4KPFC

Novel fluoroquinolones in complex with topoisomerase iv from s. pneumoniae and e-site g-gate
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
226
structure length
208
Chain Sequence
b'KLTPAQSKNPAKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKVINTAKAKMADILKNEEINTMIYTIGAGVGADFSIEDANYDKIIIMTDADTDGAHIQTLLLTFFYRYMRPLVEAGHVYIALPPLYKAYAWTDGELEELRKLQRYKGLGEMNADQLWETTMNPETRTLIRVTIEDLARAERRVNVLMGDKVEPRRKWIEDNVKFT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ParC55
publication title Exploring the active site of the Streptococcus pneumoniae topoisomerase IV-DNA cleavage complex with novel 7,8-bridged fluoroquinolones.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Isomerase/dna/inhibitor
total genus 53
structure length 208
sequence length 226
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00986 DNA_gyraseB_C DNA gyrase B subunit, carboxyl terminus
C PF01751 Toprim Toprim domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.670 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4kpfC00
4KOEC 3L4JA 1BGWA 3QX3A 2XKJE 2XCTB 1BJTA 2XKKA 2XCQA 4G0WA 3LTNC 3KSAC 3RADC 2XCRB 4KPFC 3FOEC 4Z53A 3L4KA 2RGRA 3FOFC 2XCOA 2XCSB 3KSBC 4I3HA 4Z3OA 3RAEC 4G0VA 5EIXA 4J3NA 3RAFC 4G0UA 4KPEC 3K9FC 4FM9A 4Z4QA
chains in the Genus database with same CATH superfamily
4GG1A 3EY9A 1AMNA 1RNLA 1U9IC 3F3YA 4RZXA 3LDFA 1MXHA 2G06A 1JQJC 4QDZA 3D9QX 3DOJA 1CULC 2ZGVA 1QBKC 1NUAA 3G0DA 5DYWA 1WCYA 1DTEA 2A9QA 2WOJA 3EYWA 2W2PA 1O58A 4LZLA 4FFNA 4GBJA 3RW9A 3VI4B 3WL8A 3QFSA 2VHQA 4N5IX 4Q3AA 3EZNA 1B23P 3QVGA 3ZLTA 3KSBC 5JU6A 1H5NA 2XHEA 3KT8A 3IVMA 3OM0A 4AK9A 4JR0A 1W30A 3QG5A 1Y7IA 1GLGA 1ZH0A 4FILA 4I6GA 5ILGA 3CCFA 1O97D 2Q5OA 2RG7A 3AH8A 5HPYB 3L7JA 2O19A 1IM8A 2W2KA 3BX1A 1FBNA 1KBOA 2VPTA 3X1JA 3OZTA 5KTPA 3RTEA 3B6ZA 3SF8B 5LWHA 4L02A 3OURA 2I6FA 3HV0A 2BGNA 1BHQ1 3WI7A 3ZZNA 4EYOA 1PK9A 1T9KA 2UVQA 3KCQA 3PT5A 4HDMB 4IJ5A 4KMSA 1PL7A 4XIIA 3VU1A 3DAFA 4BX9A 5HMMA 3OE4A 4FHFA 2QY6A 5U1PA 1RM5A 4MRNA 3THRA 3JQ8A 3U81A 4BDTA 5EPUA 4DWWA 4E2ZA 3L8EA 5KNBH 2XGJA 2GEUA 4GRDA 4ENSA 1RQ7A 3H18A 5A06A 2EFDB 4D57A 2O5CA 2JJ2A 1P4SA 2JH9A 3JWJA 1JKJA 3JYNA 1PHPA 3GH3A 1CUHA 4HP8A 4KWCA 2YZMA 5EKUA 3OZGA 4LF5B 1JLRA 1SXJA 3KPYA 4KKXB 5EYPA 3FTEA 3NWPA 4KFCA 3W4KA 1AO3A 1M2EA 1PZHA 2GAIA 3GRCA 3OEHD 2ZTSA 4GC5A 1QNLA 4RKRA 1T6XA 2FPSA 2QMQA 3LVBA 4U2EA 4FFPA 5H59A 5IABA 4UC0A 1IUNA 3ZIDA 3E2IA 3L05A 2BHLA 2V8BA 1F06A 4LV8B 4NAUA 1HYGA 3LLMA 2F67A 4NYMR 3UB3A 1NWCA 2IOFK 1YZNA 3EA0A 4YCMA 3JSXA 2IE8A 1T2NA 1NTOA 5IWAB 3Q40A 4JLBA 4JA0A 1OWPA 5DZSA 2VNHA 3P2KA 3DULA 4D4IA 4O2BB 1B42A 1LK5A 1ZU5A 1NVEA 3NQ41 2CL6X 4YRRA 3IIMA 4LJSA 4HWSA 3RSQA 3T61A 3IP9A 1IRIA 1TZ2A 1X8LA 2QN7A 1PGOA 5KSWB 1P7WA 5FI0B 3SSNA 1I7SB 4ALJA 3MLAA 4X7RA 2GLXA 1KO5A 1QF9A 2PXAA 3CSUA 3G2QA 2BI7A 3KQWA 4FW9A 4Q9AA 1M54A 1M8PA 4RD2A 3UT0A 4YAGA 5AW6A 3C6BA 2C9YA 1ESEA 3GLKA 3OWOA 1RZVA 2HLPA 2DRIA 4GF5A 3W05A 3IVGA 4ZTZB 1KOLA 3HUEA 1P62B 1JNXX 2C92A 4JJ8A 3R3JA 4DPLA 4Q3OA 5AVRA 3KQMA 3JQBA 3PD0A 4RNDB 2PZEA 3L6BA 3RS8A 2G08A 1YFJA 2GAAA 3DEHA 4AJ4A 5JY6A 5I4KA 2J9YB 3IQHX 1N5JA 2I2DA 1L9KA 1WU7A 1NYTA 2CCKA 2WILA 3ZHBA 4EB0A 3OLQA 1H0SA 1NC3A 2QLNA 4YRCA 5A71A 3SNKA 4WPGA 1LI4A 2H0QA 4G01B 3SIPA 1TQ2A 3WYNA 2P3LA 1JDNA 5AOVA 4D5GA 3TRJA 3RJZA 2Q3BA 4I55F 1UT6A 1ECPA 5HFNA 4E6EA 5CFZA 1H4SA 3RR2A 3CLSD 3WOVA 2NU9B 1AA9A 3FLBA 4MQ4A 1ZGCA 3TNFA 1CQXA 1YFZA 2IZ0A 3CJTA 1GYRA 2VH1A 4KEAA 1U81A 1V8OA 1R0CA 3ZW7A 3FTPA 3ZQJA 1JU9A 3P0JA 2BEKA 1JT9A 2GVDC 2NU6B 4JP2A 4GYYA 5ITSA 3CTMA 5JCOC 3QY0A 2V4ZA 4B80A 4BQSA 4HEHA 3DNPA 3OU6A 1F8FA 1P8JA 1A04A 2OG2A 4JQYA 4XM2A 5ALPA 2HO4A 3TFQA 1SU7A 2HA6A 3QKSB 2RH4A 4DQKA 4CFSA 1W4BA 2QAGC 1Q3TA 4XSVA 2FZGA 2R8ZA 4FFDA 1GARA 4GKAA 5EWJB 1A7UA 2P4UA 2W2MA 2O23A 2OFWA 3LCJA 7YASA 3FFAA 5L4SA 1S6YA 2I2FA 5JYCA 1YXMA 2VSYA 5IC6A 1ZGJA 3I34X 3NYRA 4QVIA 5CK4A 2I6XA 3WHPA 1RLJA 1XG5A 3CA8A 1LFDB 3M2PA 3SOPA 4EQZA 4QZVA 4IEFB 3SYRA 1YS2X 1T9DA 1LA2A 1DT5A 3GH1A 5UKDA 5B7QA 4G24A 2X40A 4C7OA 4TLEA 3QX9A 5EE5B 4RK1A 4RA6A 3PCRB 4TTVA 4RS4A 4E6PA 3SSOA 4IDNA 3BD8A 3ENNA 3MTAA 2ZRMA 4GRIA 4P4UA 4DL9A 4O1HA 3BZUA 1NA5A 3PRYA 4CT5A 2QMHA 4FNAA 5H4GA 2QD2A 3B6JA 2IH2A 2QDKA 1AS0A 1Q20A 1ZIPA 3IAAA 2FEMA 1CQJA 3FMFA 3OHMA 5HS6A 1USKA 2QS9A 2X9NA 2YYAA 2C7BA 5FWDA 3U1BA 3UGJA 3B9QA 1SD1A 3L6UA 3O91A 2CY0A 2QTBA 3QF4B 3QPDA 3U13A 3WNCA 4KXXA 4RDXA 4HYEA 4PONA 4LRXA 3M6FA 3PK0A 2Q4BA 5C37A 1I3KA 2QE6A 1R66A 5T4BA 2I1WA 2XUPA 3ROEA 1C3JA 4U7PB 2PUVA 4ZRDA 3D8NA 1WE2A 4RMHA 4AKEA 4C22A 3JYPA 4L2IA 3ICPA 4EI2A 3L8GA 4YS6A 5K3FA 2A1UB 3I83A 4IFIA 2YN2A 2ZDQA 4GOOD 2BGGA 3ESDA 4N49A 1U1DA 5C1BA 7AT1A 5CT6A 1M8JA 3EARA 4GWLA 2HK7A 2JIZA 5EPOA 3ITNA 5F1OA 3E22B 2O0KA 5EIHA 1JLHA 3GP5A 4GPZA 1WMDA 4B43A 3V6MA 4BX3A 1MNQA 1AOXA 3PITA 5K0SA 3L1JA 3C6KA 3L8ZA 4KQJA 3EZXA 4OQXA 4INOA 4DMRA 2PKCA 3JARB 2AJCA 2JH8A 3P2IA 3T5PA 1YASA 4MAFA 1ZOLA 4MH0R 3U1TA 2RK4A 4NONA 2VHTA 2HNAA 3H9CA 1CUFA 4XJXA 4XLZA 4O33A 1TECE 4IEIA 4IGIA 1ODJA 3QKRA 4B4VA 3R9XA 2IK8A 3G5AA 3BRSA 3SDBA 3DYVA 4DIBA 5AVUA 2Y0PA 4QGFA 1C3EA 5LPNA 