2CL5A

Catechol-o-methyltransferase in complex with an inhibitor
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
214
structure length
214
Chain Sequence
GDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comparative Study of Ortho- and Meta-Nitrated Inhibitors of Catechol-O-Methyltransferase: Interactions with the Active Site and Regioselectivity of O-Methylation.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords CATECHOL O-METHYLTRANSFERASE
total genus 81
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2006-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2cl5A00
4AX8A 4DKJA 3FPGA 4KIGA 2QE6A 5DPMA 4YUZA 2UYOA 3T0IA 4IV0A 2IGTA 5KS2A 3HCFA 5F2NA 4CWAA 3F4KA 2N47A 3UJ8A 2PT9A 1VQ1A 4KW7A 3DMFA 4ER6A 5E1MA 1O9GA 4CXMA 3M6XA 5FWDA 5FHQA 1NT2A 2VDUE 4YV1A 5KYGA 2NXJA 4A6DA 3UJ6A 3AY0A 5HIJA 3A7EA 1D2CA 4BP3A 5BXYA 3LDGA 2EJTA 4RTSA 5DWQA 4FT2A 1F38A 3FPJA 3FUUA 3MGGA 4POOA 3P8ZA 1EG2A 2PY6A 2Y1XA 3HP7A 3E05A 4V0QA 2YX1A 2YTZA 5D1NA 3RW9A 2AS0A 1BHJA 1L3IA 1XTPA 4XUCA 1JG4A 2K4MA 3DXYA 3NWBA 7MHTA 5FQNA 4QVKA 5K0EA 2PXXA 4F85A 1WS6A 5HZMA 1NBIA 4FP9A 4E32A 2I9KA 3EPPA 3GDHA 3DP7A 4CKCA 5HIKA 1ZGJA 3FUXA 2AVDA 4DM3A 2BR4A 4PYJA 3NVMB 1L3BA 5HIIA 1VE3A 2P1DA 5K0FA 4YUXA 2EX4A 4PIPA 5FULA 3NMUF 3KR9A 5DXJA 2YQZA 3LCVB 3CJTA 1M6YA 2QM3A 1L9KA 2NYUA 4FR0A 1KR5A 2PX2A 3CC8A 1R00A 1PJZA 2YR0A 3OCJA 1O9HA 2IH2A 1YZ3A 5EGSA 3UWPA 1ZG3A 2A14A 3HVKA 4HTFA 1XDZA 4G56A 3SXJA 3HNRA 4PYOA 4UOEA 2HTEA 3E23A 4DCMA 3FUWA 3I64A 1ORHA 1N7JA 1RJEA 4MTLA 1KXZA 4BY9E 3R9XB 3UJ7A 5IKMA 3FYCA 4CTKA 1TPYA 2ORED 4E2WA 2Y1WA 4R8RA 3OFJA 1NW6A 5DM1A 3UFBA 5BP7A 3SVZA 3KHKA 1QZZA 2P35A 3VC1A 1VLMA 4HH4A 4PYKA 3AXSA 5DSXA 2P3QA 2G1PA 3QV2A 1RJDA 4E2YA 5K09A 5DTMA 5D1HA 1X1DA 4RTMA 3G89A 4QPPA 2C7PA 4FZVA 3FYDA 3HTXA 4MWZA 3GCZA 2IH5A 1AQIA 3EVEA 1BC5A 4X60A 1YF3A 4IV8A 3P9KA 3BT7A 4QTTB 3GWZA 4HC4A 2NNWB 5CVEA 5FADA 3EVDA 4M7RA 4PYMA 3TPZA 3RIEA 2AN3A 3OZRA 5JR3A 5G02A 2JH8A 5LQAA 2FHPA 1YB2A 1IY9A 3QOXA 1JTEA 3ELWA 4X61A 4X1OA 2UYQA 2AOVA 4K6MA 4PWYA 2VDWA 2V74B 3PLAE 3BWBA 1YFLA 3OZTA 4LWOA 4DZRA 2E5WA 4JXJA 2JHPA 3R24A 1ZKDA 5CD1A 3UJCA 3JWJA 1R8YA 3P9CA 4DMGA 1DCTA 3PB3A 2H11A 5FHRA 4YMGA 4RVHA 5H02A 2ONYA 2PV0A 1P1CA 3FPEA 2GA9A 1VBFA 4R6XA 4FSXA 4QDJA 3P2KA 1P91A 1HMYA 2QRVA 2ZZMA 2ZCJA 4HGZA 3LPMA 4HRAA 3TLJA 2V7EA 1SG9A 2EJUA 3JWHA 1U2ZA 3Q87B 1NV8A 2Z6QA 4PNEA 2G72A 1R18A 2ONZA 4C05A 2P3OA 1DUSA 2BZGA 2GS9A 4M36A 3A7DA 4GOMD 2IFTA 3TKYA 2IDJA 5LSAA 1B42A 5DTRA 2QYOA 4QQKA 4RTRA 2OO3A 3GRUA 2HNKA 3T7SA 2FCAA 4OA8A 2QRVB 5EIWA 2PVCA 3DMHA 3SGLA 4ER3A 5HILA 3MHTA 3JWIA 5C1IA 5K8VA 3HVHA 3KPUA 2B25A 3LCCA 1AQJA 3G2PA 1L3CA 3GO4A 1JG1A 2PXAA 4LECA 2OPBA 5EHIA 5CVUA 2CKDA 5EKUA 1XDSA 3P9NA 4PONA 5EZQA 3EVAA 4KDCA 3JWGA 5HOQA 3OFKA 4P7KA 5K0BA 2UYHA 4E2XA 3FTFA 5E1DA 1NE2A 2PWPA 2YUIA 4AZVA 5EIFA 2IH4A 2P3LA 3GRZA 5E2BA 1Z3CA 2BM8A 2ZBQA 3A27A 2PT6A 3LSTA 3PVCA 4FGZA 5DLYA 1BOOA 5EPEA 2PXCA 3ELDA 3FUVA 1KYZA 2ZBRA 1L1EA 2UZ4A 3BWYA 2ZWVA 5E9WA 3EMBA 3O31A 5DTQA 2FRXA 3PX2A 2AOTB 1XCJA 5KQRA 2VZ9A 3UA3A 2VP3A 3GRYA 4YV0A 3EEOA 3ERCA 3M33A 4XUDA 4P58A 5C0OE 3G2OA 2XYVA 1EIZA 4U7TB 4YMHA 1Q0TA 1NW8A 3AJDA 3BUSA 2I6GA 3U81A 5M5BA 4C07A 1XXLA 2ZFUA 4P7FA 1X1AA 3I9FA 5E8RA 4BLUA 4ER7A 4EVIA 4PYLA 3HCDA 1QAOA 2LD4A 2PSSA 2HV9A 4CTJA 1KP9A 3B89A 2QY6A 3C6MA 3AWIA 3MCZA 4OQEA 3G8AA 3BWCA 4M38A 2IPXA 1R74A 4RTPA 2ESRA 3PT9A 4WVLA 4L7VA 5ICCA 2AR0A 2CWWA 2BR3A 3NJRA 1Y8CA 9MHTA 5E9QA 1RI4A 2ZZNA 2VDVE 1QYRA 5EMKA 3P97A 3TRKA 3LDFA 4YUVA 2AOWA 2O05A 2HWKA 5EZSA 2B2CA 2P7HA 2H1RA 1JQEA 4YUWA 3B3JA 2O06A 3SSNA 3VYWA 1FPQA 1ZGAA 4EMSA 5MHTA 1KIAA 3FPHA 3A26A 3O7WA 4C04A 1ZHFA 1T43A 5EMMA 3MQ2A 5B1SA 3DR5A 2R3SA 1NW3A 4P7JA 3KPJA 1SVUA 3E7PA 4BLWA 2NXNA 2YVLA 3GJYA 3LKZA 1KHHA 3BGVA 3C6KA 2PX8A 3EGIA 4PINA 5GWXA 3DXZA 3G2MA 2G8NA 5ICFA 1AF7A 4M37A 3SSOA 5CCXA 1NV9A 1VPTA 1X19A 4PGGA 3ME5A 5K05A 1KPGA 3T7RA 3DLCA 2BH2A 3ELUA 4U7PB 3ER9A 5EQJB 5GOZA 3FRIA 3SM3A 3HM2A 4GOND 1KPIA 1UIRA 4Z2YA 3MTIA 5C9ZA 4OX9Y 1M0EA 4PGHA 2ZIEA 4RVDA 3KQWA 5F2OA 5FUBA 4AZWA 3NTVA 1JG3A 4OBXA 2NP6A 5CVVA 4E31A 3LBYA 2OB1A 2OB2A 4RTOA 3NDIA 1D2HA 4KVZA 2FK8A 3A25A 5DM0A 3CVOA 2WK1A 4ATNA 4AZSA 5DXAA 3FTDA 5E1OA 4F86A 1VIDA 1QANA 1IXKA 3HVJA 2C7RA 2C7OA 1MHTA 1I1NA 1TW3A 1XVAA 3RODA 4CKBA 3UBTA 2CL5A 3EVCA 8MHTA 3I58A 3R6TA 5HFJA 4C06A 3HCEA 5T67A 2AOXA 3KQYA 2ZBPA 4PIMA 4DCGA 3KQOA 5FWAA 4RWZA 5DSTA 2FK7A 4ZTBA 5EVJA 3S68A 1NW7A 3KQSA 4XUEA 4AUKA 3FTEA 3Q7EA 4KIFA 4PCLA 3PS9A 4PYNA 4R6WA 3HCAA 3EVZA 3P71T 1KYWA 1X1BA 3B3GA 2CMGA 2OYRA 1IM8A 4EKIA 2B78A 5DX0A 3C0KA 4YUYA 10MHA 4RV9A 5CM2Z 1YZHA 4ER5A 3MAGA 3G2QA 1WXWA 2OY0A 1V39A 3IV6A 1FBNA 