4J0KA

Tannin acyl hydrolase in complex with ethyl gallate
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
470
structure length
454
Chain Sequence
SMSNRLIFDADWLVPEQVQVAGQAIQYYAARNIQYVQHPVAAIQVLNVFVPAAYLHGSSVNGYQRATAPILMPNTVGGYLPGPADDPQRVTWPTNAGTIQQALKRGYVVVAAGIRGRTTVDKSGQRVGQAPAFIVDMKAAIRYVKYNQGRLPGDANRIITNGTSAGGATSALAGASGNSAYFEPALTALGAAPATDDIFAVSAYCPIHNLEHADMAYEWQFNGINDWHRFEPVSGQLTVEEQALSLALKAQFSTYLNQLKLTASDGTHLTLNEAGMGSFRDVVRQLLISSAQTAFDQGTDIHKYAGFVVTGNQVTDLDLSAYLKSLTRMKAVPAFDQLDLTSPENNLFGDATAKAKHFTALAQTRSTVTAQLADAELIQAINPLSYLTSSQVAKHWRIRHGAADRDTSFAIPIILAIMLENHGYGIDFALPWDIPHSGDYDLGDLFSWIDGLCQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of tannase from Lactobacillus plantarum
pubmed doi rcsb
source organism Lactobacillus plantarum
molecule tags Hydrolase
molecule keywords Tannase
total genus 159
structure length 454
sequence length 470
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4j0kA00
2XQKA 5E4TA 5ALLA 2NW6A 2QTBA 4M0EA 4HTAA 4UPDA 2OLEA 4P92A 4N5IX 1QIDA 2XQJA 4PW0A 5JAOA 2Y6UA 2WJ6A 2XMZA 4MEAA 2VT6A 1EK2A 3H19A 1ACJA 3QPAA 4NS4A 4B7ZA 1C7IA 3E0XA 3BIXA 3IIIA 1R1DA 5CTAA 4DMFA 1X2EA 3WKEA 1CUXA 5ALSA 2QRUA 1L7RA 1K5PA 1WB4A 2HADA 5ALTA 5HQ3B 2HDWA 3OOSA 1JI3A 1QIEA 2RIPA 5AJHA 1CUFA 3FWHA 1DWQA 1UFOA 4G5XA 2XUOA 4J3JA 2QT9A 2DHCA 4TGLA 2OGSA 5ALYA 5BOVA 3E3AA 1KEZA 3AFIA 1GPKA 4OCZA 3FYUA 4V2IA 1TQHA 2ORYA 3EF3A 3I2JA 1OXMA 2BGRA 3O4HA 3WL5A 3FCYA 1UOPA 4J03A 3QH4A 3G8YA 4IH1A 4DSAA 3G7NA 5AKYA 1IUPA 4C4XA 2QKYA 2JGLA 4OYYA 5CRIA 4BCBA 5I7UA 1IMJA 2OG1A 3CXUA 3FVRA 5HF9A 4Y9SA 2O2IA 5AM3A 5LZ9A 1K8QA 1QLWA 3ZI7A 4BZWA 1UKBA 5FLKA 1X70A 1AQLA 2WLSA 3I6YA 1MX5A 5FPQA 3RKSA 2PM8A 4PO3X 3D59A 2O2HA 2DCMA 2HRRA 1QTRA 4QWWA 1WM1A 3LS2A 4U2DA 1BS9A 2VJBA 1EK1A 1TCBA 1F0PA 5AI4A 1EH5A 1CLEA 5D7BA 2PU5A 5AM5A 5K5EA 3UMJA 4X6XA 5LZ4A 3WK8A 2XQIA 4BTLA 5E4JA 2G4LA 4KYVA 3W9BA 4AQDA 2HRQA 5CT9A 4C4YA 4P08A 3RLIA 5C7YA 2PX6A 4E46A 2I78A 1XLUA 3H0CA 2BKLA 2G63A 2ONCA 3AZQA 2H7CA 1HDEA 3R3VA 1XQVA 1UK9A 2BUBA 2QJRA 5AKXA 1MJ5A 2OGZA 3STWA 2WFLA 4F0JA 3R3WA 1CQWA 5KBYA 4LHEA 1N5MA 1JMYA 1MTZA 5HFNA 3I1IA 4W1RA 2WIKA 5DYTA 4TPKA 2PVSA 2HFJA 3LCRA 4PSDA 3F98A 2XUDA 1CPYA 3L1JA 3M83A 5AM4A 3DCNA 4Y2QA 4OB8A 1ZGCA 1MNAA 2Y6VA 3B3QA 3GFFA 3I2HA 5IVIA 4B85A 1LPNA 4YK7A 5FPPA 1GZ7A 2DQZA 4X97A 3HSSA 5DNVA 1VKHA 4Q1VA 1HLGA 2VSQA 4OSEA 1VE6A 5FXMA 1WHTA 3HC7A 5T4HA 4Z49A 4N8SA 2X5XA 2FX5A 1KU6A 3CN9A 4FLEA 4H7EA 1X2BA 3W04A 5LKAA 3HJUA 5AK4A 5JANA 2Z3WA 3ILSA 4H0CA 1TK3A 4HRYA 1EVEA 4FFVA 4I4CA 2EEPA 3QPDA 4H35A 1CFJA 4L0CA 2Z8ZA 1P0MA 1ZI9A 2WHPB 4DYHA 4OU4A 5CBKA 1ZIXA 4BP8A 2AXEA 5ISMA 5JYCA 1XRPA 1VA4A 3W9UA 1VZ2A 1XQYA 3D2CA 1THTA 3H2JA 3FCXA 1BCRA 1TAHA 3RM3A 2I03A 4HXGA 1HQDA 1BCSA 1XZEA 4XX1A 2B61A 1WB5A 4G4IA 5D6OA 2V9ZA 4MEBA 1LPPA 1UK7A 4BAGA 3IVMA 4MJ3A 5LZ5A 3QVMA 5JZSA 3CN7A 4L72A 2WSLA 3L1IA 1QIFA 4CG3A 3G9ZA 1FSSA 2C0PA 3G9TA 5A71A 1BEZA 1MX9A 3BDIA 2RHWA 1XZDA 5IH7A 4UHBA 2PSFA 3QM1A 3STTA 4KE9A 3QBJA 2W22A 2WJ3A 3U1TA 4IH9A 2OCLA 2V97A 4UBKA 4BE9A 4BCDA 1E5TA 1XKTA 3HEAA 2QUAA 4QLAA 1A88A 4N8EA 1J06A 1PJAA 3GELA 2XI4A 4H7DA 3X3HA 3G02A 4J7AA 1XZFA 2AJBA 4MWTA 1UK6A 2HU8A 1DT3A 2IX9A 1ZICA 2H7YA 1VLQA 3PICA 5AHXA 5ALWA 3STUA 1ZJ4A 5ALZA 1QJ4A 1J07A 3PF9A 2B9VA 4EY6A 4GWLA 2P8SA 1ZI8A 1H2ZA 4CG1A 4EBBA 3FNBA 4WY5A 2BJHA 3I2FA 4H7FA 5A2GA 1EB8A 4H7HA 3KDAA 5ALFA 1W52X 1T2NA 1R3DA 4WDQA 4WFJA 3V1LA 1Q83A 1B41A 3C6XA 4PV7A 3PDCA 1GPNA 3F9CA 4QDUA 4OU5A 4B9AA 3KWJA 1JJFA 2WHQA 5ALDA 3FLAA 2XUGA 1LZLA 2C4HA 2ZSHA 2PU7A 1LBTA 1EI9A 3HXKA 5HKAA 1W75A 4YX9A 3NUZA 3H2HA 1UOQA 1G5FA 5CT5A 5HK8A 1NU6A 3AINA 3BJMA 3G9UA 5K3EA 5EHXA 3D2AA 2EDCA 4EHBA 5JAPA 3BJRA 1ZJ5A 3QPCA 3QZUA 2PKYX 2I3DA 2VJAA 1RWQA 4I3FA 4ZRDA 1QO7A 5KWJA 2EDAA 3I2GA 5ALXA 5CW2A 1WPRA 2HA0A 5AKZA 3ZV7A 1E8NA 5ALQA 4K2AA 5ALUA 5LP1A 1F6WA 5AIAA 3SC2A 2HA5A 3O0DA 1ZD3A 3OPMA 4BTVA 3C45A 5ALIA 4AN1A 2WIGA 1LNSA 1D07A 3TEJA 4X7BA 4YPVA 2JGMA 2RGUA 3WKCA 4Y2XA 4QE3A 4Y2YA 4XVCA 4BVLA 4XIIA 1FFAA 2ZVDA 3I28A 3BF7A 4AZ3A 3FSGA 2X8BA 5E4YA 4L9AA 4DNFA 7YASA 1C4XA 4CI9A 1THGA 4PF1A 3EQ8A 4DM7A 3B5EA 4WJLA 1IVYA 2WU3A 5CT8A 1QIMA 3R3ZA 1XZMA 4U2EA 1F8UA 2OCKA 1A8UA 3WK7A 1DX4A 4B84A 5C81A 4UBLA 1T4MA 1UXOA 3DOHA 3ESCA 3ZPXA 4G8CA 1E3QA 3KXPA 4FNGA 3WK4A 5HKBA 1NU8A 2BUCA 3A2NA 2GBFA 3EBLA 3H2KA 4A23A 1ODTC 4KE8A 1ZGBA 3N0TA 1WOMA 5DWDA 1OCEA 4JH0A 2H7XA 2XB6A 3AILA 5BV7A 2CUTA 2GBGA 4B6GA 1XRMA 3MUNA 2JIDA 4G4JA 4QNNA 1YCDA 2IITA 4ZGBA 2Y2VA 3HLKA 1BROA 3PI6A 5JASA 4ETWA 2BFNA 1TRHA 1VXOA 4MQLA 1N1MA 4BATA 3OG9A 1UT6A 4ROTA 2WFMA 5AH0A 2PBLA 4WDRA 1W4LA 2OPHA 3AIMA 1SCKA 2WFZA 3BDVA 5AI6A 1P0QA 3IUNA 4GBGA 1FFDA 3CCBA 5HF6A 3T4UA 1BN6A 4MYSA 3ZWQA 4ZV7A 4UHFA 1IUOA 1C7JA 2YYSA 1USWA 5J3JA 5A62A 1IZ7A 5K3CA 2XUPA 2AJLI 2HHAA 1JU4A 1Q0ZA 1FJ2A 4U2CA 2OAGA 5LZ8A 3MUOA 4QDOA 1ZIYA 1ZD4A 5FP0A 4G9GA 3TJMA 1XZHA 2XT0A 4Q3KA 3M81A 4DSZA 1LPMA 1EHYA 1ODSA 4DMCA 3DJYA 1YR2A 2DQYA 2AJ8A 3Q0TA 4GI1A 5ALKA 4CCYA 3WJ1A 1XRLA 5AK5A 4C01A 4ARBA 1ORVA 2ZYIA 2WKWA 1H2YA 5FKJA 4A5SA 5LZ2A 1CUBA 5DTJA 3SX4A 1GKLA 4KRXA 3STYA 1AMNA 4W1SA 