5GINE 2P2SA 2Z3ZA 4H7KA 4E5MA 4A0FA 4GVPA 4A8TA 4K7JA 3E4CA 4B71A 2FUG1 1EVIA 1XL0A 2BW0A 5JALA 3K1TA 3FCYA 3PFHA 1JTFA 5BWMA 3UEOA 3ZDFA 1VIMA 4KPEC 2AB0A 4LHXA 3WGKA 3NPAA 3T1NA 3A32A 3JQ7A 3LPNA 4TOIA 4BE4A 1VKJA 1P7CA 4DN6A 3AHIA 4PTZA 4NCIA 3I6QA 3D7SA 3BCSA 2VQEB 2C1XA 2E5FA 3QVGB 4PZ0A 2H1RA 3R3HA 3THYA 2PGLA 1HQCA 3BWVA 5DHSA 2F9MA 3TRDA 4LY9A 4BYGA 2OBMA 1VA4A 2PJZA 3O75A 1E66A 4G4JA 1L4NA 1PJ2A 1BE8A 1WUIS 2W2KB 3EC2A 2Q62A 3QTLA 1YR6A 1TUGA 3CLVA 1NVFA 4Q4JA 1GSOA 4BKOA 3PSAA 3BDVA 3KP1A 4NU8X 1WG8A 5F7JA 4MW9A 1TGYA 2C4TA 3SHFA 3BN3A 4LHEA 4YO7A 4DXHA 1UBNA 1XD9A 2QN9A 1SVLA 3T3GA 1DOZA 4GW3A 5I9SA 3QXSA 4YASA 3VPCA 3LX6A 3NB0A 3JQ8B 3SEFA 1KFJB 1MO4A 1F60A 3KC2A 4M0PA 3U4AA 3O8CA 1YULA 1BJRE 2PS9A 4N5HX 2GZDA 2C2GA 2XPCA 1RI2A 3QMWA 4NEGA 4RBNA 4RESA 1JKJB 2L42A 4CV2A 1JV2B 5KTYA 2J9XB 1SXJB 3CC8A 4XVQA 1ZI9A 1G7TA 5EYPB 1B26A 1P9LA 4QG3A 2Z6VA 1WKBA 4AX4A 1J1ZA 3OKFA 3GN1A 3NDRA 5ALOA 5ULLA 2AG1A 4IV0A 2N46A 3PUXA 2Q6LA 3SE7A 1B2LA 5D5PA 4WVLA 4AWBA 3X44A 3GLHE 1ZD3A 2WQZA 2ZR7A 3JASA 3TW8A 4D81A 1SM4A 4IVNA 1LPMA 2IEGA 4L5AA 2PQMA 1ZM3A 5I7FA 2BM0A 4IIJF 2VHZA 3LBIA 3N9IA 5LOVF 3E9QA 5SZHB 3DTVA 2PGDA 4UATA 5DN9A 4YDQA 5MN4A 1AGRA 1QIKA 4PLVA 3SSMA 3L5KA 4LCJA 1VE1A 3T94A 3HSKA 1JQDA 1G60A 1R15A 4M9CA 3CVVA 3W5JA 4NBRA 1HYQA 2PSDA 4KIJA 5L4NA 4FOLA 1L7AA 4D8YA 1GCUA 1U31A 3IVRA 4MUEA 5JYEA 3MYRA 2RGXA 2QEQA 1S1MA 2ZJYA 4GMFA 4EUNA 3SHWA 3AL0C 1PT6A 1ZNZA 1JQ5A 2HLNA 4QGHA 3KZOA 4PN3A 2JS7A 3RRYA 3KJEA 4F91B 3SR0A 2JZNA 1SBIA 1L8LA 3JQPA 1SZJG 1UKYA 2H1VA 1DAIA 4Y0NA 3PXEA 1KMMA 2C2HA 4MR7A 3EEYA 4HEJA 2X9LA 4TX1A 4R71A 3EEIA 4UZFA 1W9MA 4YCAA 4BMCA 1SQ5A 1RRGA 1W87A 2FPOA 1LCIA 4GBED 4NOJA 5IVKA 2FWIA 2O4CA 1FQJA 2F48A 5FBQB 1E6WA 2QMUA 2ZATA 2QV0A 4RE6A 1WR8A 2Z95A 3MWDA 5AVWA 3WLIA 3JRNA 5LL6P 3TX2A 1NUTA 5FTLA 2VDMB 3STVA 1QF7A 3H6HA 1AURA 4CG1A 4DLXA 2A0WA 4YT4A 2PAAA 4CIVA 4DA9A 4YR9A 5K3OA 4I9GA 1XT6A 1J22A 2GBGA 3ZVNA 3WGUA 3TQOA 1JIIA 1XVTA 5BW8A 2Q28A 1AKNA 3ON5A 3AUUA 1MRNA 2P4SA 3EBLA 3EAGA 4M2LA 4R1OA 3VPSA 1XLVA 3IH5A 1XKXA 3ZD6A 1MOPA 2YW2A 2GN0A 3NUGA 5E6RA 3W04A 1B1AA 1AHHA 2C00A 3QPVA 3WRXC 4BGUA 4NU6A 5G4KA 3RAEC 2JGEA 4RIHA 3VYRB 3GMDA 4FNGA 1OOEA 4DANA 2AVNA 4RK0A 4ZIRA 5A9RA 1OAAA 4BFLA 3TUIC 3H9BA 5LB4A 3DE5X 4A8JA 2CXSA 3L04A 2A9RA 2UUPA 3B2QA 521PA 2C4VA 2PBZA 5EXTA 3TMYA 2NWQA 3BSSA 4FGWA 3JQEA 2HREA 5I51A 1XMJA 2GK6A 2HXYA 2UZAA 5DP2A 5E3JA 4JBYA 1P5RA 5D85A 3SF8A 3VC1A 4ZGGA 2H11A 2HX1A 3ADPA 4MV9A 4R1MA 4ZYYA 1OX6A 2X6QA 1A2BA 4EVSA 1Q7TA 4PYJA 4WOCA 5CLFA 4AMUA 1CS4C 5EFZA 1S3GA 3UUGA 4LF9B 2GJ4A 2TRSB 3DTYA 3PL5A 4YN3A 3OPQA 4AT1A 2GEVA 1Q22A 3A9CA 4RA6B 4BCDA 4C0LA 4Z4HA 3GFQA 5JCJD 1JBEA 1UJMA 4KN9S 4Z86A 2VHCA 3BBLA 1T9BA 4B09A 3TR5A 4UCWA 4DCPA 2WKQA 1Q1GA 1D9XA 1LI7A 2VJYA 4KI0A 5AXCA 3W5HA 1QJCA 4M22A 5FV4A 2CC2A 2I4TA 1TCVA 3IMFA 1CQJB 3U7JA 3FF4A 1U04A 2VNKA 5HBGA 2JFPA 1PJBA 2AV6A 3BFKA 3H16A 4B73A 3H9QA 1ZINA 3T9FA 2WTXA 2XKKA 3KHTA 3DA8A 4GQAA 2Q5IA 3C3WA 4DLYA 1PZXA 4JCCA 4JX8A 4N12A 5KMGA 2ZVJA 1RZ3A 1WVIA 2WU3A 3H1BA 4L6IA 1N3LA 3J80A 1MA3A 3ZXSA 2J7PD 2XEXA 4L2IB 2OQIA 5K3FB 3KQSA 1NC1A 1Z5UA 5M29A 4PHHA 3CVUA 1KIAA 1NPYA 3MG9A 3L8FA 2DT5A 4NZPA 4P0PB 1N75A 1N6OA 1EI9A 3CHYA 3FI9A 1TKBA 3K0SA 2ZCVA 3BXEA 1ATZA 3HHPA 3BRWD 1U7UA 4UPDA 1CZOA 3RRXA 4HBZA 1VP9A 1COWD 1SH7A 4KXVA 2EW2A 4L85A 3LU1A 1U80A 1TO6A 1XEFA 4ZP1A 2MCFA 4EY3A 4YRMA 5D5QA 1WV1A 2Q3LA 3L6CA 3MTBA 1TMOA 4I4CA 4ME6A 3AF1A 1APBA 3R9XB 3QKRB 4XJTA 4PGHA 3WNZA 2C42A 4S1PA 3HJHA 5FPSA 5TVKA 1IXYA 1KK1A 2EU8A 3BL8A 4OHMA 1OA0A 2VDJA 4QOJA 3NIWA 2D1FA 2JI4A 2XNKA 1LRJA 3L7LA 2VQFB 4QLAA 4QEZA 5THKA 1YJQA 1I2DA 3HXLA 1D04A 3WLEA 1J0AA 1RLTA 1ZH8A 1YWGO 1JW9B 2RAVA 3JQ7B 4FK8A 2VT7A 4KTTE 4TS9A 1S2LA 4P84A 1XZJA 1XTQA 2CZQA 1C1YA 2P9JA 3V8RA 4LBWA 3CNLA 4DY6A 3IE0A 1GZHB 3EGEA 4TSFD 3Q8LA 2VJMA 2HU2A 1SURA 5CVDA 3THYB 2PU7A 4WCFA 3HJBA 2PR7A 4M1SA 1SNYA 3QMMA 4OTZA 4IX9A 2GRJA 3VPXA 3AERA 4PYLA 3FAZA 4Q3LA 3PFIA 2VTBA 4WFIA 3C3AA 5KJEA 5TF0A 4GWGA 1DQSA 4TTJA 1NW4A 1Y1PA 4J1TC 4WOJA 2N75A 3VJKA 5E95A 4Q4JB 3EX7C 4YA6A 3SZ3A 3TI9A 4JLKA 4CUJA 1SHJA 2D2FA 3CLRC 3RF7A 1QVAA 4YREA 2HMWA 3RFVA 4B33A 1YRBA 1YE5A 4XIYA 3NKVA 1WOYA 2FTKE 3AX6A 1HX7A 7MHTA 3ZY2A 4YXWA 4ZOQI 1A7AA 4KFSA 3FUCA 3G7UA 4MLCA 5I7SA 1W0KD 1IY2A 5ITVA 2R1TA 1LBTA 1E4VA 3C3YA 5AUPB 3QVOA 4RF3A 2HV9A 4PO3X 5B2EA 4IVQA 1VL2A 1XPJA 4RVCA 2Q7DA 1U3CA 3AO0B 4CM6A 1J1UA 1QHEA 2W6ZA 3COYA 1P60A 4C01A 1KQFA 3AHGA 1M1NA 1ESCA 5FWYA 5IS2A 1UBRS 4Q1AA 1XF1A 2XOEA 1Z6YA 4J1SA 3TX6A 2AOVA 1YUMA 2CNBA 3V00A 2DBQA 2JATA 3CSDA 4ZYTA 5K0NA 4Y2XA 2BTOA 2G9UA 1P5HA 3NI2A 1GGEA 4B3SB 1KEEA 3DAGA 3GJTA 1PS0A 2GLUA 4UTNA 2BGKA 3TW8B 3JASB 3J81A 1L0BA 3ASUA 1HOXA 3UXYA 1KA9H 3ADOA 4DDKA 1QHFA 2C8LA 4KFUA 4B32A 1A76A 3ABSB 4KXLA 5K99A 3I0MA 5HEKA 4OXNA 3RAPR 3CVYA 1BWRA 1FFBA 3DTVB 3HC7A 5ALHA 4P83A 4UUNA 4RETA 2YVKA 3IURA 3KSRA 4GI7A 4WZAA 5TGZA 3T3EA 4WV3A 1R4NA 3VR0A 3W6OA 2IHBA 2Z56A 3TQIA 3EQ9A 4MWDA 4WBSA 2GUWA 4AMYA 3R2JA 1CV2A 4TM8A 2SBTA 4H27A 3BQMB 4E2XA 5BORA 4GLLA 3QU2A 3REGA 3RHZA 3MS4A 1IQPA 3M6IA 4CNBA 1C9MA 3GF4A 4C5AA 4N3BA 