2CL5A

Catechol-o-methyltransferase in complex with an inhibitor
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
214
structure length
214
Chain Sequence
GDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATECHOL O-METHYLTRANSFERASE
publication title Comparative Study of Ortho- and Meta-Nitrated Inhibitors of Catechol-O-Methyltransferase: Interactions with the Active Site and Regioselectivity of O-Methylation.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 81
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2006-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2cl5A00
3PVCA 5IH3A 2P40A 3FPFA 3FUUA 3LDFA 4QPNA 1ZKDA 4H0NA 3SM3A 5LQRA 4XCXA 1NW7A 2O05A 4FP9A 5DT2A 2OKCA 3OZRA 3LPMA 2P41A 4MQ4A 3IHTA 2GB4A 4HTFA 2EJTA 3KPUA 2JH8A 4GOND 3CC8A 4AUKA 3DUWA 5CCBA 1R74A 3C3YA 5G02A 2LD4A 5K0FA 2VDWA 3FYCA 2PT6A 3PTAA 5FWAA 4AZWA 2BM8A 2IGTA 4EKIA 4ER3A 2NP6A 2PGXA 2PXXA 1D2HA 1VBFA 5FADA 1JTFA 3UA4A 3HA3A 2EJUA 3G7UA 5FHRA 4C07A 2G70A 1X1CA 2QRVA 3BWBA 5EMKA 3DTNA 3HCEA 3VYWA 1QAOA 3FYDA 5E9WA 5LQNA 5K0JA 5D1NA 5EZSA 1MJFA 1T43A 5HIMA 1HMYA 2VDVE 1UIRA 3AJDA 4E33A 4GF5A 3AXTA 3GCZA 3C0KA 1EQAA 1VPTA 5JR3A 3TKAA 4OQEA 2PXCA 3WSTA 3LL7A 3TFWA 1NW8A 1P39A 4LWOA 4GUAA 3FTDA 5FCDA 3B89A 2FHPA 5ICEA 1R18A 4DA4A 5E1BA 2P3QA 3ER8A 5K0GA 1DL5A 3IYLW 1INLA 3SVZA 2CMHA 2ZIEA 2B2CA 5DM2A 2NP7A 1XCJA 3KPVA 4LWPA 1P91A 3X0DA 2OPBA 5K8VA 2P8JA 1TW2A 1ORHA 2ONYA 2PX2A 1NBHA 2ZTHA 2K4MA 5E1DA 3UWPA 3MCTA 4RTJA 4HSGA 3EMDA 5K0NA 3PX2A 4F84A 4HG2A 3PS9A 4ISCA 1NBIA 1KR5A 5CUQA 3D2LA 5BP7A 4F86A 3T7TA 2IH2A 1EG2A 3A4TA 2QM3A 2G8NA 1JQ3A 2UYCA 1KP9A 1NV8A 5DTRA 1IM8A 2ZIFA 3GO4A 1Y8CA 3P2EA 4DM3A 1FP1D 1QAMA 3GNLA 3P2KA 3PX3A 1ORIA 2ZLBA 3LBYA 5CVUA 5HFJA 2NXEA 3EVZA 1KXZA 4UOEA 2GH1A 5EOVA 1UWVA 3DMGA 1YFLA 4R8SA 3DMHA 3PFHA 2C7OA 2OZVA 2AOVA 1VP3A 4A6EA 4HGZA 3KPJA 4FSDA 3FTEA 3A25A 1QAQA 1RJGA 1MHTA 3KU1A 4BLUA 1N7JA 2PT9A 4IV0A 1L3IA 3AY0A 4L7VA 4U7PB 3FPJA 1NKVA 3EMBA 5ICFA 3MTEA 3R24A 2DULA 3GWZA 3UJBA 1XVAA 3OU2A 3NW9A 4QVKA 3C6MA 3R6TA 4DMGA 3DMFA 2I6GA 3GIWA 3A27A 3I5UA 4RVHA 3UJ6A 5KYGA 2AN3A 3T7SA 4OX9Y 4YMGA 2ORED 3BXOA 4G56A 3G2QA 3UJDA 3GJYA 1D2GA 1SKMA 4WVLA 5KVAA 2ESRA 1F38A 1QYRA 5LQJA 3MB5A 4AZVA 3KR0A 4LG1A 3I9FA 5DM4A 1EAMA 1Q0TA 4DCMA 2Z6QA 2ZWVA 1RI1A 4FR0A 2N47A 4HC4A 5CCXA 1ZGAA 4GBED 3ID6C 3EVGA 3NDIA 2EX4A 4PIPA 5HIJA 1VP9A 3RW9A 3S68A 4E2YA 4M36A 1G8SA 3LDGA 3MTIA 4C04A 4DF3A 3FRIA 5EKXA 2IDKA 1X19A 3CCFA 3DLIA 3HCDA 2GS9A 5B1SA 3P71T 5HOQA 3P97A 1D2CA 2AN5A 3NJRA 2VZ9A 3R3HA 4V0RA 2Q41A 5DTQA 5D1HA 4PCAA 1KHHA 1PRYA 2BR4A 2A14A 4PGGA 5P8WA 4OBXA 3IV6A 2GA9A 5GP1A 3VC2A 3ELDA 5GINE 3SR4A 3T7RA 4XUDA 2B9EA 2V7EA 3GDHA 3NDJA 1XCLA 2CWWA 4FZVA 5EZQA 4WXHA 3TPZA 3AWIA 3DH0A 4KRGA 5EEGA 1BC5A 1UFKA 4O29A 4RTSA 1G38A 3ELWA 3MCZA 3BZBA 4E2XA 4RVFA 4EKGA 5GIPE 1SUSA 2GLUA 5ERGB 3SSMA 4YV2A 1JG2A 2OY0A 1JG1A 4PYMA 1L3CA 3UJCA 2AZTA 2R6ZA 4RV9A 2YX1A 3MGGA 3MQ2A 3KQWA 3EGVA 3OU6A 2AOTB 4PINA 4QPPA 5K0CA 5EKUA 2OB2A 3THRA 2XVAA 3OFKA 3LCVB 4ZTBA 4C03A 4EVIA 1JG4A 3P8ZA 3BWCA 1ZGJA 1NT2A 2AOUB 5DWQA 1ZHFA 4QQNA 2XYVA 2JH9A 2QY6A 3P9NA 5KQRA 1RI4A 2NYUA 3G8AA 3LECA 4PYOA 2GPYA 3G89A 5M5BA 3JWHA 2YXDA 2WA2A 3FPGA 3A26A 3NWEA 2I7CA 3CBGA 1JSXA 2YUIA 3ORHA 5DRYA 5HIKA 4IKPA 3TMAA 4E70A 4X60A 1KPGA 1O9GA 4MHTA 3GRUA 2OXTA 3KQTA 1NV9A 1JQEA 2ZW9A 3G2OA 4IV8A 3LCUA 1QZZA 1YFJA 3R0QA 2PX5A 3OZSA 3TOSA 2IP2A 4R8RA 3LHDA 2ZZKA 3FPHA 1YF3A 4BP1A 4E30A 4R05A 2YXLA 5CM2Z 5DSXA 5FQNA 5CD1A 4ER7A 4MWZA 1DCTA 1EIZA 2AOWA 1I4WA 2E5WA 3HCAA 3MAGA 2VDUE 2JJQA 4PYJA 4YV1A 3RIEA 2ERCA 1X1AA 5C1IA 1EJ0A 2BM9A 4C4AA 2AN4A 3BGDA 1SUIA 2IIPA 4PCLA 2HV9A 2O07A 4P58A 5DXAA 2PY6A 2P35A 3TQSA 3PB3A 4C05A 3H2BA 5F2KA 5H02A 4Y30A 5K0EA 3TLJA 1OR8A 2AVNA 2CKDA 4PONA 5BW4A 4KIFA 1R00A 5C9ZA 1M6EX 4PYQA 2KW5A 5E9QA 3SSOA 5LSAA 1IY9A 2PBFA 2YQZA 2UYHA 3C6KA 5KQSA 2ZBPA 5IKMA 1JR4A 3NWBA 1M0EA 5BXYA 5EPEA 2AOTA 4RWZA 2ONZA 2C7PA 3R9XB 4QQKA 4Z2YA 3GRVA 2HMYB 5DM1A 4PNEA 3B7PA 3OFJA 2AOUA 5K0BA 2OYRA 4EQZA 4QDKA 5E1OA 4ER0A 1FP2A 3G5TA 3LGAA 1NW3A 2F8LA 5LQKA 4FT4A 3OU7A 2ZSUA 4X41A 5DTMA 5DSTA 3PT9A 1RI5A 3FUVA 1WY7A 4MIKA 2I9KA 3EPPA 5F2NA 4DZRA 2C7RA 2PX8A 3ER9A 3NVMB 1B42A 3UJAA 2H00A 3Q7EA 3SX0A 3UJ8A 2G71A 4X61A 5LR6A 3VSEA 4CTJA 3KQVA 3T0IA 1DUSA 2NXNA 5EG5A 5GM2A 3OE4A 3AXSA 1R6AA 2P1DA 2QE6A 1X1BA 2YVLA 3SXJA 5BW5A 1KYWA 3ANXA 2PKWA 3DP7A 1U2ZA 3L8DA 5EIWA 3C3PA 3HEMA 3QOXA 2UZ4A 5EVJA 1VQ1A 4GQBA 2WA1A 4PYIA 5F2OA 2HNKA 4FSXA 5FWDA 4R6XA 4YUWA 1H1DA 3DLCA 4RTMA 1JG3A 2P7HA 5CVJA 3GRYA 1YUBA 3E05A 3ELUA 2YXEA 5CVVA 5HILA 2HTEA 3HVJA 3B5IA 2H1RA 3EGEA 3Q87B 3GRRA 4OA5A 4ATNA 4POOA 2CMGA 5K01A 3HM2A 5EMJA 5T64A 1YB2A 3E23A 1SQFA 1XDZA 3F4KA 5GOZA 5U4XA 3B3GA 1WZNA 4XUCA 2B3TA 4JXJA 2Z6AA 3BKXA 5DM0A 2O0LA 3UA3A 3G88A 2PWPA 3E8SA 5C0OE 4HRAA 2EG5A 3GGDA 2FCAA 2JG3A 2QRVB 3V8VA 2HWKA 1P1BA 8MHTA 2O57A 3EEOA 5EC8A 1XXLA 3TR6A 3PFGA 4GEKA 4F85A 2JHAA 4YUYA 5JUWA 7MHTA 1O9HA 4K6MA 3LX6A 2AS0A 1G8AA 1KPHA 2HR1A 1Q0SA 1I9GA 3ME5A 4YUXA 5K09A 3M4XA 3QV2A 2IFTA 