4J0KA

Tannin acyl hydrolase in complex with ethyl gallate
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
470
structure length
454
Chain Sequence
SMSNRLIFDADWLVPEQVQVAGQAIQYYAARNIQYVQHPVAAIQVLNVFVPAAYLHGSSVNGYQRATAPILMPNTVGGYLPGPADDPQRVTWPTNAGTIQQALKRGYVVVAAGIRGRTTVDKSGQRVGQAPAFIVDMKAAIRYVKYNQGRLPGDANRIITNGTSAGGATSALAGASGNSAYFEPALTALGAAPATDDIFAVSAYCPIHNLEHADMAYEWQFNGINDWHRFEPVSGQLTVEEQALSLALKAQFSTYLNQLKLTASDGTHLTLNEAGMGSFRDVVRQLLISSAQTAFDQGTDIHKYAGFVVTGNQVTDLDLSAYLKSLTRMKAVPAFDQLDLTSPENNLFGDATAKAKHFTALAQTRSTVTAQLADAELIQAINPLSYLTSSQVAKHWRIRHGAADRDTSFAIPIILAIMLENHGYGIDFALPWDIPHSGDYDLGDLFSWIDGLCQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Tannase
publication title Crystal structure of tannase from Lactobacillus plantarum
pubmed doi rcsb
source organism Lactobacillus plantarum
total genus 159
structure length 454
sequence length 470
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4j0kA00
1R50A 4CIAA 3PDCA 1RYYA 4PSUA 5FXMA 2WHQA 4H0CA 4YX9A 3SWWA 5C8VA 4K2AA 4MXDA 2QM0A 3FYUB 4EY6A 3E4DA 4MEBA 3RLIA 3VXKA 2XUKA 1VZ2A 5AM0A 3QMWA 4OSEA 4K5QA 1CUAA 2WKWA 2DSNA 1BEEA 1EVQA 3G8YA 5HFNA 2OCIA 3DS8A 3RM3A 1LNSA 4KE6A 4BRZA 4U2BA 3G9ZA 3WK5A 1X70A 4ROTA 4PV7A 4BZWA 3H2IA 4BE9A 4HRXA 1BCRA 1WHSA 2GBGA 3H0CA 4QNNA 2DHCA 1BRTA 4I19A 3WA7A 4L3WA 2I03A 3MUNA 7YASA 3HXKA 4N8SA 1BEZA 3DCNA 4LKOA 4NMWA 3F67A 2XUJA 5DYWA 4C89A 3WL5A 1R3DA 2PM8A 1XRRA 4B9EA 3N2ZB 4AXBA 3KOOA 3AIKA 3DYIA 2JGEA 5ALKA 5IVKA 1IUOA 3FCXA 4BRSA 4LXHA 3WZMA 1JU4A 3WKDA 5KBYA 1CUJA 3V48A 2XLBA 2VAVA 3B12A 3G0IA 3WWOA 2XQKA 1J2EA 4RE6A 2Y1KA 3DDUA 4KR0A 5CH5A 4X97A 2DHEA 4DLNA 5JYCA 2C7BA 3F98A 3Q0TA 3V1LA 4DIUA 1F0PA 1IUPA 2AJCA 2DFPA 3GFFA 3CCCA 1VZ3A 4IO0A 4HTAA 3YASA 5LZ8A 1DWPA 4FBLA 1GT6A 3RARA 1LPPA 1BE0A 2ZJ6A 5FKJA 4DMHA 2VT6A 2GBFA 1C4XA 3WWCA 2HFKA 1LZLA 3O9MA 4P92A 1F6WA 3D5EA 5A6VA 2PU5A 2FUKA 2JGIA 1N5MA 2DR0A 5AM1A 1CLEA 2GYUA 4MWTA 2HA4A 1QIEA 3LP5A 3D3NA 3T4UA 1W76A 1RP1A 4LYEA 2VJAA 2QUAA 1Q83A 1LGYA 1VXRA 4C6HA 5AIBA 1UOPA 4XWGA 3R0VA 3QYJA 5DYTA 3HI4A 4WY8A 1WM1A 5JATA 4G5XA 4U2DA 5LLSA 3QMVA 5A7GA 5JANA 2H7XA 3O4IA 2OCGA 1XRPA 1XFDA 1UKAA 4FWBA 5ALOA 6YASA 4BDTA 3WK7A 1AX9A 3WQHA 2W22A 3IB3A 1XRNA 4GDMA 3AUKA 2VTVA 4J03A 3C5VA 4KRYA 4X92A 1CR6A 2WM2A 4GBGA 1ODTC 1DU4A 2HL6A 4FKBA 5ALSA 4L0CA 1XZDA 1ORVA 5FOQA 4B9AA 4I4CA 2OXEA 1U8EA 4OB7A 1J1IA 2K2QB 2XMDA 5AKJA 1C7IA 2XUIA 4HXEB 4WDQA 2YYSA 2HADA 3O4JA 2I78A 3O95A 2BFNA 1O6FA 4B84A 3W05A 1XQVA 3AILA 4Y2SA 3FYUC 1E8DA 5JZBA 1MX1A 3W04A 1GGVA 2V98A 5AJHA 5CT4A 2JEZA 2WUDA 5T4FA 4JH0A 1A7UA 1IVYA 1XZBA 3NOXA 4FNMA 5AM4A 3WZLA 3PF8A 5C81A 3F9CA 4Q3OA 4H18A 4QWMA 4QDTA 4EY7A 2YH2A 3FSGD 2G5TA 1HL7A 2V9ZA 1ZIXA 5DWDA 3S8YA 1WCYA 4QLOA 3C6BA 2VA9A 1W75A 4Q82A 1H23A 4PSDA 1XRLA 4H7JA 3MVEA 4CIBA 3T52A 3TJMA 3IDAA 2DCMA 5A71A 1GQSA 2QS9A 1Q0ZA 4UBKA 2XMRA 2QVBA 3K6KA 2HHAA 5IKXA 4U2GA 2ZJ7A 1AZWA 1WPXA 4X3CA 2Y6UA 2C58A 1MN6A 5JAUA 4L9AA 4WCVA 2DHDA 4OCZA 1ODCA 4BCCA 4OB6A 1IZ7A 3O9VA 2WUEA 3LLCA 4YASA 3I1YA 2BAGA 2WSLA 5ALGA 1MPXA 1LPOA 5T4EA 1XZEA 1P0PA 4QA9A 5DYYA 4XJVA 2XUFA 1A8UA 5AKXA 5LZ9A 4EY4A 2OAGA 4CCYA 3R3UA 4MQLA 4AO6A 4C4ZA 4Y2JA 4IH4A 1XKLA 3VDXA 3WKBA 5AM2A 1TRHA 1UFOA 5JADA 2HU7A 2G5PA 3IULA 5DJ5A 2XUHA 1DT5A 5JIBA 1J06A 5K3EA 5HQ3B 4W9RA 1HBJA 1QGED 1P0IA 3I28A 1QLWA 3CCBA 1GKLA 1E5TA 1EVEA 1CUWA 1BS9A 1T4MA 4G8BA 2J4FA 3FBWA 4BTVA 5AM5A 2Y6VA 1H2ZA 3HLKA 1Q84A 1CPYA 1L7RA 3DL4A 1JU3A 5EHXA 1CFJA 3R3YA 2BUAA 2PUJA 2WHPA 2OG1A 1CUUA 4EB0A 3AINA 4F5ZA 1QONA 3FAKA 1XLWA 5AH0A 1OCEA 4OUKX 4INZA 5E4TA 4OU5A 5AI0A 1LLFA 1U4NA 1BN7A 1VXOA 2PSHA 5ALPA 2ZSIA 4L72A 4QEKA 4CCWA 4K6GA 2HIHA 3G0CA 2G63A 4QDZA 1QFMA 2XLCA 2GZRA 3WKCA 1DTEA 1ACLA 2AJDA 1Q0RA 4C01A 3PFCA 3STUA 5DTJA 2WLSA 1CVLA 1O6GA 3CN7A 2GZSA 3LCRA 3A2NA 2RGUA 4IH1A 1QIGA 3R40A 3QVMA 2I3DA 3OURA 3E0XA 2XE4A 4X93A 3STVA 1X2BA 3GROA 1ZJ4A 3DOIA 4BC1A 5JZ9A 4DM7A 3MUOA 5FPPA 1FFAA 1YS2X 4FNGA 2JIDA 3G0GA 1CUGA 3I2KA 3FLEA 3VJMA 1L7QA 4AX4A 2WFLA 1LPMA 2VT7A 4KE9A 1CUCA 2CJPA 3L1IA 3L1HA 4ARBA 1GPKA 3HYSA 2O7VA 4UFOA 5AM3A 5ALHA 3BL8A 1BROA 2D5LA 3WJ1A 4DYHA 4PSCA 4B0OA 3FCYA 2PL5A 3QH4A 4AN1A 5ISMA 3H17A 2HA6A 1H2YA 2BUCA 1XLUA 2PPLA 3FLBA 2WIGA 5K3DA 4C88A 1ZD2P 1CUVA 2GYVA 2Z8XA 2VJDA 1EDEA 1Z68A 1FJ2A 1H2XA 4E46A 3H2KA 1Y7HA 5EFZA 4BVKA 5K3FA 5CBKA 5CT5A 1UOQA 4Y7DA 2QOEA 4B85A 1FFCA 3QPDA 3QM1A 1IUNA 1QIKA 2WU4A 2HDWA 4X7BA 5ESRA 2XMSA 4HRYA 3EQ8A 4N5IX 4ZWNA 2HRRA 1N5RA 1JJIA 1VOTA 5T4BA 3AJAA 4D9JA 1JJFA 5HF9A 3KD2A 1YA4A 4BE4A 1A8SA 1DX6A 2G4LA 2J4CA 2Q0XA 5JAHA 4H7KA 1J07A 2BGNA 1VA5A 1UKBA 1QIDA 4B0PA 4E15A 3IUMA 4OPMA 4WFIA 2WFZA 4EA6A 1X2EA 4WDRA 3S2ZA 5HKBA 4XX1A 3HABA 1TAHA 3HZOA 1MAAA 3QITA 1YAJA 2O2HA 2GBCA 3D4LA 2QJWA 1TIBA 1TQHA 3DKRA 2PX6A 3N0TA 4DGQA 3F97A 4H7HA 3ZLTA 2C0PA 2O7RA 5FUMA 1ZGCA 1B41A 4RE5A 3H1AA 4G4JA 5ALNA 1YSCA 3WMRA 5ALQA 5EHZA 5BWCA 2V97A 3FYUA 1G66A 1JMYA 5D3KA 1VJ5A 4Y2PA 4AZ3A 4XVCA 4J0GA 1K63A 2O2GA 2CUTA 2VF2A 3EIOA 2C0QA 5ALJA 1CUYA 2XMQA 4BDSA 2RONA 1K6EA 4X71A 4ZRDA 3BF8A 2R8BA 5IVHA 4G8CA 5D3ZA 2OAEA 5KREA 2JF0A 3D0KA 3H2HA 4FFVA 3QPAA 