4J0KA

Tannin acyl hydrolase in complex with ethyl gallate
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
470
structure length
454
Chain Sequence
b'SMSNRLIFDADWLVPEQVQVAGQAIQYYAARNIQYVQHPVAAIQVLNVFVPAAYLHGSSVNGYQRATAPILMPNTVGGYLPGPADDPQRVTWPTNAGTIQQALKRGYVVVAAGIRGRTTVDKSGQRVGQAPAFIVDMKAAIRYVKYNQGRLPGDANRIITNGTSAGGATSALAGASGNSAYFEPALTALGAAPATDDIFAVSAYCPIHNLEHADMAYEWQFNGINDWHRFEPVSGQLTVEEQALSLALKAQFSTYLNQLKLTASDGTHLTLNEAGMGSFRDVVRQLLISSAQTAFDQGTDIHKYAGFVVTGNQVTDLDLSAYLKSLTRMKAVPAFDQLDLTSPENNLFGDATAKAKHFTALAQTRSTVTAQLADAELIQAINPLSYLTSSQVAKHWRIRHGAADRDTSFAIPIILAIMLENHGYGIDFALPWDIPHSGDYDLGDLFSWIDGLCQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tannase
publication title Crystal structure of tannase from Lactobacillus plantarum
pubmed doi rcsb
source organism Lactobacillus plantarum
molecule tags Hydrolase
total genus 159
structure length 454
sequence length 470
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4j0kA00
2WIDA 2WJ4A 1MPXA 3STUA 2GBCA 3FOBA 5AICA 4AO7A 2QM0A 5A7GA 4TGLA 4Y9SA 3R3WA 4WFJA 5IVIA 1EI9A 2D5LA 1DWPA 2WU3A 2DHEA 5T4EA 1TKRA 3IUQA 4DSZA 3I28A 2I03A 2XLBA 1IUOA 1YCDA 1H2WA 4E14A 2BGRA 3QZUA 5JD4A 3R3YA 2PSDA 4TPKA 2RI6A 5HQ3B 3PFCA 3DDUA 2DR0A 4BDTA 3FVTA 5JAOA 3AZQA 2K2QB 2C5GA 1MX9A 1QIIA 4L9AA 1RYYA 3BXPA 1MO2A 4L0CA 5ALJA 5JZSA 2H7XA 4X00A 1XQWA 5ALFA 2JIDA 4GWLA 4QDUA 4UBJA 2HADA 1E8DA 3KOOA 4H7IA 2Z3ZA 2XMDA 4B82A 1F8UA 1YS1X 2O2IA 3L1JA 1YB6A 3GFFA 3GROA 5JADA 4QWWA 2P8SA 4K6KA 3LIIA 3WIOA 5KWJA 1X2BA 4J3JA 4B83A 4X90A 3B3QA 5A6VA 3I2FA 3VDXA 3VJKA 5HF8A 3AUKA 5DNWA 3WA6A 1XLWA 2XQJA 1O6FA 3IUJA 5HF6A 1GKLA 5AK4A 4BVJA 5YASA 2C4HA 3HRHA 1ZOIA 3MVEA 3EBLA 5K3BA 4DNOA 3WZMA 4AZ0A 1R9MA 5LIPA 2O7RA 1QGED 2HU8A 2HDWA 2E3JA 4FMPA 1ZGCA 3O9MA 4AQDA 1XZIA 4OYYA 5CXUA 1UK7A 2J4CA 3STXA 1LNSA 2X76A 2GBGA 5LZ2A 2XT0A 4DM7A 1QIGA 1P0IA 4A16A 5CT6A 1A8QA 2VQ6A 4ITVA 1GPKA 4B7ZA 5DYTA 1ZD4A 3V1LA 2WG0A 3STVA 1EDDA 1K6EA 1QIEA 4G9GA 4UFOA 4YX9A 4J03A 2Q0XA 5AOCA 1BS9A 5JZBA 1AGYA 5D7BA 1ODTC 5ALTA 4Q3LA 1IZ8A 3SWWA 4BZWA 3FSGA 1UT6A 4G4GA 1KEZA 4MEBA 5JAHA 1GXSA 5SYNA 4Y2VA 3O4IA 3D2AA 5AOBA 1ZGBA 2QUAA 4WJLA 1E8MA 4Y2XA 4F21A 3DD5A 3ED1A 1K4YA 2J3QA 2XDWA 4FKBA 4L3WA 1BCRA 3BWXA 5CT5A 1RWQA 2PPLA 2VJDA 4FLMA 2BKLA 2GBIA 5ALIA 2C0PA 2OQVA 4PO3X 1Q0ZA 2XUPA 2WU4A 4EUSA 4U2EA 2FX5A 5A71A 3WKCA 4FLEA 3WK9A 3K2IA 1QOZA 1UKCA 3GA7A 3WK6A 1CPYA 1ZI9A 1GQRA 4GEGA 3T52A 3G7NA 3WWDA 5HK8A 1OXMA 1PJAA 3G9ZA 1JU3A 3M81A 1EK1A 1E3QA 3FNBA 5DNUA 3ICWA 2V97A 1C4XA 1CR6A 4HRXA 1VKHA 1SOMA 2UZ0A 1XQVA 2GZSA 1P0QA 5K3AA 4K5QA 1N5MA 1WHTA 3HC7A 1P0MA 2WHQA 3R3VA 3C6XA 3WJ1A 5HFAA 2IX9A 5JARA 1AUOA 2XE4A 5LZ8A 3DJYA 3ICVA 2AXEA 1L7QA 3OG9A 3O9VA 4HXGA 5ALDA 2XQFA 3WKAA 1OCEA 1W1IA 3C87A 5HK9A 2XQIA 1AURA 1WCYA 4Y2JA 5AK3A 3ESDA 4F0JA 4BAZA 2WHRA 5EGNA 2JGJA 1W4LA 1JJBA 5DJ5A 3O95A 2H9YA 2G63A 2J4FA 5CXXA 1CUAA 1F0PA 2WFZA 3BF7A 4XX1A 3WQHA 4W63A 4QLOA 5T4HA 2XMGA 2AJDA 5K3CA 4AN0A 1TQHA 1XZMA 5ALXA 3V9AA 1GGVA 1XZKA 3W9BA 1UKAA 4LXGA 2WTMA 4B6GA 5AK6A 3QITA 4UHDA 1WPRA 3LLCA 5FXMA 2Y2VA 3RK4A 4NVRA 3V48A 2X8BA 1U2EA 3EIOA 2QTBA 1CVLA 4LKOA 4B9EA 1WM1A 5BWBA 1XRQA 3M3DA 2VJBA 4BAGA 4PW0A 1CUZA 3MUNA 2XI4A 3FCXA 2B4KA 2BUAA 4LYDA 4UBMA 3QVMA 4K6GA 5ALWA 3H2GA 1VA5A 3EF3A 1L7RA 4FLFA 1BCSA 4RE6A 1R9NA 1SCKA 1CUJA 1LPNA 5AI9A 3WI7A 2DQYA 3H2JA 3WWPA 5AK5A 3RLIA 3ZI7A 2PU7A 4H7DA 1ORWA 1UZAA 4QNNA 5AKHA 2XQKA 3WA7A 4KE9A 2DHDA 3ANTA 4CG3A 1ZIYA 1TCCA 1HL7A 5ALZA 4X93A 1QZ3A 1A8SA 3S2ZA 5C8ZA 4UHBA 2AJBA 1UK6A 2JBWA 4ZI5A 2BJHA 3O4HA 4FFWA 2QMQA 2PX6A 1LPOA 4WFKA 1XZCA 4X6XA 1QE3A 4H35A 4E46A 2WHPA 4JNCA 1JFRA 1QIHA 3R3XA 3DEAA 2DHCA 1QFMA 4PSCA 2WG2A 5F4ZA 2BFNA 4L72A 1YB7A 3CCBA 1FFBA 5AO9A 4B9AA 4B81A 4BRZA 4NMWA 5AM1A 4EHBA 2XMSA 3W2TA 1AKNA 5ALKA 2PBLA 4BTVA 5K3FB 2GYWA 5IVKA 4Q05A 4OB8A 1CUXA 4TVKA 1SFRA 2VSQA 4FFVA 5DTJA 4GI1A 3C8HA 3U1TA 3W04A 4RE5A 5LKRA 1QIDA 2HRQA 3HXKA 3DL4A 3W06A 1CUSA 1EVQA 3PF8A 2JEYA 3AIMA 2Y2UA 3BIWA 2WIKA 3C5WP 1UOOA 1EX9A 3AZOA 1Q0RA 1BEZA 3H0CA 5JYCA 1O6GA 2WQZA 1CUYA 4C89A 2XUHA 5AM0A 1CUHA 1BEEA 5LLSA 3YASA 4G5XA 2OCLA 2WM2A 5E2IA 2RAUA 1TK3A 2PUHA 5A7FA 4JEIA 1VE7A 1YSCA 4BAUA 4BCBA 4AB1A 5BOVA 1XZDA 2VT6A 2JGLA 2ZJ7A 4H77A 1J1IA 5AP9A 5SYMA 1EVEA 1JT2A 1YAHA 4HXEB 2FJPA 4B0OA 2RONA 2PSJA 2ZJ6A 2WKWA 4CIBA 1ETHA 4IHAA 3H2IA 5LZ7A 3WKDA 1XZJA 4P92A 4XVCA 4KAFA 4K6HA 4HVTA 1THGA 4BP9A 3C45A 2O2HA 2O7VA 4QZVA 3L1IA 4LXIA 1THTA 4PSUA 5AIBA 3D2BA 5EHZA 3NUZA 3NWOA 2GBFA 3DKRA 1DX6A 1I6WA 2XMQA 2OPHA 4N5IX 3BE8A 1BRTA 5E4JA 4QEKA 3PF9A 1XRNA 4X94A 2WIGA 3I2IA 1IZ7A 1E89A 4D9JA 4PSDA 3ZPXA 2OGZA 1MX5A 1LZKA 1SCIA 4IQ4A 3TJMA 4KE6A 5AI0A 2W22A 5AI4A 5DNVA 1CFJA 2VT7A 3WJ2A 4BVKA 1BE0A 4EB0A 1YA8A 2FUKA 2ORYA 2G5TA 2ROQA 1W6RA 4AMZA 2R11A 5FOQA 4OU4A 4XWGA 4RNCA 4KAAA 5JIBA 3AFIA 4ZGBA 5AIAA 4GECA 1F6WA 1XZAA 2Z8ZA 4KJXA 3I1IA 1HLGA 4H7KA 4FHZA 3DL7A 3FCYA 3MUOA 3QH4A 4U2BA 4QLAA 2WFLA 1B6GA 4P08A 5LZ4A 5I7UA 4KE7A 5AKKA 1U8EA 4UBNA 4DMFA 4K2AA 4CIAA 3FYTA 4I3FA 1XKLA 4F5ZA 4QDTA 4J0HA 5AM2A 5BWCA 4GLBA 4UBOA 2HFKA 4GDMA 1CUBA 5LZ9A 1HKHA 5JANA 4E11A 4OPMA 