3BT7A 3G2PA 1VL5A 3CKKA 4E32A 5MHTA 1L9KA 2B25A 5ICCA 2I62A 3OE5A 1KPIA 5FTWA 5CIYA 5EIFA 1KIAA 5DX8A 5EQJB 3ERCA 1L3BA 4PYNA 3JWIA 1RJFA 3LKZA 4MTLA 1VIDA 4RX1A 2CL5A 1BKYA 5K0LA 1P1CA 3DXZA 2AR0A 2XVMA 4RVDA 1L1EA 4AZSA 1FBNA 3DXYA 4QTUB 2Y1XA 1QANA 5HIIA 2IH4A 2YTZA 4M37A 3P2IA 4DQ0A 2PLWA 4CWAA 3SMQA 4BLWA 4EMSA 2O06A 3EVBA 4RTQA 1KYZA 4PYKA 1JTEA 3GRZA 3THSA 4C08A 4CKEA 3B3JA 1AF7A 1Z3CA 4BY9E 1SQGA 3FTCA 2AVDA 2AOXA 5LQCA 4HGYA 2BZGA 3EVCA 5DLYA 1JQDA 4E31A 4U7TB 2BH2A 3HVHA 1XDUA 2ZWAA 1AQIA 4IWNA 3P9IA 1G6Q1 3KKZA 1XTPA 3O4FA 4RTKA 1EJ6A 3I64A 2V74B 3HA7A 5LQAA 3BKWA 1RJDA 1WXXA 3EVEA 3KR2A 5DX1A 5DRTA 4QVGA 5EHIA 3HVIA 1M6YA 3A7DA 2UYQA 2ZZMA 4P7GA 2UYOA 3JWGA 4KDRA 5FULA 1VLMA 4X63A 3LCCA 3HCFA 3IEIA 3HTXA 3M6WA 1RJEA 2Z6UA 2P3LA 2PJDA 4OBWA 5FA5A 2G1PA 2XYQA 4RYLA 2JHCA 2VP3A 4OA8A 3CJQA 3NTVA 5K03A 5EMLA 4FS8A 1RI3A 3EGIA 2OO3A 3CGGA 3LBFA 3M6XA 4AX8A 3KQYA 4QDJA 5FHQA 5E9JA 3TKYA 2H11A 3ELYA 3EVFA 4BLVA 4RTNA 3FUTA 5CVDA 3GXOA 1XDSA 3K6RA 3KR9A 4V0QA 1ZQ9A 3E7PA 3UBTA 2Y1WA 2ZBRA 4P7JA 1JSZA 5HZMA 2FK7A 3G5LA 1G60A 2OB1A 3KQQA 4GOMD 5E2AA 3CVOA 3UZUA 4AZTA 5E2BA 4C06A 4CKBA 2XYRA 4E2WA 5E8RA 3SGLA 1N2XA 3VC1A 1FJXA 4BP3A 2XBMA 4KWCA 4YV0A 5E1MA 5FQOA 3EEYA 2PV0A 3M6VA 4ER5A 2BR3A 5FUBA 5LQUA 3I53A 5ICGA 2IH5A 3FUWA 3M70A 1R8YA 4LECA 9MHTA 3V97A 4GC5A 3B3FA 1PJZA 3EVAA 3SSNA 3MHTA 1BOOA 1R8XA 3CJTA 2ZIGA 5HEKA 4RTLA 1AV6A 3M6UA 4ER6A 2ZFUA 3BGIA 4PIMA 3OZTA 3KPWA 4YUVA 4Y2HA 3K0BA 4M7RA 4A6DA 4XUEA 2FPOA 3HVKA 5EMMA 1YZHA 1WG8A 5FA8A 2QYOA 3RODA 3KQMA 1WXWA 3FRHA 3G2MA 3TM5A 1XJ5A 2NXJA 2PWYA 2ZZNA 3NMUF 1O54A 2P3OA 3HP7A 5GM1A 2JHPA 4KDCA 3BGVA 2OBFA 3A7EA 1AQJA 1RI2A 2ZULA 2ZBQA 4CKCA 2DPMA 1HNNA 2G72A 5T6BA 3DXXA 3DOUA 5EEHA 1VE3A 5GIOE 3PLAE 2PVCA 3GU3A 1YZ3A 3HNRA 4HTFB 4KVZA 4B17A 2PXAA 3G8BA 3DR5A 5E8JA 5EHGA 1F3LA 1X1DA 2FRXA 3JWJA 1IXKA 2NXCA 3P9CA 4M38A 4OQDA 1BHJA 3MERA 3TM4A 4PYLA 4RVGA 1SVUA 1N7IA 3EVDA 3UJ7A 4YMHA 4CXMA 2IBSA 4DCGA 3KQOA 2WK1A 1ZG3A 4X1OA 3FUXA 1NW5A 3HCBA 2PX4A 3OCJA 5EGSA 4QTTB 2ZVJA 5DX0A 4GC9A 2C7QA 4NECA 2FK8A 3LSTA 4PWYA 4YUZA 4CTKA 3KHKA 1TPYA 2YR0A 3BWYA 3CJRA 3M33A 3KPYA 3KR1A 4GOOD 4PGHA 4RSRA 1TW3A 3P9KA 5DXJA 3REOA 3UFBA 4RTPA 4KW7A 4FGZA 2R3SA 4HH4A 3U81A 5K05A 4GOLD 2ADMA 5KS2A 2VS1A 3QOWA 4EK9A 4FT2A 2IBTA 5CVEA 5DPMA 3FTFA 3FZGA 3HCCA 2EFJA 1V39A 2GAFA 4P7FA 3HA5A 2B78A 3KQSA 2NNWB 3O31A 10MHA 2IDJA 1I1NA 3KQPA 2BR5A 1G55A 1FPQA 1WS6A 3BWMA 2P7IA 3LKDA 3TRKA 4KIGA 1NW6A 2PSSA 4RTOA 2ZCJA 2IPXA 4DKJA 4RTRA 3NVKI 3OPNA 4P7KA 4E2ZA 3UJ9A 4R6WA 5GWXA 1NE2A 3BUSA 1SG9A 3I58A 2FYTA 5T67A 3DULA 3O7WA 3FPEA 3LDUA
chains in the Genus database with same CATH superfamily
1UPFA 2OLJA 4J3FA 4IIXA 5A3VA 1QC5A 2PUVA 3HGQA 5LLSA 4ZJPA 3ZY2A 4ZCTA 1GL6A 1PR9A 5BWMA 2LDBA 4GPD1 1EVYA 1RKUA 4B31A 4KIUA 1S8AA 2W22A 3HKBB 3IKMB 4X3OA 1V45E 3TK1A 5JFOA 3IBGA 3CC8A 3T1OA 4AUKA 1GPLA 2QU8A 2OFPA 4PZUA 4YP7A 4C30A 3FYCA 1D4FA 1WUKS 3HWWA 4DCSA 4EJMA 4JN6B 4B81A 1RKVA 5I3CA 5GV8A 1WOMA 3HA3A 4N5HX 1KR2A 1F8FA 4M0PA 5CFPA 1UBLS 3S70A 2LRHA 3BILA 3EDCA 3QWIA 5K0JA 1VE7A 1JHPA 4CYMA 1NMEA 2RG7A 3FOCA 1B15A 2XGMA 2FKNA 4FDAA 3F47A 4RK7A 3UT5B 5MN5A 4H7EA 1DAHA 4B8ZA 3A1WA 1BQ3A 3Q9UA 5JAHA 1L4MA 2VF5X 5D01A 1R18A 1C2TA 1XYGA 1ZVMA 3LFUA 4ZOLB 5BOSB 1FU8A 3PWTA 4N5DA 1IULA 2Z5GA 2NSHA 3U4IA 4V0LA 2NP7A 2IY9A 4PQGA 3E9EA 1JPJA 4FE3A 3VM6A 3I2FA 4FFWA 2VF4X 4O5OA 2QL5A 5K0NA 3WIDA 4LNHA 4HDOB 1V11A 4EITA 4Z4HA 2QNBA 1R8QA 3LQ4A 3S8MA 3HO1A 3QE3A 4BB0A 3IBCA 1MOPA 3D31A 4S0ZA 1T1GA 2XUZA 2GZ2A 3F6CA 4N49A 5F35A 4ARBA 2JHGA 1NVGA 4HLDA 1DPGA 4Z9YA 3KZCA 2P0YA 3IUPA 5EJEA 4QGAA 2CZQA 4BFVA 3P0HA 3DLHA 4WECA 2RK3A 2O8EA 4YUAA 4BNKA 1ECLA 4B9AA 3QVOA 3EARA 2WI8A 1WEHA 3GUHA 4YYZA 5A4MS 1QP7A 4ZCMA 2R6GA 3NGLA 4JODA 5EMNA 1ODLA 2FX2A 4OIMA 4F5DA 1U31A 4EUHA 2NG1A 4DT1A 4E1AA 1L3IA 1VZ3A 3R77A 5CITA 1KRHA 1VPLA 1JDNA 2AZ4A 1D8AA 2CBGA 2QM0A 3KL4A 4H17A 4IUBS 1AT1A 4IQ4A 4X9XA 5FOTA 1FQKA 2VNHA 1KEEB 1L1QA 4MR8A 1SURA 5EQTA 4PPNA 4E3WA 1ENOA 2I2DA 3C97A 2QLLA 2DZDA 1L4EA 1PV1A 4GXTA 2DFVA 2PYDA 1G7SA 2OOSA 3SKVA 2EIHA 1P9WA 4X7PA 5C7OO 4RVHA 4DIEA 3KSUA 1I7QB 1T3GA 2V8OA 4IM7A 4XQGA 5KUTA 4PBSA 4Z9XA 4URWR 2WDPA 3DAOA 3U3XA 3NHWA 1AX9A 1G7TA 2JLRA 1DLIA 1N3YA 2VDQB 2G17A 3W5VA 4QLOA 2WG0A 3RADC 1PV2A 1OU4A 4HWRA 4YK7A 4TTTS 1XZDA 4ZT3A 3T9DA 3ZHUA 2IZ7A 3L7KA 4V1CB 3NBXX 2B34A 1G8SA 3QGMA 1XCPA 1FZTA 3PQ4A 7GPBA 1E6MA 4YLEA 1Q95A 3PUIA 3T9BA 2GS9A 4Z4GA 4BQEA 2P9ZA 1G6HA 1NOIA 2F3UA 1GYPA 2E55A 2W5UA 3K09A 3K1JA 3NALA 1OH7A 2I76A 4LZWA 3NRCA 1QK3A 4DKXA 1P75A 5BV0A 1ZJ6A 1T8TA 4BDTA 2AJLI 2J8ZA 4LZZA 3AEUA 4P4SA 1QH1B 3RC2A 5EZ5A 2E9SA 3L5KA 3V4VB 1T8UA 3VC2A 1PEYA 3SR4A 4BO0A 3T7RA 4DVJA 2XCRB 1KY5A 1QB8A 1JDSA 1ZC3A 2G0AA 1OVMA 2GAAA 1EJ2A 3GDHA 2EKLA 2GOYA 1I10A 3F7NA 3MAJA 1T29A 3OLQA 4MR7A 1A7AA 4BNGA 4RLFA 2AI1A 3FHOA 1WLSA 4Q16A 3ABOB 4RDCA 7MDHA 2C3UA 4MW9A 1M8FA 3G17A 4Z7NB 5C53B 5G4LA 1U3VA 2IHNA 2SCUB 1PJ3A 2VHQA 2Y76A 3UF0A 4ZV4A 4N0QA 5T57A 4KLZA 5CG2A 5F7ZA 4DSUA 2G04A 2WMYA 4OB6A 2QENA 4K6OA 2FLKA 3D7MA 