A 1CLEA 5BN3A 5GONB 5K3FA 1RKUA 3L3BA 1CQWA 3HP7A 1NSYA 3GJ5A 3QXSA 2JGMA 4HX9A 1BC5A 2DPMA 3IKLA 3UK6A 1MDFA 5K0JA 2Z04A 1YVPA 2AI3A 4NCHA 3HB1A 3WSTA 4KLCA 3IEMA 1DKNA 1H6AA 1L5HB 1N7IA 2O7QA 5SY4A 2OBNA 2GRJA 2FF7A 2V5UA 4EX6A 1ES9A 2P0EA 1L7VC 4FGZA 1KEEA 3DYVA 2XW6A 1N2ZA 2ODBA 5TXGA 1JHVA 1MAWA 5FO0A 5BV2P 3DV9A 1P1CA 4RZQA 4OSOA 3W9UA 1J5PA 1Z25A 2G9VA 2PT7A 2ZJ1A 2VP5A 3JAKA 3N87A 1XKTA 2X4DA 4BNZA 3ZHZA 1LC0A 1HYBA 2OG1A 2NZVG 4L9AA 4P08A 4UD6A 2O0MA 1EGAA 4QOJA 5A7FA 1K6MA 1UL1X 1UDRA 4D6XA 3H1BA 3K0FA 1ZOSA 4YLEA 5CYGA 3IXLA 1K7CA 4CLRB 1Z74A 3IOCA 3STXA 3LXXA 2BTEA 1CB0A 3W5SA 4IFTA 2C4WA 4FFWA 4RFLA 3K2BA 3KEMA 4HWTA 5J2TA 1KR5A 3LKZA 3AEXA 4LDNA 1I01A 1TEXA 4CCSA 1WZCA 3ZKWB 2WSSD 4MGIR 2EZ9A 2JGEA 5AJUA 5LWQA 2AJDA 1EVIA 2ORWA 1NMZA 3DJYA 4NJMA 3DUFA 6AT1A 4LUCA 4A0HA 4ZYZA 5A4KA 4B6EA 4QQRA 3GDFA 1Z5PA 4BCBA 3BWBA 2NYUA 3C45A 4R2IA 2A59A 1OX5A 4E0BA 3G1UA 4ENVA 1TMYA 2J0UB 4IIDA 3UJ9A 4NOKA 4IX9A 1DBRA 4LK2A 5M5BA 2PH7A 2PXCA 3LSTA 4WN9A 4PGHA 2KHZA 4WXYB 5TGDA 1IBRA 1ORTA 4X92A 5IT4A 1YS6A 2BL4A 4EG6A 1UMDB 5AOAA 1N9GB 3NP7A 2X40A 3GEDA 2KX7A 3WV4A 1SA0A 1ZOIA 2RI6A 2VDOB 2E82A 1T43A 3O1IC 3GZJA 3PC7A 3A4IA 5DHQA 4ZZ3A 2W93A 4PN7A 4LZNA 1YB5A 4DFDA 1MG0A 1AQJA 1ZWKA 4KR9A 2H0RA 4F85A 1FNNA 2R6FA 1UOQA 5ALEA 5A7HA 2PANA 5FBHA 4PAGA 3H1PA 1CYDA 2WHEA 4H9GA 3U3OA 4CQNA 1ISMA 3UENA 2OVBA 3OQMA 1C4XA 1PP4A 2K2WA 4LE0A 4X60A 1G1AA 2ZQYA 3FJYA 1ONPA 4AIRA 4HUQB 1YONA 2QW1A 4FSHA 5D51S 4GE0A 3ZQJA 2C3UA 3D59A 1R0CA 1VFPA 5AYVA 4MYCA 2G9NA 5KPDA 2QTLA 2OYRA 1P9OA 3UHOA 4GI2A 1Z39A 1SOMA 2A9OA 1NMSA 2Z30A 4KQ9A 2QN6A 4C6HA 4EGJA 1R9GA 3DMTC 3O7MA 3QEJA 5BRJA 1NV8A 3ORQA 4JUCA 3VHXB 3ZNPA 1M33A 2OL4A 3HJNA 3ME5A 3MTEA 4X24A 3X1JA 4KIUA 2ZYTX 5B58T 1QVRA 1EFHA 1JYEA 1RLTA 1YR8A 2CXXA 3O8QA 3IAFA 1W5SA 1GNLA 2OGZA 1ZMRA 3TTWA 3H11B 5HQ3A 1AY0A 1D2AA 1JWAB 1YHNA 1L8QA 1U3CA 1Q5PA 1RFGE 3B7GA 5SZHB 1NY5A 3FZQA 4WFJA 4PSUA 2ZAGA 5C0OE 3NH6A 3L8ZA 1LW6E 2AR9A 4R9NA 4HAOA 3UK1A 4E51A 2FWAA 2QD3A 4DNPA 3SHWA 4Q1AA 2VJMA 4MRMA 4DLRA 4HDRA 5BYBA 3MN1A 5IULC 1KY2A 1O77A 2PRYA 3CX7A 4FFOA 4JEIA 4AL4A 5CEFA 2X86A 3LZCA 4H3HB 3CA8A 3H6HA 3GDOA 3LUBA 3VVCA 5LPNA 1H4VB 1ZMTA 3HA2A 4DUPA 5IKEA 4Z4QA 1A98A 5BN1A 3MFYA 2BFPA 1COWD 3F8TA 1NVFA 1R8YA 3LQRA 1KKLA 4BGIA 4YPVA 2PKEA 3GPLA 2C2HA 3F9IA 2VDPB 1VLVA 2O5RA 2A5FA 5GIPE 5HIJA 1NMQA 1R4AA 2PKYX 2P9TA 2Q1TA 1KYYA 1TO2E 5ILGA 4BV3A 1N2CE 2BEJA 1PGQA 3PHBE 2INGX 1ZIYA 3P9ZA 1WY5A 4DJ5X 4UTNA 1H0RA 3Q8KA 5IFKA 1H4SA 4F3NA 2DQZA 2XE8A 1H2EA 3DOEA 1K4YA 1H8HA 3HKDB 3O83A 4GNRA 4PLYA 4JX9A 4FW9A 2AC7A 4OHRA 5A9RA 4DMKA 2GKSA 2I4NA 1C1DB 4MR8B 3RW9A 1OX4A 2BC9A 2F3UA 1Y4AE 3RUCA 4M9UA 5I7EA 1VL0A 2BEVA 1RHJA 1E4YA 1QFSA 3VR6H 2H9IA 3I9LA 1YSCA 4Y1RB 5KOHA 3N70A 1ACLA 4GT1A 5L4NA 1G8MA 4P4NA 2I0FA 1KAEA 2QIOA 3IVRA 4C2TA 1GPLA 4F97A 1H69A 1UP4A 2ANBA 2P9QA 4OQNA 2VC2B 3HBLA 3QIAA 3SHOA 2PVSA 4ZOEA 1U65A 4HVLA 2Z2IA 2BGTA 3PPXA 4MW6A 3ZIAD 2AGVA 2NNLD 2ECFA 3X2FA 3OMWA 4DM4A 2VRCD 1CF2O 5IT5A 1ZVMA 4UVEA 3RABA 2PX3A 2Y9PB 4PXYA 2ODWA 2QRMA 3JZMA 4KXFB 4RPCA 2CT8A 1UPCA 2Q5HA 4OMFG 4RLFA 