1SUIA 3LKDA 4MIKA 5FA5A 3SX0A 2AOTA 3E8SA 5EHGA 2EFJA 4KWCA 5EMJA 4E2ZA 3NVKI 1JG2A 2G70A 1G8SA 4MHTA 4AZTA 1JQ3A 2GB4A 3I53A 2O0LA 2PLWA 2IBTA 5EOVA 3TM4A 2GLUA 4LG1A 4GOLD 2IP2A 4DQ0A 3A4TA 5ICEA 3DULA 4GOOD 1XDUA 5FTWA 5T64A 2JHCA 2NP7A 1UFKA 1HNNA 4BP1A 3KR1A 2H00A 3EGEA 3M6UA 3LBFA 3TFWA 4GUAA 1VP3A 2ZIFA 2ZIGA 4EKGA 1MJFA 1ZQ9A 5EMLA 4HTFB 2GPYA 4ER0A 2GAFA 2NXEA 5K01A 3IEIA 2OKCA 3KR0A 2Z6UA 2FYTA 5LQUA 3DMGA 1M6EX 3KQMA 4RSRA 4NECA 5E1BA 5CUQA 1H1DA 3G5LA 2BR5A 5EC8A 5FQOA 1P1BA 3ID6C 4IWNA 3KKZA 4IKPA 4CKEA 3BKWA 2R6ZA 4RTJA 3IHTA 3C3YA 2ZWAA 3GGDA 5DRYA 5FCDA 3M6WA 3B5IA 2HMYB 3FRHA 4GEKA 5E9JA 3EEYA 4V0RA 2ZW9A 4PYIA 3P2EA 3GXOA 3P9IA 4QDKA 3D2LA 1G6Q1 5K0CA 3V8VA 2ZLBA 3UJDA 3THSA 2YXLA 5DX8A 5T6BA 2GH1A 5CVDA 3TOSA 1WZNA 2DPMA 2OBFA 3CCFA 3R0QA 4HG2A 5CCBA 2Z6AA 5DM2A 2UYCA 2ZTHA 1YUBA 2PBFA 1EAMA 1X1CA 4GC5A 5K03A 3PTAA 3OPNA 3P2IA 1F3LA 2JJQA 3TMAA 5KQSA 5K0NA 2VS1A 3G88A 3NDJA 2AZTA 3IYLW 3MTEA 3CKKA 5EKXA 3R3HA 5E2AA 4QTUB 3T7TA 1NW5A 5LQCA 1KPHA 4ISCA 2ZULA 3QOWA 3UA4A 3NW9A 3ANXA 3TR6A 4RTQA 1N7IA 1QAMA 3ELYA 3SSMA 4C08A 4B17A 2G71A 3LHDA 3ORHA 5LQRA 2IIPA 5BW5A 4F84A 5EG5A 1XJ5A 1RI1A 1XCLA 1EJ6A 5DT2A 5P8WA 4H0NA 3DOUA 2ZZKA 4RVGA 3MERA 4A6EA 3OE5A 2XVAA 1RI2A 3FPFA 4RTLA 5BW4A 1G60A 1JTFA 3GNLA 5EEGA 3WSTA 3PFHA 1FP2A 3L8DA 4FSDA 4R05A 2P41A 5GIPE 3MB5A 1SKMA 3BKXA 2F8LA 3VSEA 2B9EA 3REOA 3DTNA 1TW2A 2AN5A 1R6AA 3C3PA 3HA3A 3KQQA 3OE4A 1JR4A 5DX1A 4BLVA 3EVFA 5LR6A 3TM5A 4KDRA 5GM2A 1I9GA 5CVJA 2IDKA 3I5UA 4MQ4A 3B7PA 2P8JA 2AOUB 3FZGA 4QPNA 1DL5A 2JG3A 3EVBA 3K0BA 3GIWA 4PCAA 5KVAA 2CMHA 2AN4A 4RYLA 3DUWA 1SQGA 4HSGA 4E30A 3KR2A 4GF5A 1RJGA 1NKVA 1EJ0A 3DLIA 3SR4A 1P39A 4RX1A 4GC9A 1R8XA 2NXCA 4OA5A 2ADMA 4LWPA 5K0GA 3PFGA 3MCTA 2PGXA 3AXTA 1SUSA 3HCBA 3LL7A 4O29A 4XCXA 4E70A 5FA8A 1INLA 3KQPA 3OZSA 2YXDA 2XYQA 4RTNA 4HGYA 2IBSA 3M4XA 5LQKA 2PX4A 2PX5A 3EVGA 2P7IA 4RTKA 3LCUA 1JSZA 4GBED 3M6VA 3BGIA 3HA7A 2BM9A 2JHAA 1BKYA 1WXXA 2ERCA 2B3TA 1RI5A 3O4FA 4GQBA 5LQJA 3HEMA 3BZBA 3LX6A 5ERGB 5HIMA 2DULA 1FP1D 2WA1A 3HVIA 4Y2HA 5EEHA 3LGAA 1EQAA 3FTCA 2O57A 3BGDA 3CJRA 3KQTA 3ER8A 3G7UA 3LECA 2ZVJA 1N2XA 3OU6A 5E8JA 5F2KA 3CGGA 4PYQA 2KW5A 2Q41A 5DRTA 1I4WA 1O54A 5K0JA 2AVNA 5DM4A 3DH0A 3UJ9A 3FUTA 2I7CA 3HCCA 3KPVA 3M70A 4X41A 5GP1A 1WG8A 4C03A 1FJXA 1JSXA 3G5TA 1VP9A 4FT4A 3TKAA 4QQNA 4E33A 3CBGA 5GIOE 1SQFA 5GINE 1RI3A 4Y30A 2XVMA 4QVGA 5CIYA 3EMDA 5U4XA 3SMQA 2FPOA 2P40A 2PWYA 3GRRA 3NWEA 2HR1A 1JQDA 3G8BA 3OU7A 4C4AA 4KRGA 5K0LA 1RJFA 2I62A 1G8AA 3H2BA 3K6RA 3KQVA 2OXTA 3KPWA 3VC2A 4RVFA 4OBWA 2PJDA 1QAQA 4X63A 5IH3A 3UJBA 5LQNA 1G38A 2XBMA 3B3FA 5ICGA 4DF3A 2EG5A 1PRYA 2YXEA 2ZSUA 3BXOA 4OQDA 4P7GA 3V97A 2C7QA 3OU2A 2PKWA 1Q0SA 1G55A 3GRVA 2XYRA 1OR8A 4YV2A 3KU1A 1YFJA 5GM1A 2AOUA 2JH9A 2OZVA 4DA4A 3GU3A 5HEKA 1NBHA 3EGVA 3HA5A 4EK9A 3X0DA 1D2GA 1VL5A 3KPYA 4WXHA 1AV6A 5JUWA 3DXXA 3TQSA 1ORIA 3CJQA 3PX3A 1UWVA 1WY7A 3BWMA 4EQZA 2WA2A 4FS8A 3LDUA 3UZUA 4R8SA 2O07A 3UJAA 3THRA
chains in the Genus database with same CATH superfamily
4BE7B 1GTJ1 2WVAA 2HA6A 3LGSA 2WJPA 3LL4A 3DTYA 2OEPA 1NI4B 2ZSAA 3MEQA 4ZCQA 3TUJC 4ARSA 4NH0A 4C89A 1J0XO 3RTBA 2GNOA 2XOXA 3D8TA 3FH0A 2O50A 2V0GA 3ZLTA 3COJA 4OI0A 2NXJA 3C7KA 3ZWNA 3UJ6A 2X5XA 4RK4A 2EJTA 2V7TA 4JFAA 2SCUB 3ZVRA 3S7ZA 2ATEA 1QH0A 3O1HB 1OJ7A 1WPRA 3RRFA 5KCMA 1AG9A 1PTJC 4UAJA 5IYZB 3PBKA 4LV5B 4W8HA 1T4BA 1EX6A 2V5AA 1JKIA 1FYVA 4JDPA 5CCDA 2OXFA 4TL8A 4F3CA 3FZQA 3SY8A 3N6XA 3JQGA 4NH4A 4WFIA 2BF7A 4F85A 2AXNA 2GUWA 1WS6A 3E5RA 3MYYA 4B6RA 1S7GA 1LH0A 1HE8B 1TTQB 1ZGJA 2GEVA 1W25A 2MIIA 4FN4A 4Q1BA 2ZUWA 1OA1A 1VFPA 4NCIA 5B53A 3HK2A 2JFVA 1ZWKA 2QN8A 1JZQA 3SF8B 1WQ4A 4IUYA 4OGWA 3ETGA 3MLBA 2B98A 1K9VF 3ENQA 1OXMA 3GUUA 4C7OB 4YBRA 2QQGA 1JHXA 4HCJA 5A62A 1W0KA 3FOZA 4GYKA 2ADOA 2G0NA 2NYUA 3FG9A 1JSRA 1K8RA 3RDPA 4D4HA 1OWLA 5A2QA 2Z09A 4ME6A 3WOVA 3NHRA 3QHQA 4HUTA 3WNVA 4FLMA 1ZG3A 3WBFA 1OH8A 1T35A 2PQ6A 4C4ZA 1SIUA 4EW6A 2CLMB 3O84A 1VSQA 2IHYA 1GQQA 1K8QA 1GZDA 4HDRB 3L7AA 3AV3A 5K4GA 2QL7A 1ORHA 4W8GA 4XOIA 3U4CA 2XOKA 1NU6A 2DAPA 3M4JA 3RAGA 1NBAA 5TX7A 4V0ME 1Z4IA 4L6AA 1XA0A 2X76A 1T9GS 5KYXB 1JL3A 2LRHA 2O48X 2AG1A 3CVJA 1NW6A 4O4JF 3R7SA 4P54A 2H2WA 1E2QA 2K87A 3RAPR 2Y99A 2V4MA 2HQOA 2VT7A 3AXSA 1U65A 4FEEA 4JUIA 1O03A 4AP6A 1OB5A 3ZZ0A 1FX1A 2BFEB 2BWJA 5BWNA 5KVVA 6REQA 3THXA 4K3VA 3AZQA 1ZMBA 4WUTA 4BVJA 5IG2A 4LYJA 4XW2A 3DJYA 1OLSB 1Z6ZA 3PJDA 4PPGA 5A2GA 3EWSA 1AMOA 3OMXA 1GZUA 1RMTA 3D6NB 4DV6B 2PGJA 2JFFA 4GM4A 3ESXA 1QP0A 1QGED 1U6JA 3ER6A 1OT5A 1KIMA 4KQFA 4K6OA 5FADA 3GFQA 3W8FA 3HADA 4ZJPA 2ECPA 3W4JA 5CH8A 1IY9A 1AMNA 1WVMA 3PQ6A 1K89A 1USVA 1THTA 1UP7A 3F6RA 2OLEA 3VPGA 3IXQA 4LQ4A 4R9UC 2XB9A 