4RELA 1YZNA 3OKFA 5AJZA 2IYRA 3F3KA 5HMLA 1FNDA 1HEUA 1VBKA 4RFSB 2VNJA 5EKSA 2Z83A 2EGHA 2VOEA 1X1QA 1JIXA 2P11A 2JBWA 3ABZA 3IQXA 2MSDB 4KR0A 4OJMX 5ALLA 5F4ZA 2X7JA 4C1NA 4WHMA 5A02A 2H1OA 5D5HA 1M5UA 2GK3A 3GHHA 4JD5A 4IWYA 4OQYA 1BOFA 2HOQA 5EJ8A 2WHEA 4K46A 1GCUA 4W5NA 4EGFA 4K7JA 1T9ZA 2HQRA 4GLOA 2O8BB 1KYVA 3L6CA 1B2RA 2YVQA 3UV7A 5K8UA 1UBNA 4WLVA 3P20A 4KR3A 3JRNA 4ZAXA 5F12A 1NW4A 4K03A 1YXMA 3GRUA 2GEKA 2YMLA 4M6WA 2IYOA 3GAZA 3MT7A 3DV0B 4M53A 2XQVA 1Z6YA 3FFWA 3N2GA 4AO7A 4G9EA 1B4DA 4YGYA 3ZC3A 1A4IA 3DE2X 5A1TA 1U7DA 3C7AA 3IUBA 4LVUA 3BOSA 2DHCA 2E85A 2QRUA 2D62A 3PPVA 4R5MA 5HKLA 4CR8A 4NZZA 1FX1A 4S12A 5EFZA 1KZ1A 1BEEA 5CM2Z 3U4CA 1HG1A 4MAMA 3LY9A 2ODQA 1HE2A 3T99A 3ANYB 1KJJA 4YX9A 5B6IA 1W6UA 4ZAVA 4R1PA 1MN6A 4UBMA 3FOFC 3I5XA 4BEWA 4DIDA 4FKBA 4QXRA 4DG9A 2WNSA 5ARCA 1E1QD 3AFMA 5JADA 3JWPA 3G2HA 3BIJA 3TB6A 4ZK6A 1N36B 4C7BA 3AL3A 5DXAA 2B1GA 1FFBA 1I6WA 2EZ8A 5KNCH 5LP6B 4MKZA 2XOEA 4NZ9A 4EKGA 3SKYA 4R2WA 1VHDA 1R00A 2I4MA 3HR7A 3KAPA 3NBAA 4U9UA 3DO8A 5KKAA 3Q88A 1QCCA 3OOWA 2B7LA 3LW7A 4O8CA 5EWJA 1QUFA 1BS1A 2MSWA 5IN5A 3BXXA 4KO8A 2IIBA 5IKMA 5I7OA 2AC2A 1D1TA 2D1TA 4Y1RA 3RFXA 5ALNA 2VUSA 5BW8A 4RWZA 3WK9A 3BK1A 3GB9A 3IBTA 1WXEA 3CWQA 4BMSA 1V41E 3QBJA 4OB8A 1YR2A 1JEEA 1JZQA 2DKOA 4Q4LA 1N8KA 5E1OA 4D92A 2G1UA 3S7TA 4Q7KA 2Q8QA 1VKRA 4QG7A 4XWYA 2HJRA 4GX5A 5IYZF 1F48A 1N3BA 4V02A 5EQFA 2MYUA 2J5QA 5CFRA 1O95C 1G0OA 1IIRA 3QPUA 1NN3A 1KF0A 3SYKA 3IBFA 1AZLA 1IWOA 1VTKA 3K3PA 4IRUB 5ADUS 1NU8A 2H00A 3KK0A 3QPBA 1XTSA 3MMZA 4G1VA 3I05A 4J76A 4Z3KA 1P0FA 3QPCA 1YA4A 2CXTA 5BN4A 1T6NA 2CEKA 2Z5VA 3PQEA 4MS3A 1AGNA 1C9MA 2C2XA 2FZKA 2YS7A 3F3SA 3I01M 2ZJBA 3L8DA 3N2NA 4BFYA 4QYTA 3PGVA 4KSCA 2D74A 1JAIA 2VYFA 1KVRA 4DANA 2HGSA 1C8BA 2TSYB 1E1CB 2BBOA 1RZRA 1JFTA 4IDHA 3FKSD 3HGMA 3OM1A 3ZVKA 4P0PB 1VIMA 2QORA 1K27A 3OJCA 3E9NA 3IHLA 3W4JA 1VI6A 3SBDA 1JG3A 2ENUA 1A9XA 3TZLA 4BAZA 2R1VA 2ZYWX 5SY9A 3B20A 4FLEA 2H1RA 4W5OA 1J9GA 4JHXA 4POOA 2ZSKA 3O4IA 5CLFA 3D7RA 5EMJA 1KIFA 3VYTB 3I8XA 3W5IA 3O4HA 3BWDD 1NBEA 1E99A 5DK6A 1J22A 5GOZA 4BN0A 1K7CA 4MPPA 3LPLA 4RM2A 3BREA 1V47A 2DM6A 3JQ9A 3LX4A 2EG5A 3TFQA 7ABPA 2GCGA 1JHDA 4GX2A 4OQFA 4AMUA 4MLDA 3HJAA 3V8VA 1R5JA 4G26A 5ADWA 3R9XA 2GLXA 2DJ5A 5H59A 1T9HA 3WIUA 4J4TA 2HIGA 4XE5A 4Y98A 3PUXA 1XNHA 2WD7A 3BVPA 4GRDA 4H3VA 1MEEA 3JX9A 1ZMRA 3PRJA 4REQA 3UJPA 4X97A 1GZDA 1JDTA 2X4GA 3R3SA 3HKDB 5KC9A 5D51S 1OLXB 4GDMA 4JBIA 3RH0A 5HF9A 1UFRA 2EAUA 2PYZA 1E79D 3K5WA 4MUIA 5TQ0B 1EEXB 4AW9A 3QJ5A 2FSGA 4LXYA 5EQJB 3E3LA 4XWAA 2F2TA 1TK2A 3JWIA 1TJYA 1NNLA 3LRTA 5EPOA 3C4QA 1E0JA 4KAAA 3WR5A 6PFKA 4Y2PA 1ESCA 4ZOCA 1Y9EA 4ZXFA 4PG5A 1WMDA 5A62A 2ZJYA 5IANA 1RHKA 4O25A 4YRSA 1HFJA 1YRWA 2CXNA 3PKZA 1ZM2A 3RIMA 2FSPA 1WBBA 1JKMA 4RTQA 3EVBA 3LW8A 3M9LA 1KYZA 1EE9A 2C42A 1MOZA 3IPRA 3ORQA 4GNKA 4PRLA 4RKWA 3SS8A 1AF7A 4AJ2A 1SQGA 4O4HA 3VHXA 1QMPA 1I7DA 5JJIA 4QXMA 1I2BA 1MDBA 3OT5A 3M1LA 4HGYA 4CGZA 3TLBA 1C7QA 2ZWAA 3NH6A 2YH2A 5J2UA 3K9GA 4BKUA 4UFPA 1QIDA 2DKFA 3F1LA 4YAJA 4ZCLA 1GAEO 1EJ6A 3I64A 1B7GO 2GN1A 4I5GA 2GLTA 1HK7A 2V74B 3D8TA 2I6SA 4KE8A 1N0WA 1WXXA 2JGDA 4KEAA 4QVGA 2WZCA 4WRRA 3GAAA 1ZICA 4OAPA 1XDDA 5JD5A 2X4DA 4C0KA 4X63A 4D99A 1CV2A 4Y7DA 4EUFA 3ASVA 2DG2A 4KQCA 4WN9B 2AE2A 1WRBA 3ZUPA 5HS6A 3MQFA 5FLEX 2OHVA 2VRCD 3JD1A 3SLRA 4PVDA 4D8UA 2QTLA 4B75A 4TKUB 1QH8B 1RQGA 2QNIA 4BE7B 1E6LA 4YMUA 2F4VB 3QZUA 4FGKA 3W6PA 5E9AA 2G9RA 2WHRA 5F9MA 5FHQA 1NN5A 2PM8A 8ABPA 4R8LA 3SP1A 4H4DA 3AZQA 4U6QA 2C2WA 5I5GA 4AYWA 3QVXA 1EA5A 4LHEA 1ACLA 2DFDA 2ZB7A 2NUAB 2QMQA 4RGVA 4Z0TA 2Q3BA 3UAZA 3V4RA 2BMEA 1C4OA 4UM5A 3GLHA 2DHEA 3KQQA 3PFWO 4G4SO 4WXMA 3NHAA 3RAEC 3FF1A 1BW9B 1KSJA 5E2BA 1SEVA 5K8JB 3ND6A 2VDPB 2WR8A 4HJRA 1Z07A 3VC3A 3CLSD 4U7FA 4OF4A 1R12A 4PSKA 3B1KA 4WT7A 5K3DA 5B4TA 1C50A 1N2IA 2IJGX 2BELA 2NPIA 1YCHA 3BXFA 3AEKA 3FCCA 3ADDA 4J0EA 1O87A 2ZRIA 4MLPA 1KY3A 1KFCB 5KZMB 1QCDA 4JUIA 3MRXA 4KAJA 4LECA 5KX5B 2KYRA 2BJWA 3A0RB 1W581 1AC5A 3LWDA 3RUAA 1JJFA 3OKPA 4FEYA 2RCYA 3T4PA 2F3QA 2H92A 3AT1A 1T26A 1TA0A 3UO8B 5KU1A 3FPBA 3D8BA 1N75A 1T8SA 2OUKA 2OORA 2Q9BA 4BE4A 3DVAA 2RDMA 2WG2A 3RCBA 4F4IA 1MH9A 1RZUA 3GFQA 2HJ9A 3TM5A 2W2OA 1VJ1A 1FMLA 5HQTA 3P9PA 3PV0A 4E1VA 4RSHA 4YJFB 5IC4A 4C2TA 4BO9A 2UXBB 2XMRA 5AKJA 3ZN2A 3AJ8A 5JTTA 1KMQA 4HAUA 1H2FA 3N2LA 5C8VA 4PCVA 3DCYA 3TX6A 3T5GA 4DLKA 4LJ4A 1TO1E 5MGNA 1QV6A 4FDLA 3PNBA 1RBZA 1TYBE 2PWBA 3CX6A 2NTEA 3PXEA 3K0EA 4Y9RA 2IEBA 4A5SA 1ONPA 1Y82A 2J7PD 3QXGA 4GHWA 3WXMA 3K0AA 5I9IA 5HNKA 1BO6A 1KMCA 1I1HA 2OCAA 1P2BA 1IUPA 4J29A 2HDHA 3RGGA 3AF1A 5ALWA 2XVXA 2MSLA 1W44A 2FQXA 2P0AA 4E21A 3KOXA 4MW7A 3KZMA 3HI4A 1VYTA 3VR6D 3ZHXA 2WJZB 4PX9A 4FQ7A 2XOKA 1F06A 1X13A 3CR3C 2FWIA 3C7DB 1TPYA 2YR0A 3NRJA 2O52A 1V4VA 4P80A 1X14A 4RSRA 3RS7A 1XEWX 1V8PA 2PMEA 3UFBA 4RJTA 3WV5A 3CNBA 3GDGA 5K05A 3DT8A 1XZKA 4UNPA 3TI9A 2B2NA 3GLSA 4R3NA 4UHKA 5KTTA 1DAOA 5CVEA 4BASA 3ZHZA 2L0XA 1NX6A 1FQOA 4LVCA 4NE2A 2TMYA 621PA 2IYUA 1U4NA 4PLVA 1KAGA 4FOSA 3DOEA 1VRCA 2XA1A 4A8JA 1XKQA 1YU9A 3H9CA 2HTFA 3G0OA 4ZVRA 