2XUJA 4EB0A 1U8EA 5C8VA 4E14A 4B80A 3A6ZA 3DEAA 1CUJA 2DR0A 4OPMA 4IH4A 5T4EA 2ZYSA 1RYYA 2HU5A 3VISA 3DDUA 2G5PA 3G9XA 1JT2A 5A7FA 1W76A 5AK6A 1AC5A 3H2IA 5FRDA 5HK9A 1A8QA 2XMCA 5EHNA 3DKRA 3WKBA 3GA7A 5JD4A 1H2WA 1VXRA 3LP5A 3HACA 2C5GA 1VJ5A 1GQRA 4B81A 1MT3A 3WKAA 5DYYA 3IB3A 3WL6A 4C6HA 4AO8A 2XMDA 5SYMA 5IVKA 3W05A 1CEXA 1DTEA 2WU4A 2QOEA 2JGJA 4QWMA 4X94A 3FYUC 1PFQA 4Y7DA 3WIOA 2QXTA 1G66A 2HA3A 3EQ9A 4EA6A 3CCCA 3PE6A 3WK9A 4JUIA 4C4ZA 1O6GA 4LXHA 2XUKA 5EIEA 1DWOA 3STXA 4QZVA 4GEGA 3GBSA 4M0FA 1EX9A 3OC0A 4MXDA 2Z5GA 1QFSA 1GT6A 4W63A 1L7AA 4KE6A 3HI4A 5C8XA 1EDBA 2QXUA 2JBWA 3FVTA 3VDXA 1GPLA 4Y2UA 2PUJA 1XLVA 1HPLA 1CUYA 4DNPA 1K4YA 2XUFA 5HF5A 2XMGA 3DQZA 4CCWA 1ZD2P 2RAUA 1MO2A 2BGNA 3VJMA 4W1PA 2PL5A 1U4NA 1QIGA 3UUFA 1P0PA 2DHDA 4AO7A 4Q3OA 3VJLA 4DNQA 5A7GA 1DQZA 4H7JA 5LKRA 2WG1A 1CUGA 1HBJA 3ICWA 4RNCA 4MQMA 3ZLVA 2FJ0A 1HKHA 4RPCA 3R40A 4G1FA 2QR5A 2E3JA 2OQVA 1FFBA 3WL8A 4WFIA 2YXPX 1EB9A 1ODCA 5ALJA 3G0IA 1F0NA 2OGTA 3TGLA 4UHCA 4H18A 2X76A 5H3HA 3C6BA 4DLNA 4OUKX 3DD5A 4A16A 5T4FA 1CUWA 5FUMA 1Y37A 3ESDA 5AO9A 1AGYA 3R3XA 5JARA 4U2BA 3K9BA 1PV1A 4JYMA 1JJBA 2V96A 4FTWA 4FNMA 3QYJA 1EXWA 5ALGA 3F97A 4AO6A 5ALNA 1MX1A 1LZKA 4UBMA 1CUIA 3ICVA 2IIVA 2OQIA 1DINA 3G0GA 4RE5A 3EQ7A 2O2GA 3T52A 2JEZA 3IUJA 4EY7A 4BBZA 4Y2PA 3K2IA 5FOQA 4K5QA 3PFCA 5JZBA 4B83A 1E66A 1H23A 2R8BA 2QMQA 3H2GA 6YASA 5BWCA 4QDXA 2B20A 1WCYA 5HCUA 5I9IA 2GYVA 2VEOA 4PQEA 1CRLA 5JD5A 1DT5A 3PF8A 3EIOA 3I6ZA 4FBLA 4Q34A 1LPAB 4FBMA 3WZMA 4PSCA 2QS9A 2GZSA 2WJ4A 3D5EA 5IKXA 1YB6A 2XQGA 1WPXA 3DNMA 3FLEA 2ECFA 4FLFA 1U65A 2C5FA 3H18A 4X71A 5AM2A 1DWPA 1A8SA 3WWCA 5EIAA 1XLWA 4BAUA 3MVEA 4ZWNA 4KRYA 4OB6A 4OB7A 1JFRA 4X00A 2QM0A 3C8DA 1YS1X 4LXIA 3O95A 2C58A 4Q82A 1EA5A 5LZ7A 3I1YA 3B12A 1LPSA 2CEKA 1SC9A 1GXSA 4WCVA 3KWFA 4LKOA 5HF8A 4AB1A 4BCCA 2BUAA 2JGEA 3I2KA 5D3KA 2G5TA 4EY4A 3VVLA 1CVLA 4X85A 1VE7A 4FLMA 1VOTA 2GYUA 2XMRA 5CH3A 5LLSA 5AOAA 4W1QA 4NVRA 3HZOA 4IQ4A 4UBIA 4B0PA 1AZWA 4AZ0A 5ALPA 2WM2A 1XRRA 1EINA 2FJPA 2WG2A 2PSEA 1CR6A 4QDZA 3HRHA 1XZIA 4J0HA 1ISPA 4J0IA 2BAGA 3H1AA 3HYSA 2WIJA 3V1NA 2H1IA 4P9NA 1HL7A 1ZOIA 1TKRA 5K3DA 1H22A 5CT4A 2JEYA 3AZPA 2WTMA 4UFPA 4Y2VA 1H2XA 3I6MA 1FFCA 1R4ZA 2JGIA 4KEAA 2CB9A 3AIOA 4FKBA 5AKLA 4Q3LA 1CUDA 1Q84A 3WK6A 4G4GA 3OTQA 5F4ZA 3WYDA 4GECA 3O9VA 1CIJA 4BVJA 2D0DA 4BYMA 1XZLA 2YASA 4AXBA 1J1IA 2DSNA 3F67A 4QDTA 4WY8A 2GYWA 1RP1A 1ACLA 3Q8WA 4BRZA 1TIBA 5A7HA 2HA7A 1BN7A 5JAHA 1XZBA 5CXUA 2J4FA 4BP9A 4AMZA 3BF8A 4NMWA 3YASA 2I3ZA 4G8BA 4J0JA 3S8YA 1DQYA 5DLPA 3U0VA 2WHPA 4MWSA 2XUQA 3WL7A 4Y2TA 4CCYB 3G0DA 3D4LA 2V98A 5AKJA 3D2BA 1E8MA 5DNWA 2XUHA 4EUSA 3A2MA 3IULA 5CT6A 4FWBA 1YA8A 1Y7HA 4ITVA 4Y2JA 3RK4A 1DU4A 1B6GA 4FHZA 2ZJ6A 2HU7A 1CV2A 2OCIA 1L7QA 2JF0A 1XRQA 2B4KA 4LYEA 1UK8A 4BDTA 5CH5A 5AKKA 5HZGA 3H04A 4K6GA 1JU3A 4PNZA 4QLOA 3WI7A 5K3AA 1BEEA 1CUSA 1SFRA 2XMSA 3D3NA 1G4HA 4BC0A 3WA7A 1O6FA 4MYDA 1MAAA 5AIBA 5K3FB 3E1GA 4LXGA 4NZZA 2WHRA 1CUEA 2ZJ7A 5EI5A 3H17A 5DNUA 3R0VA 4JYPA 3L1HA 1XFDA 1QGED 2XUAA 2C7BA 2XUIA 5C8ZA 1J2EA 3GUUA 4UBOA 4N5HX 2WFLB 4QA9A 1E8DA 4DGQA 4FMPA 1YB7A 4PSUA 1IUNA 4KACA 4FFWA 2QUBA 5CMLA 3V48A 2RHTA 5AKGA 5K3FA 4AN0A 2HA2A 1QOZA 1DX6A 2VT7A 2C0QA 5ALRA 3WMRA 4DMHA 1CUVA 2R11A 1CUHA 1UZAA 4LIPD 5AI8A 3WA6A 5D3ZA 2VATA 3C87A 1M33A 4BRSA 5EGNA 1SCIA 5CXXA 2O7RA 3ESAA 1S8OA 2WUEA 5EFZA 1AURA 5IVDA 5E2IA 4J0KA 1ETHA 1CQZA 3C6ZA 1BRTA 3OM8A 2ZYHA 3VJKA 1GKKA 4XJVA 4BZZA 2ACKA 4B82A 1YASA 2UZ0A 4RE6A 4J0DA 2HA6A 4C87A 4E15A 1KU0A 1K6EA 2HL6A 2XMBA 4JNCA 4U2FA 1QTIA 4INZA 4F21A 4I19A 3N2ZB 5ALMA 5I8PA 1ORWA 4HVTA 2K2QB 3SWWA 5T4BA 4X90A 4G8DA 4YASA 2PSDA 2VQ6A 3IURA 2OXEA 4HXFB 4X6UA 4CIAA 3WJ2A 3BIWA 4J0GA 3DS8A 1A7UA 2JGKA 2GZRA 3SK0A 2ACEA 2CMFA 5DTIA 3QITA 1QIIA 1YAJA 2CKMA 5JALA 3V1MA 3R3UA 5CH8A 4W9RA 1EVQA 4TVKA 2XMQA 5K3BA 1QFMA 4U2GA 1EDDA 1ZI6A 3O4GA 4BAZA 2PUHA 1K63A 4B9EA 1XZKA 2XLBA 3V9AA 3ANTA 1MN6A 2HFKA 3GROA 1ZD5A 2J4CA 3FYTA 1UOOA 3DKKA 2HM7A 1XQWA 1LPOA 5A6VA 2D5LA 2WQZA 3FBWA 1I6WA 5JADA 4WFKA 3C8HA 2AJDA 1WB6A 2OAEA 3ED1A 4UHHA 1CUAA 3DL4A 3WWDA 3GZJA 3C70A 3PUIA 3O4JA 4GXNA 2VAXA 3FSGD 1SCQA 3AJAA 4Y2RA 2ZYRA 3WWPA 4CG2A 2HIHA 4BVKA 2HA4A 3LLCA 1UWCA 2XQFA 2FUKA 5DYWA 2VJDA 1N5RA 1OILA 3BWXA 5SYNA 1LGYA 1YA4A 5HQ3A 4HRXA 5ESRA 2CBGA 2J3DA 1WHSA 4G9EA 3DOIA 5ALOA 2RI6A 3W2TA 3KD2A 5AI9A 5JZ9A 2ZSIA 3S2ZA 5KWIA 3DYVA 3KSRA 4UBNA 1YSCA 2VTVA 5LYYA 4X3CA 4C89A 4FOLA 1YS2X 3A70A 3AIKA 3BE8A 3STVA 2Z3ZA 4C88A 1FFEA 2RONA 1LLFA 3ZLTA 1XROA 3ESBA 5AKIA 4E11A 1TCAA 3RARA 1AKNA 2J3QA 3DYIA 3F8SA 4EY8A 1SOMA 1R9NA 4HZGA 3W06A 3VVMA 5AI5A 4FDMA 2WG0A 4GHWA 3F96A 3C6YA 3R3YA 1XKLA 1JJIA 3TRDA 3V1KA 4DNOA 4F60A 5ALVA 4X93A 4Y2SA 4GLBA 4CFSA 1QIHA 4P93A 2QZPA 2JGFA 2PSJA 5CURA 1R50A 3C43A 5YASA 4KE7A 4UBJA 3IUQA 4QEKA 3E4DA 4F5ZA 2OCGA 4ZREA 2W6CX 1Q0RA 3DLTA 3O4IA 3PUHA 4GDMA 4BDSA 4LYDA 3O9MA 2PSHA 2Y1KA 3VXKA 3LIIA 4UHDA 2GBCA 4D9JA 2ROQA 3WYNA 1QZ3A 4HXEB 4EY5A 2WUDA 5AOBA 2YH2A 3H1BA 3LIPA 4X6YA 2DFPA 3OURA 1QONA 4H7KA 1VA5A 3JWEA 4UHEA 3IUMA 5AM0A 4KR0A 1QE3A 4IO0A 2PPLA 4K6HA 4B0OA 4X95A 5JD6A 3FOBA 1E89A 