4KPFC

Novel fluoroquinolones in complex with topoisomerase iv from s. pneumoniae and e-site g-gate
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
226
structure length
208
Chain Sequence
KLTPAQSKNPAKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKVINTAKAKMADILKNEEINTMIYTIGAGVGADFSIEDANYDKIIIMTDADTDGAHIQTLLLTFFYRYMRPLVEAGHVYIALPPLYKAYAWTDGELEELRKLQRYKGLGEMNADQLWETTMNPETRTLIRVTIEDLARAERRVNVLMGDKVEPRRKWIEDNVKFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Exploring the active site of the Streptococcus pneumoniae topoisomerase IV-DNA cleavage complex with novel 7,8-bridged fluoroquinolones.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Isomerase/dna/inhibitor
molecule keywords ParC55
total genus 53
structure length 208
sequence length 226
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00986 DNA_gyraseB_C DNA gyrase B subunit, carboxyl terminus
C PF01751 Toprim Toprim domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.670 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4kpfC00
1BGWA 2XCOA 4FM9A 3KSBC 3RAEC 4G0WA 3L4KA 4KPFC 4KPEC 3LTNC 4G0UA 4KOEC 4Z53A 3QX3A 4Z3OA 3K9FC 4I3HA 2XCQA 2XKKA 3FOFC 3L4JA 2XKJE 2RGRA 3FOEC 5EIXA 4J3NA 2XCTB 3RAFC 4Z4QA 2XCRB 1BJTA 4G0VA 2XCSB 3KSAC 3RADC
chains in the Genus database with same CATH superfamily
3LPNA 2KX7A 3IXLA 5FAXA 3L93A 4EFLA 2QM8A 2V0NA 1AQ6A 1JHXA 2VBIA 2YQ4A 3UJHA 4GSYA 4Z7JA 5B7QA 2QYTA 2GOYA 2WWFA 1KORA 4OV6B 3R3WA 3R74A 3R7AA 3KLNA 1JDBB 4AG3A 1QFXA 3KL2A 1MU0A 3JX9A 3CM0A 3QPDA 4XEUA 2I7TA 3HDQA 2BRUA 2M98A 3G82C 3I6YA 4EFNA 1D4OA 5JS1A 4YA6A 3NAMA 3ES9A 1T4DA 4TUYA 3NXKA 1I4DD 4TTSA 2ZBEA 4MQLA 2HWXA 2YL2A 5HRUA 1H4SA 4CGYA 1ZCZA 2BHLA 2C4WA 4I0WB 4O4IB 4TL7A 4XTRA 2CDAA 3F8SA 3ANYB 4G65A 4OF4A 1FX0B 4QG3A 1P8JA 3F6CA 1O87A 4FGWA 4O5AA 3UFBA 4FFBA 3RYIB 1WG8A 2QN6A 2AD1A 4NBVA 1CUUA 5EEHA 2YOFA 3IVXA 3CPHA 4ECAA 4HYYA 4EUFA 1QIFA 1DC7A 4U1RA 2J33A 1P77A 3DEIA 2PUDA 4MIKA 4OMDA 1KQPA 2NSLA 3MLBA 1W8IA 4B82A 5G4KB 3IBFA 5G3YA 3TQOA 3OLCX 4OXQA 5IJZA 1NVTA 1Z6TA 2FG7C 2QD2A 3NDPA 3PC7A 4P08A 3ER8A 5IS2A 1UJMA 4LOKA 3GARA 3GLQA 2O52A 5FWXA 1DAKA 2PJZA 3ZZ0A 3CX6A 3WMFA 2H4ZA 1YASA 2GLUA 1Q2XA 3FYUB 3MERA 4KXYA 4MYRA 4Q48A 4RLQA 4Y6PA 2O50A 2RAFA 4YQZA 5D5QA 3V8NA 5IVPA 2AF4C 5CNJA 4EPWA 1ULHA 2ZSJA 1ZC3A 2A30A 5LYJB 1XZPA 3KBBA 1FBNA 1WM1A 4H18A 4MVYA 5E7JA 3S0JA 4CFYA 3D6NB 4CM5A 4GWLA 5H68A 3MW8A 3W79A 3HZRA 1CTQA 2EJBA 5AVZA 4V0ME 4EJFA 4CMCA 4F6CA 2DPHA 4F96A 1PYGA 1TUEA 5BSVA 5KTMA 1M6YA 5DTRA 2WMDA 3VC7A 3KWMA 1CP2A 2Q27A 3K92A 4Y6GB 3BDVA 2OP0A 1P7YA 2WBLC 3GFOA 2Y1FA 3ASZA 4WDQA 4QRIA 3RYTC 1HWYA 2O1SA 4IO1A 1C14A 1FP6A 3IMKA 2K4MA 5LB4A 4RE6A 4RPJA 1WL8A 2A4KA 2N9UA 3MJFA 2PSSA 3AINA 1UPBA 3EGIA 7ADHA 3ZTTA 3T3PB 2EBHX 4NCIA 1I2CA 3OX1A 1PWHA 1EHYA 4FDLA 1BMDA 4UDNA 4K8OA 4AMUA 2D2FA 3TGLA 1JMVA 1K7CA 5H59A 2Q2VA 5IJWA 2H1HA 2VP0A 3GFBA 2FGKA 5AW2A 5KYWA 5DDIP 1U2DC 3IDQA 2G5GX 2BFFB 3GV0A 3LBIA 1DTSA 4M9SA 4YB8A 4CM4A 2GA8A 2REOA 4MCHA 4CG0A 4EHFA 2DTEA 1AE1A 2OV3A 4L5IA 5C31A 3HKBA 2C2BA 2XT9A 3TSAA 1I7DA 4AY4A 2JLVA 2Y1DA 3W2FA 4XVRA 4KH0A 2WK1A 4ZRMA 2OXIA 4DSUA 5BSEA 1FSPA 4HDRA 1B0ZA 1EA7A 3PQFA 4XB1A 2V5AA 2CF6A 4IFBA 3TX2A 3CF4A 3QFFA 4OTZA 4LC9A 4XXHA 3PC3A 3RK4A 2I29A 1NGSA 2CWWA 4FHCA 1B8VA 5ESDA 1CQJA 3VSDA 3E82A 4YV2A 9ABPA 2OZPA 5GONA 3EA0A 3Q8KA 4CEIB 3L0CA 4HAYA 3QX7A 2FMTA 3IAXA 1NBAA 4IQ4A 4DJJA 1D8TA 1TQHA 2IOHA 4YIKA 3SS8A 3WMWA 1DFHA 3DHEA 1ZRHA 5IJ9A 1LC3A 4M22A 2C2ZA 2V6GA 3CPEA 3KFVA 4CR8A 4E2YA 1NVVR 2JJMA 2B8NA 3DDZX 3V1KA 1DZIA 2G4CA 3IULA 5DBFA 5FTJA 3VRHA 2Q4BA 4YRNA 1TO1E 3CMMA 3HKDA 5AJTA 5HQJA 2W6OA 4LDQA 4YMGA 2RMKA 5FLKA 3DXXA 1E5DA 2KM1A 1AZTA 3C6YA 4W9MC 1I5OA 1Q14A 2A5GA 4RVHA 3BB3A 2VZLA 3QYJA 4MVJH 4BFYA 3T0GA 3SQWA 2QS9A 1W44A 4B3BA 2QTHA 1V0JA 4MV3A 2NSDA 3PC2A 4NAHA 1MO6A 2EWMA 3QYPA 4XSVA 1MO4A 4YPVA 4OGLA 5G0WA 5DM70 3BWMA 3DPSA 3NBAA 4GKAA 3KJIA 1G5TA 3FRJA 4K1LA 1QGYA 3DZ8A 4AF8A 1DRWA 4FMPA 1H2BA 2J9YB 1OLSA 2IHJA 4KDRA 4E5MA 1TF2A 3NC1C 4NE2A 1UKYA 4MS3A 3H1PA 2V4UA 2FUG1 1U7DA 1USVA 2PLFA 3BULA 3L6RA 1U0LA 2B61A 1J5XA 3S2YA 1HFEL 3X1ZA 3TNDA 2IA5A 1WB6A 4HBGA 2VEDA 3TBFA 2XYGA 3IE0A 3P71T 1MIHA 4LF8B 1SBIA 4PRLA 4MH0R 3FA2A 3M1IA 3CUVA 4QU0A 3UY4A 2O0KA 2OHOA 3ZCQA 3ZGLA 4R8MA 2ZR8A 3L84A 4FDAA 3FKSA 1FB5A 2PFKA 2WKWA 4I6EA 3D59A 4PRYA 4LBYA 1TQ8A 4Q9KA 1TW2A 3IGFA 1BWPA 1DARA 4IFEA 4WQMA 4AWAA 3WA7A 1UMBB 1XHEA 3FOCA 1F1JA 2LBPA 1BEEA 2ZJBA 4BN5A 1C41A 2ZIXA 4BFVA 3ICCA 4QU5A 3KM0A 2PJRA 4MR8A 4E46A 1P4SA 4BC0A 5CD1A 2F1IA 3WISA 1CNFA 4M8SA 3CZMA 2Q5FA 2WW8A 3LWDA 4C03A 2Z08A 1FU7A 4FCTA 3U0VA 3OU7A 1Y4DE 5AVXA 5K3BA 1C3LA 1G38A 2VNSA 3EA4A 3BWBA 4N82A 3GN1A 5K45A 4BE4A 3WFIA 4D3XA 3UV3A 3OKCA 4C4YA 1GUFA 3GA0A 5H1YA 4DQLA 3GFPA 3T7IA 3OZDA 1XMVA 2WV7A 3A9TA 1BDMA 3JR7A 2CLLB 1M1UA 3WNCA 3B1FA 1HT3A 2WV9A 3F0TA 1JG7A 3EYAA 1W35A 2D13A 2P7IA 3F5QA 3IJPA 3E18A 1YT5A 3L5KA 2V7QA 2WFZA 1PW7A 1Q0TA 2O8FB 3C3DA 4JITA 4MW1A 2CSXA 3LLCA 5DCWA 3QBDA 1XVTA 4YCMA 2ZIVB 3F1LA 5CCDA 5KTNA 4MAAA 3GLIE 1G7RA 3W6ZA 1J4AA 3DAFA 3R8FA 2PAFA 5B57C 3AMVA 1GAQA 1RRGA 2XDAA 