1P8JA 5JG7A 3X44A 4C0HA 2C4KA 4MVJI 4E2ZA 1QKIA 4F93B 2CE7A 5TPWA 1K2WA 5AIBA 2AFHB 1VG0B 5HF8A 1KJIA 3ZDRA 2CCGA 3D7NA 3LDUA 4KB5A 4R1NA 2DPHA 3EH1A 2VNSA 1FVXA 3PVCA 4MSUA 2ANBA 3LDFA 3R8FA 4JI7B 2ECKA 3OI7A 2R65A 2VJBA 2WINI 4XCXA 3AJ9A 3V5NA 1TMKA 4RKYA 4KCGA 2NLOA 4RIHA 2H57A 2X9VA 2GB4A 4KO3S 2EJTA 1TZKA 1YHYA 4FEEA 3BL5A 4QHTA 4RF5A 2WWTA 3JQBA 3VZCA 2G88A 4Q0MA 1JI3A 1OFUX 3B3AA 3I2KA 4LRUA 3O2QB 1GZUA 1QRDA 2I8CA 4OSOA 2W90A 1EFDN 3F98A 1V4NA 1G4AE 1GN8A 1WMFA 3CEMA 3DTNA 3KXLA 2BIFA 4GG1A 3VYWA 1JVSA 1GA6A 5HF6A 4J91A 5D1NA 4PFSA 1S1MA 3E5HA 3QBTA 3HBNA 4LBWA 5FLXA 3ZGZA 3C6ZA 1EQAA 1UWKA 1RCUA 4OQEA 5CXUA 1NWCA 4L1KA 3VSDA 1Y9DA 4LWOA 1WHSA 4X8MA 3RRMA 3UB3A 3QF7A 4KKXB 2FMKA 3CNQS 4JSRA 3RNOA 3OEED 1DTSA 2XA2A 4J9UE 3SEZA 2W71A 3L8FA 1W19A 3MMPA 4RS4A 2TECE 3LZ6A 3DE4X 3BTSA 4PRYA 4RDHA 3RAFC 2DTEA 4O2BB 3WWYA 3THXA 4ABTA 1MRZA 1IY8A 3I3OA 1PLKA 1E2QA 1VL8A 2P8JA 4JBXA 1VMAA 4YO8A 3ROGA 2X3FA 4DYVA 5IJ0B 3VNSA 4IINA 2HI0A 2NADA 2WQZA 3KFVA 3FN4A 3RC1A 5CU7A 3PC8A 3KEMA 4F86A 2C57A 1F20A 4WGFA 3KAKA 3LDAA 4F3RA 2VXYA 3KRTA 1Z38A 4AJPA 2OQIA 3UC5A 1AZSC 1ZONA 2X14A 3PX3A 5CT6A 4ZU6X 2IHBA 1NMQA 2FA9A 4J16A 5CVUA 4ZI7F 1PFQA 3KWJA 3EVZA 3LF2A 5AM0A 2JLVA 5FBWB 3LX5A 4I3GA 5EOVA 2VHWA 1NPDA 3ZJ4A 2OO5C 3CVYA 1W49A 1ZNQO 1KA9H 1PWYE 2P2YA 1QU3A 4QDXA 1TL7C 1YE8A 2ZIUB 3GA0A 2C7OA 3GVCA 2GCEA 4MWOA 3SFZA 4AKSA 2P4UA 3AOEA 3KEOA 4EY3A 2B4QA 4XX0A 3ZXXA 4QUDA 1RJGA 4EB3A 1GDTA 4AJ1A 5B3KA 4FK8A 3PGA1 1QVVA 5J4HA 1JE1A 1U7HA 3R3YA 4ARUA 1B0UA 4CMHA 1XPOA 1NKVA 2VSQA 4MXDA 2XXAB 3R24A 1IEWA 5DMXA 2FPMA 1U0SY 4XDGA 5BN3B 2O50A 2ZPUA 1TCUA 2NTNA 4G9BA 1N77A 5FDFA 3B52X 2JLAA 3CUSA 2FZCA 3WK6A 2G9QA 1V6CA 1YNOA 4OGFA 1T9DA 3C3DA 3CTMA 4RYDA 5ALEA 2GZRA 2W6IA 3BXOA 3S2EA 1UIMA 3G2QA 4FOLA 4Y2YA 4YMGA 3BXEA 1Y7HA 1XQVA 4FIDA 4IEFB 4JP3A 5CG1A 3WNVA 3ZX4A 1T5TA 1Q14A 1LU9A 2BDTA 3NONA 3QX9A 1V8OA 3DC2A 3RRXA 3AVYA 2DFLA 3WB9A 3ZHVA 3QQPA 2QTMA 1QS0A 1GRVA 1LVUA 4RLQA 3IJPA 2ARKA 1ZGAA 3JU3A 3NBYC 4GRIA 4LS3A 5FJIA 2ONJA 1X2EA 2E1PA 2O2GA 4GBGA 4E2YA 3E03A 3GA5A 3KAQA 4P4TA 1RM3A 4KQWA 4XOUA 2QYSA 5EKXA 4IMRA 1HE3A 1KMHB 3RWOA 4EPTA 3L1VA 2Y67A 3OPYA 1D2CA 4LPKA 4GWKA 1RPJA 4MLCA 4Z7JA 3E5MA 3H6KA 3CX7A 4LDJA 4QT0A 1ZJYA 2FEOA 3KALA 1OIXA 4YIKA 1YS7A 1M6HA 3B13B 4PHGA 1QFMA 1NXVA 4IO1A 2J48A 2R68A 2P69A 4TLMB 4KX3A 5HZHA 4AKHA 1OA0A 3NDJA 1XJWA 3LP5A 5KWEA 1WE2A 2GPTA 5BSGA 1EH5A 2AYYA 2W00A 2NU9B 1KEVA 3I2JA 3ZIAD 5IN4A 4G0OA 3S3TA 1HLFA 2PYIA 3LBAA 1SVIA 1DTEA 2GLUA 4KNWA 4RZHA 1V7CA 1KMMA 1UBUS 3KLMX 3PTZA 1YB1A 4K86A 4WCVA 3UJCA 4NONA 1XRRA 1L5FA 3A4MA 1GCGA 3IP9A 1DSSG 5K0CA 4GL2A 1PT8A 2P9HA 2YY7A 4ALIA 4ZTBA 3TEJA 3CMMA 3I0ZA 4G4SP 1U8UA 2BFEB 2A1TS 1DAPA 2NVUA 3BWCA 1ZGJA 2BI8A 1KARA 2CLLB 4FFPA 5E6RB 3KSAC 4G5HA 3E15A 3I72A 4K9LA 1JHMA 1RI4A 4L5AA 3AB7A 5F73A 1Z4OA 2QTCA 2GPYA 1B2LA 5K6AC 1PFYA 5M5BA 3QKUA 2ZU0C 1R5BA 1KHTA 2ZYRA 4JYZA 1H1TA 2YVAA 2C88A 3KO8A 1JSXA 1WTAA 3UTCA 1M2JA 4L73A 3U39A 1PR4A 5FBRB 3GGPA 2I33A 1CW2B 1JQEA 4TM7A 4IIDA 2WV7A 2NV2B 5KNDD 3OQOA 4K9DA 2J0EA 4A4DA 3R3ZA 3TAHA 4KG7A 4UHDA 1YBFA 2HBYA 3SG0A 1G7CA 4RDXA 3W8DA 4BP1A 3RO7A 1K8ZB 3M6MD 1CE8B 1M6VB 1EP9A 2G28A 1T3HA 3LY5A 4MUMA 4MA0A 1IPEA 3JZIA 1G3RA 5EY5B 3SYTA 1XB2A 3LJKA 2XAUA 5JFTA 1I4WA 1PVOA 4K28A 2A78A 2JJQA 2BEJA 2CXPA 2KPOA 4L4YA 3HJFA 3WKBA 1X80A 3AV3A 4R8KA 1PWEA 2R66A 2VXBA 1O97C 3MGAA 4OYRA 1B6RA 1S0UA 4TXMA 1OFGA 1PSZA 2NXWA 3NWJA 4ZT6A 2JAUA 4MCAA 4NBKA 2HH9A 4RD3A 4C05A 2O7SA 1PNVA 5AXBA 1MJGA 1P62B 1NRIA 1T1JA 3DB1A 4INAA 1S7CA 4HAWA 5ALJA 4LJRA 4LF6B 2WIKA 2NVOA 2FPPA 2X8JB 3L01A 2GZ1A 2XITA 2OG1A 3B6IA 3ADOA 4G24A 3OG9A 2XTNA 3TZCA 2FQWA 5EPEA 3IE2A 1QVWA 2VYNA 3IT3A 4ND8A 2IWHA 3ZVLA 2C3OA 2RHTA 4X5OA 3GRVA 3MGKA 4QBFA 3ZWKA 3ZCXA 3VKGA 3MIIA 1JSCA 2GJ8A 2WT8A 2ALJA 3KYDB 2JJ2A 4ERNA 3H42B 2RI1A 1VA5A 2OGUA 1OUMA 2CFSA 2UYGA 4RPLA 2O8DA 2ZYGA 5IJ9A 5JAZA 3CPEA 3AINA 4AN1A 1ZD2P 3DPIA 4YAWA 1JMVA 3GRKA 3Q2KA 3TQFA 4L4SA 1O5IA 3NVMB 1TEHA 3UJAA 3CZPA 1JGTA 1GY8A 3CRRA 4U2CA 3A6HA 4J8PA 3LCMA 1MGPA 4D3YA 3ENZA 3NANA 1QE3A 4MJ3A 4QZVA 1G17A 4DR4B 1TUBB 3I3SR 1X1BA 4N0PA 3S2FA 4CQMB 1T3ZA 2HF8A 1G8MA 2ADFA 2XD9A 4WWHA 5EIWA 3ZNOA 2AQHA 3QOXA 1HM5A 3FGNA 4FINA 3AQ4A 1FTWA 4E1BA 1BE8A 2ZXUA 1GLVA 3H0KA 2D8AA 2AMFA 4F5ZA 5B7GA 4DB4A 4QTZA 1DBVO 4YUWA 2PL9A 3MCVA 3G0IA 1TD1A 1ZI6A 5F5NA 1ISJA 1A8IA 4Z4IA 3C3KA 2JEYA 2ZB3A 3R4VA 3QWFA 4G2TA 3U56A 5DMHA 3N2KA 2P9GA 1WCIA 1GILA 16PKA 1BMTA 2KJQA 4FMDF 4EA8A 2CXOA 2WWYA 1Z62A 4FI3C 3L41A 5DIZA 1JQBA 4RAOA 5G0VA 5I7AA 3PNMA 3AL0C 1ZH2A 4P3KA 2ZJ0A 1T5OA 4FKZA 4XIYA 1RM0A 4KQ1A 3EXG1 3O8BA 3PBKA 4YMSA 3ZNNA 2Q8PA 2GEDA 5DBOA 4DQKA 2VDNB 2FCAA 4Q3OA 4CUKA 4WOCA 4IZHA 1XIVA 3ETDA 1NI3A 4DLXA 1L5LA 3NP9A 4DSZA 4YPVA 4F85A 1EWYA 3GN1A 3K73O 3SEQA 2GM4A 4JV5B 1CEXA 2ZBUA 2AS0A 3P9RA 2FV8A 1ZYUA 5DW0A 1DIOB 1E92A 2X4LA 3GRCA 2CDNA 2D3TA 2IFTA 3ET4A 1ISSA 3A3OA 1WVGA 3HXTA 2BLLA 4R41A 3CKKA 1WU8A 4HAVA 1WDWB 4WZ6A 3QOFA 4TUYA 1AH2A 1G5TA 2A7XA 1YRAA 3OMWA 1QNFA 1RJFA 4QAQA 3P7MA 5EIXA 1Y4UA 1AQLA 