3HABA 3G0BA 4BE4A 5JIBA 2WUGA 4DIUA 1Y7IA 4S0XA 4O08A 2VA9A 3BL8A 5ALHA 3AZOA 3DL7A 3D7RA 1W1IA 3WKDA 1BU8A 4KJXA 1XZGA 5AP9A 4UUQA 5IVHA 5FV4A 3KOOA 3QMVA 3IA2A 4JEIA 5EHZA 4CIBA 3WZLA 4AX4A 3NOXA 1LPBB 2LIPA 4HS9A 1MNQA 4M0MA 3NGMA 3PFBA 4X91A 1AX9A 3WQHA 1NX9A 4GW3A 5AM1A 1EDEA 3G0CA 3A2LA 4L3WA 4ZI5A 4DMKA 2WUFA 1UKAA 4UFOA 3NWOA 5FDFA 5AOCA 1MPXA 3JW8A 1R88A 4AMYA 2XDWA 4ZXFA 1CUZA 1AUOA 5DJ5A 1Z68A 3IBTA 3MGAA 4HAIA 1XZCA 1CUUA 1LBSA 2O7VA 1N8SA 5HFAA 2Q0XA 3C5VA 1XZJA 1MU0A 3WWOA 2CZQA 3P2MA 2XE4A 3FLBA 3FYUB 4H7IA 3D0KA 2VJCA 5LIPA 3ANSA 3ZLUA 2GBIA 1UKCA 3WWEA 1JMKC 1P0IA 3JYHA 4KAJA 3WIBA 3M82A 5JAUA 3WK5A 5BWBA 3BXPA 1U2EA 4N8DA 1VZ3A 2Z8XA 2WILA 4RGYA 5ALEA 3UUEA 1YAHA 3AUKA 1GQSA 1QO9A 4J0CA 2Y2UA 4H77A 1R9MA 3M3DA 2WIDA 2CJPA 4KAFA 4XWGA 2WTNA 2BCEA 4ARAA 3R41A 3IDAA 5AKHA 3WLAA 4Q05A 4X92A 4IHAA 5EIHA 2ES4A 2DHEA 4DTCA 2QVBA 4K6KA 2VF2A 2H9YA 1TCCA 1XRNA 2QJWA 3I2IA 3K6KA 2VAVA 1IZ8A 4ZV9A 2XLCA 3QMWA 1GGVA 3VKFA 3QMMA 5EHQA 5AK3A 5KREA 5JATA 5AKEA 5AI0A 3FAKA 1BE0A 1CUCA 2AJCA 1QIKA 2WIFA 1XZAA 1MAHA 3C5WP 5AICA 2ZJFA 4UFNA 1JKMA 4BC1A 4OYLA 1W6RA 1G42A 4OD0A 4KAAA 1XQXA 1QIJA 4EZIA 4BB0A
chains in the Genus database with same CATH superfamily
3U4CA 1AS2A 1MBZA 5E4TA 3CO5A 1N1EA 4WLFA 2ERXA 2JW5A 3KJXA 1F3OA 4MINA 4PICA 1X7XA 1A3CA 2HGZA 5JECA 2NW6A 4N82A 4M1WA 2FPPA 1RI1A 1RC1A 2BVNA 2VYCA 2GWRA 2J3KA 3E15A 4HTAA 4KMRA 3SR0A 3TOVA 3BRWA 4QUEA 4P92A 1N77A 2EEZA 1M1YA 3AUAA 4LMAA 3FRHA 3TAUA 3AVXA 3I37X 5JAOA 3QTTA 3UWDA 5FQNA 1CZKA 3NETA 4HVAA 5AW1A 2VT6A 4XPIB 1EK2A 4ITUA 1DIHA 4ZI3A 2HHJA 3A32A 3NCTA 1ACJA 1L3BA 2X8WA 4WECA 1AUQA 3FGNA 4NS4A 4ON9A 3T9FA 4CMIB 3OFVA 3TTUA 3BIXA 3DHWC 2X58A 5A0FA 2Z2XA 3AI3A 4DIFA 2BM9A 3QUAA 4YYEA 2ZXUA 2OBNA 1AY0A 4NICA 5IM5A 2IHZA 4GGPA 1XAGA 3PLAE 3ZVKA 3VC2A 1NXPA 4F86A 2BFOA 3S2UA 3LXUX 2GBPA 4A6XA 4B71A 1O96B 3VJRA 1SXJA 4WESA 3G6WA 2WAXA 3ETDA 5ILGA 5SYAA 3EXEB 4EW3A 2NXEA 3FNRA 4YMWA 3ANMA 2RGDA 3OOSA 4OHMA 2F3QA 2OCDA 5DSZA 3RC2A 1RFLA 2ODQA 2Q46A 4F1JA 5EG5A 4AT1A 1WLSA 4CT4B 1SHZA 4JJFA 1AQNA 3DVRX 2QPTA 4LDJA 1O1YA 1QV7A 2VRWA 4G5XA 2XUOA 4Z4IA 1SAYA 3L7KA 5JS7A 4P86A 2OCXA 1X39A 3AQ4A 3IIEA 2DF8A 5JAMA 1KMMA 3DO5A 2AE1A 4ZO9A 3LGSA 1T3TA 3MJDA 2NPIA 1T0JB 4TGLA 3CVOA 3CU5A 3FRIA 2W8BB 1D5WA 3GZ4A 3K1ZA 4JROA 4NJMA 1N33B 5T5QA 3DZJA 3S44A 2W83A 3D6AA 4EMSA 2EWMA 3HO8A 4KXFB 4WXMA 4TYQA 4YAWA 1WMSA 3UMVA 1F8XA 1JBQA 1HV8A 5EP4A 2XTNA 4BUZA 3CLRC 3BE4A 2CNNA 3ESYA 1GUZA 3EF3A 3VPBA 3EGDB 3NT4A 4Q9DA 4HDAA 3ZW9A 4Q7MB 1KI1A 3PNPA 2RBKA 3MRTA 1V35A 2BR3A 1E9BA 2C29D 2R1VA 3I9NA 3PT9A 3ZGOA 2V65A 1JEDA 3GAMA 1MDBA 3BMXA 4XPIA 1KIAA 5AVKA 4EL0A 3FDFA 3WGIA 4WJKB 4NCNA 4HDMB 2VPYA 3ZJUA 3FCYA 1MB9A 2HXGA 2VKTA 2XKAA 3OLVA 1KY2A 2BH9A 3QH4A 1F4PA 4G2TA 1MA3A 1C0EA 3NCHA 2C8JA 3G7NA 2VSNA 3N76A 1WDMA 3MQFA 4RK6A 1XKXA 4XJSA 5AKYA 1F17A 4F4IA 3ASYA 4BKUA 5HKOA 1IUPA 3ZYZA 4YWHA 1L7EA 3T3IA 2N75A 2QKYA 2BDTA 3EPPA 2CCKA 1YFLA 3HN2A 1FTYA 1VPVA 4LE1A 4A5OA 4EGCB 1UWKA 3PTAA 3AVUA 1A77A 1UMCB 5HF9A 4UULA 2LCFA 4BX0A 5C1PA 4MDFA 2DKOA 4C22A 3UFXB 2DTXA 3I04A 4DSNA 4E4TA 5IJ9A 4PZAA 4YGXB 3OLCX 5ESDA 4XIGS 5FLYA 4LVCA 2XCSB 2H4WA 4TKLA 5FLKA 2F7SA 4B76A 1VJDA 1X70A 2OORA 4CG0A 5IUJC 5IK2D 2IHNA 1Q12A 2C42A 1TKCA 1BA2A 5ADVA 1H8HA 4XCVA 2PM8A 1AV7A 3ORQA 4HAUA 4PO3X 1Q57A 5NLLA 8AT1A 3VNUA 1JL3A 3EZLA 4XB1A 1KJNA 1V9LA 4HGPA 4IO1A 1T3LA 3G68A 2WC1A 3LS2A 4U2DA 4MR9A 4OJTA 2BE7A 4J75A 1GNPA 2C59A 3OEHA 5CJJA 1F0PA 4QG7A 1FXWA 1UR5A 4L02A 4QBHA 5KINB 1ZM4A 1RKQA 4G6ZA 5D7BA 3VSEA 4BVAA 4QVGA 3JQEA 4XDHA 5LVAA 3L7JA 3PC7A 1N2CB 1OA0A 4CM3A 4K2HA 1R7RA 3ZU3A 1POXA 3H87A 4G09A 4YRLA 3RVRA 5DMHA 2ZTSA 5CFQA 1JDTA 3RUAA 4XVQA 3K5WA 4OK5A 5LSAA 2NACA 1T5SA 1RACA 1VSTA 4PO8A 3CT4A 4B3BA 3NBAA 4B32A 5IAAA 2JCXA 2ZIWB 3W3AA 2CSXA 2QPOA 5BN1A 4L3VA 1P7WA 2G4LA 3ZBQA 4Q93A 4KYVA 5EVCA 4BQOA 4B3JA 3CLSD 2HBQA 3U4GA 3ROTA 3BXFA 1MXHA 4O8ZA 2CXHA 3FAZA 4O5AA 1W44A 2PUVA 3VDMA 1IBCA 2VPQA 5GONB 4BBPA 3EFOB 4ZT6A 3Q8XB 3U3KA 4RDIA 4V2UA 4WPGA 3UJPA 5AW8A 4P22A 3ORFA 3RLIA 3W9SA 4C3VA 2APJA 4PZDA 4JT2A 4MUEA 3UEOA 4JMPA 4LYAA 3GX1A 1U8ZA 3O84A 1H93A 4UVHA 3W5UA 1P2BA 5B3AA 4D44A 3L02A 3NRJA 2I78A 3PKJA 1XLUA 4IQ8A 5CFNA 2HKIA 4KO4S 2F43A 2FN3A 1VPEA 3AZQA 1QGZA 3ILVA 3JYOA 4MA4A 1SCBA 4Y1RA 8MHTA 2H7CA 3IIMA 1HT0A 1SELA 3QSYA 1JDJA 3C5HA 5E6RB 1NMYA 1W581 3TUJC 2XZTA 3IA7A 3CSSA 2OGZA 3STWA 4BQQA 4D9IA 5EQJB 1NHGA 2YBEA 3UJ6A 5HYVA 3R3WA 5T7BA 2I80A 1NJ1A 4AL4A 1WXXA 3PC2A 3TM4A 4C7JA 5C46F 1XWFA 1ZVQA 2UVPB 3P2JA 1KZHA 4Q66C 2XSZD 5KBYA 1BMTA 4CKBA 4KC0A 4NNOA 2VTKA 1SNYA 1P44A 2Z3VA 1I7SB 3KSZO 4RFSA 1YMUA 5C4MA 5CA0F 3H9EO 1GU1A 3P2EA 4Q1DA 3DV0A 1I4EB 3CIFA 4W7HA 4W1RA 1HYHA 4OJYA 1DJLA 1G20B 5DYTA 5THKA 3ZDCA 4KIWA 1N4AA 1PR3A 2PVSA 3TYXA 1Y42X 2HFJA 2PNFA 2EL7A 2XV1A 2O1XA 1IWOA 2GZAA 4HTFA 3CLRD 4OHVA 2BPOA 2ET6A 2EGGA 1MEJA 3RVMA 3INGA 1PGPA 2ZS7A 2QMZA 1L4HA 3SC3A 3ZE7A 1D2NA 5AM4A 3DCNA 2FLKA 2PK3A 3ZQJA 2QRPA 5K8UA 5FUXA 1WKBA 2IPNA 3FGZA 4MW0A 1JZSA 2A5GA 5IYZA 2QLMA 3U5TA 1QAQA 4ZAXA 4U4AA 4ARVA 3B3QA 4Z3OA 2W42A 1EDZA 1LPNA 1IH8A 3QEOA 5FPPA 1EKXA 