4DCJA 2J08A 2RHGB 4I55A 1XFAA 2EHDA 1C7QA 2O57A 2VEOA 3HJUA 4JQCA 2I71A 4X6UA 3A25A 5ALIA 2NPFA 3OCWA 3W6ZA 2GPSA 1THZA 1ZQ1A 1U28A 2GO1A 2PT6A 3GZNA 4Z1OA 3W5VA 2VP4A 2G0TA 4MR7B 2O8EA 4TTRA 1BD3A 4ZGBA 4QAJA 2IHUA 1WCV1 2P78A 4X5OA 4ENRA 1FYDA 2Z04A 1Z39A 3EVTA 3G2OA 4RORA 1BHO1 4AECA 3U3ZA 1LTHR 2IUTA 3E61A 4UASA 4LRTB 5HDQA 4TL9A 1GUYA 4YAUA 1DFGA 1C9EA 3OLZA 2OXCA 3MWDB 2V3WA 1N5OX 3I9V1 2H1SA 1C1XA 1TXGA 2YUTA 3E35A 4GLFA 4PIMA 5EMKA 3G8CA 3GAFA 3DL2A 2VZLA 3CEPB 1TKRA 3ANXA 3Q1KA 4G5FA 1DBIA 3DL0A 3JWGA 4XB1A 2D1QA 5C3MA 3IP7A 1QORA 4DB2A 4QODA 2O2IA 2GBCA 4BYMA 1CBUA 2AN3A 1XVIA 1T8RA 5CLQA 2O2HA 4MVJD 2IZ5A 1WWKA 3A4VA 5E6RB 3I72A 5IG2A 1U8EA 4NK4A 3TOCA 1NJ8A 4RZHA 2QLTA 3E9EA 1JTVA 3IXQA 3NFRA 2Y4OA 5G4KB 2JAXA 3ZU4A 2JCYA 5JNLA 4H17A 4ZIRB 1KFBB 4XLTA 3NNSA 5DLPA 2A92A 3OEED 3JYQA 1UBLS 3H2GA 1C81A 1KZYC 3MQ4A 3OF3A 1L5HA 3WNBA 2OGUA 3L92A 4IDGA 1DHTA 3DOOA 4E2WA 5INTA 2K7FA 2RCNA 2CV0A 3R6GA 4ZVVA 3EBPA 3VR4A 3BRQA 2DAPA 2H16A 2XVXA 4X0EA 1KDPA 1XJ0A 1MG5A 3LDUA 3NETA 1WVGA 1SXJE 2L17A 4ESEA 4GKVA 5AM0A 1GTJ1 3K9NA 2JFWA 2VPWA 3IQIX 4JIMA 1VXRA 2C61A 1BRMA 3S2SA 3LHSA 1DWUA 3TLYA 4QGSA 4XWWA 3IAS1 4GZ6A 3T3IA 5J4YA 1HC7A 1YACA 1LDMA 2EFCB 5BPFA 1BW9A 3KKKA 3H0EA 4WINA 1U1IA 1NM5A 2EWWA 3DXZA 3F8WA 3T1VA 3LBFA 1TM7E 2ZJ4A 3U17A 2OD7A 3DFIA 1JHMA 1OX5A 2SECE 4P36A 3U7RA 2WIFA 2YMLA 1PKEA 1FTWA 3F9IA 3PC4A 4ZAFA 4EB6A 4PNEA 2GWRA 1LNSA 1PW5A 5LP1A 5DPMA 8ABPA 5FUYA 1Q77A 3AEXA 2R0QC 4C3UA 2QM8A 4BEWA 2QVLA 3DWEX 3RBVA 3RASA 3AUAA 4FDAA 2HJ9A 1KGDA 2I3AA 3NBKA 5I7OA 5JARA 4AMZA 2WIGA 1DEAA 1TVKA 3I76A 5KMGB 4Q9HA 5EXDA 3EEQA 3UPTA 3D6NB 1TK9A 2LD4A 1XELA 2QTMA 2G9ZA 2XQGA 2Z8ZA 1RSZA 3RSFA 1KOJA 3EISA 4IOKA 4BU1A 2O8BB 2F3QA 3RVOA 4BQOA 4EGCB 4F1WA 1L2TA 2BKEA 1JVSA 1TQ6A 3AP2A 4NPCA 2IIVA 4OUDA 3UA4A 1AMOA 1WXDA 2HT1A 3AJ8A 1JMYA 2PRJA 2OHXA 1PR0A 3T9AA 2C20A 2IW1A 4M1MA 3UVEA 4JI3B 3KEGA 4AROA 4EEXA 1Y1KE 3ZQ6A 1Y3CE 1AKEA 4B3HA 4G0UA 1R0XA 2OOKA 3Q12A 5GVSA 1SR8A 2JFOA 4F2GA 1ZOIA 1DRJA 4Q1EA 2B1GA 4M36A 1BDBA 1ZIXA 3TBKA 1JFLA 2WPDD 5KWEA 2Z2XA 4M1OA 2WV7A 3K92A 3FFXA 3VI3B 1ECJA 1TRHA 3TG2A 4FGLA 4FQ5A 3LGAA 4ZOEA 2E89A 4KLCA 2SHKA 4HVAA 4W5QA 3BGDA 4MV6A 3IEKA 3O2QB 1U8UA 2J0UA 1U2GC 1Z4QA 2P5YA 1P72A 4JHXA 2Y92A 4QULA 4TYQA 5JT1A 1JZQA 4PICA 1O6CA 3IBSA 1M75A 5CJJA 2CDRA 3LIIA 4KUHA 3O3NB 3R5KA 5FNVF 5GMOA 4WKOA 4E31A 1WZEA 5K3CA 1RYEA 4WJKB 3ZJ4A 1ZBQA 2HZ7A 1UMCA 3SEZA 1NGSA 4OQMA 3E7XA 3CZPA 1M9NA 2VJMB 2ZUSA 3EXHC 1Z0KA 1NW6A 2KPOA 2XRFA 3DJYA 3F90A 3QBDA 4TMXA 4WCFB 3WGTA 4DDHA 2X2FA 2P4QA 2RH5A 3QE4A 3AERB 3RGGA 4TWBA 4HLUC 2VTBB 5KVVA 3H3FA 1QONA 2LWIA 2X9VA 4I4NA 1RKVA 1CNEA 2EAUA 1MEEA 5FTNA 4ZZ2A 2W2QA 5LQAA 3NAQA 2NPIA 5E2IA 5J2TF 3GWZA 1GRCA 3NGMA 3PSHA 2ZUWA 5KOHA 1HG1A 4D42A 1HEYA 1XZIA 1L7PA 1ZGGA 2FSVA 2FEOA 2VRNA 1MJGA 5F2EA 5L40A 2WYOA 4HNQA 4X65B 2IRWA 3R3SA 2Q41A 4RSRA 4OHYA 4BEBA 1JDUA 4G8DA 3RHFA 1NXPA 2AMFA 2OWEA 4IIJA 5LOVA 3H2HA 2O3RA 2BMFA 4JH0A 4B45A 3HY3A 1EP1B 4J7AA 2R1TB 2ZBGA 3D43A 3FGOA 4E30A 2I87A 5CW2A 5EERA 4IILA 4X9XA 5K5EA 1P3JA 1OAOC 1RYMA 4HUJA 4LDNA 4D9MA 2QSJA 3HCPA 3WGIA 1Z56C 1BXRA 1D7AA 1HNNA 2XGGA 4TKUA 1M1NB 4DF3A 5FWYB 5I4BA 1V71A 4HB4A 2AOWA 3V1TC 4UQLA 2WAYA 3AIKA 4ILKA 1ORVA 3PNBA 2RHHA 1PJRA 2GA8A 4U6SA 4W6QA 5A4DA 1EZ4A 2JKZA 3KALA 4MI6A 3DBRA 1KEEB 2VT2A 4ZT7A 2PH3A 4JJZA 5C8VA 4Q1DA 3ZS8A 1UCFA 5JO0A 1DTWA 4GXQA 3HI4A 2PZKA 5SICE 3V80A 1I4DD 5DGTA 3VDRA 3FDFA 3K3PA 2J0SA 1WCIA 3IQEA 3VU3A 5EMLA 2GEFA 1P2SA 3IBCA 1XCJA 4FYVA 5DF1A 3ZDXB 4UUQA 4DAEA 4EGFA 4QUHA 4BGIA 4WZAB 3UUEA 2FFQA 4ZZIA 2QGFA 4JOBA 4OVKA 1I4LD 1R4NB 4RCYA 3ZWXA 1G64A 4AD8A 1Q1QA 4IQGA 4OYLA 1AUQA 5IC5A 4OHFA 4QVKA 1AGNA 3MB8A 1DWPA 1VMAA 3CZ5A 2EZUA 1QP7A 3N0TA 4GYKA 1JA0A 1OAKA 4MCIA 4YJKA 3ZS9A 4COKA 4I55B 4NENA 1TJPB 4UE2A 5IAEA 3L93A 4LNAA 1I1HA 1F1JA 3WP0A 3GQVA 1JQKA 4G4SO 1NLMA 2IHZA 3ZPXA 1GNPA 3GZNB 4ER0A 1X39A 1ZRHA 1E1CA 2FZWA 2PLFA 4R3UC 4PWZA 1D2AA 4U8GA 2O8EB 1E94E 3SMVA 3U4CA 1CZLA 2HJVA 2ZQZA 5BR8B 4QUIA 1WEKA 5LM3A 2CW5A 2G7MC 1P4RA 4E5KA 1C80A 4H77A 2OLEA 3P5SA 5K3BA 3V2UA 3H6KA 3ZCSA 3B9BA 3G59A 3ZWAA 1I7NA 1DZ3A 2AG5A 1GCOA 4C7OB 4CUKA 1C1XB 1BAPA 1YD7A 4OXKA 2BEJA 4IDOA 1QRAA 1R88A 1W93A 4F9GA 5I9LA 3MUFA 2HIMA 4CCWA 3EBOA 2YNMA 1H3FA 1CC1S 2IPMA 4M9UA 3MJFA 5CLLA 2WMOB 1NIPA 4HDAA 4JI7B 4OHKA 5TY0A 5KYKA 3E58A 4MV5A 3EPHA 4Y6OA 4XAQA 2VJAA 2YICA 5H7XA 1KPGA 4UBJA 2VYNA 1MQ8B 3FTNA 2A5FA 4HVCA 3RU7A 2IOQA 2FQYA 3A1EA 3ONVA 5K6AA 3CZQA 4RHYA 3UG6A 5C81A 3DD1A 5P21A 3ZVKA 4EUFA 1L5HB 1LDEA 2PMWB 3D8BA 4KQ6A 4QO7A 3UGQA 3OU7A 3AJAA 4EW1A 4NZYA 4TS3A 2Z5GA 4RVUA 1TQHA 1CXZA 1O94C 1R5BA 2NG1A 1DKRA 2ZROA 3FXAA 4JL6A 4DGQA 5J58A 3FHTA 4OMUA 4XUEA 2E2WA 3AF3A 2G1KA 4L6AA 2RH9B 1W19A 3INTA 1KVSA 1RKQA 4FU0A 4EG6A 2O54A 1IU9A 2HDHA 1CG6A 4R2KA 4TLLB 5DIFA 4N0DA 4I5FA 3D64A 4AY3A 4PGMA 1W5TA 1FMLA 1I9GA 1M83A 2VG8A 1YQUA 3K4QA 4TROA 3BTVA 4C5BA 1BW9B 3UJCA 2NQ8A 3TCNA 4DTIA 2QP3A 5C7IO 3SVTA 4LZAA 4HTAA 3NT4A 2XVAA 1D1PA 4X94A 1YMUA 4RJJA 4M7WA 3RUIA 1SBNE 4J9UE 3WIOA 3WWEA 1RM4A 4EB6B 2W5UA 3BIOA 1F38A 2ZIZA 4G86A 1OZGA 3KT6A 4NZOA 1ACLA 1GFZA 