2DERA 1CZNA 2A1TR 1SC1A 3GARA 4JBYA 4TLCA 3ICCA 4DUGD 5T7BA 1DUIA 4RV5A 2ZM5A 4KX5A 4PQEA 4AJLA 1E4EB 2PKQO 3O8DA 3CY6A 2NPOA 2Y1XA 3DKIA 1D07A 2JA2A 1LW7A 4IQFA 4KZPA 4TV9A 3NAGA 2PLWA 4I50A 3T41A 2W43A 3C3BA 1N5IA 2BGIA 2CHGA 1WCWA 4KR9A 2WVAA 2LIPA 1QZXA 2OFXA 4JA2A 4CKEA 2BYTA 2W6NA 1XVUA 3GZTB 3GG9A 4PZAA 1UKCA 4UAUA 3T38A 2ZS8A 3K9HA 2RAFA 1KO5A 2FMTA 2ILVA 1XDUA 1YA8A 1W48A 2EJWA 2W2LD 2XGSA 3MIZA 4Q00A 3WGZA 4NG4A 4IFTA 1YR8A 1TLFA 1FK8A 3R7BA 3OUUA 3DM5A 4KWTA 3FOAA 4F2GA 5DFAA 2JASA 5G1PA 2PZEA 3V7FA 1GZ7A 4ZAWA 4ZGGA 1X3SA 5BWLA 1MPXA 2MMGA 3QVMA 1U1GA 1M6YA 3E22B 2UYQA 4MCIA 4PC7A 5LZ4A 3A1FA 5FULA 2XZLA 1E6WA 3LCCA 2P79A 2EBUA 1Z35A 4KJZA 2ZBVA 2FXVA 3DUFA 1JR3A 4R1TA 1OC2A 1I0ZA 1LA2A 2L82A 1K4YA 1I5RA 3KVRA 3MOIA 4RQAA 4DHWA 4DV4B 2BHSA 1R9NA 4ZV7A 4PHTA 2YCLA 1UXJA 2NO6A 4RA9A 1RXIA 3HYLA 3KQYA 5FPSA 3GH1A 4F2PA 1FLVA 2BGUA 1UC9A 1DJOA 1YJQA 2GSDA 3OHPA 3Q7PA 3OLVA 2NU6A 1NFRA 3QYAA 4IXDA 4ZEOA 5JH7B 4HAOA 2DR2A 5CYFA 4IIFA 2QMYA 5AOAA 3IR5A 1M8PA 3RG8A 2YJNA 3J7TA 2J33A 3URMA 1NI4A 2FK7A 2H8KA 2BTEA 3MWDB 4G5OA 4NHOA 4ESHA 2HN9A 1KDOA 4TMWA 4BFZA 1H2EA 3N59A 3LQ1A 3HHPA 3SF0A 4KWCA 3VPAA 4WJLA 1CEYA 5DN9A 5FQOA 3DT6A 3U4HA 2J9FB 2E4UA 5CIWA 3EUEA 2HSEA 4R5HA 5CRIA 2R1TA 3ZGXA 2VYCA 4Q4CA 1PQYA 1VHQA 5DYWA 2IH5A 4MPTA 3FUWA 5F7JA 4PZDA 4V0NA 2AMVA 1LLDA 2YY5A 2DB3A 5LDHA 1OX5A 3LBHA 5AQEA 4MYUA 1FP4B 3ED1A 5HEKA 2OHJA 5LIPA 4LOHA 1S3FA 3V8NA 3TW6A 1G0NA 2SNIE 3B2QA 3E0QA 3NIGB 6REQA 1K7FB 2NWQA 3WYBA 5ALUA 2HIMA 3AUXA 3H9JA 5CIQA 1LPSA 2F00A 3GWGA 4U9HS 4E14A 2YXNA 5LIRA 2I66A 2EKBA 2QSJA 4ZO8A 5DVZA 5FA8A 1I24A 1BGWA 1SXPA 4U9IS 3G1WA 1UBJS 3A6PC 1S4QA 1QC5B 1T2NA 1SNYA 4DDWA 2QRHA 5E0OA 1YZKA 4DJEC 4MS1A 2EJVA 1X7XA 1GTJ1 3I1YA 4LSWA 4LZPA 4DARA 4S1TA 4TTIA 1M5TA 4U2EA 2RI0A 1E3WA 4OMCA 4HWTA 2W93A 4RD6A 2X9LA 5GIOE 3AVXA 2J09A 1DEOA 1D4ZA 2QM8A 5EXPA 3EZ9A 2IODA 3G8BA 2E7ZA 5ALYA 1X1DA 2V7UA 1G4UR 2XF2A 3P9CA 4M38A 4YJ3F 3FPAA 4DV7B 3TE6A 1Z34A 1QTQA 4B4OA 1IM2A 3KQOA 5J5CA 1ZISA 4C3UA 2QL9A 2X19A 2BMWA 4J0GA 4YP1A 3ZCRA 1DJLA 2HDOA 4OGLA 1NW5A 2EL9A 1JLRA 2Q27A 1CD5A 1IBCA 1NMYA 1VL2A 3FSJX 4HB0A 1ANKA 2F8MA 5EGSA 3W2EA 4BJ5A 3GPBA 4B32A 3GT7A 4RK5A 3H99A 4BDSA 1SBHA 3JTMA 4C3OB 3GRFA 3HUFA 1I0LA 3CJRA 3QLUC 4WKGA 3T7KA 3NOQA 4LE0A 4E0BA 3P9KA 5FRDA 3LFTA 1YI1A 4KW7A 5ABPA 3U81A 1I0IA 2VS1A 2V1XA 3JQBC 1GOTA 1FSSA 3JD0A 2FWJA 2OXFA 2XCQA 5JC8A 2X77A 3E9YA 1EWVA 4F1KA 4C7OB 2H06A 4I08A 4GKVA 3KYIB 3KB2A 3BG5A 1JJ7A 2J08A 3IHWA 3ZTWA 4BV3A 3WLQA 4ENPA 1JU4A 2PSSA 4PZ0A 1N2ZA 4DY6A 3T3IA 4ILEA 2BUBA 1RXCA 5CTAA 5KDDA 1BU5A 2B8WA 4HJXA 4AO8A 1XK6A 2YWCA 4ZQEA 4G84A 1G1AA 4RK0A 1LS1A 3A1EA 3FA2A 2IWRA 3VZPA 1MHPA 3NAZA 1ZKDA 2HNBA 2Y1DA 2ZE6A 3JQAA 1U90A 2I8AA 3LUAA 5A7GA 1EFVA 2I6UA 2PLNA 1THGA 5HQ3A 2V0GA 2O8EB 2C58A 4C29A 1PEAA 1A82A 1XUOA 4HLCA 1QCYA 3MCWA 3PXDA 2GFHA 4ZGBA 2XT6A 3ESYA 4DLAA 3N1UA 3PC8C 4CMCA 1DT3A 2YOGA 1U7XA 2C9BA 3A6JA 3CX3A 4JI8B 1IN5A 3WB1A 2R8XA 4O3FA 3RK4A 4FC6A 3GY0A 2BM8A 4RXMA 3U3DA 4DT1B 4CM6A 2PUBA 2PK3A 2W6ZA 1JTFA 1ECGA 2WB2A 3QXXA 1YC5A 4J16C 4MR8B 5EMKA 3TD6A 4RE5A 3BXZA 3NHZA 2RJNA 4DG5A 5BORA 3SYRA 1WDLA 1Q1AA 4CZ2A 1Y9AA 4H0FA 3IT0A 1SC6A 4TS4A 3SS7X 3DEJA 1I4EB 3B89A 3Q0TA 3NEPX 5K3FA 1ZOLA 3VU9A 4M9QA 3ZGOA 3K1AB 4N0MA 3ER8A 3GGSA 2MJLA 2BKAA 3SLKA 2A9KA 4XUDA 3ZS9A 4JGBA 5EJ7A 4CV3A 4RF2A 1U3CA 1L7DA 2Q3DA 2H51A 3CUVA 2ATIA 4PWZA 4PX3A 5FP0A 4GUDA 4WOPA 1RXSA 3HVUA 1N8NA 1WUJS 2ONYA 3MGBA 4B8YA 3UWPA 1H6CA 4QBKA 2P75A 3PS9A 1JKIA 4HG2A 2HV8A 2DVMA 4L4UA 4RA6A 1NBIA 4LOAA 1KR5A 3RS4A 3SR0A 1TU4A 1C7FA 4MQLA 1IB0A 5GVRA 5KOIA 1SFRA 3WGOA 1KP9A 2XQKA 4D4IA 3AEUB 4HWOA 1N6IA 4P4SB 5I7VA 3QVGA 4FFVA 2IV3A 2ZSEA 3S2ZA 1Q11A 3TLYA 3UICA 3W9BA 4G67A 4OXYA 1IM5A 1GFWA 2AI2A 4QRDA 1Q17A 1IN1A 4YAEA 4C22A 4D3XA 3AHFA 2ZRHA 1T0PA 4G0WA 1NU6A 3IQIX 3PUWA 4AO6A 3GLFE 1XMJA 1IQ0A 2E6KA 1IHUA 3A25A 3HZZA 5FLYA 3DQZA 5HGJA 4ZAGA 5C37A 1ZVVA 3K72B 1M1UA 1M1NA 4BV9A 3VPSA 5JWOA 3WRYA 9GPBA 4UATA 1Z33A 2WJJA 2M32A 4PSUA 4H27A 5AVVA 1TKAA 3A32A 5C52B 3C3WA 3FZQA 5DLQC 3W6UA 1QHYA 1K6MA 2O3QA 1ETUA 3VKHA 2XT0A 2OPHA 1JVNA 3R6TA 1J2JA 3DMFA 4KI7A 3RT7A 2XWPA 1C3JA 2HKIA 4M0LA 4N9WA 3RIYA 4D6PA 3H16A 2PKQP 3UJ6A 1P4AA 4FW8A 3O26A 3LGXA 3L40A 4O2AF 1UJ4A 2ZYAA 5DNUA 5BQFA 2QW1A 2G9VA 5BQPA 1KKUA 4UZSA 2ESRA 1M54A 1QM5A 4FIZA 1VCNA 1ZM4A 2YJ6A 4DMLA 1ZLYA 1VCIA 5GJWC 2Z04A 3L6RA 4QX6A 4BBJA 4H1TA 4OM7A 3O1JC 3T1HB 1L5VA 2YNMC 3HUTA 1EVJA 1P19A 2XUAA 4M6WB 3QPWA 4DG8A 4BJHB 4ES6A 3CCBA 5A71A 6YASA 5IUJC 3C98A 4GBED 2B1IA 2P2LA 2RHJA 4L85A 2Q9AA 4FCCA 4M36A 5LZ5A 4XQEA 1T5DX 2JKYA 3AR8A 1XMPA 4LOKA 3OFVA 1SVMA 1TUEA 1CK4A 1ZINA 4GVPA 3ZWWA 2WFLA 4R68A 2BAGA 4UBKA 3VKUA 1UKVY 3BZUA 2HCFA 3K70C 4ZJZA 3HO6A 1OW3B 1NVAA 2WMNB 5TNXA 4FM9A 4EG5A 4JJEA 1JJAA 2JEOA 3CLHA 1EX7A 2R7LA 3MOGA 4N5LA 5EGNA 3LH5A 2JAPA 2C9CA 4JHLA 1MF7A 3TPZA 5EIAA 2OECA 5T4EA 4TRJA 1A4RA 1R1DA 4M76B 3GHYA 3KTAB 3WQRA 4HNQA 4O29A 3TPFA 3ZK8A 3U9LA 4TVSA 1P17A 5C51B 1XV5A 3FHTA 1SU6A 5EHZA 1I7SB 4RVFA 4DM4A 4GBJA 3WISA 4KR7A 3CURA 4TKMA 