3QWFA 3OX2A 3N8IA 3OEHD 4X97A 4DHWA 4FONA 2H16A 3LO5A 1CKEA 4LNUB 4E21A 4V0OA 4CCSA 1VKHA 3O8QA 4MLPA 3V7UA 4IL5A 3UANA 4DCCA 2VSQA 3MFYA 1C4OA 3E0QA 2ZBFA 2CD9A 4Z49A 1T2DA 4AKIA 3ZW7A 4CUKA 1IXZA 5EY5B 4PHFA 4BWVA 1K7FB 2O23A 2IRWA 2X5XA 3VR4H 3W3AD 2J0SA 3PFFA 2RK4A 2H5LA 3G2IA 2VJMA 3KD3A 1UQRA 1W4RA 4HLDA 4PC7A 3W04A 1Z2DA 1B3RA 2JZOA 4R2JA 3IXQA 1FP4A 5AK4A 4ALIA 5DNCA 3FDZB 1I7DA 1Q1EA 3LKDA 3U4AA 1CD5A 5C3UA 3DZ8A 2F8SA 4F4CA 4LHYA 2FR8A 2CNBA 3LZ6A 4HB2A 5T6BA 4UDXX 4C0LA 2HWYA 4ZJZA 4CLOA 1LFAA 1J2JA 1TK3A 4KVZA 3B6IA 3UWSA 3JSAA 4FFVA 2XRYA 4TVBA 3W8NA 3VAZA 2IL1A 1CFJA 1T36B 2BJWA 2FWJA 1RXIA 2RCNA 3EY9A 5I7OA 3BZWA 1P0MA 3AYXB 4MV7A 2JLSA 5B58T 3PFHA 3WMEA 3QX3A 2EF1A 3VOTA 3PX3A 1RM3A 2EJCA 5LLTA 4L0QA 1I4DD 3IAM1 1N57A 1QYWA 3QWHA 4DLYA 1YU9A 5JXGA 3GPLA 1X7WB 2F90A 2D7JA 1WCIA 3PBKA 4QOFA 1G2QA 1WL8A 3BTOA 1VA4A 1Y3CE 1KWGA 1OKKD 1WB9A 5TQ2A 5HGXA 1WDLA 5IEJA 3W9UA 5THXA 5LL6P 2VRBA 4QPNA 1OFVA 1UZMA 2AMVA 4RF3A 5CEFA 3HJRA 2OHIA 4J94A 4QDJA 5HVNA 4Q9NA 3GGCA 1T8UA 2V0CA 2WSIA 3JQCA 3DZIA 5BYJA 3HBMA 2VS1A 3FCXA 1DVRA 1BCRA 4RELA 5F7ZA 3SY8A 1XA3A 2VHYA 2JBAA 1NR1A 4L4ZA 4HXGA 1DBSA 3AUJB 4MITA 4Q1EA 3H16A 3T9AA 1P2TA 1UJCA 3CXRA 4RENA 3SHOA 5DH9A 5KYUA 2OAQ1 3HEBA 2W00A 4QUKA 4R7ZA 4XX1A 1UAAA 2O6LA 3IE1A 3R3SA 2NV0A 4RD4A 2J0EA 1DIAA 1NKSA 2XYHA 3NAZA 4AVYA 1W2HA 4KYUA 1LK5A 3BWMA 4KFUA 5JH7F 4JXZA 5IU6A 3EBOA 4JQYA 4CKCB 3LNCA 5L7WA 4C14A 2OO3A 4LRQA 4QOJA 3AY6A 1J21A 2GVNA 1T8RA 1N2HA 1FQOA 5IJXA 1KGSA 4AUMA 1E98A 3QOWA 4N7MA 4AUNA 4YUXA 4P0QB 1B8UA 4KBFA 1LPPA 4Y3UA 1UK7A 3OTWA 1Q19A 4CIVA 4D9HA 2H65A 1OU4A 3QVMA 5AJXA 4RD3A 4YJFB 5KNBA 1X7WA 3THXA 1PGNA 1GGEA 2ZRQA 3DMTC 2OV6A 3G9ZA 2ZIEA 1FSSA 3Q5GA 2C0PA 4Q9IA 4AS3A 4MWOA 3I12A 2PQMA 2NSJA 3DL2A 3R2JA 3QU9A 2FW6A 3RIYA 2EKDA 2MSLA 1GTSA 3Q2IA 2QAGB 3AF0A 3H2ZA 4XYGA 2FFQA 1MX9A 4GP7A 4BB6A 2BMJA 4GZ6A 3O03A 2Y68A 4UHBA 4NYMQ 2CNDA 2X1LA 2XOKD 3I76A 1U1GA 3OWHA 1JG4A 2PWYA 5GAJA 3RYHB 2PSFA 3A1VA 3CHYA 2CV0A 3TM5A 3I9KA 1AKUA 4GU5A 1V43A 4JN6B 2GD6A 4WH0A 2ZK7A 1Z56C 4KE9A 1YKGA 5H70A 4DXDA 1A9QA 2OUKA 2ZE5A 3OUUA 3KKNA 5CA1B 2FUG1 1RLIA 5JXIA 4HY3A 3SPXA 1Q1NA 4PBTA 4K9RA 1U7TA 2R5WA 5EXSA 3ZD7A 2SHKA 1HFWA 1NLZA 2PJDA 2W22A 3KJHA 3KVYA 3AFMA 5CJPA 3T0IA 2OCLA 3TRIA 3WYCA 5A9SB 4I8XA 4B8WA 1JFFB 2UUAB 1UMDB 3PGLA 1E5TA 4EI8A 3MJ4A 1Z62A 4C03A 5G53C 2QRVB 2JCVA 1A88A 2Y92A 1LD3A 2XE6A 3UCXA 2XI4A 1U8AA 2H9IA 2OC4A 2YN4A 1Y3AA 2YTZA 2OOSA 4HGQA 4J7AA 1XZFA 3VTFA 4BNWA 4JEMA 3JWHA 2D06A 5DBIA 2R1TA 1ZICA 2EW2A 3AR8A 3DT6A 5BSRA 4HJRA 3H4TA 2JFHA 3AU9A 3L93A 5FUVA 5AHXA 5ALWA 2IOHA 2BZGA 2CJWA 4GLJA 2VCYA 2R8ZA 2HMSA 1ZONA 5B1IA 5DOZA 1TYAE 2QLJA 5LNK1 3R5XA 1C9EA 5IBPA 1NBEA 4ND3A 4AJLA 5ALZA 1QJ4A 3ND6A 3TMKA 3CWCA 1J07A 3FTNA 4OIFA 5AUPB 4RYLA 4EW1A 5JFGA 1C9YA 1C8LA 1G20A 5B1EA 3MTDA 4CEIB 5BT9A 1TD1A 2QRZA 4WW0A 1O8BA 3FTQA 3WB2A 2FWMX 1U8YA 3EUWA 3UIEA 3DV0B 4UTVA 1CZLA 1P33A 3ON5A 3OPQA 5T41A 3UKJA 4DRZA 1WXQA 5CCEA 4EVRA 2JD1A 3GH1A 5DPMA 5JSZB 1DCTA 5GVSA 3W2EA 2FG5A 2X5NA 4WY5A 2XWJI 3ZH2A 1F2TA 4EF6A 2BJHA 5CPFA 4YI5A 4D8YA 4DV4B 2QTZA 4R3UC 2NZ8A 3EIQA 3ORHA 3I45A 3OIWA 3KDAA 4YJ3A 3R8FA 5ALFA 3GRYA 5FO0A 1T2NA 1T9AA 3UJAA 3IC5A 5IKOA 1L7NA 1H6AA 1T2FA 3SNHA 2C7OA 4CV2A 2FFRA 1MJGM 2F00A 1N32B 3CCFA 1CR1A 1B41A 3C6XA 1XMXA 2PIDA 1A9XB 3QYPA 2RSLA 4EA7A 3F9CA 3L84A 3AF6A 4CGZA 1NAHA 3IO3A 4G63A 2V59A 4PAQA 5CVDA 3WLEA 4B9AA 4BGDA 1TMKA 1KXZA 3JVUA 1G60A 2I2WA 4HLQB 3KWJA 2WHQA 1HOTA 2CLOB 5ALDA 5FFMA 4PBRA 1LZLA 4IDDA 3P71T 1QGUB 5B1DA 3RAJA 4DQXA 2G09A 5FJIA 4K8OA 1E9VA 3KG2A 3OZRA 1SKYE 2KX7A 1K66A 1OWNA 3N59A 1RTTA 1YHYA 5DCWA 3NJ4A 4A8PA 1SUDA 1VKRA 4MUAA 4RAOA 3U4MA 2UZ1B 2WIBA 3UT5A 1V1JA 2DGDA 5FWXA 2PSSA 4HGNA 2VNAA 3GGPA 1BFKA 5FFFA 5CPBA 1ZUIA 2AUTA 2BFMA 3WDLA 4ZJYA 1VIYA 3BJMA 4L9WA 4BKQA 4EUNA 5BUSA 5EQDA 2X6RA 1GZVA 2IV2X 4E2ZA 4J43A 5JAPA 3TXAA 5TPWB 3BJRA 2VZ8A 4B3IA 4CR6A 2I6FA 3QZUA 1P39A 4HMQA 3AH8A 4A8JC 2YS6A 4I9NA 5MFPA 4ENWA 4I3FA 3CEJA 4H08A 5DM70 3ZBTA 1Q20A 4MPDA 2GAIA 5CW2A 2OBYA 1WPRA 3PUYA 5TGZA 4AW9A 4DXHA 1XG5A 5JJIA 2H8GA 1RYNA 2H4HA 3PDIB 3F47A 1G8PA 4K2AA 5ALUA 5E7IA 5LP6B 1Q7CA 2X19A 3BFXA 2FUG6 5AIAA 2O5EA 2HA5A 1ZD3A 1U6KA 2H57A 2G67A 2NTYC 1RMTA 2J3JA 1C3LA 5ALIA 5G4LA 3SEAA 3QVKA 2VTBB 1KYIA 2VDRB 3GCXA 3A9TA 3OSZA 4IWYA 4NYMR 4AK9A 1QUFA 3I83A 4MV0A 2AS0A 4MUKA 4W6ZA 1VJ0A 3WGGA 4H1WA 2CJXA 2CFOA 4NCHA 1KQGA 2V7XA 3CRQA 2VQFB 3K2QA 2JGMA 2RGUA 1L5ZA 2PZFA 4UEKA 5JQWA 1Z82A 1N36B 1OH7A 1T8YA 1TXGA 4J7XA 5JSQA 2M6LA 1RC0A 2JHCA 4O2BF 4XIIA 5JS1A 4GR5A 1U28A 1UKEA 1MABB 4P80A 5LYJA 4BO0A 1KVTA 5C5IA 2DEUA 4KDRA 4OLBA 2A4MA 2ZR9A 2LDXA 4PXAA 2FPKA 3NONA 4B75A 3GEGA 5DYNA 1XAHA 3EH1A 2X8BA 3IQGX 2EV9A 1KFEB 2NSYA 4WBNF 4ZTUB 1NW9B 3SZUA 2OZVA 1QGOA 1C4XA 1RZVA 4I1RA 4IQ0A 4BFXA 4CI9A 1X8XA 4G81A 1KTVA 2CMDA 1GL9B 2HYDA 2IY7A 2R66A 2VBCA 4PHHA 1IVYA 2PKQO 3A05A 1JXOA 4P81A 4P54A 4QJ5A 3T7EA 1GM5A 1GZSA 3D8HA 3NT5A 1A5TA 1U2QA 4EY3A 3THWB 2YYAA 1OYYA 1A5ZA 4K7JA 8LDHA 2C98A 2XE7A 4Z4FA 4B84A 2F8TA 2ZM5A 4BPRA 3V8MA 2B30A 4UBLA 3H5OA 1G9SA 2GKOA 4DMGA 2REOA 4Z9XA 3AK4A 4G24A 