5FV4A 1AGYA 5AI8A 2WG0A 1EDBA 3QZUA 2BKLA 5K5EA 1XZFA 2C4HA 1UXOA 2P8SA 2XUPA 2CZQA 1AKNA 4MQMA 5AI6A 1ZD5A 3G7NA 4M0EA 2WG2A 3WK9A 5LZ2A 1QO7A 3IVMA 4EY8A 1UKCA 2H7YA 3M83A 1R4ZA 4EZIA 2B4KA 2J3QA 1VKHA 4X94A 3I2FA 1R9NA 2IX9A 4G4GA 2XUQA 5A7FA 4LXIA 4OB8A 2VAXA 2HA3A 2JBWA 2YASA 2JGLA 5C7YA 4UBOA 4HXFB 1CQZA 5C8XA 3OPMA 4EBBA 1XZHA 1E8NA 1KU6A 1ZD3A 4AZ0A 1QTIA 2AJBA 4ZXFA 3C8DA 5LZ5A 1DWOA 4Q3KA 1JMKC 3ED1A 2WIDA 3E1GA 2HU8A 4J3JA 4QZVA 5EIEA 4Y2RA 2XQIA 1YB7A 2QRUA 3DQZA 1ZI8A 5ALWA 4DNOA 1DT3A 1P0MA 4G9GA 4Q3LA 4J0HA 3DOHA 3OM8A 4BAZA 2PUHA 5AKHA 4CFSA 2C5GA 3WL7A 5K3CA 1CUEA 3FYTA 5AO9A 3H18A 4WFKA 3OC0A 1NU8A 3NUZA 3DKKA 4UBLA 4AO7A 4JYPA 1N8SA 3ZI7A 1BN6A 4N8EA 1ZI6A 5T4HA 4Y2QA 4N5HX 3WK6A 4GW3A 3QPCA 4EY5A 1EB9A 1XZAA 4IHAA 3D7RA 3UUEA 3PE6A 5LYYA 5HZGA 3K2IA 5F4ZA 1ZI9A 2CB9A 5EGNA 2ZYRA 4DSAA 4F60A 3A2LA 3RKSA 1CV2A 4UHDA 5K3AA 5CXXA 4B81A 3R3WA 5E2IA 4AB1A 4UUQA 4B83A 3Q8WA 2J3DA 3O4HA 5AKEA 3W06A 3I2GA 1D07A 2WG1A 4QWWA 3ZWQA 5EIAA 1JJBA 4J0IA 3WJ2A 4TPKA 3KWFA 1LBTA 3BDVA 3DLTA 2ONCA 5CURA 4EHBA 5JAPA 5EIHA 5HFAA 3BWXA 1SCQA 1UK9A 4GHWA 5HK9A 1W6RA 2QJRA 4ZV7A 2H9YA 2WTMA 2QMQA 4F0JA 3QMMA 3ZV7A 4MYSA 3BXPA 4MJ3A 1IZ8A 5FP0A 5A7HA 3OOSA 3ESCA 3WIBA 3AZOA 3FNBA 2ECFA 3TEJA 3SK0A 4Q1VA 5FRDA 2WHRA 4CG1A 1QJ4A 5AK6A 3C6XA 5ALRA 1SFRA 2XQFA 5E4YA 1WOMA 3HEAA 3V1MA 5AKGA 3MGAA 2JGJA 5HF8A 4QDUA 2OQIA 5CW2A 4F21A 2PVSA 1EINA 4NVRA 3I2IA 1OILA 4B80A 3PI6A 1CUHA 1RWQA 2VSQA 3OTQA 2I3ZA 1USWA 1FFEA 4W1RA 5CMLA 1PJAA 4UBNA 3D59A 2ES4A 2VQ6A 4B6GA 3LIPA 2XQJA 4BBZA 4FHZA 4DNFA 5ALDA 4U2FA 1EHYA 3EF3A 4DMKA 1UOOA 3NWOA 3M3DA 3HSSA 2PSEA 5ALUA 4UHBA 2R11A 1UK7A 2BJHA 4V2IA 2Z5GA 5AK4A 3E3AA 4K6KA 2ROQA 2ZSHA 2PBLA 2HA0A 3PICA 3STYA 1IMJA 1MX9A 1LZKA 1GZ7A 4BATA 4FBMA 1QIMA 1PFQA 3G0DA 2ZVDA 1EH5A 4Y9SA 2V96A 2H7CA 5HQ3A 1XQXA 1ZOIA 5ALFA 4AN0A 4GLBA 5JZSA 2QUBA 2PSDA 3EQ7A 2WJ6A 1AQLA 4JNCA 3VVLA 4BC0A 2QTBA 4LIPD 5AIAA 3FLAA 3BJMA 1LPNA 1WB5A 1K4YA 4UFNA 4FMPA 3I6MA 2B20A 4PQEA 3ZLUA 2X5XA 3D2AA 1YS1X 3PF9A 4GEGA 2JGKA 3C45A 5AOBA 4J0JA 3C5WP 4K6HA 3GUUA 2OPHA 4C87A 1MU0A 1UWCA 1YR2A 4HZGA 1YA8A 1MAHA 3HC7A 2WU3A 5IVDA 2OCLA 2VATA 2FJPA 2B9VA 1QIHA 5A2GA 3D2CA 1XZIA 4X91A 5FDFA 5LIPA 3PFBA 4Q05A 4BCBA 2ACKA 3AIMA 4UPDA 5LKAA 3R3VA 1MNQA 3BE8A 5LKRA 2XDWA 2XUOA 1GXSA 4BVLA 5JARA 3BDIA 3OG9A 4BP8A 3SX4A 1M33A 3VVMA 1ACJA 4DTCA 1UK6A 2Z3WA 1CUXA 3WL8A 1AC5A 2HM7A 3AZPA 5D6OA 4X00A 3ANSA 4UHFA 3W2TA 4OD0A 4FLFA 2XMGA 1HPLA 3G9XA 1DQYA 3VKFA 4X6UA 3DEAA 4M0MA 1BCSA 1E66A 2GYWA 5I8PA 1QE3A 3VISA 5CRIA 5I7UA 1UT6A 4HS9A 4U2CA 5ALTA 2WFMA 3UMJA 2CBGA 2H1IA 3G0BA 1CUDA 1MTZA 4LXGA 2C5FA 5DLPA 2VJBA 2HA5A 4ETWA 1ETHA 3GELA 2IIVA 4Q34A 5AOAA 2CEKA 4OYLA 1CUIA 5JALA 3ESAA 4E14A 3PUHA 3JWEA 4DMFA 1OXMA 3C6ZA 4PW0A 2QR5A 2DQYA 2XMBA 5ALZA 1R88A 4I3FA 5CH3A 2DQZA 3U1TA 1K5PA 1KEZA 3LIIA 3BJRA 3K9BA 2RI6A 3ZLVA 2XMZA 3O4GA 3ESBA 1LPAB 4AQDA 1CUSA 3V1KA 2EEPA 1SOMA 2BUBA 4AMZA 2ACEA 2JEYA 2QXTA 3WWDA 3AFIA 1R1DA 4ZGBA 1E3QA 2RHWA 3C70A 4Y2YA 3I2HA 3A6ZA 1GPNA 4TVKA 1ZICA 5AKKA 5JD5A 1XQWA 3VJKA 2X76A 2PSJA 4WJLA 4Y2TA 2VEOA 2XT0A 4PNZA 4FLEA 5AHXA 1R9MA 1XZCA 4Y2UA 3IIIA 1ODSA 3EBLA 1SC9A 1HKHA 2WQZA 4U2EA 3FVTA 4ZREA 3WA6A 3I6ZA 1QIIA 1JI3A 5AI9A 1KU0A 5A62A 2E3JA 3BF7A 3C43A 1EK1A 2X8BA 1QO9A 3KWJA 4FDMA 4J0KA 3WKAA 1XZJA 5J3JA 4MWSA 1EDDA 1L7AA 3ESDA 3IURA 4ZI5A 2OGZA 4FLMA 5ALXA 3R3ZA 2JGFA 5BOVA 2AJ8A 4MYDA 4BYMA 5AICA 5ALMA 4A5SA 2XUDA 2XQGA 1MJ5A 4P08A 1E89A 4G4IA 3ICVA 5DNVA 2FJ0A 3IUQA 5ALVA 1MO2A 3WIOA 3I6YA 4IH9A 3TGLA 4OYYA 3VJLA 4UBIA 5AKYA 3V1NA 4AO8A 1YB6A 3DL7A 1C7JA 1B6GA 1YASA 4O08A 1CUZA 2WIJA 3W9UA 4P93A 3EQ9A 4M0FA 3C6YA 1TCCA 3IUNA 3WLAA 5CXUA 4CG3A 2AXEA 4C4XA 4GECA 3FOBA 3M82A 4Y2XA 1XROA 5EI5A 3DD5A 2XUAA 3P2MA 1AUOA 5LZ4A 1PV1A 1XZMA 2EDCA 5CH8A 3RK4A 4ARAA 1H22A 2HFJA 1CUFA 1F0NA 1EI9A 1LPBB 5AKIA 5C8ZA 1CIJA 1ISPA 4ITVA 3H2JA 2EDAA 5LP1A 4W63A 4GXNA 3FVRA 5JD6A 3BIXA 1DX4A 2XMCA 2HRQA 1GPLA 1XKTA 2WIFA 2HU5A 2ZYHA 4Y2VA 3G02A 4UHEA 1JFRA 1WB6A 1XRQA 3IUJA 2RIPA 3D2BA 4QE3A 5CT8A 3GBSA 4H35A 4HVTA 5HF5A 4H7DA 1CUBA 3STWA 2Y2UA 2HA7A 1XZLA 3IBTA 1QIJA 3KXPA 4UBJA 1UZAA 3AIOA 1YCDA 1S8OA 2WTNA 4YPVA 2HA2A 3WL6A 2PKYX 2GBIA 3G9UA 4P9NA 3KDAA 2CMFA 1MT3A 5HF6A 3HRHA 5AP9A 4X90A 1EB8A 4DMCA 5ALYA 5ALLA 4W1QA 2W6CX 1VE6A 3CXUA 3JYHA 2ZJFA 5SYMA 1EXWA 1XQYA 2WIKA 5AKZA 3L1JA 4N8DA 4HXGA 1THTA 3FSGA 5AK3A 2NW6A 2LIPA 1VA4A 2WUGA 3X3HA 3WKEA 4KACA 5IH7A 1Y7IA 3FWHA 5DTIA 3ILSA 4E11A 3GZJA 4AMYA 3ZPXA 3O0DA 4W1SA 3V9AA 1W4LA 1DWQA 1WPRA 2O2IA 2WJ4A 3NGMA 5JASA 4CCYB 2PSFA 3UUFA 3U0VA 4NS4A 3STXA 5LZ7A 2ORYA 1LBSA 3WYNA 1SCKA 2JGMA 5E4JA 4X85A 2QZPA 4YK7A 4X6YA 4B7ZA 2OQVA 1HQDA 3F96A 2VJCA 4DSZA 3W9BA 2Z3ZA 4JUIA 2OLEA 1ZD4A 3R41A 1VE7A 1XZKA 4S0XA 4IQ4A 4A23A 2CKMA 1DQZA 2XI4A 5YASA 2QT9A 3C87A 2OCKA 5AOCA 5KWIA 1YAHA 4BCDA 5CTAA 3WK8A 3DJYA 2WILA 4UHHA 4H7FA 4W1PA 5ALEA 3ANTA 1JKMA 3A70A 1BU8A 3WK4A 5IVIA 1H2WA 1GKKA 4KEAA 2WHPB 2FX5A 4QLAA 4KAFA 1NX9A 4G1FA 3HACA 2RHTA 1THGA 4QDXA 4BTLA 1F8UA 3WWPA 5BWBA 5CT6A 3TRDA 2Z8ZA 4FTWA 3DNMA 2XUGA 5DNUA 4KRXA 5CT9A 2ZYSA 1GQRA 1A88A 3JW8A 