1KH2A 4UM9B 4KQ2A 1BHQ1 4FOLA 2ID7A 4EEZA 2BKXA 1JIVA 1SBIA 4P4LA 3EA4A 2F3SA 2XRZA 1Z6AA 2Z09A 5EWMB 3U37A 1YQTA 5JHGB 3ZJTA 1LW7A 1YZTA 4B4DA 3BK7A 4L85A 4WZBB 1F8UA 2CF5A 3O82A 1TM3E 4Y0NA 2A4KA 3BQMB 2AT1A 2F2TA 2RHRA 4HQKA 1E59A 1S89A 1NHWA 4YV0A 1OLXA 2OCLA 4YCAA 4WXEA 1KH1A 2C5HA 2ZJ2A 4KGXA 4MVJE 4C0JA 5BYKA 1NBMD 3V55A 5KS2A 3FCOA 2UUPA 1W1IA 3AONB 3LX5A 4J91A 4Y1FA 1QGED 4MUMA 1NQOA 5KSWB 2FN9A 4YONB 3AM1A 4FYPA 1A8UA 2W11A 3PRHA 1E3SA 1H3NA 5B2ZA 4BMSA 2PGDA 1KJIA 4MVJA 1U6IA 1UBMS 4DQXA 2UYGA 1WMFA 2H1CA 1PFVA 3R5TA 3HJHA 2FCRA 4B43A 3LCRA 1E4EA 2SKEA 4CUJA 5H80A 4E31A 3LLUA 2RONA 1MQ9A 3SCZA 1Z5OA 2BHSA 1NTOA 1EG2A 2ZATA 2ZSUA 2ZYAA 4NI5A 4D92A 1YUBA 5I01A 3RI3A 4R0VA 3R3ZA 5I7VA 4L0QA 4K6FA 3IRUA 4TMTA 5FWAA 1TLLA 3P5SA 3QSYA 1GNPA 4MV9A 5D1NA 4FINA 5L4LA 3VJKA 1DJQA 1SCUB 2ISCA 1H9CA 1I3MA 5I45A 3DFZA 3IJRA 3U9LA 3BBPA 4TYQA 4AFNA 1P7ZA 4N0DA 3BT7A 4E32A 3AT1A 3P97A 5CIYA 1FTNA 3ZJUA 1II8A 1ODJA 5I9NA 3CVUA 5TLSA 1APBA 4LZLA 1OLSB 2I87A 3MTAA 2O2JA 4M1KA 3KAPA 4QQKA 1WD7A 2J45A 4R84A 2D0DA 1MZVA 4KBGA 3BQNB 4LCEA 3RIEA 4FHZA 1ZJJA 3OIYA 2V8BA 4BUZA 2GZDA 3ZWDA 4HH3C 1FYEA 1IZ8A 1Z8FA 3AR9A 4LY6A 3DC7A 4D99A 1NP7A 3CPEA 1PBTA 4MW5A 1M6YA 2FPXA 3ECCA 4L3OA 4MS4B 3RYFB 5BOSB 4ZEMA 4KTVE 1AA6A 4X90A 1N5LA 1U2DC 2AG0A 4LGCA 4MKXA 2HTEA 3GH1A 3EB9A 1TZ2A 1ABFA 1FBNA 2PUTA 5JSZB 3PRKE 4RS4A 5EYPB 1JP7A 3MINB 5ALYA 4A4DA 2OXTA 3OBBA 4XLZA 3SQLA 4Z4HA 1HNZB 2W2KA 4MS3A 1ZH4A 1R0LA 5G4KB 3TE7A 3LUHA 1SO8A 3VR0A 1DDGA 1G1MA 3AVQA 2DCUA 2HNKA 2HLNA 1Y0BA 3C3WA 3FPFA 3HP4A 1FUKA 4E22A 3QKSA 3VZBA 1Q6ZA 1ZESA 1UIRA 4S1PA 4TQ9A 4OPMA 3TB4A 1C8LA 2X1HA 2Y68A 3G2JA 4HC4A 3IIKA 3Q3IA 1KZ4A 1YBFA 2WYVA 1QGOA 3ANNA 4MJLA 1B6TA 4R68A 2YZMA 4ZOLB 1B6GA 4K9SA 4UEJA 3SJCA 1C41A 3FMIA 4D80A 1XJCA 3AOEC 1WZUA 4YAWA 5ITZA 1RZVA 1R0BA 4IV8A 3VC1A 5BSVA 5CT8A 3PQEA 2VNHA 2XWBF 2ZYIA 2ZYWX 2HDOA 3SHVA 4PFQA 3ROPA 5LFAA 5GWXA 2CNOA 5DP2A 5I9SA 3P0EA 3G0GA 1DX9A 3SMVA 3NHLA 2AOUB 2QG4A 3FPKA 1ZN8A 2B83A 3K9QO 2ZJAA 4NBLA 3WX0A 2I9PA 4JI6B 1V5IA 2HA7A 3A7EA 4G09A 4TXMA 2R1TB 3DOCA 4ENWA 8ATCA 1TW2A 3VR3D 5DLPA 3ZXSA 2XNKA 3A25A 2P5SA 2JGIA 2PCJA 2WHQA 3C8HA 3V1YA 2AE2A 2C7GA 1QX4A 3MWEA 5EFOA 3CF4A 4H35A 1NAIA 2BBTA 1A3CA 1O97C 1E3EA 5DI3B 3QPWA 3KT0A 4F7DA 4QJ3A 4AZ3B 1CFZA 3QOFA 5LKRA 5HJ7A 1H93A 1RM0A 1PQ4A 3I30X 4ARVA 2XCSB 3ZVNA 2VSQA 2VHJA 1J07A 5F78A 4E5YA 1QCDA 3JYQA 4B76A 4PLHA 4JSTA 2GVZC 1LWOA 1U0HC 3KQTA 4HZUB 3E7WA 4WUVA 4EBBA 4ZDKA 5KNCH 4O2AB 3AKCA 3SHTA 1YHZA 2RK4A 3AVTA 2ZJ7A 4ZRMA 1RPNA 1VSVA 4H1WA 4ZV4A 2NU7B 2C7RA 2GN6A 4QSHA 4TYYA 1ZL0A 3EC7A 5A03A 3AR4A 3VZRA 1OZFA 1L4NA 1DTWB 1EFVB 1PEAA 2JF0A 4O4JA 1GCOA 3I39X 1V26A 1E58A 1LD3A 1BKSB 1HE3A 2K87A 4M88A 4F3CA 4O3MA 1S1MA 2YWHA 5CT4A 4D41A 3AM4A 3AZPA 4A0GA 3UBTA 3U44B 1DAFA 1H9AA 3PGLA 2Q5CA 5E6SA 1U8AA 3NOQA 1LGYA 2GHQA 1NULA 3GLTA 2OCDA 4L02A 5KOJB 1N77A 1WO8A 1OU4A 4PIPA 1GRNA 1WU8A 4IUBS 4YUXA 5K8LA 5GTDA 3KXKA 4EMSA 3SEQA 2PTHA 4INJA 4P4TA 3LMKA 4R9VA 2SBTA 3GPDG 4HLCA 2ZRMA 4RELA 2P69A 1LLDA 1CDOA 1X7WB 4D02A 2I4RA 2C8KA 3LK7A 1E9BA 1NQVA 1MRNA 4I19A 4QUDA 