4US0R 4H6PA 4RVOA 3TJMA 1XL0A 4IQ0A 1QHFA 3TVDA 4B8ZA 2XJ4A 3HKCA 3QWHA 3VOBA 1A5BB 3DF9A 2NOAA 2GT1A 4WBSA 4KZKA 3RVJA 2AC4A 2FMTA 4M8IA 2ZRJA 4JB0A 5AFSA 5B3LA 5JCXA 4IMPA 4BQEA 1RTTA 1HFWA 2J87A 2QTVB 4ILKA 1NXOA 1EM8A 3SLKA 3WMEA 4FSXA 1NR7A 3P2KA 1RHJA 1YRQA 4BZXA 5ALPA 2ZCJA 3QU4A 1F1JA 2VDNB 1W4BA 3CRMA 3DC7A 1RYZA 3DMTA 5F12A 1J22A 3X1DA 4YR7A 1NN5A 1Z26A 5A4DA 1XMSA 1OAOC 2ZI7A 3QX3A 2NV0A 2PH5A 3W78A 4EMBA 4BNVA 4IHJF 1Z9BA 3A7DA 5E9AA 2G80A 2VF2A 4NRDA 2FMKA 3FBWA 3KKEA 3MUOA 1CQIA 2RH9B 4M9RA 5DTRA 2QYOA 2O6HA 5K6TA 1R0CA 1U99A 3GUVA 3NOQA 3OCZA 2PCJA 3F3YA 3PQEA 4UPDA 3Q10A 4RDCA 3U17A 1VXRA 4N9QA 1C4OA 2RGUA 5TXGA 5K8VA 3OIYA 1OCEA 2Q4EA 2VBCA 1H5QA 1D0SA 3PYLA 2O8DA 1FX0A 1RQLA 1NLYA 2CLKB 3FLEA 2W37A 3EOBI 3GLHB 3IURA 4L2IA 3REFA 4BWGA 5F33A 3TRDA 3DHNA 4BIMA 5JMWA 3ILVA 3UAOA 4O2AF 3K0CA 4FK8A 3FTFA 3DBRB 1G5TA 1EVKA 4JJFA 3RWMB 4CF3A 5LD2B 3I8SA 2R8XA 1C9JA 4MWEA 3RFVA 4JUAA 2CXPA 1T5BA 4J7XA 5TMPA 2WU8A 1UK7A 2JHFA 2QRLA 3ANTA 3H5WA 4G0QA 2PXCA 1YR3A 1B93A 3EEBA 1FB5A 2XVXA 5KSYA 1RAHA 2PKRA 3BMNB 3E9MA 3IT3A 1FVOA 2QGFA 4JENA 2L69A 1K2VN 5E9WA 3QITA 2XOKD 5HIAA 1L5VA 2L2QA 3GT3A 4L9RA 3UA3A 3AIMA 3AOGA 1MA0A 3V4FA 1M8JA 1Z6GA 1WSBA 2Z4SA 3ISJA 4P7FA 3PJGA 3LQ4A 1ZUIA 1JMVA 4MKRA 2JCVA 5DDIP 3R8FA 4KE9A 3TK1A 2Y8EA 1T4GA 4ZVRA 1U5AA 2GF0A 2QY6A 2Y76A 1VPDA 4HVAA 5HK8A 1KZ9A 5DP2A 3VU1A 4EY8A 5JY1A 1PGPA 1KO5A 2IPXA 3FNHA 3R0XA 4ZVVA 3TSCA 4YRGA 4RTPA 2H1LA 3WIEA 4DGQA 1J1IA 4MRRA 1TMKA 1RHMA 4ZVSA 1HBJA 5DTJA 3QUAA 5FYDA 3TRKA 3PQ2A 4B6JA 2P65A 4P86A 4CLHA 4C7XA 4W4TA 4FGKA 1S2IA 1ENYA 3BGOS 1AY0A 2HC9A 4RL6A 1DJNA 3QTTA 4L50A 3ZU4A 4ETNA 3J7TA 5CTJA 1GA6A 4L5JA 4ZZ1A 1NONA 4ZPXA 1FP4A 1ST3A 3NKLA 1JV2B 2XRMA 5JPIA 3SBEA 3UATA 1MO5A 2R3SA 4HV4A 3OTOB 3AI2A 3NM6B 1KTIA 1DMRA 2QSYA 3ZJYA 1UZMA 1VL1A 2NXNA 3AFIA 3LKZA 4G0WA 1FDIA 4NU5A 5GWXA 1TFRA 4E5VA 2FR1A 1TCVA 4H35A 1J00A 2DE0X 4KACA 1T34A 1AUVA 1MJGA 3UK0A 2X15A 3K9GA 3MJVA 2C4UA 2O14A 3VHLB 3K2BA 5CB4B 2H92A 3AC0A 1NM5A 1T3GA 2VUSA 5JROA 3TI9A 1WD7A 2NG1A 2ZSDA 4H4DA 3WKBA 4BB5A 4XFKA 2ZBVA 1QJ4A 3RTDA 2C61A 3ZCUA 1UWKA 1U02A 4KOEC 3LBYA 4TZ6A 2W6PA 1KEEB 1YFKA 5DHPA 4MCIA 4AWXA 2BHSA 4KC0A 1Z8NA 2R62A 3CF0A 1VKRA 4I1SA 3V1KA 2AE2A 4ZT7A 1X6VA 2W0SA 1OUMA 3GPBA 3KKNA 1RU3A 3UBTA 1WXFA 3C5WP 2XCSB 1QVZA 2CL5A 3IHLA 1KP2A 2C8VA 2PGIA 1G8MA 2HDNB 2ZPUA 1KAQA 5T67A 4C87A 2AOXA 2CLOB 4KDEA 5TSDA 5BSMA 3OTHA 5IVDA 4QGFA 3KQOA 2J09A 4G25A 1H42A 1W96A 1F2DA 3K09C 1RPAA 1N6RA 5F3RA 1JZSA 2WHXA 1I7NA 3N2ZB 4KIFA 4RY2A 5L3ZA 3JZAA 2ZSKA 5HTKA 3B3GA 2CMGA 2JDIA 4J4HA 3I1FA 3KAJA 3QXGA 3S27A 1YZHA 4IFBA 4CU2A 3QFRA 1GFZA 1WDMA 1MH1A 4KKVA 4L73A 5LC1A 1K7SN 4ZI7F 4X24A 2JGAA 1FUKA 3FWHA 1R0ZA 2O0LA 2QTLA 4ND8A 1UKEA 1ZMRA 2OBNA 1AQYA 1SBTA 1PG5A 3MWDA 2Q3MA 1MT3A 4NBSA 4GOLD 4UBLA 4CYMA 8ATCA 1VE6A 5ALQA 2C42A 3OFNA 3SP1A 5LMUB 5INTA 3ZHVA 2XT9A 2GM3A 3ACCA 2GHTA 3IIKA 3WL7A 3SQXA 1B2LA 2WZQA 1TRKA 4R84A 3EQ2A 3EZ9A 2A9QA 1I3NA 3EZFA 3IT2A 1Y80A 3JXEA 3KR1A 3H0CA 3KYCB 3M6UA 3OOYA 3LBFA 4X90A 4BAGA 4Y2PA 5IMSA 1EINA 2I2XB 2Y6VA 1J9EA 4AG6A 2WR8A 1VM6A 4N0MA 4RPLA 2IEYA 4UU7A 4BNWA 1A5AB 3GLVA 3O93A 3U13A 2WD7A 4LGMA 4KP7A 4PFJA 1UFOA 4HEA1 4TQAA 2W70A 4MOWA 2C4TA 1ZH4A 1GAWA 3WP0A 1WKVA 1AT1A 1NBWB 1N2CB 1U0GA 1WB6A 2XGGA 2O1EA 3EK2A 4PFKA 3TX2A 3ZXIA 5FNZA 4KJXA 1ECCA 1WX1A 4BX8A 4UUPA 3B12A 5AW7A 4DIKA 5HYVA 4NFYA 2HO5A 3H9CA 4L4ZA 1MG5A 2ODAA 3NANA 4PG6A 3ZJTA 5EJ7A 1GDHA 3CNNA 3NIDB 1B6RA 4GH5A 3U4QB 2VJLA 2V5UA 3FOCA 2GKGA 5ICEA 3G85A 3KV1A 3WS7A 3UMSA 1QIHA 2FTKE 3TR5A 4RDIA 1EBBA 4LEIA 3M5DA 1JKFA 4B4VA 3A0RB 2FUG6 1ULHA 1PEAA 2PVPA 1QK4A 1Y5MA 2REQA 2I6XA 3D3EA 1NXSA 3BXGA 5B57C 5LD2C 4EHHA 1O0CA 1VLQA 3MUFA 1OZHA 3GDGA 1NFFA 3QLTA 1XBTA 1ZN8A 3PGMA 2BAGA 1LUAA 1UXIA 2NTJA 4XGQA 5E2AA 2HHAA 2ZJ4A 3DEFA 3R3WA 4KX3A 1H2XA 2NO9A 4R7GA 4XEHA 5GMOA 3BIOA 1AKRA 3NOXA 3CG4A 3QNMA 4LCBA 4QSHA 2D3TA 5LQRA 3P27A 2VJYA 4C0WA 2AF4C 4KGXA 3SLRA 5DI3A 1Y9AA 1W4ZA 3JV7A 1FTGA 4D6YA 4WH0A 4GOJA 5LQMA 3CNOA 4CTOA 4NSNA 3GX1A 1ZDMA 3LX4A 3FPFA 1CUBA 2WT4A 5IPFA 1UOPA 1BMDA 4II3A 2XUDA 3INGA 3HV0A 5TRTA 5GJCA 3WSVA 4YFVA 3IVMA 3A3PA 1C9MA 4MVWA 1K7XB 2ZPTX 1Q7BA 1PZGA 3G1TA 3QVGB 4IXTA 4TXNA 1KU6A 1Y81A 2JAOA 4BZQA 2JDID 3HR7A 3QELB 1H2FA 2R86A 1SQSA 1JR4A 3UB2A 1AK9A 1HDIA 2EIHA 4YDSA 3VPAA 1MZPA 3EXHB 3R76A 3L84A 1M2GA 3QPAA 2JBAB 4GBJA 4DHEA 1AN9A 3V1MA 1L5RA 2P8JA 3FUCA 1GARA 4AY3A 4BPRA 4P32A 1A7JA 2CMHA 2H4HA 2AN4A 3DKKA 1Y3AA 3S1AB 1KFJB 16PKA 1RM5A 3ET5A 3K3PA 4OHWA 4NMWA 1AQUA 3O8OB 5JCOA 1BE0A 1P5RA 4MZDA 4N5HX 2GN6A 5K0SA 3CLKA 5A9RA 2IYPA 4GI5A 4KGDA 3PFGA 2DTEA 1ENZA 4XM2A 3UGQA 3FVTA 3UYKA 3AB3A 2RHWA 3C3BA 3CWZA 4U6SA 1M5UA 2E21A 5D00A 