1K6JA 5HE8A 3U7EB 1Z5WA 3JZDA 2Q5LA 1ZMBA 4WH0A 4X62B 2OMEA 4JB3A 1LC0A 2JKZA 3MGGA 1ZU5A 1K8XB 1RC1A 1WXHA 2H4ZA 3KQWA 3OAAD 4WUTA 3RG2A 3VUFA 3THRA 1ZUHA 4JX8A 3IQZA 2P62A 3P8ZA 4HXEB 1UBTS 1S2LA 4PZPA 1RQ2A 4Y6PA 3VZRA 3MJEA 4U3JA 5KHLB 1I5EA 4PYOA 4Z4QA 3GJ8A 4L7QA 1L6RA 1E5TA 2JL1A 3HABA 3OA0A 3TVYA 3UAWA 1QH0A 5JSQA 1QRRA 3N58A 1DADA 1PG2A 1MTZA 3OQMA 1XL0A 1RRPA 3GNQA 3NYQA 2YUIA 4K9KA 4X91A 1BX0A 2CNWD 5FPYA 2MR6A 3VDXA 3HE3A 2JVKA 3JCZA 1DS6A 4R9NA 2A92A 1U8FO 1DCMA 5BOVA 4BQIA 5BN4B 1VJDA 3DMDA 1U0JA 1WP4A 4MS3B 3L7NA 2QVLA 3ROMA 4S3MA 3X3HA 1C0PA 4ISBA 3FGOA 3TLEA 1LQTA 5K6RA 1OFIA 3WWDA 5CDHA 3HL0A 5ICSA 2NU8A 1ML4A 4RO0A 2ENWA 2QG4A 3AUYA 4P8RA 3W77A 2IYFA 2Z3ZA 3SEAA 1PKXA 1UKBA 1UT5A 2J7KA 4GPIB 4IVNA 3UM9A 3DVQX 4B44A 3DZKA 5CDYA 2R1VB 1CYEA 2AN4A 2HA5A 1THTA 5LBTA 4LYGA 3MQ4A 3LHKA 2IIPA 3GEMA 4JT9A 2PY6A 1MIOB 3R6WA 1H8HD 3WDKA 1KO1A 4ID9A 5H02A 1MZPA 4WSOA 1PJTA 3ZLUA 4U2DA 4KIFA 2CEAA 4CTNA 1O94C 1NULA 2KW5A 3CZQA 5LSAA 3NDBB 3OIVA 2WVJA 3MWYW 4EVRA 1C3OA 1VRWA 3LTNC 1AA9A 3LUJA 2ZBPA 4KV7A 3NWBA 2AW5A 1GT6A 4IYRA 3VR4A 4HQ6A 3IUJA 3K5IA 2J4CA 1NNI1 2JI6A 4EF5A 3R9XB 1Z0FA 2L42A 3MUOA 4FILA 4WTOA 5FI0B 4MDFA 2OVFA 1WSBA 4EB6B 1PDWA 5EESA 2WD7B 3ZD7A 1CF2O 2VHXA 4IIBA 4MVJP 2JRCA 4RCYA 1H5UA 2ZYSA 3MTBA 4REQB 4Y9SA 5A4KA 5JCOC 4E51A 1Y80A 2W6QA 1EVZA 1JU3A 2C5FA 3OMXA 4KHZA 2P6NA 4G8DA 4N8SA 4O33A 5FPHA 2GKOA 1QGAA 2MYNA 5DBGA 4YI5A 2H2AA 2BKUA 1Q7CA 1E2IA 2JGIA 1MEJA 4I5EA 4N7RA 2KB0A 5CLQA 5B37A 4OIFA 1AUOA 2CMKA 4AZ3B 2C2OA 1K5HA 1CQPA 1XZFA 1Z12A 4LNAA 5JEDA 1SHJA 5IDVA 4PPYA 5AKYA 1PL7A 1KEUA 2QJWA 1CUDA 2VZLA 5FWDA 1M75A 3ZXYA 5DZSA 3W2TA 5AW8A 1EUDA 3Q3IA 2VCHA 3H2KA 2FP3A 2Q6LA 3DDOA 4O4HB 4RKQA 4CHTA 3KNZA 4TWRA 2WAYA 4NIMA 3B5IA 3H86A 2VBIA 4FR5A 5A0TA 4I1VA 1H93A 1JQLB 1XP5A 3CO0S 3EGEA 2PZBA 4NR0A 2O23A 3W04A 1T2AA 1FW8A 2LDXA 3ZK7A 3IDZA 3PGKA 1QDUA 1R50A 3VNVA 3U60B 4UUOA 3OT1A 3F67A 3FHJA 2JGDB 2HM7A 4JXJA 4YRRA 3HU3A 3TOZA 1B00A 4CG1A 1RVV1 3WMRA 4ZFNA 1P80A 1RYHA 4NQRA 4D79A 2GNOA 3FVRA 3JQCA 3PL1A 5U4QA 1N5OX 4WZAA 2WWWA 1E7RA 1FFXB 2QRVB 2HWKA 3LKBA 2F9MA 2ZBGA 3LBIA 4YMWA 1CY4A 1E1RA 4B84A 3KJIA 3M0EA 1QRSA 3ZDFA 1FYEA 1IQRA 3ICOA 3EOZA 4W7SA 3D6JA 2R47A 3D4PA 2YV3A 3N6XA 3O2SB 3TFOA 1QVZA 1Z4LA 5HGXA 3THYB 4HRXA 1Z0KA 4ZDWA 3C16C 1IQPA 4J7CA 1HR0B 4B0PA 3WNDA 2X2PA 1FVFA 3CF4G 3I2IA 1PR5A 1XX6A 2H5LA 2VRNA 5CFZA 1J49A 3H83A 4ACBA 2BFWA 2CHUA 4RZQA 3DE0X 3GLHB 2BF4A 2MR5A 4RVSA 5IG2A 3BMCA 1J5PA 5JDIA 4NARA 4RX1A 4EVSA 1N5KA 1U0OC 3PQDA 4G97A 4H1HA 4KDFA 1GQ2A 1JL3A 4FD2A 5L3VA 1JQ5A 3LV8A 4L4XA 4J75A 3F9IA 2ZB4A 3Q72A 4LCBA 1EZ1A 4HVAA 4C0JA 3DPUA 2WOJA 3L8ZA 4I1RA 5EP4A 3IBSA 3DEAA 5FOSA 2QU7A 4BLWA 2O06A 3NFRA 1XC7A 4PYKA 3KYCA 3MAAC 4IDQA 3RHFA 1E6KA 2HU7A 3D64A 3A6DA 1YVDA 1MB9A 3HLTA 4Q9DA 1M67A 2FJ0A 1C3LA 4QGGA 1H6BA 1K0UA 3B12A 2ACWA 1JQDA 3EVCA 3GJXC 1A9YA 2XWJI 3PD0A 4P93A 3TGLA 5JCPA 1M72A 5IRCD 3LS2A 3DVAB 3VSBA 3DVLA 2X3YA 4YRMA 1IWBB 1AF4A 2I54A 2GKSA 2ID9A 2XB6A 3FTPA 3HA7A 3E58A 3NUGA 4LK3A 4OGGA 5ERYA 4HXFB 3UGTA 1X8XA 2FRDA 2C5BA 3GEBA 1D2RA 1P1IA 4FB5A 4D97A 2AC7A 3QUAA 1QP4A 4J1SA 4KDRA 1VLMA 2C1EA 2CD9A 2WWFA 5HBGA 2WYIA 5L8VA 1CZRA 1JPUA 4YV7A 1N6OA 1T13A 4HZGA 4D4HA 4GOXA 2Q7XA 3GGCA 4CMJA 1EDEA 1J2YA 1HC7A 1W52X 2YV4A 3ENVA 5JAQA 4YJHA 1T6BY 3IX7A 1FFYA 2XE7A 3DW1X 4I6EA 1RQLA 3FAZA 4QDJA 5ULLA 1ZL2A 4JK3A 1E2EA 1XKLA 4IQ8A 3TDKA 3A9UA 4LHVA 4EBFA 3K0AB 1UDCA 1WSDA 2FN9A 2OV1A 3JRWA 4V0QA 1RW4A 3QTTA 3X1YA 3O93A 3MC1A 1ZA2A 3HXPA 1MU0A 3QYJA 1C9JA 3WP0A 5GJBA 2ZBRA 5ITVA 1EPUA 2AR7A 3BSSA 3QG5A 1JSZA 3DYIA 4RL6A 1Y5LA 1SG6A 2B8EA 3GVXA 4MEBA 4K3UA 1XMQB 1PTJA 4NDAA 5JSKA 4BP3A 4QECA 1Y1TA 3PVSA 5TMBA 3STYA 1EUYA 1H3NA 1DEHA 3CRZA 3EFEA 4AUMA 1G66A 1WP9A 3AFIA 4IVQA 5LM3A 1RXWA 3PICA 1QF9A 1HLGA 1PLJA 3JQ8A 1YAJA 3PHLA 2LWIA 2QLBA 2O0HA 3EUFA 2C4TA 2RHDA 4L0CA 2KX7A 5HRUA 2Q07A 4ETMA 4UDXX 4IP0A 4WBXC 4D74A 5JTUA 4ER6A 1Y6RA 1DZ3A 2P2NA 1JV2B 1NQ5A 4A8JB 1HYHA 1GQFA 4BHTA 1POXA 2AMYA 1WABA 1Z6QA 3DDNA 3CH7A 1L5QA 3P19A 2IHZA 5J9FA 5TPWB 3R7SA 4J0CA 3GLFA 3F5SA 5BYBA 1K92A 1KE1A 1WG8A 2CC2A 5EXXA 5LOVA 3ZGLA 1VECA 3D2CA 3FWNA 5DYGA 3RSGA 5KIAA 4LTDA 7YASA 2WT9A 1Y1SA 3AU9A 4KDCA 1NUSA 1F9AA 1OZHA 4BNVA 4RIIA 4WPGA 3FH0A 4D46A 3D0KA 4ZA2A 2QUJA 5BSHA 4YONB 5LLDA 3OZXA 1P4JA 4MWGA 5AJXA 3OX1A 1TUGA 3M5WA 3U3KA 2F8TA 4GO1A 3RFCA 1E9EA 1IB6A 2FRXA 4JLKA 5DW3A 4XM1A 2HK9A 3SIPA 5K01A 4J7UA 2IBSA 3OF5A 3U3MA 1G8JA 3F46A 3R5XA 4GI7A 4I6GA 4YQFA 5I7EA 5ELXA 3PCRB 1CF4A 4IJWA 2HMSA 3EQ8A 3U1TA 1WU7A 1XWWA 4YJDA 1LBQA 2FKAA 4NESA 1R8JA 3L46A 4WCFA 3SXPA 5B1EA 1Y9JA 1X1EA 4N3AA 4KV9A 3E4DA 5BQ3A 4ZTUB 1MC5A 5KREA 3COZA 1VZ2A 2X9QA 3DNFA 1BCSA 3NBFA 4PAWA 5L7TA 4LJYA 3OQVA 5C5DA 5AVWA 2XHZA 1C81A 3A0UA 1EDDA 1KC3A 4C43A 1DT5A 2FX3A 2NNLD 1KSGA 5JRZA 2HT1A 1A71A 1WHSB 5IAKA 5BYKA 3CEAA 3DL4A 3AKEA 3KU4A 3FZYA 3EX7C 3RK0A 4EEXA 5F5LA 4NWIA 1LSSA 4OMUA 5KJ6A 3U61B 4UFNA 2P9CA 3QUQA 4MUXA 1V1RA 4HDCA 3WGUA 2J9ZB 5JASA 4UXHA 1S4MA 2B78A 4IY1A 4MI3A 4Q7QA 3AR4A 4MRVA 4NULA 4C6SA 3KQPA 1IZ0A 