4R8SA 1B7GO 2G71A 4BCDA 3TLAA 4LOLA 3FPEA 2H4YA 4WW0A 4DVJA 1SKYE 3RUPA 3AR5A 3DKPA 3U7QB 3IAXA 4HSEA 5HZGA 4B4UA 3N8DA 3NEPX 3CGGA 4RTRA 3RS2A 3VVBA 1HMPA 2QBYB 1Y8RB 3ECSA 5JAUA 4INZA 4BOYA 2WTEA 1KXZA 2ZR8A 4L0DA 4B79A 1TT7A 1X8XA 3AW9A 3AJ9A 3OJWA 3QTTA 5AFSA 1N3IA 4EG3A 5ADUS 2CE7A 4PBSA 5CB4A 4MUXA 2X8JB 5IC5A 1PZNA 3B48A 3SNHA 4BRZA 1SBCA 2ZIEA 3PC3A 1R15A 5K4GA 1JSLA 3GJZA 2YY6A 3H5WA 3HDGA 3UUWA 1JJBA 1YZNA 4A1OA 4AM8A 1IJKA 2QVLA 621PA 3I01M 2QT1A 5DFAA 3G23A 3VRHA 2R66A 1XDGA 5KYXA 3NHSA 3PVCA 3NV9A 2JA1A 2CFRA 3HYTA 4WESA 1LA2A 2AWOA 3IAS1 4IZ6A 2AZDA 3HXLA 3EEFA 1R4MB 2BN4A 5IT0A 3BZWA 3R5HA 4NESA 4MQEB 3O3CA 4HNAA 3S7TA 2I4OA 2IHUA 4YTEA 1KQNA 5FEUA 3NFRA 2CNDA 4HEA6 3SEAA 5GIOE 4DV3B 3VAZA 2JLYA 1T8UA 3KBOA 1OKKA 4QX6A 4F1KA 1G4UR 4ZQEA 5THKA 1J56A 5GINE 2C4KA 3B1YA 3G6WA 1WZNA 1DADA 5DX1A 2OWDA 3B8EA 1ZAYA 4AU1A 3UWKA 4BASA 2WJJA 4XSVA 1H2ZA 3OLCX 4LN1A 1T0BA 4Y2JA 3K53A 4Z7QB 5GZ1A 7MHTA 1D4ZA 1L6IA 1H22A 2R00C 3D02A 3H3FA 3KP1A 4G41A 3K0HA 3QPUA 2YINC 3ABSB 1KRXA 1M6VA 2Y1FA 3FN4A 1VE1A 1JMYA 1SVKA 4RYLA 3TXYA 4M0MA 1ZI9A 1ZM4A 2J32A 3X2SA 1WDLA 9ATCA 1EHYA 4Z2YA 5I9TA 2WQ7A 4TTIA 1ZKDA 5EIBD 4Z99A 1L7AA 2J9YB 4LOKA 2E48A 4UE3S 2XUJA 5EUCA 3ZCTA 4BJ6A 1YA8A 4ZKEA 1H1LA 2JJ2A 5KYUA 4EKNB 1CEXA 3BDAA 2W90A 3FXAA 1V37A 1LI7A 1KYQA 3BERA 2FW9A 2QPLA 2ZUWA 1Q0RA 5DYGA 5JAQA 4NCJA 1S5PA 4ENRA 2PY6A 3E03A 3IQIX 3RTAA 4PZUA 3D3QA 1UDBA 1X0XA 3HCDA 1GGFA 1PI3A 3DTNA 1J00A 3GRZA 1F4LA 2FPGA 2CYAA 4UTRA 1I7NA 1SIUA 4MDFA 3BWXA 5FUBA 4XQ9A 1K7FB 1BD3A 5HG0A 3A1NA 4U9UA 1Y5RA 5BUZA 3HLYA 5LN1A 1SOVA 3EISA 2DUWA 5AKYA 3SKXA 4TL8A 1YAHA 1S8AA 5IM4F 1JDPA 1YB4A 1MH9A 3GNLA 4IFBA 5BMVB 3QE0A 1WB4A 3L0BA 4JODA 3IV6A 1ZITA 3F46A 3I9V6 3LBYA 1FNCA 1L7EA 4KAAA 3W6PA 3S1LA 1O0SA 4C0QC 4F38A 4QNNA 4ZAYA 4JN6B 2P62A 4QGBA 4GOKA 3C3MA 4M9RA 4H4DA 3VISA 2VHTA 3ZDDA 1VPVA 3F2VA 1DEHA 2OG2A 4JQZA 4RHCA 4G2NA 4P93A 4F5DA 1YDEA 4W82A 2XKBA 3TQCA 3LYAA 4L9SA 4WGGA 1D2NA 5CR9A 5JUWA 4GPEA 3VPDA 5GVRA 1L4EA 1JJAA 2G7MC 3KPUA 4FIDA 3MGKA 2HZBA 4QBKA 4TMXA 1MAVA 4EJ6A 4B3TB 3UT6A 1SUPA 2Y1WA 4OQPA 4D0SA 1ECFA 1QIDA 1YJBA 2MU1A 2Q5EA 4I99A 1WXQA 5EE0A 5CH8A 1XL1A 1TRHA 2OFWA 3FD8A 3G49A 5DBIA 2X8AA 1PJQA 3KXIA 4OBXA 2O3QA 3KKPA 1YFZA 2P35A 2JAHA 4OBBA 1M8KA 5JVDF 4B7CA 4ACBA 3FLAA 3ZZMA 1X3SA 4CI9A 1U99A 2IYTA 3VX3A 5JD5A 4Q3LA 3WNCA 5BOVA 3IHWA 2G1KA 5L9AA 1S3IA 1GGKA 1NQUA 4FLMA 2H1VA 4C6SA 3V5NA 1R6BX 1C4KA 2HB6A 1Q16A 3GVXA 3Q9SA 2IP2A 1QM5A 4LYFA 1XLWA 3IUQA 2ZQZA 3NWJA 4F9EA 1EI9A 3ICVA 3OCCA 1XU7A 2B1JA 4TSRA 1JJIA 1E66A 1JHXA 4I50B 4HH4A 2IWHA 3E9QA 3SE7A 3O7WA 7REQA 2A1TS 2R8RA 4L5CA 3IPRA 4O4IF 3QHAA 1D03A 4FJ1A 4PYKA 4WFIA 3H6KA 4B2LA 1YVDA 1NNSA 3P9CA 4G1FA 1OILA 4C0SA 3O3OB 3OIUA 2CL5A 5JT1A 4ZAWA 5BQFA 2NSYA 4M1YA 4YX9A 4YXWD 1WP4A 3RAFC 3ZHYA 1N4DA 3EOZA 4KIWA 1OBVA 1CCWA 4I55B 4QFCA 4L6AA 3VKFA 1U2GC 3Q0TA 2VUSA 1BRTA 4P5DA 4TM7A 2HQSA 3CH5A 2IKSA 2JI8A 3JYLA 3CT4A 1HDGO 1RAAA 3ENVA 3OH8A 2TS1A 4N0PA 4WTOA 3SJAA 1CX9B 1WQ3A 2ZBUA 4Q4LA 5A5GA 2NP7A 3QXCA 3MA0A 4ZQGA 2ADFA 3NEJA 2EZ4A 4QAJA 1G7TA 1ZM2A 5JOQA 4K9PA 1RYBA 