4O4IB 5DLEA 4AXXA 3N2GB 3DWFA 5GZ1A 1NJFA 1XNHA 4HQKA 4BO1A 2WAOA 1XRJA 2BFOA 5AVYA 4ZC8A 5LBTA 3FPBA 2DSNA 3NWPA 3W6OA 5CDGA 3WAKA 1RHKA 3LX6A 2WHEA 2O54A 5EE5B 2E4YA 1UBSB 4C5AA 2CJXA 4EHKA 3GH3A 2FEKA 1HPLA 1WULS 1A9PA 2GSDA 2XE4A 1C30A 1J70A 2C2MA 2PD6A 2GQ0A 3KQTA 4KKXB 3ZKAA 3L4JA 1OVGA 1RR6A 3PLNA 1IQPA 2X3FA 3LECA 1CDEA 1UKBA 3QW4B 1KKMA 1H93A 4EUNA 3O9ZA 4M9CA 1GGMA 3N05A 1TIKA 5K0TA 3G2KA 5ALUA 5E8JA 4TM7A 2JW5A 2R68A 2Q41A 4KNVA 4OMCA 4CDRA 1C7ZA 5IDQA 3NIGB 2RKWA 4A8JC 3N8DA 4WA7A 3ZCSA 3NP7A 4NG5A 1RQXA 1N36B 4QQNA 2Z5LA 4AJJA 4UEWA 4MV6A 1H2YA 3O8BA 1HG1A 4MEJA 2HNAA 3RVQA 3ONEA 5HBRA 1N5JA 1Z4NA 2A57A 3BB4A 3V1UA 1FFGA 1L4EA 1VHLA 5I7SA 1T4CA 3MSCA 2WI8A 1A77A 1BRMA 3CHYA 2B8EA 1WKCA 1Y82A 3UGTA 2ZSHA 3DTTA 4G0XA 1LBEA 1ZS9A 2LIPA 4YJ2B 2ID7A 2XWPA 3H2BA 3IXLA 5AKJA 3X1ZA 2FQ1A 2GZRA 3H83A 2HSGA 2AIRA 1VRCA 3HPRA 4G4JA 5K51A 1EHIA 2FEPA 2FN9A 3WKEA 5IULC 2PUAA 3DCJA 3ML1A 3OFND 3N2IA 4AZ3A 3AW9A 4NBLA 4B7ZA 1P2GA 2XQJA 4LMBA 4JGBA 1N33B 3QG5A 3WRXA 4B87A 5GM1A 4OL9A 5C80A 1PJRA 1AUPA 3GU3A 4H27A 4LQLA 4YIHA 1RABA 2GXAA 2FRDA 1QS0A 4MYSA 1GLNA 1DUVG 2P6MA 4H7IA 3EQ6A 4Z9YA 4Z7JA 4FS8A 5FBKA 5ALHA 3R1IA 2PGDA 5FTJA 2R7AA 1IAVA 1ONOA 3KZKA 5AD1A 2OAP1 1WTAA 2HHCA 5F1KA 4CWAA 3LC7O 3PVSA 4Y9SA 3TSOA 4BJ5A 2QR3A 1C81A 2UAGA 1J06A 2XE6A 1BMTA 4QU9A 3Q9LA 4KL8S 2CNLA 5FHQA 4NU0A 3IIJA 5EN4A 1KQFA 3CNHA 1PZMA 4QARA 5JFGA 3E22B 1A7AA 1E9VA 1P81A 4S2UA 2FZVA 3KU4A 1VI5A 1IPFA 3AETB 5I5EA 3E05A 4TPKA 1L3IA 3SZUA 2O52A 3TJRA 3H1FA 4EA7A 2J7KA 1U5BA 4QVKA 2C7GA 2FDRA 3HYRA 2XRYA 4EHJA 1XZMA 3U3ZA 5KPJA 4Z9BA 1N6IA 1B6TA 1I4LD 4ND7A 3K0CC 1JEYA 3HU5A 2BGGA 2BT4A 2DJ5A 2TMYA 2P2GA 2NSLA 3RUEA 3W3AD 1GGHA 1V0JA 1OLUA 5KJFA 1BXRA 3FAZA 4ZYXA 2XOEA 5EE1A 3OA0A 2ECKA 5TPWA 5LZ7A 5JARA 4NCJA 1T1GA 4YLGA 3REGA 3T94A 1YDFA 2D4AA 1Z5NA 4ACAA 2BBTA 2ZITA 3ABQB 2VWHA 3CRRA 4Q37A 3AFNA 1FJ2A 3P7MA 5KSPA 4CV0A 2QW8A 4NXMB 1Z7WA 3BFXA 3D6HA 3VRHA 2UV8A 3CR7A 1ODSA 4FIDA 3WWEA 3M0EA 1XWWA 4IH4A 1XDWA 2WVGA 1JI3A 1II0A 1T0UA 5HDQA 2GCOA 1E60A 4V24A 4G1BA 2WE7A 4MUNA 5K3SA 3WSWA 2C20A 4D9KA 1C3XA 5THQA 3KQNA 1NOIA 4NZMA 1B76A 1COWD 1N7JA 1TA0A 3OZIA 1HMPA 4GPZA 1P2VA 2QJRA 4MTLA 4GZ6A 5G0WA 3UJ7A 1X8XA 1T3TA 3H99A 3K0FB 3O8QA 3AIOA 1N78A 1DOAA 2CDNA 4BNJA 2Y9MB 4H77A 3MGAA 1I8TA 4PG7A 4RPJA 1GPNA 4ZO4A 3VZQA 4YH1A 4PPYA 1F12A 5ALLA 2V6MA 4YJHA 3UUWA 3MBOA 4YRCA 2YNMA 4DLSA 4R0MA 4RKYA 1ONSA 2ZT7A 2ODBA 3DONA 3GCZA 4OK6A 5EQFA 3WDSA 1QIMA 4GAEA 3ZV5A 1SCJA 3ONDA 2A0KA 3W05A 1TQDA 4MLPA 2Y3IA 1XZGA 3TQTA 1JAYA 2D2FA 2OOSA 1B8VA 3F1LA 4W5HA 3NNNA 3WQHA 2GEJA 4JDUA 3I6QA 3CBQA 4LXYA 3SSAA 1ZRNA 2HMUA 2XMPA 1ZGHA 2VRNA 3ETEA 2FHPA 4Q93A 1QFYA 3L8ZA 2VLIA 3IDZA 5D6NA 1JU4A 3ROZA 2J6HA 1EFAA 4FFPA 4IHQA 1EX7A 2IUEA 4DILA 3JALA 4DLAA 4JXJA 1WMAA 4ZCIA 2XZLA 3LRPA 3E9QA 2Z8XA 2BOVA 4D9JA 3AB7A 4MMZB 2OGTA 2XCOA 3L7JA 4PQFA 3ZJUA 2Q07A 2D54A 3KQUA 3JAKA 3T4UA 5AVOA 1P6XA 4OAPA 4OHVA 4RDHA 3S2EA 4E13A 4E12A 4LPSA 4NS1A 4AS2A 3H7IA 1SG9A 1Z88A 2EJUA 4QL3A 4MI6A 2CB0A 1JKMA 1BHSA 1GSIA 4PLYA 4UZSA 4CKBB 2HT1A 3I09A 1RBQA 1RLIA 4A8JA 3CW2A 1CFJA 4M36A 1Z5ZA 1I3LA 3UTCA 2J7PA 2Y05A 4TTRA 3VKWA 3OZ7A 1AF4A 3R7AA 1CC1S 3TKYA 3WQBA 2HK8A 3CVYA 4JELA 1EFPB 5LJLA 1NLUA 2BI4A 4CU5A 4RUKA 2HNKA 4LV8B 5H5JA 5SY9A 2NPFA 4E5NA 4G5RA 3L18A 1WXDA 3OLZA 4YO7A 5EIWA 1XI2A 1V3UA 1M2OB 2G5GX 1BXGB 3PL1A 5HVNA 3EHDA 5IFLA 4DWOA 2JK0A 1COZA 3QE3A 3MINA 1GZHB 3G2PA 3FWKA 5EWMB 4DZZA 4LECA 2GXUA 2RAFA 5I7VA 3BK1A 4CEHB 4REOA 1XF1A 2HSWA 1XQXA 4PONA 1LPOA 1ZH2A 1JZTA 4CE6A 3WZ2A 2H5JA 1ESMA 3AF0A 4N12A 4GXRA 4B3GA 1LVGA 4WBNA 4E4RA 2NTVA 3PU6A 5LZ5A 1HSZA 1GZ6A 2PWPA 2K2WA 1SG6A 5BWCA 4HEQA 1WWKA 3K9QO 3ZVLA 5IH7A 4GD3Q 4X93A 2XR1A 5I4CA 3C1TA 2HMTA 3SEQA 3Q7RA 3ELDA 3FHCB 1ULBA 3R44A 1J7KA 5HKOA 1IQUA 4DCJA 1O7JA 2QMHA 4I7EA 3W6NA 5IXYA 1GRVA 2Z2KA 4DLUA 1QUEA 3ZHYA 2XWBF 4PXSA 5KJCA 1SKAA 4UAGA 2Q1YA 5ITZA 2VZ9A 2E4UA 2AB0A 4CMIB 5CNKA 2QQ0A 2P91A 4HNAA 3CF2A 2QL9A 4P58A 3WIUA 3ZZUA 4F9EA 4YMHA 2VK1A 5BSHA 2PE5A 1DSSG 4CETA 3U81A 1U6IA 1CJKC 1L4NA 3IRUA 4M0FA 4C07A 5H59A 1K3UB 2OM6A 1A4XA 1GV0A 2X2EA 4CTJA 1F6WA 2PX6A 2ZJ1A 3U61B 2QTVA 2IHTA 2JIPA 1TA4A 2Z58A 1TDJA 4DCTA 2ZTVA 2I99A 1Z6XA 1HEUA 3HU2A 3ULKA 4ZT3A 3RHFA 1SIBE 1ZW1A 2E6KA 1H6CA 2WWIA 1WHTA 4JH0A 4L7VA 4P3YA 2CWWA 4NESA 1X1EA 3NIFB 4BVLA 2ZRIA 3GG2A 2RHRA 3DPUA 2VF4X 4D3SA 2WWVD 1XOIA 4HK4A 4ZCPA 4ZZ3A 3C6XA 2AKAB 4KXMA 3VYWA 5LBUA 1FUYB 1G20A 2WT9A 1Q3TA 1ZGAA 3KWFA 1D5CA 1ND5A 5IUJC 5MHTA 5JSZA 2Q0SA 3EIOA 5I45A 4FDLA 2OORC 1FNSA 1T24A 2C5LA 5IU6A 4UTNA 1KJIA 2H2AA 2YASA 3K2QA 3NYQA 3DR5A 1MX5A 1OBOA 3E1GA 1RLJA 4KV7A 4AG5A 4HNTA 4ENQA 2BI8A 4Y9TA 3CF4A 1DCFA 1PSWA 3O8LA 4AY2A 