4W5NA 5I7WA 2NLOA 2BFEA 3NANA 1N9GA 3OX1A 1HEUA 3RV4A 4MRRA 3A25A 5DSTA 5LDDC 2HK8A 2NTNA 3MTQA 3P9XA 4FNGA 1E32A 5J2TF 1A9ZA 3WK4A 5H80A 1U6JA 2OXTA 3MOSA 4HH0A 3L8HA 3EMBA 4I9GA 2UV8A 1T6XA 3H86A 1EG7A 1WZUA 3JY6A 2QMYA 2HJHA 3HJCA 3TJRA 2WKSA 4Q7EA 4EO9A 2PAAA 2ZBEA 5NULA 3DCYA 3I92A 3I9V1 4FFRA 3EA0A 1ZGBA 2KJQA 4RV4A 2JJMA 5DGHA 3ZJ5A 4IY1A 4IS2A 3N0TA 3E2PA 1WOMA 3WDMA 3TD9A 5HXAA 2NZXA 3QLEA 4JBYA 1SWWA 1X1CA 4NAUA 5BR1A 2QZ9A 4BFWA 4FNOA 2BONA 2YBDA 4C0XA 4WX2B 2P9BA 1LNZA 2X0RA 1GAJA 1NJ5A 2QY6A 1PR9A 3LQ4A 3IEXA 3AV3A 4UZFA 2P3QA 3DH0A 2JIDA 2ZSFA 2JAPA 1EBBA 4JELA 2DHQA 1XJ0A 3NIBA 4R9RA 3HB0A 2DJ5A 1M1YB 3U5ZB 3AESA 3IILA 4ZEVA 1ISFA 1JLKA 3T8YA 3RS0A 1CY1A 1X7ZB 1PBTA 1XQ9A 2FPPB 1KL7A 3PYMA 2C2YA 5F3DA 5G0WA 4B4DA 4ETWA 3WGUA 3QPVA 3SE7A 1TRHA 4CR8A 1Z83A 3KJFA 4CKXA 1Z2CA 3UG6A 1N1MA 4F9FA 1D8TA 1WG8A 3ABOB 10MHA 3U44B 1RQXA 3O31A 2ABWA 3V00A 2DERA 2NXNA 1DJMA 3DP9A 1UT6A 3LAWA 3Q3IA 5AH0A 3G1TA 1VHWA 3JATA 4X5OA 2JAHA 1C3XA 2FW1A 2NM0A 2P6PA 2CMHA 1BWPA 4AS2A 1JB9A 1W4LA 4EABA 3KJGA 4GM4A 1IN1A 2NU8B 4A8TA 3SS7X 2G9QA 4DMUB 4R71A 1DIGA 4RC9A 3AIMA 1SCKA 4V0NA 5KYUB 2WFZA 1IUKA 3Q7PA 3S1AB 5HHTA 5DHAA 3OQMA 4EO7A 3BDVA 4QYSA 1CT9A 4QUDA 1WSBA 3K8OE 1ULSA 2VRCD 4GBGA 4U7PB 2PKEA 3AB3A 2FF7A 2YWDA 1LH0A 5D00A 2AFIB 3A58B 4WK0B 1SCNE 4B2YA 2P6UA 4LN1A 1BN6A 1IONA 3ZWQA 1D0IA 4M0LA 5I5EA 1PAUA 3PA6A 5HGJA 1EXMA 3OJWA 1K6JA 1C1DB 1T0UA 2NGRA 3EZXA 4AZ3B 1YQQA 1DC4A 5IAEA 4ZO7A 5FI5A 3RVOA 4CI0B 3TOZA 4EZBA 5A62A 4GAEA 3C1AA 1AD2A 4V24A 2ZYAA 4PG8A 4HEA6 3UATA 4C6TB 5F7XA 2AR7A 2QYTA 3A26A 4FQ8A 3VUFA 2YIVX 2MMGA 3FJOA 3GY0A 2XDAA 3OMXA 5B6JA 1WW8A 4C3UA 4C4RA 1HDIA 3WGJA 4PFJA 4EHAA 3WY9A 3QELB 1N2GA 1ENZA 4U2CA 3T7AA 3W90A 2OAGA 2WYVA 3I9MA 4OIMA 1KYYA 4YV1A 4IEFB 5LZ8A 3PUJA 1LJ8A 1NC1A 2ZYTX 1ONBA 1ZIYA 1ZD4A 2N42A 3CTPA 5H68A 3WP1B 3UTCA 1QCCA 3KVOA 4G9GA 3ZU2A 2COKA 3WGNA 2BFAA 3TJMA 2VJMB 2XT0A 4IDFA 4Q3KA 1EHYA 3GNTA 5H3LA 1R0BA 3DJYA 4HN2A 3SZ3A 3ZVRA 4DLRA 4ZDKA 3IPYA 1OXTA 4C5AA 2E87A 1FP2A 1Y7TA 2JI6A 4GI1A 4CCYA 1Z7BA 3WJ1A 3DBLB 3ZQ4A 4MUIA 1G18A 2AJTA 4IXWA 1T9HA 4XM0A 2RHLA 4YJFA 4PC1A 3TZQA 2I2AA 2A1TS 4TUYF 3PX2A 1MO5A 1J2TA 2XTJA 5TXGA 1ORVA 1X0XA 1PR6A 5BV8A 1XPRA 4MRMA 4H0FA 3LF1A 3RYFB 5JNSA 5ECWA 3QUTA 2GOYA 3RQIA 2CC2A 2BSAA 1SKMA 3P96A 1X9IA 3IPXA 1YV9A 2WLTA 4Y2GA 4WBXC 4L4UA 2VUTA 4PAWA 2GCOA 2KLHA 2XUJA 1LS6A 3I8OA 3K1AB 3MPOA 4IOJA 4FILA 4OLJA 2VPZA 1IIBA 1DKQA 1O4VA 1OLUA 1XMVA 2B8NA 2PLWA 4GOND 4H1UA 4BMSA 3CNOA 2C2HA 3FZEA 2H48A 3DW1X 3EOBI 5CA0A 4ZYLA 1SHKA 2GBLC 1JX6A 2ZOSA 3EC7A 2HGSA 5F3RA 2KPOA 1CUJA 4I5FA 3UB4A 4WBNA 1I3KA 1VIAA 2PMKA 2R79A 4ZOCA 3AKCA 1BW9A 1VMAA 3HJBA 1N5DA 1KZ6A 1XDWA 4DDMA 1TZBA 3L0BA 4I9FA 1NG1A 4I1IA 3A4MA 5DLEA 1PR1A 2W9XA 5JFOA 2HV9A 3OJOA 3C3YA 4HS4A 3WLTA 2XCLA 5WRFA 1S8FA 3KAPA 2B94A 4F11A 2FWAA 1EUCA 1N1DA 3E9NA 5IZCA 1RYYA 4C7OB 2FPOA 5TSDA 3WMXA 1J0AA 1L4KA 1XTTA 3CKYA 4R9VA 1UC9A 2J9FB 4RMNA 1QQAA 3LM8A 1KEWA 1NI4A 3GFOA 5KVSA 1YFJA 4B17A 1E3EA 3K70B 1ONNA 3DDUA 2J32A 1D2AA 2R65A 3JTMA 1DAMA 4ZCPA 1W76A 3F3MA 3I04M 3O2SB 2WWXA 4HEHA 4JY7A 3T3HA 3PGJA 3JAKB 4G1BA 3VO9A 4CTMA 2GHRA 3HUFA 2DH5A 3L6RA 2XMCA 1SQSA 2G08A 2YINC 4PCVA 3GA7A 2Z9DA 1U0EA 2FWNA 3B3JA 2H08A 2JHPA 3KKKA 4DQ0A 4DDTA 2BELA 4ZAVA 3TUIC 3CURA 1GKYA 1ZMXA 1DZIA 1G8HA 1Z0ZA 1NZFA 3HACA 4KQWA 3KQNA 2C5GA 3PNSA 3T0FA 1EWYA 4B81A 1GHTA 2ZQZA 3EWAA 4QFCA 2VP6A 1TB4A 3T06B 2BRUA 2ZULA 2P1ZA 3ICPA 4C6HA 3PVCA 3MUEA 4JX9A 5JHHB 5SYMA 4U7JA 5FYQA 1W49A 1BRMA 2NQ2C 2DUWA 2X22A 3GMDA 4M1EA 4EBFA 5K8JB 1T9CA 5GJVC 4KQIA 6ADHA 2WU4A 3P9NA 4INAA 4NULA 2Y66A 4BV8A 4JP5A 5AJVB 1U3UA 2IP2A 4JCOA 1JAXA 4EEXA 2ZAIA 4AUKA 2E55A 1B8PA 2AC7A 1RKXA 1TTQB 4JLDA 3FYUC 3TLYA 5KVVA 4BY9E 1ZSVA 5BNIA 1L8LA 1IXRC 2EQAA 2RKWA 1FPMA 2HA3A 4EA6A 1RYDA 4CQMA 1V96A 721PA 4D5EA 4DKJA 3GNQA 4QHYA 5DSXA 3L06A 2H0RA 4JUIA 1HLFA 4URVR 3PR2B 5HEKA 3FWZA 1GAEO 4KX3A 2W6MA 1ZGHA 4TM8A 1WPQA 1DWOA 4I4TA 4IUCS 3UV7A 3B6ZA 4QZVA 2YZGA 3GYGA 1QUEA 3AL3A 4GEGA 3SBOA 4EPRA 3PQCA 1RLMA 1EX9A 1PJ3A 1K3UB 1N0HA 4MXDA 2ZM6B 1GL3A 1KO5A 3DBIA 1ZO8A 1IBSA 1CJTC 1UQUA 1M5TA 1OMOA 1YZQA 2GF9A 2IDZA 3JASB 1REQA 5D8DA 2IOFA 2IEBA 3A6HA 1LC0A 4KE6A 4D8TA 3FGPA 3G49A 3VBEA 3M6MD 2YOHA 3HI4A 5C8XA 1JQJC 1XL0A 1VG1A 3B2QA 1N7JA 3GLQA 5K6RA 3GBPA 4B3FX 1YT5A 3E48A 3I1FA 5I3ZA 2NSDA 2QXUA 2N3ZA 2JBWA 1KI4A 3KOWA 1ZOLA 1Z0KA 3BGOS 4GZ3A 5JH7A 3PX7A 3VDXA 1Z0SA 1LLUA 2C0CA 5B4VA 1H1DA 1RPJA 2HCJB 3E27A 4MNTA 2QMEA 4OXYA 3RYFA 1V45E 2O6HA 2QRGA 4Q4JB 2DPYA 4M99A 4MP6A 2XT6A 4RHEA 2X2PA 1XALA 4AU1A 5LUAA 3LYHA 2FP4B 1HWYA 3ENWA 1E2HA 4GE0A 4JWTA 4J2TA 2IPAB 3VZPA 1SZDA 1O7JA 4BHTA 1M2FA 1JVSA 2QVYX 4L85A 3ROEA 3W1VA 5ITZB 4LV5B 1FLAA 3MC1A 4I4NA 2CYAA 1C9JA 4UZEA 1XEWY 2HLHA 1YF3A 1TJYA 1TZCA 5EP2A 3EWIA 3ZTWA 4JU9A 1JWAB 3INRA 3V80A 1N5LA 1G38A 5E95A 1RYEA 1P0PA 4U7FA 2GHTA 1WETA 2Z6AA 1Z06A 5KYGA 1GFWA 1E60A 3X44A 1HNNA 1T5TA 1KHHA 2GPYA 5BOSA 4Q3OA 5CXQA 3VPAA 1GDHA 2QRHA 3H7IA 2IUSA 4DNQA 5IARA 4D3ZA 5KVQA 3ZE8A 1JIJA 3LVRE 4LC1A 1F2VA 2CBXA 3KVVA 2WG1A 1OWLA 1IVNA 3EG9B 2CL6X 1TC2A 1FW8A 2ONZA 1WVIA 3PHJA 