5IKXA 3BIXA 1BU8A 3RKSA 2QKYA 2HFJA 2YASA 4KYVA 4J0JA 2B9VA 5D3KA 4U2FA 5ALMA 1CEXA 3NGMA 3I6YA 1GZ7A 4ZWNA 4MYSA 1N1MA 2QZPA 3LS2A 1YR2A 1ZD5A 5EIEA 4QE3A 2QOEA 2XUFA 3DYVA 2QVBA 3P2MA 3DOIA 3GUUA 4AXBA 3QMMA 3A2NA 4FNGA 5ALOA 3H18A 2OXEA 4A23A 4KACA 3B5EA 4QDXA 5C8XA 1J07A 4W9RA 4H7FA 4M0MA 3FBWA 3G0DA 1CUGA 1WHSA 4Y2TA 1L7AA 3QBJA 1NU6A 4EY5A 5FP0A 5JASA 2WG1A 1OILA 4NZZA 1AMNA 4UHFA 4N5HX 4I19A 4Y2QA 5JAUA 2OLEA 4GW3A 4N8DA 3D5EA 4H7HA 4YPVA 2VAVA 2WUEA 4UBKA 3PE6A 3R3UA 1YA4A 2EDAA 2C5FA 5DLPA 3AINA 4Q34A 2OGTA 1JKMA 1G66A 2JEZA 5DYYA 3BJRA 5ALQA 2FJ0A 4EY6A 5FDFA 3K9BA 3G9XA 1XFDA 4PNZA 1F0NA 3F96A 2WJ3A 4BE9A 3EQ9A 1EK2A 2G4LA 2BAGA 3G0GA 1ODSA 1EH5A 3WMRA 4X3CA 1VOTA 1EXWA 3HABA 2R8BA 1YAJA 2WLSA 3M83A 3PUHA 1DINA 1MT3A 1Y7IA 1QJ4A 4P93A 2OGSA 2C58A 3BJMA 3WK8A 4BBZA 1LGYA 2VEOA 4H18A 3H17A 2ZYRA 1J2EA 1X70A 2VA9A 2XMRA 3F98A 4BB0A 3A6ZA 1JU4A 4QWMA 4GHWA 2HIHA 1UK9A 1MAAA 2XUAA 1H2YA 1XRRA 4DLNA 1JJFA 1R1DA 1EINA 3HEAA 4RPCA 4C4ZA 1AX9A 4HRYA 4XIIA 2IITA 4G8DA 2PL5A 1GPLA 4LHEA 3EQ7A 1UKBA 5A7HA 4G8BA 3ZWQA 5CH5A 4C01A 4CG2A 3F9CA 3STWA 2WJ6A 2XLCA 1VE6A 3FLBA 2JF0A 3QM1A 1XKTA 3NOXA 2QS9A 1G42A 2XUJA 4DYHA 4UFNA 5EHXA 4UPDA 3R3ZA 2QUBA 4O08A 4J0DA 1CRLA 2X5XA 2HHAA 4JUIA 1QO7A 2QR5A 4MXDA 2HA7A 5C81A 3R40A 5ALPA 2WSLA 4DNPA 2RIPA 4HAIA 1ZD2P 3QPCA 5EIHA 3KXPA 5AKGA 3IIIA 5ALNA 3V1MA 4HS9A 1K8QA 1R3DA 7YASA 1DX4A 5ALLA 4W1PA 1CUFA 3PDCA 2YH2A 1UK8A 4IH4A 4AMYA 3UUEA 1XZEA 4OB7A 3Q8WA 2HA3A 5FKJA 4M0FA 2C0QA 4UHCA 4M0EA 1IVYA 2WIFA 5A62A 1CIJA 5KWIA 2WTNA 3I2KA 5D3ZA 2QT9A 1CUUA 3IDAA 2ZYIA 4WY8A 1YS2X 1GQSA 1VZ3A 4BRSA 4OUKX 1CUVA 4EZIA 4BVLA 2OAEA 2ZJFA 4ARAA 4F60A 1Z68A 1K5PA 3VJLA 1A7UA 2VF2A 4N8SA 4J0GA 3FLEA 4B80A 2AJCA 1JJIA 3QYJA 2XUQA 5K3DA 3AIOA 5CRIA 1XZBA 3WL6A 2ONCA 5I9IA 1UXOA 3BDIA 3FYUC 5CW2A 1FFCA 2PU5A 3TGLA 2RHWA 5JD6A 1B41A 1WB4A 1QTIA 4ARBA 3V1NA 5DWDA 3F97A 4BC0A 2PKYX 1BN6A 2XMBA 1U65A 5ALSA 1GKKA 3WK5A 1M33A 4G4IA 2I3ZA 2BUCA 3FSGD 3WWEA 3CN7A 3G9UA 1BROA 5T4FA 2WHPB 3G9TA 3F67A 4UUQA 5FPQA 3C70A 4X7BA 2WUDA 4CCYA 1LPPA 3JYHA 3WL8A 2EEPA 3AZPA 1FJ2A 3E1GA 4OB6A 1VZ2A 5E4YA 4BCCA 6YASA 3H1AA 3MGAA 4WDRA 2ACEA 3JWEA 1DT5A 4Y2RA 3I2JA 3KWFA 1ZI6A 3GZJA 1E5TA 5AI6A 4CFSA 1ODCA 4UBIA 3B12A 2JGIA 1GPNA 3WZLA 1XZGA 4AN1A 2HRRA 4YASA 4DTCA 4DNQA 1WB5A 5AJHA 4YK7A 1CUDA 3OURA 4G4JA 4H0CA 2I78A 4H7JA 4C87A 1FSSA 3OTQA 2XUDA 3WIBA 1TIBA 5HFNA 3BL8A 3VVLA 1MTZA 2Y6UA 4MEAA 4FOLA 3OPMA 1LPMA 3CN9A 1TCAA 2RGUA 2OAGA 1QFSA 4MJ3A 4U2DA 1QTRA 3WKEA 5C8VA 4ZXFA 3WYDA 4HXFB 2QXUA 5LKAA 1ZJ5A 1LPBB 5AH0A 5ALRA 5ALVA 1ZJ4A 4EY8A 1WOMA 2Y6VA 3C8DA 3GELA 5CURA 5AKEA 4LYEA 1ACLA 2WFMA 3HSSA 4FBLA 4AZ3A 3FYUA 1FFAA 3G8YA 3O4GA 4ETWA 3W9UA 2HA2A 3G0IA 4H7EA 2BUBA 4Q1VA 1DWOA 2PVSA 1E66A 5CTAA 3LIPA 3WK4A 1K63A 5JD5A 1QIFA 1XRPA 2GYVA 2XQGA 1AZWA 3DYIA 2RHTA 3L1HA 4X92A 3FLAA 1UWCA 4OYLA 4B84A 1XZFA 3VVMA 1WPXA 3KDAA 2DSNA 4AO6A 2CUTA 4MQMA 5CMLA 4G9EA 3T4UA 4BTLA 3IA2A 1G5FA 2OCKA 2HU5A 5EFZA 1MX1A 1A88A 1LPAB 2D0DA 4INZA 5HQ3A 1VXOA 5H3HA 1DQYA 3PUIA 3SK0A 3R41A 3VJMA 4ZV9A 1CV2A 5K3EA 1MAHA 4Y2YA 3LP5A 5HF5A 3STYA 2HA4A 4DGQA 5I8PA 5AM3A 3G0BA 2HL6A 4WY5A 2DCMA 4CI9A 3BF8A 1S8OA 2ZYHA 1GT6A 2QRUA 5EIAA 3BDVA 2O2GA 2J3DA 1XLUA 4OU5A 2WFLB 1Q83A 4X85A 1R50A 4Q3OA 1ZIXA 4ZV7A 1LPSA 4JYMA 1R4ZA 2DQZA 2HM7A 1USWA 4X6YA 1KU6A 3I2GA 1DT3A 1A8UA 5ALYA 4EY7A 3D2CA 2BCEA 2OCIA 4QA9A 5JALA 1TCBA 2CBGA 4KE8A 4ROTA 1NU8A 3WK7A 2Z5GA 4B85A 4J0KA 1BN7A 5AKJA 3QMVA 2I3DA 5FRDA 2QJWA 3ESAA 3PICA 1XLVA 3DCNA 1X2EA 3FVRA 3WWOA 4ZREA 1ACJA 3O0DA 1H2ZA 3HACA 3OOSA 4DNFA 1JMYA 2PSFA 4FDMA 3SC2A 5AKXA 1SC9A 5JATA 2CMFA 4B0PA 3A2LA 3D3NA 3RM3A 1MU0A 3C43A 3E4DA 3C6ZA 3ZLUA 1XQYA 4Y2SA 5J3JA 3OM8A 4X71A 2QXTA 3D59A 3HI4A 3H1BA 5CT8A 5ESRA 3C6YA 4HZGA 5CH3A 1MNQA 3WKBA 5CBKA 3HLKA 3O4JA 4FNMA 4BCDA 1EHYA 1JI3A 4EA6A 2XMCA 1Y7HA 1AC5A 2OG1A 3EQ8A 4KAJA 4NS4A 1PFQA 3DKKA 5ALUA 1ZD3A 4DMHA 3G0CA 3I2HA 3UMJA 1UOQA 4BDSA 1MJ5A 3VISA 1U4NA 4CCWA 3VXKA 1CUIA 1W75A 5AKYA 1UFOA 4X95A 3ESCA 4UHHA 5ALGA 1ZICA 3X3HA 5JZ9A 3IB3A 3DS8A 3C5VA 3UUFA 1ZI8A 1QIMA 2IIVA 3AILA 4QDZA 5EHNA 1IMJA 4LIPD 1E8NA 5HF9A 4C88A 2XUGA 1ISPA 3N2ZB 2PSHA 1XRLA 3JW8A 5AI8A 2CJPA 1FFEA 2ZVDA 3PI6A 1TAHA 2WILA 1J06A 1QLWA 5DYWA 1CQZA 1LLFA 3OC0A 4AX4A 2OCGA 4Y2PA 3ESBA 2HA0A 2WUFA 3C6BA 1QIJA 2PUJA 3QPAA 5HZGA 3F8SA 1QIKA 2ZYSA 5CT4A 4XJVA 1VA4A 4W1SA 3M82A 3STTA 2EDCA 4X91A 1CQWA 2JGFA 1C7JA 1Q84A 5D6OA 1FFDA 2PM8A 4FWBA 2ES4A 1IUPA 2XMZA 3H2KA 2CB9A 4Z49A 2ZSHA 4RGYA 1NX9A 3IBTA 4N8EA 1MN6A 4UHEA 4Q82A 5FUMA 5JAPA 3PFBA 4GBGA 5E4TA 1XRMA 4MQLA 1EDEA 3CXUA 4EBBA 5AHXA 5AM4A 4Y2UA 1XZLA 4Q3KA 2V9ZA 3IUNA 4KRXA 4WCVA 2ACKA 3K6KA 2HU7A 4G8CA 5ALHA 4JYPA 3DNMA 1WB6A 4J0CA 5IVHA 1XROA 1CUWA 1LBTA 2OQIA 2Y1KA 3QPDA 5LP1A 1R88A 5AI5A 5K5EA 5T4BA 3IVMA 5AKLA 3R0VA 1XZHA 1T4MA 2CZQA 3IULA 1HPLA 2B61A 3HZOA 4U2CA 2GZRA 1C7IA 4LXHA 3QMWA 1HBJA 3HJUA 1EB9A 4C4XA 3CCCA 2AJ8A 5DTIA 4CG1A 1YASA 1HQDA 5C7YA 3GBSA 5AOAA 2VJCA 1KU0A 4UBLA 4P9NA 5ISMA 5HKBA 4QDOA 3ZV7A 1MNAA 2HA6A 3ANSA 3LCRA 3H04A 1H23A 4GXNA 2YYSA 2WIJA 2VTVA 2XUKA 3IUMA 4ZRDA 5KREA 1RP1A 3W05A 