2FSFA 1KYVA 2HA0A 4HUJA 1TUGA 3I72A 1AF7A 1TQ2A 5J5AA 1OREA 2KLHA 2X9VA 3ME5A 2VKTA 1OHHA 3O26A 4RAOA 3EGXB 1N34B 3GJQA 1E0JA 3ELUA 4U7PB 5GOZA 2AI3A 3HO6A 2AUTA 4IHJB 1IVYA 2QRPA 3BXFA 3C7DB 4RIHA 3ZNPA 4F93B 5F2OA 1QYXA 3GQBB 1E3QA 1NQTA 1Z5OA 4WZAE 4BO4A 5JY6A 3E53A 3SC2A 1ANKA 5CTAA 2GK6A 1IUNA 2ZBUA 4FU0A 4NVRA 4LDJA 4E31A 4ZI2A 4JSRA 3SC2B 2CXXA 4MRNA 3GD5A 1GP2A 5EHNA 5U9CA 2NZ8A 5F73A 4ZODA 2IW3A 3QEMA 3QVWA 4FD3A 1WR8A 1TO6A 1U2EA 3AFGA 4EYSA 3ZIAD 1YZKA 5KYYA 1Q0ZA 1RRFA 3C8ZA 1DRUA 2GZHA 4CMEA 3AR3A 4KR2A 3DOFA 4O2AB 2WZBA 3AUFA 4IIYA 4IIJB 4QEZA 421PA 1LTKA 2CDCA 4L9AA 2SCUA 4CJXA 4G67A 2M1XA 2XX3A 3WBKA 3WLMA 1BDJA 1LRLA 3CPEA 1UOQA 2OVFA 2QNBA 2XYPA 1NVFA 1R0RE 2FQYA 5EWJA 5ITSA 4FJ2A 5KOHA 1KEWA 1VBNA 1X1BA 3QEKA 3H5VA 2VK8A 5ENZA 1Y6JA 4DXDA 4UPVA 3C0KA 2G1JA 1X74A 3P9PA 3WLLA 1QTRA 1WXWA 2GBIA 4NC9A 5CB6A 2PS0A 3ZHZA 3GLFE 2G70A 4TSFD 2ZU6A 4V0SA 1LVUA 4JMLA 3UMYA 4BXOA 1TEVA 2HU7A 1OHHD 3ZDRA 4C6HA 4BFUA 4DQ0A 1C0KA 5AR1A 5HS4A 3DE1X 5T64A 5JNSA 1HKHA 3GH1A 3A06A 5J3JA 1NT4A 1ZL0A 1WBBA 1FX0B 3IQGX 1B7GO 2CFIA 1FEZA 5DN6D 1MVNA 5CPBA 2PZEA 4L5IA 3GFSA 2ZIGA 1QXSA 3Q2OA 4WINA 2FQWA 4BQIA 3ROQA 5IJAA 5K20A 5JLAA 1BCRA 3OEEA 1P6UA 5EP2A 1VDZA 4Q12A 1B1CA 1NF3A 3TVTA 1DWPA 1U80A 3HB7A 4N1AA 5HBGA 3W8DA 4BL5A 4CKEB 5EMHA 4XYLA 5KBYA 2G04A 3JVUA 3N76A 1C1XA 4QUJA 2P1RA 3K1TA 3SNHA 1D6NA 1ULUA 4IXWA 5EIAA 5JYBA 2BGRA 1S2GA 2PYZA 3BXZA 2CW5A 3DB1A 4HDMB 2C29D 4IXDA 3ZHCA 1NJ5A 1VJCA 3VC3A 1WBDA 1UADA 1N6HA 1OLOA 2YFQA 3I01M 4G2NA 1ZJ6A 2FG5A 4NOJA 1W2GA 1YRLA 2OCIA 4BNDB 3RYCA 1XEFA 2MINB 4IFIA 1Z22A 1JGTA 1QHEA 1SUFA 2MSKA 4OSPA 4WOBA 3TIVA 2OBFA 3K32A 3KEOA 2A58A 4QWMA 4MVJM 1EP1B 3TSZA 2CNWD 2AEMA 2AZMA 3VR0A 5L3SB 2FF5A 4W5JA 3ZDQA 3IHKA 3FVQA 1UBFA 3KLPX 2RE8A 4WY2A 1WF6A 3ZE8A 4C7MA 3Q40A 3W4KA 4O4HF 1PVVA 3CW9A 4MARA 2H07A 2NV6A 1O6BA 1WQ3A 3GB9A 2AD1A 3NBUA 1QHGA 4MRVA 1E99A 3BPSA 4N5MA 4FOSA 3IYLW 4PSCA 3RUIA 5BQFA 3N2KB 4QRDA 1ABFA 3CH4B 1MC8A 1ORDA 3QOWA 3NW9A 3ANXA 2AFHA 3HKEB 2FW7A 4TWJA 2C4MA 3ZDXB 2FWMX 4X6XA 5JAZA 3AMVA 3Q7PA 4LUCA 4TV8B 4D4MA 1XQVA 2RHJA 4BC0A 1YL6A 2D13A 3QHPA 3RVPA 1EJ6A 2PA0A 1U0EA 2EC5A 3MERA 3NDPA 4ZRDA 1RI2A 4B47A 1YU6A 4F8EA 3JTMA 2FETA 4QAQA 4DN6A 2FPLA 1L7AA 2QZPA 5F7XA 3PFHA 2ALJA 4FSDA 4Y0AA 1MG0A 1NN3A 5J4LA 3A04A 3MB5A 4XDGA 4DEXA 4X8LA 1AHHA 2B9EA 1SA0B 5FIUA 3V4LA 5KI6A 3WRXC 1U0NA 3P19A 3CCBA 5AW0A 1Q1GA 1W1IA 1B26A 3I6IA 2JGFA 2XTZA 2HK6A 4QNNA 5F4BA 3RUFA 1J20A 3BC1A 3CISA 3H1TA 2D0PB 1U8TA 1UBKS 2HSJA 2X5NA 2IDKA 5CFQA 4A6XA 2EJWA 2XZPA 3U3XA 2X8LA 4G5OA 2FN3A 4B45A 2AK3A 1G5RA 1IN4A 2FNAA 1FVXA 2AGVA 3JATB 2QMYA 4JITA 4IDDA 4KG7A 4HRVA 4N82A 4QIHA 3ORSA 4RJ2A 3HUTA 3ANYB 1P5FA 2JI8A 7ADHA 1B23P 1EJ0A 3SR4A 4RVSA 1P39A 1U1FA 4E0BA 1TTTA 2FRVA 3BWDD 2NXCA 5EUCA 3PX7A 1VIVA 2QM8A 1PR1A 1NP6A 1SXJD 4R1SA 3EB9A 1SUSA 2BD0A 2WM9B 1P7PA 1YZVA 3R4VA 1V2HE 1R1DA 1XU4A 4HGYA 4RTNA 1S6YA 4FI3C 4PGFA 4QUBA 4H1WA 2HOQA 4M60A 1VYVA 2WKQA 5WRFA 3KSBC 4WXMA 5IXSA 3SR3A 5EQDA 4A1FA 1R4NA 2DULA 3EAGA 3HVIA 1SVWA 3PNOA 4BJ1A 2IBTA 4XKJA 2M6LA 2NUAB 4A10A 3G5MA 1H2EA 4FSHA 3QNWA 3D6VA 1IG3A 4WV3A 5B1EA 5LXTA 3KKLA 1R8SA 4JY7A 5GOTA 3MBIA 2BMWA 3ND6A 4BPBA 2ATIA 2OQRA 2I3ZA 5CK4A 5BQOA 1RBMA 4BV3A 5DRTA 2QXTA 3IP9A 2VZ0A 3O8NA 2EJCA 3WTCA 1DIGA 1FS5A 4N5IX 3D0RA 4FKBA 4FHCA 1GNRA 2PEYA 3HVUA 3DV0A 5TJ9A 4ZOCA 5HRAA 5JXWA 1PO7A 5KNCD 1XXHB 3A11A 1FJXA 4F4FA 4KQJA 4NEHB 4O2AA 1Q3KA 4G0OA 1NQAO 2AX4A 4AYTA 4ZHSA 1R66A 2JIRA 1C5KA 3IR6A 4YMTA 2Y0CA 1IOWA 1KY5A 2H1VA 4AKHA 2AJCA 2FUEA 1HEIA 2FCRA 1ZIOA 1DBWA 1SULA 4IJUA 1XU9A 1TZ2A 1U1IA 2Y2UA 1JG7A 4Z9FA 4ALKA 4MPPA 4RVFA 3PVZA 3TTTA 3DMTC 5IASA 5EKTA 2QMEA 5ICGA 2LR0A 3T61A 2YXEA 3CURA 3BVPA 2XMGA 1JEEA 4CLOB 1EVJA 4PRKA 1FQKA 1W88A 3OY7A 2C5FA 4LDRA 4EBFA 4DC0A 4QHSA 3DAHA 3KVVA 4JCCA 4CCAA 3COSA 2F43A 1G5FA 2QTBA 2YN0A 4AM8A 4ENRA 5AESA 1EDOA 1BDIA 4HWGA 1YJAA 3DFMA 2FSVA 1EVZA 4IICA 3HXKA 3HJBA 3NNSA 4OY3A 2QOEA 3IKMB 2ZBEA 3VDNB 3EC7A 3GJZA 2DETA 4G1VA 5BV7A 1I0LA 3BWEA 5JTTA 4NFHA 1L1QA 2EW2A 3C7CB 3KUXA 3GLIB 2VHUA 5IW8A 3O2QB 4P80A 2QE6A 3U37A 4BZPA 2WFMA 4JP2A 4XQEA 2GEKA 4JHXA 2PIDA 3WKDA 2H08A 2WSBA 2O20A 2O2HA 2C96A 3ICOA 4YAFA 5LYJB 1HZJA 1NU8A 5E1MA 2I1WA 3KYBA 4ZRMA 3PR1A 2XJ9A 2VDUE 4B4WA 4CR7A 4MS1B 3WGKA 1G0OA 2UUOA 1PX0A 1UBNA 3DBOB 4A6DA 1JYFA 5ES4B 2YRWA 3NFRA 4MPRA 1EHCA 1EUQA 2AV6A 3FUUA 4POOA 1WV1A 4ZVPA 5G0VA 1AX9A 4EL0A 5CYGA 3G2NA 2AS0A 5L9AA 1U8EA 3BMCB 5JCZA 5LXTB 3TG2A 1OH7A 2OHOA 1UXOA 3DXYA 1R4NB 3GAMA 3NWBA 2REXB 4RIFA 1F2TB 4W63A 4JLWA 1JA9A 2J6IA 5LDGA 3DMYA 2QUAA 3VOTA 2PHZA 2O3JA 3LWNA 3L8MA 4HEA6 4PZLA 2V7PA 3GP5A 1DX6A 2KQUA 2H59A 3BTSA 4QSMA 4Y6RA 3VAAA 4BBZA 5TQ2A 2AVDA 