2B0CA 3HYLA 3GBVA 2EL9A 4UREA 3TEFA 3CMCO 2GAFA 1UOQA 4JJGA 4C7XA 2J6HA 2ISQA 4NOJA 2QRKA 4CI0B 4LXIA 5ECWA 4X64B 3EGCA 3W05A 5IBPA 4CTMA 3AG5A 4U9UA 1G8MA 1KZHA 1C8BA 1NW7A 1KO5A 4NCHA 1EUQA 2ZSBA 2BKLA 3HU2A 3PRYA 3RTAA 3GFTA 4L22A 1SUAA 4TXNA 3HJTA 1O96B 1Z4MA 2FN8A 3G2NA 3PA6A 2BUCA 1JR3E 1TUBA 5EZYA 3NKLA 3DE0X 4IGKA 4U2EA 4XPIA 5G0TA 3REOA 2O8FA 1O94A 2XKBA 1B8PA 3OM1A 5IHPA 3T5TA 4M0UA 2N1MA 1RJFA 4FYWA 4BLWA 3V8MA 2WD7A 3ZWCA 3L8HA 1AZSC 2A1UA 4RU1A 4ENVA 5ABPA 5I7WA 3L7NA 3UAXA 3KYIB 4HS9A 4EBFA 1E2DA 1Z45A 4KO4S 1BXZA 4DIFA 2PGNA 2R8ZA 3D4LA 2PUCA 3EUAA 1LV7A 5EA2A 2ZUWA 4FMDF 1H69A 3QFHA 5KSPA 5C4MA 1QVWA 1TK2A 1E0DA 2BGJA 2ZWAA 5JH7B 3ST7A 3DBLA 1QHNA 3OM9A 5CK4A 4ODIA 2V98A 5EJ7A 3RB8A 1HEUA 2JLSA 2PWAA 1YCHA 1T24A 2VTEA 2AH5A 4C0BA 1N33B 3OUTA 4HQNA 1UQTA 4DCGA 1S1CA 2J5RA 4K9QA 5K0TA 3PUVA 3AHEA 4PYOA 2CV2A 3IIJA 2Q5OA 2X1LA 3O4VA 3H16A 2ZT7A 2Q5JA 1CJUC 3NWEA 3O7MA 4UPVA 4X0EA 2R4TA 4C1NA 1G18A 1FMJA 4JWKA 1HK7A 1TTHA 1Z3CA 2GZ3A 4BMXA 5FOQA 1E0SA 1SUFA 1IY2A 1S4QA 3N2KA 4P4SB 4BFLA 2OT3B 4V1CA 3H6GA 5FUWA 5K6RA 4WV3A 3TZKA 1P5JA 5FFFA 1CP3A 4WOPA 2GXAA 4ZEXA 4TX1A 3MT9A 1NOJA 1LBHA 1Q20A 4IW3B 3EIEA 3KOOA 3OLYA 3HM2A 4MUGA 2XZOA 4G0WA 1GQYA 4NYJR 2HU7A 2YZMA 4UXIA 2BMVA 5BWOA 5EE1A 2HUNA 3DT6A 2GJKA 2R1VB 2ZAGA 4ZQFA 2O8BB 2X6QA 3JVVA 1TZMA 3ESYA 2AN1A 5AJXA 3RFVA 5KNDD 2WG1A 4I14A 2A84A 5F2OA 2AFRA 1U0HC 2BMJA 1IVNA 1QFSA 4A73A 5BP7A 5K6TA 5A5VA 2HM7A 2ZTHA 5LKRA 4TYWA 1Q15A 1NU8A 4WEQA 3GEBA 2NM0A 1RP7A 1UK6A 2O6LA 5LSAA 3ZDDA 4M7OA 1XDUA 2LRHA 2YWJA 3O75A 1C8LA 3LXRA 4AMYA 1WIWA 2QL7A 5I9BA 3FCAA 5LDGA 3U7RA 2W6MA 1ZM9A 3F5DA 3JWHA 1XTTA 1T3TA 3QSGA 3GEDA 4JQCA 4XQCA 2PD4A 2G88A 4N5NA 3OCWA 1AUOA 3JU3A 4BX9A 1FJ2A 1L7VC 1QQ5A 4X62B 3O8NA 4EO9A 2UV8A 4K0KB 1W46A 2ZTSA 2XNDD 3D3JA 4ENSA 3B12A 3ETJA 2AN9A 4GSLA 4U02A 3CTMA 3WGYA 4RTLA 4KO2S 1K7FB 3AP3A 3ASUA 3Q5EA 2CNDA 4EZEA 2V7QD 3BILA 4JP3A 4D74A 3EIQA 4FD3A 1M8JA 4HP8A 2XQFA 4H7EA 4JDUA 2O8EB 4P32A 2GCOA 4TV9A 4M4SA 1J00A 2W2LD 2FY8A 3LZDA 4DEXA 1JQEA 1WCXA 1BGVA 3NJRA 1B73A 1GPLA 3PWZA 5J1TB 3RSFA 1SG9A 2Q6TA 3T7KA 1KYQA 3UGQA 4EW3A 3O47A 3QMVA 4Q9HA 4K9LA 4EG3A 4LOJA 1LDYA 1QGUA 5FORA 4C6TA 3QUTA 5JWHA 1A9YA 1MTZA 2XYQA 3GG2A 4DCTA 1JVBA 4ZMSA 2PUTA 2HSGA 5FRDA 3BD8A 4L6IA 3S99A 3ZE6A 4HNAA 2QY6A 3D0QA 3DBVO 1KDRA 1IXZA 1Y4ZA 3CB2A 4OKIA 1QTRA 3SG0A 4LPKA 2BHTA 3PBKA 1ORIA 4QGBA 5B12A 4TS9A 1A5AB 2CC2A 5EYPB 3CISA 3VKHA 2PA0A 2XKJE 3IAAA 3KKKA 1UKEA 3TOVA 5FL3A 5KOIA 3EXFB 3K72B 4JLMA 4NG5A 2JFPA 2VDPB 1JAIA 1OXVA 1QF9A 5FR2A 5B1EA 5IXYA 3ZY4A 1QAOA 1TUBB 1WSAA 2I54A 3I23A 2O54A 2Y05A 3FOWA 5C5CA 1AN9A 1Z29A 2Q1SA 2B2NA 2VP4A 4FB4A 5IWAB 1N5OX 3B1KA 3HCNA 1XTRA 1KH1A 3GUVA 4XDHA 1Z38A 1YL5A 1IB6A 2FW9A 4QT4A 3AUJB 5C1PA 2I9KA 2I7CA 4EELA 3I1YA 5KREA 2X5KO 3ELBA 1HL3A 2GPWA 1XDWA 1XZKA 1WV0A 3SIXA 1B3BA 2X0JA 3C98A 4OSOA 3C8UA 2OWEA 2JD0A 1NQVA 1HE5A 1OFUA 3M0EA 2YOHA 1CR0A 3HBLA 3PXCX 1G8PA 2H59A 2H4FA 4TRMA 2ZSDA 4DMKA 4EJ0A 4TYYA 2ZBPA 4QM6A 2DPYA 5HJ2A 4AX4A 4RTKA 2Q62A 3K8ZA 1GT6A 1V3TA 4BNJA 1U99A 2YMPA 2ZVJA 3GWZA 4KAJA 1V9SA 2QF7A 1ESCA 5DTIA 1VE6A 3INNA 4M7RA 4ROSA 5DI3B 1GZUA 2CNKA 3A26A 3G2HA 4GBMA 1YZGA 3C43A 3DB1A 1Q16A 2XLBA 1P7PA 4OI2A 2OPBA 2DWUA 2VHEA 4QHSA 2ZB3A 2I7XA 3QX8A 4OFWA 1KMCA 2NU7A 2PX5A 2QGFA 2Y0BA 3BWYA 4AKEA 2PN1A 4QQNA 5GAJA 3DZFA 1PFYA 5JC1A 1EZ4A 1O6ZA 1Y81A 1Z88A 2GPBA 2J0UA 4UFOA 1QLWA 4EWLA 4DB4A 1D6NA 3HJFA 4LF6B 1QHGA 2YWEA 4INPA 1J22A 3H5IA 1NVAA 3BUSA 3M82A 1MDBA 2PRKA 1GFIA 2ID4A 3RODA 3P97A 3TIFA 3SIWA 1GNSA 1QDLB 2QVCA 4LW8A 1H65A 1ZSNA 2DULA 3W78A 4MWSA 2PXCA 3KZ1E 1J0CA 1OLOA 2EKBA 3KSMA 4L4YA 1GSAA 3BHNA 4TMWA 4Q9IA 1M6WA 3VZQA 4AX8A 5B7GA 3KKLA 3MHPA 5CYPA 4QYIA 1R27A 3F2VA 5ALPA 3RHTA 5I7VA 4B6GA 5JAIA 4WJKB 2Q21A 2EZ8A 5AKYA 1K0FA 2CK3D 5CM2Z 2XCIA 3B1XA 5C1IA 1F0YA 5CITA 1WMFA 4L51A 4RK6A 1YZYA 2ZR9A 3DQZA 4M9UA 5EERA 4I7EA 1A7KA 2AR9A 4RY9A 1XO1A 3AKEA 3ZI7A 5E6RB 2OR3A 3AF3A 3VBEA 3WAGA 1OKKD 2BP7A 1T35A 4TTVA 3GLHB 2BBOA 2ST1A 3QLVC 3VR1A 4DIBA 5IZCA 1OMOA 3ZCPA 1WWKA 3CNEA 3V4PB 3CSSA 1TZJA 4GL4A 3GY0A 3KHTA 5HKBA 1VLMA 4MPDA 1ULTA 3ZHBA 2G80A 3SQLA 2HPVA 2J31A 3FYCA 1Q0PA 3E5RA 1F5SA 1MJGM 2Q2OA 4KE8A 5IVKA 2FMKA 5EQDA 5MFPA 4G4IA 4DQDA 3ZCUA 1NX6A 2V55B 3X43A 1THMA 3C24A 2BFCB 1V16B 3N5CA 4HYTA 4Q3CA 1HMYA 5SZIA 4L4XA 1XGKA 1OB5A 4NSNA 1A2QA 1DJPA 2UKDA 1XQXA 1S8AA 5L53A 2R5WA 3TK1A 3U37A 2B8WA 5TPWB 3R5SA 2V0CA 1QP7A 4PX2A 2VPYA 4GOLD 1D07A 1MORA 1SNYA 1MJFA 2FSSA 2GRJA 1CRQA 1B41A 3OMXA 4CIYA 5CDYA 4XI9A 2YZNA 4G4SP 5E7MA 3C6QA 2HOQA 4E5NA 1B14A 3MAJA 3BQ9A 4M83A 3A4TA 2CY0A 1QR6A 2RK3A 2IYPA 3NBQA 3RSSA 4ARZA 4C0WA 3ENZA 3TFOA 1XCGB 1Z83A 4C5CA 3CX7A 1XKXA 2NIPA 1CY4A 5CCEA 2WDZA 4XD7A 1ZGHA 4YGYA 4S12A 4JVSB 1SHUX 3EZYA 4JUDX 1M2FA 2NVWA 2QX9A 3NEAA 4E3WA 2R6CA 2I8CA 3VV3A 5CBPB 3IX7A 1SVWA 3MXTA 4RIGA 2HA0A 1ENZA 2NUAA 3EXHC 1E2MA 2BZSA 3FAKA 1OFGA 1C3VA 4Y2GA 4M99A 5CIQA 3U4HA 4AZ3B 2DT8A 3CZQA 4PNHA 2AJTA 1Q21A 4JYPA 3A7DA 3AEQA 3ZKWA 4A0QA 4IV8A 5DNYB 1C0IA 5GGYA 3ZNOA 2EIXA 2BC9A 2HYDA 4KMMA 3PIIA 3VR6D 4DR6B 721PA 1IPHA 3FF4A 2IZ7A 2NZXA 4COOA 1KMHB 2QD5A 