1W52X 3QBJA 1ZGBA 1JT2A 2AJLI 2OGSA 4X95A 4H7EA 4KJXA 5BV7A 3I2JA 5JD4A 4J7AA 3SC2A 4KE7A 1G4HA 1AMNA 2BGRA 4LHEA 4FOLA 2ZYIA 2YXPX 1MX5A 1VLQA 4XIIA 3IA2A 4C4YA 4X6XA 3H19A 1EA5A 1HLGA 4BAGA 1K8QA 3B5EA 3I1IA 4GWLA 3F8SA 2Y2VA 5HCUA 4GI1A 1TCAA 1MNAA 4JEIA 3WYDA 4BVJA 1W1IA 4KYVA 5AI4A 3H2GA 1FFDA 5JAOA 2WUFA 4RNCA 4G8DA 1CRLA 1FSSA 1TKRA 3WWEA 1CQWA 5KWJA 3PUIA 2WFLB 3KSRA 3DYVA 4RGYA 3CN9A 5FLKA 4TGLA 4FFWA 1G5FA 1CEXA 1I6WA 5I9IA 4HAIA 4KAAA 4KE8A 5AI5A 1XRMA 4OU4A 1QOZA 4H77A 3ICWA 1UK8A 1T2NA 4CG2A 4NZZA 1TK3A 1NU6A 1WB4A 1N1MA 1QIFA 1EK2A 5HK8A 1FFBA 2OGTA 2QXUA 3WI7A 1TCBA 4UFPA 4BB0A 3G9TA 5EHQA 5K3FB 3M81A 4EUSA 3H04A 3BIWA 1Y37A 1QTRA 4B82A 4BAUA 4H7IA 1QFSA 5ALIA 2PU7A 4RPCA 1G42A 3R3XA 4PF1A 2D0DA 4JYMA 3H1BA 2WJ3A 5HKAA 3A2MA 4KAJA 1ZJ5A 4J0DA 1XLVA 1XZGA 4Z49A 1U65A 4BP9A 3B3QA 1ORWA 1HDEA 2IITA 5SYNA 2B61A 4LYDA 1WHTA 2RAUA 4UHCA 5K3BA 3STTA 5DNWA 4A16A 4J0CA 2QKYA 4WFJA 1QZ3A 3C8HA 4BZZA 2BCEA 1U2EA 2UZ0A 1DINA 1P0QA 3AZQA 1A8QA 4QDOA 1ZIYA 1EX9A 5FPQA 5EHNA 2XB6A 4ZV9A 5AK5A 4MEAA 3LS2A 4CI9A 5H3HA 4WY5A 3GA7A 4DNQA 1E8MA 4UBMA 1LPSA 4G9EA 3HJUA 1SCIA 1AURA 4PO3X 5AKLA 4DNPA 5D7BA
chains in the Genus database with same CATH superfamily
3RUAA 3TAUA 2X9NA 3CEHA 3FOEC 4C7KA 4MA5A 3PQ7A 3RS5A 4D41A 1JBQA 1CT9A 1J0DA 3ROEA 1RYYA 3DTVA 5FXMA 4MS4B 4MIKA 3N2KA 3EGEA 4I1YA 4X62B 2WHQA 1VHQA 3MN1A 1HE1C 4MXDA 5E1BA 3L82B 1MF7A 3OCYA 4M99A 4OXKA 2P9JA 4YJFA 4LF4B 3R6LA 5EESA 5D8DA 3M5WA 2WU8A 5F2EA 1LNZA 5FUBA 5HG0A 3E4DA 2OBLA 4HQNA 4HJRA 4JELA 2XUKA 1USGA 3Q3EA 1HG1A 1ZK1A 2J08A 3WV5A 1CUAA 2FSSA 5K3SA 1TE2A 2A0UA 1IZYA 2DSNA 2EGGA 3IOCA 3WMGA 3BWCA 5A4IS 3KKKA 1Y6FA 1FYVA 4MUNA 4L28A 3AV0B 2WF5A 2JJQA 1DRVA 3INYA 2PLWA 3RJ5A 3V7NA 3G1WA 3OTGA 1Q3TA 3EWAA 5A02A 2R6R1 3AETA 5JNTA 3N3BC 4AL4A 5FAXA 1XU7A 4PV7A 2HOQA 1RFGE 4NHEA 1A9XA 8LDHA 1JECA 2IEGA 3DDCA 1Z2NX 1DEKA 3DFKA 3GLKA 3VC2A 4CJXA 4BE9A 2FWNA 3T3GA 4R01A 4GMFA 3DBVO 2IQIA 3JRNA 4UEOA 5FI5A 1RPZA 4TRMA 2O54A 4I5IA 2AB0A 5E6RA 1D2NA 3U5TA 1W4CA 2YN2A 8MHTA 1SUAA 1UMCB 4HDNA 5FL3A 2X8AA 2ZKIA 2R6GA 1YQXA 2C97A 4DT1A 2G7MC 2X2OA 3CZ4A 4RKYA 1W8DA 2GPTA 2ZIFA 2Z3VA 1QVZA 2VF4X 4M8KA 4E7OA 4EO4A 1KFKB 3TZLA 3CF2A 4L3WA 5K8JB 3MUNA 2GHRA 4EGQA 1WULS 2ORIA 2HSEA 3M7IA 1NI3A 3MJTA 4FQ8A 1GL9B 2XNDD 3EXHB 3I2YX 1QZUA 4UTOA 1Q7GA 2QXYA 3RREA 1W4AA 2BE7A 1OXUA 2IHYA 1P5FA 1QX4A 1X0XA 3VNUA 1I1QB 4BFCA 4BO6A 1T9AA 5IRCD 2H51A 2ZPTX 4BU1A 3A9CA 4E4RA 1R3DA 4K9MA 1V45E 1XRRA 2H4YA 3N2ZB 2NU7A 3BFKA 4K9RA 4LVCA 4XYBA 4MIYA 1KDVA 3OKAA 1UQUA 3NT4A 2D2XA 3MMPA 1QSGA 1B1CA 3MJHA 2X6RA 4I8DA 5EA2A 3UJCA 4EA9A 5CFNA 2ORED 4RFSA 2A1TR 4XLZA 5CX1A 1NTOA 3EGDB 2H63A 4PS0A 5EKSA 3BXOA 4AZWA 5E6SA 3LQQA 1S4MA 3G13A 3RUDA 5TMPA 2B2XA 5KQLA 3FCXA 1MHPA 3H3FA 3JCZA 1VL1A 4WN9A 2QG4A 2JJ2A 2GPNA 3I64A 3P9YA 4WHMA 3RAJA 5C53B 1V1JA 3K0CC 1AE1A 2XLBA 4L3OA 3B12A 3AVWA 1FVHA 3WWOA 4O1MA 2G9VA 2J46A 2G9NA 4D4GA 4RE6A 5G4KA 5H83A 2Y1KA 5IFLA 5FLXA 2C8VA 5CH5A 1YTUA 3JQAA 3U31A 1PJSA 5L40A 2IVFA 3Q0TA 4CM5A 1JFTA 2AOUB 1LRJA 5CVDA 2HLNA 1F0PA 4WKPA 2FZ4A 4MUXA 2B8EA 3LMKA 4WASA 3R77A 2BSQA 4X1KA 2DFPA 4LX8A 2ZJYA 1NVWQ 1YIOA 4EVSA 3CT4A 1QHHA 3AU8A 2Y05A 4Z2AA 3Q8XB 4EUHA 4N3CA 5DMXA 2QQ5A 2TS1A 3TL6A 2OSVA 1P19A 5LZ8A 1DP4A 2DWOA 5JRJA 3N2GB 1R6BX 2W48A 1YQDA 1DZ3A 1FNMA 4FZJA 4J7XA 4ZZ0A 5CLJA 5E1MA 1I1NA 4V1CA 4GNKA 3WRYA 3P9KA 3ZR4B 1HI9A 2EV9A 3QKTA 4R8KA 4F92B 3FB4A 1EDOA 3R6GA 3BXZA 2CDRA 5F73A 3ELUA 4X1YB 4ZO9A 4D3DA 3MPOA 3I73A 3DZGA 3EDOA 1JIVA 3MEQA 5FWNA 2QTLA 4WLVA 1EFLA 4P92A 1F6WA 3T3OA 5KHOC 2AE2A 1E0AA 4N0MA 1EE2A 2YJTD 5K0ZA 1GILA 1L8AA 5EJFA 3PUXA 4YA6A 1BDMA 1QMPA 5J5CA 3LPMA 4CF7A 2PU5A 5AW5A 1KQFA 3R0IA 4UTNA 3CUVA 4CR8A 3EZ9A 5T8KC 3DMRA 4CE6A 2DR0A 1PYGA 2IPOA 5AM1A 3MJDA 1WV1A 1MEEA 3NHAA 2P3SA 4CFZA 4DAEA 4RJ2A 4O4HF 1ZWKA 2AG0A 2XAUA 4H6VA 4WXMA 1YCGA 4OLAA 1Z22A 1P29A 3D3NA 4RAQA 1RP1A 4M0LA 1TMGE 3Q7EA 4JLSA 5DHPA 1EFRA 4YRKA 5HM8A 3LX8A 1Z0ZA 4C6TA 1KAEA 1PNOA 2F6RA 3O75A 4HQLA 5BQOA 2HMYB 3UTDA 2VBFA 4KWCA 3JD2A 5DCUA 1LK5A 1UOPA 4G24A 4HEJA 5FULA 1U1EA 4PGGA 1Z39A 3R0VA 5B2ZA 3VNAA 4DSTA 1HM5A 3KWMA 3QYJA 2QTNA 5DYTA 1U3FA 2QLFA 4P1ZA 4WCFA 5JATA 4U2DA 1RBYA 1CZRA 4MUMA 2RFLA 5LLSA 3PUVA 4OHOA 1P77A 4QUGA 1O94C 4KQHA 4AY6A 1F8XA 1IY8A 1EZ4A 2P9TA 1LDMA 5H68A 2DPHA 4C4AA 1XRPA 3B53X 2X1VA 1DKNA 1HT1E 2P7HA 3A1EA 3PGXA 4LDQA 1XFDA 1Z74A 2R48A 1ONPA 1UKAA 4FWBA 4KPUA 4L3VA 5FI0B 4CMCA 5AVVA 1JDJA 3D7NA 1CCWA 3VO8A 3CCFA 4JIGA 3URKA 4DV0B 4TV9B 3GJXC 3I5UA 2PYDA 2W22A 1QKKA 4ZODA 3WQHA 2O48X 4Q4CA 3WSTA 2PRKA 5KNCA 3DMTA 1OJ7A 4A91A 5BQXA 2ETXA 2FG5A 3A4TA 3HEMA 1ZA2A 2VH1A 4OQEA 5D3MB 1M10A 3VVBA 5KWSA 3EC1A 4KRYA 1JH8A 4X92A 3N2EA 3QVVA 1KK1A 5AJUA 4F38A 1A9TA 2C8JA 3V34A 1R8JA 4X9XA 1CR6A 1B0ZA 3A9VA 3AG5A 3BJEA 1O5OA 2WM2A 3BICA 4QFCA 4XQ0A 1ODTC 4B5LA 4YRIA 5ERYA 4PQYA 4X66B 2FEXA 1BQ4A 3AEYA 4FKBA 4DQUA 1C30A 1FXWA 1RM5A 2ODEA 1OFUX 3AWIA 1GQQA 4RVSA 4L0CA 1RC8A 3IAEA 5FBZA 1PWYE 1D03A 4JIMA 3H5OA 3QTLA 4ZVTA 3J81A 1QO0D 4D9EA 1BFDA 2WV7A 4BEWA 4CEJB 2P2ZA 3I4LA 1N9KA 2OA0A 2FZKA 3VV2A 1QGUB 4CMAA 4R1PA 5FR2A 4EARA 