1LK5A 2CCKA 2BN4A 2I3GA 2H1WA 5GGYA 4FQ7A 1BVRA 2JI7A 2P1DA 3COPA 1H0RA 1TM2A 4K8RB 4M0EA 3SI7A 4YUXA 3SEAA 2PUVA 4HT3B 1JF8A 4DV5B 1H4SA 1V43A 3TIFA 1RWQA 1C3OB 1K8ZB 1GXSB 3WKAA 1I30A 4AZ0B 1T2UA 1TYZA 1MEEA 1QNLA 2EGGA 3L5KA 1HYGA 4NATA 2X13A 5EGNA 2J9ZB 2WTUA 1V8OA 2C7BA 2QK4A 1BAPA 1Z7BA 1KQ3A 1I0ZA 1KVTA 3WLSA 4PEVA 3D7LA 1W49A 3R0VA 5HKLA 4YAWA 2IYWA 3GT0A 5JZOA 4AQYB 3KXPA 4OGGA 3X1MA 4D3DA 1NVKA 2QU7A 4P4LA 4HDQB 3R9XB 3OD1A 1A04A 1JBQA 1ACJA 5CEFA 4DLTA 3H2HA 4CFZA 3NT4A 2HA4A 3RYTC 2DECA 4MVXA 1MTZA 6ADHA 2O2EA 4QO8A 3KHKA 1SXIA 1LPBB 2WICA 4MUGA 2QJOA 4E51A 3ZZNA 1AQNA 4R2HA 1KI4A 3OOSA 1QIKA 1TUIA 3EDCA 4P22A 4UTOA 2F3QA 1VE9A 1C29B 1OBHA 1P2BA 2FSSA 3IR5A 1OFVA 1SXQA 1NDUA 3IP1A 5DIFA 1W35A 1CCWA 1V8PA 1JXOA 4L5YA 2XADA 4AK9A 4QC2A 5L40A 5KSOA 5EJ4A 5CEJA 1W1UA 5KVSA 3WHKA 2Y4NA 1S2NA 3OH8A 1NVDA 4H1TA 1NVGA 1PWZA 2QTHA 2F3TA 3WMXA 3HPQA 3X2FA 3CZ5A 4B3XA 2H2HA 2RIPA 4C7BA 1AE1A 3CPSA 3LBNA 4KWEA 3WMFA 2V74B 3QA9A 1VHTA 4DLWA 4JEMA 2ZTUA 2HA3A 1JHOA 2WAYA 4C4OA 1GADO 5DWVA 2H51A 4DMCA 1QHYA 4U1RA 3HDJA 3IGFA 1DBPA 2DUJA 4H1VA 4C0JA 3ZEAA 3AKYA 1EM6A 1UXGA 4N5LA 5HJ5A 1P91A 1P4AA 4U8GA 3R2JA 4OI4A 5ESXA 2DUNA 5AM2A 4DBVO 2R84A 2NYVA 4DGSA 5DI3B 2Z6QA 4P2BA 4IDQA 5ARCA 2F2TA 3Q3EA 1BIFA 1FUIA 4PAQA 5AM0A 1UBUS 3VHXB 5JI3E 3DF7A 1JAZA 1WNFA 1EGQA 3L0ZA 3K0HA 3O3CA 3QWIA 3PWZA 2IFTA 3OZEA 2V96A 1E5LA 4IIGA 2QX8A 3DD5A 1CY7A 2HZBA 3O4VA 2Z08A 4PLCA 3A9CA 3LOQA 3T7SA 1IBSA 4AMGA 2GJSA 1N2IA 3DMHA 4DQXA 4RV5A 2V97A 4PHFA 5HILA 2VZLA 5L95A 4K9LA 1I2MA 1JG1A 3TIXB 5L3QB 3P1JA 2BDTA 4EDFA 4UM7A 5LVAA 3Q7QA 1W36B 4ZAYA 2VOJA 3CG0A 3MCVA 3A58B 4FWIB 4GMHA 2R6DA 1IIRA 1RT9A 1JW9B 5AKZA 1SCDA 4FR5A 4FW9A 5AHXA 4B79A 5EZYF 1EH5A 1M1NB 1HT1E 4J1NA 4PFSA 1GD1O 3CCCA 1VCMA 3AEZA 4MSUA 2BM8A 2HWYA 4P7BA 4ERNA 4MKFA 3V42A 3S7TA 4B3MB 1SCUB 2B35A 3MJHA 4RK7A 4EPTA 4XRGA 5CB0A 3MELA 4WZBA 3T3IA 4ZMSA 4AECA 4US1R 2A1IA 3PCTA 1OYOA 1XCJA 1LTHR 1MV8A 1E1RD 5FBWB 4DHWA 2VJOA 4ABYA 1RHQA 3GRYA 2CXQA 3AYXB 4B3FX 1KC1A 1L2TA 1JLSA 2NVBA 1FYFA 2ZETA 3AJRA 5ELLA 4HGRA 1ZR2A 4LNAA 4S1WA 3WGMA 1P2FA 2MTBA 1EGMB 3QBVA 2CXOA 4QASA 1E94E 5AVWA 4MW4A 3SIXA 4MW5A 1DBRA 3RUCA 3MHPA 4DQKA 5HTOA 2ZGVA 2MSLA 3BT7A 4EYQA 2PZJA 3P9QA 2IYUA 4J3FA 3N39C 1K2WA 3ABZA 3AHHA 4ZEXA 4LJ9A 4LS3A 2WJYA 1GN9A 4J0JA 2OOKA 2ODEA 3I6MA 1U1GA 3QYFA 5AJXA 4I4TB 4ZVLA 1HI9A 2DY1A 3E2PA 1NQ5A 2I2AA 5EE0A 4OBBA 2OXCA 4HYYA 1RI4A 4XGKA 3S5UA 3Q8WA 1ZM7A 1C9EA 4FILA 4XOUA 5JJCA 4Y8VA 3ZGOA 2C2WA 3I9V6 5EXEA 3VAYA 3QZUA 4KYIB 4R98A 3IL2A 3QIAA 3OQBA 2YOFA 1PG2A 3O73A 2PM8A 5AVUA 4ETIA 4YMWA 5ALTA 4IIXA 1XHFA 1WPGA 1T43A 4Q9DA 2D1YA 2WIDA 4RMGA 3QI7A 3L1HA 1Q0HA 3E81A 5EWMA 4HO1X 4Y1FA 4QYXA 4UEOA 2F3UA 2J3EA 4FBGA 3DAFA 3IUNA 5A5FA 1XPUA 3K09A 4YJFB 3HH8A 3ZS9A 4BYMA 1GGFA 3ANMA 3PZBA 2RBGA 1JIVA 1XNGA 2G8NA 4DSNA 4PHHA 1J5PA 5PNTA 2PJUA 3KJZA 1H23A 1DFIA 3PQDA 3IOCA 5JASA 2ST1A 2ZRDA 3DLCA 4MQEA 3SM3A 4OX9Y 1P0FA 3I2YX 1W6UA 2IE0A 3NC4A 2WUVA 4MVJG 5FPTA 3RYFA 2DFTA 3ZWWA 1QV7A 1UAGA 3EA0A 4EYKA 6REQB 1P9OA 1R6TA 2A59A 4LDNA 3WQSB 1W73A 3TLZA 3ZBUA 4P34A 4DUGA 1Z63A 3U7GA 2NP6A 1F17A 4JNCA 1KZHA 5KX5A 3VMMA 1EFPA 2QE7D 3GRAA 4I4IA 3NDIA 3LY9A 5DM0A 3RC9A 3ZU6A 4QKQA 5BV8A 4D74A 3NHYA 2FPIA 4O1MA 3AUSA 1XG5A 4MVJI 1E61A 4XYEA 4ZO7A 5BRAA 2FSGA 3QLJA 4M8LA 1IBKB 1IN5A 2G07A 2J1LA 1S1CA 1VHDA 4G81A 4KSCA 2WPDD 3ZCXA 4C06A 4S35A 2D7DA 1Z5UA 3RASA 3GVHA 3PFWO 2X0IA 2FSVC 4DSAA 1CY8A 3ZNQA 1E1CB 4PE5B 3B70A 2GERA 5DOZA 3IAXA 1W85B 3I4LA 2AJ8A 1IH8A 2FV8A 4LDZA 4E08A 1JALA 1E89A 1ZCFA 4PCLA 1NNSA 2N3ZA 3I52A 3LZCA 3A28A 1IPHA 1KRXA 4DR6B 3SX0A 4A5OA 2YYAA 4F4UA 1MT0A 2NYRA 1JG2A 1CZLA 2H1CA 2XCUA 2C2BA 4KWIA 4LYDA 1YMQA 2PLWA 3VR6D 4ADSG 5CDYA 4LF7B 1WEKA 1F60A 1ZVJA 3GRPA 4JCOA 1YQGA 3WIDA 1TZKA 2UYGA 1N1MA 3AB8A 2PUHA 5DI9A 3RIGA 1DOZA 2K7FA 1ATZA 3EBOA 1XTKA 2C5GA 1PJSA 4BMNA 3OLVA 4N3CA 1IZ7A 4OV6B 4Q6WA 1NBMD 1Q6ZA 4MS3B 4YRDA 3D3JA 1J25A 1XTBA 4PGAA 1W9HA 1RXWA 5IMBA 3JARB 3ZE0B 3I4FA 3NEPX 1U4OA 3U49A 4M0LA 5EXSA 1NF2A 4HDNB 4BRUA 3RS0A 4TRJA 5LQUA 3D0QA 1Y7LA 1V9CA 4R7ZA 3O8QB 1D1QA 5JC8A 4KFTA 2C9OA 2O1WA 4BOYA 2AI1A 1H1DA 3GAAA 5DE3A 4KAAA 1KWKA 2HHHB 4NOMA 1VMKA 1YZNA 4KN6A 3TO5A 1M2EA 3PCRB 3V7NA 4MRMA 4MWTA 3KJNA 5A5GA 5FCDA 3EVNA 3WQQA 2O3TA 1V45E 1NIJA 1JIIA 5YASA 4JIMA 1TEZA 1MUUA 3BORA 4ND5A 4PZZA 1AA6A 4B3SB 1MD9A 4L9WA 4Q19A 1NLFA 2OO5A 2ZLBA 2WFLB 1RE0A 4TVOA 3UHJA 1IXRC 4KXYA 4QDTA 4X62B 1JFVA 3H9EO 4Q4DA 4RZ3A 5CH5A 5FTMA 2NZUG 2KS6A 4H1UA 3RB8A 3V3KA 4B44A 4D98A 1AM4D 1B8UA 1ECBA 2ZTSA 4RMNA 1BGWA 1QHHA 3LT0A 5EMNA 2RGBA 1R9MA 3LWZA 1WUYA 1NP7A 1U9ZA 3PGVA 3G88A 3KHUA 4II7A 5SY6A 4UEKA 4U0KA 2GKSA 1XVIA 2PH1A 1HETA 1JAXA 4MKIA 1NW5A 