4L0DA 1K0UA 4LTDA 2PWBA 4CV0A 1LJUA 2ORIA 2NPFA 1K3TA 3OX4A 4JC0A 5J63A 2EFEB 5BV2P 2D3TA 4MQMA 2TMYA 4FJ2A 1SBQA 3UMGA 2D2IA 4PQFA 1B2LA 2C00A 5JJLA 3OJXA 2ZAMA 3IQIX 4WLUA 1FL9A 3QU5A 3UJ9A 4EKDA 1HZZA 5KEIA 3GVIA 1G2IA 2QM8A 1LUAA 2IEDA 4WGFA 2RGNA 4ASUD 1HYQA 4MARA 1MA0A 2UXDB 1BMDA 1E5DA 2QK4A 1H3FA 3P8ZA 4F12A 4UVIA 1MFPA 5IJZA 1GUYA 5IS2A 1DG9A 4G1FA 2QR5A 2ID4A 3FF1A 3H0EA 4S04A 1VL2A 4HQ0A 3TDKA 4NXNB 1KEPA 3WL8A 3P9IA 5FEUA 3K9HA 3NTOA 4WZBE 2IHKA 1SUFA 4HB3A 1KZ1A 2P30A 2L82A 4XPZA 1CSEE 1SG6A 4EHIA 2YXPX 3CBQA 2QR2A 3LNTA 4WK4B 4BWGA 4ZCMA 4ZV4A 1W9HA 2DULA 3ZS9A 1Z63A 2IP4A 4JOSA 1TM7E 3OZFA 5ALJA 3CNLA 1C3VA 1F0NA 1UPTA 1E79A 5CVEA 2OGTA 4MULA 3AF1A 4DZRA 4Q5IA 5EJ4A 3G2LA 3QA3E 5EKUA 4I46A 4DB2A 2EBWA 3TGLA 4H18A 2BT4A 4D3XA 5KYXB 1R6XA 2G4CA 4EA9A 5H3HA 1JHZA 4RY0A 3DBVO 3LY8A 5JPIA 4OUKX 1RQGA 3DD5A 1SK9A 2JLCA 2VOEA 3EASA 3KJIA 3NIDB 4TT3D 4OP3A 1N6NA 1T29A 1K9VF 5AO9A 4HNUA 1FDOA 1QH8B 4KNWA 3DHYA 4PIVA 4WKOA 3O8DA 1YDMA 4OXNA 3B9QA 5G0VA 1UOEA 4BYGA 3KTAA 4GQIA 5IABA 4MJXA 2E4UA 1YVUA 3K9BA 1PV1A 1W93A 1Y5NA 4WNCA 4QFBA 2G8LA 1JJBA 5LQUA 1DEOA 1P9WA 3MUFA 5CA1A 4FNMA 5FWYA 3P9RA 2C9ZA 4UDYX 4AP9A 4XSHA 3NVAA 1ADCA 3F97A 4ZVTA 3O83A 4AO6A 1CUIA 1KE2A 3ICVA 3ZE9A 4B7UA 1R6AA 2YXBA 3KJNA 4EH1A 4HQKA 3RYHA 4JWKA 4B33A 4XEUA 2IH2A 1X7HA 3OESA 2O2GA 4K9SA 3T52A 2B0CA 2JEZA 4J1TC 2R6HA 2D5CA 4XUDA 5EZQA 4D79A 1GILA 1WKCA 4EY7A 2IS2A 4Y2PA 1C0KA 5B3JA 2FKNA 3K2IA 3SIWA 2R00A 4K5QA 1IK6A 5FA8A 1LTQA 5FTKA 3EF1A 4B83A 2CHFA 4X60A 4CV1A 4E1AA 3AI7A 3CZQA 5TRTA 2B4RO 3H6GA 4G5SA 1NATA 6YASA 1V1MA 3P52A 4PS1A 1W5AA 2X0DA 2UYHA 5IRCD 2NYRA 3SEZA 3HKDA 4Q01A 3ZE1B 1QV6A 5HCUA 4C2BA 1DADA 3NBFA 2VEOA 2EHJA 2PXCA 2W48A 4PQEA 4DG5A 5FBVB 3P5SA 2WICA 3MMXA 1YA6A 1NTOA 1DT5A 5KYXA 5JH7B 1FXSA 1HX7A 4DR2B 3EIOA 3KT0A 1IK4A 3I6ZA 3IRVA 3MOGA 1LPAB 2FHPA 3WZMA 4YTEA 3TLEA 1VLVA 4DLVA 1J8QA 3BOSA 1P6UA 3IGFA 3JWPA 3GJ8A 1X8LA 1AE1A 1LJLA 4GPD1 3D5EA 1V3QE 1VGRA 4PLTA 5AXDA 5A02A 5FAKA 4JJ7A 2J0QA 2DP4E 1G5RA 5AUNB 4OUDA 2MSCB 2P6MA 3MA0A 2VNSA 1ELOA 1QG0A 4E3WA 2ECFA 3CVJA 4QOEA 1VSUA 4L78A 3SIRA 3IDZA 3S29A 1R2QA 4LDPA 3X1MA 4QQFA 4EQZA 2X8AA 4X71A 3P4YA 1B6RA 3D5QA 1SG0A 1K27A 1YVDA 2NOAA 2R9VA 2WPNA 4N39A 3WFIA 4I66A 3TW0A 2BMEA 4F4UA 3LDUA 1BX3A 1KAMA 1TA4A 3AB8A 3DFUA 4JVNA 1BC5A 3HDVA 5EIAA 5LQAA 2QBYA 1Y1PA 4Q7JB 2V0NA 4BAUA 4IDNA 3H2YA 1Y6JA 3WGYA 3EPJA 3MVEA 2YQZA 3TX2A 3E05A 1VL1A 4OB6A 1G5PA 4DXAA 3FE2A 1ILEA 2C2OA 4RKEA 3A11A 4YUZA 2FSIA 1ZOOA 3S6JA 1YS1X 1TQ2A 1F9EA 4LXIA 4IFTA 2A5FA 3EG9A 4AP6A 1C0IA 4TT3A 5D86A 1TLTA 2NADA 2JFOA 1UBOS 1P3DA 1AIPA 3FYSA 2OK8A 1FF9A 2ZIVB 1HE4A 5GM1A 3JALA 1NX6A 3OHSX 3R6LA 4O8CA 4CMCA 2JH9A 3I1YA 4JZYA 3OLZA 2O20A 2CXUA 1AV6A 1NQUA 4URXR 2F9MA 1K2WA 1PGQA 1JLMA 3E3NA 2J4DA 2G9RA 2JI9A 3FPGA 1HEIA 1PG2A 4OUDB 3NBYC 4QPDA 3HB7A 2WB2A 1F51E 1K6XA 3TI9A 2WD7A 4DTIA 1IY9A 2OT3B 1G20E 1PS8A 3BXEA 4WBSA 3I2KA 3Q2KA 5LYJF 3ANXA 3E82A 4GC9A 5D3KA 3LGAA 1P1BA 3RHZA 2N46A 3BG5A 3PE3A 5EC8A 1XEXA 4IVNA 2VKQA 4E7PA 3NDPA 1VOTA 4WKPA 1GRNA 2O5RA 5I9TA 2W2OA 5HJ7A 4CTKA 5GIPE 4TT8A 2DG2A 1NT4A 4H4CA 1HSZA 1AKYA 5CH3A 4JIGA 3USES 2XD9A 3N74A 5LLSA 4RLFA 1J8FA 2CKDA 3FPCA 4O4IF 2BEWB 3QJGA 4DQDA 2C3MA 2ZQ5A 1AZWA 5B2ZA 4JSRA 4AZ0A 5BR8B 1XMIA 2AR0A 4GMHA 5JRDS 4A0GA 3ZIUA 1ISSA 1TF2A 2UYGA 3EQ2A 9MHTA 1T3SA 3GNSA 3H75A 4ZMBA 1RE1A 3A37A 2J7PD 3UF0A 2PWAA 4Y8VA 3FKQA 2PX8A 5IYZB 2F48A 3BB3A 1ICEA 3L7AA 3ONFA 4UREA 1MJGA 5B12A 1UZLA 1E1RA 1KBQA 4D8WA 4Q21A 3B1KA 3I30X 3DE5X 4B48A 4FFDA 1FBNA 4Q3EA 2A3RA 1SO8A 3FPSA 5AXAA 5LUBA 2W6JA 2A2ZA 3IAHA 3EDQA 4Q4CA 1JR3D 3AR4A 1L5RA 1C8BA 4ISCA 3VZQA 4B6JA 2LZ0A 1Z36A 2DUMA 4FFLA 4D96A 3ROQA 1R0ZA 2BSXA 3HYSA 2WU1A 5DI9A 5E3JA 3IE0A 4ZRNA 5GOZA 5M04A 2EX4A 4DZZA 4LF9B 3FROA 3V6MA 4KXLA 1WXHA 1PWZA 2NXJA 3GUHA 3KXLA 5TMEA 3K1AA 3QXXA 2Y1CA 4P9NA 2A5DA 1YFZA 2O2SA 3MXOA 4RFSB 3NIFB 4TXNA 4Q7LA 5MN4A 1QH8A 1VRCA 2IX3A 1Q0HA 4GMDA 4I7EA 4XEHA 3LGXA 4EYGA 1IY0A 1H22A 4OMFG 2PJZA 3C8ZA 3GJ3A 3RYCB 1GAXA 3DO6A 7MHTA 3N7TA 3AZPA 5FCDA 1XDBA 3ZZ0A 2QLLA 1QLHA 3I5XA 3BMCA 5JS2A 4TN5A 1UC4B 1ZJ6A 5K8VA 4DA0A 1GCAA 2IHYA 1FFCA 3AXTA 3P26A 1R4ZA 2EG9A 1IG3A 2TS1A 3CWQA 4ECEA 2YHAA 4KEAA 5K4AA 1FFWA 2CB9A 1XEWX 2HBYA 3VI4B 1GPDG 3ZUPA 2JVKA 4CIDA 3GUCA 2RDMA 2YOGA 5AKLA 1HE8B 1USGA 3SC4A 1KY5A 2XJ4A 1RMYA 2LTAA 4IYRA 4PZPA 3TVTA 3VYSB 4UCXA 1UH5A 1UPXA 3MNFA 5EPEA 1IL0A 1S9HA 3OBIA 3WX0A 1OIXA 3LDFA 4LTMA 5FBWB 4G4GA 1FRZA 5LWHA 1PE0A 1VJGA 2F8LA 4LGCA 1CYEA 2DHRA 1YTUA 3IAFA 4ONEA 3NDRA 5BQFA 2QD1A 3ADOA 1PUXA 3HU1A 4XDGA 4YFYA 4KLAA 2R1TB 4PLFA 2FPUA 1H0HA 2VSOA 4BYMA 4KFCA 5CG1A 1NONA 4M87A 1XZLA 3LQ1A 3AX6A 3SBDA 1OFUA 1JAYA 4AXBA 4UKDA 1NI4B 2NO7A 4R69A 4XB6B 4ZP1A 2OENG 4NAVA 3KTOA 2RGRA 4BBJA 3F67A 1U90A 4MKGA 4AQ7A 4G0WA 1E3JA 4JIMA 3LWDA 1JHOA 2HLDA 2GASA 5ILQA 4FSDA 1ACLA 4D0NA 2MSKA 1RCTE 2NVOA 1PVVA 4JOBA 2R97A 3ICCA 4QGFA 4PTLA 2IF2A 4ZZ2A 1XZBA 2QLFA 1ODKA 3BIFA 4BNLA 5CXUA 2J4FA 5A4JA 3SXPA 3IQWA 2HEIA 1YOBA 5CM2Z 1UBFA 2A9OA 4EHLA 1MDFA 4HXYA 1JA9A 3U2QA 2XXBA 3N8NA 1TEXA 2E4ZA 1D2CA 2IZ7A 2VDLB 4B5LA 1E1RD 1IBLB 3NB0A 2P4HX 