2L17A 3A4LA 2PUHA 4LXGA 3IAM6 3H9QA 3ZOKA 5AVTA 3K30A 1P45A 4PQRA 1NR7A 3HKCA 3HL4A 3A06A 2AX3A 5JARA 1J1ZA 1PYGA 2XEDA 3G8YA 4JQYA 4NENA 5HDQA 2C5LA 5JS1A 5DB4A 5IASA 5DWDA 3VKFA 1CIPA 4HTAA 3RREA 4X3PA 3O7WA 1MC1A 2M6RA 2WJ6A 5BN1A 3I9JA 2BFDA 2IXFA 4C1BA 5HKAA 3OZEA 3NX4A 1TTQB 2RHRA 1UPCA 2Z3VA 4JNKA 4PPGA 1PNTA 3ZHSA 1FNMA 4BN5A 1T1SA 4M3NA 3W8FA 2BRUA 1VSQA 3NHKA 4JKYA 3ZI0A 1B0PA 2DTXA 1H6AA 2ZBEA 2XNCA 4DXAA 1F51E 3BN3A 3KZOA 4XPZA 1QWOA 1CR4A 5IT0A 1Q0QA 2IS4A 2D5BA 4XX0B 1WMEA 1M8KA 1T0BA 3JAKA 1J5XA 1LJ8A 3L7CA 3MXTA 4N01A 4RSMA 3TZ6A 2RGXA 4EKIA 1IC6A 2XR1A 1GNLA 3GXBA 5AUPB 3AK4A 1GPNA 1VBFA 5LNK6 2O7NA 4UREA 5TB5A 3IGFA 3TVTA 3BWBA 2ZWOA 4ZU1X 2I2XB 3FOZA 3NEJA 4K88A 1Y6JA 3L8YA 4P4NA 2JAHA 2IU4A 5EZSA 1AN0A 3AJDA 2UZIR 1Q6ZA 1E3SA 1NF9A 2BBTA 3BXGA 3V8MA 5F1OA 3U09A 3TQIA 1S9HA 4Q3AA 3EXIB 1Z5GA 1R9MA 4HGNA 1H6DA 2EFYA 3OE7D 2RAPA 3HCNA 4HNSA 2QP9X 3BFPA 4AI6A 2B83A 2YZNA 3ONEA 4M1WA 1TF7A 1I5OA 2Q3HA 1OT5A 3IP7A 4P35A 3I30X 1G5IA 5AKZA 4ZC1A 4C21A 4DHEA 1SCJA 1AMOA 2Q1TA 5C3MA 1NBMD 1E3MA 4BVFA 1YSCA 1FVOA 2LBPA 5K3AA 2R7AA 3K0FB 1DRWA 1FRVA 2C7VA 2J9XB 5I7WA 1ZRHA 3EODA 4XB1A 4MV7A 4N3BA 5E4TA 4NZYA 4AJNA 4HUTA 5KKNB 1QDEA 2J3MA 3LP8A 4BP8A 1ATZA 4CIBA 3ZK9A 4JELA 1XMSA 2D1SA 1CHDA 1NFFA 2XTZA 4HQFA 4K6KA 4NOKA 1T2FA 3LC2O 1C9NA 3LBNA 1DOZA 3UV3A 1D7AA 1RAGA 1BDMA 5JAUA 1XDGA 2O2ZA 4K9QA 4OI4A 5KJEA 4ZK2A 3NKVA 2Q4TA 2ZRPA 2GO1A 3OCYA 1L1FA 5IYZA 2IYWA 2Z58A 1TPZA 4MAFA 4WIAA 5D86A 4BGUA 5AVSA 1VCMA 1R0WA 3CKYA 4RL4A 4CMEC 1OY1A 4D3FA 4M88A 5CA0F 3PFHA 3TOCA 2C4WA 1UKYA 1Y8AA 3QE0A 4MKGA 5SYAA 1FDIA 4OOFA 4FSDA 3UIEA 2V59A 4V39A 2B8JA 3G49A 4ZANA 5LXTF 4ME6A 1AB5A 4JOQA 1EU1A 1KERA 1JS1X 4QFDA 3ZZNA 1F3OA 1Q20A 5HUHA 1GHTA 2WDZA 1YL5A 4C7XA 4JDUA 5AQ1A 2QAGC 4I55F 5REQA 2SHKA 1XALA 4OHRA 2NVUB 3QP9A 2JD0A 4HEHA 3GQBB 4R83A 4RIFA 1BWQA 1T3SA 1L7VC 3VH4A 1QO0D 3AESA 5I48A 2XMZA 1OXKB 2JFVA 2VNIA 2EZ9A 3I5UA 3ISJA 3M1AA 5LJIA 3A4IA 3QNMA 3OY7A 4DMFA 3UB2A 6Q21A 5DU2A 3ADCA 3GFSA 1SKMA 2BPOA 3G9UA 2GNPA 1UUFA 3NVAA 3VV3A 4OX9B 3K70B 4LW8A 2ZIXA 1DC4A 3PIDA 5I8WA 3P2OA 2ZR7A 3L2OB 2VBCA 4R1UA 5AKXA 4H0CA 5BYJA 1G16A 2N47A 2O8NA 2WF7A 3N5KA 1OF1A 1AKRA 1X70A 3EVGA 5HIJA 1ODKA 2H2HA 3KDPA 3PC2A 2QKYA 1I13A 1KQGA 1NP6A 1Z82A 2OWEA 3A2MA 5F52A 2I3AA 4C20A 4DR1B 3QFFA 1RS0A 2A5JA 2C5EA 1BFDA 2GN9A 3BC1A 2VPIA 3DMTA 4IYJA 4UMVA 2A6PA 1L5KA 3F73A 1JT9A 2WMOB 2ZI4A 2EFCB 4QREA 3AETA 3WMFA 4GZLA 3W79A 2VK1A 2CHVA 2GD0A 5KSWB 4OBXA 1R0YA 5BWOA 1OBFO 5D87A 4S1NA 2Q5OA 3TNDA 5HM8A 2FH5B 2OV3A 5H16A 3EWIA 1X80B 1EUCA 2NO9A 4FSHA 1JHUA 4MVJE 2C99A 1FPMA 3VMFA 1BWSA 4WXHA 2QQGA 1GYRA 1KU6A 4BGDA 3OC0A 5CP8A 4P32A 1NSTA 1KQNA 3HZRA 2W6MA 4GKBA 1ZVKA 5ALSA 4BO7A 3WO0A 4JB2A 1Z5UA 4PFJA 2R25B 4L9RA 1K8QA 4D3ZA 4WLNA 1AXRA 2A1UA 4KLCA 4W1SA 2PLAA 1BDJA 3WJ7A 4ZI3A 3QITA 3L7DA 2QQFA 2EDAA 4ND8B 1PO7A 3L1JA 2FETA 2ZRGA 4YMIA 4CKYA 2OP1A 2QSYA 1BD3A 2AW3A 3FG9A 4I4TF 1MB4A 2OV2A 4KZKA 4M1ZA 4PFKA 4DAOA 3ZW8A 4S04A 3GZ4A 4BPBA 1XJ0A 3GOHA 2YJGA 3KTOA 4PHFA 1G2IA 1BFUA 1SKQA 2O8CA 1XZIA 3H8WA 3GEEA 1PZFA 3H3JA 3T1QA 1TIPA 4LDPA 2GEUA 5IJ9B 2EJBA 1G3IA 3RVBA 4JENA 3ZQ4A 2WA2A 2EG9A 2XVYA 2XW6A 5SZHB 4GPBA 4RULA 1TK9A 3IPCA 3CBGA 1MA0A 3ZE7A 3T9FA 3VHQA 3PHGA 2B3DA 2HLDD 4Y1GA 3PDJA 3THWA 4NEGA 3BE5A 4RU1A 2OXTA 4F4DA 1F4VA 3SD7A 4W7IA 3L0SA 3E82A 4ZQHA 2R7MA 3CIFA 2W42A 2RGYA 2WF8A 3D8HA 4M49A 3J7AC 4US1R 1H2ZA 3D81A 1JKXA 4HNRA 4E30A 3NBKA 4R05A 3GV0A 5CD1A 3M6AA 1I94B 2O2JA 3QWHA 3B8HA 3HC7A 2VBGA 3R20A 1T8PA 3RQSA 2YVKA 1WNFA 3RSSA 3HCAA 4DVGA 3I5YA 5IPFA 3ZWQA 4ND3A 4YV1A 1CTQA 5GVSA 2V5UA 3U17A 1M34E 2VP5A 2JLXA 2O2SA 4NOJA 1LPBB 4KO2S 2C1ZA 3BGSA 3N2KB 2P5SA 4ILKA 1WCIB 4YCMA 3JYHA 3SJUA 4O0LA 4JR0A 3FYTA 5K3EA 3CLUD 4PU0A 4Y30A 2PJRA 2JI8A 4IVRA 4E13A 2HC9A 2V4ZA 1PKEA 3PNKA 3OESA 4PPQA 3HMQA 3LSYA 3C8DA 3MBKA 9ATCA 1AO0A 4GMDA 1JR4A 3DR3A 4C2UA 5AIAA 1BN6A 1R3UA 2FE4A 3O6VA 3H97A 4MI6A 4RE6A 1TYEB 4NBNA 4V0OA 1SKYB 2ETXA 5BQ5A 4F97A 1R16A 4IGFA 1GTG1 3RVSA 2CLEB 2GBGA 3B7PA 3TTXA 2G9ZA 4IJVA 3PXXA 4RVNA 3TAUA 5JAIA 2QPTA 2VYQA 3I9V1 5B4UA 1YQUA 5DTMA 1QHIA 5DHTA 1SZDA 5HJEA 1DIHA 3W06A 3PXCX 3TLMA 4XDHA 4K3VA 3VI4B 1XZPA 1UM9A 4R7ZA 1AKYA 2EQAA 4AM8A 4EPWA 4TUYB 1ORVA 5LR6A 1IZ7A 2BZSA 5EAIA 1ZR2A 4G25A 4JWTA 2XI4A 4U2FA 4PLYA 3T0IA 4HOYA 3FW1A 2IU0A 1MP0A 1HDEA 1DUVG 1FNBA 1P2GA 2YVLA 3T8YA 4CM4A 4CT4B 4EY8A 2BDUA 1CFZA 1U2ZA 4BO6A 2Q46A 1IY0A 2R6FA 1JAHA 4TV9B 4I50B 3UHPA 5DNAA 3A31A 3CKMA 3DLBA 2JC3A 3EXHA 1RHMA 3OETA 1SKYE 3AUUA 4CKEB 2RBKA 2MTBA 3IP3A 5FBLB 3TQHA 5L4SA 3AM4A 3R0VA 1M6WA 1T8WA 3P5BA 1MPTA 5LA6F 3RBZA 5JE8A 4I9GA 1WMBA 3PPYA 1FRFS 5AW9A 2WM9B 2Z6VA 4IIJF 4KQEA 4L02A 1RAIA 5TPZD 1H2RS 2FFAA 2O3UA 4MGIR 3RFFA 1TKRA 1HY3A 3HV2A 1SQFA 1EWQA 3I04M 5C8ZA 3HNOA 1RLOA 4TQGA 4N0EA 1E3DA 2IIVA 1OAOA 5CDFA 4BTVA 2B0CA 2INGX 1ST3A 3K15A 2PWPA 3R7LA 4ECEA 4BX2A 5M2QA 1VMEA 3OFND 2AXNA 4LFBB 1PFUA 1PNOA 3KT8A 5DF1A 5DNVA 8MHTA 2JLQA 2IOYA 1VB5A 3OQJA 2QTTA 1UBHS 1HE8B 3AHDA 4XCVA 1MNQA 3DUFB 4AB1A 1U28A 4YUYA 3U3RA 5JUWA 4K6MA 1DJNA 