2FFRA 2NW6A 3EH2A 4XAQA 3B7GA 1YQTA 3K71B 3LHKA 1DBSA 1PD0A 3L4BC 1CD5A 4G0PA 4W5RA 2XRZA 3BAFA 4BMXA 1T9HA 4KPGA 3RCBA 1B4DA 5FLYA 1VXOA 2MR5A 4JJAA 2GBGA 5DT2A 4BFVA 4RVGA 4CKXA 4COOA 4PC2A 4RD3A 2IOYA 2RARA 1XLVA 3CPJB 4GQIA 2DWCA 2O4UX 3TD2A 1UZUA 2GM4A 5G1NA 5EEGA 3NBFA 1M6VB 4JLAA 1RCUA 1ZD1A 2FQQA 1OXBB 2P79A 5GIPE 3UFXA 2EEPA 1W52X 3A1SA 5HA5A 1FRFS 2AXQA 2GRUA 1VB5A 3AR7A 4WX2B 4XASA 4YJ3B 5JJIA 4F12A 3NHPA 1KAMA 1JFFA 3OESA 2Z4TA 5LR6A 3TLEA 1PX2A 4QOGA 3PXXA 1OTHA 3VPDA 3PDHA 3IQFA 4B35A 1ISGA 1APBA 5ARBA 2O3RA 5BN4A 4N03A 4JI0B 1GR0A 5KVAA 2CHEA 1G66A 5H0IA 3W6UA 3V8QA 4PCUA 3LUAA 3FA2A 2RJ3A 2HBRA 4HB2A 3WZLA 1G18A 1ETHA 2QZSA 1NKVA 4E3ZA 2W6IA 3L6UA 4MS4B 1J6UA 1R8XA 3C3XA 3R3JA 1UM9B 2GEFA 3JD3A 1GL7A 4C30A 2WWWA 4UUQA 4NBTA 4Z54A 1IU9A 2R7LA 3B9QA 3BIXA 2SICE 4X20B 1U0FA 2GF9A 4H7JA 3W5BA 1NJ2A 3VUFA 1XLUA 4NP6A 2E9SA 1J49A 4I1IA 3TBHA 3S3TA 3RAEC 2V4UA 1PVOA 3ETLA 3BGIA 4ND8B 1Z37A 3KYDA 5DW0A 2EZ4A 3IR7A 3UMBA 3T5AA 3KKOA 4QDOA 4KX5A 1LLDA 2R7NA 3LDHA 5IN4A 2IVZA 1QPGA 1MO4A 2ZEJA 4I50A 3BOSA 4CCSA 1C1XB 1L4HA 2WAMA 4RGBA 4I50B 2X9LA 3OI7A 3TN7A 1RLUA 4AG3A 4BVGA 1EUZA 4TLDA 1L1RA 3QBTA 3QE4A 1TUBB 3ND9A 4OLAA 2O7QA 2Q46A 3GLTA 3T3GA 3PA8A 3U4MA 2Z98A 2FFHA 3WXMA 2MT9A 2COEA 1NMXA 2W6QA 3HCCA 3GC6A 3KZXA 4JJ8A 4JS0A 4XB6B 3U3JA 1FXSA 4A92A 5ABPA 4WGFA 5JPCA 2AZ4A 4HQFA 4DARA 4AI6A 4FT4A 3M9LA 3N75A 4JL8A 4UDOA 1E0DA 5EJMA 1DAHA 1Z0DA 3CX7A 4L4YA 4BNFA 3KELA 4UE6A 4RXUA 3KDSE 1PLLA 1R6VA 1HYEA 2OMKA 1ZA1A 4IF4A 1WVGA 2FPKA 2MR6A 3B9PA 4KAJA 3AU8A 4NMHA 1OSNA 1OX5A 1WHSB 1OA0A 2JFYA 4OFXA 3N2KA 3HUFA 3H6GA 4DLXA 2H5EA 4D41A 2YZ7A 4RJTA 2FLWA 5IJ0A 1U3FA 1P60A 3UWMA 2NTYC 1PRYA 2NZJA 2ZSUA 1E1LA 5D3ZA 5ALIA 4TKVA 4Z4IA 1QP4A 2DBVO 1I0IA 1NKSA 2OHHA 3H3FA 1O4VA 4E07A 2Z04A 2J0QA 2OZVA 2G88A 1YZGA 5HF5A 2VP9A 4FOTA 3I9KA 5BNTA 4KQ2A 4D44A 2YY5A 3BE6A 1I5OA 3SQNA 1I5EA 2C92A 4IP0A 3ZDEA 1ZW6A 4HOYA 4EQZA 1CYEA 1QUFA 2ZRKA 2X7JA 3U1TA 2WIAA 3DWIA 3BWVA 4ZD6A 1Z12A 4ARVA 5AJTA 3C39A 2R8YA 3E9DA 3AOEA 3R77A 1C0EA 1LJUA 2P1ZA 3VZRA 4ZAXA 4X00A 2RH5A 3V7UA 1EK5A 1DKUA 1EK1A 4AJKA 4TZTA 4CIBA 3DT9A 4LDQA 1ODLA 3TTVA 4UOQA 3A7EA 1J24A 4RTSA 1NTRA 4CUJA 2NUBA 4H0FA 3S2GA 3HB4X 4RKEA 4TKLA 2WJ4A 3SGLA 2Z6VA 4CF4A 2D0OB 1SD5A 4XUCA 3DOIA 1YB4A 4KE6A 3VKUA 4BEJA 1Z5PA 1FMTA 1PL0A 1DEKA 2GAAA 3B1YA 4U6QA 2H1HA 3U3MA 1PJCA 1QCZA 1YONA 3FYUB 2PBZA 3EGDA 4PO3X 4IDPA 3MGCA 3GA7A 3A3OA 1UT8A 5HGJA 3OPXA 4E32A 2XDQB 2ZQZA 5JJBA 1PT9A 2ZJYA 1QRUA 3DA8A 3NVMB 2P2SA 3H8JA 3UUGA 4JYMA 1U3DA 3GNQA 5AYVA 4BJ6A 2YCBA 4BKOA 3WFZA 3UT0A 4F6CA 3P5BA 1Z3IX 2W2MA 4U7WA 4NNJA 3CLTD 2HRDA 1KGSA 4XXHA 3K8YA 1Q0RA 4B6OA 3KCNA 1XVVA 2PX2A 4DIBA 2JLYA 3L0PA 2N75A 2AQ8A 1ZLXA 2I7XA 2XQVA 4K6FA 3PEWA 3G9ZA 4PQYA 1GCUA 5EJGA 2ODPA 3HFJA 4KXUA 2A6PA 3DVAA 3PITA 4H7EA 4PPFA 2PWBA 3HNRA 4AN1A 1DXHA 3FNQA 1MGPA 2WSMA 2CXRA 4I4CA 2C3YA 3I64A 2ZJZA 3E27A 5T57A 2I1VB 2ZUUA 2JIZD 2IOQA 3OQHA 2WD7B 1QQTA 5EIEA 2BRUA 3FFXA 4RK6A 3UK1A 5REQB 3ZHBA 1S02A 3SC6A 2JGMA 1P7CA 4AP9A 4EI2A 1PKXA 5KIAA 4WNIA 1M1YB 1CIJA 1XKLA 3NTQA 4EA8A 5HSGA 3RSLA 4OEHA 1NJSA 1OLXB 1NZJA 1GKYA 4RZUA 1M8KA 4I8XA 4BB6A 1K63A 3F7TA 3OP1A 5EPOA 1E32A 1NE7A 4RTMA 3Q15C 1JHYA 3C2QA 1Y5RA 5DTIA 1AQIA 4J0CA 4QEDA 3SZLA 4L02A 5HJ2A 2OZEA 2R60A 2RGEA 4ZXFA 2QWXA 5HOEA 3KDPA 3OT4A 5EA2A 3PFKA 2QUZA 4PYMA 2IYZA 4AF6A 3BFJA 3ETHA 5JR3A 1QO7A 5LQAA 5EYPA 2ILTA 1PDVA 3C4JA 1MX3A 2MSNA 1C41A 5KTNA 4PN3A 1JE1A 2IITA 4FEGA 2CJWA 4Z51A 4AW9A 1WOYA 1ZOSA 2Q5OA 5MFZA 2J9GA 2VDWB 1ZKDA 4FX2A 2VI5A 2EX1A 2VG8A 1SC3A 2IY7A 4UMDA 3WLPA 2JAPA 1L5WA 2DYKA 3BGWA 3DDOA 1QE5A 1DAOA 3GL9A 3JQ7A 4FMDF 2OO5C 4PQRA 4ZEWA 4AICA 5AQ1A 3HKEA 1ZIDA 4J03A 5LYJF 3J7AC 2QAJA 5BVHA 2C07A 4JXXA 1HMYA 3VR6A 3OZUA 4V0NA 4HRAA 3QE2A 5BV2P 1UL1X 4JLSA 4O4IF 4X6LA 1K5DA 2VAVA 1PJQA 3T4PA 1A7KA 1QRRA 4G0NA 4RPHA 3RYHA 5CG2A 2QL5A 1M67A 1FS4A 4HQLA 4K9KA 2P3OA 3D8SA 3KO8A 4KGZA 4V2IA 5ALKA 3RYHB 5ICMA 2IYNA 2FP3A 1OC2A 5JS6A 2FSHA 1B42A 4ID9A 2Q49A 3A1WA 3H2ZA 1UOOA 1V6AA 5E7QA 5H4GA 3RI3A 1N1GA 1UP4A 2O6LA 3K1YA 1ECPA 2VWQA 4NU6A 2OD9A 2YQ5A 2DFNA 4Z9XA 4K9RA 4YRFA 2OORA 2YV2A 3F67A 1VSBA 4TS9A 1UJ5A 3GO4A 4M0UA 1ESNA 4G86A 1Z06A 2XT0A 2CKMA 3H05A 1XO1A 1PR9A 3NO4A 1ZOOA 5LL6P 2C3PA 3EFOB 4DT1A 2UYHA 1R0KA 2E2WA 2WIBA 4V38A 3MLAA 1NATA 1AQLA 2YUIA 1XYYA 5CHEA 5TC4A 3TL3A 5U4QA 3DOEA 4AKEA 3PSHA 1C7IA 4FGZA 2EJBA 3H4TA 1PWYE 4LE1A 1YK0A 3H9QA 3IO5A 3IB6A 5J58A 1PGOA 4XJTA 2JKZA 2P77A 3MB8A 5LLTA 3TZ6A 2GUGA 3NVAA 4LVUA 1M72A 2PDAA 2B2NA 4E88A 1Z0JA 1TEHA 4BU0A 2EBHX 4DWJA 1VCHA 2FMHA 2RDMA 1X92A 5IHXA 5FAXA 1U9YA 3PYXA 3QFCA 2J3MA 3KBBA 4NAHA 4C7OA 1TK2A 2H7XA 1UBJS 3EIFA 3E61A 3S2SA 1QF9A 2WQZA 5JS8A 