3S8YA 2YW9A 3RSCA 2A88A 1JU4A 3RYHB 1WV1A 3DKKA 4LWOA 1NMXA 1SBCA 3KB6A 1C1XB 4P54A 4I4IA 1NN3A 3EIUA 3KPVA 4QJ5A 2V7VA 4ER0A 4BC1A 4HC4A 4YRGA 2W83A 3HNPA 3OT1A 4OBWA 1B42A 1E4OA 4QVIA 5EJFA 4R54A 3D8BA 1F5NA 3CUWA 3W77A 2QW0X 3D4NA 3EPPA 3KG2A 1YQDA 4GD3Q 1N32B 1ONBA 3PYMA 4V0LA 5DNUA 3MRTA 3S5JA 5BUQA 1KR2A 3BE6A 3D8RA 2G9ZA 3DLAA 4R7GA 2ZZMA 5CK5A 5A4AA 1J9ZA 4BMOB 3OP4A 4Z4HA 2RBKA 2HW8A 3CNNA 1SCUA 2QTVB 3ROXA 2Q07A 2GEVA 2A1IA 5KTSA 5C7LO 1SG6A 2JHAA 4OP2A 3HVIA 4BN0A 3M33A 3ZWKA 5HHTA 5K01A 3EHEA 3RVPA 1A9XA 1OWOA 3B2NA 2XJ9A 3QIVA 1YSCA 2FKNA 3KJGA 3BXXA 4RWEA 5LWQA 2IP1A 2ORYA 3UICA 7YASA 5KTYA 1ONNA 1OX5A 3IR6A 1RMTA 3QNMA 5JYBA 1GOTA 5IABA 5KHOC 2XE6A 3HXQA 1JLKA 1ZIXA 2HB6A 3B8HA 5HDQA 1P5ZB 1RADA 2LXNA 3L4JA 1NMEA 1FS5A 3NWBA 3T7RA 3CWQA 1SRQA 3FPEA 4MTLA 2JGDA 4YJ2B 1AKEA 4F1KA 4E2FA 4PZYA 4JI7B 2VWHA 2QZZA 4BNZA 3EGEA 4G1UC 5KJEA 1UDBA 2I6QA 4C7VA 4MVJA 4YPFA 3BAZA 3V9PA 2JFGA 5P8WA 4UHDA 4DC0A 3ADBA 3JXEA 2GBPA 4U7TB 4AWXA 1F0KA 1JNYA 2RGBA 1SZCA 4I50B 2W90A 3CG4A 4W5WA 3VVMA 4KGVA 2CXHA 4Z2YA 2XADA 5AVOA 5JNSA 3G89A 1P0MA 2NZJA 3ABQB 1NHGA 4RABA 3TD6A 1HA3A 1QHEA 4F71A 3V1MA 3LQKA 3O6VA 4IINA 4N6GA 3ZK7A 1V7QA 5KSYA 1SHJA 3SVZA 3L1UA 1QAQA 4BZXA 1IQ0A 2Z2XA 3DDHA 3N0TA 2AZ4A 1JSLA 4OHCA 4HDMA 5CVEA 3B7GA 1JR4A 2NSJA 4PHFA 2PBRA 2WVJA 1C3OB 1QVVA 3HO6A 2P11A 2Z04A 5DN9A 5U4XA 4D4IA 5BWBA 5FL7A 3H42B 1E1KA 1WMEA 1KJ8A 1Y37A 2PMDA 3U3RA 3WGIA 5D87A 2HA7A 4AUNA 5AHXA 1K97A 2GKOA 4MS1A 1BQEA 4UAUA 4KP7A 5BVHB 3U5ZB 1Q0QA 1MAUA 1YS9A 1MG5A 3K1AB 3QEMA 3BG5A 2CLFB 2X77A 4MITA 2B9EA 3RAGA 2XGJA 2XIQA 3OT4A 4EFMA 4HB3A 2J3KA 5JXWA 2CVFA 1W36C 2FSUA 3MEQA 3O0TA 4L8LA 3FSGA 1J2RA 2ZKLA 3H9JA 1N1EA 1IRIA 1NKTA 1LA2A 2XCQA 1VG1A 2HJRA 3I3OA 3WLKX 4TL6A 5ALNA 4BRWA 5TQ2B 4WASA 1H42A 3NRJA 4ARZB 4FXOA 2M32A 1X80A 3I9MA 2OLEA 2VP6A 4D8VA 4MRPA 3HWX1 2DB3A 2FFHA 3WZMA 1L5VA 4EKYA 1RRCA 5CLQA 4GZMA 4O2BA 1XQWA 3I9OA 4HVLA 3UT6A 2GBGA 5HKKA 3S2SA 1QVZA 3PKJA 5EVJA 1SIBE 3KHKA 3KLBA 3HPQA 2MSKA 1UOPA 7MDHA 3PDIB 2IYAA 1BW9A 3VDQA 1RM3A 3BXPA 4ZEOA 3V7UA 4ZZ1A 1PIWA 3U4GA 5EJGA 3AUSA 1DRUA 3GI1A 5KQGA 1JQBA 4KLZA 4Z3DA 1E5XA 4WNYA 4QZVA 1RYZA 5CAEB 2Q99A 5COQA 1KOJA 4G1BA 3JQBC 1M5UA 4ZK6A 2NSHA 2I2DA 3TSCA 4CU5A 1G21E 4LZAA 1Z2AA 2D0OB 2C9DA 1U5AA 1XC7A 1YRLA 2O5RA 3S1AB 3IBYA 5BUSA 4R1MA 3W6OA 4ESEA 3OTOB 1R88A 1NJGA 2BKEA 4P1ZA 3D2LA 4CF4A 3FLBA 1DKOA 2FZLA 2ZPUA 4PWZA 4KQKA 5HIIA 4X93A 4CKEB 5JANA 1OUMA 1TPZA 2OMKA 4RULA 2UZ3A 2FLVA 3H5AA 2B8EA 3RTCA 1II0A 3Q2KA 4JOSA 4WFIA 4QXPA 1U8AA 5THXA 4BFUA 4J4TA 2XLCA 7GPBA 4ZT5A 4PX9A 1G21B 1PR1A 1R0CA 1YE8A 2C1ZA 1NLMA 5IZ4A 5HQTA 2PH5A 2P40A 4W9NA 1SR8A 4DLLA 4F7DA 3GAAA 1QHXA 3N8GA 1KDVA 3ZWMA 3DS8A 1VCMA 2ZGVA 2XDQB 4JI4B 5AO9A 3FPHA 2BEUA 2QN1A 1U3GA 2GTHA 4C22A 3LVBA 1LKZA 2Z2YA 5LBTA 4XQ9A 2IS2A 4CEHA 5EKXA 3PE3A 3FHLA 2C5SA 1RRFA 1F3OA 1XRJA 2OG1A 3IDFA 1A1VA 4B0OA 2VPQA 3JQFA 3NU1A 4S24A 2R11A 3THXB 1Q1NA 4L2IA 4FIZA 4BNHA 4PPGA 3CY6A 3ILYA 3RVDA 3WLOA 1C9MA 1AXEA 3KYBA 2CF5A 3DKVA 2UDPA 4F92B 2X1HA 3TDNA 4IHAA 5K3DA 1E3LA 4H0FA 2J1LA 3IDOA 1Z75A 1S7CA 1LGYA 3EPRA 5CDHA 2DWCA 1P44A 4J0CA 1AK1A 5TGTA 5EIEA 1OHHD 4GLLA 1RBZA 3BJRA 3QU2A 3H3XA 4MCAA 5JEDA 5IDWA 5GJCA 3JVIA 2HL6A 5AJYA 5DTJA 4R6WA 4HVAA 4UDXX 1OC2A 4Z4GA 3D2BA 4LVNA 3UOAB 4JYMA 3PVCA 1TCUA 2OAP1 1G291 3SYLA 3DAGA 4AMBA 5BRNA 3H2GA 3EXG1 3QVXA 3PJEA 1VKOA 1GQOA 1CQPA 1U5BB 2AEEA 3V2GA 4S1VA 3PDJA 1Q0UA 3NV9A 1PGNA 3H2ZA 2WD7B 1R1DA 1Z6AA 2XUHA 4KVGA 4PSVA 4B8WA 1N6KA 5CHEA 4ZT3A 5A3QA 1YC2A 3SX4A 3UT0A 4YMWA 1N2CA 2FRDA 3CPJB 1PJZA 3NV7A 3JYQA 4KR7A 1TCCA 3GL9A 2P6OA 1QE5A 1ADBA 2OHGA 3K5WA 2CHEA 2FJUA 4WUVA 3ADDA 2JI8A 1SC1A 5HE8A 1UDXA 3PT9A 2ZATA 4JYCA 2I34A 5DH9A 2IIVA 2VUIB 3VR3D 4B79A 1TK3A 3EBOA 3G5AA 4ZYYA 4W5OA 1E7MA 5FTLA 1ICIA 1PJ8A 1Y63A 3H17A 3QY0A 3AGPA 3ONFA 2G28A 2I6XA 3RS9A 1P1BA 3F1KA 4ABYA 4P34A 5BRJA 3LHKA 4MQFA 4A0FA 3VU0A 3RVRA 2CFTA 3PP8A 4ZVPA 4OUDA 3ZE1B 3R8XA 2B4YA 3NH6A 3UCFA 3MUEA 3THWB 3IJEB 4WUTA 3RUEA 3T1YB 3DV0A 4RPKA 3OTHA 1W88B 2X8JA 3TE6A 2VQ3A 3DDNA 3D7KA 3NTLA 3BL5A 4ZO6A 3C3JA 3L0SA 1T6BY 4IHJF 3ZZ1A 1KQOA 3R7WA 2AB0A 2ZJAA 1JJIA 2QYHA 2QU8A 4FXPA 1M1YA 4BFTA 2R7AA 4QXRA 2J7KA 2AMYA 2QT0A 1ILEA 1RWKA 1UBGA 4XKJA 1QGUB 1MKYA 2JFHA 3G5UA 4AN1A 4EHIA 2PZGA 3IOEA 2GH1A 3OJXA 2EYUA 3KS9A 1RIFA 4MUYA 3LC0A 1Z74A 1JXOA 3KXKA 2EFEB 1AS2A 1ZMBA 2VWPA 5FT9A 3CRMA 4KSCA 4O0LA 1F48A 3S70A 1SCIA 1K2VN 2F1OA 1TTPB 1NFFA 2P1ZA 2XWQA 1W1WA 1FF9A 1U2PA 2RH4A 2A9FA 4LX8A 1FS6A 3L9WA 4Y1FA 3H8WA 4X1OA 3LHFA 3OPVA 3SY8A 5BQPA 1G2QA 3FTQA 3OEED 4J2OA 4DPMA 1C0EA 2OECA 5THKA 3LQQA 5DCUA 2JRLA 2PKRA 4ATNA 1GNVA 3SNHA 1AC5A 4URHA 4ZVNA 2UVPB 2W42A 4HGZA 3WHPA 1QCDA 1QPZA 3T7TA 1SXJB 4RX1A 2XUIA 3TG8A 1P6UA 4J03A 2B4KA 2J3MA 3DW3X 1KO1A 3BSSA 4BO7A 1OYYA 4FYMA 2MSLA 4DMFA 5I7RA 1W2WB 4PU0A 5JVDB 3IELA 4EB0A 3AT1A 1V3VA 5IMSA 4XW2A 2I4TA 4F06A 4W8HA 4HY3A 3WDMA 2Q0XA 3FGOA 1CWUA 5GOTA 5MN5A 1NASA 3W3AA 1DG1G 4PSUA 1HFWA 2O3RA 1ZGBA 3M6VA 3NJ8A 3SAJA 2ZEJA 3K9GA 1ZW1A 4NWIA 2HK6A 4QDZA 4DUYB 1P0PA 2YFYA 2OZLA 3QE3A 4BKUA 2IV2X 1H9AA 3TQIA 1XDBA 1P4RA 1I4OA 2VJMB 3IR5A 4A0HA 