1MPTA 5BWOA 4MP8A 4X5OA 4N82A 2GETA 4EA8A 2OCAA 1Z26A 4G25A 4MUHA 2J5XA 4QHYA 4KQKA 3EN0A 1IXZA 1Z8HA 1QFYA 4KVGA 3JYPA 3GP3A 3PT5A 4NRDA 2HADA 4F06A 4ZOLA 2IV3A 4AD8A 2J1LA 3OEHD 4UM5A 3KSMA 1HFJA 3KQOA 4I08A 5BSEA 2C9YA 1P62B 5LA6F 2RBGA 4XE5A 3AILA 5JJ5A 3I8OA 5BORA 1E8DA 3C4JA 1QV6A 1XVIA 2VZ9A 1QBGA 5FUVA 3AC0A 1F48A 1S9HA 2JCYA 4FGLA 5J2TB 3TDMA 3BGOS 5AJHA 3SF8B 3L43A 5G0VA 3T1QA 5T4FA 2G25A 1T0BA 2KX7A 3D3QA 3B9BA 3FUWA 3FZEA 1ZEJA 4OY3A 5CLQA 1T0IA 5IDVA 2P65A 2YQ4A 4YV7A 1Q0PA 1G9XA 4NYIR 1HTBA 1WO8A 3OHSX 4FX5A 4MVYA 3RFCA 3F1KA 3LX6A 2YW9A 3RUIA 5H80A 1T26A 1QHGA 4M1KA 4QWMA 1H42A 3V8EA 3U3MA 4X65B 1BXRA 4JU9A 1YJCA 3PQ4A 4JT2A 1WY7A 1F7VA 4UVGA 2G5TA 4ZYLA 5IAKA 1P17A 1RXUA 1ZIXA 5I4BA 4D4LA 4NFYA 4PGAA 3GJQA 4YP0A 4EK9A 1Y89A 2ODTX 3HFSA 5EWLA 3U3DA 4JOQA 4E1VA 1E3WB 1GLVA 4MINA 1IB6A 3SE0A 3C6BA 4K9OA 2BI4A 4FGJA 4HB4A 2R96A 4EPTA 1QAMA 1Q57A 1BHSA 2ZRBA 5BMVB 3PC6A 2WINI 3LE8A 3VOBA 1BU5A 1XELA 2JK0A 1SCUA 4CKCB 2FQXA 2Q5FA 2REOA 5T3UA 3RBZA 1FJGB 4FOTA 1Y0BA 3ABSB 5LFAA 3KJGA 1FLDA 1R0ZA 4CIBA 4M89A 5AD1A 1KAMA 5BUSA 3I0NA 3C1OA 1E1KA 3HN2A 4M8NE 1EKXA 1APBA 1DO0A 2BHNA 3VNRA 4Q7MB 2QS9A 3SYRA 4RFVA 4ON9A 4W5OA 1CY8A 2XMRA 2WK1A 3IP9A 5JSZB 3K6KA 1V95A 5TGDA 2G77B 1UAAA 3THYB 2FZWA 1KL7A 1WCV1 2R8XA 4FYWA 2IYNA 4LV5B 2Y6UA 4I81A 1ECPA 1MN6A 4NK4A 5AW2A 1YFLA 2PUAA 3QRWA 2A1TS 4Z8XA 1I10A 3HKEA 3QENA 3U7HB 1QFZA 4KXWA 3IO3A 1JHAA 4PAOA 1G18A 5G4LA 3ROQA 3CR7A 4RH0A 1L4UA 3HH8A 4EGFA 3PQ8A 4L8LA 3RKRA 4PG6A 4KO3S 5EE3A 3MWEA 2XYVA 4RDCA 1IFXA 3E6AA 5I3CA 1XZ8A 2GAIA 4NH0A 3RNLA 2Q6KA 2PNFA 3BXGA 2BAGA 3FPSA 3MTIA 3G6WA 2WZQA 5EXXA 5HGJA 2W6IA 1MPXA 3OF3A 1YCFA 2EG9A 3VDNB 4EG5A 1SBZA 1CYDA 2I2DA 1PEYA 1Y82A 1NSTA 2IVZA 2VK8A 1XZEA 3N7UA 3PIRA 4HNSA 1SBNE 3EUAA 2PR2A 1Z75A 2P4SA 1RJGA 1S1CA 2D62A 4N6OA 3W5VA 3TQRA 2YR0A 2W2KA 3F4LA 3G2IA 3QXXA 3GZ4A 1E7SA 3J7AC 1E0SA 2FG7C 4YS6A 2XYHA 1C3LA 5IEBA 1SOVA 1SOAA 4Y2JA 4C4ZA 1XKLA 3I6QA 4ZKDA 3WKBA 1QR2A 2CF6A 3NVDA 4TVSA 5KTTA 3SZMA 4P0PB 5TMEA 2Z9BA 5JQWA 4EYEA 1HE8B 5AM2A 4ALLA 5JC8A 4PZ0A 3K35A 1KDZA 2ZUTA 1TNDA 1ZH0A 2GZDA 2G5PA 1N9GB 4NJMB 2LKCA 3TIFA 3PUYA 5FADA 4B5KA 1Z2CA 1HMYA 3BFJA 2IU0A 4N5DA 2IUEA 2D1QA 5DJ5A 5THXA 3K70C 4HO1X 1NASA 1GQ2A 3HCEA 3GIWA 3KVOA 5FPYA 5HMMA 4ZT4A 3SD7A 4FXOA 2IYXA 1BDHA 1E69A 5B12A 5HQ3B 1JQ5A 4W9RA 3M0EA 4JUFA 4BPBA 5SY9A 3W7VA 4RK1A 3UPDA 3VNBA 1VLHA 3WISA 2ZYTX 1WXQA 3CRW1 4PFSA 4YUVA 3R7LA 4XPIB 2I9PA 2O0HA 1KSGA 2KW5A 2BL4A 4URYR 1NMXA 4EPXA 1SCBA 1E7MA 3AI1A 1T2DA 3FBWA 1KAQA 4KXVA 4PTYA 4RJIA 4WACA 5D7NA 5AM5A 3RJMA 4BQQA 5IUNC 2HGSA 2FUEA 2PJUA 1NIPA 4BPRA 2AF4C 2YN0A 3LU1A 4BNFA 1PT9A 4NBRA 4Q1EA 1L7RA 2ZB4A 3C3PA 1XVVA 3I30X 1DBQA 3LHDA 4F3YA 1ARZA 1P0CA 1YO6A 1LI4A 2PQMA 2OO3A 4CXMA 4CQMD 3ZZNA 2FUCA 5LBUA 2WHPA 3ZZ0A 2Q4EA 4GXRA 1P33A 1MH9A 4HTFA 1NWHA 3IV7A 2CLEB 3LPCA 4F5ZA 1PQPA 5AK0A 1QONA 3Q9UA 1J0AA 3V7FA 5ADVA 4P2GA 4HMOA 1XLWA 1KYXA 4DR7B 3VU9A 1WXWA 3D0QA 5AH0A 4BBPA 3IXLA 3CFYA 4TZKA 3C3EA 3MJRA 2EL7A 5AHRA 4R68A 2R8ZA 4PE5B 4HEHA 4FEEA 2F67A 1DADA 1ZM7A 3OMXA 4L0DA 3Q41A 1Z83A 4FOSA 4NE2A 2YNMC 1YDEA 3H9BA 4OU5A 1BN7A 4TL7A 1GZHB 5MHTA 2VWHA 4N9QA 3I61A 1U94A 2I4NA 3PC2A 1GYPA 2HKIA 4WZBE 1U0FA 1GARA 2G6BA 1E3TA 5A4JA 4F93B 2QSJA 2ONJA 1P7CA 4XB6B 4PRKA 2PX0A 4Q93A 4RVNA 2O19A 2HCBA 1RBMA 4I36A 4OHFA 4ZT2A 1C7EA 4BEVA 3GT3A 3KEQA 5FD8A 3O0TA 4TTJA 4HC4A 3H0EA 3TRFA 2ZROA 3OQJA 1QGZA 5D01A 1VLJA 1Z15A 2NSYA 4EQZA 1X13A 1QORA 2A4MA 4BY9E 3B78A 5LMUB 1P5HA 5HBGA 3PFCA 4BLVA 2J5QA 3CR3C 4ZO7A 3OY7A 1GQOA 1A9ZA 2P1RA 3GEPA 5DTJA 1T5LA 4PRLA 2YKGA 1JIUA 2WLSA 3BWBA 1CVLA 1M1XB 4Q48A 3CN7A 5L3VA 4OAQA 3KFXA 3S55A 4DA7A 4CKXA 1J0XO 2O2XA 2RGUA 3AP1A 2H1LA 3M6WA 2ZJOA 4JGIA 3GMSA 3OCWA 1M72A 2R1VA 2XRFA 3JS5A 1W0JD 4YQEA 5LUBA 3U1VA 3C1UA 5A0TA 3B7GA 1GZ5A 1FQWA 4MGYR 3STVA 4E88A 3GROA 4FDAA 4B3XA 3DOIA 4LBYA 4OH7A 3ORHA 1ODFA 1NG1A 2D8MA 2MSLA 3VC1A 5F64A 4FEAA 1U8AA 4D25A 1XN1A 1BCSB 4BXOA 1UEIA 2P4EA 1JW9B 2EQAA 2VYQA 4LWZA 1FFAA 5NULA 5CB4F 2JIDA 4LDAA 4MWDA 3EJ6A 4K81B 2W7TA 5HJEA 2ACVA 3AV3A 3P9SA 2OENG 4JVSB 5EKDA 3PQ6A 3D5TA 1HXHA 4NBNA 4Q02A 5AW1A 3ECSA 3GRRA 1CUGA 2WZCA 1N8NA 1HWYA 4Z9FA 1MD9A 3I2KA 5H0IA 5M3BA 3RC9A 3SDSA 3TCXB 3ZHBA 4BWFB 4GT1A 3VJMA 3AKYA 5LP6B 4U7HA 5F35A 2HU2A 4INAA 1L7QA 2YWBA 4J6EA 2VRCA 4BMCA 1FFXA 3DO5A 4TTAA 4HPJB 4UTXA 4DADA 5L7TA 3RC8A 3IEPA 1B8PA 1GL7A 1UP7A 3EASA 2VPXA 4M2LA 2WJHA 3L1IA 2C92A 5AM3A 4UFOA 2O7VA 1GAEO 1MO4A 1P1JA 1N6OA 1NW4A 3R23A 5ALHA 5TSDA 4ARSA 3IR6A 5CYGA 2UXCB 2VAMA 3CF6R 1L4HA 4FDVA 2VP6A 2GZHA 4W5NA 5JMTA 1C1DB 1V71A 1STOA 2GX6A 3C41J 3QVSA 4GI2A 3T0GA 4EPRA 3IJEB 2DOKA 3DAGA 3CWCA 2PVCA 3N6XA 4QXPA 3NCTA 3LBIA 4NDNE 1H2YA 1INLA 1XLUA 3UMCA 4CU5A 2PPLA 4LZNA 1MFZA 4BVGA 2R44A 1KF0A 2GYVA 3C85A 2BGLA 4IQFA 5FBWB 4BX8A 1C8VB 2WSYB 4MULA 3V9PA 1RKXA 1SVMA 2VJDA 4RM3A 4AWBA 1Z68A 1AA9A 1ZISA 4NBUA 3EIUA 1E4EA 3GRYA 2PS1A 4AYTA 1K06A 1WW8A 2FXIA 2PXAA 2RKWA 4AKEA 4W5JA 1CFZA 4B31A 1A69A 4Q7QA 3CTPA 2P5TB 1OWLA 3HA5A 5HRCA 5REQA 1UOQA 2OUKA 4ZQBA 4H6WA 1W29A 3QNUA 1OBVA 3H5TA 4XA8A 3SZLA 5IFKA 4MV4A 1BXGA 3DZKA 5ADHA 