3Q0TA 4J0IA 3DLTA 2B20A 4UFPA 3HYSA 3S8YA 2XB6A 4W1RA 5BV7A 3A2MA 4V2IA 1DTEA 1VXRA 3WLAA 1P0PA 3KWJA 4FBMA 1EDBA 4BZZA 1Y37A 4HTAA 4IH9A 3WYNA 3WL5A 1DU4A 5IVDA 1SCQA 4PV7A 4U2GA 2JGKA 3WL7A 3TEJA 1VJ5A 1IUNA 2PSEA 4MWSA 1CUEA 1D07A 1PV1A 2H7CA 4C4YA 3A70A 2HA5A 5LYYA 1EA5A 2CKMA 2G5PA 5FLKA 4W1QA 4BYMA 1N5RA 3ZLTA 4KEAA 2QJRA 1CLEA 3SX4A 4WFIA 5AKZA 3I6MA 2WUGA 4EY4A 4PQEA 2JGMA 3AIKA 3I6ZA 3U0VA 4KRYA 1T2NA 2VJAA 2VATA 3KD2A 4X97A 4CCYB 5K3FA 2DFPA 1ORVA 5FPPA 1LZLA 1LBSA 2VAXA 2YXPX 4BE4A 1N8SA 3ILSA 3RARA 5EHQA 4AO8A 5KBYA 4DMKA 4BATA 2NW6A 3V1KA 2H7YA 3D0KA 2XUIA 2ECFA 1UOPA 1VLQA 5EI5A 4BC1A 4WDQA 5IH7A 3D7RA 5CT9A 4G1FA 4MWTA 1W76A 1AQLA 3WWCA 2H1IA 5HCUA 4DMCA 4I4CA 1CUCA 4IH1A 3FWHA 2Z3WA 1TRHA 1W52X 5AKIA 1XQXA 2V98A 3DQZA 4Y7DA 2CEKA 2C7BA 4X6UA 1QONA 2V96A 1QO9A 2LIPA 4DIUA 3KSRA 4OSEA 4JH0A 1H2XA 4J7AA 1DQZA 4FTWA 1JMKC 3TRDA 4IO0A 4BP8A 5A2GA 2Z8XA 3N0TA 3DOHA 2ZSIA 4OCZA 5ALEA 1H22A 2XUOA 3ZLVA 3FAKA 5LZ5A 4DSAA 5FV4A 5HKAA 3I1YA 3D4LA 3G02A 4KR0A 4MYDA 2GYUA 4PF1A 3VKFA 2W6CX 1HDEA 4OD0A 2AJLI 5AM5A 4C6HA 3IURA 5CH8A 3H19A 1DWQA 3E0XA 4S0XA 1EB8A 3E3AA 2JGEA 2BGNA 3FYUB 3H2HA 4A5SA 4E15A 1G4HA 3AJAA
chains in the Genus database with same CATH superfamily
4PPGA 4AMBA 4CLRA 5FNVF 5TB5A 1TK9A 4N9WA 3FFAA 4QEZA 5KNCH 5AW8A 4C3VA 1SKAA 2G1KA 3GY0A 3HKDA 4I5GA 2VP6A 3FOBA 2AFRA 3G3EA 3L7BA 5FYQA 5D7NA 5AICA 2B34A 3D4OA 4L5JA 4WKPA 2NPOA 1DC8A 4OIMA 3F5SA 3ETCA 3OA2A 3VKHA 2FRDA 2C5LA 1I3NA 4TGLA 4NQRA 3I72A 4YT4A 5D01A 4GLFA 2P9ZA 3PC2A 2PT6A 3MERA 3KYDB 4LV8B 2ZRGA 3ED5A 1J8YF 3I83A 2NSDA 3EQ6A 4UD2A 3U3XA 4EWLA 2HJHA 1AMOA 3NH9A 1XHEA 4PHGA 3VKWA 5T4EA 1ZH6A 2NTJA 4N4AA 1RRGA 1LF5A 2JJMA 3NHZA 2OSVA 4NMLA 1K08A 3QVUA 3L5KA 4RSHA 4FMCF 4CODB 1YU9A 1B2LA 1IUOA 1SRRA 5HMMA 3I2YX 1O8BA 4JLBA 3Q3CA 4LTNA 1LDMA 3TIFA 1Z6TA 1E1QA 3WTBA 3BQ9A 4C0WA 5HVNA 1ONBA 2J6IA 3DB2A 3AF3A 3F74A 3D4IA 3H83A 1HI9A 4E3ZA 1F1JA 3M5PA 1ZL0A 4AP6A 2W90A 4MVWA 1WG8A 3CR8A 4WKCA 4JBYA 5M2QA 4GSKA 1WV0A 2Z2JA 4G1VA 3AKZA 4UXJA 2IHVA 4C7OB 1D6SA 3MN1A 3E9QA 1RRPA 4HX5A 1CF2O 4K9DA 3GFVA 1Q0HA 3MT0A 3R6GA 4DCMA 4E22A 3KJHA 2AUTA 2LUOA 3FFBA 2XKAA 1WAMA 2V4MA 2B5WA 4RK6A 4PNEA 4Q9NA 1DSSG 1J5EB 1LY1A 4RWEA 3KZCA 2PUVA 1IAQA 3UPUA 1P9LA 1RQXA 3B82A 3DDHA 3DW1X 3RO7A 4OQLA 1FDWA 2JD1A 3BXPA 3I5UA 3CZQA 2GEKA 2XGJA 2P7HA 1XQWA 1J8MF 3G2LA 3ON5A 2FZ5A 4ZYVA 3EXHB 3DF9A 1O97D 1JQ3A 1OZHA 1N75A 3TLEA 3QBDA 4BLQA 3C97A 1JHZA 2Q5EA 2HADA 1ZNWA 3DLCA 2O2SA 3KOOA 2Z3ZA 1H93A 1AA6A 1F8UA 1CS0A 4A1FA 4RLFA 5DNAA 2O2IA 5JO9A 4MA0A 1QHHA 3L1JA 1YB6A 4QAQA 5FOSA 1DIHA 2VHZA 3TGWA 1K5HA 4YXWD 4X41A 3W7AA 2PVCA 2Q6IA 3CLSC 2WOOA 4O8CA 3FNFA 5DM4A 4BV9A 1XPJA 2J48A 4IV5A 4QWWA 5K0ZA 2QNIA 2P8SA 3OPYB 3PYLA 2GZ3A 1V25A 5K0BA 3WSWA 2VTDA 4JYCA 3WIOA 2A0WA 3IR5A 1L4EA 1JA9A 2WIAA 2Q3DA 4W5HA 3ZDZB 3LL4A 1PSWA 3ZJUA 1X6VA 1W8DA 4N03A 3X1KA 1ZN8A 5DHUA 2PWBA 4KN8A 5DNWA 2HF9A 3IQWA 1AGPA 1LW6E 4CF3A 3E2PA 2PDAA 1XLTA 5EWJB 5I48A 5CX1A 4MSUA 3G1TA 1TT5B 2ECPA 1QOPB 2XVZA 4L2IA 3U7EB 3IUJA 5FWNA 5JSQA 1XNGA 3KDSE 3QKRB 4H0FA 1NATA 2YVAA 4ARZA 3BORA 1RWMA 3D8RA 1CTQA 3L8DA 3MMZA 4AM8A 1GKLA 4OQQA 5I9NA 3NBFA 3ACCA 2FWRA 3P2KA 1UJ2A 2VJMB 3FWKA 5FBQB 5YASA 3HRHA 1ZOIA 5CW1A 2FRXA 3IV6A 2FQYA 5C3MA 3C4JA 3EEQA 1BDJA 2DAPA 3EBLA 3MELA 5JSYA 2YWRA 2QX6A 3JQ9A 2AC7A 2WT8A 3LWBA 4N8DA 4RQAA 2M1ZA 1AG9A 3WZMA 4UNRA 5A9SA 1G5HA 2VJOA 1WU8A 5BWOA 1GTRA 1GLVA 1KYIA 1U02A 1I2BA 2HPZA 4I4TB 5CM9C 5LIPA 3L0OA 2DSTA 5HIAA 2HDWA 1TTHA 4URYR 2F48A 3S4YA 1FMJA 3RC2A 3DE4X 3S44A 3TSCA 3U4HA 1ZGCA 4U5QA 2HXSA 4K9SA 3M6IA 2YY7A 1F48A 3DPSA 3AFNA 1Z83A 4DV6B 2F3QA 1P4GA 1C0PA 4OYYA 4FCWA 3UT6A 1Z5OA 5BSTA 1SVOA 3STXA 4D9BA 4NCBA 3TCXB 2XEXA 1S01A 3CUUA 1X80B 3VZCA 2MU1A 2ZM5A 1ULSA 3ZWAA 2VRBA 3GJRA 3TLJA 5LDHA 2W6ZA 1Z4MA 3BFKA 1XD9A 1J9EA 1DUIA 3E03A 2I55A 5AHOA 1P0IA 2IP4A 4REQB 5IX8A 1IN1A 2XT9A 2H1WA 1P7YA 4ZO6A 2G83A 1A8QA 2Q4TA 5I9SA 4JFAA 1R6BX 3UJ3X 4BKPA 1NWHA 4WD3A 3PITA 4HQRA 3UO8B 4B7ZA 4WZBB 3EF1A 3BILA 4ARCA 5DYTA 1U7WA 4FR5A 4EB8A 3KSUA 2XD9A 3RGGA 2WG0A 4JXZA 1EDDA 1FP1D 2ERCA 3I9V6 3Q5EA 1HMYA 1QIEA 2YC4C 3S68A 4DLAA 3DC2A 4B48A 1ECCA 4B5KA 1JBKA 1PK9A 3DWFA 4FEGA 3VR4D 1VM6A 3ZR4B 3Q7IA 3WNQA 2JDID 3AU9A 2ZRAA 4ZQBA 1ORIA 1UDCA 1KYZA 4NS1A 4QU9A 4XI9A 5ALTA 3U0BA 4BU1A 3QE4A 5AHRA 4YMIA 4EAQA 3AQ4A 4YS6A 3IE1A 1GQQA 3MZ0A 1I4WA 1Q0PA 3V8QA 3CW2A 1K8XB 1SXIA 4BZWA 1QUFA 4G4GA 1KEZA 3UJBA 1LQUA 3FDIA 3PXCX 1BTOA 2AFHE 2D5BA 4MEBA 4OMFG 3VVCA 2VP2A 3MRSA 1G6KA 5A4JA 4GKJB 3QE2A 3OFVA 4B7XA 3OQVA 2FOXA 1XEXA 1ZG3A 1T9DA 4O6VA 2PLNA 3O4IA 4HN4B 4F3CA 3D2AA 2ZI4A 2FG7C 2QUAA 3NIDB 3CW9A 3OH8A 4I0WB 1E8MA 2IYXA 1DG9A 4Y2XA 1K8RA 1DAFA 1RYEA 2GASA 5EHGA 2G04A 3UPDA 2Q62A 1K4YA 1OT5A 2C29D 3HXLA 1KERA 1WXGA 2J3QA 4N40A 4NV1A 4K9PA 3ROFA 2IZ0A 4CDGA 2VO1A 1EUCA 1PZEA 2PPLA 4ARSA 1J42A 1OR8A 1E62A 4LXQA 4KHPB 1NBOA 1NKSA 1FQJA 2KQUA 5CEFA 2GBIA 2NV0A 5KQPA 2IA5A 4R2WA 3UENA 4DUGA 2EV9A 3RHFA 4UVHA 3UHOA 5FAKA 4UXHA 4LA4A 2WSIA 1I24A 2OQVA 1FNSA 1WX1A 2A9QA 4LY6A 3KU4A 5COQA 1J5PA 1J2UA 3O3NB 2P9FA 2X0IA 3OQ1A 1JXAA 4EUSA 2P41A 2AN4A 4LOLA 3I8XA 