4L9SA 1FL9A 1ULBA 1QZXA 2R7MA 4CM4B 1ZMXA 4EB8A 3QV1A 2RC6A 1G4UR 3CNLA 3JWPA 4MUIA 3A4NA 2O1WA 5LA6A 5JQWA 4GYKA 3NPAA 4D9FA 5CA1F 4DV5B 4PEVA 1X86B 4LXTA 2FXIA 2A0WA 1FJHA 2FEAA 2P2NA 4KIJA 4UNQA 1TJNA 3EVTA 2B78A 2PXHA 2C5AA 2CDBA 3IS3A 3EFOA 3TTSA 2OXFA 3FZYA 1C30A 1PG2A 2GHRA 4JLUA 4FW9A 1YVUA 4WZ6A 1RLUA 3AHHA 2ETVA 4MRVA 2QRVA 4YQFA 1FZQA 3KB2A 1NOKA 1OX4A 4ENUA 1FMTA 4OQMA 1I4LD 4XWKA 2X7HA 4Q3OA 3MMXA 2C5FA 2W6QA 1VBFA 4WGGA 3WK6A 5G02A 2WIJA 4HN2A 4UM9B 5C53B 5HTOA 2DETA 1NONA 1FLVA 2QRHA 4DJFC 3VJRA 4I5FA 3KTFA 3EBPA 3FH0A 4ZHQA 4INOA 4HX9A 4E12A 1EX1A 4ZVSA 1F17A 3DE7X 5C8XA 3HKDB 1ZBQA 5CFOA 1I7SB 4N7RA 4DNXA 2BFFA 2DWPA 2WRZA 3PI7A 1M2EA 1RPJA 1IQUA 1K98A 2J07A 1VP3A 2X41A 3CLHA 3R5FA 3P9CA 4K9RA 4PC2A 1IDOA 4U4AA 4QELA 3REGA 3U7JA 3VR5H 3ZGYA 3NVKI 1HDRA 1KA9H 1VE9A 2PBLA 2QYOA 4GLBA 4HQKA 2RGYA 5HZHA 2NAPA 4IIGA 4XA8A 2D00A 3O74A 1M66A 5MHTA 1JWBB 3O4HA 3W2IA 5KMGA 1CETA 3MELA 3M49A 4LBVA 1AHNA 2M6KA 3LVQE 1E3QA 4WOKA 1A0OA 5AOVA 4EGCB 4YDSA 1E66A 2Y71A 4CCSA 3BCHA 3I01A 4O63O 4TMVA 4JLSA 4JLJA 4AO7A 4R8VA 2HMWA 5EJ2A 3DBHA 4M1WA 5B55A 3KX2A 3FRHA 5ALLA 4I4NA 4WLVA 4EMBA 1W88A 2X8JB 2MHCA 3FKSD 3LLVA 4M36A 4DQVA 4FI3F 1CULC 2E37A 2ZSEA 1CY2A 3ZJ5A 1M2OB 2C8JA 2JI9A 4DNQA 3UUEA 1Y3HA 5AOBA 4I08A 4D9NA 2FF5A 3RF7A 4W1PA 3W2GA 2ZRQA 3BIWA 1YL6A 3DONA 4QGAA 1Y1KE 3LQFA 2X8AA 3ET4A 3SEFA 5L7WA 1J1IA 2ZJ7A 1POXA 1Z26A 2WU4A 3MGAA 1ZM3A 4X85A 3DLHA 1SU4A 3NOQA 1F6WA 4BBAA 2IPXA 1RQGA 4JYZA 1AO3A 1M2HA 3FI0A 3K0CA 1RW4A 1O89A 4U2DA 5JCOC 2B7CA 2HJSA 5EJ4A 1S89A 3HO8A 4QFDA 3H75A 5KSZA 3UFXB 1E18A 3QJYA 3IYLW 1LDGA 4E33A 1UWCA 2DKOA 3TKYA 2OQVA 3EQ7A 3EY4A 1QIKA 4TXHA 1HE2A 1P33A 3SM3A 2H7YA 2XOKA 3V55A 3I2YX 3I9KA 4IZIA 1IEVA 3EEIA 1VIAA 4BX3A 1DX9A 2H5LA 2A5JA 3HCOA 2ZI6A 2FQWA 5HQ3B 1EAYA 1JFLA 4NJEB 4REMA 1WB4A 3TM5A 1Q3HA 1VLLA 4KBGA 2DJIA 2OCAA 3BEOA 2CHFA 2FW1A 3ODPA 3PQ4A 5AQEA 4XSGA 4W7HA 2RGEA 3IO5A 2AW3A 4ZI7A 3GXOA 4AD8A 5H4HA 1JL3A 5H3LA 3SEQA 3THXA 1KZ7B 2N3ZA 2IF0A 3GCGA 4D44A 4TKMA 4RTSA 3CX8A 4M0EA 2R6JA 4XM0A 5K8UA 2IE0A 3TNYA 2VF2A 1KP3A 1IAVA 3MTEA 2ZUTA 1PR6A 2H63A 2HREA 2H92A 4BX0A 2R00A 2DFPA 4LGVA 1IYZA 1CRWG 4I6GA 1AMOA 1Q12A 4I1UA 2OG2A 1MOZA 2PJDA 1JIQA 2PZKA 1Q95A 2WF8A 1LZKA 3FIUA 1XZ8A 2I33A 3M4ZA 3DR5A 4WNAB 5KQMA 4NOMA 2B4RO 3IKTA 4EP1A 2L0XA 3ORSA 2CHUA 1ABEA 2JEZA 4EFKA 3PIRA 2O5CA 4FN5A 3QJGA 4Z0TA 3DMHA 4OYHA 1GRRA 1KJJA 3B7WA 3GN2A 3HWRA 5EPOA 4C5AA 2CNOA 4YNBA 3LFTA 4F12A 2F4NA 1LBTA 1QIGA 3ON5A 4QLAA 2BUAA 3TLKA 3VTFA 2BFAA 2PV0A 3G0DA 1PUXA 1S2LA 1P2DA 2NQ2C 5DMXA 1XXHA 2V7BA 3QPCA 3VYUB 4BRSA 4BVAA 4LGYA 2HCFA 3G02A 4BEVA 1I51A 4PWYA 1G9XA 1II8B 1WKVA 1ZK4A 3IMGA 1OH8A 4EM6A 1AF7A 4WPGA 5CFMA 4YROA 3Q0IA 4J1QA 4IJVA 1AMNA 4CKEA 4B47A 2DSTA 1X13A 5B1IA 1THGA 2W00A 5JT1A 1NJSA 2GI4A 2GN2A 1IEQA 4Z7QB 1UBCA 4PW0A 1CCWA 3EMKA 2DPGA 3I37X 5JI3E 5I9NA 1X7WA 2AS0A 4PZAA 2H48A 3HHEA 1RCFA 4P7FA 2AL7A 4WZBA 4CIWA 4CIBA 3TNJA 2PUBA 3DL7A 1IHDA 3RROA 1UXHA 1L3CA 2X4DA 2A5YB 2O4CA 2XWBF 1OBFO 4HXEB 2HNKA 5C4GB 5FDFA 3N7TA 5IVDA 1DKLA 3H11A 3WHLA 5CFLA 4TLDA 3BTOA 4IJ6A 5J3JA 1UFQA 3DKIA 2F9LA 1GTVA 5CYGA 4W82A 1ZAKA 4YI3A 1EGMB 3DMTC 3R7BA 4D9IA 1T9GR 4AS3A 3MJTA 4UCXA 1ZL0A 1MCZA 5DZSA 1HG1A 2PVSA 3CLVA 1MAAA 3E9CA 4HLUC 2CV0A 3FSGD 2RC5A 2W4QA 2XWJI 3HR8A 4KLNA 4XEHA 1V5IA 1MNAA 4GPAA 1KWGA 3LQ4A 4LHSA 5DXAA 1RKUA 2RBGA 4D98A 1HV8A 3TEJA 2GFHA 3HFSA 3WLRA 1T91A 2Z43A 1E2BA 1F2UA 3NHMA 3S2EA 3HTXA 4B5KA 4FJ0A 1FLNA 1HE4A 1L5MA 4ZP1A 4F5DA 1KQNA 2FP4A 5KI6A 2IHKA 1A9SA 1J2EA 4WN9A 2CLHB 4N0PA 3RVSA 1M0EA 3ENWA 3BMQB 3GT3A 4N54A 4HVCA 3SJCA 2GWHA 4TWJA 2D2VA 1SXJA 5EZ5A 2AG1A 4BB0A 1BMFD 3OTQA 2YW2A 1NY6A 3GPLA 3A2KA 1TKAA 2PTHA 2ZUCA 3WLFA 3GP5A 4M9XA 2IE8A 3SDBA 3BTVA 4I50A 2CL0X 1FC0A 2JGMA 5BR8B 2ASVA 3O8OA 5AW7A 2VA8A 4CEIA 3TIIA 3H2SA 3L43A 1KIFA 1DELA 1CZUA 1H5NA 3LBAA 3MC1A 2LVBA 1W581 1E6KA 4TMTA 5HQ3A 2BE7A 5A6SA 1RI1A 1V41E 1GXSA 3RUFA 1GZ6A 3GJXC 2H57A 1IIRA 3II6X 1RXVA 2W6ID 1XP5A 3AUYA 3OD1A 4PLPA 1Y80A 3U1VA 1EB9A 1G8AA 4R1LA 5DE3A 3GLFA 3FVWA 4YAJA 3DVAA 2N0SA 5H80A 1VA5A 1P17A 4M0PA 4K87A 5EP1A 3G1TA 3KJXA 1VPTA 3SE0A 3P1JA 1H8ED 1NAHA 1QMPA 2YICA 2AOUA 1U4NA 3NEPX 1IAQA 3D1LA 2BR3A 1QC5B 1U9ZA 3L0YA 4XQGA 5EZYF 4FEAA 3WWCA 3ZWWA 1P2UA 3CUEF 3EGXB 2FSPA 2OV6A 1NF3A 3GNLA 3P27A 2FDRA 1QBGA 4B2IA 4COKA 3MGGA 1XLTC 4AICA 1EFLA 1M6EX 1TZCA 1YCFA 1ZOIA 1KXJA 1AOXA 2WTMA 4KN9S 2PWZA 1U0NA 1PJSA 1YQTA 2JFVA 2Z8YM 4QBIA 1UEJA 5DX0A 2YV1A 3F7MA 5L3QB 1Q17A 3AUXA 4I66A 2IT1A 2ZB7A 4HTFA 4QAJA 4X24A 4MVXA 4K9PA 4O2AB 4C30A 3VXKA 2WICA 3RVOA 3Q11A 4N48A 2W70A 4ZVLA 2FX2A 1XU7A 1V71A 3RABA 2A0UA 1ML4A 2E3JA 1A5BB 3IERA 4INJA 4MTCA 4DUGA 2BM8A 4MRAA 1H6CA 4AUMA 1DOZA 1NQXA 4DILA 4PIVA 4RTMA 1Z33A 4HEQA 4ID9A 3F3SA 1X19A 1U9CA 4A8JA 5HKKD 2GF9A 2CMFA 1L1QA 4IS3A 3FMOB 2AJLI 2CJYA 3HR4A 4QPPA 2ZP1A 1NRXA 1AQIA 3QKIA 1GAEO 1DC6A 2GTIA 3FTCA 3LHIA 5JV5A 5F51A 3OCYA 1X9GA 3PTLA 3PTZA 1RABA 3VTKA 4IJUA 2ODPA 3NALA 2XUOA 3T5BA 1A5TA 1O5IA 2CKDA 2Q5IA 3IRVA 1FUYB 4HFMA 2X15A 3RUHA 1CC1S 3ZLUA 3G2JA 4WFJA 4YT4A 4DSAA 5ALQA 3HYRA 3LGAA 1VPLA 4HNAB 2JIZD 3G9TA 1HR0B 