3B2QA 5DO9A 3ND8A 4B85A 1DO8A 1AMUA 1X1CA 4KLNA 3V8PA 3W77A 1S5PA 4JX9A 3BCUA 2AS0A 4N0PA 5EIFA 4ZAVA 4D4MA 1COWA 1CP3A 3IVAA 3LLUA 2BFDB 4MW9A 3EZ6A 1LVUA 3QM1A 3GJTA 2NYVA 4LSGA 3URMA 4D81A 3GD5A 2JARA 821PA 1M7HA 3MWYW 3QVXA 1OFUA 4KW7A 4V0MA 1I7NA 2DYKA 2SHKA 3CZ5A 1WF6A 1QP4A 3TE6A 4NXNB 5AFSA 3TD2A 3KZOA 3T7TA 1O95A 2O14A 2FRDC 5ESRA 2WF6A 2IZ0A 3B51X 3WHIA 4N5IX 4ZWNA 1ZJWA 3VPDA 1PP4A 4W6QA 3UHFA 4BLPA 3U7FB 1N5RA 5FA5A 5BMOA 4TTIA 3QOXA 4DPLA 6Q21A 4J76A 1VOTA 3HWWA 1KC1A 3L01A 5A6SB 4Y6PA 3U62A 2BDTA 2G80A 4TTVA 4OQYA 1VE9A 1PJTA 1OXSC 4TM8A 4UOEA 3WJ7A 1Q95A 3NM4A 1U2DA 2ZXUA 1D4AA 3W2FA 3RJTA 2J6IA 5HF9A 5TJHA 5JVDB 1SHUX 3OPYA 5K4AA 2NNLD 4OQNA 2XA9A 3OMWA 2VJKA 1SUSA 2AYXA 2Q0XA 3IP1A 2E2WA 3KSZO 3CLTC 1J07A 5E1OA 1Z2PX 2PKCA 3V1TC 2BGNA 3W6PA 4B3IA 3BD7A 2HPVA 2UKDA 4E15A 2CFRA 3IUMA 4IHJB 4OPMA 1G9SA 1N57A 5EUBA 1OPRA 1PD0A 4R9SA 3AUJB 4N9WA 2FW7A 4X0EA 2WFZA 4K6CA 1VBNA 4XDYA 3OIUA 1C2TA 1GZ3A 3VUFA 2F4VB 5JEDA 1X2EA 2GASA 4HDKB 4P33A 2AR7A 4BO7A 3LL4A 5EYPA 3KSUA 4YALA 1NMEA 2ZE5A 4WD3A 3VVCA 1I13A 3CH4B 1G20A 1U9ZA 4KRGA 5F33A 4LOHA 2B37A 3GHHA 1ZMBA 1MAAA 2FOLA 3RFVA 1YAJA 1SZDA 3LOQA 3H9JA 4O4IA 4F6LA 3HVRA 4ZEOA 1GZ4A 4GH5A 3NTXA 2XNCA 3EYAA 3OJWA 1KNXA 1PWXA 3BPSA 5K0EA 2ATCA 2JW5A 2B0JA 4OXXA 3R0QA 1G2OA 4OJQA 1BH2A 2JLBA 1T9GS 5I7RA 2FPOA 2FOXA 2PS0A 4JEUA 1S2MA 3NHKA 4BFUA 4BMXA 4IRUB 4XM0A 2O7RA 2VQDA 4LWQA 5C5EA 3DBRB 1MP0A 4TUYF 3H1AA 4YV0A 4G4JA 4U7DA 3WMRA 1YSCA 3EFBA 4I55F 1BD3A 5ALQA 1NRXA 4OHKA 4J4BA 3UOWA 5EHZA 3E22A 3WMWA 3FYUA 2QE7D 3TCKA 2H00A 4FC6A 2PD4A 5K0BA 4M9UA 1KOFA 2E4UA 4XD7D 1XCOA 2ATVA 5L3SA 4UD6A 3AEQA 2JI7A 5AVZA 4FI3C 4YP6A 5TS3A 5IM4A 4MW2A 5D3KA 1RM4A 2EGHA 3UGQA 5ENZA 5GINE 1E3MA 5TQ2A 1QCYA 3K16A 4XVCA 1BGXT 1CQPA 3GEHA 2O2GA 3W8RA 1WP4A 2H4WA 2C0QA 2J0EA 3C97A 4YP5A 3V3TA 1CUYA 4K3UA 4F96A 5B5SA 5LIRA 4Q1CA 3WY9A 4KLRA 3FG9A 4PLTA 2RONA 1ID8A 3SJAA 4NFSA 4PSVA 5DLDA 4ZRDA 4ZU6X 5C52B 4I50B 2ZDQA 1VSQA 3C3AA 2QX8A 3A7DA 1J23A 2G5CA 4ARCA 4V24A 1HQYE 1TTQB 4ZCQA 2BHSA 3HZHA 3H3XA 1GFIA 2HK8A 3NRBA 1PX2A 4IUCS 1SG0A 2CFIA 3H2HA 4MUIA 1B4DA 5K0JA 1JILA 3LCMA 4HAYA 4Y6LA 2R2AA 1H4VB 3EDYA 5FOXA 3QPAA 1JE0A 4KUGA 2I34A 3EVNA 3UY4A 3RC2A 3WQSB 1P31A 2BMFA 1YL5A 1EDBA 1SXHA 1X1QA 2CNWD 3QZUA 5J5AA 4CIYA 2CSUA 2MIIA 5I7EA 3K4QA 2QN3A 3G7SA 3M3PA 4R5HA 1T3TA 3TF5A 4JLKA 3SNKA 2P8SA 2HPHA 5DXFA 4LGMA 2XUPA 3R8XA 3T95A 4BB5A 4AC9A 4XX0B 4P7KA 4UULA 2EWWA 4JXZA 5BN5A 2WOJA 3FOWA 4LN1A 4PZCA 3R6TA 4CBVA 2J59A 3CJTA 5AI6A 1JG3A 2HNBA 3P4YA 3CLVA 4GR5A 4YQZA 4QDXA 3G7NA 1QS0B 2VBCA 1KERA 1UC8A 4WXEA 1KH1A 3GVIA 1RZVA 4L8WB 4Q21A 4YCBA 5JISA 2O23A 3ZDRA 1ZL2A 2HD4A 3DQQA 1WPGA 3NBQA 1P1BA 1ISGA 1T3HA 3OU7A 4CUZA 5LU9A 2GKGA 1Q1BA 5JAIA 3P8ZA 3M83A 1IK6A 3P0IA 3IQGX 5FOSA 1CVIA 1R4ZA 4FE4A 3GCWA 4RZSA 4A27A 4GKKB 1XMPA 1U2QA 4D1YA 1DCFA 1OGIA 5I7OA 3CVVA 3ZCRA 1KJNA 1KEUA 4OIMA 2J3MA 4D9FA 2ACWA 1R6XA 2C07A 3EF0A 4ES6A 2ERYA 3T1HB 2OUIA 2QTFA 3K6JA 2EOAA 4NS1A 1UH5A 1Z88A 2AW3A 5FORA 3A1TA 4EFNA 2R8EA 2VAXA 4L5CA 2HA3A 4Q7JB 1OGJA 2CDAA 1U3CA 2OESA 3G68A 3IE0A 4BKQA 4TQAA 4XRRA 3W34A 3WXMA 5GIPE 1KC3A 4QNMA 5L3QA 2GM9A 2ZSAA 1Y8QB 2X7XA 5B1DA 1EXDA 3FJYA 2G70A 1RAIA 2J0QA 4D44A 1CQZA 3S1AB 4OF4A 3T5CA 4HDCA 5C8XA 1YRAA 2X1MA 3OF5A 2PEYA 5HVNA 4IO1A 1E2QA 1ZONA 2W93A 3ABQB 4EBBA 1XZHA 4LPKA 3UIEA 1E8NA 3RAGA 4DY6A 2ID4A 1IAVA 3ZCVA 3PQ5A 4UU8A 4AKIA 2A5FA 3K9GA 5IUKC 1QTIA 1TM1E 1KI6B 3AF1A 2I3BA 4MVCA 3NVMB 5FPHA 2GM3A 2QX9A 1TK2A 1AJEA 2CFOA 3COPA 4GOKA 1OC4A 2QUJA 3C8DA 1DC7A 3PHBE 4V38A 3ZBPA 1AM4D 1SB8A 1PE0A 4ERXA 4W5TA 2VQEB 4E51A 4PAWA 3T34A 2C77A 2XUZA 3GBVA 5G3ZA 5LZ5A 3UAZA 3GJ3A 2V9CA 5EKXA 4DABA 2XHZA 5LQNA 1JMKC 1NLUA 3TM5A 4AJLA 2WIDA 1G6KA 2A9KA 1BJRE 3SYTA 2KBFA 2QRGA 4IS2A 2CL0X 4IV0A 4J3JA 4OQPA 4IJ6A 4DLPA 3TLGB 1YB7A 2GLTA 3LZCA 1J8DA 3ULKA 3VA7A 1P81A 3O8NA 3C3JA 3FKSA 3KJEA 2A0FA 5BN4A 2BGMA 3CVOA 1RPAA 5ALWA 2Y92A 1ZQ1A 3HCOA 3GNTA 4DNOA 5IJXA 4PRZA 3TFWA 2PYIA 3L93A 6NULA 5BXYA 4G9GA 1N2HA 3LLSA 4UKDA 5DKFA 2R00A 4RLHA 3TZQA 4DZTA 4YUWA 3EH2A 3AJ8A 4F12A 2VS1A 3LRPA 4YAEA 4JDPA 1UJCA 2X13A 4B3CA 1FDVA 4ER0A 4MKHA 5AKHA 4CFSA 3OX3A 2LKDA 2C5GA 3LT2A 4PTZA 1BFUA 1F51E 1U90A 1A5SB 4NJOA 2BMEA 1HYQA 4B6QA 4NMLA 2H0RA 1CUEA 1JIQA 4F2HA 1LDYA 4OSPA 1J5XA 5K0GA 4E3ZA 4YCNA 4WFKA 1DG1G 1P1CA 2WQ7A 3NUZA 1EFDN 3DKKA 5H3LA 1JG6A 3GQBA 2B7LA 4GX1A 1RJ9A 1OLXB 1L5RA 2F3RA 2BR5A 3IQWA 4YROA 4DQXA 4LPSA 4LHSA 1K66A 1QYDA 2WF7A 4CMJA 1NL3A 3LVRE 2EGUA 5CITA 4QO7A 4TWAA 1M2GA 3DMFA 2FR0A 3KOUA 5AVOA 2TMKA 3ROPA 3SSMA 1KXJA 4G0MA 1ZG3A 3OTHA 3BD8A 2A86A 1R6AA 2DZDA 4Q1DA 4YJKA 5IC4A 2IZ7A 4PYLA 3P97A 4HVAA 1J9EA 3AGPA 3EFOA 4OK3A 3KQVA 4HQFA 5AXBA 2VHUA 4FMBB 5FBHA 4MDFA 1X7YA 1CZNA 3HP1A 3E8XA 4LC1A 4IYJA 1YS4A 3CW8X 1EQ2A 4N5HX 5KX5F 5DM70 1TMOA 2RMKA 4YT5A 3QPCA 1WE2A 3NHYA 1GTRA 1EB9A 4WV3A 5K9ZA 1KBQA 4HH0A 4IHKA 3GA5A 4IDPA 3D7RA 3FVVA 4NESA 4QD3A 4RPHA 4TWBA 1MJFA 5EP3A 3SG0A 1P75A 1RYMA 1R5JA 3PE6A 1XBTA 5JD3A 5LYYA 5LSAA 5K03A 1SWWA 1ECCA 2IELA 1VHWA 2ZIZA 2F8SA 2CB9A 4LJYA 3GPLA 4I1IA 2VIIA 2ADOA 2CLHB 3B8HA 3F6SA 4MVXA 1J0EA 1W88B 