3BE5A 1OF1A 2JA1A 3WL4A 2QY9A 1YRAA 5CDGA 1JGTA 2HCTA 4Z3DA 2XEDA 3F0TA 1W75A 1TK3A 1JAHA 1YZKA 3TQQA 1UDAA 1XYVA 4GT1A 3FMGA 1C0IA 1NJ5A 4W5RA 2WNSA 1TVKB 1TW2A 3HLKA 3H4TA 4F4IA 1LD3A 2CNNA 2PBFA 4IPTA 4BO1A 1VHJA 3OT1A 3F8SA 4AO7A 4OH7A 5EJ4A 2OAGA 2XOKD 3VKVA 3W06A 4AIIA 2XD4A 4BNXA 4MP6A 5LXTF 5IVHA 1NVVQ 3HSSA 4G26A 1OQAA 4RH1A 4OUDB 1IQ0A 3WNDA 3KZMA 1P9RA 4BJ5A 3HCOA 5DXJA 2E1RA 2YJZA 3BA6A 3CIFA 4YQYA 5LJLA 3WJAA 1PU2A 2IU0A 4OX9Y 1RR6A 5JJLA 4A82A 3CONA 2P2CA 1M7BA 1W85A 3EZGA 1D4OA 3KEQA 2RGYA 2WWGA 3CW9A 3L8YA 3G8YA 5EKDA 5H70A 3RGWS 5TLSA 1WKVA 2W0MA 4AJPA 1BC5A 1Z2CA 3PWKA 4JYPA 3RSLA 3UAXA 2F1KA 4N5DA 4PYIA 4A26A 1QFXA 3ZZMA 4AKSA 5ICEA 1CJVC 3G89A 3CLHA 2LCIA 3UCEA 2I6UA 2PQ0A 3GU3A 3QEKA 4LF6B 2WUGA 3C8ZA 3A3NA 5I7AA 1USWA 3ML1A 3G2LA 2J0UB 1FPQA 4ZQHA 4P80A 3AJEA 3CZAA 2C0QA 1W5BA 4UMFA 2P4EA 4RY0A 3BA1A 3HXKA 4OUKX 1KO7A 2H54A 2RGWA 3LBYA 3SN6A 3DOHA 3GC6A 4Y2JA 4I6JA 1NURA 5C80A 3GPCA 3GUHA 5DTQA 3E5MA 4WJZA 1NJFA 3DVQX 4BNDA 1YVPA 1UMCB 5AW2A 4OHPA 2D74A 5KVQA 3OZXA 9LDBA 1GJRA 4M0EA 4Q1CA 5ALDA 3E5NA 2AR9A 3H2SA 4LVCA 3MD0A 4OB8A 2IYSA 3IE1A 4R1PA 4OH1A 5FUBA 3VPGA 2E85A 4X24A 2BC9A 4E5YA 1UJ5A 4KO3S 4NE2A 4YXFA 4Q7KA 1RAIA 3W79A 3AV3A 4NOMA 5KOHB 3MWJA 2P5SA 3RODA 5CBKA 1LDBA 5IJAA 1P44A 3GFSA 1ENYA 3MC1A 4R1SA 3VO2A 3T3NA 4IWXA 1SCDA 2RSLA 3Q5EA 5F64A 4ZXFA 3ZHYA 2JEOA 3L18A 4GZLA 3NAMA 4YMTA 3BWBA 2CL7X 4QWMA 3WK6A 3FPJA 4IIJB 4U2KA 5LA6A 4F84A 1E32A 5LOVB 2OD9A 4IDQA 4C4TA 1XJ5A 3UXMA 3ZQUA 2JIOA 3DP9A 4NCHA 4CMJA 3RU9A 3HPQA 1BX3A 4X60A 4JSYA 5FBKA 1BXRB 4P5PA 1SKAA 1A5TA 3HY4A 4TKUB 9ABPA 4ZI5A 3NP7A 4YP9A 3RVNA 1MW8X 5IVPA 2JA2A 2EDCA 2GUGA 1ND5A 3J7AC 3KXDA 3FHOA 1CIVA 3EHEA 5D7NA 2PJUA 2BFDA 4IMPA 2B8JA 2FGKA 4RL4A 1XTBA 3RANA 1YDWA 1EZ1A 3DBRB 4LYEA 3GRUA 3NRJA 4YRSA 1DTWB 3PHIA 1FRVA 3OIFA 1YZFA 5KWJA 5EIXA 4NLLA 1WMSA 3DOUA 1WCIB 1TJYA 1WW8A 4ZVLA 4B3IA 1HLGA 1E4YA 2ONYA 3MUEA 3DMPA 3THOA 5JLJA 4U0JA 4YPVA 5ESXA 4GUDA 1L5OA 1GLNA 1LBQA 4DVJA 1F12A 13PKA 1H0KA 2D3WA 2E7ZA 3LP6A 1Z7BA 1XMSA 2VJBA 3HEMA 3I4CA 5REQA 4TT3D 2PX0A 3PXXA 1JEDA 5LDDC 1F48A 2YMPA 3C4QA 1PGQA 4CG0A 4AJHA 4CGYA 5K8IA 5HKBA 5ALLA 1PVOA 1EK5A 4D3ZA 4FB5A 2BFBA 2XMCA 3QLUA 2FFBA 1OKKD 4PCUA 4MRAA 3DUWA 4NENB 1G20A 4UHCA 2FPGA 1U3DA 2Q1XA 3AM3A 3K94A 3PEEA 1E7QA 4NH4A 3SIWA 2AMJA 4BUCA 3FVWA 4EW6A 4PRKA 3UMRA 3MHPA 1A82A 1GNLA 2OHOA 4XDYA 1E1CB 1QHHA 1UFOA 1LBEA 1M2WA 5JRDS 5K8VA 2FETA 3COJA 4UM8B 3F3KA 3BXPA 3O4GA 1L5LA 4DM7A 2FMXA 4JVMA 2HXGA 1LU9A 3GGJA 4RWEA 3LQ4A 3ZD8A 3RARA 4E70A 2JZCA 1CERA 3RFFA 1BIFA 1N2BA 3CISA 5ALMA 2ZM6B 1SOMA 2I4OA 4UNRA 5C18A 1C9NA 2RAUA 4WLVA 4YONB 3GCDA 4RDCA 1NXWA 3UA3A 4KJXA 2YXNA 3R0ZA 2MR6A 3CU5A 1OROA 4R1LA 4KRFA 3WMFA 1L5FA 2G6TA 3I9FA 3OFJA 3P7MA 4C1NA 2KHZA 3HYLA 3BD9A 3EGXA 1HSOA 2G5CA 1S3FA 2I67A 4ZZ0A 2WM3A 3O0TA 4A3SA 1XAGA 2X1HA 5T4HA 4GPEA 1QM5A 3C3MA 3K53A 2ZITA 1NX6A 3PZRA 2HIHA 4OA5A 2VZEA 3VKFA 3NG1A 4AM8A 4WXYB 1FY2A 2CF5A 4JUAA 4HAOA 1GV0A 4X93A 1ZVMA 2MYPA 2X9GA 1XXHA 3UJDA 4QICA 4PSVA 1BKYA 4ZK2A 4QAQA 3NHRA 6GPBA 1CQZA 2G70A 2IF0A 1ZLYA 4B35A 2GBPA 3H83A 3ZX4A 1SCNE 1D9ZA 3TLCA 1Z3CA 2AD1A 4R5HA 3PWZA 3TLXA 2C7QA 4EY5A 3SNHA 3QPBA 1G98A 3N70A 4DCTA 1HTTA 2ROQA 2PGXA 4QPCA 2J5QA 3M5WA 2GZ2A 4MP3A 3UK6A 3WQQA 4U7DA 3D6AA 3BAZA 3O8LA 4K1LA 3B1FA 2A0XA 4G0NA 4R54A 5FLKA 3K0CC 2BKVA 3VSAA 1P7YA 2WPNA 4EH1A 5B30A 1RW4A 2PT9A 3VR5D 5FBHA 5BN4A 1XLTC 3R74A 4GOKA 4JEMA 3LNTA 1SVKA 4YQEA 1SCIA 1MVNA 3D8TA 4JKOA 3UNXA 3WIEA 3JQ9A 4FCWA 1OV6A 4UAVA 1R6VA 1YZVA 3NBYC 1NKSA 1SIOA 1YB4A 5LQRA 5M04A 5LQKA 4PSAA 5KNCH 2HA3A 2WIBA 4YJDA 4ZO4A 5JSUA 4H60A 1JXAA 3BXOA 3EUEA 4RXTA 1JPVA 3U48A 1ORDA 3H65A 1W0CA 4WZAE 2VBFA 5FTWA 3HM2A 9LDTA 4BP1A 4BATA 5IZ4A 3OT1B 4KB5A 4YIKA 2BGRA 4LTMA 2RHBA 1GVHA 4WKPA 1Y0BA 2WB4A 1PZGA 4M83A 4G23A 1JEOA 2XUQA 3LCCA 3OP1A 5IUKC 5BSUA 4ZYUA 5FNVA 3KAPA 4PQEA 5HVNA 3RT1A 3DLHA 1FU8A 4R0MA 3BK1A 2NU7A 2RGBA 3CGGA 3AM5A 5CM8B 3L7KA 4K3VA 1Q3HA 3UG7A 5CB6A 1DINA 3IV6A 4FZJA 3LPAA 3EXIA 1W85B 2NQ2C 1WDWB 5DULA 1N2IA 1RRFA 1AQLA 4FLMA 3NALA 2RGEA 1Z6ZA 2ZE6A 2GZRA 1G3MA 5COQA 5HF5A 1KTIA 3S8EA 2Q3EA 3ZY3A 1DL5A 1WL8A 3KE8A 5CFNA 1K0FA 1K5HA 1CR0A 1N1MA 1BMFD 2B4KA 2XQFA 1TCBA 3P4YA 2BMWA 3K9BA 5A03A 5HP4A 1VLHA 1BWPA 1D6JA 1M6NA 4XEHA 4KR6A 2HK8A 4IJWA 4DR1B 3R7BA 3ZV4A 1EXMA 5BPHA 5LMNB 4R8VA 3LPDA 1FQWA 2PV0A 1E9BA 5AW1A 1K3UB 2WJZB 2DY0A 4KLRA 1OREA 2VWHA 3G2PA 4BNDB 1K6XA 2AXPA 2VJOA 2YINC 2RC5A 2BCGY 2P7HA 4G07A 3UOGA 2ZYDA 4C88A 4J0QA 4OLBA 1KVTA 3U4IA 3F5MA 1PL8A 4C89A 3ADDA 4E0BA 4DSNA 2VAPA 3L84A 5EJIA 5FFMA 5E7JA 2GJKA 1QIIA 3GEMA 2BMAA 2P77A 2JLRA 3ZLBA 4CUZA 3NVDA 5KWSA 1U1GA 2AD5A 2OUKA 1TJ3A 3A58B 4JLSA 5BYBA 2C8KA 1WABA 1DDIA 2V7VA 1TZJA 2PSFA 1JQLB 1OCEA 3OH8A 1RXSA 1Z13A 1A4XA 3E0QA 4I50F 2ZU6A 4L5YA 2YASA 3BWEA 1E1RD 4V1CA 3L1IA 2A9JA 2CJFA 2DTXA 4IV5A 4KE6A 1JSLA 5D3KA 1DUVG 5LA6B 1KJ9A 1VSUA 5TVGA 2BUBA 3GXOA 4M38A 3L1VA 3WSTA 1CEQA 2JLXA 1T5IA 4LTDA 4DJJA 3GJ5A 1LX7A 1OT3A 4NKRA 5IPFA 4EBBA 3TR0A 1L4BA 4RMIA 1L6IA 1ZMTA 2VH5R 3B8HA 2PXHA 1NT4A 3HFRA 4WERA 1U0FA 4CM4A 2NXJA 5JEDA 2RBGA 5H02A 4B3MB 2BFDB 2YJNA 3I0ZA 