5DRYA 4K6CA 4Y6RA 1Y5LA 1JT9A 3W8NA 1I4TD 2JIQA 3B89A 3WA6A 3BMCB 1DMRA 1ZMOA 4JJ7A 2PBLA 3P9PA 4FUTA 1CFJA 1T36A 2OXCA 3F0TA 3PV0A 3MTQA 4MVJI 2WJWA 5ULLA 2WU8A 4L2IA 3R9XA 3DWIA 3IEXA 3X44A 2J0SA 1BA3A 1YRYE 2XUGA 2CEAA 3ROGA 3D9QX 4HYTA 1Q74A 2VTBA 3VMFA 5LQCA 1B0UA 1O9GA 3L2OB 3G5LA 2H7VA 1RADA 2WF6A 2WTAA 1ORWA 2FSIA 3DVSX 1I4WA 2OZPA 1EEXB 3LDUA 4Y9UA 3U9SA 4B35A 4DWJA 4JI8B 1Y4DE 1WVMA 4CTMA 1RD4A 5KQPA 1HG0A 3FOCA 1QQ7A 3BUSA 4TN5A 3IUMA 4ZO9A 1Q1AA 4GYJA 3SN6A 1BE0A 1OAOC 2BEUB 3HI4A 1PG5A 1A97A 2RKWA 2DZDA 2O1WA 1XXHA 3GFTA 1EFTA 1NZFA 2YBDA 3BB3A 4YFVA 1KS2A 1KVQA 3HZHA 2PBZA 3LW8A 3RVKA 1SHTX 4MWCA 3PXGA 4XEUA 1YACA 3EMDA 2FUG1 1PFUA 4XRGA 2QNIA 5F73A 1F0YA 1ZVQA 2O2EA 4Q4AA 4HK4A 2C20A 4NYJR 4RLSA 4BKOA 2I54A 5KHOC 1FDVA 3NI2A 4N6NA 4MUKA 1A1VA 3AB3A 2I4IA 2R0QC 1VL1A 4BV9A 1Y6QA 1HDCA 1XCGB 2JVJA 4YPFA 5JJ5A 1BW9A 2ZBGA 3EQ6A 3LVRE 4RIGA 3WGLA 1GPWB 1U9JA 4H08A 4RQUA 2YWXA 3WDMA 1H8EA 3KPYA 2VZLA 5DYTA 4FKBA 2G4VA 4RMJA 1KDVA 4B80A 3HVKA 1N1MA 6ABPA 5JY1A 3GEBA 3RBXA 4YN3A 5KJFA 3KCNA 3SJ7A 4DV2B 4KG7A 1DIAA 4UOZA 3QLTA 1N25A 1V9CA 3IMCA 3QLVA 4UHKA 5AKHA 3CX6A 1N2HA 1X7YB 4OO3A 4ZVLA 4PCUA 4RY0A 1OX6A 2DPGA 3WGMA 1QGAA 1RMYA 3LC0A 4ZDJA 2V59A 1KYTA 3UIEA 3TQFA 5HVNA 1IH8A 5IHPA 1H4TA 1YS2X 3TUIC 1UEIA 1XEXA 3FWPA 3JSXA 3O4IA 5D7NA 2D6FA 4J1TC 2FN8A 1KDRA 2R86A 2I1QA 4M1MA 4EDFA 5K6AC 1EHIA 3TWOA 1C7EA 1I6LA 1TUIA 2G9ZA 2IZ7A 3BM5A 4URFA 1ZHOA 4IVPA 4LJRA 4MWBA 3EGIA 4RHUA 1DQPA 2ZTMA 3DOJA 1GFSA 1JE0A 4PBRA 4TS9A 2CLDX 3HJTA 3MIIA 4V1CA 1CJMA 1K8YB 3JASB 3MT8A 5JPDA 4JT9A 4Y9TA 3KKLA 4MZDA 4BO6A 4OFBA 4MIKA 1QS0A 1YZKA 2G5GX 3CRQA 3KVRA 3ZC3A 2C94A 5CBPA 1KTIA 5LBIA 5ALHA 4CQMD 4D9JA 4KL8S 2OXEA 1KIAA 4MV7A 1KP9A 4BO7A 4DUYB 4G2TA 4TWZA 4KR3A 1KK2A 1FRFS 3JV7A 1VPWA 4RIEA 4IRMA 4E1AA 1CUBA 4ZMSA 3K15A 1CG6A 3GO4A 4XYEA 2OV4A 5DI9A 1VIAA 5FQNA 5GP1A 3ZCSA 1XZKA 1BCRB 3DL2A 3G8BA 4G07A 2VK8A 3KOZA 4G5SA 4QTZA 3T0FA 2IITA 3I6BA 1MT3A 4RK1A 1CHDA 1PK7A 2GCIA 4PIVA 2ZI7A 2WWVD 3VR6D 2FEKA 5T64A 1QHFA 1JT2A 1XZHA 2NXEA 5EJAA 1HG1A 1U8ZA 1CYEA 4TGLA 4X61A 1IK4A 2AMVA 4KGZA 1XTIA 3V8BA 5KQLA 5LC1A 1Y89A 4AJLA 3EZGA 4Y6QA 3H2ZA 3U4GA 1HT3A 3UK0A 4MAFA 4LV6A 1Q0LA 3C3CA 5CVEA 3IV9A 2YHIA 1PS8A 5EVCA 1RRVA 3HNPA 2RMKA 2OZLB 1XTSA 2CB0A 1U2QA 3EFHA 4UHFA 3S40A 4HGQA 2AFHA 3IGFA 3C48A 4HMOA 4X8OA 2UYCA 2WAOA 3FFXA 1A9ZA 1LFAA 1SQFA 2XMSA 2XYHA 2YFHA 4C3UA 5BSHA 4P38A 3ZHXA 3PPYA 4EG8A 4C08A 2ZI6A 1EU1A 1MG5A 4UMFA 5ALVA 1DAIA 3PD7A 4OQMA 1ZGZA 2QS9A 1WF6A 4PG4A 5IAJA 1F60A 5T41A 3K0BA 5IYZA 5IHXA 5TMPA 5JCZA 1EX9A 4LOAA 4LXGA 4M9SA 3DL7A 3AUFA 4B44A 3I12A 1K8RA 1RPAA 3EHDA 3RSOA 3INGA 4C0HA 4F1JA 3B53X 4R8VA 4TSFD 2C7OA 4DL9A 3KO8A 1N6RA 2O3UA 5C5CA 4CTKA 2H11A 3NHKA 5IT9A 1SC4A 5IBRA 1HRKA 4UULA 5L40A 2AW3A 1N5RA 2NPOA 4FBMA 4ZREA 5AVJA 1W87A 4FONA 4V2UA 5KCMA 4YRAA 1QO7A 1MIOB 4OOFA 2OHHA 1N8KA 1CIPA 4EATA 2BCJQ 1AKVA 4OJQA 2GVDC 2JGAA 1DI0A 2VG8A 2XIQA 4QTTB 5D86A 5FL7D 3BWCA 1VG1A 2IZ1A 3N3BC 3OETA 1JTFA 5CCDA 4YMHA 521PA 3TS1A 4K9LA 4NOLA 1O6ZA 1RXYA 2YJGA 4UC0A 1N5MA 3OKFA 3VGJA 4B3CA 3M3DA 5A0TA 2AFIE 3CZAA 