3ZZMA 3TQHA 4F60A 3RK0A 3SFTA 1P60A 4QFDA 5EPOA 4BGIA 5IYZB 4RESA 3W5DA 4AMBA 3PA6A 1JNXX 2PAAA 3K2EA 2PZFA 3QA9A 1FW6A 5HFJA 3DUFB 3PWKA 4IKPA 3L7NA 1DAOA 5F5NA 1ORIA 2V7GA 3JQ7A 1JEYA 3GFVA 4YBZA 3WLNA 4HUQB 4RO0A 5JDCA 3U44B 3OPQA 2HMWA 3P96A 1A9RA 2GQ0A 3B13B 1FDUA 2DXIA 4UUQA 2NOAA 4YJ3F 3EHDA 3OLXA 3SFZA 3L0IB 5E6UB 3DKVA 3QPVA 4RNDB 3IILA 1SBQA 1QHNA 1ZCJA 5EQFA 3G2NA 3DAYA 4GI5A 1YL6A 3EG5A 1CDOA 4D9GA 1E1CA 1WDTA 3RAPR 3ENNA 3Q8WA 1Z35A 4G0UA 4UPEA 4ZAWA 3O4HA 5ELMA 3SP1A 4X20B 4DZZA 1DEOA 1ZN2A 1PD1A 3W06A 4C0AC 3W6UA 1KJZA 3FFTA 5JLJA 1TF7A 3BXXA 4NYJQ 4RETA 2WG1A 1GVHA 2CZCA 4MWCA 1NQUA 2A1IA 2VJOA 3QHPA 1DKUA 4DN6A 2FMIA 1CDZA 1TEXA 1Q22A 3KXIA 4AYXA 4ZI7A 3E7XA 1ESZA 4ZZ1A 1B0PA 3KT3A 2HWUA 2WKPA 3L0ZA 3BCHA 4N3GA 4PG8A 5LNK6 4RULA 2WQ6A 3RJZA 4OI0A 2RB4A 4CODB 4WERA 4Z4EA 1P39A 3PDUA 2OFFA 1RIIA 3DLTA 3VR4A 2UUAB 2ZJ1A 3D02A 4KH1A 2EG5A 1RXVA 2NNWB 5EIHA 3EG9A 5EJIA 4YMSA 2XR1A 3LCJA 5HK9A 3T1VA 3L18A 3CF4G 1W6RA 4BV9A 3FGZA 2NTYC 1E7WA 4Z7QB 2ODWA 5COQA 4R9RA 4RIEA 4A2QA 1YOVA 5EMNA 5J4LA 2K7FA 3FHOA 2GN4A 3GPIA 5L3RA 1IEVA 2VNSA 1C0KA 1AXGA 2NVOA 1U0BB 3OT5A 4QGSA 1O4WA 2X0KA 2GAJA 3QMMA 3MGGA 4TV8B 1I6LA 4DIEA 1ZX1A 1M6HA 1X9IA 3B1ZA 5E95A 2EJVA 4ZYYA 4XWAA 2BKXA 3T7JA 3ESXA 3USES 5GZ3A 2BT4A 3GRZA 3COJA 3TQCA 1FE8A 5A7HA 2P9EA 4X44A 1PSZA 4B4DA 3HVUA 1U4OA 3O8LA 2AQIA 3WIBA 3PPYA 4E2FA 1PL0A 2ECFA 1G1MA 1E5XA 5KKCA 1G2IA 5B53A 4KQCA 4Q15A 3WNBA 5AW0A 5JZMA 1ULBA 2ZQ5A 1SBHA 1ZU5A 3CNBA 4L74A 4TTSA 3L5OA 4KTTE 2WHRA 2BM0A 3H8VA 4C2AA 1PK7A 4CDMA 1PG2A 1C14A 2VSFA 3CUEF 3P0HA 2QP9X 1Y63A 5CYFA 3RE1A 1ATIA 4ZHQA 3QUQA 3OFKA 2VL7A 4XJXA 3EZ7A 3U81A 1C2YA 4X84A 4B17A 1QPBA 1CY6A 3K6SB 5CNKA 1M34A 4MUBA 1RE0A 1I24A 1W35A 2QAGC 3V46A 2XQFA 1YUMA 4F7WA 1XP5A 3DEFA 3RGWS 4KYUA 1A8PA 4ZT6A 3DHNA 2R84A 1LS6A 4MQBA 5D87A 3VPFA 1XDGA 1VYUA 2VJYA 5IJ0B 5CDFA 1XD8A 2OQIA 3ZY3A 4RUKA 4DCSA 1VE3A 3U3OA 5CW2A 2KPOA 1S89A 3ME5A 1IWPB 1PYOA 4N0EA 2RBEA 3SU8A 2AN3A 2VT3A 3QOYA 3I2IA 3RBXA 3QVTA 4NR0A 3AEUB 3OCZA 1H8HA 4IMJB 2C04A 4ER5A 3HYRA 2IUSA 3S2IA 3LYAA 5DZSA 1E58A 1W2WB 2PMWB 3OT4A 2D0IA 4MS1A 2IPLA 2PTGA 1DRKA 1JBEA 1JR3A 4QASA 2R65A 4LYJA 1E62A 4V0KA 1PL6A 4W1RA 3RYFA 3CWZA 3QXJA 3EARA 5CMLA 5KKAA 4ZQCB 5J4KA 3K71B 4HGYA 1WUIS 4UBNA 3D59A 1JV2B 1VE1A 2Q8NA 3H1TA 4E7PA 5KU7A 2C3OA 4M9SA 2VQ6A 1ZH8A 1SVNA 3UJPA 3ECAA 2EBFX 1R4NB 3HB7A 3WC4A 4AZ3A 1G6Q1 2H18A 1KEPA 1UC9A 1SU4A 2WM8A 2X6TA 2OHHA 3COVA 3EXFB 3I8XA 1BA2A 2ZTLA 3LUGA 4KK4A 4RH3A 4BBZA 3KQKA 1MC4A 1ZR2A 2PKXA 4DCUA 2E49A 5ALDA 4GZ5A 4CF3A 3RC1A 4FYMA 2CXPA 1JX6A 1RYHA 3DR5A 4GNRA 1P4SA 4EKYA 121PA 2PKEA 5H81A 2WSBA 1J8VA 1ULTA 4BP1A 3WGMA 4DMKA 3ZD7A 1V3VA 3M5PA 5L4SA 1ZMXA 1B26A 4O02B 3EDMA 3NWOA 4D3ZA 3M3DA 1MJGA 2INGX 3U4HA 2ESRA 5DK6A 3DMTC 2PSEA 2AFIE 1Y6RA 2XOKA 2FHPA 1YQGA 2A94A 1Q1GA 1XVTA 2G9RA 2YXLA 3PNMA 4FYHA 4JP3A 3LD9A 3OZFA 4Q37A 2QLBA 3E3AA 1NUHA 2ROQA 3NVAA 4AJNA 4DDHA 2PBLA 2QROA 2HA0A 3CVXA 3PICA 2V3CC 1YQUA 2OOKA 1JS1X 2FFBA 1UJ6A 5FNZA 3KT0A 3D4BA 4NLLA 1MX9A 4E5YA 2DY1A 2WYUA 3AHEA 3L8ZA 1U0GA 3NEJA 4FBMA 4QXQA 1K8XB 1SOWA 1MB2A 2PYZA 1L4EA 1UWVA 4CV0A 3FYDA 1YBAA 2HSGA 2TSYB 3G0DA 1LW7A 3KKPA 4MCHA 2ZVDA 3FCCA 3E9CA 4W6ZA 8OHMA 4MJXA 2V96A 2X5JO 1IYZA 2DR2A 2RI0A 4P81A 2G83A 4BNXA 2AOTA 3HUFA 3LDFA 3CLRD 2PUEA 3UJDA 1V5WA 3H8WA 1XEXA 2IYZA 2FWPA 1XDDA 1HK7A 2F9LA 1NAHA 3LUFA 5EP4A 3FDZA 4EHHA 3G6KA 3E5RA 2MOKA 1W48A 4ZP1A 4GICA 1MZPA 2BEUB 2RHBA 2J9FB 2JIRA 3DAPA 4JGBA 1GSOA 1MZVA 4WJZA 4NCJA 4KO4S 4BB9A 2CW5A 5DTQA 1UJMA 4YJGA 2C7GA 3KVYA 3LK6A 4RIFA 1QAOA 4PLPA 5K8VA 3ENZA 2ST1A 2XTAA 1EUCB 1AQLA 1M6EX 4JNCA 3VVLA 4BNGA 1VLLA 1GA4A 4K6FA 1F38A 3PTAA 1VLZA 3KYCB 1RRKA 4PZPA 3S2YA 1YVDA 1SKYB 3PIIA 4WXHA 1IM8A 5M04A 3REQA 2ZIWB 3ESZA 1WB5A 4DS3A 13PKA 1T35A 3ND5A 1ZLXA 4GM4A 5KSOA 4B3DA 3U7GA 4FMPA 1KMNA 2V7PA 1XP8A 4IRMA 4G86A 2B20A 5I9TA 4EM6A 3LKBA 2CXOA 4LF5B 2YFQA 5CIQA 2L18A 3A26A 3N7AA 3PF9A 1BXZA 3NAGA 3C45A 3FMPB 4FMDB 3QKWA 4JLWA 1FNNA 1NAIA 5C31A 4Z0HO 2VNHA 4YJDA 2OPHA 1Z34A 1K6IA 3SEAA 3WGLA 1P8JA 1V9SA 5KNDA 4HZGA 3RRBA 4NXMB 1A2KC 5JU6A 1E6LA 2N9UA 1MAHA 5E2AA 3EK2A 5G0TA 5G1OA 5MF6A 3UWPA 1TL7C 2E7ZA 4UE2A 1Z0SA 4XWWA 5FNVF 3HC7A 4RJJA 5IVDA 2QLJA 2AK3A 1NR5A 2J9XB 3L9WA 3NV7A 2VATA 4UARA 1W36D 4ZYXA 1AQNA 2B9VA 1QIHA 5A2GA 3D2CA 3GRCA 4L50A 2PMKA 2A84A 1NG9A 1UPAA 3ID6C 4GOND 5HMLA 2XYQA 2R62A 3QPBA 2I6QA 3D1VA 3F6EX 4RCVA 3T38A 2ACKA 3X1DA 4D82A 4I4TF 5C8YF 3UW1A 3DOFA 1X3SA 5LKAA 4IL5A 3R7DA 2VOEA 1KFCB 4JLPA 5GMOA 3TBKA 1PUJA 1SULA 1SU6A 1EFPA 4NENA 3ZWOA 2ZG6A 4LYYA 3BE8A 3UAYA 1P0FA 1EGMB 1T91A 5IBQA 4DIKA 4G26A 3AVUA 2XUOA 2OZLA 1N5DA 1W8IA 3MWDA 1GXSA 1VCHA 2REBA 2IXFA 5G1NA 1BYUA 1UIMA 3NAZA 2P6MA 4DWJA 4Q03A 2BH9A 3V00A 3AKDA 2VHYA 1EHIA 3BDIA 3GB9A 2W8BA 2JCGA 4BP8A 4CQJA 2JA1A 4TQUS 5K3OA 4OX9Y 3DBHB 4Q3EA 5DSZA 1M33A 1EFHA 2JKYA 1XNGA 3F7TA 3RVOA 1ACJA 3VVMA 4EYGA 2GUWA 2X4GA 3EXG1 3HSYA 4QUDA 4UREA 5EZ6B 4B3JA 2ZJ2A 4U7WA 4C7XA 1E9BA 3GDGA 1VL2A 4ZO4A 5CB0A 4LBZA 4YP9A 2Y0CA 3UYKA 3EVFA 2HM7A 7ADHA 3S8EA 3ZVNA 1E2JA 2G08A 2JGRA 2JIQA 4IILA 4ENUA 3OUUA 1L7XA 3LQ1A 3OHPA 