4HNAB 3JXEA 3RVLA 4FLEA 3WK9A 3X44A 2BTOA 2UZ1B 3K2IA 4WACA 1KYVA 2H57A 4C4PA 2DKFA 1SUPA 1TMOA 4FE3A 4JR0A 3R0QA 4L85A 1R4AA 3T52A 1E2UA 1SH7A 4ZODA 5ED4A 1ZUWA 2O8BB 4RAQA 3PCRB 3KQOA 5HK8A 4HN2A 3M81A 3TDNA 1T0UA 2VJPA 5KSOA 1ADYA 5KYYA 1KS9A 3LSTA 1UT8A 3K70B 3FNBA 4WZAB 1KQ3A 1PFYA 3FY4A 2V97A 2BGKA 4XX0A 1JLRA 3FZYA 1CR6A 4F9EA 3NBZC 1VKHA 4LF7B 1C1HA 3NLLA 3PSAA 5CPFA 2QX8A 6REQB 2TMGA 2GZSA 2RGYA 3CUYA 2QDKA 3CZRA 3IALA 4M53A 4K5QA 3IT1A 5K3AA 2JGDA 2PRYA 4WLFA 3U49A 1AUVA 1CJVC 5FUBA 1AKTA 1P0MA 3TDKA 1QGUA 1TM4E 3T12A 1BHO1 4ZEMA 1MEOA 5HFAA 1IEXA 1CJSA 3F7OA 1NRWA 4BNLA 1B73A 2V7QA 1IXRC 4NAHA 1C7QA 2OQRA 2XE4A 1X9IA 3G23A 2RHHA 3DJYA 3H6GA 3PE4A 3AEQB 3NHWA 4MVJG 5LZ8A 2K4MA 4Z2YA 1C9EA 1L7QA 1ZRHA 3ZI0A 1RWPA 3DFFA 3F49S 1T3TA 4JVSB 2I6QA 4B40A 1NFQA 3IAS1 2IX3A 3NANA 2MMCA 3NHMA 4AY3A 4CM7A 4IZOA 2QBYA 1OCEA 3D02A 2WJHA 4I5FA 1YQUA 2IYEA 2UVQA 3C87A 4HDRB 3ODPA 1FUKA 1XF9A 3M9XA 1NW4A 2HIGA 2XQIA 3ZHTA 3R0XA 1PLLA 3B2QA 4Y2JA 5AK3A 3BZWA 3OJWA 4XDZA 5M3BA 3AKCA 3SPXA 3KQNA 3ET4A 1LWNA 2OP0A 1PI3A 4WGGA 4PFJA 4WBNB 4YLEA 1VCMA 4ABYA 1JJBA 2FP4B 4JOCA 4YRDA 3V34A 3KQLA 4UEWA 5DJ5A 1COZA 1N6OA 3DCJA 5IXSA 2G63A 2ID8A 3COPA 1P2DA 1I4LD 3QFTA 4LDZA 5JQGB 5CXXA 4BVHA 1F0PA 4EY3A 1KSJA 2B8EA 4PZUA 4DHWA 4BO0A 1EG2A 1JT9A 5J47A 3BF7A 3O0TA 2ZPAA 2IWHA 1BFUA 5AVSA 3CA8A 3OF3A 2BEWA 3B6MA 3HHEA 4JASB 2OUKA 5DI9A 1TIPA 2OFXA 2PX5A 4H6PA 2ODBA 1QRDA 2XMGA 2YXDA 3NONA 1DAOA 5T4HA 3VPHA 2YYYA 6GPBA 3S55A 3GLFE 2IPLA 2ZTLA 1PQWA 3F5FA 1VLJA 4XYGA 1OB2A 1NOIA 4V0OA 1GV0A 2VI5A 1GGVA 2BR4A 1WUKS 3DM5A 2ADFA 3HBAA 2IYTA 4LJLA 4J1TA 1MB9A 3I3SR 2Q07A 4CQMD 2B92A 4EJSC 1IZZA 1U2TA 3Q4GA 1YNOA 3NJ4A 4KNYA 1OWOA 1E6EA 1S2MA 3V48A 4BGVA 1ZXBA 1EGHA 2X8BA 2HMWA 4TL8A 4HNUA 1U2EA 3AUXA 4H7PA 5LOVB 1G21A 1OIXA 3BTVA 1C1DB 5KTOA 1R0RE 1Z4JA 2FMHA 2QROA 2VUHB 1MC8A 5GOTA 3HK2A 2WRZA 4RTPA 5BWBA 3VYSB 2GERA 1MH1A 1XRQA 2B4RO 2FZVA 2GO7A 2SICE 2VJBA 2Y67A 3HZRA 1H1DA 4PW0A 3M3DA 3A3OA 4BAGA 4BN5A 1E2QA 1IY9A 1W44A 2BFMA 1KVTA 3N75A 3ZIAA 1CUZA 3UBTA 3NR2A 3AR8A 1VHJA 4DA7A 1FUUA 3S6JA 4IIHA 3WLHA 2XCQA 3IVAA 1IBCA 3GH3A 5LWHA 1V8DA 1PR3A 2QMUA 4ZAXA 4ZI7B 5ALWA 1DEHA 2BELA 4AJIA 3K20A 4NBSA 8OHMA 3S0JA 3UANA 1BA3A 1VA5A 4IWNA 1NJFA 3FROA 1BC5A 2BEVB 3EF3A 4MR7B 4WEQA 4Q7JB 3IFSA 5HKKD 3JAMA 2PD3A 3OHSX 1RRCA 3NV7A 2I29A 2WVAA 5MN6A 4LNUB 4TV8B 4I55A 1U0LA 2CMKA 2JHGA 2HHHB 3ENZA 2NN3C 4NCNA 1R9NA 1RZRD 3KQHA 3AOGA 4FGWA 5AVQA 4JJ6A 2PZJA 2F59A 1SCKA 4XW2A 4YIHA 1LPNA 2QL5A 4N41A 3LYAA 2PEZA 5DTEA 1S3GA 3RV3A 3IEMA 3RVBA 3ZI7A 1SVIA 2PU7A 1N7JA 2AOUA 4EJ2A 4BQFA 4JLUA 3AH8A 2A0FA 3WOHA 1SA0A 1ORWA 3CLUD 1YJ5A 2GKOA 1JDZA 4LKRA 1D2CA 2RAVA 5CFNA 4YFYA 3DQQA 2K7ZA 2OV2A 3DZHA 5AOVA 1I5RA 3RSOA 4DJEC 1TW3A 1GCAA 2XYPA 5D86A 1GR1A 3G6WA 2IYAA 1L1QA 1PJRA 1VJTA 2J3IA 1D6JA 2OZPA 2ZBFA 3IESA 3OZXA 3R7NA 3RS3A 2DEUA 1TCCA 3HVRA 2EERA 1R0ZA 5IDVA 4DLYA 4PZCA 3JRNA 5H82A 4X93A 1QZ3A 4IIYA 3HG7A 3OZRA 4UHBA 3VPCA 3ZE7A 2CSXA 2NO4A 5L6LB 1ORDA 4FT4A 1T0BA 4QICA 2AJBA 4CNQA 1WXHA 1IG0A 3CF4G 2HWXA 1JEAA 3TW8B 1XPRA 2BJHA 3V8BA 2QMQA 1OWMA 4RVHA 3UMRA 4ALKA 4O8ZA 1AUQA 3LTEA 3IOMA 4HDMB 3BKXA 3T99A 4OHRA 4MS1B 1IJEA 4NHOA 4YJ3F 2CE7A 4I8DA 1YIDA 4LE0A 5FNZA 4ETMA 2VH2A 4DZTA 5BSKA 5BN5A 1DV2A 3CEHA 1AGNA 3DFIA 3L40A 4H35A 5CA1A 4IS2A 1PVDA 5F1PA 4CKZA 3WIUA 4MLDA 2VF5X 4EUHA 1N3YA 4CNBA 1JFRA 3E9RA 3GDWA 4FWIB 4KDCA 4YRPA 3HTXA 2YXNA 4YECA 2VDLB 3T61A 5TRTA 4HWPA 1QFMA 1T0IA 4MI3A 5CB4A 4QKQA 2OBMA 3D7NA 5FCDA 2FQ1A 2YYAA 3RFUA 3A4YA 4G0ZA 4HFJA 2DULA 3OT4A 3SQOA 1WRBA 4LYAA 4W7IA 4RFSA 5C35A 1WZIA 2XRFA 4K3VA 2C5SA 4RKFA 3EFOA 4BRZA 5F23A 3RIXA 4NMWA 3BMNB 1YTUA 3IPRA 1I1NA 2P11A 1NSYA 3MTBA 4NE7A 4GL2A 3LXRA 4FGUA 2AJTA 2IIPA 4RHTA 4I36A 3RS9A 3W2TA 1W87A 4B6FA 2P0YA 3TXXA 1H1LB 3PEEA 2R8OA 5HDQA 4MLZA 3W9YA 1Z47A 2P3QA 4BTVA 4C29A 4Z3OA 1O5TA 1MC4A 3JSAA 2I8LA 4RFVA 3EC2A 3HCDA 1KR2A 3WHPA 1KPHA 1XXHB 4TVKA 1UBKS 1X1QA 1EMDA 1GUZA 5ES4B 3TFOA 3N0XA 5FD8A 3UMFA 1BXGA 4HLQB 2NVBA 3ZVKA 1KVQA 1DP4A 1BX1A 2ZWIA 1MRNA 1V41E 4DR1B 1Z36A 4RE5A 1G16A 3MNFA 3T7KA 3TL6A 3NIFB 1ZH8A 3HXKA 3AJDA 3DL4A 3LUCA 3QVGA 5K8CA 3CUEF 2RAFA 3CLSD 4DCCA 1WB9A 4OQXA 4HH3C 1H3EA 3KZ1E 1MQ9A 4X9XA 1THZA 2QN3A 1N1EA 1SCBA 2EZ8A 2XYGA 3GLHE 1CJMA 3PF8A 4QYXA 4TV9B 4X61A 2EIXA 3BIWA 4D9EA 1RM0A 3RIEA 2C03A 2PRZA 4PFQA 4CPDA 3EG9A 2OWDA 3IPXA 1UOOA 3GAZA 4FE7A 5IDQA 3IEKA 4G5GA 4ZJZA 3EPRA 3GOQA 5K0SA 5ERYA 4N76A 3B38A 3BD8A 1Q0RA 2QW1A 4ZYZA 3M4NA 4RMJA 1QKIA 2VPQA 3GW8A 2E2WA 4W6ZA 3SNKA 4FM9A 1YZNA 1AHPA 4U6NA 1U2RA 2HSDA 4WXRA 1FYWA 3USES 1YK0A 2H4XA 3BMOB 2R87A 3RVJA 2ZIXA 1Z0SA 3HJBA 2RGGA 1XJQA 4XWKA 3U4IA 4D0NA 2HJWA 5LLSA 1SQGA 3RRXA 3OZAA 3ROKA 3T7EA 1Z2PX 2MINA 5KYUB 3GHHA 2JIZA 4HF7A 1V9SA 3R3HA 4CM9D 1V39A 3CVVA 3ILHA 3PD0A 4LRSB 4P58A 4JEIA 2QMYA 1YXMA 3ANYB 3NPAA 4LCBA 4C2AA 1V43A 1EFVA 2J6BA 3PDJA 3PXBA 3R4CA 4M1ZA 4RACA 3HXOA 3OX2A 4MINA 1UBRS 3BSYA 4MUNA 4RA6B 4XE5A 1V1MB 1E0DA 2ZS8A 5BOVA 1ILEA 4LVCA 3GH1A 2VT6A 3GVHA 1PFWA 3QMPA 3ZZMA 3EOAI 3PKJA 1Y3CE 3AYXB 5JZOA 4ND5A 3H5NA 3RIYA 4H77A 4DRXA 4PTYA 4Q1EA 1Z5ZA 2AS0A 3RH0A 