5GONF 2H51A 3KQYA 5T67A 4BTEA 1N7GA 4UDNA 3BBLA 3ANYB 2IX9A 4E11A 1I10A 3BRWA 1FYFA 3CONA 3K6RA 3QA9A 3ITEA 1TCAA 2BGGA 3H9JA 1GG5A 2QIPA 1YDGA 4JDUA 5EUQB 3DZFA 5EJ9A 1JEYB 4CJXA 1XNHA 3PE6A 5ESWA 4NHOA 3RT7A 1JIQA 2QZSA 5BW8A 3DDZX 1B8UA 1R1DA 2BR5A 2PMKA 2EKZA 4C07A 3NUGA 5CBKA 3A2LA 3M4XA 1U8UA 3KYCA 3QP9A 4C5AA 2GAOA 2PA3A 4WY2A 5TPZA 1IPFA 4JK3A 3JWPA 4YV2A 3GLHB 2FFAA 4ETIA 4G4GA 3COPA 1KYWA 5KTNA 2WFLA 2O2YA 2O3SA 1KQ3A 1ZP6A 2B5WA 3Q41A 4AS2A 1L8OA 3HI6A 2ZS8A 3C0KA 4L16A 4M8LA 2AL7A 2XMRA 4LYYA 2CJWB 1FFXA 1AXGA 1V4NA 3PDHA 4QASA 2NUAB 3IQXA 4HWOA 1H9BA 4U7JA 2KQUA 5EPUA 5IWAB 4TKMA 3PKZA 4G0PA 5ILQA 4CM9A 4NH4A 4M0UA 3KQPA 2WUVA 2YS6A 1YD7A 1X74A 3K05A 4KDRA 4X6LA 4Z54A 4JV5B 1HX7A 4CM8A 3EXG2 3REQA 1IN4A 1O6BA 1USVA 2E37A 1AK9A 4QUAA 5DNAA 1K8QA 3IMFA 2JLVA 4O08A 5CIWA 1QIHA 2ZG6A 3LYHA 1Y9EA 3COZA 2J4DA 3LECA 2YXDA 3GRCA 1S7GA 2VEOA 2VIIA 4LXQA 4ZARA 4MQ6A 3AU8A 1PG0A 2P40A 3L04A 2EW8A 3LPAA 3QVMA 4KSCA 4L8VA 3NU1A 4URXR 1A7JA 1GNQA 3KNZA 3OPQA 4MEBA 2J9FB 4LTDA 1U8EA 2PSDA 2GLXA 4EJMA 2B25A 2GYYA 1W85B 2R8EA 1AV7A 3UOWA 4B47A 4BUCA 3FTFA 1BX1A 3D4IA 2IOQA 3HQ4O 4H3SA 4HLUA 4A82A 3VKGA 3C6BA 5BWMA 5IBQA 3HMKA 1U3FA 3M4JA 3PHCA 4ENQA 1LZLA 4TV8B 1W0KD 2OBLA 1PGNA 1IUKA 1A5TA 1T4BA 3M89A 4O33A 3ZN2A 3QYFA 2UUOA 3RB8A 4BLOA 1PW7A 2H1WA 1TTHA 1KDOA 4X3PA 1IZYA 4QYTA 1MZPA 3I1FA 4LJLA 4PQGA 1A9XB 3MG9A 1GGHA 4S2UA 1V25A 1YZQA 3DB1A 5DASA 1AS0A 2GZAA 4D0NA 2WJPA 4FYJA 3ROMA 3WIEA 1DHRA 2HWXA 3GK3A 8ABPA 1QMPA 2XE4A 4LOIA 1LTKA 2G70A 3PTZA 4L08A 2XIJA 4EFDA 1IG0A 2O3RA 1OXMA 4A0RA 1G6HA 3PWZA 1I1NA 1W6UA 3PFGA 5LLSA 1E1RD 3LCJA 1ZN7A 4EI7A 3GW8A 5KNCD 5FBQB 3LX6A 2A5JA 4Q4CA 1NVTA 2F90A 1WJGA 4U3JB 1ECPA 1G98A 4QU5A 2YCBA 5ICFA 2P2DA 3T9CA 1QO0D 3IE2A 3DGEC 1UT5A 3PU6A 4KQEA 1GGVA 2FDCA 4FEAA 4LOHA 5DGIA 4ENSA 2P6RA 1PSWA 1Y7IA 2WUWE 1ZI8A 1ONSA 1TZKA 4IXDA 2XADA 3BJZA 4N3BA 3PUXA 4L6IA 1B6SA 2WIAA 4ON9A 2ZROA 1GL9B 3P9IA 3RIYA 2J3JA 1PYOA 2IYXA 2QGNA 5TQ2A 5KKAA 1E79A 1EP3B 3FCXA 3Q7RA 5INTA 2REOA 2YV4A 4DEYA 3W9BA 4TZ0A 4PZCA 4I5GA 3NBQA 4HP8A 4Q3EA 4YS6A 3KQOA 1BE1A 4K6GA 1ECLA 5I7HA 4MVXA 1THMA 4H1TA 4V3CA 3UG6A 2JI6A 4X6XA 3KYDA 2XBLA 1T2FA 4JA0A 1DGQA 1OI3A 1ENYA 1A77A 4Q4JA 3V4SA 3A05A 4EY4A 1KE1A 3ZNOA 3ZZ1A 2DX7A 3TOZA 4CZ2A 4MKRA 4OGLA 3WNVA 4MWEA 2Y4NA 3W3AA 3OIDA 4CCAA 4JGGA 3ZU2A 3A0RB 1CUGA 4DYVA 2XBMA 3ZWPA 1VIMA 2FN4A 3BMOB 3EW7A 5I7AA 5LCXA 3B9PA 3NR2A 4RFSB 4ZJZA 5LL6P 2BT4A 1HI9A 2P9YA 3QWHA 1MJGM 3BFXA 1OWOA 2JD0A 1KMCA 3FSGA 2JLSA 3F6BX 5H5JA 2PMDA 4Q39A 2HA4A 2PGOA 1KI6A 3ZHVA 5L3SA 2MYTA 4P3XA 3O94A 4AMUA 2O19A 1KJQA 1QK5A 1FJXA 4GQBA 4BWYA 1NP3A 3IJPA 3TRHA 2XCUA 1H2WA 2O48X 1X7XA 3GMIA 2FVXA 4CDRA 1X1BA 2J0VA 2YASA 4CMIA 3B1JA 4IJVA 2H92A 4N03A 3GP5A 5ERXA 4C4RA 1U0RA 3WL5A 2PZMA 3I2IA 4OQQA 1AQ6A 1LFDB 2EOAA 5FNZA 2GCEA 3KJHA 4AJ4A 3DM9B 1RI5A 3I45A 2KS6A 3ESYA 3GOHA 2X0JA 3BIWA 1EFPA 1EVLA 2GS9A 3MT9A 4HR7A 5EHXA 5DRTA 1OW3B 3IVMA 2GD2A 3WC4A 4ZK6A 1PDWA 2GH1A 3IIEA 2G09A 3QF4A 1W75A 4PYNA 1GQFA 1ZM9A 1A8IA 2EKBA 1F7VA 2ZI5A 3W2FA 1M9NA 1S4MA 1ZDMA 3FDXA 1I5EA 1PW5A 5CM2Z 4QBGB 1HDZA 