3BKXA 1MCZA 3PJEA 1SWVA 3RVKA 5L6LB 3KAKA 1DCTA 2B0CA 2N47A 4G5HA 3T3NA 4EB3A 4NBLA 3ODPA 2R97A 3DTVB 2CC2A 3IXQA 4KI0A 1E2UA 1CE8A 2BM8A 3N2KB 3GNLA 2OXIA 1X9GA 5FBKA 2BYTA 2I6SA 2W0MA 2BI7A 4YJFB 3ENWA 3TXYA 1E66A 1Y8ZA 1KPHA 3RCBA 2XGOA 3GLVA 5JWHA 2GARA 4TWIA 5I8PA 1DVRA 1AGPA 1JKXA 1QTNA 3EW9A 1ZVMA 4KU4A 3WRWA 621PA 1FMLA 3E9RA 3GDHA 5I7UA 1D2HA 5T6BA 4U2CA 2G8LA 2WFMA 1DJQA 1J00A 2B69A 3CB4A 3ZI0A 3HB1A 4D56A 4RD6A 2GEDA 3LXMA 4U39A 1SXJD 2NUBA 3EMVA 3PQDA 3ZTTA 2Q45A 3AETB 3AHCA 1YR6A 2BKEA 3F78A 3DVSX 3G0BA 4LTNA 3WLJA 3O8RA 1DSSG 1IEWA 2B4TO 1VKNA 3FNQA 4K9KA 1A9XB 4BNLA 1JIIA 1L9XA 1P73A 1SHJA 1H2BA 1TU0A 4FZVA 3G5UA 4PANA 2HA5A 1QP7A 2DFVA 2PFKA 1AKMA 4G0QA 4BJ1A 4IGAA 4GPZA 3RSOA 3WGZA 3KAJA 2DB3A 4LC0A 3QG5A 3T5BA 1ETHA 1KYVA 1VECA 4DQKA 3I72A 1QVAA 5IG2A 4DR1B 3OFVA 2LE0A 3CNLA 4NEQA 2IIVA 3R3SA 4Q34A 5KKNB 4D4IA 5LBTA 5E6RB 2HK7A 5I9LA 4RY2A 5CBPA 4MGEA 3JWJA 3U6KA 1CUIA 1NJSA 4HDNB 3DE4X 1VG8A 3E9YA 4PLHA 3SYMA 1XLTC 1M73E 4DT1B 4JZKA 1YDFA 3EPRA 3I3SR 5IT9A 2I0FA 4XM2A 4O3MA 5A5DA 2HT6A 5DM4A 4KFTA 3GH3A 1J56A 2QD2A 1OYYA 3BFVA 3EQ6A 3Q3JB 4HB2A 4IFTA 3OJ0A 1OH5A 3GRAA 4K88A 1DHRA 2G76A 2UZAA 4NCIA 1KMIY 1OXMA 2DPMA 5IJWA 4UVHA 1Z6TA 4KXNA 4PW0A 5JW6A 2B98A 3NJ8A 3Q40A 1WW3A 1ICIA 2QTMA 2XMBA 2Z6VA 2YZMA 2RK4A 1LUAA 4DYVA 1NZDA 2Q5IA 4AIRA 2DJ5A 4XJTA 1T15A 4CM7A 2P0YA 2UZ4A 1F8GA 3FY4A 4ID3A 4JLJA 2NU7B 3SZ3A 4I3FA 4AS3A 5JO0A 1EJ0A 2DQZA 1S9DA 2WWHA 4Y1GA 1BHO1 5JPCA 2R3SA 5HRAA 3D7MA 2GN0A 1K5PA 2Y99A 4RFSB 5CX1B 3W7BA 4RVFA 3LUJA 4A03A 1DKOA 1KGDA 1W5BA 2DMRA 1BS2A 1JSZA 5E6SB 3ZI4A 3PGJA 3PSHA 3K8OE 3VKWA 1GLNA 3EA5A 4AUMA 1E92A 4DPKA 3HQ4O 3A10A 3OOYA 4WN9B 5EMLA 1FL9A 3GC6A 1K3FA 3A31A 3KELA 3NP7A 4RVOA 4ETMA 3CW2A 4F46A 1O0SA 3L7JA 2Z30A 1SQSA 1R8XA 5KQMA 2CNKA 1UPCA 3ESQA 4L9RA 5G4KB 3OM0A 4NBKA 4KQJA 4QPDA 3K53A 1GTMA 5I01A 2QXTA 3UM9A 3QJYA 1Z0FA 3I52A 1OUMA 3AFIA 1F20A 3JQAB 1R1DA 4U0JA 3O7MA 3UEOA 2O8EA 5EJEA 2B1GA 2AH5A 5KJEA 4LRSB 3ROMA 1R15A 4CTKA 2DBQA 2NXWA 1KYYA 5C80A 4OHZA 1D8AA 3WGGA 4X1KB 1TLTA 1N77A 4YEDA 2WJVA 4YAFA 5SZHB 4B7AA 4Q47A 5EUCA 2GFQA 3DW1X 5DBOA 4TYPA 5EKTA 1ADBA 3HCRA 1GRNA 1QHHB 2ZDHA 4GOMD 3F73A 3RU7A 4HVLA 1KOJA 2NIPA 1KWGA 2NZUG 1BMFD 1X7GA 2I99A 3D3JA 2FEKA 1G64A 3AB8A 3TQSA 3DMYA 2PZJA 2VEOA 1C8BA 4LFBB 3FIUA 3HV0A 5JMPA 1SQGA 5HOEA 4Y6GB 3A4IA 5AHXA 4V1CB 2ISQA 1XZCA 1PT7A 1CJBA 1GPMA 1Z37A 4BNHA 2Y67A 3EBLA 1X7WA 1AK9A 4EELA 1YZNA 3PHLA 3U3ZA 2BV3A 1SC9A 1IONA 5CYOA 4CV1A 5A5GA 3NPAA 4JJFA 4EFMA 3FVTA 4IJ5A 2G1KA 2NV6A 1KQNA 4RD1A 1XCBA 4BRUA 4RABA 3QQPA 1PKXA 2QSUA 1N7HA 2YJ6A 1JI3A 1HDCA 2VXBA 1ZM4A 3CQ9A 4ALKA 1OT5A 1U0RA 5A62A 3RIYA 5LD2B 1L9KA 4QJIA 4OI4A 3B36A 1B6TA 3PXAA 5DGTA 1VCIA 4FR2A 1CU1A 4AJ9A 4F4FA 5I48A 3A3PA 4JI6B 2NU9A 1P9RA 2WT8A 3P94A 4P22A 5KEIA 2VJPA 2QGFA 2P2GA 3I0ZA 3PXXA 2A6PA 2ZCVA 3WKAA 1XZJA 1RVV1 3VTAA 3RSCA 3WO0A 4BO9A 5TB5A 1Y7PA 1PLKA 4BVHA 5CFPA 2MSNA 3FX2A 3UH0A 2IC5A 5DHAA 4FN5A 3HYNA 3IURA 3UBTA 2WWRA 4F2WA 4C6TB 4UCXA 4IV8A 5CFMA 1GGHA 4FLMA 4KPEC 1DC4A 4ZJYA 2A2ZA 5B3AA 4PZAA 5DGXA 2CVHA 4XOIA 2JGFA 2W37A 4MVJE 2OD7A 4DPMA 5C35A 1Q14A 4P3XA 2AJ8A 4MV1A 5ED0A 4ZI2A 4Y6SA 1W0CA 3JWHA 2OV1A 2GRJA 5ADWA 5CCDA 4WCFB 1SUCA 5L4LA 4UNIA 3VKHA 1ZQ9A 1ZNYA 2AI2A 3IQXA 4LK3A 1ZN9A 4IIDA 4NU6A 1QGDA 4P08A 3OBBA 2X1HA 3GN2A 3VR3D 4B1FA 4DIMA 1SG6A 4G4IA 4ND7A 1HY3A 3U49A 1IB0A 3MT7A 1A72A 1TFRA 3ZEIA 5IAGA 4M0CA 4MR9A 4PN7A 5ALVA 2AQ8A 1VMDA 5HKKD 4XUCA 1IHUA 2QN8A 4KPUB 2GPJA 1PZGA 4PBRA 4UBIA 5FHQA 3W9YA 3AVQA 1WPQA 3JQ8A 3L1UA 3S1AA 5D6NA 3KZXA 4WWHA 4ARZA 1TYAE 2QU7A 1DAMA 2WJZB 3QUCA 2RE8A 1B6GA 4HS4A 4O08A 4V02A 1QM5A 3MBOA 3FDFA 2RAFA 1EWRA 1RYEA 3GN1A 3K9QO 3L8GA 4FU0A 5KJCA 3CEMA 5IT5A 1R0YA 4UQLA 2GCGA 2NSJA 5JS8A 1S96A 2GDZA 1R7RA 1WOYA 1Q44A 4JKYA 3ZU6A 3ZCQA 1RRMA 2WNIA 3C6YA 1DJMA 4IZ6A 3K5WA 3WGIA 3F3MA 1I1HA 5CXUA 3VSBA 4MSUA 3UHAA 2OVBA 4FS3A 1C30B 4G5GA 1UPXA 2VHQA 4IJKA 1RZRA 3FOBA 4Y2XA 3OWXA 2G04A 1EFVA 3DD5A 2XUAA 3RG2A 2GCIA 1P2DA 3VDRA 2BIFA 5KYVA 5BV1A 1PV1A 1XZMA 2EDCA 1E1RD 3TXAA 4D0GA 1QU3A 3R6DA 2EJBA 1G5PA 4L75A 2TMDA 1H22A 2R6JA 4NZOA 4R2JA 1JA1A 2AMLA 2PY6A 2A0YA 3EGWA 2H31A 2P4HX 4O0LA 3L6OO 3DFZA 3BL5A 5AKIA 1M74A 2V7QA 4I9HA 1CIJA 1K2VN 1QE5A 2OHJA 5JSFA 1U7XA 3H2JA 3OX4A 3V7UA 2NACA 4L6AA 5LP1A 4MPJA 5KVQA 1TZMA 2CLIB 1XF9A 4LXUA 3OZRA 2VLBA 1GFWA 5KTPA 1WMAA 4NV0A 4R7TA 4ZOLB 5TV2A 2O1SA 1G8AA 2EF0A 3T61A 4EG3A 3EPLA 2YWRA 2HHCA 2VQSA 5JD6A 1MVNA 2UAGA 1GSHA 2P77A 4QHSA 2E9SA 1L6RA 2F59A 2Q07A 5GONF 2WABA 2XMCA 5EVCA 4JXXA 2HRQA 1GPLA 3L7DA 1TJ3A 4M9XA 2H6EA 1H1TA 2WIFA 1KS9A 3L7OA 3IESA 3OQBA 5EUMA 3MCAA 1D2GA 1H2HA 3DBOB 3TZEA 2CK3D 4UHEA 1UBNA 4IDNA 3E23A 1WB6A 3AI2A 3M6FA 3EXIA 5HJ2A 4FWTA 5FBRB 1E3EA 3O38A 5AVKA 3RS3A 3CJRA 4CT0A 3I4FA 3VI4B 4YRAA 2YWCA 4ZOQI 2NP6A 2X2PA 1XHFA 1Z5VA 2PQ6A 3GBSA 4H35A 4IF6A 4BNIA 2PK3A 1KFBB 3LKDA 4OXYA 3W1WA 4CWAA 1BXRB 1RMQA 2ICAA 3Q85A 4CDNA 5JJLA 2DR3A 4H7DA 1PGNA 2FF5A 4FEGA 4LJ8A 4O25A 2LCIA 2HA7A 4BO0A 1UBFA 2GAAA 2AGVA 3TW8A 4Y2GA 1U0NA 1YQQA 3NO4A 4EVIA 1G3UA 3ZU3A 4LFCB 3QSGA 4M7OA 5TDHA 1FK8A 3CRQA 1KRXA 2X0RA 1SUDA 