1CQXA 2C88A 3Q85A 2VP9A 4MJ7A 4N8DA 3UYKA 3HUUA 2GEFA 4PPNA 1LWOA 1K08A 1ZQ9A 1YUBA 4I9UA 1TMOA 2W0SA 5L3RA 1CR2A 3ED5A 4S1OA 3DXYA 1J49A 4EG4A 1DO2A 5L3VA 1MIOA 2V3CC 1N2JA 4ETWA 4YO8A 1ZX1A 4ZV9A 4GVLA 5FCDA 3MWJA 5FBVB 2ISCA 3HA5A 3VH2A 2ESRA 2HQRA 2VYNA 3KVVA 4OHOA 4V3BA 3SZGA 3TAUA 4CTNA 5ALJA 2CZCA 4OHVA 5HTKA 1N92A 3SSMA 3TLZA 1HE1C 2RB4A 2IHYA 1G16A 2WJ3A 4B4VA 4YAIA 1H0RA 3GZNA 5EXEA 5FLXA 5JZVA 5AMXA 3ZLBA 1XK7A 2QROA 1KYWA 5M2QA 4MRNA 2O8CA 4J3JA 1ZGZA 4TV8A 1FYFA 4F0JA 2QR2A 3TZEA 1AIPA 3ZWNA 3IQIX 2XAAA 1PZEA 3BIXA 3LLSA 4UTPA 1UDAA 3DDUA 4XE5A 3HVJA 3DTVB 4GS5A 4RZIA 2ZJOA 3SXPA 1ZM7A 2FP3A 4F4DA 4H59A 3NVDA 2C9YA 5CH8A 1SIWA 3DHNA 3LQYA 3FOBA 2I2AA 5JCPA 4I9GA 4JN6B 2OV8A 4OL9A 1IBCA 2BGTA 1WUYA 2JRCA 3M1LA 4IDGA 1E6UA 2IVFA 2FZ4A 4L2IB 2OA0A 1V5FA 3SZUA 3V1LA 4E03A 3IDAA 4RZ3A 3ZWVA 1WDWB 3UAVA 3EFBA 1VSBA 5KNDH 1YI0A 2Z4RA 1EYZA 2OFXA 4KR6A 4Y30A 3N5KA 4YJHB 2WJVA 2PAAA 4GOJA 5DB4A 1NDUA 2FZGA 3CH5A 3PFKA 5K8LA 1CU1A 1DLIA 2WUWE 1GL9B 2X76A 5B4UA 1Q84A 2A3NA 4DMHA 2QMYA 3FWYA 2AUMA 4KYIB 3PFFA 1AUPA 2WI8A 1F9EA 1JQJC 4TTPA 2I3BA 4WA8A 3C74A 1P3DA 1XXLA 2E85A 2JIZA 1O95C 2WSYB 1X94A 5AP9A 1I2DA 1T36A 3WKEA 3NATA 3V1YA 3WO0A 1FU8A 1P9LA 4GC5A 3TLAA 5H9VA 4MVJE 3I9LA 2W43A 4RVNA 3TEMA 5KSWB 5JY1A 1EXWA 1NLYA 1R7RA 3QOFA 3AOGA 1TQ2A 4FD2A 2WWTA 2JLZA 5BNIA 5TVKA 1XTZA 4WKOA 5KYXA 2CK3A 2VAPA 1CF2O 3RSOA 2XNKA 5KQSA 1HX7A 5EHZA 2NYUA 5AKKA 1R5OA 3M81A 2QM3A 5LYJA 5I45A 3VYSB 3JQDA 4YUWA 2QG9A 4M98A 3DWEX 3PNPA 3GJTA 3HABA 4MQ4A 3ESBA 3S1AA 2AMFA 2AX3A 1D7AA 4LFBB 3WWYA 1I1OA 1W48A 1SOMA 5ALDA 1YOVB 3KR1A 4ZAFA 2VPWA 4HH4A 2E4YA 5IMBA 3VNBA 1I3CA 4OXIA 1DV1A 4X61A 3KVOA 2CB0A 1Z62A 3ZDZB 1GSHA 5EC8A 1E58A 3E15A 3F4KA 5GV8A 1P5HA 1Y7HA 3ICPA 3PQ8A 4DF3A 4TYMA 4MXDA 3E1SA 2WR8A 3ZDBA 3GG9A 5B2EA 2J0EA 5ED4A 4P3KA 1K0UA 2F3QA 3ONDA 1G55A 1I14A 1BD4A 3DMRA 5F77A 3VPHA 3DM5A 1TZKA 2JVJA 3ZEIA 1CZRA 3I45A 2A3RA 3AJ9A 3VTAA 1NFQA 1X1RA 4QOGA 1Y3AA 4PYMA 4R83A 4F3RA 3WJ1A 2NQTA 1T9DA 1H2YA 5IU6A 2XB2A 1FNNA 1WX1A 4X94A 4ZU1X 1CUCA 2A9KA 3OFVA 3OTWA 2P1DA 1HYEA 2JGDB 4QXMA 1Z4OA 2AFIE 1A4XA 1R0YA 2X9LA 3W1EA 2GN8A 4BKMA 1DIHA 2G6TA 4IEFB 1EP2B 3A10A 2P77A 4RETA 4BFXA 5KPDA 3KUKA 1TUGA 1PJ3A 2A1TS 3OU6A 4KAFA 2G1JA 2X9QA 4YJFA 4ZGWA 4S1NA 4EFDA 2JHCA 1VI5A 1DC4A 5D84A 3PEYA 4KUHA 4RD6A 2AZDA 5FKJA 4CNQA 1IONA 2GS9A 2QRGA 1SBQA 1M2WA 3ND6A 1ORRA 4ZKEA 1JKIA 1SQ5A 3U1TA 3SXUB 1JG3A 1Q44A 2MMGA 3F97A 3T4XA 2QDKA 5EXSA 4OHWA 3D8NA 2DM6A 1IEWA 4LF7B 2ZBGA 4HDMB 4BMDA 3I1IA 4Q15A 1ZU4A 3MSXA 4UTVA 5A3RA 4KX3A 3T9AA 1SJ9A 3F7NA 1Z0AA 3GZ4A 2NU8B 1QG6A 2ZB4A 1XJCA 1FNBA 2IOFA 3Q8XB 2BEWA 2R85A 3AFNA 3D9QX 3NTOA 1N9GA 4WVFA 4RH1A 5CM9C 5C8YF 4Y7DA 4B3MB 2YV2A 1FW8A 2AFIB 3VH4A 2QSJA 4Z4CA 1HGXA 2AE2A 2NO0A 2QRUA 2Y77A 3U7QB 3HJNA 3DGEC 2NYVA 3LBHA 4X6YA 5HCIA 1GL6A 3U44A 3CRVA 1J2TA 1UZMA 5LD2B 3PFGA 1ADCA 4AZSA 1WUKS 4PQYA 3L7LA 1JVSA 2ORVA 2PGOA 3BGOS 3VPBA 1X3SA 4EL5A 3H97A 4GICA 1ZWLA 3DV2A 1BU8A 3QQ5A 3T94A 5GZ1A 4M37A 2XY4A 4PYKA 1VSQA 1JKFA 1XJ5A 3Q41A 4Q66C 2BV3A 3ZI4A 2O2DA 1PLLA 1RIIA 1RPTA 2H9YA 5K0JA 1BCRA 4C1BA 3DL0A 1D6MA 1ENYA 2WVHA 3AR6A 3IBSA 3MBOA 2HFJA 3RW9A 4ZJPA 5EJ6A 3HVRA 3PQEA 4GMXA 2C9ZA 3P0EA 3H9BA 3ESZA 1P81A 3D6VA 4TLMB 5E3JA 4HT3B 4GAEA 5HJ5A 3IVGA 2EX1A 2Q3BA 4HRAA 4Y7CA 3H9QA 1LDNA 2Z6AA 1XD8A 4K6GA 2B35A 3A04A 2R8XA 3M6UA 2OHVA 4JBLA 5FADA 2CNLA 4P36A 1UMBA 2FUKA 4EGQA 1T36B 1ZH8A 4JWTA 2YXNA 4D92A 2YHAA 5K2OA 3TL2A 1N1DA 3AU9A 3C7AA 3GJ3A 3H2KA 3E84A 3FBTA 3KAQA 3N6RA 3PV0A 2C92A 4HQOA 4UFPA 1PJCA 3GVPA 4YWHA 4RORA 4UZFA 3KSBC 1DMRA 4EW2A 1XNQB 3L4SO 3EIFA 4EYOA 1P61B 3I83A 4HDCA 1Y9JA 2GBCA 1VRVA 5DWQA 2O14A 4XJTA 5K8VA 4L5BA 1RDFA 1Y5MA 1ZK0A 4FGLA 3NHYA 1NR5A 1CIPA 3OCZA 3VZBA 3VU3A 4YT2A 3OF2A 2X8BA 5FO1A 2ODNA 2R6ZA 3SX0A 1RJGA 2UYOA 1DU4A 1A98A 3CR3C 5TVGA 3W8EA 3X2FA 1Y1SA 3W6NA 1VFNA 2ZS8A 1ISSA 3L06A 4MYHA 2C78A 1P6QA 3BXEA 2WVAA 3PVSA 1UBLS 2WHPA 2ZVQX 2J08A 3G0BA 5BN1A 4XOUA 4GH5A 1NTRA 5HIAA 5JD5A 3SDZA 3WR5A 3IUNA 1JBKA 3JS5A 5A7GA 4UUPA 1RMYA 2RCYA 3TRJA 4QXQA 2H4HA 1RHMA 2YN4A 3BX1A 1R8JA 3IDZA 3MRSA 5TJHA 4IIHA 2JZOA 3K70B 2IIPA 1C4KA 2AC7A 1LSOA 1TLLA 3BL8A 1SQGA 3FJ1A 5FHQA 1UXIA 2WWIA 3H1FA 4WI1A 2Z8YA 2KHZA 5LMZA 3LOUA 2R6AA 2M2IA 3MWYW 3RUIA 2CVOA 2YJ5A 2VR1A 2HQOA 2G09A 2IZOA 4BXOB 1PCXA 2CGEA 2X3UA 5G3ZA 5FOVA 1MG0A 1EUCA 2YV5A 8LDHA 1F38A 3JQ8B 1YZ3A 4RF2A 2DEUA 4IDFA 1ONPA 3HGQA 1SKYB 1GCGA 1A8UA 2QTAA 3I5UA 4YRQA 1Y1LA 3ETCA 4J0QA 3SICE 4D0RA 4YMHA 1QQBA 1MT0A 2WZBA 4WKCA 4BV2A 3STXA 1I2BA 2BGIA 4CKCB 3KQPA 5CDUA 4UM9D 3AH8A 1KO7A 3MLEA 4PIPA 2DHCA 2BRUC 3JZMA 1HLPA 1R74A 4CLXA 4REQB 4ZOLB 1ENPA 2HYIC 3M3PA 3WB1A 1BGXT 4I5EA 4WY8A 1JMKC 1VJDA 4KLAA 2C2MA 2ZCVA 3THWA 1QF6A 2BDEA 4EYKA 2GUWA 5KVQA 1VHJA 2HBRA 4LSZA 1YH3A 2E89A 2VTDA 3OF3A 1ZA2A 1YGPA 3IB6A 1OROA 3ONVA 2IEIA 2O8NA 3PTAA 4E08A 5ALEA 4E51A 5GJVC 3DEKA 3H5NA 3UVEA 3KR2A 1YDEA 3DOEA 2QDXA 1JP7A 3GMIA 4QVKA 1CEEA 3WQHA 3VHXB 4EVIA 3VU9A 3EWNA 2SHKA 1Y3FE 1ZOPA 1Z8NA 4WY5A 3K5IA 3KPYA 1XPOA 4OATA 1VCHA 1ORVA 1NAIA 4FGKA 5T4HA 1N4AA 4L5YA 3KC2A 2BISA 2YRWA 1YFLA 4PXSA 3KD2A 4NZPA 1X39A 