3LWDA 5CW1A 2VCEA 2CJPA 4EB0A 2Z1NA 1JWBB 2ZVQX 3PK0A 1U7WA 4RENA 4LVNA 3HEBA 4IZIA 1G5HA 1HDEA 2FZ4A 4HYYA 2O59A 3ROTA 6REQA 1JSRA 4C0LA 1F8FA 3AFGA 1KO4A 4GOND 2NXJA 2RHHA 2LCQA 2HF7A 1Z5VA 3I4CA 4AQ7A 3IB3A 1P5HA 1ZD1A 2ZRHA 2J5KA 3AI1A 3KT6A 4L07A 4BNHA 5B58C 2X5OA 4M89A 3ZBUA 3V7FA 1JL3A 1TM7E 2PL9A 5DX8A 4MGEA 4QREA 3T3MB 1AN9A 1E6KA 2BJHA 2YRWA 4GBJA 4LZWA 4BZXA 4U7DA 3IE1A 4AY6A 4LRSB 2PH5A 1N2JA 3M9WA 1R0YA 3IQWA 4RXMA 1CK4A 1Q21A 1CQJB 2HIAA 3CRRA 3EGDB 1JLLB 3K2QA 4P1ZA 4UZEA 1E1CA 5FQOA 3S55A 3WWCA 1ZA2A 4BMXA 5KWSA 3AFMA 2C4NA 1EK2A 2DWQA 2Q9UA 1U3WA 1SIOA 3PS9A 1NF2A 4YAIA 3H99A 4ZT5A 1L5RA 2Y4OA 2ZRBA 2WAXA 4RA9A 1BCSB 3LM8A 2HYIC 3SKYA 1NXOA 2PEZA 1JFVA 1YKSA 3PDUA 4WNYA 3TLJA 4BBJA 3EZ2A 1DNPA 1AXRA 2CUTA 1SWWA 3VI3B 3R6TA 1G7SA 1QFZA 2JKVA 2L2QA 3RS3A 5K0BA 5JS1A 3PA8A 1NURA 1NI5A 3L4BC 1G3UA 3VZDA 3ZW8A 3E48A 5H8WA 2V4ZA 2Q1YA 3NH9A 3FMFA 3EFOB 1PKEA 1VHJA 3N53A 1BA2A 4FUQA 4QJ5A 1C9YA 4DCJA 4DE5A 3VSEA 4LCJA 4WZ6A 3RTCA 2AUTA 2VK2A 2LR0A 2OAEA 4M1OA 5E7JA 4ISCA 4HOYA 1ISIA 1LU9A 3IP3A 5IRCD 2F17A 2P9JA 3WHLA 4E5KA 1EDDA 2GK7A 3W7BA 2D74A 3NAQA 3OJCA 1VC2A 2B99A 2R25B 3NANA 3QENA 1KOLA 3KR0A 1EEHA 4MB2A 1KY4A 1S9DA 1SD5A 3DFMA 4QQNA 5CM9C 4DNXA 1NU8A 1MFPA 3OF2A 2IH5A 5BR4A 3D2CA 4AF7A 5E7MA 2WDPA 4UU8A 4DV0B 3I6IA 1K92A 2OBBA 1K2VN 3G9ZA 2O8FB 1KKMA 1YFKA 2W6PA 1NG1A 3VV3A 4A0FA 3W2EA 4KXYA 2JH3A 4MPPA 2DTDA 4EELA 3R6GA 1YBAA 3B12A 2PX5A 2HJSA 3CYFA 1QAQA 4TLLB 5E0OA 2BD0A 5B12A 3FOZA 3AWIA 1HFEL 1K7XB 4O8CA 4NR0A 2GJSA 1NW6A 4XAQA 2BTQA 2F1HA 4NBRA 1PFWA 4EO4A 1WBDA 3M6LA 2W4IA 4NYIQ 4W1SA 2JBAB 3PDCA 2VNJA 3GFFA 3BREA 3OZFA 4KVAA 1L3BA 3TLXA 2D5IA 3ELYA 4ZYUA 2FVYA 1L7DA 2ACKA 4ZOLF 5JADA 1NVDA 4RDXA 2A0KA 3DAGA 4NV3A 1B8NA 3K9GA 1L5VA 5J4KA 3R3YA 4MGYR 4H15A 2HZ7A 2O8VA 1GKKA 3IVGA 1A5ZA 4HS9A 1XNGA 3KLPX 4GXRA 2PLAA 3JVUA 4ZVNA 3QV1A 2JNWA 4P3PA 4QPZA 3ZD7A 1O4WA 1QLWA 1V43A 4G81A 3RGGA 5E3HA 3AFHA 1KMMA 4YY3B 4RD6A 5CFNA 4IIGA 6LDHA 2C00A 1C0LA 4TYNA 4NICA 4BFXA 3UMJA 1I3NA 3I42A 2QAGA 2Y27A 3KTFA 1BWQA 4K3VA 5E4YA 1KAQA 2XSZD 3TLGB 3PC4A 1W5FA 1J8VA 1YQWA 3K8YA 4RW0A 3OFJA 4OHBA 3HGQA 4DMRA 2J6IA 2QAJA 4S12A 2DF8A 2MT9A 3VH3A 2QUIA 1NE2A 1LJLA 3R8XA 2DJIA 4CR8A 1DWOA 4V0OA 3TFOA 2IPOA 3NZEA 1ULSA 2J07A 4U2FA 4YO7A 3OEYA 4NYMR 2OD7A 1L7PA 3A10A 3C5HA 1PR6A 1NQTA 2AXNA 5DX0A 2BF7A 4R2MA 1AKNA 1NBME 1P73A 2Q4BA 2WM3A 2XDWA 4LYAA 1V1RB 3DL0A 3HC7A 3D5TA 1OBFO 2NSJA 3KHSA 4X6UA 4AJKA 3QJGA 1RJWA 2FH5B 2ZUEA 1J5XA 1ZUNA 1KQPA 3BQ9A 3FGNA 3PUWA 1KMHA 3MFQA 3BGSA 4I4TA 5A62A 4HVAA 3C5WP 1KVRA 1NJFA 1BGWA 4J76A 1DXHA 1DE0A 2QYHA 1XMPA 1K6JA 3Q0IA 5EIXA 3R7BA 3LFHA 1E3WB 3JAKB 4GLOA 2Y0DA 1C9EA 1QHIA 2YVAA 4LBWA 2XD4A 2ZTUA 3ZHBA 2QROA 4FFLA 1ZICA 4BKMA 4CM4B 4Y0AA 5IAGA 4AY3A 4MRSA 1FDSA 5DULA 3QVGB 4B83A 1WSWA 2WAMA 2GPWA 3LCUA 3KFXA 2JL1A 3K1ZA 2JK1A 1MB2A 1Q0QA 1C1YA 2W22A 5COAA 4EZBA 1RFLA 1MOQA 4ARZA 2P2ZA 3D6AA 4GKBA 5CDFA 3TRJA 3W9YA 2B20A 2JIOA 2H2DA 4X97A 2P2YA 3IKMB 3KELA 1M6WA 4EKGA 2EYUA 4NJMB 3L5KA 1EX7A 1ZRHA 2ID9A 2Q99A 2Q3HA 3AP2A 3EE6A 2WU1A 3DC2A 3AVOA 1ZLXA 4M4SA 2IHVA 4M6WA 1Y82A 3GFVA 