4HNRA 4L22A 3F3KA 3HGTA 5BW4A 1ESDA 2JDIA 2KYRA 1QTNA 5FPYA 2GCOB 4MWSA 4HDOB 4RVCA 5J5AA 2Q2OA 2QN3A 2I1WA 1HSOA 1M6WA 2XAUA 1Q2UA 3OIGA 3O7WA 3TTSA 3WSVA 1U9IC 3G0DA 3DZDA 2V98A 3Q98A 2JFFA 4LXTA 5HTKA 2QAGA 3HGQA 2ZRMA 1V7PC 4PC6A 2B99A 1OGYA 2GD0A 1XJCA 3G6KA 1J7KA 2CW5A 3RAGA 4DMLA 1W94A 1EJ0A 1YRLA 1WBJB 1N5OX 3LXXA 4O4LA 4XQEA 1W29A 3VR6H 2FK8A 3CKLA 2AEMA 3Q87B 4MB6A 3K9LA 2D5IA 5CT6A 5IN4A 5HZKA 1P4GA 4RM2A 3RHSA 1R5BA 3ZXUB 1TAGA 2X42A 3W4KA 5G1OA 5KSWB 4LZNA 3W6ZA 5HJ5A 5CM9C 4N0QA 1OXXK 3WGKA 3OCCA 3BHNA 1SMKA 4HO1X 4K03A 4Y2JA 4ZYYA 4C30A 1IM2A 2C9MA 1Z5GA 4KQ1A 4XB2A 4O59O 3KLNA 2OCIA 6NULA 2AUNA 4LVOA 1OE0A 1Q17A 3OIYA 2R4TA 4IBOA 4E4YA 3TQHA 3ELYA 1TIPA 4LYEA 5EUQB 4EHNA 1GPYA 1UK8A 5H81A 3ELDA 2QSYA 3PC4A 2M1ZA 4O0MA 2GLUA 2Z9BA 3L8DA 1EK6A 4KTVE 4HVCA 5HZGA 3VRHA 1D0VA 3ZN2A 5LOVB 1V39A 5BMVA 4A0FA 3OECA 2P3OA 2IS1A 3WI7A 4Z7JA 1WCIB 1ZJZA 1W0KD 3GWGA 1DELA 2EL9A 2ORVA 1HC7A 4CTNA 3FTCA 3GI1A 2AZDA 2EFGA 2GA8A 1SFRA 2JD0A 2O06A 3CW8X 3GGJA 3GRCA 4GOKA 2XMSA 3ETEA 2DETA 5HP4A 3PQDA 1G4HA 2G7MC 1F2UA 3DMRA 2WPDD 3W2HA 4LJ6A 3M1YA 3TJZA 1PI3A 1ZKDA 2TECE 5HG0A 5TQ2B 3FOCA 1P4RA 3THRA 2O48X 3L7MA 5IW8A 4BLUA 4KN5A 4U2KA 4E2XA 1Z47A 4QRIA 3QLVA 4RGVA 1DC6A 1PWHA 1QPBA 2ZJ7A 3LY7A 4G07A 3H17A 3TKAA 3CX4A 2JFBA 1W88B 3DLIA 4JYPA 3P4UA 4I6GA 4X3OA 2BFDA 5GJCA 1XFDA 5EGSA 1YBHA 2QXYA 2YMMA 1G8AA 1UBHS 2ZUCA 4HDRB 3PUVA 1CWUA 4N5HX 4HMPA 4OYHA 3JVEA 2CCJA 2BKVA 3IKVA 3U26A 3LI2A 4U39A 1OJLA 2ZJ0A 3DLAA 5GQSA 4MVYA 4UNSA 1E8DA 1M1XB 2JNWA 1M67A 1B43A 1RTKA 1YB7A 1KFCB 1DPGA 5CBPB 1MTOA 2OD7A 4H4DA 4B46A 4DSTA 2AX4A 2QUBA 1IWPB 2WF5A 3W5VA 5EUCA 2C7QA 2YZMA 5JY6A 5AKGA 1PJQA 3CH4B 4FHCA 1L5HA 1PK8A 4Z1MD 5KOJB 4U3JA 5HILA 4Y9RA 1DX6A 4XH9B 1OI2A 5EPUA 3RFUA 3TLMA 2C0QA 3QKIA 4TM7A 1RCFA 3K35A 1NVTA 2ZR0A 1B0ZA 3RRMA 5JTUA 2FN4A 4BO4A 4U6NA 3GUZA 3P7MA 3TOCA 1HE1C 5HWSA 5LJLA 1Q7RA 3BQ9A 5LB2A 3LK7A 3BD8A 1CUVA 1O2DA 1TFRA 2GCGA 3ASUA 4IIFA 4RW0A 2EBHX 2NZWA 3RS8A 3AVYA 5IZ4A 1RLTA 1EGAA 2XD4A 5FNZA 3T7JA 2GPSA 4LIPD 2LPMA 3WA6A 5JRZA 1A8PA 2VATA 4UEQA 1L5FA 1GG8A 2UVDA 2R6ZA 5EGNA 5EZYF 4HB0A 3KQSA 3E3LA 4M36A 3W5JA 1S8OA 2ZKLA 1Y8CA 3MLAA 5CHEA 5EJEA 5EFZA 2I9KA 4EZEA 5E2IA 5B55A 1GDTA 1OX4A 5A4FS 5H7XA 2Q49A 2H1HA 1BRTA 3EZFA 1U81A 2ZITA 4ZZIA 2LUOA 3CEMA 2XIJA 3CJTA 2ZYHA 2ZUEA 4JKOA 2EJWA 2G1KA 3DMGA 3OIDA 2QX8A 5BSHA 2ZYUX 4OBEA 1JSLA 1PYDA 1ZG3A 2ACKA 4QHSA 4AYXA 3FUWA 1Q0LA 4G26A 3V7YA 3P0FA 1YDEA 1EM8A 3RU2A 3KEQA 2HA6A 1KMCA 4CM9A 4N7RA 4E13A 3FCEA 5KTMA 1SU4A 4L5AA 1A72A 1P1CA 2RIRA 5CVUA 3T41A 1M7BA 2Z56A 4C76A 5CB4F 1JH9A 1IDN1 1ZOPA 1IDOA 2HL6A 2M6KA 1GPUA 1TTPB 3RG8A 5BVHB 4R3NA 1IN5A 2DBRA 2NXCA 5GONA 1OFGA 5F2EA 3RR2A 1HTWA 1SOWA 1NRWA 4U2FA 3SE0A 1SZCA 4B09A 1ABBA 2QG6A 1VHLA 4IDPA 1RJ9A 4N3AA 3R7LA 2C7GA 2RC5A 3H9QA 1Y34E 3IDQA 3KWLA 3ELBA 2OCYC 3EDYA 3CLTD 4JEHA 4R01A 4K1LA 1IULA 4L6IA 5B30A 3GUVA 5EE0A 3PTLA 2RKBA 1P29A 5BPHA 1DKLA 4J29A 3X2SA 2NWQA 4RF2A 3E4CA 4LRYA 2GARA 3UUWA 1EG2A 1FQJA 4Y1GA 3BBPA 3ZU5A 5EYPA 1V8BA 2YL2A 5TGTA 4BX8A 1ZW6A 2Q3BA 2CV1A 4G8DA 4HI0E 4CN9A 1TDJA 2YXDA 2OXEA 4RZXA 4JT4A 3WJ2A 4NPCA 1O89A 2ZIAA 3HU5A 3LC7O 1A7UA 4MVJP 2CK3A 4V38A 2V55B 2QAJA 4CQJA 4EHFA 3R3HA 1YB2A 1ZR2A 2ZFUA 3KBOA 3LP6A 1YJAA 2CMFA 5DTIA 5CD1A 4ND2A 1N6OA 5SV2A 1JLLB 1PVDA 4PYJA 3S1AA 1Q50A 4R1SA 1YAJA 2CKMA 3DSRA 5IF3A 4UVGA 2CUZA 2AGVA 3L41A 3LBFA 3N2KA 4KXWA 5GJWC 3R3UA 1GNLA 5CH8A 2B3DA 2VJQA 2YRXA 1ZCZA 3S8MA 4HG2A 4MR9B 4PLPA 2SKDA 1G21B 4RLQA 5CP8A 2WD9A 1GZUA 1I2MA 3MYRA 1KYWA 1YVEI 2PXXA 4BO2A 2PUHA 3NKLA 4QYWA 3PC6A 5EZYB 4B9EA 2IQ5A 3L6CA 3V9AA 4DJFC 3WRYC 1KNQA 4R1LA 1MN6A 1OBHA 2HFKA 2QRJA 3FX2A 5REQA 4MHTA 1GAQA 2A8YA 3H6KA 3FYTA 5LBIA 3QSGA 4HV4A 1JIIA 1NA5A 4UD6A 2AB0A 1JQ5A 2D5LA 2ERYA 3D3WA 3PNVA 5TARA 4BMNA 3DOOA 3Q3HA 1LEHA 1I6WA 4E88A 4WFKA 2DECA 2UUOA 5CW1A 3IE2A 4OBWA 4DV0B 4PHTA 5L8VA 4ZOLA 2AVDA 2GTPA 3PNYA 4D82A 1DDOA 4FD2A 1SZJG 4KI0A 1XVLA 4N0DA 4PINA 1V41E 5ETJA 1DTSA 5K6TA 4BWFB 4DWJA 2O3UA 4JOCA 4YPFA 3DL4A 4G8JA 4MX8A 2NZJA 3EGDA 1B0AA 1XZQA 1IHOA 3BQMB 1DQPA 1J5EB 4NDAA 1J6UA 1G55A 1PJ8A 4FE3A 1Y5MA 4TS4A 4HWOA 3CZAA 2TMGA 1T8PA 3GU3A 1CIVA 2JA2A 3SSNA 2JBHA 3FSGD 5BT8A 2BM1A 4GT1A 1ORHA 1VCIA 4Q6WA 4TZKA 2MR6A 1OASA 1SCQA 5H82A 4YIHA 1Z35A 3TBKA 4XUCA 3I4LA 5A6SA 1HMYA 4IXDA 3C7CB 3M5DA 4UE2A 2EXXA 1TA9A 4IDOA 2HJVA 5U4QA 3RS4A 1T6YA 5DIFA 3RGGA 5JNWA 1Q7EA 1TT5A 2HIHA 4XWKA 4QREA 3HS3A 3PC8A 4OHFA 4DILA 5C4GB 5DM1A 4XYLA 2I67A 1UWCA 1DIOB 3LVBA 1ARZA 4A10A 3SLKA 5K3OA 2HYIC 5G4KB 3D3WB 4HUJA 3QI7A 3VR6A 4TVSA 2LGJA 1Q1QA 2VJDA 2PS0A 4LC9A 1KJ8A 5DBOA 2WNSA 4QASA 1UIMA 1OILA 4BGIA 1XOIA 1RWBA 3NTXA 4BN4A 1LV8A 1LGYA 2BC9A 3IIJA 1Z2PX 2C95A 1Z22A 2OBBA 2XQVA 3FDIA 2QD4A 1X6VA 2CBGA 1Z4OA 2WE8A 3WS7A 3R6WA 3Q4GA 1PYGA 3TQQA 1T0HB 4I9UA 1A1SA 1Z37A 4EECA 4QXQA 4M3NA 5ALOA 3K31A 3MILA 2FFHA 3SF8A 2MU1A 4FMDF 2I29A 4TV8B 5AI9A 3NXKA 2ZSIA 3IAEA 3BMOA 4JENA 3M6WA 4KWIA 4P4SA 5KWIA 3DFMA 1TE2A 3DYVA 3KSRA 4N0MA 4ZAYA 3TLJA 3PHGA 1JQBA 3KPVA 2G83A 2KBFA 4Q4AB 3GLRA 2O8FB 2CN1A 1YJXA 4X3CA 3H5LA 1NV8A 2I4OA 3D6VA 4P34A 2ZRFA 1Z39A 4NECA 