1EXVA 1TQ8A 3KOZA 1DAEA 4KMRA 1SWVA 3JVUA 3QV2A 5D6NA 4D9GA 1WULS 4KQ1A 1Y5NA 3GNLA 1RJWA 4FGZA 4BRWA 3R7LA 2QBYA 3X1MA 2GPJA 1JU3A 2CDNA 2QTLA 3H2BA 3RVJA 2YFYA 3H8JA 3C6YA 1A69A 1M0SA 1SXQA 1I3LA 3ZWPA 1VSQA 2WUVA 3SM3A 1AQUA 2XD9A 2FDCA 2GPNA 4GECA 2IEIA 4W63A 4RACA 4IVRA 4P3OA 2DP4E 5EHXA 1IOVA 2R7AA 4FDTA 4BMSA 3RFUA 2O7NA 3MRXA 1IUOA 1A27A 2JRCA 4NC9A 1CJTC 2C9DA 5REQB 3FGNA 2ONCA 3T5MA 4HOYA 2B37A 5EEHA 1FRNA 1UOQA 2C9ZA 1C5KA 2ACVA 4G97A 1Z0FA 2EHJA 1N5MA 3U6KA 5AIAA 5DNVA 5KWVA 2BFBB 2QT9A 5C8YA 3JQ6A 3PC7A 1GUFA 3F2IA 3EIFA 3UMYA 2Q50A 2OM6A 1G20B 2WBLC 3IHLA 2FPGB 4XI9A 3TIIA 4B6EA 1H8EA 2BI4A 3DQQA 3G88A 4JASB 5DGIA 1GGVA 4ALMA 1VKHA 3HN2A 3A14A 4B85A 1CDOA 5JAHA 1FU4A 1QHHB 1IXSB 4CIBA 2L19A 3NRBA 2ZT6A 1ZGAA 4BRUA 4URFA 5H9WA 1XCLA 1MX3A 5F5LA 4LSGA 2G0AA 3VVBA 2IWHA 4UARA 5F9HA 1JJBA 1TVEA 2P2DA 3ZZ1A 4I1PA 1XDUA 4I8IA 4F5YA 4BKRA 4DV7B 2P62A 4QTXA 2R2GA 1L7BA 5JMPA 1B00A 4KAXA 4YRQA 2UZ0A 2IIQA 4FZVA 4F0JA 2I78A 3EGXB 3JZDA 2O1XA 4PZUA 3HNRA 1NLYA 3KJGA 2PX4A 4C21A 1K1EA 1Z7YA 1U1CA 3TQTA 4BZZA 3FKSD 5SV2A 2JAOA 2WWTA 2XNDD 2JGIA 4ZQIA 5C8DA 1J2EA 1H85A 2XIQA 3AONB 2TSYB 4FI3C 5FWNA 3HVRA 3A2LA 1QG4A 1XOIA 5E3IA 4PHGA 2PH1A 2ZVQX 4RV9A 3FDZA 3B3FA 5FL7A 1XCPA 3CF6R 4W7HA 4CDRA 3K1ZA 1GO2A 1WO8A 3MJCA 3U16A 1XXHB 5IWCA 4CYMA 4E09A 3CN9A 4GSLA 3TAXA 1HWYA 2TMDA 1P2GA 3C85A 3VX4A 4UBKA 5EMNA 3AUXA 4U2BA 1N3YA 3WKCA 3EPKA 3L06A 4BP8A 3LUCA 1G3RA 2EJUA 4EFKA 3WRVA 3I5YA 1U8CB 4RVOA 4BO7A 2B92A 3A6HA 3O8QA 1ZVVA 1R3UA 3HDHA 3E8MA 4AN4A 2EJBA 3OFND 3Q72A 1DCFA 2VF8A 1GG8A 1M33A 4FIZA 5KINB 2HU7A 3WOHA 1JG4A 1WSWA 2VYQA 2VSQA 1USGA 5BN4B 4N8SA 4PANA 5LYJF 4Z6KA 4J07A 3ULKA 5LFAA 2P9TA 3RIEA 4P0TA 3GLGA 3O7MA 1T91A 3MTIA 4N54A 4K1XA 4RHEA 5T67A 3U1VA 2R751 4WEQA 5KOYA 1HORA 1K5GA 3GG9A 3RPEA 1FEZA 4E1BA 3OVMA 3ZGLA 1U9CA 2HJHA 1WAMA 3R7NA 4E07A 2DFNA 2DB3A 4N40A 4W7IA 1WXGA 3HLTA 4DTCA 1HRDA 1KQOA 4JT9A 4ZCLA 4EGAA 3O93A 2OV4A 1PZFA 4ZCMA 2FEPA 1GQQA 1JPUA 3ST7A 3H13A 1W35A 4IH9A 4CM5A 2A8YA 2FA9A 3UB2A 4PRLA 2WTBA 4RIIA 2FOLA 1X7GA 4DGSA 2J67A 4C3ZA 4N9WA 4R2WA 4KI7A 1FS4A 2IYXA 3TFOA 1G7CA 4S1TA 1NN3A 1XVAA 3ZHQA 1Q0UA 1V3UA 3G3EA 5FNVB 4CU2A 2D13A 1ZO8A 3MELA 4I2VA 1LVGA 1LS1A 1NW9B 4KGXA 4BZQA 3BT7A 2NU7B 3HR8A 4UXHA 2OCLA 3W1EA 3E7PA 2Q5FA 2IVFA 2XH8A 3EGIA 3HU5A 3EXIB 1G8AA 4U6NA 2IHNA 4GM4A 3AVQA 4FHZA 4FE4A 2CXTA 1ZXXA 3V55A 3PC8A 3T5DA 3NANA 1YQ9A 3FY4A 1K86A 4ANFA 1YU9A 2GI4A 1FLVA 3ZU5A 5H68A 4DARA 1SCUA 2FWPA 2JI9A 2Y93A 4YMSA 1BZYA 4CEJA 4EFMA 1FW6A 4CT0A 3VH1A 3C3BA 4Q1FA 3CRMA 2PPLA 2RIRA 2V55B 2QROA 1VHDA 4FCVA 5ABPA 4QDOA 4EY6A 5CA1A 4IIUA 5E4FA 5H83A 3VV2A 3PEUA 4BO5A 1CB7A 3P2YA 2RJNA 4HDOB 3U40A 1OGYA 1KZ7B 4N03A 1I5OA 4EMTA 1PAUA 4B8ZA 1RAHA 2I2BA 1NVMB 4H4DA 2QE7D 2CHUA 3HB7A 2CNKA 4LDZA 3MWEA 4DYDA 2PKEA 4TTPA 1G63A 2A7XA 2AF3C 4EB8A 1VJ5A 1LDNA 1I4TD 1IE3A 4WFQA 2CXQA 1Q0SA 2P0EA 5BSWA 1HL7A 5HJ5A 4X1KA 1YV9A 4OQYA 4C3OB 1G5QA 2C0PA 1XZDA 2VNSA 1H93A 3D0OA 4B4OA 2IZ6A 1L5YA 2UUOA 5DNYB 4GOLD 3GD5A 2PUFA 1ISFA 1AQIA 1KYZA 4P93A 3PVSA 1D2NA 1WX1A 3SKYA 3GEEA 3GNTA 4EI9A 1AD2A 1ICIA 3HNOA 3IAXA 2EFYA 5AQEA 2YV4A 5J63A 4UMEA 2JL1A 4V1CB 4N6NA 2QW1A 4ZQFA 1V5IA 1BJKA 3C6ZA 3EDRA 4NJMA 5CYFA 4HNGA 5JE8A 3W9SA 1UM9A 1XK6A 2WU4A 2IEDA 3GEDA 5ALGA 1SOAA 2NT4A 5E6UA 3SU8A 3WR5A 5BN1A 5BV1A 4KNVA 3U5ZB 1CUGA 4MS4A 2XCOA 1QB8A 4CWAA 1HYBA 5DK6A 3SHQA 2RDMA 3GUCA 3UK0A 4M8LA 4P7BA 4BBZA 16PKA 1CZUA 2BFFA 1AKUA 1CNMA 4M0UA 4IDCA 4HUQA 2C3MA 1K06A 3ETGA 4XKJA 1IN1A 4U7WA 4Z7OB 4L95C 4IV8A 1PGNA 3A1CA 2J0EA 3OTQA 3RUCA 4R0VA 4N5LA 3S2IA 3WGLA 3PQ6A 1EESA 4G0ZA 3BKWA 3DE2X 4QXAA 4RTMA 1X19A 3NFYA 4JV5B 1J0BA 1QZUA 2Q2VA 4FT4A 2QBYB 2VJNA 3KEFA 1NJGA 1IOZA 2GESA 4GXTA 5AJTA 4C7MA 1JX6A 2FFHA 4Z54A 4X90A 2EP7A 1T3TA 2ZAGA 1T3GA 2E82A 4QECA 3WJ7A 1ADCA 1L5ZA 1Y1QA 3FLMA 4Z1MD 2HU5A 5BR4A 1MD9A 4EMUA 3EFOA 4CTOA 1CP3A 3E7FA 5J23A 2XMSA 3HJCA 4P81A 4XJSA 3V33A 2YWCA 5JCXA 2RKWA 1QOPB 1PFYA 2BH2A 3K4HA 3BAFA 1XIVA 1V7QA 3DBHA 5HCIA 2H7XA 3GL9A 2OLJA 3ORHA 1GCGA 1ZW1A 2CJYA 4BX8A 3OESA 2H9YA 3CUEF 2YMQA 3HB1A 3L82B 4GX2A 1YZTA 5C8YB 1ABEA 2XUIA 1XRJA 3BJIC 4GLJA 3FWYA 4Y7CA 3TXYA 2V7EA 4L9RA 4NFHA 2WNHA 4OQQA 5AK5A 3D4IA 3EQZA 1TI7A 4QDXA 2HF2A 3VYTB 1XDBA 2VPXA 1H5QA 4FD3A 4HPXB 2YL2A 3UWPA 4JFRA 5BXQC 3KVNA 4O59O 2QYHA 5KNBA 1GWNA 3OSZA 2G9RA 4F5ZA 2PSEA 2ZJOA 3NH9A 3NM5A 4CEIA 1WB9A 3MJHA 1LBIA 4KWEA 2AOUA 4GVXA 1K2VN 2ZRJA 2NXEA 4LZPA 1C3OA 2OOSA 3EK2A 3N3BC 3CW2A 2FH5B 2DE0X 3IE2A 5L95A 4G5QA 3LXRA 3KZ1E 4KUGA 1ZCFA 1LC3A 4ZVMA 1O97C 2VZ9A 3PNSA 3CPHA 1BDMA 4WNYA 3UANA 4P4NA 1NNSA 2C59A 3OTGA 4X91A 4AXBA 1JHZA 3IIJA 1AK9A 4F2DA 3E9DA 4QPPA 3GN2A 4JHLA 5GY7A 3OCYA 4G56A 1OUMA 3FIUA 3QBEA 4QXPA 2Q0SA 2XTMA 4CG3A 1GCIA 3PHHA 2HMTA 4B46A 2DLCX 3QW4B 3TUJC 3QPUA 2GZ3A 3RSSA 1W94A 2OAP1 4K87A 3FDZB 4FQ8A 1S7CA 3BICA 3D4LA 1J5XA 1ZA2A 3IV9A 3KOOA 5AJUA 4F6CA 4ZK6A 1PFGA 4XRRA 5CDTA 2PG3A 3ZBTA 5A3RA 4M9XA 3DZBA 3QW2A 4S12A 1V6AA 1XWIA 1VHWA 2JDID 4XD7D 2X8BA 4R7ZA 2QG4A 3FW1A 3OQVA 4RVGA 3MBOA 4BNZA 1FUIA 3JQCA 3OOEA 4JUDX 4E5PA 4F3CA 3VHRA 1AGYA 3WYDA 4TYYA 1AK2A 3O8QB 1W1UA 5FFFA 5HK8A 