4DTCA 2GK4A 1ZC3A 3L7MA 1F1JA 1THZA 1UQUA 4EB6A 3TDMA 2HW8A 3HUFA 3JQ6A 5DE3A 4D4HA 3NIDB 3ZHQA 1JFTA 4GLLA 1Q77A 3DEKA 3PD1A 3R5JA 1OTXA 2DWOA 1P0FA 3PUYA 1WETA 3WY9A 5FLKA 2PLRA 1G7RA 2PRKA 4FZVA 1D1PA 3HZZA 4KXNA 1MMFB 3H3JA 2IEYA 4FHGA 1CVIA 3E9CA 2Q6LA 3CUWA 1UBGA 4JBWA 1PZHA 3ICWA 4WLOA 1KO1A 5EZYA 5JZSA 3TZEA 1Z7GA 4Y6LA 1XD9A 4YCMA 3FZYA 1XKXA 3O74A 2ZWIA 2BVNA 4C2BA 2REBA 4MWDA 3FMGA 4FWBA 1DOAA 3DMYA 1WDTA 2Q28A 3TQSA 3OEHD 4XGQA 3RTGA 1SBYA 2HX1A 3D3KA 4C7VA 5EQFA 2CV2A 4RPHA 1PQUA 1T9ZA 1WTCA 3BIOA 1LDEA 3LQYA 3LUDA 3MJRA 4R1OA 2GILA 4OHUA 4XWGA 2KLBA 5AW4A 2YIJA 2VSNA 2DHEA 1R0KA 5ECWA 2G0NA 4TMYA 1XF1A 3P27A 3BPSA 4GZ3A 3RVJA 3V97A 2V4UA 3HJAA 2WE8A 1JBQA 2YJ4A 2ZDGA 4UE6A 3VPBA 5A5VA 2CNNA 4OXXA 1JEEA 4ARAA 5JMTA 3TBFA 2ZANA 3KQQA 1M0SA 2AXPA 2WWFA 4UBMA 3TL2A 4A9AA 1SRQA 1KXJA 1UC5B 2FG6C 2OZKA 2R751 2YCLA 2H9AA 4UBJA 5LOVB 3AUXA 4J29A 2P3LA 3C24A 1CS4C 1G2QA 2R47A 5FA5A 3C4VA 1XWIA 2RK3A 3LFUA 1GN8A 2XQJA 2UU9B 4US2R 2FZEA 3D3WB 2W83A 3H9EO 3R5FA 4BX0A 5AKGA 3SSNA 4I9HA 2VDNB 4QQFA 3DBHA 1IN7A 1T5SA 2NX2A 3EULA 5FFFA 3VX4A 1DX6A 3FYTA 4WK0B 2ZTLA 4YCLA 3O2QB 4MH0R 3M1LA 1KDPA 2GD0A 1IN5A 1W44A 4EKYA 4F7WA 3PUZA 4LWPA 2GN9A 2Y0PA 4I5FA 3GEEA 4KX5A 5COBA 2NZWA 4EIWA 2X2FA 1NVAA 2OAQ1 3OJEA 3WLQA 4WPGA 3H1TA 3T7SA 4CLEA 2WWYA 3E22A 2JFVA 3TKAA 5HKBA 5HZHA 1HKUA 3AKZA 3OLZA 1RWQA 1IDOA 2ZYGA 2R85A 3JQ7B 3FWNA 3PI7A 2GN2A 5NLLA 3Q5EA 1QV7A 2BONA 4MI9A 1Z4MA 4QFBA 1VL6A 4DQLA 1IOVA 1KI3A 1VL8A 1M1YA 3VYUB 1G19A 2DFVA 4MKIA 1L4YA 1Z5GA 2BM9A 1TM5E 2ZJOA 2CHQA 1N2SA 4K86A 2NV6A 4XQ0A 5HOEA 3KZXA 2EIHA 2GAAA 2OGWA 2Y1KA 2VQSA 3EGXA 1RXEA 4BP8A 3IL2A 1QG6A 3ABZA 3Q10A 3WKAA 1VHTA 1RAHA 3CSSA 4GPBA 1YK0A 4A73A 4EHJA 4YUWA 5BMVF 2WPDD 5MN5A 5AXBA 3Q2KA 2YRFA 4X7BA 3BXXA 2I3DA 1TK9A 2GI4A 4BWGA 1F2UA 2EFHB 1T1JA 1T4MA 1P1HA 3FUXA 3L7CA 2WIKA 3OOWA 3VOAA 2I8LA 4PAQA 3ESZA 2COEA 3THYA 3E1KA 4IFIA 4NENA 1B42A 2H1IA 4YO8A 5TDHA 5F52A 2VP2A 1VE5A 3SAJA 3UVEA 1SXJB 4WWHA 1NUTA 1NC1A 1V5GA 4UVDA 4A6DA 4TVSA 1Z45A 3D0KA 3KXDA 5EJFA 2FE4A 1XCOA 2JVIA 3MHTA 1E32A 3KS9A 5L3QB 4NE2A 1Y6GA 1X1TA 2O52A 5IN5A 4EY3A 4KP7A 3MQ4A 3IVXA 3QMWA 5ENVA 1WOYA 2GDZA 3GCWA 2H08A 3GBSA 3PEFA 3RV4A 4B3XA 1EBBA 3G02A 3WL8A 1DO8A 1XHLA 5F7OA 1Z0FA 3IA7A 2O2SA 1SHUX 4UJ5A 1W5EA 1SUBA 2XNDA 2YWDA 3MC1A 4KFUA 2NADA 1U28C 1ORHA 1ZD8A 3H2YA 4M0LA 5EEGA 2WIDA 1N0HA 1ZUWA 2R5NA 2BFBB 4GOXA 4R7ZA 4CKYA 4XUDA 1MLDA 5JDCA 3RK4A 3U7GA 4QPNA 4PZLA 5BSKA 1JKJA 5A1TA 1ILEA 3PHGA 1RTKA 2DBYA 3OO1A 1OLXB 4MVJP 5DOZA 3E8XA 5KKCA 1VYTA 2IEDA 3IXMA 1KDZA 4MIYA 5K4AA 1L7BA 2PU7A 1KEKA 4FNAA 4DXHA 3AJRA 4UTOA 3RFCA 1QPGA 4I50F 4D3YA 3MWYW 3CUEF 3ENZA 3PFNA 4AMYA 4DSTA 5KYNA 3D8UA 1QZ3A 4I3GA 5JC8A 2RC5A 1EJ6A 1PYGA 2A78A 3MLAA 1DJLA 4JVSB 3EZYA 4ZAGA 4LKRA 3AHFA 3N8NA 1RXIA 4L4RA 4RQBA 5FORA 1GWNA 5AW2A 1ZGBA 4W6QA 5AJYA 4XWOA 2CHGA 4UBKA 2NUPA 4WBSA 4OQFA 5KX5B 3FHTA 1NZDA 4H7KA 3JATB 2C1EA 4LZOA 4N76A 1SXJC 3EC1A 4R8MA 2G72A 4AW9A 2EAUA 5EZSA 1J20A 4RESA 4I55F 3C70A 4YJ2B 5I7OA 2X7JA 1AQNA 1SU8A 4B6RA 5AVYA 2JIMA 4KX3A 1F20A 3VYSB 3CF4G 2DETA 2RD2A 3GLFE 1ZW1A 