1IXKA 5EWLB 3KHSA 1ZIDA 3OZ7A 5K09A 2Z95A 2C9ZA 3ZHOA 1UZAA 3VX4A 1A50B 3CSUA 3AR9A 5EZ5A 4YTEA 1KYQA 4M36A 1S8OA 1TVEA 4GMXA 2WTNA 4HJXA 4DCNA 4DLVA 5IT0A 3L4BA 3CINA 3ZHUA 3TB4A 2CWWA 3E5NA 1SCUB 4JSTA 2RGXA 4KQWA 2NO5A 3ENVA 3G9UA 4WQMA 2FSFA 3KDAA 5SICE 4E5VA 3HXTA 5KNDH 1T36A 3FTDA 3NORA 5BVHA 4GLJA 3QKRA 4TT3D 5T6MA 2R8PA 1T5OA 2XHEA 5HF6A 4F3TA 2FZ5A 5HZKA 1G4UR 3IHKA 4A0FA 5KPDA 3FNGA 3V42A 4NG5A 4KKXB 3WLTA 1P7PA 2HRBA 1Y9EA 2HHLA 3FAZA 2P1ZA 1L0BA 2W6CX 3LQ2A 4ACAA 1ZRHA 4EYQA 5IPFA 2PFGA 3L06A 3SJBA 1FU4A 1ZH4A 2J09A 2ZJFA 3W79A 1YB4A 4FFBA 4XDGA 4YMWA 4DBLC 3HKEB 1MOZA 1R0WA 2JFNA 5LMCA 1AB5A 3SQWA 4L6CA 1MG5A 1THTA 3FSGA 4QU9A 2XVAA 2AR9A 1GKIA 4MTCA 2NTJA 2GM4A 2O50A 2NW6A 3DEIA 2VEDA 3FMOB 3INGA 3N7TA 2LIPA 3NW9A 3TD6A 4F3RA 1RD4A 3T9EA 3R2JA 3RODA 3MWEB 1XEAA 1HGXA 3RANA 3AVYA 5HKLA 3I37X 4RF4A 1T8RA 4OQLA 3IS3A 1PTJC 3A14A 1SVLA 3CKMA 4KACA 1SJ9A 4K9NA 3MCZA 4TMXA 1Y7IA 5JG7A 3ZCSA 5KYWA 4KGVA 4E11A 4HL6A 1TKAA 1FLNA 1DE0A 3JQCA 4IXMA 1JLRA 1U0EA 3RT7A 3TR6A 4O4LA 3Q11A 4W1SA 2WVHA 1Z5NA 1U9JA 2QM3A 1NVAA 4BEBA 4QAQA 4OBBA 1CS0A 2JJ1D 1QE0A 2W2KB 3NGMA 4KQ1A 3SS9X 5L51A 1HNWB 1YRWA 2A9JA 5IMBA 4JASB 4NS4A 3CE6A 4DV3B 5LZ7A 2C5AA 1LBSA 2G4VA 1TC2A 4FZ3A 4QSMA 1Z7GA 3SC6A 4OL9A 3VR6D 1EG2A 1OBHA 2JAUA 2C9CA 5DXJA 3A9TA 5E4JA 1WZEA 5BR7A 3HNPA 1GO2A 2QZPA 2H1OA 1OA0A 3ZLJA 2PUVA 4J1QA 4X6YA 4HYQA 2C29D 2H3HA 1Z7BA 1P7ZA 2C1EA 1SUIA 2H7VA 5DNEA 3RSFA 3FDJA 1Y81A 2B83A 3A1NA 3F96A 3V1UA 1IAQA 1JYFA 1OC2A 1EP9A 3MWGA 1NY5A 1XE3A 5I9BA 1SKYE 5TPZA 4A6EA 4DSZA 2QYOA 4HXYA 4Z4CA 1NFFA 3W9BA 1PX0A 2DJIA 2C78A 1ULAA 1ZGZA 2R8RA 2IWRA 2IZ6A 1DEXA 2VP4A 2YXEA 3AP3A 3IPLA 4HPWA 4U7GA 1WMFA 3R8CA 4YCSA 5A03A 1I7QB 3UWOA 1P3Y1 5KVVA 3WOHA 1PZEA 2ZU0C 3E9ZA 1UBLS 4GM1A 3TKAA 3E1SA 4DLYA 4E22A 1OV4A 1U7OA 2HEGA 1VJGA 3MMXA 4QTZA 3ZBTA 3CBGA 3CX6A 2NZ8A 2ZBVA 4HFMA 5K6AC 4OLHA 3IT1A 3QE3A 4G2TA 2Q2NA 1IZ0A 3NBMA 4DLLA 3GFOA 2IOQA 1HE5A 3TVYA 5CTAA 1FS4A 1GP2A 4COKA 3AW9A 3UB3A 4WNCA 5JJKA 4C03A 1WXDA 2P2YA 3GA0A 2FN8A 4H7FA 3V8NA 3WIVA 1FMCA 3KXDA 3DLPX 4PX5A 3ZKAA 2EFJA 1U11A 2H2FA 3G2MA 5AW6A 5DHQA 2IODA 5AUNB 1H2WA 2HJ9A 3K96A 1ZZGA 3PU6A 4WXYB 4X41A 3BHIA 1RI2A 1KZHA 2WHPB 4S1OA 4BLWA 1AKEA 4QLAA 1C0IA 1OKKD 4HTFB 3B2EA 4ZVUA 3R7SA 3HACA 1EJ6A 2ZUEA 4J90A 2WIBA 4KQEA 1ND5A 3P9QA 1G8KA 2A88A 2IZ5A 1YC2A 2KM1A 2MSCB 2PRZA 2R87A 3CA8A 1Z4PX 3DVAA 1R0KA 5JZOA 3C5EA 2WDPA 1T43A 3GCGA 4LGVA 4CF6A 2Z2ZA 4MMYB 4XZ3A 2H4JA 2QLNA 4ZRMA 3VU9B 3WWPA 1KQGA 2I2AA 5BWBA 3M3HA 4ND3A 3KUKA 1B3RA 3HKBA 4PNPA 5CT6A 3TRDA 4D92A 1BVRA 3I09A 4DJAA 2Z8ZA 1BX0A 4E5PA 1I4TD 1AXEA 4HGOA 3JVVA 3ZCXA 4YPOA 3BGVA 4OYRA 1IM2A 4GI7A 3RFUA 3ZGLA 2LR0A 1ZU4A 3CONA 4INPA 4UXIA 3VR4H 2YMQA 4AVYA 1DQPA 2HJRA 3OZGA 1A88A 4NU0A 3QBJA 3HZZA 4LGYA 1XNRB 4AKGA 4CLHA 3HWSA 3O2QB 4FJ0A 4KREA 4HLQB 2F3SA 4FHEA 3BILA 4XFJA 1HSOA 2Y1GA 1R18A 1QZTA 2AXNA 3S99A 3GI1A 4H3HB 3I5YA 5LOVA 1C4OA 4QJBA 1Y1TA 3T5TA 1RWWA 1OZHA 1ZMTA 4GE0A 5JD4A 2GUGA 3SC2A 2I2FA 2OXRA 5CIYA 1ONSA 3A3YA 1R10A 4H16A 4KE7A 3RFTA 1AMNA 2NO1A 4OP3A 5BNIA 1CIVA 4GPTA 1M1YA 4LHEA 2ZJ8A 1CRZA 3EIXA 3FUUA 2ZYIA 2Q7XA 4KR2A 1GUZA 1A95A 2KYRA 4J4TA 2IEBA 3IA2A 3QI7A 5KOYA 1A7KA 4KMRA 3ZW9A 3CKLA 2Q4TA 2I55A 5HDQA 1UJ2A 2OXTA 4J16A 3CRZA 4EITA 5JJBA 4QGFA 3Q6IA 1XA4A 1K8QA 1DEHA 2P41A 2R1VB 3D6HA 3F3SA 1N6LA 2JA2A 4IFEA 3NKVA 4RX1A 3TW0A 1D2MA 2E4XA 3ILHA 4RMJA 4X8MA 3T5PA 1U8XX 5IT4A 2CNLA 2HSZA 3TFOA 5J59A 2BEJA 1NJ5A 1I2ZA 1Y5MA 3DOUA 3FF1A 2GZ3A 4DSUA 4LDPA 4TV9F 1KQ3A 1SURA 2GFIA 4D4HA 1TYEB 1PDVA 3H05A 5HCUA 1YMUA 2JASA 4C14A 4BXOB 4JEIA 1MDFA 2OHGA 3AR2A 3ZTWA 1GUYA 3GZNA 1JQ3A 2K2WA 1PTKA 1M2FA 2D1FA 2W2TA 3LHSA 4KYVA 5KYNA 4KFRA 4MW4A 1J97A 4FFNA 3H2GA 3ISVA 3O1JC 5JAOA 4HYYA 1RWPA 2VHTA 5KYYA 4QREA 1S7CA 1J49A 4LNHA 3X1MA 4IDHA 4PPNA 1CRLA 1BMDA 2BN4A 3BXHA 1FSSA 1ZJ6A 4LCEA 1FUUA 1CQWA 1QNFA 2QB5A 4KNVA 2OV6A 3GVXA 1FFXB 3HWX1 1V6CA 4RGYA 4R1LA 4BNTA 4FFWA 2ZR0A 3ZWPA 4PSKA 3G8AA 1PI3A 2UYOA 1E79D 1ZW1A 2XTMA 3DL2A 1G8HA 2AHOA 2ZK7A 1C81A 4H1TA 3AR4A 2ZT6A 2IYLD 4ID9A 1S8FA 4OAPA 4PLGA 4A0QA 3O8BA 4KAAA 5GPBA 5CFQA 4IWXA 1B23P 2PFSA 2GEFA 4ML3A 4KQ9A 2R68A 3B1WA 1EWTA 2RBKA 3HCFA 5GOTA 4JR0A 1KPGA 2FN3A 3ZGYA 4CCAA 3RWOA 2OD9A 4X8HA 4H1UA 5CXQA 1QG4A 1B73A 2RHCA 1XNHA 2Q5HA 3NTLA 3EXG2 3IAXA 4DVJA 2CL6X 4IOKA 4I99A 1TK3A 3L8MA 4NEHB 3MJEA 4HUJA 2DFTA 4Y98A 1N1MA 1MA3A 1NM5C 1NLMA 2KQUA 1XRJA 2VG8A 5HK8A 2WWWA 4Z9BA 2VDJA 4TTQA 1E4EB 2QXUA 4UEWA 1IHOA 1OYWA 2QRKA 3EOBI 2D2EA 1C8KA 2XNKA 5JSKA 1HE2A 1H66A 5J2TF 4BB0A 2F1OA 4EF6A 3M81A 2E87A 4EUSA 3H04A 3NM6B 4OM7A 1Z0KA 4R2MA 5REQB 3SFVA 3VDQA 1Y37A 4H31A 1UAGA 2Q27A 3HWRA 3ZWWA 3G1TA 3KHKA 1BXGB 1HFEL 1KY5A 3FOAA 4UE3S 4Y30A 5GOZA 1KORA 4JOBA 1EWKA 4II7A 4GRAA 1XPRA 4H7IA 1TF5A 3HDJA 3U2QA 1QFSA 2IZ1A 2HBRA 2ZDGA 1US8A 1IHPA 3P9XA 3QY0A 5ALIA 2J7PD 4JP8A 1XB2A 1JYSA 3BZUA 1I4OA 3DV0A 4RPCA 5BWNA 5JC1A 1MKYA 5IHPA 2ZP1A 1U28A 2D0DA 1P2UA 3CVJA 3IQDB 4JYMA 3MELA 4PF1A 2Q4RA 1Z7EA 1POXA 4EB8A 1JQAA 5HKAA 3UUWA 1SEPA 4WKBA 1N6PA 1M8PA 3ONNA 4QJ5A 3EGVA 4KAJA 3UWDA 1ZJ5A 2R66A 2VZLA 2WKQA 2YRFA 5TR9A 3LTNC 1UDBA <