3ZCXA 1L2TA 2O4CA 3AM5A 3A1UA 5T64A 4IIJA 1YS2X 5I47A 5DGCA 4ARCA 2A0KA 2GRUA 2SICE 3MWKA 3TZ6A 3RAEC 5HRCA 3S2IA 1BWRA 4H1HA 4TWAA 1GN9A 3E61A 4QOIA 1ZH0A 2H54A 3EC1A 4REMA 4CDNA 4F1WA 4YQFA 4WKBA 2Z30A 5KCMA 2IYVA 5FTLA 2JJ8A 3C3EA 3K96A 1JW9B 4B3MB 1AKRA 4TVOA 4K81B 3QUSA 1RRVA 3K2EA 2CDNA 1JXMA 3K8YA 3MS2A 4D3YA 3U7EB 1YZFA 1T2EA 1XROA 3ZLTA 3U1BA 5B4TA 2VP3A 5AW5A 4OAQA 3ZHSA 1DIBA 4NFHA 1T36A 2FXVA 1ZL2A 2FSVA 1D7AA 1NBME 3FUCA 1NXVA 3OX3A 1E2MA 2ODTX 4NONA 1I4TD 4RZQA 1T25A 3W06A 3VVMA 3ZD8A 3NC0C 1V5WA 4CLRA 1IQUA 2P2LA 3D4PA 3CISA 4PZ0A 1M2VA 1H2AS 4CLOB 3VDNB 4GHWA 3F96A 3SEFA 3DD1A 4BV3A 1THZA 1SVSA 3DV2A 4LFBB 2X0FA 1JQEA 4PANA 3OIFA 4G85A 5C1OA 3DDSA 2QU7A 3KKMA 2P68A 2QEQA 1T0PA 4M9SA 3UKDA 2PRIA 4D1YA 1JJIA 3LC2O 4UE3S 1QHGA 3IXMA 2O8BB 4BV2A 2CMKA 1CTQA 1DBQA 2BTQA 3IMKA 1SRRA 2VPPA 4G23A 2JIMA 1NBWB 5FB3A 1UDBA 5A3QA 1Y9JA 4F60A 5BN5A 5ALVA 4F45A 1Z5WA 2CY0A 3EGXA 2A0YA 3NC4A 1J00A 3ONWA 4GICA 1RM0A 3JQ9A 1CS4C 4GLBA 4RF5A 3HN7A 1OJ7A 1PK7A 2ANBA 4KVAA 4MYCA 2BFWA 3UJCA 3BUSA 2NO4A 2CVQA 1QYVA 2W2KA 2WSYB 3A3YA 2Q5OA 1W5EA 2X4DA 1O77A 3DCIA 4RVFA 5EUBA 2IXDA 3I9FA 2VHWA 1U0HC 5HDQA 4P5EA 1QP7A 1T3ZA 3FFAA 1P7CA 3C43A 2QG9A 3LHKA 5YASA 3F8WA 5CGQB 3OLXA 3GJQA 3TFWA 1I7QB 1EFPA 3G8AA 5DCLA 2EKZA 4QEKA 2BN4A 2EC5A 1WPGA 2PKXA 3KQLA 2PZBA 2YXEA 4NU8X 1Z07A 4F5ZA 1V3TA 1SZPA 1GA4A 4BGVA 4BEBA 1B26A 1WW3A 3E7FA 3O4IA 5FI3A 2AD5A 2HCRA 5G2OA 4X8OA 3RUEA 5CAEA 3ZUGA 3HLYA 4FEAA 4GDMA 3ILXA 4LYDA 3C24A 1POWA 3REFA 621PA 4O3MA 3UH1A 3RC7A 1Y9ZA 1BNCA 1FFXB 3ZGYA 4DV2B 2M2IA 3DEKA 4U3JB 3ZK7A 4HYQA 2CXSA 1AB6A 5DRTA 2FDCA 1ORIA 3FMVA 3PEEA 2G1PA 1CP2A 1RADA 3KU4A 4MI9A 3K9NA 3SYLA 3IPRA 4UHDA 2GBCA 1K7YA 421PA 4MUMA 4FZVA 1G64A 4JP3A 2AMJA 2Z2KA 3WYNA 3PEWA 1ATZA 1XTPA 1RPZA 1Q1BA 4F2GA 3ZV3A 5JOQA 1OLSA 2HBZA 1NW5A 4E1VA 5IT5A 1W2GA 3U7RA 4ENSA 3URMA 4ZQGA 1QVWA 1UQTA 4MTLA 4PQGA 3H1BA 3LIPA 2EJVA 4WASA 4V39A 1TW3A 1FNDA 3IMCA 1W30A 3F3YA 4H7KA 5IH3A 4O3FA 3UA3A 1DLJA 2R96A 4TYWA 2M6SA 4JJIA 2PA3A 3CX6A 3IUMA 3NHJA 2OLJA 4KR0A 3GXBA 1U7HA 2XYPA 2PPLA 1OROA 4P53A 3S2SA 4B0OA 3T1HB 1CDDA 2Q6TA 3FOBA 3BH0A 1TQ8A 3G9QA 3FTDA 1EFDN 2V7VA 4BE4A 1VPLA 3FNGA 1BVHA 1PZEA 3LPAA 4IXMA 2RCYA 3OP1A 4JJ6A 1W5FA 1N2OA 1MF7A 2EFJA 2WUGA 4JL5A 3L1KA 2UYOA 3USZA 4MSUA 1I32A 2PX5A 5DNEA 5JDIC 1PJLA 3EOZA 3GD7A 3MTJA 5DX1A 5TQ0B 3WKDA 5HDBB 5KNCA 1BU8A 1FB5A 1I6KA 1K97A 1XZGA 3NTUA 4MS4B 4TTQA 4KQ6A 1N8TA 4RPJA 4C4AA 3I8SA 4OGFA 2R6JA 2I7TA 5FBZA 2QZ4A 3C3BA 5M7EA 3LF2A 3K0CC 1KFBB 1SVWA 3K9QO 2FSPA 3B3AA 5H9VA 3WNVA 1QU2A 4PVDA 2Q1WA 4W6QA 3U4QA 1TVEA 2BZ0A 2LKDA 3KOOA 3PVSA 4BNZA 4JEIA 5H1YA 4BJ1A 2PFGA 2ODBA 4IIDA 3ZXIA 1HZJA 2HJSA 2XNCA 4D0RA 1FVFA 4NDNE 5CYOA 2Z1DA 3B13B 4RTSA 3WZLA 2Q5IA 1OT5A 3UPTA 2YX1A 2PYZA 3C0KA 4OHYA 2RBGA 1DG3A 4HS9A 3CIOA 2GM5A 3AIIA 3PFBA 2F4NA 4IGKA 8ATCA 3DGFC 5H8WA 2NNLD 4LY9A 3WQHA 1GDDA 1NVWQ 3ETLA 1NX9A 1Z45A 1RI2A 2IYUA 5AM1A 2YYYA 1M6VA 3LBIA 5ITSA 3A2LA 1LKZA 1F2TB 1R27A 4TRRA 1E5QA 4OQNA 3RNLA 5FH9A 4V02A 2WUFA 2YWRA 5BSEA 1HDYA 1UKAA 3J7TA 3LT2A 4P32A 4WKCA 4ZU6X 3A27A 4EITA 3TVDA 3D31A 1WX1A 3PXUA 1MPXA 1NV9A 1V95A 2XCQA 3JW8A 4MQ5A 3R8XA 2XDWA 1QQ6A 3LYUA 4H6XA 4ZXFA 3WBJA 2IK8A 1RWOA 2VNIA 2ZIUB 3W6PA 2WT9A 4ARZA 3K4HA 3DP7A 1J49A 1Z68A 3K72B 3NHWA 3MGAA 3PT5A 4BMDA 1M10A 1JJAA 4RKRA 2DTEA 2AG8A 2B7CA 4HBZA 2OA0A 1CRZA 4Z1OA 4GI3A 3NV9A 1N8SA 3RTAA 2HCBA 3KOYA 3DMNA 3I1JA 1U7OA 3TNYA 5EJ5A 3UK6A 2JLVA 4EJSC 2Q0XA 5JZVA 1OTXA 1XZJA 3K09C 3HQ4O 5G41A 3RD5A 4YS6A 3WWOA 1QQ7A 4R0NA 4DBLC 4DLAA 5DULA 3AR2A 2ZZKA 5A04A 3J80A 3U7QA 1ESMA 2ZXEA 2QR3A 4H7IA 1A4UA 1NQ5A 5E8RA 1UBNA 5FA6A 4FP9A 3T34A 2VJCA 5LIPA 5JS8A 2RGAA 1XHFA 5A5VA 2OXFA 1OAOA 2L18A 4GOXA 2GBIA 3EARA 3OEED 3ZLUA 1E9AA 3O3MB 4OK6A 1XX6A 4CKYA 4D42A 2PX0A 3AV0B 1JMKC 3L4BA 2VG8A 2AUMA 1RLOA 1RLUA 2O0LA 2O8CA 1DKUA 5AHOA 2C7RA 3OE4A 4JODA 1RJGA 1UMBA 2IODA 1KSGA 3E7XA 1VKOA 5JAUA 3E3OA 2IY8A 1E69A 3TSOA 4K3UA 4JR1A 3FB1A 1B73A 4WOJA 4MPJA 3L2OB 4ODIA 4M4SA 3BXPA 2Q9UA 3IXLA 3IUEA 4D92A 2WWHA 4N8DA 3SYRA 5TS2A 5F7OA 5K20A 4HDKB 4BVEA 1D6MA 2WILA 4OA8A 4RGYA 2HK9A 2C61A 4KJZA 4XR9A 3L05A 2C1XA 5ALEA 1IIRA 1TADA 3I5YA 4FZ5A 1I5RA 5HR5A 4DR3B 1SXJB 2HJWA 4PYLA 1BHSA 3RU3A 3U56A 2EG5A 2QN6A 4LPSA 4Y6GB 4A1FA 1NVFA 2NU6B 3UWPA 4GQBA 4YAGA 1GQSA 2YKGA 1PFGA 4R9NA 3C16C 1O4WA 1JBEA 1MW9X 1NVXQ 2Y2UA 3QEJA 4J0CA 4KPUB 3V3KA 1IJFA 1LBIA 1MX3A 1SKAA 2QSUA 3HDJA 3NX4A 3P9ZA 4IEIA 4ZAFA 5KDLA 4C0AC 2WIDA 2I6QA 3CH7A 2ZUDA 4QVKA 1U3TA 3JYNA 4WNIA 3O4RA 2J0VA 4PPYA 5F33A 2WTNA 3CMMA 5ECDA 2BCEA 3G88A 3MYYA 4PPQA 5FAXA 2HHCA 4M22A 2F62A 1H66A 4IVRA 3ZVLA 4M1SA 2MTBA 5EJ2A 1X8KA 1ZMRA 1YL5A 5AKHA 3COVA 3O0TA 1GOTA 1UM9A 3P45A 1R4AA 3L82B 3OUTA 4Q05A 1GT91 1MB4A 2A7XA 2ACWA 3B53X 1M73E 3DHNA 1EWKA 2C4UA 2ES4A 3HWRA 4AJ9A 1PYOA 4OFBA 4YQZA 2NUTA 2ZWOA 4DTCA 5E6SB 3WFJA 3LKBA 4I8DA 1TZ2A 4K6KA 2AOXA 1ZD9A 4DDVA 2VF2A 4UTNA 4LMPA 4WT7A 1SIBE 2H1WA 4MCIA 5KJ1A 4AULA 3VKHA 1FU8A 4O33A 3O6VA 4W9NC 3HUDA 3I2IA 3M1AA 2O3QA 3LPNA 3QVLA 2VAVA 1T1SA 4FK8A 2C84A 2F3PA 2VLBA 1B00A 2X9VA 4I5EA 2AXQA 1A71A 1JP7A 1I6MA 3QMWA 1IFXA