3GGDA 3EXIB 2ONKA 1EK0A 4CG0A 4FB5A 1Z28A 3MWLA 1AZTA 2VN8A 4Q7KA 3QEOA 5CLIA 1OWLA 1FOEB 5LMCA 3IQZA 5M04A 1NLFA 1S96A 1T9DA 2C78A 1KE2A 4RVDA 4BX3A 3EPHA 1XEAA 1Q44A 3BMQB 3D7NA 5GV8A 3RBAA 4C30A 1NLMA 4B7ZA 5HR5A 4QXMA 2NO5A 4GUDA 3AFNA 2JJ8A 3AR2A 4EFKA 4QUEA 4JJKA 2K4MA 2VNSA 1T5BA 2H6EA 4MPDA 2WJAA 5EGSA 5FP0A 1QDUA 2OCKA 2QV0A 3DYBA 2Z8XA 3D54D 3N75A 3TNJA 4PN3A 1IVSA 4ER5A 1XNJA 3FJOA 2WLSA 1K0FA 1Y5MA 2B8EA 3AF5A 2X5XA 3OE5A 4L5IA 2W2KB 3A9RA 1Q0HA 3WK9A 3RSLA 2GF0A 5KDLA 1DSSG 1ZSNA 2IOFA 2QWXA 1ZD3A 3CLRD 3FVTA 2RH5A 1QC5A 3QY9A 4DG8A 1FLNA 2WMDA 1D7OA 1RAEA 3BA6A 1M5UA 4I6GA 1V1MB 4M46A 4RVNA 1GFWA 5F4ZA 2N47A 3W1EA 2QF7A 1PUIA 3QX7A 4LRTB 5BUQA 1CUAA 2IVFA 3HMQA 4K26A 4FYIA 2NM0A 2PVPA 4C6TA 1E2JA 1LPMA 3UYLA 4GL4A 4NFSA 2R1VB 3IBYA 2WJHA 4Q1VA 1XCMA 2WEKA 3V34A 1M5RA 1Q50A 1RCFA 1REQA 1HO3A 2ZQ5A 3JW8A 1MC8A 3EZNA 1YL6A 5U1PA 1U98A 3WO1A 1Z7WA 2RIRA 2ZU0C 1DAPA 1H2XA 2JI9A 1FPMA 3LT5A 4GDMA 3KALA 1LDBA 2DU8A 1ONNA 2JJQA 3H9BA 3O47A 3HY4A 4RZUA 5E3IA 3ZE2B 5FI3A 5ECDA 3LC2O 4D56A 4DBLC 5JNSA 2XE6A 3QU4A 1AKEA 2EWWA 1QZTA 2NZYA 3AESB 2J3QA 3P2EA 3GPIA 1ZOLA 2ZUBA 5G0UA 4LF5B 5C46F 1R8QA 3ED5A 2XY4A 2ZKIA 3F97A 1E3JA 3D6MA 5HF8A 2CCJA 1Z7EA 2F1KA 4PHHA 1KJJA 5FTLA 2H0AA 5F2EA 4ND2A 1JIJA 4M60A 5KJ1A 3ZJ4A 4Y67A 3QPVA 1C81A 1VCNA 3G2HA 3Q40A 4IHJB 4V24A 3C2QA 3R7AA 3TJRA 4ALMA 4GL2A 2WHXA 4A2CA 1QTIA 3I5MA 3JPWA 3L6BA 4H60A 4X7MA 3KTDA 1NJ1A 3QVWA 3RT1A 5ALXA 3ZXUB 4KXXA 3B9RA 3ZXYA 3QXXA 3USCS 1JEQA 5KVCA 1Z33A 4ZV7A 4H16A 1GZ3A 1GU7A 1Z8DA 2ZSAA 3ZK9A 2P0AA 4D3SA 3D4LA 5EESA 3WNZA 2I3AA 1KF0A 4BNLA 4K88A 1U6JA 2YTZA 1O5IA 3PYMA 2O1SA 3C39A 5C4GB 4IILA 3THRA 4IDFA 4WH0A 4COKA 2AEFA 3FWKA 5JWRA 1O89A 3K09A 3QG1A 5CH3A 1XZ8A 3EASA 5EQDA 3VH4A 5HUHA 3H7AA 4MK4A 4AG5A 3HCFA 1MGOA 1PNRA 5I3ZA 2F3QA 1G20E 2Q46A 3O8LA 3WB1A 5KWIA 4LS3A 1M67A 2VDKB 1W9HA 3HCEA 3JQ8B 5E6SB 3LUCA 1XDSA 4GR5A 2I2XB 5JRJA 4OX9B 4QT4A 2QMOA 5L3RA 1MQ8B 1DARA 2QY6A 5BV7A 4JYMA 3G9UA 3OT1B 4LDQA 3K32A 4XDZA 3TVYA 4E13A 5LQRA 2VHUA 3FF1A 3FTCA 5F1YA 1QH8A 2YNMA 4XB6B 5EPEA 1Q3HA 2DTEA 3AEQB 3OLQA 4WMLA 2BFAA 3HHEA 3KUKA 4IKPA 4B3IA 3HPRA 3MJTA 4NBSA 2D0PB 1NW4A 4ZU1X 3EVAA 4GLBA 4ALLA 1T8WA 3RUHA 1KEPA 1XZEA 1DQNA 1YWGO 4Z0TA 3GIDA 3HDYA 1NWHA 2A84A 3ES9A 4NE7A 3GXBA 2FWJA 1G3QA 2NVUA 3L7KA 4ZWNA 3EJ6A 3G0BA 2JKZA 4A03A 1HXHA 1UFQA 4NBKA 3ID6C 3ZX4A 2NSDA 3I92A 2AG6A 4AYXA 3HM9A 4RZ2A 1MX3A 4G5RA 2AKEA 5HUQA 1OFVA 2P7HA 1FLVA 1ZZEA 3O84A 1L4MA 5AXDA 3R5KA 3RVNA 3A4YA 3G2PA 2PH1A 4G1VA 3A4TA 5B7PA 4RGBA 3OZ7A 4P84A 4B33A 3DNPA 5C37A 3DCNA 3KIPA 5EXEA 3IULA 3CZ9A 1M75A 4A7PA 2AOVA 3HKEA 4K0RA 2H4WA 1DKMA 3RTBA 2IUYA 4NXMB 5BW4A 5EP2A 2IPLA 3DF7A 5FWYA 4M21A 1TO6A 4OMUA 3ADKA 1FP1D 3FKJA 4OXNA 3SJBA 4DLAA 3CW2A 3QEMA 4EYKA 2JD1A 1T34A 2XUZA 2YL2A 1UWKA 2EP5A 2C9OA 1N0VC 2WB2A 3FR8A 1RAIA 2G76A 4EHIA 4LRQA 3DLHA 3M1YA 3IQFA 3L1JA 1JHMA 1Z0KA 3DBRA 4KQKA 1V41E 5DXAA 4EA6A 1E18A 1E9CA 4KGDA 4K9KA 4HNAB 4PM4A 3SWWA 1JYSA 1I2BA 5CH5A 3CW9A 1DAGA 3FVVA 1SJ9A 1ADFA 3M82A 4H1VA 4BQEA 5JH7B 1V95A 3TRDA 4X45A 2X8BA 4Y18A 1YZYA 1N1GA 2WTXA 3USZA 5IG2A