1PZNA 4Y2UA 1LF0A 1CJSA 1ODTC 2X7XA 3L8ZA 3U1BA 3B38A 2MYNA 3E27A 2V4MA 3JQAB 5TS3A 5KYGA 1IXSB 4HEJA 4PGMA 5KDOA 1QGED 2XCRB 1R00A 4B87A 2Y1XA 4EA9A 1V1JA 2IYNA 3BJEA 3A2MA 1ULSA 3C5CA 1OGJA 4M49A 4R3WA 1WABA 1C4XA 3OBBA 1NVVQ 3L40A 3K70C 3HP4A 3DQPA 3WIVA 3KQYA 1Z2OX 4D5EA 1BWRA 5CPFA 2OBMA 2VRWA 3KETA 1XF9A 4OAPA 5L6MB 4NNOA 3WNVA 1LI7A 3PUZA 2IPLA 1L7EA 2WWXA 3MT0A 4ILKA 3K09C 3BIOA 4UTXA 2ZJ4A 2YFKA 3GNTA 3JCZA 2Q5HA 1BE8A 3DF7A 3FKJA 1BYUA 2X0IA 4MR7A 4X3OA 5IANA 3KSRA 4R9UC 1PDWA 4CL3A 2XT6A 3ESQA 5DNAA 3TW6A 4D42A 1KFKB 2XRZA 2J3DA 1E9CA 2QTFA 3PWSA 4OFXA 2IEAA 1FIUA 1EFKA 3RV4A 3NTXA 3QSYA 3OT1B 1QHFA 5B7NA 3HBFA 3I92A 1SKUA 3WQRA 2QRNA 1LLDA 4ZT2A 1KAHA 1ZUNA 3TXAA 4CUJA 2HSDA 2ATXA 1YZUA 2O0LA 3IRUA 3BM5A 5JZSA 2AN3A 5A7FA 3ZDEA 2B5VA 2FPRA 4WGFA 4H7DA 5C8YA 1AHPA 1JILA 4CPDA 3FFTA 4N41A 1DHTA 1E69A 2JCSA 2I4NA 3IAM6 5EQTA 4KQJA 5A9SB 1D9ZA 3RFXA 4RCYA 2VJAA 4RF3A 3VYWA 3WMXA 1SAYA 3E2MA 5DLDA 5IDQA 1Y4UA 2JHFA 1E7YA 2PKQO 2VEOA 4PCUA 2VJKA 1B7GO 4KRYA 1VBMA 4MW0A 4E31A 5IZCC 1CX9B 1KDOA 2VJQA 3QE0A 4X5OA 1CUHA 1TRHA 1E59A 2EBFX 4FKBA 5JHGB 1SD5A 2PYIA 2ECQA 3ZY2A 1XZGA 4LCBA 2FOIA 2P6NA 1N5MA 4S0XA 2LDBA 2P0AA 3E4DA 4RJ2A 4YAOA 4JFRA 2V6FA 3CPSA 1E9SA 3MUFA 2GD6A 3VKUA 3AERA 1SC4A 2ZI7A 2O7RA 3WNDA 1PFQA 3ISTA 1RYBA 1KSFX 3IP8A 5SY6A 5F1PA 3DB2A 5FWAA 2BMFA 1T0IA 4JHXA 4FZ5A 5FHRA 1E4VA 2D1TA 3A8TA 3WNQA 2W48A 1RHQA 5FBQB 3JPYA 1SCAA 1Y1RA 2P4UA 2V7GA 2J7PA 3IKMB 3AY6A 5KJ1A 3BE4A 1OF1A 2DFDA 3I42A 4I1OA 4I6JA 2UVPA 5I9SA 3DZCA 3ZE8A 1G8JA 1OJLA 1DT5A 4LJRA 1A69A 4BKRA 2IS4A 2Q1UA 1MJHA 4IGIA 3GDFA 1QCCA 4QJBA 3WQBA 3I61A 1SKYE 4MB2A 5TXGA 3ZWAA 5BQFA 2ZM5A 1ABFA 1ZO8A 2YVUA 5IDVA 4DDTA 2GZAA 5SZKB 4C06A 1UBEA 1XHLA 4DCSA 1E3WA 4NIMA 1E64A 4G63A 3I1FA 4JOBA 4XIYA 1U1CA 3OOJA 1NNLA 3C48A 1RYNA 4OP1A 3SGLA 1QBKC 5K05A 4PYJA 3M5WA 4C4ZA 5A5EA 5MFZA 4XUCA 2UUPA 2Y99A 1ZGCA 1AKQA 3VC3A 4EYQA 5KYWB 1KVTA 1K5PA 3PL1A 1JZTA 2VUTA 2HU2A 2ZKIA 4RGVA 3FW1A 4YRZA 1WZCA 1OWPA 3B5EA 5CH5A 2JLBA 3DT8A 3E8MA 4EO7A 4BVFA 5E0KB 1ENOA 1DEKA 1OAAA 2ROQA 4QYMA 3WHKA 4YRBA 2XUPA 4ALLA 1BH6A 4DYHA 2H1FA 3N86A 3WYNA 3C6BA 1PT7A 4E5PA 3DKPA 3AYXB 1SBNE 2OBNA 4MWZA 4R7TA 2VDOB 3OFKA 1QS0A 1W1UA 4J1TC 4Y9DA 4N8EA 1NZDA 4DA7A 1PG5A 4GLOA 1FMLA 4C7OB 1MABA 1NY5A 4KREA 5TEVA 3EDCA 3VV2A 5CVUA 2NQ8A 4GNRA 3R2JA 5F4BA 1BJKA 4X20B 2DPXA 4ETNA 1G6KA 2OOKA 1MRZA 1U2TA 3F7OA 3GAMA 2NUPA 5BSMA 1C29B 1HPLA 1GFZA 1UWVA 3FRIA 2P91A 4GYYA 4L8YA 4P4TA 5HMLA 1NJ6A 3G2LA 4CLOA 3TWOA 1B1CA 1NIPA 2VNJA 3LBNA 2KSQA 4N65A 3NM4A 4D8UA 1J56A 4QNMA 4MDHA 3HACA 2Z6VA 3MCAA 4M0DA 1M8KA 1SO8A 3KPUA 4JC8A 2BFMA 4RY8A 4ZZ0A 1JR3D 4GM0A 3CO0S 1R6DA 2IIQA 4NP6A 4DMLA 2I22A 3PNKA 2PGXA 2UZ4A 2QTNA 4Y9RA 1KFCB 1UBFA 3R0XA 1U0EA 3Q72A 1FNCA 1A95A 2W71A 1KJNA 1VHQA 4BASA 5J58A 5DF1A 3IA2A 2X5OA 4NHOA 5K0CA 5JSUA 3UPTA 2JGIA 2QQ0A 1AKUA 5E4TA 3O8LA 4B75A 4OI1A 4YV7A 3MINA 3P4UA 1VYVA 3LL7A 3QG1A 5JD6A 1WNTA 4PG7A 4XUDA 2AJBA 2NTYC 3JALB 4H1TA 1GUDA 4D99A 4NC9A 3SBEA 4IHKA 2JLWA 1PGQA 3KWJA 1IN7A 3KXLA 2D74A 4FHFA 2NLOA 1GGVA 2VP5A 3FNRA 2XEXA 4OHZA 3A7EA 2Y2VA 3WYBA 3O26A 3I5AA 3HNRA 4HFJA 5JNRA 1PX0A 2DZDA 1TMKA 1B93A 2C4UA 1GU7A 1ZLYA 2C84A 1NVGA 2D5AA 2F17A 2JKYA 2Y1KA 4X20A 3CKLA 5EUQB 4CF3A 4F4CA 2DR2A 1ZIPA 2FI1A 1RZRA 3AXTA 2WAYA 1ZMTA 3MJHA 1BA3A 3WICA 3SKVA 3C8HA 1IDN1 1ETUA 1GL7A 2MYPA 3DYBA 2RJ3A 1NRIA 2E0IA 2RARA 1GLVA 1Q0HA 4M54A 3C14C 4X1YA 2QVGA 4R41A 1QXSA 2JEOA 3EQ2A 4OM7A 2PH1A 4Q0MA 3G0OA 1V1RA 3DUWA 4E4YA 4RVDA 3K2IA 5A4JA 1G20A 1OFTA 1P9WA 3LWZA 1J5EB 3BH6A 3INYA 3KV3O 3DC7A 3D8TA 1OYWA 3FY4A 3OLXA 4XLZA 1L6IA 2O7QA 5JNLA 2J9FB 1K6XA 3IUBA 2FHSA 2J0VA 2RSLA 3M1AA 3MJVA 1P2VA 3A2LA 2ID8A 3Q7RA 4HADA 3GEEA 2XBLA 4OJNA 3ZXSA 3F8WA 1P6XA 2V9PA 4JXJA 4HL6A 3HXMA 3BD7A 2PZMA 5CHYA 4CW7A 3HB9A 4JODA 3R8CA 2H16A 3MF4A 3WQSB 4R71A 3FDZB 2XNJA 3R20A 4Y0AA 1DIOB 1WUJS 3QEKA 4MGZR 3ZHQA 4BTLA 5LJLA 2HJ9A 2QMZA 5AK3A 2PM8A 2CLMB 4WKNA 1HTTA 2VF5X 2Q0QA 4CDGA 3AI2A 3BGVA 5BNTA 4E32A 4O8CA 2ENUA 3PXDA 1P2BA 3NUZA 4HFRA 3BN3A 1Y9AA 2XXAB 3ILHA 3MAAC 5IW8A 4Q4JA 2VQSA 1N36B 5F21A 4UATA 5ADVA 1ZAYA 1WMSA 2CHQA 3K6RA 3TI9A 1FNSA 3TQRA 4BNGA 2ZWOA 1BS2A 1N0UA 2ZYSA 1FQJA 4QOJA 2B37A 4OGGA 3PQ7A 4P82A 2JAWA 4ZRNA 1DQNA 2E55A 1GADO 1YS2X 5JR3A 4LBZA 1USGA 3GBSA 3W8NA 1C80A 4ZAVA 2XOKD 5LOVA 3TJMA 1OH5A 4G26A 2F3SA 3SFZA 3SR4A 4XYLA 4H2DA 4UTRA 3L8CA 2UUAB 4RIIA 4GRDA 2JLXA 2AMVA 2JJ2A 2RIRA 1PKXA 1UK7A 3EUWA 1XA4A 4J0EA 4JBGA 4RPLA 4Y2QA 13PKA 5EMLA 3EMBA 3U48A 4EOGA 6YASA 1GVNB 2QE7D 3ZTYA 3K5PA 2V74B 5A62A 4QUEA 3AP1A 1KO4A 4MW7A 4EY3A 1YJBA 1NBMD 4FOPA 4TLCA 4NY1A 1IJKA 4YHHB 5CT5A 4YUZA 1A7UA 1ZRSA 2YZKA 4IZ6A 3E7DA 4P33A 1EQUA 2GM5A 2EJUA 3DV9A 4BL5A 3PE4A 3LUBA 4EMUA 2WTUA 4BU0A 1FXWA 1RC0A 4MYSA 1N6NA 3GPBA 1QRUA 3EZ9A 3EXG2 1FRZA 3JV7A 2X19A 4NBTA 4F2HA 2HLDA 2G4LA 1NIJA 1EUZA 4HH0A 4FYIA 3R0VA 3C4QA 4AN0A 3LUPA 2X9GA 4LZLA 3P0HA 3NO4A 1L4NA 2CEKA 4AQ7A 1W76A 5UKDA 4RKWA 3BWEA 3N0RA 2VZ8A 3MTAA 4R3NA 4W7SA 1IRXA 1R6TA 4X1KA 3M2PA 3M9XA 1FQOA 2Z5LA 4M2LA 4A6DA 3UHOA 1HM5A 4CM6A 1A4UA 4NCBA 2XR1A 3MUNA 4GWKA 9GPBA 4DGSA 4P4NA 1M74A 2J3HA 5BV2P 