3O73A 4EUEA 2GHRA 4D4KA 5I9NA 4NZMA 1WP9A 3PXCX 5KYXA 1OB2A 4WASA 2J4DA 5J4LA 4H7JA 1G4HA 4DV0B 1XZAA 5J1TB 4Z4CA 2PK3A 4PXAA 4DHEA 4RD1A 3M81A 3E6AA 5IAGA 4LVOA 1P31A 4B74A 2AQ8A 2KM1A 2D7CA 3B8EA 1DMRA 3CH5A 3O84A 3TOVA 4WBNF 3OX4A 4ESHA 5C5CA 3OQIA 1F5NA 3EODA 3DXYA 3KSMA 1R9GA 3GLGB 2IY8A 1NV8A 4OGKA 3ZCUA 2BF7A 3UFXA 2C97A 3EZ9A 3ITKA 1R64A 2CUTA 1RHKA 1UWVA 2JHPA 5BV2P 2IS1A 3PTAA 5LBTA 2C77A 1KZGB 1LPBB 2WYHA 4LOKA 3FOZA 2FMTA 4EHNA 5L6LB 4MJ3A 4EMBA 4DLAA 1SUIA 3ZH9B 3NWOA 4WWHA 2QMYA 1IAQA 2YJGA 4ZO6A 2Y05A 5DM4A 2WWVD 3C7KA 3IBGA 3UAOA 3AR7A 4GR5A 3PRHA 1I13A 4MPTA 4KPYA 2EF0A 1WUHS 1WF3A 5C32A 4B3FX 1V41E 3HU1A 1HOTA 2GD1O 1RWMA 2COKA 1IIBA 4MV0A 3RYCA 5TMPA 2W2XA 2IDJA 3KB6A 4KE8A 1GTMA 4G36A 1WRBA 2BFOA 1G20E 4L72A 4MOWA 4ZDKA 3R6WA 4MYRA 4WOBA 4K9SA 1SC9A 5I4IA 1GL7A 1T0HB 1U0HC 3NCHA 4MO9A 4L0CA 4WXRA 2HYDA 5LMUB 4DSOA 4KUEA 4BZPA 4LQCA 2ATIA 3PDCA 4L22A 4PYNA 5KDDA 3C98A 4I4IA 3WRYA 1IY0A 2JJ2D 4LGVA 3F6YA 3VYVA 2B82A 1EBUA 4OHWA 3N0RA 2R97A 2W42A 4AY2A 1SXJD 1SCUB 2IU3A 2QVYX 4CEJB 2O48X 1X1AA 3BDIA 3K9GA 2O8CA 4HX9A 3GOHA 3CLSC 4TXLA 1T10A 4NR0A 2F9LA 4NV1A 3S70A 1CRWG 4UAGA 3S7ZA 5CA1B 3UJ9A 4XR4A 4Q82A 2M6LA 1HI9A 2FR1A 4OKNA 5DNCA 2VJKA 2LUOA 3V4SA 1PX0A 1MAWA 3MN1A 3QNUA 3HVUA 4LJKA 2OCPA 1KORA 2JANA 1BGWA 3N0XA 2G67A 3LHFA 6YASA 3PYLA 3AFHA 4WL0A 4PZLA 2GJAA 1FCJA 3JS5A 3MWEB 3F5DA 3WLHA 2FG5A 3W9YA 1D8AA 1MH9A 4E4RA 1LSUA 2QIOA 4P4TA 4EW3A 5PNTA 4H18A 3R0VA 4LQ4A 4X1KB 4FN5A 4JGBA 2H57A 4UE6A 5TJ9A 1RXCA 1KU0A 3QTTA 2NN3C 1U2DA 3FN4A 4L27A 5JZ9A 1XXHE 4J0KA 2EFGA 4OQEA 1CY6A 1FDTA 2FFAA 5J2UF 1GZVA 2GBIA 8GPBA 5CIQA 1LSOA 3BGSA 1QYDA 1M2HA 1R12A 1EFKA 3B13B 3B7PA 3NBXX 1R0ZA 3HB0A 3EZ7A 4QYTA 1JR6A 3AIMA 4ITRC 2Q6VA 4OLJA 3QMVA 3IKVA 3SHVA 2FSGA 3HA7A 1VE3A 2C8VA 5F4BA 2HM7A 1JEEA 1RBMA 4KHZA 4C14A 4YUYA 5CFPA 3DNMA 2BP7A 2G9QA 4EG4A 1WVMA 3KYBA 1H3NA 4XOIA 2QHXA 2A5LA 2BONA 3LUPA 4NJMB 5AXDA 2VUSA 3RWMB 4AG5A 1UM9B 5EIBC 1QTIA 5DK4A 5JC1A 1Y4AE 3QK7A 5E6UB 5IUJC 1NI4A 4KRXA 4MS4B 4UCXA 1U0BB 5ERXA 3CVOA 3LXMA 4YGXB 4ZICA 4Q4DA 5DISB 1DC4A 1YB5A 1XVVA 3OICA 5F5NA 3TTUA 4DJEC 2BFFB 4EEKA 4L3OA 2QYTA 4EF4A 1LBHA 5LQDA 4HUQB 1U8FO 2A86A 2PRSA 1L4KA 3CR3C 3O26A 1LX6A 1O8CA 3G0CA 5B2ZA 3D8UA 4D8UA 4V2UA 1B73A 1RAAA 1T2UA 1XZCA 2O14A 5IZCC 2HLHA 4XUCA 5AHRA 2IOYA 5HKOA 5K6TA 2FLVA 4J2HA 4NS4A 1X7DA 1KJYA 1CY4A 4L4SA 4FMCF 2W9XA 2NO6A 3PU6A 1XJWA 4INPA 4RD0A 1DXQA 5ILQA 4V0LA 3T7DA 4AJOA 4ARVA 3WAJA 4L9WA 1L5RA 2R60A 4NJOA 4OJKA 4BGEA 4BQEA 3RNLA 2IUFA 2R96A 4IMIB 3TINA 4URYR 3SBXA 3WKBA 3UV7A 3PZBA 1J39A 4MUAA 4EVIA 5IHPA 2R65A 1CUIA 2IOFA 2JI6A 2VH2A 3EFOB 3K1YA 2Q49A 3O94A 3UFBA 4L8GA 4FC6A 4HGZA 4OAQA 1U5BA 3SZMA 4RTPA 3FYUC 2HADA 2WY2D 4LF4B 2IDMA 3FD8A 3I6MA 5JFTA 3DBHB 1T4CA 3HL0A 3O1IC 4GNKA 4UNNA 2JEYA 3T5TA 1YE3A 3RHTA 3UKJA 4JITA 3WLAA 1JDBC 5B3KA 4K9LA 4P2BA 1X6VA 4TWZA 4BUZA 1OIVA 3EDCA 2W70A 1IM2A 3O8OA 1E1LA 3LC1O 4WACA 3WLOA 2H8GA 3OQHA 4QOEA 1ORWA 2CKDA 3GAAA 1JQEA 4QDKA 2CMHA 2WWWA 2P6MA 4P1ZA 4KIUA 4K2HA 4WNCA 3BL5A 5THXA 1QKJA 3A0RB 3GG2A 3GLIA 3I45A 1TYAE 1VCOA 2A84A 4NCBA 1ZK2A 2FHPA 3LQYA 4HAXA 4OQ4A 4DDVA 4LZWA 1NVDA 3KOWA 2VHJA 5JS1A 4CEIB 2FJ0A 2AOUB 2HCBA 4EX6A 2AYYA 1BE6A 1JAIA 1C3OB 1CUVA 1DG3A 4HH1A 1IC6A 3KO8A 5JDCA 1CHNA 5AKGA 4CR6A 1BXZA 4QBGB 1VP3A 3CX7A 2X41A 3VOTA 2ILVA 3D6TB 1YAJA 2AF4C 3HV2A 4O4LF 3T12A 2W43A 1U0TA 2V65A 1Z07A 3FWNA 1XNQB 3JWEA 4TZTA 4MKRA 2HF8A 3TSCA 2OE2A 3H9GA 3UXHA 2J7KA 4I2NA 3S2FA 1OI3A 4NCXA 2X6RA 3B6KA 3S44A 3PBKA 5LYJA 3JQGA 1VKZA 4J9VA 4JBXA 2B4QA 4B17A 1IB6A 2DKFA 1UANA 4U5XA 3JZAA 1TTHA 2J9RA 1G8PA 3I42A 1DIOB 4ISBA 4KMOA 4S1WA 1J99A 5CXXA 2JIZD 2WYWA 4Q7QA 5KQMA 5DBGA 1J07A 1U8YA 2K87A 5CGQB 1P4AA 4MVJF 2JFUA 5FOXA 1Q0QA 2NSYA 5GV8A 4RVSA 2H48A 3Q7QA 4DJDC 3ZNQA 2B9VA 3P1JA 1FUUA 2HRCA 4IRUB 5T3YA 1JHQA 1X9IA 4RMNA 3KR2A 1Z2NX 4IWYA 3ZV3A 5KYXB 2Y8EA 5H3CA 4UUOA 1RLUA 4MHOA 4BLUA 5BNWA 1WUTA 4H1UA 2ABWA 5AWFC 3T4XA 4IRXA 3EULA 1FFEA 3TD2A 1CETA 4I4TA 4TLCA 1YJXA 2GPWA 4CR8A 5LJIA 4TXHA 1CZRA 2YY6A 3Q8XB 5FA5A 3RIHA 2G83A 3R4VA 4S1NA 4DIFA 1KO8A 1NNI1 1XGKA 2OYSA 3OQIB 4QJBA 3SR4A 3U2QA 1IBRA 4F56A 2ET6A 1R0LA 2X2OA 1SKQA 3UFXB 4HN2A 2ZWAA 3BIWA 2CUNA 1U7HA 1P91A 2G25A 2Q2OA 3FPHA 1PR9A 4JI0B 2XVMA 5DYGA 3THXA 4QBHA 1UC5B 2VTKA 2WUWE 1WZNA 1GXSA 2I3BA 4FR5A 1V8FA 2WU1A 3OJXA 4UDYX 5LZ9A 4MIYA 2IYLD 3D3WA 5EJFA 3H1PA 1C3LA 5LU8A 4A2CA 4Z3KA 2W37A 4QPJC 1E20A 3JSAA 3K8OE 3NW9A 3IQGX 4LA4A 4BVBA 2QD5A 3TNDA 4CHGA 3SBEA 4HLCA 4BKMA 3RYCB 3HCDA 4AY6A 2D2IA 4M9RA 1A4RA 3K20A 1TUIA 4H2DA 4QC2A 2ZM5A 4MWSA 2RHWA 2MSKA 2FWAA 5LN1A 1QLWA 2EFHB 2JVIA 5EHIA 1P2FA 1XL1A 2C96A 2MYTA 3HA5A 3PEFA 2ERCA 3DMDA 4YAKA 5K0JA 5KYNA 2PM8A 2ZB8A 1W76A 1Y42X 5BW5A 3H2JA 3QZUA 1GKIA 5KJFA 3ICQB 1SRRA 2Q29A 3ETHA 3MERA 4KYTA 5CFRA 3DVLA 2OORA 1CWUA 4MWGA 5E7IA 5CD1A 3KWFA 3PX2A 2XRMA 1IXKA 2EJWA 3Q85A 4U7HA 2RK6A 1MFPA 4DLUA 4R9VA 5BXYA 2B1JA 1ONNA 2AEFA 2NV0A 4JIGA 4NI5A 2O8CB 3BHNA 2WKRA 1ONSA 1QRDA 2P6NA 4KIWA 1IJKA 2Q5LA 3DHWC 3GZJA 3NEJA 4TQ9A 4K8RB 4US0R 3VAAA 3GYBA 1ZN9A 1LS6A 3B38A 2RJ3A 3UPDA 1J42A 5JHGB 4H6XA 2ZB4A 421PA 2AHRA 1S2DA 