1OY1A 1JXQA 2O3TA 2ZUVA 4RK5A 4WFQA 2R7KA 5DN9A 2UU9B 4QD3A 4CIYA 1JT2A 1YZLA 2XY4A 5DI3B 3AESB 3I04M 1ZM9A 4BNZA 4NZPA 2JJYA 5DCYA 1M72A 2AFHB 2PSJA 2ZJ6A 2AOTB 2RIRA 4PPYA 3WQSB 5CCBA 4CIBA 2ECOA 4LRUA 1V16A 1PLJA 1RCFA 1ETHA 3I5MA 4RJKA 4K86A 5EJAA 2P79A 1B00A 3W5CA 1Z6QA 2X7XA 1TAQA 1Z15A 3H2IA 3KS9A 2IEBA 3NTUA 5LZ7A 2PA0A 1YUNA 1XZJA 3NB0A 4P92A 4LDRA 4PN7A 1LUAA 3FHJA 2ONZA 1GG9A 2RSLA 3BBPA 3R76A 4DCTA 1RW4A 4KAFA 1S96A 1THGA 4HVTA 1R66A 2P2YA 4AWXA 4EJ0A 1A9YA 2O7VA 1WQ3A 2FVYA 3QTBA 5ITSA 4KGDA 1X7YB 2H85A 2XW6A 3OQPA 3T7JA 3LDUA 2YWCA 3SS7X 3D2BA 4KQEA 4XYMA 1A95A 4AJPA 1GL3A 4RX1A 3J7TA 1AS2A 2ZJYA 2OTCA 1I6WA 3ADOA 5AUNB 4D6XA 1SKUA 2JI6A 4M8NE 4N5IX 2J85A 4NK5A 3GJQA 1BRTA 4MIYA 2HIMA 4C0HA 4BGDA 1E6LA 4X94A 2WIGA 2EP7A 2YIMA 1P9OA 1A76A 1N6HA 4I1PA 1AB6A 4IV0A 1KY3A 2PAAA 5SY4A 3FMOB 3E4CA 4H31A 4QHTA 4L4SA 4TL6A 1LDGA 3CNEA 4RD2A 1E89A 2PX2A 4P5EA 3OWHA 3DUWA 3LZ6A 3HRKA 2JATA 4HQFA 2YJGA 4NLLA 2E4AA 4GR5A 4AF7A 2VQEB 4PSDA 1T8SA 1FZQA 5FI1B 1Z7BA 3ZPXA 3AR6A 2HLDA 4BO6A 4I99A 4NNPA 4CIWA 2O8DA 1LZKA 1SCIA 4IQ4A 3HA7A 4BLWA 1W1WA 1QYRA 2AW3A 5I9MA 1J8VA 1MOPA 3TJMA 1QYCA 5AI0A 2DFTA 1NI3A 2O0LA 5JNSA 2HIAA 3ZNNA 1NVVQ 3UKOA 4R8MA 5MDHA 4PR3A 3C0KA 4R54A 1YA8A 3PNYA 2IBMA 3H0EA 4ZCQA 1VE1A 3FHLA 3NQ41 4D41A 2VK1A 3A6KA 3HJTA 3V2GA 4NOJA 5KKCA 1RTKA 3WWZA 2ZBEA 1S2GA 2CFSA 2ROQA 3KCNA 3N07A 5FUWA 1EU1A 4BKRA 2GAFA 1TFRA 2WMYA 4DHEA 3IAFA 4PANA 4ND3A 1JFLA 2J67A 2F1JA 3MMSA 1P77A 3CKLA 3TLCA 1L5HA 4HBGA 5A02A 2A8YA 4XWGA 3HYTA 5CJJA 4Q7EA 1H2BA 3P2EA 4AY4A 1P7ZA 1YRAA 3AXSA 2YIDA 5K6TA 3BJZA 1MXHA 3SZRA 2Q6KA 3DTVA 1O6BA 5D5HA 4ZGBA 2V7WA 3LGSA 4DG9A 3LFUA 3P2YA 1G4HA 4GECA 1F6WA 3ZU3A 2FWAA 1XZAA 2Z8ZA 4B44A 1H42A 2AQ8A 4G5OA 3SM3A 4M60A 2RGRA 2YWDA 1XK7A 1PF7E 5H59A 1JAIA 1CJCA 4IXMA 2HUNA 4D4KA 2HSZA 3JPWA 2GK3A 3DOFA 4GE3A 1GL7A 2IXTA 4OGFA 2Q0HA 5ECYA 2F8MA 2IXGA 4GMXA 3OX3A 2A6PA 5KQLA 4KE7A 2A1UA 2CL5A 3EGXA 4G0WA 2HBRA 4LZZA 3BWYA 4TYQA 1KSHA 4NDAA 1EESA 1O6ZA 4CLDA 1IEVA 3OM0A 2A2ZA 4PLGA 3VR1A 4J16A 5I51A 3LLVA 5CNJA 5CLLA 4G2NA 3DUFA 4EBFA 2HNKA 4EHIA 1SZPA 4OGWA 4F5ZA 1WZCA 2X86A 2XIQA 2W4QA 1W5FA 2IYLD 2HHJA 4Y0AA 4E70A 3DZBA 4MI6A 2WTUA 2R7LA 3HVJA 2DB3A 4GPIB 4F56A 2V58A 3KT3A 4JUCA 2YTZA 1TO1E 2F3SA 1VIVA 2ZT6A 4IJUA 4QU8A 3L0IB 1F2DA 5C1OA 3HCNA 3NTLA 3RQIA 5LZ9A 3IR7A 3T5AA 3R23A 2GXUA 1THMA 1UXHA 4KFUA 5IKXA 3ESQA 3BIXA 3H9QA 5TPWB 2YV2A 3JSXA 5KMGB 3RTAA 3GLFB 4FYMA 4HT3B 3QTLA 2OV3A 2YJ3A 1XDZA 3MOSA 2P3SA 4HAWA 4RKWA 4YJGA 3F90A 4UD6A 3KYJB 2HFJA 3E3OA 4OATA 3PQCA 3IE2A 1QFZA 4WMLA 3TNLA 3VOBA 2HNBA 4MCJA 3I30X 4FS8A 1QH1A 4JOQA 4MYUA 1ZVKA 4QARA 2B9VA 3C74A 4HAZA 4RA9B 2ZUUA 1LSOA 4P5DA 3HH8A 3CY6A 5CCDA 4LDJA 1FSZA 2IIBA 4XOUA 5ALMA 2W70A 3WLIA 5CG1A 1P1BA 1YRBA 2XDYA 3I6YA 3MF4A 4X1OA 1KBQA 4UVIA 3THRA 4CM4A 5IJWA 5LYJF 1AN0A 2X3UA 5KSZA 1R6DA 4ZAWA 2J08A 3QSGA 4PNPA 3H9JA 4K03A 2VYNA 5EMMA 1GZHB 3VYWA 4EJMA 3OJOA 3KP1A 2NVUB 3F78A 1S02A 1YHZA 2IW3A 4S1VA 1XXLA 3KUCA 4PSAA 3VYUB 1NYRA 3BA6A 4NENA 4EW1A 2VDOB 4RD6A 4QE3A 4UPVA 5KNDA 3RK1A 3RYIB 1XTBA 2EATA 5JWOA 5HWSA 2QVBA 4YRBA 3JCZA 1HZZA 2WFAA 5HFJA 4DR5B 5DGXA 3ADBA 2OBBA 4KOEC 1OLSB 1YZTA 4FIZA 4Y6RA 5ARCA 3RFXA 5BN1A 2C98A 4LOAA 3NJ8A 4OY3A 3TR5A 4FNGA 4BLPA 2QW8A 1ZMTA 3NNNA 2C77A 4TZKA 4MGIR 1QVAA 4CEHA 1GGKA 2DPYA 1VLMA 4LHSA 4JI3B 3T7DA 1GGNA 1G0OA 1G6HA 1X14A 1X8JA 4ZRMA 1A9TA 2OXEA 3RYCA 1CY2A 2YICA 4R9NA 1QBKC 3IA7A 1TKBA 3B5EA 1ISIA 1J07A 2WAXA 3I01M 4AD8A 5JNRA 1BU5A 1M1NB 1WU7A 2Q27A 1WCIB 4W9RA 4H7FA 5BN4A 1NTRA 4NOLA 2H7VA 1CUGA 1W5EA 2VSYA 2VYQA 3D6FA 1R0YA 1J99A 1IULA 2RHMA 2ETVA 4RVFA 3F1KA 4Y2TA 2GNPA 3KAPA 3ZHUA 5BT8A 4EY5A 3GNSA 3M5DA 4KV9A 1PEAA 2OMKA 3LUKA 1KMQA 4RORA 1J49A 4MVJF 3P4YA 1B8OA 4TQ9A 3U7JA 1U8CB 1I13A 2BZ0A 1ZD9A 1Z6YA 1RI3A 4JT4A 1TLTA 3UUGA 1N2CA 1P7PA 2V65A 3U56A 2HV9A 4KR6A 2NP6A 1VE3A 3CUVA 4I19A 4Y2QA 5L9AA 4HGRA 3SDZA 4YNBA 4OBEA 2XHEA 4LRWA 1C9NA 2XNSA 5M7EA 3TW4A 5LMNB 3LQ4A 2AI3A 1XEFA 1ZUNA 2P4EA 3BCRA 3LO8A 4WA7A 2EG5A 4F5WA 4HNTA 3Q41A 3A2KA 4R4JA 4GP6A 5E6SB 4QM7A 1U9YA 2WUEA 5KIAA 4BQEA 1A2QA 4ZVQA 5CPBA 3RBVA 3VR6A 1J70A 1L9KA 4P3PA 4WNAA 1JEEA 1RRMA 4D9KA 4OQNA 1N77A 2X41A 4K0KB 2KYRA 5FJIA 2GFIA 2C5FA 2P9TA 3N2GA 3D64A 5KHOC 4HZIA 1WY5A 2IU6A 3AINA 4Q34A 4RIFA 1Y6ZA 2B8JA 3MWKA 3Q87B 4FMDB 2ZSAA 3MT8A 4HQOA 3MWGA 5DYYA 2Q1TA 1C3VA 2V0GA 4EG0A 2Q5OA 3K0EA 5AXAA 4OXXA 2GJKA 2XH8A 1JIJA 2IEGA 2WTAA 1U0GA 2QUZA 3LU1A 1JNXX 4EY6A 3REOA 3T41A 3EVNA 2Z6VA 1T5LA 2FOIA 4H7HA 2IU0A 4G81A 1GXSB 1YL6A 2SCUB 3NC4A 3G9XA 2VRNA 1XFDA 4LY9A 1J0EA 5FL7D 1KAOA 2WJ3A 4PZZA 2QTRA 4MUMA 4WBXC 3PC4A 3TE7A 1QORA 4R2LA 5DSXA 4YFVA 2QZ9A 5BSRA 5DBEX 3PJRA 1IBMB 1E63A 1EK2A 2DF8A 4MV7A 4ND8A 1OI2A 4A0HA 2G3YA 2NPFA 1NN3A 3G0GA 3PC3A 3UMMA 3FWZA 3PQ8A 2D5IA 2FSIA 2P9CA 3SIWA 2WWFA 3OLWA 3NM5A 1T0JB 3UT5B 2CZGA 1XD8A 4R6XA 4WUVA 2XR1A 5DBHX 1KJZA 4G1UC 3QV2A 2J0UB 1UOEA 5F52A 3TMKA 1Y7IA 3E9MA 3DHWC 1LI7A 1P9NA 2ENUA 1W88A 2C58A 3BJMA 5EJIA 4LDQA 4BBZA 1PQPA 2NU9A 3C41J 3IERA 5EJ5A 1KZ1A 3UIEA 1FJGB 1TUBB 2Q3EA 3PHLA 2E37A 4G1EB 2ZYRA 1N2XA 2AGVA 4LYGA 2QD1A 2R6R1 3I9V1 4QUGA 