3BHMA 1HMPA 1EVEA 3NX4A 1QO7A 5F2KA 5AHOA 2QZ9A 1UXJA 1OA1A 4V02A 2H3HA 2YCLA 2PMBA 2XZDA 4AO6A 1VMKA 1LLUA 1YJ8A 1E1QD 2ZLBA 4C3VA 4CL0A 4IDEA 4K9OA 3HA7A 5K03A 2IXFA 1U8CB 3R76A 4F2DA 5ICGA 4GBED 1MO3A 3R75A 2BKXA 4HQ0A 1OWNA 4P5EA 3IV6A 1VBNA 2C5BA 3QFSA 2O9JA 4QDUA 5HF5A 2Y67A 4L76A 1CK4A 5DHTA 4MGIR 4RJJA 4UULA 4G4JA 4UEJA 3UMGA 4C6HA 5JMOA 1T5SA 2GNPA 2VTBA 4JUAA 1GPWB 1XU4A 2JFFA 3LIPA 4GKBA 3QRWA 1QANA 4ZAZA 1L5LA 3ZOKA 4YJDA 4BLVA 1NG1A 1GPAA 4NR0A 3PGKA 1ODIA 3IHTA 4IYRA 1SKMA 5E1DA 1SEPA 2XNSA 5AI5A 3PPXA 1NI4A 2UYCA 2IITA 3KOXA 2CMGA 4RV4A 4UXHA 3DLBA 1J0DA 4IHQA 1DX4A 1YR7A 4FS8A 2PKQP 3BSYA 1DJNA 3D1VA 3GVXA 5FYQA 2X0DA 2OAEA 3CZ5A 4AECA 2FPIA 3KZMA 5ERGB 4GI5A 3Q8WA 1JHPA 3V8BA 3X44A 5FV4A 2QG6A 2L82A 3UOGA 1XCJA 4IDQA 3VSEA 4RHFA 3K96A 1L1FA 1XCBA 2VFAA 2P4EA 3UEOA 2IDMA 1XV5A 3VNVA 1RQXA 2BVNA 4G5OA 3Q9LA 4LCEA 3KDAA 5SZHB 2W2QA 3V2IA 1VJ0A 1P4HA 3CZPA 3VVLA 1LBQA 4ETMA 5JS2A 1B23P 4F3YA 1B6TA 3NP9A 2OZEA 3ID6C 3A27A 4Y2YA 3DG9A 2CXRA 1DRKA 3AKCA 3F49S 3N3BC 2NZ2A 4QUIA 5JXGA 3PXXA 1UBRS 3TJRA 2R8RA 1IC6A 1YB5A 3QWBA 2GFQA 1XLTA 3KCNA 3MJDA 4GE3A 4OHRA 4QNNA 5KVVA 4LBWA 5F4ZA 3GNQA 2NUAB 4I3HA 2IH2A 2D5LA 1KI3A 2G17A 2GM3A 1NUSA 3GGPA 3N70A 2OXTA 1YU6A 1GCUA 3NM6B 3UA3A 4QGSA 1EUYA 2ZE5A 3DOFA 3MB5A 4JLNA 5CNIA 3TR0A 3L6BA 5C5EA 4A36A 2OHFA 3FDZA 3LPMA 1MB3A 2ZUSA 2CVHA 3X1WA 3FZNA 4DUPA 5KYNA 1VOTA 5IJAA 1C1HA 3GT0A 5EIHA 3E9RA 4Y2JA 4EK9A 5JO0A 1JDSA 1X38A 5FPTA 3U09A 1S2NA 2ZDQA 3PUIA 3CS3A 3ZQKA 2IRWA 2O6HA 4NNPA 1O54A 4QDKA 4WH0A 4OYLA 1T26A 4UNIA 4FS3A 3RS3A 2ZRNA 1TFRA 1T8UA 4DTIA 1E1YA 3KLMX 4E3ZA 3EF1A 3GLTA 4MWOA 1DBPA 2X9NA 2DQYA 4FDMA 5G41A 3X1MA 1RRVA 2GDZA 2BEWB 1GDHA 2COUA 1XWFA 3S2IA 3SNKA 5CEJA 2AFVA 4QXOA 4RK5A 2CZGA 4XGKA 3T06B 4G84A 3TH5A 3RJTA 1EM8B 3A3KA 1VL8A 4BNIA 1RWQA 2I1LA 3DEZA 1M0WA 2A92A 3AW9A 1JLMA 2GVDC 2O23A 3VR4D 4LF9B 1PJLA 3HUFA 3IR7A 1RJ9A 5GOZA 1KK3A 3EVAA 4EATA 5E7IA 3NG1A 3JW8A 1F14A 1FFWA 1T3ZA 1WMDA 2QP4A 3QENA 2XHZA 4HLNA 4BMSA 4E5SA 3CT4A 1S8OA 2A7QA 2G8LA 2PS3A 2RJNA 3LT4A 2YJ4A 3QITA 2EZTA 4GU5A 3ZCSA 1L4UA 1BCRB 2G36A 1CEQA 1MGPA 1G5FA 2UZ0A 4IWNA 1CUDA 2FETA 3R6GA 1YZQA 2IXTA 1LD3A 3A4LA 4JLVA 5YASA 1NMYA 4C2TA 3KCQA 3WIOA 5EWMB 4Y98A 5DYWA 2ODBA 4ZT7A 1F8GA 5GIOE 2XWPA 3FSEA 2BJWA 2JJ8A 3VNRA 3WYFA 2O7NA 1E9FA 1R4AA 4WCDA 1R6BX 3TSOA 1T2CA 3H0KA 1QH1A 1T6ZA 2LR0A 1HKUA 4PLYA 4BTVA 1QJCA 1PJ4A 4F5ZA 4IGFA 4LTNA 5B58C 3MWFA 2A4MA 1LQUA 4IKPA 3N2GA 4WJZA 2WZCA 3QKUA 4AZ0A 3T5CA 2H18A 5B6IA 5JI2E 4H16A 3QLEA 2H9AA 4YJGA 2JVIA 1U02A 4B4DA 3GUZA 3GO4A 3MPOA 2AT1A 4G8BA 5B4VA 1QYDA 1EWKA 2Z9DA 3AEXA 3Q7PA 2H85A 3PUHA 1R0ZA 3N53A 4MAMA 5EAIA 4EF6A 1T3GA 2TMYA 5B37A 1L5KA 1KP9A 3HDTA 1L0BA 1XN1A 3WB0A 3G7UA 3U7FB 3HSSA 3UH1A 1FDWA 4F3CA 3JTEA 2VDMB 2QLMA 3H0CA 1P2SA 5AVYA 3QWAA 1K6IA 2JH3A 2JK0A 1GAWA 2IY7A 1ZD4A 2A9OA 2QX7A 1IJBA 2R2GA 4LY0A 4Q6BA 5F9HA 4XR9A 2A59A 2N47A 3RTBA 1OCEA 4V0QA 3ISJA 3OJ0A 2G04A 5HIKA 2X3YA 3KJHA 4OAQA 2PSDA 2J3IA 2GPNA 3I64A 1ANKA 1AB6A 1ISHA 3FYTA 3EVGA 2D2XA 4P0TA 4C07A 1IHXA 2VSYA 2KYRA 3BWDD 4N3GA 2VDKB 2C20A 2JJ1A 2ZYTX 4NEGA 3ZEAA 2AXQA 4EJ6A 1ZRNA 3G59A 2I7VA 3EMVA 4P7BA 1LRLA 2I1VB 3LVFO 3R23A 3O4JA 4ED9A 4URVR 1Q22A 2QJRA 1LZLA 4MWBA 4ZYZA 1MENA 5E6UB 1ETHA 3HXLA 5C37A 1AH2A 2P41A 3FVQA 4QICA 4CDMA 5L3QA 5BXYA 3OLZA 2ADFA 4YY3B 1V47A 1CUZA 2C9OA 1OIXA 4AKHA 2XE4A 2G1AA 1P75A 5HZKA 2YYSA 3D7RA 4L75A 3F46A 1JLRA 4RS3A 4Y9TA 3TTUA 5ICCA 1DVRA 3KK0A 4J7UA 4BZWA 4QTZA 1SMKA 3GAFA 3JQ6A 3G5MA 2GN9A 3GLKA 3OFND 2FQXA 1A5ZA 3BZWA 3PUYA 3F5SA 1PR9A 5AKIA 4WBNF 4P86A 1F3LA 2Z2ZA 4G0UA 2EP8A 1NSFA 2GJSA 2LDXA 2SBTA 3T9DA 3CEMA 1ZSYA 4XWGA 1QTQA 1KZ1A 4XYMA 1JTFA 1N2GA 1H3FA 1FUIA 1XCLA 2AYZA 1X14A 2RGWA 1GUAA 2RKBA 1Y8RB 2FR0A 3RSGA 2B82A 2P90A 5F9MA 1L8QA 3F5MA 4JBXA 4KK4A 1U1DA 1PJRA 2X42A 2P75A 3KT3A 5G4KA 2AK3A 1IULA 1KBQA 2XVMA 3IDSA 3PUKA 1Z6XA 1PJ2A 4GUDA 4GEGA 4QQRA 1G6Q1 2BSXA 1M10A 2B8TA 3I04M 4BGIA 1IFXA 3QPWA 2V58A 4R5MA 4JEIA 1JXQA 1R6AA 1T13A 1ACMA 2FX3A 1AT1A 3QFRA 1MOSA 4TXJA 3TAHA 2OB2A 2BFEA 1JHDA 3IURA 2R7NA 3PFHA 4IHJA 4X54A 5IAKA 3U4AA 2WYUA 4HAWA 4Y6OA 4F04A 3QVJA 1Z4LA 5MF6A 4FNAA 4TLLB 1V4NA 1UXKA 2GPJA 5GADl 3ZBPA 5JQGA 3HU3A 1WU7A 2PZAA 4HAVA 4J1NA 5L7TA 3MYYA 4UM7A 3OHPA 1P60A 1AUVA 1E3DA 2ZTMA 4RFSB 3T6KA 4RHUA 3SEZA 1BVHA 1XAIA 1NW4A 1CY1A 1QG0A 1VI2A 3NIFB 1X8LA 2JFYA 4KSYA 4BHTA 1MABB 5KCMA 1I94B 4R31A 1I3LA 4UUQA 2NU6B 3V4SA 1LI4A 2JDID 1ORTA 1XTVA 4P6VF 4ASUA 2IEZA 3FAZA 1TX4B 2C29D 2K5UA 2YJTD 2FEOA 3M9LA 1NLZA 3TOCA 3Q3VA 1ZIYA 4Q1FA 4ZMRA 2HNAA 2BN4A 1GGMA 3WMRA 2EDCA 3JYPA 3GXBA 3PHBE 2QTCA 4KTTE 3DEAA 2RHLA 2VJPA 2XODA 1BXKA 1IN8A 4BJ3A 4ZGGA 4BFSA 1AB5A 4L0CA 1YQ9A 5FBKA 2FYTA 1DKPA 1TMGE 3P4YA 4ZTBA 4BYGA 1WTAA 5C8ZA 1NR7A 1XDZA 1N2IA 2W2OA 4BLOA 1P9NA 2FG6C 2XCTB 1MVLA 4UQOA 3S28A 3D3KA 5B6JA 4AYWA 4WEOA 3HWSA 1YXMA 2V6JA 2R00C 1N6RA 4YJHA 3TGWA 2HK8A 1YBFA 4NPCA 1M1NB 3RGWS 5E4JA 2CZQA 2YBEA 2R0QC 1EMDA 1S9DA 2W8ZA 4LY3A 2G5CA 4CTOA 1BN7A 1E1RD 5CTJA 2ZUUA 3ZU5A 1J2JA 5F1KA 5CGZA 1CPYA 3IP5A 2EHJA 4KXNA 3LFHA 1XK6A 4NJEA 2FFQA 1YO6A 4KN6A 3D8HA 5ANRB 1UCFA 2V65A 3UAWA 