4BBPA 4OL9A 4QUDA 3B89A 5ES4B 2H4FA 3PV0A 4LWPA 1AC5A 1DXOA 3AXTA 3O9MA 5B1HA 4EVRA 4AS1A 4B4KA 4AO6A 4DLLA 4K9KA 4RO0A 5E8RA 3E70C 2FR8C 5J5CA 3ERCA 4BIIA 2QTNA 3RS9A 1FFSA 1Y6JA 3DBVO 3ISTA 3PHJA 4D56A 1R5OA 4E03A 5AW7A 2IEYA 2YVQA 1F4VA 5JDIA 4NBLA 3ZV6A 4U39A 5A2GA 4RFVA 1NXQA 2RGNC 3D1LA 4IOMA 4CHTA 4JJAA 3WJ2A 4KVGA 1SVNA 4MP8A 2J5RA 2H1LA 2OV6A 4U7FA 1GGKA 1Z38A 5HSGA 3D3QA 3W78A 3AF0A 3M33A 4U7TB 2B5WA 1H66A 3OM8A 4U5QA 1NQOA 1MB9A 4P0QB 1OXMA 3FHJA 2BP7B 1UQUA 1BX1A 1U3TA 1PJAA 1EUCA 2BZ0A 3C4JA 3DMHA 1ZXLA 2HZBA 3GUVA 3S28A 3ZU6A 2QRQA 2ZSKA 4IL5A 4Q7MB 1NI4B 1HEIA 3AF2A 4NZNA 3UC5A 2QRVA 3V8BA 1NW7A 3JWIA 2DHRA 4EBFA 1J49A 1F6WA 1AVTA 2CLLB 2WUEA 2BGLA 3AIOA 1C4XA 2RJOA 2SICE 4UEJA 5IJXA 3W5AA 3RSCA 1XZLA 1E92A 2PS3A 2WHEA 4LBVA 4MGYR 3GT3A 2L0XA 4RGQA 5K0CA 1KE1A 4CLEA 1ELOA 5ISMA 3GLGE 1IN6A 3FTQA 5CFLA 5T7BA 1Y5MA 2GT1A 4LI0A 1U2SA 2BN4A 4PPYA 5AM4A 4ND1A 1Y8ZA 3ER9A 2VWGA 4UHDA 5DNDA 2M1ZA 3OPYA 1Z7WA 3KYJB 3PGKA 3E9YA 3A6LA 2XYRA 3BM5A 3FSRA 3MWKA 3BDAA 3PJEA 4I1YA 4WQMA 4PXSA 3E5RA 3T7IA 2NTYC 1WS6A 3CE9A 4BMNA 4J4BA 2J45A 4ISCA 5F52A 4AWXA 4F72A 4IIVA 3I5UA 2JCGA 1KFKB 2EYUA 1NSTA 1QUEA 4Y1EA 1EWRA 4QJ5A 1IZYA 3QA9A 5JPDA 3AFGA 2WOOA 3QKTA 3A6JA 1SRQA 1HNXB 5L51A 3JVDA 3SZUA 1IBSA 4AJLA 5C46F 1QVRA 2ZDHA 1E3LA 1U5BB 2TYSB 2ZOSA 3QE0A 4M4SA 2Z2ZA 3CRVA 3GJ8A 5ALNA 5TX7A 1W36D 1QANA 4FEYA 3VZPA 4JLJA 3E3AA 4PZZA 2OXRA 1T4CB 2YV5A 2GXUA 3HMKA 2FWRA 1BE0A 1VI5A 2C4MA 3C1OA 3LJKA 4RY9A 3ADBA 1KYXA 3COZA 3FYDA 5AJYA 1FP2A 2QVZX 3WG9A 1K0UA 1U0GA 3EZLA 5TS2A 2IEZA 1OYOA 3ONEA 2XYHA 2C82A 1DV1A 1P0CA 5EEGA 3O8OB 2DR0A 2WAMA 1FSPA 1V16A 4M3NA 3JWPA 4GQBA 4AW9A 5D1HA 1X94A 2ANCA 4DBLE 4CMIA 4PLFA 4NV0A 1L7OA 3GLIB 1TQDA 1USUA 1Y9JA 3DNFA 2ECQA 1E18A 2FP3A 1B3RA 5HIJA 4JDPA 2VXCA 2FX5A 2IU6A 3C6QA 1UINA 1GZSA 2WZDA 3GA0A 3ND7A 3GT0A 4Y1FA 1XEXA 5ALRA 3S8MA 3L40A 1GGFA 4NYMQ 2DQSA 1IM5A 3AHJA 4KU4A 2GCOA 3JD1A 1YHNA 3K4PA 1YBVA 3FYSA 3G8AA 2O05A 1P80A 3ESRA 3ETLA 3KQOA 4GMXA 4NL4H 4B7ZA 3VJRA 2DBRA 3MAGA 4MJ7A 4YAWA 4QPNA 1BQEA 3D31A 1S0UA 3VTKA 2HRRA 3I37X 2QRZA 5K2MA 1I94B 1N3IA 4MYCA 4Q18A 3D3EA 3KAQA 3WQRA 5CT9A 4W5NA 3EY4A 4JXKA 5DGCA 3MYYA 3NJ8A 5JAPA 4H7PA 1Z28A 2VC2B 3LWZA 1LK0A 3TD6A 3RH0A 1XAIA 3I92A 4NCKA 1N25A 2Z6AA 2A59A 1XZBA 3U3RA 1HRKA 5LYJB 2WP0A 3JQGB 4ESOA 3LZ6A 1I01A 1KC1A 4WBNA 4D9FA 1EGQA 1LVHA 2VWQA 3HJAA 1NP3A 3K5IA 4AZTA 1L3IA 2BV3A 4J2TA 2PEYA 1VL1A 1QGUA 3ZHZA 5AR1A 4AP5A 3OOJA 2RI1A 5JCJA 2QRPA 4GXNA 2QP9X 1PRYA 1SVIA 1Z4OA 2GHQA 1S7GA 1EUZA 1Y8AA 2BH9A 2R44A 4FB4A 2ZZKA 1XJCA 5JSZA 2GN2A 1G5PA 4JYZA 2ZZNA 2ZJ5A 1E7WA 3P4XA 5A3SA 5ALFA 3EAFA 2R8RA 1H6DA 2QW8A 1UBUS 1MEOA 3GGPA 4BAUA 4MRSA 1DTSA 1A8IA 3D6UA 5FB3A 5I7EA 2G17A 3HH8A 1M2FA 1L5SA 5CH5A 2BTQA 3P0HA 4I4TB 3ZWVA 2ZKIA 3LUBA 4W6ZA 2A5GA 2G71A 1NRJB 2V7TA 4MLDA 4PLTA 4PY2A 2C1ZA 1KS2A 2GPAA 4WBXC 4PSCA 5CT4A 5FYQA 3ZGVA 1PT9A 2QNBA 2BSQA 3IDQA 1DKNA 2E1PA 2P9CA 4O08A 1K75A 1N7GA 4H16A 4WK6A 5LZ5A 2GCPA 1GL9B 1R9JA 2J7PA 2X22A 4OQLA 4YRTA 3P9RA 1NKVA 3T95A 2GBFA 3GVHA 4MEAA 5K3DA 1NR5A 3THXB 2HCRA 3QE3A 2E55A 2WVHA 4HDNA 2GHTA 3KG2A 4PFQA 4QPDA 4UU7A 3H87A 5DM0A 5HTKA 4FZ3A 3CLUD 1GXSB 4OXXA 2P9FA 1MCZA 3BRWA 5JXHA 3D3WB 3DEFA 2JGKA 4F11A 4FHCA 4MVJI 2XB9A 3NVMB 5AHOA 1EB8A 1A88A 1E2KA 2R4UA 3FSEA 5AVJA 3MSCA 2I6SA 1HFKA 1E8DA 2ZT7A 4I9FA 1UAYA 3LAWA 4N7JA 5JVDF 5JNUA 1KP9A 3A1FA 1KI8A 3WGNA 1KI1A 5JR3A 1DBVO 2MSEB 5FULA 5KDOA 2Q6KA 2Q3DA 4BE7B 5BR7A 5A7GA 1VJDA 4YXWD 2C4HA 2RI6A 3OKCA 5TXGA 5ADHA 4KQGA 2D06A 4MMZB 3V3TA 4LE1A 2POQX 4B7AA 1BH6A 4N4AA 3U3XA 2CFOA 2F8TA 2FRDC 2WZQA 4HATA 3LYAA 2CLDX 2JI8A 4AMVA 3IT1A 3B60A 3DDHA 4LX0A 4AZ0A 4R31A 4RAQA 5K45A 2VZ0A 4LNHA 3DO8A 2UZ4A 1FFWA 4JC5A 1BWQA 2Z5LA 4FOPA 4Y6SA 2YZKA 4I19A 1PG5A 3R7DA 3H5IA 1EH5A 3LK6A 3CVWA 3PRJA 3UW1A 4F5DA 5JAQA 1NZDA 5TPZD 2XYVA 3UGTA 4LV5B 3O21A 3S1SA 4NESA 3BF8A 4KC0A 3QLVC 4ETMA 3IPYA 3RJ5A 4A5SA 2R86A 2QOEA 3W2IA 3HL4A 3GIDA 1QHIA 2NYRA 2P69A 4W9NC 4DQLA 1QV9A 4EITA 3IUJA 3UK7A 3DGEC 3IPLA 2ECOA 5JI2E 5E4TA 1Z25A 1W48A 1XTJA 3EVFA 4JBHA 3REOA 4F6RA 3L1HA 1UOEA 2A9VA 2JFNA 1F9EA 2RFLA 3DOEA 4G9EA 1IZ9A 4LISA 3ZNNA 1P6QA 3PXUA 4MUHA 3VUFA 1OR8A 1PT8A 2O6LA 3RBZA 2I1QA 3K05A 1AY0A 4HGRA 5ALQA 4WRRA 5FA8A 1ZM2A 3LXUX 3O03A 5CLJA 6NULA 3DLAA 3KQVA 4RKQA 5EGNA 3ZDQA 4TTAA 1EUCB 4O63O 1JHXA 3LLVA 2OFOA 3LKVA 1NXOA 2FVXA 5FUMA 1SOWA 4NBUA 2HSDA 2V7XA 2QRVB 1DFIA 3ZGXA 4RSMA 2VRBA 1KZ1A 2X4IA 2YWJA 2HA4A 5ALWA 2Z1MA 3O4RA 1VPTA 3HBMA 1OH8A 1BVHA 2FKNA 1L5KA 1J0XO 2X19A 5T5QA 3CLTC 4AKIA 2AKAB 2ZYIA 3T34A 2Y27A 3USES 2OHVA 2WKSA 4N3NA 3LVRE 4IGFA 2M6KA 3T7TA 1OE0A 5EJGA 3VPAA 1Y1LA 4XQEA 1D2EA 1E8MA 1X13A 1IRXA 2OCIA 3ZW9A 3OPYB 2W71A 3KYDA 2WU8A 2XGMA 2NO9A 1I5EA 1HR0B 2XT6A 3PUZA 2W4IA 1ADFA 5J5VA 2ARKA 6Q21A 5AJXA 4GOMD 2CLOB 2WG0A 4QASA 4D8XA 3ZV5A 2ONZA 4AX8A 5BN5A 5LQJA 2AVDA 1RRVA 3C16C 1TTPB 3KLOA 3Q0TA 9ATCA 2ZUFA 4MA4A 3D5TA 1T0UA 3WGGA 4EKIA 1C4WA 3H75A 1SHUX 2PXXA 4JA2A 4JKIA 4EVQA 1ESMA 3TSAA 1NUHA 2B8EA 3AIIA 1QNFA 1O7JA 2VR1A 2JH3A 5CA0A 1SELA 3TB6A 1BH2A 2X13A 2YTZA 3VQTA 3W1VA 4E3ZA 1KY3A 4B2PA 2YZ2A 2DKOA 1FTYA 1XCBA 