3T3DA 1J2EA 4MR9B 2VKTA 3Q3HA 5JNLA 3THYA 4DJFC 1AD2A 2CNDA 3SIPA 4IIJA 4CMJA 2ZQZA 5I9BA 3QOFA 2GZMA 3F98A 3BSWA 1KOJA 4Z9XA 1AGXA 4HDNB 1CF4A 1CQPA 2FUEA 2GX6A 2WLTA 4JP2A 3W79A 5BSWA 4A0FA 3QKTA 3IHLA 2DOKA 4A8TA 5BURA 4NYIQ 1QKJA 4AYXA 1NNEA 2WB4A 3QELB 4P4UA 1R8YA 2GQ0A 2W6JA 1MAAA 4H1HA 5FTJA 4ND1A 1QF9A 5JE8A 1UAYA 2DLNA 4IDAA 3ZU2A 1H2HA 3GLHB 2YINC 1JJFA 1EUDB 3JRXA 3TOVA 1FDTA 3N2EA 1JIXA 1EINA 4QYMA 4RPCA 3DBLA 1AX9A 3BH0A 4C4ZA 1XPOA 2ODWA 4XIIA 4EHKA 4RETA 3T3IA 3IO5A 3QE0A 1ZGGA 1E1QD 4EITA 5IM4A 1GPLA 1DQRA 2FMFA 1RYNA 2A1IA 4M37A 3SF8B 1YR6A 3W5BA 3R2JA 4QELA 5IJXA 3KJZA 4ODIA 1NUQA 1C14A 2IYOA 5DT9A 1M74A 4YUVA 1CWUA 1WXIA 5E2AA 1I94B 2C5HA 1XZQA 4G25A 4ID3A 2REBA 2WJ6A 1OLXA 4HUQA 4BO1A 1POWA 3AR7A 3NX4A 4AG5A 1GUBA 2C59A 4BLOA 2J9ZB 1GPDG 5BWLA 2JF0A 1P2FA 1XKTA 2QI9C 4HGPA 1GPMA 2W2OA 4FFBB 4NPCA 4R9VA 2H1VA 1TX4B 2OD9A 1O57A 1XF1A 2YZ2A 3HYRA 2WKPA 3LCCA 4MCAA 2O2XA 4PYIA 4B87A 3HWRA 3NEPX 5L4SA 4DJAA 1GQYA 2X42A 3Q7TA 1UWLA 4HAYA 1MABA 4UTRA 1KI4A 4OMUA 4FN5A 1O6CA 4OQMA 1RT9A 2DT8A 1SMKA 5EHXA 3NT2A 3N58A 1Y6RA 2X7JA 3ZXXA 1XMOB 1PGNA 3NZEA 3ZXIA 4WNYA 5K0LA 1J7KA 1MV8A 5KYWB 4OA8A 3EF0A 5K05A 1GYQA 2KMLA 3RREA 2CT8A 3D6UA 1H65A 3L8FA 3I09A 3LDFA 3E22B 4I2NA 1GVHA 3NP9A 1EVZA 2F1KA 3OQJA 4HR7A 1A96A 2A5YB 5IPFA 1OJ7A 3W6ZA 2PD4A 3DEFA 5L3SA 2RIPA 1ZD2P 1MEJA 4QSHA 1EFRA 1ILWA 4CI0B 3MJCA 4LYHA 2XT6A 3FMGA 1ACMA 4UDXX 1RWBA 5IARA 2PZLA 3D3JA 2VHWA 5A3VA 3IAM6 4TQAA 1VG8A 4ENUA 2RC6A 3LA6A 1PG0A 3KXPA 4I5DA 3IIIA 5AKGA 5ALNA 1Z25A 1KZ6A 3H1TA 3OSUA 3VHXA 3AFGA 3P2JA 2R25B 1J0DA 2QR3A 1XRJA 2HDNB 2YS6A 4MCIA 4BZXA 5CDUA 3ELUA 1EK0A 3CGGA 3DWGA 2M2IA 2VNJA 1DX4A 2D1SA 5ALLA 5JSHA 2BZ1A 1CUFA 4IY1A 5K0GA 1KMHB 3UOGA 3UXMA 3VA7A 3PIRA 1RYZA 3EB9A 2HBQA 2OE2A 4OHKA 5HQTA 5EOVA 1QH8A 3WRXA 2J32A 3P4XA 2FHPA 2W8ZA 4HLDA 3DHVA 4JBIA 1IVYA 4GXRA 2WIFA 1VL2A 3VTAA 3RSFA 3G2QA 4R40A 3ZBTA 4C0KA 1CIJA 1QCZA 1V5FA 1Y82A 2AMJA 5FLYA 4C6SA 4KO4S 3PL1A 1OI4A 2E48A 2PKEA 3ZHYA 1IAVA 4DKXA 2GN0A 1KPGA 4Z7JA 4OI4A 1XTTA 2NLOA 3LQ1A 1ISSA 1F2VA 4PLWA 1PYDA 3I2KA 4ZI2A 6PFKA 1NDHA 2XADA 4FXOA 4FZVA 5T5QA 3LECA 4C08A 3FGPA 4QUDA 1A8IA 4A6EA 1CUUA 1YB2A 5TPZA 4WNCA 4Q01A 2ZYIA 4WY8A 1EQUA 1YFLA 2H1LA 4LISA 3O93A 3U40A 1S8NA 2F2TA 2WD7A 3IMCA 4FKZA 1I2CA 1K3FA 1NC1A 1Y5NA 1T13A 4QYIB 3TLZA 2H3EA 4OUKX 3ITEA 4EYQA 1JIQA 2GN2A 2Y3IA 1U2DC 5EFOA 3SYTA 1Y6JA 1K8ZB 1BCSB 1PL8A 1NRXA 2GRUA 3FYDA 1S4QA 3JALB 3QF4B 4UDNA 3S8MA 3WMEA 1Z68A 1TDJA 3LDHA 4TS9A 5EMLA 2BMVA 1EVLA 4KN9S 4H2DA 1V8PA 4PLTA 3VJLA 1YT5A 2WUVA 5F7OA 1A7UA 1JVSA 5DRTA 2HZBA 4O02B 3UMGA 4DXDA 2EBHX 3OQ6A 2VF2A 4F4IA 1JQAA 4N8SA 3ILVA 4B80A 1X77A 2IUEA 4YI5A 1Z8NA 2C82A 4KCGA 1LQTA 4X1IA 3FZEA 1O9HA 5FH9A 3G6KA 2NZ2A 4B3IA 3H7IA 3WBKA 3HB7A 3OIDA 1ZXXA 2ZXFA 3DV9A 3UV7A 1UAAA 3JAWA 3TTYA 4K0RA 1NG9A 5CW2A 1SB9A 1FFCA 3R0JA 5DF1A 5IF3A 4DT1B 1FDOA 2GT1A 3NHUA 2PU5A 1QDEA 1SC3A 1M2EA 5L3QA 1YZ3A 4MTLA 4BO3A 5KTNA 1KI6B 3JQ8A 4KK4A 4Z1MA 3EHEA 1RP7A 2IFTA 4IF4A 3W9SA 3IO3A 4MUJA 4GX0A 2RH8A 4KXYA 2VAMA 4FYHA 3UBMA 2R7NA 1FNMA 4WX2B 3WZLA 4CM8B 1Z22A 1JL3A 2PKYX 1JR2A 4DQ0A 1FL9A 2XMBA 1RYMA 3GAFA 4F5EA 4LNAA 2XWBF 1O0BA 5ALSA 3O8CA 5KTSA 1GKKA 1ORTA 4CGYA 1T4GA 2J6HA 4DXAA 2E5FA 1TRKA 1XZPA 1OIVA 2I3ZA 3PRJA 5JJBA 4O1IA 5BPHA 3CRMA 3CN7A 2RB5A 2YCLA 3G9UA 3MPUA 4CKCB 5T4FA 2GSDA 3PXDA 4YCAA 2C8LA 2X5JO 3VR5A 2A0XA 3AHDA 2Q2VA 4LJ5A 4MV6A 4NMMA 2FETA 2HZ7A 3OQHA 1R9JA 4JP1A 3T94A 3PGKA 5EXDA 3S40A 2R1VA 1I3OA 1PVOA 5KPDA 2FF5A 3AHFA 4JI8B 1MT0A 3AKDA 4CCYA 1UBJS 4ZMBA 4KG7A 2ZXEA 3BMQB 4XJSA 1RWWA 2OHVA 2XHZA 2FQWA 3ROEA 3JYHA 1OBCA 3DEHA 4LHWA 4MKRA 5J2TA 2B0CA 3L4SO 3MCWA 4MW9A 4ED9A 1VPDA 3P32A 1HORA 5F3DA 1UH5A 3UGQA 3FWYA 1U5BB 4KXQA 4PBSA 2VP5A 4ZT2A 5TF0A 3OMLA 4FYWA 5ELXA 4I08A 9GPBA 3PXEA 4DUGD 4F38A 5LNK6 3GT3A 4UU1A 1KY5A 1YR9A 3MGAA 3L43A 3OKAA 3ZNQA 1D03A 1I4EB 3MXTA 4QXOA 2OHOA 3JWEA 4AUEA 1K4MA 3BCHA 3FPAA 1WKVA 2NVWA 3G5AA 3UATA 4DTIA 3QQPA 3L07A 1K7FB 2CFOA 2CJWA 2RGNA 4NESA 4LJ6A 2ZYAA 2VYFA 2Q50A 5IVPA 3LY7A 3GZJA 3OVMA 4G0PA 3M4JA 1GYPA 2J5KA 1EWRA 2X6QA 5AI6A 3U9LA 3H5VA 3ZGNA 4OP3A 3B12A 2A30A 1GPNA 2REQA 4C5CA 5EJGA 2R6CA 1M2WA 4JCCA 2PANA 2RBEA 3AUSA 2E4YA 4R0VA 3SNHA 1FS5A 3EVDA 1DC7A 4NRDA 5DLEA 4DXHA 4DNQA 3DPIA 4WXYB 5AXBA 4ZVRA 5AJHA 2FZLA 1ZH4A 1GTZA 2O2CA 3EXHC 3OFNA 1CUDA 2GARA 3JQRA 4N3GA 1Q16A 3K8YA 4HWTA 2WZQA 1T6ZA 4G4JA 4ACBA 4EO7A 1HDXA 1N0IA 1TZCA 2AA3A 2FGJA 2JIOA 1T43A 3L9WA 1QRRA 3A1DA 3N8GA 4DM4A 3JTEA 3ZCSA 5DISB 1V8ZA 4F97A 4XSGA 3TZ6A 2ZJ1A 1T36A 3WIBA 3WGIA 3AFOA 5U4XA 5DM0A 3UEOA 1VHTA 2G80A 3KRTA 2J5RA 5DNEA 3QEAZ 4YJ2F 4YR9A 1C81A 4R1LA 4FOLA 3ROGA 3EOBI 1T4CA 4Q6BA 5FB3A 5SZHB 3BOSA 3KQVA 1GFWA 2C9CA 2QN1A 2NSLA 3CC8A 1SPXA 3RQSA 2NT3A 2OAGA 2JJ2A 1S9DA 3AW8A 2V7QD 3LRXA 1IXSB 3O8LA 3QRWA 4HPXB 4W5JA 5BV0A 3E58A 4MJ3A 1QTRA 1BZYA 1T26A 1U1IA 4RZQA 4Y7CA 2O23A 2QJOA 3I9MA 3T0FA 4DPLA 1SU6A 1QXSA 3TNJA 2Q5HA 1S2NA 2BCGY 2QXUA 4JJ4A 4O2BF 2B69A 3TLBA 2OKCA 4LGVA 5LKAA 5D84A 1Z2OX 1LPBB 4LDAA 3V55A 3DGEC 5SYAA 2VUIB 2ZJ3A 2VHCA 3GJ3A 4ZT7A 2CK3A 4HZUA 2FR8A 4RYLA 5KEIA 2WNIA 3QU5A 4HAUA 