1N9GA 4CM1A 1NVVR 2HRQA 5KTSA 4RA9B 3G5AA 1L7RA 5ESXA 2C2YA 3UPUA 4CG3A 1CUXA 1E1QA 1GTVA 2AMJA 2XMCA 3HJTA 4B83A 3P4UA 3ONNA 1WTCA 5LDDC 4CCAA 2NU6B 2H3HA 3WI7A 4M0KA 1RAAA 5P21A 5HYVA 3GL9A 3HY6A 3NKLA 1NI4B 1L3BA 4O1HA 4M7OA 3DAGA 4P9NA 4Q1EA 4KPYA 3DZFA 4WBNF 1B6SA 2AN9A 3R74A 1LD3A 3IVMA 4ESOA 3E2PA 3CSDA 2D0IA 3OJFA 1ND5A 2DAPA 4Y9DA 1HE4A 1CUAA 4UCWA 1Z4PX 2R1TB 3RS2A 4QBHA 4GH5A 3STHA 5B7PA 3GF4A 1GGFA 4HLUA 4LJ7A 5ESWA 1MABA 2C78A 2YTZA 3BDIA 1CQJB 1RWOA 2CYBA 3GLTA 4NMXB 4TGLA 3SMQA 5KI6A 2ZT8A 3DWGA 3HP1A 4ROTA 1ZN9A 3GLGB 4TWIA 1XTJA 5EERA 2NPFA 1O03A 1EGMB 4DUZB 3D02A 3WQHA 4ZHQB 6REQB 4KBFA 1UXKA 1SC3A 4Q1CA 4RIEA 3PFKA 4PV7A 3QVLA 1PTJC 3RTBA 1IONA 3OM9A 4TMZA 1I6KA 2GXAA 3OPXA 4L5YA 4HVLA 1XJCA 1FUUA 1YUNA 2Q4BA 2X5KO 3LXXA 3WLEA 3ROKA 4LHSA 4N65A 2GAIA 3DZIA 2W8BA 1T25A 2W6JA 2HU8A 2OUIA 3JYPA 3UMJA 1GEGA 3SAJA 3ET5A 1U7ZA 5DHAA 2W48A 4I9NA 5IM5A 3ZXIA 3AO0B 4EHLA 4ZYUA 2BKLA 3BDVA 2GQ0A 1N5DA 2A0XA 1ZCZA 2PL3A 2X5OA 4YJKA 3S2IA 1C1YA 4MS1B 1X7XB 1U2QA 2P30A 4IFIA 1XI2A 1W1UA 2D5CA 2YASA 2XYQA 3BYZA 2JHCA 4MGZR 3HDQA 1E3WB 4IJ6A 4CN9A 3OQIA 3MWEB 1C9DB 4IZOA 2VJLA 1GUBA 4BS9A 5JNSA 4RABA 2HHHB 1EESA 1DARA 1ULBA 5GZ1A 2A0UA 3P4YA 2QNRA 4WKCA 4TTRA 4Q9NA 1YQEA 4OK6A 4QEDA 4W5JA 1E5DA 2O6HA 2WY2D 4BMDA 1VPWA 4E5PA 3OD5A 4TTSA 1SHUX 2DHDA 2CLDX 3GLGE 4NNPA 1W46A 2IOQA 4PYRA 6CHYA 4JX9A 1CUHA 3LUCA 4W5QA 3RWMB 1MX3A 4P7JA 5AUOB 3BXHA 5EP1A 1WKBA 5IT5A 1JZSA 3RKSA 4YXFA 1LJLA 3B53X 4UBLA 1R4MA 1N2XA 1LZKA 3MRVA 4HH3C 2B8TA 3I1FA 2RC6A 4ZI7A 3MJRA 3UUGA 4W1QA 1UOEA 1YCFA 2OBXA 4CQJA 1ICEA 3RAPR 2I8LA 4H1WA 2BR3A 3UMFA 1NY5A 1P44A 3TQCA 1RR6A 1X6VA 4LYEA 5ALQA 3D0OA 3ETEA 5BT8A 3OD1A 5HRAA 1EXVA 5GV7A 2TRSB 4KFTA 3UHOA 1RRKA 1LWNA 2WTNA 4WCFC 3JVEA 4HGQA 3CB2A 3AR7A 3HJUA 2Q2WA 5EJFA 4DIKA 5TMDA 1M2OA 1II9A 2ODTX 2QQ0A 1BH6A 2DSTA 4TXNA 2IU6A 4DE5A 3LLMA 1E4YA 2CV0A 3EHDA 1CLUA 4XOIA 2UV8A 1Z6ZA 3SQLA 2Y6VA 3L92A 3JATB 4CU2A 4B79A 3PFCA 2NAFA 3N39C 4DXDA 1XG5A 1N4DA 3K2IA 3W9UA 4AX4A 2G4LA 2IXBA 3QFSA 3DEFA 1RI2A 1E3QA 1RYEA 3DG9A 3ZE9A 3JQAB 1SHLA 3ZHRA 2ZJOA 4EGAA 5T41A 1DWQA 3LU1A 2PS9A 4A03A 4QVIA 4DV0B 2DJIA 3DOUA 4NZNA 5CA1F 4XLZA 1G9TA 3M5DA 3RC3A 1PNRA 4DIMA 1YZ3A 1U3DA 1RYFA 5EHGA 1S5PA 1J42A 1TNDA 1Y3DE 1LVGA 3G9TA 4HF7A 2P27A 3TM4A 2NM0A 3UJ7A 3N7AA 5BMVB 5KMGB 2C0CA 5FXMA 4V2UA 3H4IA 2ZAGA 4H31A 3RVOA 2JA1A 1NSYA 2QMEA 5DBFA 4B2IA 4XIJA 5L7WA 2JZCA 2GZDA 4UQLA 1OU0A 1XPJA 3ZCPA 2C7QA 4WFJA 4DUYB 3OHMA 4DDMA 2E4ZA 4J1TA 2PWAA 1N1EA 1VIAA 3LY7A 3RFTA 2J67A 2W9XA 4MEAA 1RWVA 4AJIA 4ZI5A 2ISCA 3REOA 4CT5A 4AKGA 1PFGA 4Z5XA 4NMMA 2PUAA 2R3SA 2WPNA 2ADMA 1SQ6A 4WAUA 1YKGA 5K3FB 2PFKA 3VU9B 3COPA 4C0AC 1L4LA 2NGRA 4E2FA 1WUHS 5CAEA 3JV7A 1Q0LA 2POCA 2GRAA 3DYBA 3NM4A 4NV3A 4GGOA 4UKDA 3VR0A 4DLLA 5K4GA 3HDJA 3DNMA 3D1JA 5FTNA 4G09A 4MVJA 3LKDA 1KGDA 4OHVA 3D8UA 4RA6B 2XDAA 2HCJB 1Y1LA 1J39A 3OPNA 1EX6A 4M0UA 1EE2A 4U39A 3UJ9A 4KXNA 3ETHA 2BMJA 3BUSA 3ODGA 2HWUA 3GMSA 2DBZA 2ST1A 2FSVA 1CJSA 3IO3A 5A6VA 3OHSX 1PIWA 4TKVB 4UE2A 2XAAA 1RC0A 1CR2A 2BSXA 1CUIA 2OHOA 2XYPA 3AJAA 1BS2A 3FPFA 3Q7IA 4FMBB 3WLAA 3WKCA 3L4KA 3R75A 1U1DA 3WNBA 4W99A 3R8XA 4QARA 2PLFA 3QHAA 3RE1A 3GDOA 5L40A 1DMSA 3OZRA 3EE6A 5I45A 1RZRD 1H2XA 3EIQA 1DO2A 2BE7A 3SZGA 3RU9A 4HTFA 5JSHA 3REQB 1B1AA 4KXMA 3QXCA 4EJSA 1QHGA 1JHQA 4W1PA 3PUYA 4B1FA 1T91A 1PG5A 2FW8A 3A8TA 3EZ6A 4QICA 3QSYA 3WL5A 4CNBA 4RK6A 2A57A 2E3JA 3GG2A 2WPDA 1U3WA 1N1GA 1IG3A 4BQNA 3A6GA 5F7OA 1NTRA 2AYZA 5EJIA 2ZETA 2WM8A 3GCZA 2P6RA 2RK4A 1K8RA 2MHCA 1F2TB 1EM8B 2OGSA 3RRBA 3K6JA 4OQZA 5EWMA 1VMIA 3SC4A 1V2GA 2ZAMA 3ANNA 4MUAA 2Q3MA 4AUEA 1EFCA 2TMKA 4EHFA 2HSDA 2DRIA 4Q5IA 2C2KA 4FHZA 3T7CA 5COQA 2GR9A 4JLVA 2DQKA 1PFWA 3K6KA 3KE9A 3Q1KA 5B53A 3LYAA 4KK4A 4BNNA 3AM1A 1M34A 1OX4A 2PX2A 2V7PA 3A37A 3R7WA 1YJ8A 1MX5A 3QLVC 4PZZA 4G8JA 5I5EA 1QIIA 2Q50A 2JGRA 3H8JA 4KHPB 1QTIA 1W85B 2D13A 3DBVO 1SXHA 1T15A 2BISA 1NXPA 5CUQA 4ZT5A 3TTUA 2GHRA 5B2EA 5C4IA 3A4TA 3CUTA 2IH2A 3Q9NA 2OC9A 2V96A 4JYAB 3RU2A 4DJAA 1GCIA 3WGJA 1KU0A 3G2IA 3P2KA 4N6OA 2CW5A 3V7NA 3LYUA 2ZLBA 4KTTE 1WQ1R 2BZ1A 3ICVA 5J4LA 3WYGA 4OHOA 4CF3A 1J8DA 3SR3A 1OB5A 1MO2A 5FFFA 4HS4A 1UWVA 3DMGA 1XZAA 1NL3A 1Y6ZA 4TYQA 1DX6A 3DMTC 2HZ7A 2R00C 2CVQA 5AM4A 3I1JA 4M7PA 3TTVA 3OCCA 3O4GA 3S44A 3SQDA 4RF4A 2EFGA 3MS7A 1JNXX 2I2WA 3ONWA 1AVTA 3NGXA 3D4LA 3PWKA 3RC8A 1G3MA 2O7QA 2HIAA 2ECOA 1XVAA 2B30A 1IHDA 2PR7A 4JXXA 7AT1A 1KOJA 2B9VA 3E3OA 1WHTA 3OZVA 3NFYA 4JMPA 3TXYA 2ZR9A 2J6CA 4Q4HB 1KP3A 4LYDA 4Z7OB 5B7QA 4K5QA 4GLLA 3IEKA 1E9BA 3M6LA 5LQJA 1XWFA 2X5XA 1KGSA 4C7MA 1JXQA 2I22A 3CVJA 2ZI5A 1Z37A 5ERXA 5LQDA 2JFBA 1II8A 4CCWA 5BMOA 2ZVDA 1UBFA 2YFYA 1Y8ZA 5EUBA 4RAQA 4HH1A 2ADOA 1QH9A 3AI3A 3OM8A 4KQXA 4LNUB 5E6UA 1OI3A 4C04A 4DRZA 3KDAA 1G42A 1B41A 3KHSA 4GI1A 3U48A 2Q5JA 4CQNA 1LDBA 2TS1A 2XWBF 4ONEA 3RARA 3OF3A 2BCJQ 3V7YA 2NU8B 3IL2A 1N6HA 1BMDA 1Z3IX 1MAVA 2GUGA 2BR4A 5EZYF 2RC5A 4B8WA 2FDCA 2CDRA 2PZGA 3DXFA 3OZAA 2V9ZA 4HUQA 4TMKA 2GA9A 2QN9A 3E3NA 4HQOA 5GP1A 2PFGA 3TGPA 4R1OA 3WIOA 2VJYA 4RK1A 2B9EA 1B76A 3OJXA