3UJDA 4DLVA 1SUPA 2DWQA 2DUMA 1XZLA 4ERXA 2AYXA 3Q6MA 3MWLA 1MC1A 2WSSD 4RZQA 4ZVVA 5IUJC 4DIUA 3W0LB 4UOQA 1QWOA 3OCJA 4G5YA 4NESA 4BBJA 2J0QA 1X2BA 2XZLA 3AFOA 3LCCA 1DIAA 4LPSA 3OZGA 4FHEA 4IQGA 1XRSB 3H3JA 4Q3BA 5IBRA 4AKSA 3LUGA 1IPEA 3WE7A 2ZDHA 1ZEJA 3KKMA 4OHXA 1UANA 4Y1GA 5FYDA 3G9ZA 2BGRA 4Q1AA 2CLKB 2FZ5A 4DWWA 2YXDA 3H7AA 5ALTA 3NM5A 4U3JA 1CZKA 1TM3E 2W6IA 1UP7A 4YP5A 4AFNA 2E87A 5G1PA 2VPPA 4L3WA 1N2SA 1OSNA 4M1ZA 1RHKA 3WHIA 4B8YA 1MIOB 1Z6PA 2AV6A 3BE5A 3E58A 4OP3A 5LUBA 3ZXIA 1IWBB 1E6CA 3BORA 4ALMA 1RQNA 1FY2A 1J9EA 2FZCA 4YRPA 2MT9A 1MAHA 3RIGA 4UOZA 1KHHA 2QK4A 3MTQA 3PRJA 4LRXA 5J2TA 2ZTUA 2C82A 1V5WA 2ORED 1FDSA 2Q49A 3GC6A 4Q4HB 3QKSB 1QK4A 2CLIB 4QX6A 1QLJA 2IDKA 1DOHA 2P2ZA 3A1EA 4TRNA 3RNOA 7AT1A 1YNOA 2HJWA 1Z0SA 4DMUB 3C3WA 3UJPA 4Z9XA 4F56A 1Y89A 2ZCJA 3QOWA 4RGYA 1UC8A 3AK4A 3KYDB 2A9RA 3DLPX 1I7PA 3GU3A 1TF5A 3PD7A 2VSQA 1M9NA 2QZJA 3WJ7A 4BV9A 2BMEA 4DMCA 4JNKA 3SZLA 5BMOA 1A77A 4IQ0A 4RFLA 5LUAA 4MO9A 1W29A 4K7JA 4C6TB 1PL8A 2GJ9A 4GLJA 2YHUA 3JZDA 2O8DA 2GK3A 4M7WA 3OIWA 2ZQYA 2WWVD 1A9QA 3DEYX 1O5OA 1WNFA 3GAZA 5T4BA 2FW6A 3KU4A 2W2XA 1KKLA 1KVUA 2I3GA 1XZAA 1D04A 3O03A 1JZQA 3RBAA 5JSKA 4UHJA 1K7SN 2NO4A 1KP2A 3E5NA 2DQZA 4D79A 1SFRA 5FFNA 1QVRA 4KWIA 1TT7A 1MW9X 3MCWA 2E4WA 4WMLA 5E8RA 3EEOA 3O8OB 2QRJA 1B8UA 2W8BB 4MV1A 3N6XA 4YRIA 3THYB 1EDBA 2I76A 1J25A 3SOZA 4O3MA 1QO9A 1EJBA 3I34X 3RHFA 1NI5A 1K8ZB 4QO7A 3UPUA 3O95A 4D56A 1YK0A 1JKJA 1VJRA 3OSZA 1EBFA 3B52X 4MVJM 4QJIA 2XECA 4FEYA 4FR2A 4HAOA 4NU6A 1KZ9A 3LDGA 3GIWA 4PZCA 3WYCA 1L8LA 2W6NA 2A0KA 4EBBA 5IUNC 5U9CA 1ZVVA 4EUEA 2PX0A 5K0BA 1O6FA 2PHZA 1JI3A 1J09A 4NEQA 4MVWA 4RK1A 2XDQA 4X65B 1JG4A 1BFUA 1GZHB 2O2HA 4TTAA 3U7IA 2QMHA 3OO1A 1ZK1A 3K6SB 2RGNA 1QH0A 1DSSG 3PD0A 3DBRB 4W6ZA 4UMEA 4UOEA 1PS9A 1Z4JA 2WJYA 1V8PA 1UBNA 2Z8ZA 1QAMA 2PS0A 4LJSA 4LXXA 4KFUA 4H0CA 4NX2A 4BDSA 1Y8CA 3TQQA 3CO5A 4QASA 1VG8A 3HB5X 3FB1A 3T95A 3FVVA 1DC8A 1HTWA 2I4OA 3GJ8A 3EWSA 2XBUA 2JIOA 1LK7A 3EFOB 2FQQA 2VPTA 3AF1A 5FPSA 3WRWA 4HWOA 5IDYA 1U2EA 5G1OA 1KSGA 2YIVX 3EVNA 4NBLA 1M2GA 4IL5A 2AEFA 2A5DA 3SC4A 2WFMA 1AQLA 1O57A 4B80A 1FFDA 1WHSB 1K5GA 3KU1A 3QVSA 3W8FA 5K5EA 5LZ9A 4HZGA 4DZZA 5J2UF 4LZZA 4P31A 1EUDB 1NFRA 3HKCB 5EMHA 4DR3B 1KEVA 4MGHA 2PDAA 1DKQA 1HDXA 1KXZA 1KS9A 3GJRA 2QLLA 4OHPA 2D0PB 4RV9A 5JDIA 5K0ZA 3U4MA 3V4ZA 1FUEA 4TOIA 1BX3A 1OR8A 4GR9A 4S1WA 1SZPA 3HRIA 1ZW6A 1GNLA 1CJBA 2B5WA 3USCS 2JZCA 2XVXA 4OHKA 1WD7A 2C5LA 1U98A 2WD9A 1HC7A 1PSWA 4RJIA 4WW0A 4A8JC 1JFTA 1HLFA 1NSTA 3ZVKA 3U4QB 1ZD3A 5CDTA 1QG2A 1U1FA 3L02A 3HSYA 3CCBA 3KQUA 5KJFA 2VAWA 1MC5A 1UBUS 4W5TA 1FTNA 3M3DA 3HK2A 2IHVA 3K9HA 2GILA 3CUKA 3O31A 4LNUB 4D25A 2IUEA 3T54A 2V7WA 3TLGB 2XAUA 1JBQA 3ILVA 1C9JA 4Q9AA 4I55A 5KO2A 3N7AA 2BFOA 3GZJA 4I50F 4NFHA 1LSJA 4N1AA 5TT1A 1NQTA 2C8VA 3KKOA 1IZ8A 4RMHA 3U26A 2DFKB 4GL2A 5KWEA 4E5VA 2ACEA 1WHSA 5C35A 3UWOA 2FNAA 4B40A 2EFCB 1LNZA 1V3UA 3ETGA 1QPBA 1PNVA 1CQIB 3TLBA 1OAOA 3W2TA 1EQ2A 2GHIA 4W1SA 3TNLA 4NZNA 3D31A 1SBZA 2P65A 5A7HA 4ZYXA 3HL4A 4CQNA 2NZWA 5BPFA 5AXCA 1ZG3A 4G81A 4YK7A 2R65A 3P9PA 4K9KA 4MDEA 3L41A 1SUDA 1TD9A 1UR5A 4QEDA 3AVPA 4Z51A 5GIPE 1S3SA 3H5OA 1VMIA 1OFHA 4TQAA 4X60A 4M8LA 3ZGXA 1BKSB 3LDAA 5BOVA 3UUWA 4DYDA 5J59A 5AM3A 4G8DA 1R4NA 2LIVA 3GZTB 3PRKE 2Q3HA 4IXMA 1K8XB 1MFPA 3LDUA 1RT9A 3LO5A 1QKKA 3KOUA 3G2OA 4N03A 1DCMA 4RHYA 1EXMA 1N5JA 2F1JA 4U2KA 3DYIA 1AQJA 1IBMB 1UMKA 3ZNPA 3A6PC 1IN6A 2CXXA 1TD1A 3S7ZA 3KR9A 3MAGA 5CNMA 2J5QA 3HA3A 3B85A 3VZDA 1WEKA 2DE0X 3VZRA 3HZHA 3LPDA 4B9EA 1L5SA 5F52A 5TE9A 3D5TA 2DFNA 2Q9BA 5ISMA 4TYPA 2ORIA 2EU8A 2Q3JA 5BW8A 1CUWA 4FLMA 1ZGGA 3MQFA 1EFRA 1XNJA 2X0KA 2DQ4A 2WKSA 5M29A 2HMSA 2OYSA 3D6JA 1GZ3A 2FZWA 1K5DA 2YZ7A 1P1IA 2L42A 1EWTA 1OT5A 1PFKA 1SIUA 1SRRA 2CLEB 1WPRA 2R5NA 5I8ZA 2F00A 5ICFA 3UMRA 4A2QA 3EE6A 1UBHS 3UJ8A 2G1KA 1JDZA 2REBA 1G59A 4UHCA 4ZVQA 3STWA 4MS4B 1PFVA 3T3DA 4C4TA 3IILA 3GLUA 4R98A 4QARA 2R1UA 3W9YA 3QPUA 4BY9E 5JH7A 1C7RA 1JU9A 1VFPA 4DLRA 2VAXA 3B6IA 2R6R1 2RH5A 3GT7A 3Q3IA 4A2CA 4EITA 3R6LA 5DLQC 4LF4B 3LO8A 2XCLA 1QPGA 3WC4A 2YINC 3ORHA 3KEOA 4UC0A 5TQ2A 3TLYA 3K4PA 5EE3A 3L7MA 4K5QA 3JQAA 1W47A 2G1UA 3CBGA 4P53A 4DANA 2G5PA 2VAVA 4OMFG 4Q01A 2IUTA 2WSBA 1XRQA 2I6UA 2Q7OE 4E5YA 4F4JA 5J47A 1E9RA 1PUJA 2PSFA 3GFVA 4GG1A 3WVNA 1QRAA 3QG5A 4R2IA 4RANA 1PNTA 3ZIAA 4K05A 4MQFB 2F4VB 3ZX4A 1U8ZA 4RKFA 5EZ6B 4ZPJA 3P2EA 4CCYB 2TS1A 3MUOA 3VPSA 2YR0A 4M6WB 3TI7A 4MCIA 2EGHA 1OQAA 1BVYF 2CVZA 1PKEA 2XITA 3OQHA 2C3YA 3OA0A 2Y76A 2KBEA 2ZK7A 1L8OA 2PVCA 1BFKA 2JKVA 2A6PA 2PVPA 3OE1A 4IILA 2WYHA 5EJMA 2QQGA 1BDIA 3HLYA 1BS9A 1TZBA 3AB7A 3NB0A 4PG8A 1RLIA 3BCUA 3D3WA 3KSUA 2ZWMA 4EY5A 1UJBA 1FDUA 2HSJA 4UEQA 5ALXA 4E1BA 1CF4A 3ZIUA 4KWEA 1YRWA 2FKAA 5CLLA 2IK8A 3LF2A 4ZVMA 2C3UA 2NYRA 2WA2A 1OW3B 2HHLA 3BOSA 4MW6A 3SE7A 4ZI7F 2HIHA 4G1CA 4I1RA 2ACWA 2DUWA 4PFJA 1SN7A 4H1HA 4WJLA 4NH0A 4MYDA 4ZDKA 3T4PA 4W9RA 3JD0A 3C6XA 1GEGA 2AZXA 5FO0A 1C3XA 1EFAA 4MUJA 5DW0A 1T0HB 2FUCA 1J8YF 1SXPA 1M54A 2UVDA 1I10A 4EW1A 4MEBA 4I19A 2PFGA 1T9ZA 3ND5A 4JMPA 2OBBA 3NAQA 4GGPA 1PFUA 9LDTA 1OX6A 3FXAA 1EGHA 3JVEA 3NJ4A 3K0AB 3ILXA 4R0MA