3VSEA 5ALVA 1VYVA 3LHIA 2OPBA 3SICE 3UV3A 2I33A 3L8ZA 3LI2A 3HJFA 4LFBB 1MO6A 2FFRA 1OASA 3PX2A 5GV7A 1C0IA 2VZ9A 5T57A 3RSGA 3MRTA 3V4PB 5TE9A 1FTSA 1G2QA 2ZIGA 2GBLC 3DA8A 2B99A 3OZEA 5JJKA 2VSFA 4RKEA 2IYVA 2DLCX 1K6JA 4S1WA 1L9XA 1T9GR 4MIEA 3RVOA 1IPHA 2KLBA 1WR8A 3UV6A 5LJLA 1S7CA 3KQMA 3BJIC 4FBLA 3FYUA 3MT9A 2R8PA 1ZNQO 3LXXA 3RC8A 4BBJA 3G8YA 4XIYA 2A9RA 2H06A 3KPUA 2I4NA 4LGYA 2FEPA 3PFKA 5CDSA 4IQGA 2OHFA 2BH2A 4IDOA 5EE3A 1LF0A 4Q03A 4MW4A 1EVJA 1W0JA 1HXHA 2BUBA 3LKZA 4NCAA 4FD3A 3BWDD 3HU5A 1E66A 4UMVA 1CETA 5CTAA 3SM9A 4ZQFA 1OC2A 3C6MA 1FU8A 1PS0A 3PQ5A 4UXIA 2VOEA 2FPLA 2I34A 2OAP1 4RXUA 1QFJA 4R05A 4CEJA 4JYAB 4ZQHA 1L5NA 5MHTA 3BT7A 1KJJA 1XMVA 1GPUA 2FMUA 4TUYF 5F78A 4E0BA 2GYVA 2VHQA 3PSHA 1O87A 1UKZA 1ZVQA 1W6UA 4A0RA 3ZE9A 1E3DA 2V54A 3EAQA 4A82A 3KKQA 4FGKA 2O14A 3VUFA 4IGKA 2ODAA 2ZKLA 1DBWA 2CF6A 1H9CA 3BQNB 1NBEA 3COSA 3FLAA 3HEBA 3PYMA 3N8HA 4MPDA 1JTFA 4EB6A 1A2KC 2JK1A 2KHZA 1I0ZA 3WMWA 3O73A 2VAPA 1ETUA 1KA9H 2DPGA 4WJKB 4B35A 2J0SA 1FBNA 3ZIAD 4C1BA 4ZZIA 4QT4A 4CMIA 3K6SA 1ZHHA 1O54A 4FZ5A 5K6RA 1H6BA 5KOIA 4L02A 3OIWA 1E2KA 4G9EA 4OGLA 1E1DA 5JAMA 2QAGA 3ZCQA 3FB4A 1ZN7A 3FDZB 2QM3A 2YMQA 2F4NA 2HBYA 3F0TA 2QUKA 2IOYA 2VIIA 4QBFA 3Q1KA 5ELLA 3RNOA 4C20A 3CRRA 4P38A 2AG8A 2IHTA 3IA2A 1V8FA 1ITZA 1G5FA 1PJ8A 4JP8A 4U9HS 3LY5A 3FPEA 1C3XA 4TMXA 2HU5A 3RJZA 5JCZA 3L79A 2VH1A 3WGKA 2XBMA 1IBSA 3L4KA 5E4FA 1U3VA 1FP4B 1VXOA 3PUJA 4TLLB 4IM7A 1GZDA 4TLMB 1DBRA 4PBTA 4LI0A 4KITB 4N6GA 2ENWA 1BQEA 3SK0A 2NTEA 2H5IA 2Y0CA 4X20B 3SJBA 5CLGA 3G82C 4X5OA 1ZOSA 2FYTA 1CV2A 2FFHA 3P0JA 5K3EA 3EY4A 1FXUA 1KC1A 1ZCBA 2NYAA 1FTGA 3QXJA 1MG0A 2Z8YA 3F3YA 4N5NA 4BGUA 3CNHA 3K1AB 4X62B 2B3DA 4JZKA 5CLJA 1EM8B 3E3MA 1CRQA 2AHOA 4TM8A 1BX3A 2BI8A 4O0MA 4C4OA 1P44A 3OPXA 5LQDA 1DUVG 4PM4A 1K06A 1L5ZA 4ZZ0A 2HQRA 2O3QA 3C4VA 3G0BA 2RGWA 1QWSA 2BGIA 3UOWA 3IMEA 1IVSA 3BF8A 2J9XB 3W7VA 5HZHA 3MBIA 1DJMA 4CZ2A 5EIAA 1GU0A 3BDVA 4FCTA 2FCRA 2DY0A 4KIFA 4OU5A 3GEDA 1Y5LA 4L3OA 5IU6A 4X85A 1R50A 1NRJB 1VG0B 1KGDA 4RANA 4ZV7A 1IHPA 3W8EA 3RWBA 2OOKA 1M76A 4P7KA 3I39X 3W5HA 4P4LA 3EGDB 3GGGA 4PG6A 1BNCA 3EEOA 2NU7A 1WXFA 4KFCA 2DQZA 2HM7A 2NTYC 3R9XA 1USWA 4X6YA 1T4DA 3ZGXA 2RHDA 4TKVB 4JV5B 1A8UA 3EJWA 1JG6A 3TFQA 5M04A 1Q7CA 1JHYA 1X1RA 3Q1LA 1A71A 2OCIA 2O3JA 4FXPA 4QA9A 1XAJA 3KHKA 3UG6A 4S12A 4AN4A 3W90A 2NAFA 2I76A 3N8KA 5JYBA 1J9ZA 3CPJB 3EWIA 1TYDE 2R6FA 1EE1A 2BMDA 2FLVA 2HJRA 3VSAA 4F9TA 4Q4JA 4ROTA 3X1YA 2E9SA 3U6KA 1V37A 5EL0A 1NU8A 1T9CA 4WN9A 4R68A 2W0MA 3GFRA 3ZZ1A 1XVTA 4LSGA 2PO7A 5CAEA 4GG1A 4RMHA 2BDTA 1U3GA 1S2LA 2G8NA 1E1KA 2Z98A 5H9WA 1T10A 4H6XA 4UATA 2AZ4A 5IUKC 4DEYA 3QXGA 4XYLA 1I3LA 2H11A 3W5DA 2VSNA 5FR2A 3MWEA 2OBNA 2W2XA 3W3AH 2I3DA 1W5TA 5LC1A 5BORA 2QJWA 2RHGB 4R51A 5CJPA 4D6PA 5CA0A 3GLKA 4Q21A 3S28A 3HDJA 4J9VA 1XLVA 1ZMXA 2ZRIA 1ULHA 3K2QA 5FOTA 3LLMA 3EXEB 1ACJA 1VE9A 3O0DA 4JFRA 3K5HA 3RR2A 2HLNA 1FQKA 1EAYA 4AZWA 7ABPA 4FOTA 5EJ7A 4CM3A 4RMNA 5HILA 3GLGA 2Q8NA 2P1ZA 3PS9A 4QT0A 1HKUA 1VHDA 5DX1A 5FFNA 3COWA 2XKKA 5AKXA 4DA8A 2BR3A 3EZGA 1SC9A 3C6KA 4JI1B 2ZW9A 1G60A 2Q4RA 3HJCA 5G40A 2Q3JA 3ESRA 2R6GA 4M8SA 3O4VA 4Z99A 2AWOA 3PQEA 1V5IA 1MU0A 1CR4A 1H1TA 1LBHA 3C43A 3E4DA 3INYA 4MLPA 5CDHA 3LLUA 3GRPA 2MSEB 2EYQA 2OO7A 4O5OA 3ZLUA 1WJGA 1XQYA 3OM8A 4X71A 3E5MA 1GD1O 2OILA 1NP7A 2QHXA 5ESRA 3QVKA 4PAGA 2OZKA 4FFRA 4I1OA 3ZOZA 3C6YA 4HZGA 4KNVA 5CH3A 3MTJA 1U2QA 5FPTA 4BMDA 1Z4QA 2IXEA 1XELA 2NZUG 3QX9A 3RVSA 2JCSA 5D1NA 2ZZNA 5I7OA 2QZSA 3WKBA 4YV0A 5T67A 2PYIA 4JUFA 3L01A 4BCDA 1KNXA 1QE0A 1Z4KA 5JJIA 2YR0A 2OR3A 5ITWA 5FO1A 1E96A 5JI3E 3UYKA 2OG1A 2FN9A 1WHSB 1UC5B 1ID1A 1QHNA 4UZFA 2PD6A 3VNSA 2W83A 5ALUA 1ZD3A 4G24A 4ND4A 3FVVA 1DLJA 3NP7A 5BVGA 5K7SA 4GX2A 3AV3A 3L7JA 1AK9A 3D1LA 4EW3A 2WT4A 4BDSA 2JIZD 3QKSA 1RFLA 3T1VA 5E6UA 1DEKA 3UWOA 1FSPA 1JTEA 5TQVA 4QU0A 3VISA 4I14A 4D8VA 4EQ6A 4BNDA 4WIAA 1KO8A 4GUAA 1GN8A 3R7AA 3WDSA 1IWOA 2BF4A 3U7HB 1CK4A 2XF8A 3PLRA 1EBUA 1W75A 4OO3A 1FK8A 3ESXA 4QTXA 1GTL1 1TEHA 3VR2A 4X95A 4ZCLA 5KQGA 2W2KB 4UHHA 3PPIA 4WQMA 4DS3A 4GX5A 1D8AA 3QQ5A 3HU2A 1E4YA 4Z5XA 3EPLA 2EP5A 3QWAA 2VDNB 4R5HA 3SYKA 4PG5A 4JVOA 5CVVA 4DILA 1DIOB 3B53X 3DS8A 4DRYA 3C5VA 1O94C 5H02A 4ZCRA 2W7TA 4B75A 3JTMA 1QIMA 1GNSA 3RYHB 4D8YA 3COZA 2HC9A 5G53C 4POAA 5L6MB 1I7QB 1UMKA 2RHJA 3CKKA 4PYOA 2C4UA 1IMJA 2IYRA 2GTPA 4LIPD 3Q9SA 5IM5A 3F71A 1JFSA 4G5HA 2EJBA 1W36D 1E8NA 1C0LA 4RTMA 3TOSA 1NL3A 4GRAA 4GM1A 4HY3A 3V1TC 1X1CA 2FSPA 5FPSA 4RNDB 2B7LA 3ONNA 2NVOA 4KJZA 2RGDA 4PWYA 3B9RA 5AI8A 4TXNA 1FFEA 4HQNA 3ZQ6A 2JI9A 2ZVDA 4AJ9A 1TAHA 3EZYA 4UTZA 1E3WB 4TYYA 2GHTA 1VHQA 5DYWA 2G9VA 4AROA 2QMOA 2YBDA 3B6KA 5FULA 1UJMA 3OC0A 3UM9A 5E3JA 3N2KA 2OCGA 3ML1A 4Y2PA 4YAEA 3ESBA 3H1PA 1A8PA 1GNTA 2YW9A 1K3TA 2HA0A 3K9GA 2QV0A 2IEZA 3E7PA 3MWDA 3PUWA 2Y1WA 1P4JA 3OFSA 1NHGA 1TJPB 1G59A 3S27A 4NJEB 1QIJA 2QTGA 1U63A 2ADMA 5BRJA 3QPAA 4I9FA 4Z51A 1G3QA 4R1PA 3FDFA 4XLTA 3BD9A 3QU2A 5BXYA 5HBGA 1QIKA 2PKRA 1QV9A 3CO5A 4DCGA 4AXXA 4ZGGA 3T3EA 3BXHA 2I8CA 1RQLA 1IHXA 2VTKA 2WMNB 5CT4A 4XJVA 2C1EA 1Z0IA 2OO5A 4W1SA 1ODFA 1G8GA 4L4YA 3TSOA 4ETIA 3DXYA 