4IMRA 5AO9A 1JAXA 2B98A 3QLEA 3ZQ4A 3KYCA 3WYAA 1C3VA 1R9MA 3KKNA 4BRSA 5E7QA 2UXCB 1L7QA 2PVSA 3MWGA 3R3YA 4O4LA 3B2EA 2BZGA 3DVAA 3DEYX 3PFBA 4MCHA 1SPBS 1IEVA 1VFPA 3NBUA 4DA6A 2GFIA 1VRVA 1WXWA 1I8TA 1ZFNA 2R8OA 4UNSA 5H3LA 1V16B 1NX9A 1WBDA 4M8IA 3UMCA 3W77A 2JJ8A 1OU4A 1F17A 1MQAA 2ZTHA 3BMOA 4ILEA 2V54A 4YV1A 4IHKA 4CMIB 1ZJ4A 2D5IA 2A3RA 2PD6A 3MIZA 1VM6A 1UK7A 4FYYA 1GEEA 2XHZA 2QLJA 2GTIA 5EJMA 3L41A 2ISSD 2RGDA 3BWXA 3IP3A 2QQGA 4G0XA 1YQDA 4ER7A 4MQ6A 1XEXB 1Z15A 1YA8A 4MK4A 1ZJJA 2GCOB 4IXMA 3FB4A 4J43A 2DQ4A 2WFZA 3F6CA 5G1PA 3VFDA 4ARZA 3Q4GA 5LKRA 4WNIA 4B7UA 1TAQA 4BQNA 1TW3A 4MYUA 3A8TA 4K9MA 4IUYA 1S4QA 2DLNA 2PSJA 3P27A 1N2OA 5CIWA 2XCTB 1D0IA 4OHCA 1DAGA 3WA7A 1XTRA 2ETVA 3SYLA 3T41A 5FRDA 5ERYA 1Z37A 5F7XA 5A5DA 2OC9A 2ZRNA 1DQZA 2ZRLA 3S2UA 2VAMA 2ZAOA 3P94A 4P82A 4YUWA 5MF6A 1RQLA 2GZHA 4O0MA 4K5QA 1OTHA 4IH1A 1SKYB 1TZCA 2ZR8A 5FNZA 5JWHA 1FYXA 3DB1A 3L5OA 3M1AA 4AZSA 4WBNB 5LLTA 4Z4GA 2E0IA 5D51S 5KHAA 1SC3A 1YGYA 4KR7A 4MGKR 9MHTA 2DPYA 1PBTA 3ZE1B 3BFJA 4ZPJA 3W0LB 4BEVA 2GM3A 5DH9A 5IFLA 1DJNA 2AL7A 2A3NA 1FDIA 5HIKA 1QGUB 3SDSA 4F6LA 1U9YA 1MB4A 2F43A 4PG5A 1VBNA 2DFTA 2DHQA 4J1QA 3BSYA 1ODIA 3JR3A 1BX0A 2GCNA 3CKMA 3RG8A 2HYIC 1ZI6A 2VHUA 3U7QA 5JSZB 4DT1A 2V7WA 1JG3A 3DMTA 4RMGA 3OE7A 5KOJA 3RLFA 4IVPA 1JJ7A 2A0UA 2ECPA 4PFJA 4EK9A 3D1VA 2X0RA 2BTQB 1QK4A 4BB5A 4ODIA 4P3PA 2WZBA 3DZIA 1PUJA 1W6RA 2H59A 4MQ5A 1KL7A 1EG7A 2BDEA 1J90A 3V8QA 4MUFA 2CVPA 2O5RA 5ICSA 3Q7RA 4RXUA 5BT9A 1PS9A 5B3LA 3OIWA 4R2XA 3EZFA 4PCVA 2P9ZA 2R7LA 3KOMA 2GZMA 2YQ4A 5DJ5A 3RYFA 3PXAA 3UBMA 2IA5A 3GCZA 1YKSA 4G5RA 3I9JA 1TOAA 4S2EA 1DFHA 3GCXA 3N3AC 4RVDA 4HDNB 1EJ0A 3TKLA 1DDOA 4MULA 4V24A 2VT3A 1DQNA 4LZNA 1MRZA 1XEWX 1CT9A 3TNJA 2PLRA 1SG6A 2F00A 4GSYA 4ZN6A 1HFJA 1JFSA 4KAFA 2GM9A 3DXXA 5I6DA 3HBLA 2MMCA 2ZIVB 4DV2B 1WXIA 4QOGA 1UJBA 5EUQB 3D6MA 1GRVA 3H2ZA 4KFTA 1I7DA 3T9EA 1T8PA 4CLRA 5AUNB 2EWVA 3IDZA 1DIGA 4U9UA 4DA0A 1AHPA 2X0DA 2O2EA 4CLXA 3G13A 1XTSA 4HR7A 4R01A 2IV7A 5FEUA 5FPQA 3GBPA 2XWPA 3DGFC 4XB2A 4E15A 2ZR0A 4WY5A 2OO5C 5TPWA 3TJZA 3KM0A 3GLIE 2O50A 4XDHA 3EVAA 3GRYA 1VLVA 2C5SA 3CNOA 4FMDF 4XGQA 4OYYA 5EXXA 4QA9A 1TJ4A 2QX8A 1AA6A 1ATIA 4AZ0B 1C9DB 4JZYA 1BYUA 2Y9MB 5C52B 2DWCA 2FPKA 2HB6A 4XE5A 3PKZA 2Q6TA 1XK7A 2GB4A 1G5FA 3AEKA 3JV7A 4CBVA 2Y1DA 1J2UA 4ARAA 3NWBA 2XV1A 2XAAA 3P0EA 4BMXA 1E59A 4EABA 1BHSA 3EPLA 1ECFA 3OE1A 2DETA 3I64A 3OQ6A 2BE9A 3PGJA 2W22A 3F47A 4GYJA 2QTVA 3M9WA 3A6DA 1FVHA 1DBRA 2HPAA 2CBZA 1B8VA 3CRNA 3R8CA 4PYRA 3UF0A 3MS2A 3WLPA 4RTKA 2E4XA 3TR6A 1G8SA 2Z8XA 5IXYA 5G1OA 3ZTTA 4NYJR 2IPXA 3M49A 4UNIA 3ICEA 3FB1A 2I1LA 4H1HA 4RQAA 2G0NA 2ZE5A 1AUPA 3L6RA 5A5VA 1EJ6A 1YQTA 3C3PA 5EJAA 4QJ3A 4IH4A 4IZOA 4F6RB 2YN4A 1WB5A 1U63A 1EVLA 2FMFA 1XBTA 3LPCA 3ZGYA 5EZYA 3FCCA 4GPTA 1G19A 2D1YA 3KPUA 4NV3A 2VBIA 2FY8A 1GSIA 1CEXA 4EA7A 2JJMA 4DIKA 4FMCB 1MJ5A 1U7ZA 1KMQA 4DC0A 2F2TA 2B34A 1VG1A 4M8SA 1SBHA 3L1KA 2BRUC 5CP8A 4LE2A 3AUFA 1C41A 1LPPA 1QFJA 2AJDA 1NQUA 1H2FA 3KUUA 2ZI7A 2DH6A 3MGGA 1UPTA 1F8GA 1XNRB 3SX4A 1LPOA 2EFJA 5TE9A 2QUZA 1AV6A 1W7AA 3SYTA 4I1RA 5AM2A 1BMDA 2XT0A 1CX9B 3M9LA 1Z47A 2BUAA 2FW1A 4QBTA 3SHTA 3C5VA 2G77B 4HADA 4BFSA 1MC4A 3IQXA 1UP4A 3HGQA 1LJ8A 3I52A 4XPIA 5JRJA 3ZZ0A 3IHWA 3MIIA 3P0IA 2ZIWB 3AJ9A 3KYDB 4BMYA 2I33A 1JJVA 1TTQB 3EZYA 4D3XA 5B3JC 2NAFA 1NN0A 2IF2A 3BSWA 4XH9B 4D79A 2ANBA 2QTTA 3NTRA 3WL7A 1NASA 5BN5B 3ADKA 3F6BX 2YNMD 3T9DA 2GHIA 4QJ4A 3K8ZA 3PXGA 4N01A 2F3UA 1P8AA 1PVDA 2IYZA 1XJQA 3EMBA 2EIXA 1UBFA 5DI9A 1JIUA 3IJPA 2ZSHA 5BWNA 1KOGA 2OUIA 5CA0B 4HN9A 4CKBB 1GRQA 3G7NA 2YDYA 1V5GA 3FWHA 4NQRA 2CD7A 4W99A 1FVOA 3C7TA 1E2QA 3RG2A 1P29A 2VYND 1GR1A 3WV5A 3TF5A 2YZ7A 3BWYA 4WZBA 5A5GA 1GUBA 4FYMA 2B2NA 2XCIA 3KYCB 5AVQA 5HQ3A 1F0NA 2BBTA 2XODA 2A4KA 1F4LA 1N2ZA 4O4LB 1H1TA 4KPGA 2Q8NA 5FHQA 3V8EA 3DVAB 4BB0A 3LSTA 3OLVA 1YZ3A 3LECA 2W6OA 3AFOA 4GHWA 3CWQA 1UBGA 3QM1A 5F9MA 3WFZA 1ZIYA 1E5XA 3TLEA 4WGGA 3BMOB 2I65A 5EQTA 4A7PA 1JBQA 1HLDA 1Y34E 1LXCA 2H0RA 2IP4A 3RWBA 2F1IA 4FIDA 2G04A 2P6RA 2ONJA 2W2VA 1ZUWA 2OB1A 3L4SO 3M5CA 4MGHA 5FTMA 3P9SA 3S1LA 4X63A 2H7VA 3LOQA 4D0SA 2O1EA 2XVYA 2Q9UA 3DEZA 5EE0A 2GEDA 3ES9A 3H9JA 1VOTA 4RHXA 1G0OA 5GPBA 2QM0A 3PUWA 4R05A 4GM1A 4ARZB 1P18A 3FPAA 1JBKA 1MVOA 4R2LA 3L8DA 4TTTS 3QFHA 2VATA 3VNVA 3G8BA 3PNYA 1SEVA 4ON9A 2Z2YA 5JD3A 1JLLA 1GNTA 1H42A 2NACA 5G3ZA 1W4AA 4U7GA 1KYYA 1ZRSA 3N86A 3QX7A 4I5GA 2C5FA 3A9TA 2CVZA 1KY5A 2FG7C 1PSWA 2GH1A 2VEDA 3K1JA 4LXXA 4LYGA 4XCVA 5BNFA 3JVEA 3UJ6A 3LY9A 4K28A 1WDLA 1D4AA 1P3Y1 4JC8A 4JUCA 1Z83A 3RUAA 1TEZA 4O8CA 3HB4X 2AMYA 3ANLA 1D0VA 2W6MA 3BZWA 3DKPA 4QOHA 2DERA 5GIOE 2H5JA 1CUDA 4MNTA 4QO8A 2Q46A 3R44A 4XPZA 2JD0A 2QK4A 4MQUA 4IJQA 4Y9DA 4RHTA 3H7IA 4R98A 4F8YA 3NCTA 4ZU1X 2F43B 1UKAA 4I1SA 2WHXA 2I0FA 2JGFA 4HQNA 3F6EX 1VIAA 4RGVA 1C7IA 1OC2A 5ARDA 2R9VA 5SY4A 3TB4A 1WCWA 3HBJA 4IOJA 5AKZA 1KI4A 1BU8A 2R5NA 1RMTA 1QFZA 1W4ZA 2ORED 2XE7A 2HF9A 1F6BA 1SQGA 1SUCA 3T06B 5KOJB 1UFVA 5FHRA 3ZBUA 4NP6A 1J2YA 2OGWA 1Z5PA 2H4XA 1MOZA 1GZ3A 1R5JA 4PAQA 4BMZA 1RVV1 1K27A 4X92A 1J0DA 2WIAA 4UPVA 2M1XA 3FOAA 1P4HA 1QFSA 1AF7A 1VCNA 3ABIA 4G41A