3NYWA 2HLDD 5FORA 3NHKA 4NABA 2Q8PA 2J3LA 4AL4A 1CQJA 1Y4DE 2NOAA 1Y33E 4JGGA 1M1YE 1PHRA 5GAJA 3DHYA 3WGTA 1VTKA 4AKHA 3EISA 1OKKA 2CGEA 2P4SA 2ZCVA 4G0NA 3U5TA 1Q0LA 3ZY5A 3K0BA 3BE5A 3LZDA 4CE6A 2WYWA 2V7XA 1CP2A 3LHFA 3R7WA 3WIVA 4ZQIA 5AW9A 1ZCAA 3ZE2B 1SBTA 3GDHA 1J33A 2R6DA 4O33A 5JAZA 1QG0A 2Y0PA 2VXBA 1I4OA 2RAPA 4EHHA 3C3MA 4NZMA 3SCZA 2I62A 1L8LA 1DUSA 4IX9A 4XGQA 3T7RA 3OCJA 4K6FA 4UM8B 1NX9A 4EGCB 4R1OA 4RGVA 1LW7A 1L6IA 1P1CA 3KV1A 3PWTA 4LSZA 1MN6A 2QX7A 3FH0A 1QU2A 4TTRA 3UF0A 4UHEA 1Z5NA 3LM8A 4XUDA 3DTVD 2N9UA 1SJ9A 3O2QB 4XM2A 4OJYA 2YJ6A 3WLOA 4DA4A 1T6NA 3FJOA 4HGNA 3TAXA 3W2EA 3K2BA 1L7MA 2VEDA 4IWYA 3SSOA 5E4TA 1UPAA 2NYRA 1XRMA 1HETA 3LKVA 4MQLA 4LF9B 2A0KA 3I4FA 1P4SA 4Q4HB 2EZUA 4GYYA 5AHXA 1IMOA 3QOYA 4F6RB 1GUAA 5AM4A 1JR6A 1XZLA 3G1WA 1NRIA 4K3UA 2LNDA 4RJ2A 2V9ZA 2FQQA 3IUNA 4RF5A 4QOFA 4WK2B 4XVHA 2B83A 3A1FA 1B26A 4ENPA 3Q7PA 3QYAA 2ACKA 4FHFA 5J2UF 3AVUA 4R8RA 4MUHA 1NZJA 1U7HA 3R09A 5TT1A 1DS6A 3KYCA 1YQQA 1WB6A 1EXNA 1Z12A 1HC7A 2DWOA 3PQ3A 4UM7A 4Z4EA 1X8KA 2A4KA 4J0CA 5LA6A 4NULA 1XROA 2O8EA 1CUWA 2PPVA 5JS6A 1K7SN 4LHXA 1TOAA 1NQVA 4M1WA 5GTDA 2R7MA 1K27A 4ZICA 4LOJA 1Z2NX 4XVRA 2X4IA 5AUQA 3AI7A 3TB6A 1UQRA 3RSHA 4IINA 1BHQ1 1XZHA 3V2IA 1O4VA 1YBFA 2ZE7A 4K7JA 2GO1A 2D8MA 5FEMA 2CZQA 2GN9A 2H1FA 2Q1UA 1NXSA 1NVWQ 1HPLA 1OPXA 1MOZA 2R8RA 4O2AF 4OV6B 3ZWPA 5JVDF 5KO2A 1OYOA 4J07A 3M6XA 4OAQA 4U2CA 4PYKA 3S7TA 2PUAA 4Z1OA 4W5RA 1JE0A 3W5JA 4FWTA 5KDLA 4GP7A 1G5RA 2Z04A 2RK4A 4HH4A 1G63A 1N2HA 3DG9A 3E05A 3TI7A 1EB9A 3U4QA 4N6NA 2PXXA 1BWRA 4GOXA 2C3PA 1RLJA 3U5ZB 3VU3A 1Z5UA 2B21A 2DUMA 3VQTA 2G1PA 1H9BA 2IGBA 5AOAA 2O2ZA 1QHSA 3FCSB 2VJCA 3DPUA 4JQZA 2FZWA 1PQYA 3S5UA 1X9GA 2IP2A 2EVWX 2PL1A 3P0IA 3CR7A 1G20B 5DNCA 2ODNA 2CLEB 2DJIA 1OLUB 1RYBA 2EKQA 2FW7A 2Q2QA 2VYND 3AUUA 3C3PA 4FSHA 4REMA 1NGSA 4DPKA 5HKBA 4TTVA 1PS8A 3TB4A 3ZV7A 3OIYA 1MNAA 3ANSA 5GONB 1MIHA 1J0XO 2C3MA 3OZTA 4XGNA 1RJFA 3L1UA 3H04A 2PFGA 4LOHA 3OOYA 4QEDA 1DC4A 5KNDD 2IV3A 1E1CB 1XKQA 4J29A 1A7JA 1ZU4A 1Y8AA 2DRIA 4K1XA 1M34A 2C2OA 4PGMA 1KDYA 3U1VA 2E1RA 4ZRDA 1RP1A 3FNRA 2J8ZA 1GO2A 3K8OE 4MYRA 3DLTA 4O4LA 2I22A 3OHPA 4MV9A 1VSTA 1D09A 4PPNA 3J81k 3PHHA 4W1RA 4XCQA 3A2MA 3ZUPA 4QM6A 1K2WA 4V2IA 1JE1A 5DCLA 4PZLA 3WLAA 1G8HA 1N2GA 2JL1A 2OZEA 3CVJA 5I7AA 4LF4B 3IAM1 4NAVA 1WZEA 5HDBB 3CEAA 5WRFA 1JYEA 3M9LA 3PENA 1Y7TA 4P34A 1EDBA 4B3RB 3G59A 2E0IA 4FUTA 1OGJA 2YJ4A 4MQEB 4YRGA 1R5BA 4FPXA 1IIBA 2OXCA 2YN4A 1SXJA 5DXFA 5KOJB 3JVEA 1EFKA 3M4ZA 1ZKMA 1PKEA 1NLYA 2ZVJA 2VQSA 2AEEA 4TLBA 1SCQA 1V6AA 3H8JA 1OAAA 3P0RA 4KX5A 1CX9B 2Q5CA 3EMBA 3IMKA 1RMYA 1X42A 2VJNA 2BFFA 3OZ7A 4R0NA 4YN3A 5FUVA 3ZNPA 5IASA 1GUFA 2A92A 2JGKA 3OZCA 1TJ4A 4MOWA 5D85A 2LCQA 3UA4A 3WL7A 5CDGA 1O08A 2GVDC 3TLKA 2UVPA 2I87A 1V6CA 2YV1A 5E6RB 1FNBA 421PA 2O9JA 4INAA 5BV2P 1D07A 3R5KA 4CF4A 1TIKA 3ROMA 3DT6A 4HHEA 5DGDA 1PQUA 3I64A 3HL0A 4LTMA 3KWMA 1JHPA 4PCUA 5E3IA 3A70A 4NL4H 1G2OA 3W8DA 1RYFA 3VR6D 2HBZA 3PUYA 1JA0A 3NH6A 3CMMA 2JI8A 2BVNA 1VMKA 4AZVA 3CUTA 3FPGA 1N5RA 3GJSA 4A6XA 3O92A 4CM1A 1DPGA 2E49A 2OYSA 4QQRA 2QJRA 3ZK9A 4HC4A 1RCTE 3E9ZA 4JJFA 3HBMA 2WUGA 1MZVA 5IJ9A 1CR2A 3UB2A 2YXLA 4AF8A 1O0SA 3I6ZA 2FW0A 3EZLA 3OEEA 1PE0A 3INNA 3OUUA 3BJEA 4LZWA 4XKJA 5KTMA 4LVOA 3RAEC 4PIMA 7ADHA 2MIIA 4KN5A 2VJAA 4NV0A 4HB0A 2VATA 3ICCA 1QLJA 3I6IA 3K4QA 4BFYA 4LGMA 3FOWA 4IRUB 4FU0A 4W5TA 1DKUA 3A9RA 1KARA 1YRYE 3PK0A 3BD6A 4ER5A 2PA3A 2PWPA 1E4EB 3PQ6A 4KDEA 2A88A 1I1QB 2I4MA 2Y1OA 3UMVA 3VU0A 3HSKA 3ZNOA 1UBUS 2DFPA 1ORVA 2Q5LA 5CYPA 2RGXA 3EIWA 2F64A 5FPPA 3VBEA 2Y92A 4QQFA 2VAXA 3ZZNA 1XA4A 3BXEA 5A4DA 1QQBA 4UAUA 3SJZA 1P4HA 1II8A 2DMRA 2PMBA 3OUZA 2ACWA 3K0CA 2P9YA 3PQ7A 3TQFA 1QCCA 2C2YA 3P71T 1U2ZA 5G4KA 1U3FA 2D2FA 5E7MA 3I5YA 4M7PA 4DYVA 1NVDA 1PDVA 1NI4B 2O6LA 1F4VA 5EHQA 2OFWA 3AWDA 3M1IA 1H5NA 4FN4A 5ER6A 1Y6FA 1CC1S 3V1KA 1QMPA 3D0KA 2FZEA 2I54A 1JPJA 9MHTA 5B1IA 4JDPA 5IH7A 2JH9A 1P61B 3X43A 3I23A 3MT7A 3UFXB 4H4EA 5F1OA 4TKUA 5BUZA 4MWTA 4IILA 1OREA 1G6OA 1FDVA 1MDFA 1V26A 1W76A 2WYHA 2AR7A 3B1VA 3BB4A 1ZIDA 4IDHA 5AJYA 1AQLA 3ZDRA 3PHIA 1Q11A 1H0KA 3HHPA 2H1IA 3B5IA 1W8IA 3OKPA 4G5QA 1RD4A 2BBTA 3DMYA 4KOAA 4KXMA 3PL5A 3N59A 4MW0A 2QF7A 3AERB 1UBLS 4F3YA 2QEQA 3ZC3A 3VO1A 5HUJA 2PGDA 2W6JD 1HO3A 5KAPA 4F86A 1SUDA 3AM4A 3BWCA 3GGDA 2JLQA 3K9QO 3W1VA 4OBXA 5IC5A 1B1AA 1QONA 1WNTA 1XDSA 3VSCA 5JH7B 1NX6A 1EFDN 3GD7A 5LU9A 2Y1DA 3JQBA 2NSJA 2AH5A 4YT8A 2V6MA 4MV3A 4YTEA 5EWMB 5H4HA 3JARA 3VR4H 3KSRA 4OSEA 2Q2WA 2VNAA 4JH0A 3T0GA 1E9AA 1TFUA 1TPZA 1RHRA 1E94E 3GCXA 4Y1FA 1UMDB 3CZMA 1TMKA 4DIEA 1E6KA 3HADA 1PL7A 3SZ3A 3ZBPA 4IOMA 4BP8A 5JBQA 2GN1A 4ZCTA 2Z1MA 3E2MA 3NHFA 2C31A 3QUTA 1JA1A 3H1FA 2Q4DA 4P0TA 4E2FA 5KYGA 4KQ9A 1AKMA 2QXYA 4TYNA 4I9NA 3MUEA 4BTEA 4GGOA 4XA8A 5U9CA 5AVTA 2PK3A 4IIXA 2YHIB 1P7WA 5ALEA 3NVMB 1H22A 1VCIA 3SC3A 1OVGA 3SFTA 3NHBA 4D9HA 5EKSA 3U09A 2Q6VA 1KFJB 5DTMA 3V2HA 3GFTA 4LUCA 3N28A 1FU4A 4DMLA 5BR7A 2PR2A 4EKIA 1KFKB 1U7OA 1ODJA 2HSWA 4EFDA 4HL6A 5HKAA 1NY5A 3N0WA 1U0NA 2BONA 3H1GA 3EGVA 1ST2A 2YFQA 2BFBB 1FXWA 3W2HA 1M2HA 1X7ZA 4N0QA 1YVDA 1DBQA 4IRXA 3SZLA 1I1OA 1N5LA