3M6MD 1UK8A 4MQBA 4A2QA 4EVIA 3Q3IA 1U7HA 5JZ9A 4MDYA 1GZ4A 3GZNB 4OXYA 3UMGA 4YCBA 4Q82A 1PJLA 1JKJA 3I30X 2VNJA 3DFKA 3QKUA 1SY7A 3H2KA 5DLDA 4IH1A 3NHBA 1J1UA 1UDCA 4INOA 1U8FO 3K5IA 1L5SA 1NUTA 3S8YA 1VGRA 3N70A 2WU0A 2ZI6A 2VT3A 3V5NA 2BR3A 3NJRA 4X95A 2G9RA 2IY8A 5EQTA 3W8RA 5DB4A 4HZGA 3UH0A 2E4WA 5AKIA 4YUVA 1N6NA 1E4YA 2VHTA 1CE8B 2HWKA 1UBRS 2HXGA 2O05A 3LYHA 4C3VA 2HJ9A 3J80A 2O59A 3U0BA 4H18A 2DUMA 1PFYA 5GV7A 2B21A 3VPSA 4Z7OB 2VQDA 4KIWA 2ZCUA 1DS6A 4QQFA 4D9NA 5ALWA 1HLFA 3UM9A 2N42A 1X3SA 2R00C 3WRYA 2IXBA 3RRXA 4DWVA 3WYDA 3NBMA 1XNQB 1W0JD 2BBWA 2H5IA 3FOWA 1QG0A 2G63A 1CS4C 2YIDA 3JPYA 1EFUA 3B7WA 4QFMA 3RUAA 1I7LA 2BHRA 1TECE 2QI9C 3P0HA 1GDDA 4YMUA 5BUQA 4G97A 4KREA 1VGQA 2DH6A 4KO2S 3AX6A 4G1FA 3RLIA 4EYGA 3ZJVA 3E9CA 2XGJA 1UPCA 1GPKA 1U8CB 3BQMB 5DH9A 2R6AA 4HLDA 1T2FA 1EAYA 4PXYA 1M2KA 2VN8A 2ZRBA 3D4NA 4KLAA 3ROGA 4C2UA 1R2QA 2CN1A 1SKQA 2QVGA 4BNKA 2QRJA 3HMQA 4RVDA 1U3WA 3N2YA 1HTTA 4PSDA 4UATA 2GPBA 1KI8A 2IYOA 4WACA 3VU9B 1CJUC 3C43A 5DO9A 2QVCA 2PN1A 3AVPA 2ZE8A 4M0DA 4NBWA 2WTBA 2FK8A 3OHMA 3MUEA 2V1UA 5AHWA 2C5BA 4MKHA 1D7OA 1JIUA 5J47A 4TLEA 4J75A 4AO8A 3B2NA 4OM8A 3BSYA 4Q6BA 3FMIA 2A4MA 4JXZA 2EKZA 1EFDN 1M66A 3CRQA 4CL0A 1DQNA 4YCMA 3CVXA 2ABWA 5AI6A 5HKKD 4L78A 2QU8A 1ZGCA 4RKWA 4Q3OA 4RWZA 5EVJA 2W2KA 5HCIA 3V9AA 1W9MA 3CZCA 2IU3A 3E82A 4FVTA 3ZY5A 4DPMA 4EKYA 3HKCB 3USZA 2V3VA 4EFNA 3PS9A 4PYNA 4CEJA 3JRWA 1UOEA 3LDAA 4X45A 4ER5A 3A9TA 1ZN2A 1T13A 5JHHB 3IV6A 3ZWQA 4Z0TA 4FB5A 3EAQA 1A5ZA 3JVDA 3OPYA 4TUYF 1VFNA 1IUOA 1G8SA 1S3GA 1DTSA 1PV1A 3DDSA 4UZEA 3F7MA 4EB0A 1QYWA 2BGIA 3IKJA 5JWHA 4YMGA 4KIUA 4HLQB 4HAVA 4LCJA 1R64A 2B69A 2Y1DA 3JVVA 3DYBA 3A4TA 1PW5A 2QHXA 4M0CA 5CNIA 4KR9A 5BQ3A 3A4LA 1GT91 1V37A 1O58A 3C3CA 3KFXA 3PE4A 5K9ZA 2J7PD 4P3OA 4QAJA 3EOZA 3A1DA 1L5OA 1U9IC 1GPH1 3ZHUA 3O4RA 3GNTA 1PT5A 2ZIFA 5F23A 2CY0A 4CNBA 2YJTD 4XLTA 3NJ8A 3IEIA 2P90A 5D5PA 3HL4A 4D3YA 1GCAA 4CM1A 2CFRA 1DEHA 3BYZA 3KTFA 4ITRC 5E1BA 3U44B 2QLTA 3G5LA 3LRTA 5EC8A 1UMCA 3O8CA 4M9QA 4L16A 2Y0EA 5JS1A 3PNQA 2HX1A 2PMKA 3CINA 1K8YB 3CA8A 4FCWA 3FIUA 2CB9A 1JS1X 1OWMA 3SCZA 3PI6A 3HB1A 4JZYA 3D3WA 4M6WB 1T5IA 4IZIA 4X8MA 4WEOA 2G77B 5IDYA 3T1OA 4BTEA 4EKNB 5JCPA 4I1RA 4P8RA 4CDNA 2WKSA 1JR3E 1TQ6A 4BGVA 3SYMA 2WU1A 2RCYA 4PQEA 4QEKA 2XECA 4EJMA 4BMSA 4LMAA 3THSA 4LFAB 4WKPA 5SY4A 1O6CA 4FFSA 5CVDA 2CSXA 1FYWA 5MF6A 2WJ3A 5A04A 1WZIA 4JLKA 4WGGA 3NU1A 3OZGA 4IF6A 4O4JA 5KKAA 3UK7A 4DBZA 3VNSA 2Z1MA 3D0OA 4OP1A 2C4NA 4MS4A 3ENKA 1QE3A 3OURA 2VJAA 3PUIA 2J9XB 1FE8A 5HUQA 3EZ6A 3OZDA 4F4HA 1FLNA 1F8YA 1R10A 1RWVA 3SQLA 1J9ZA 1CUAA 3TCNA 3WKCA 4CVNA 1S2OA 2IXDA 3AVQA 2GN8A 4M1QA 2PZMA 4YK7A 5BN3B 1YUMA 3H1AA 1XMVA 1YV9A 4HX2A 2JJ1D 1B73A 2APJA 2JPDA 2R6GA 4XPIA 1NC1A 2AYZA 2GYWA 3LOUA 1U2SA 5L51A 4C7JA 1N7IA 1GU7A 3LP6A 3ORHA 2E3JA 2GPAA 2J3DA 4AXBA 5AI8A 2FI1A 3CMCO 2Q5QA 2IXGA 3ZOKA 3UC5A 3JAWA 3STWA 3OE5A 4PZUA 4C21A 2VAMA 1DCMA 3INYA 5J4KA 1QLWA 4MR9A 2IODA 1XN4A 2Z57A 3BAZA 3K9WA 2CV2A 2H9AA 4RGVA 4YCJA 5AIBA 5J40A 4OHCA 2Q9BA 1BEZA 1SKMA 4PZ9A 3H8VA 5B12A 3N58A 4RJJA 2JLSA 3AI3A 3KOUA 3VSDA 1X7ZB 1UPBA 3VVLA 1CKEA 2Q5LA 4RY0A 3EXAA 4GMXA 4JUBA 1QH1A 1ONNA 1ZXLA 3OA2A 1KJYA 4B6EA 4EWLA 1W36C 3PUKA 3DHYA 5GM2A 3F3SA 4WKGA 2KWIA 3TE6A 5CVJA 4CHTA 2GX6A 4L4SA 2AOUB 4X1IA 3TTYA 1PWEA 1DL5A 2FPMA 4QPNA 2PL3A 4ZAWA 4D6XA 5C3UA 1C9NA 5CVCA 5G4KB 1L5GB 1RCTE 1SQ6A 3W5UA 4E30A 3WYFA 1RDFA 2FDXA 3R75A 2F1KA 4K7JA 3RS5A 1CR0A 4B83A 4F96A 1NVTA 1U7WA 1CB7A 2NZ2A 1QOQB 1QHHB 1YS2X 3G9QA 3DDWA 4RD4A 5CYFA 3TLBA 3VBCA 3HWSA 1QX4A 4TL9A 3ZY4A 5B2EA 1EZ1A 3GRKA 4NYJR 1YJBA 2MMGA 2YNMC 3QKSA 1FFXA 1Q77A 1INLA 1GL3A 3E4CA 2V8BA 2B1IA 3BCUA 4ND1A 3RBVA 2FGKA 2B0CA 5LQKA 3ODPA 3RWBA 1L0BA 4N7MA 2C2KA 2WTNA 1U2TA 2P7IA 3GQVA 2IPAB 5EIBC 2QRHA 3IO3A 4GBED 1PHPA 4OQ4A 1H1LA 4M8NE 1H2RS 4B4UA 5HDBB 3DM5A 3JX9A 1YA6A 2KMLA 4XQ0A 1V4VA 1TJPB 2EX0A 2QIPA 1GNLA 1GR1A 1EQAA 4JI2B 3VKGA 2ONCA 3U19A 4UVGA 3L9WA 4QBKA 3EZYA 3G7UA 1TAGA 4DAOA 2ZVJA 4ECEA 1CEYA 1X3LA 3CN9A 4Y2QA 2YC2C 3QJ5A 3CW8X 2GN9A 2P9FA 1XPOA 4MUJA 5LP6C 4J4BA 1Y3FE 4DR5B 2GLXA 2YZMA 3CZPA 3HBMA 3TNFA 1Q91A 2JARA 4C0AC 1MP0A 5JSKA 1UODA 2VTKA 3R9XA 1S2MA 1GNVA 1T9GR 2GPWA 2VSXA 4UTZA 1VE7A 4WADA 3MRSA 4HN9A 1BCSB 5CJJA 4CFSA 3VR4H 2X2FA 3ZV3A 1A9XA 4E5SA 1XZAA 3RS9A 2GVZC 5EWLB 4RH0A 2JIQA 2FPOA 2GNPA 5J59A 5IWAB 4X84A 1TC2A 4RFSB 2Q2VA 4GEGA 3QE0A 2WW8A 1FFBA 3OU7A 4C4AA 3EC2A 4TVBA 1XIVA 3BH6A 1C3OA 1VZ3A 3U60B 1W76A 4N54A 4K87A 4V0KA 5LA6F 5JAOA 1PQPA 3SJBA 2Y1EA 4H7DA 2HF9A 3GFGA 2IHNA 3BJEA 3C3AA 3T5TA 5JDCC 5BWOA 2PKWA 1Q0SA 2JVJA 3TUIC 1BKSB 1CWUA 1PR2A 2XYRA 1AOXA 1L7XA 1E5XA 1RACA 2DWQA 3U4DA 1HR0B 3W5IA 3M83A 4L0MA 3EGVA 3TEFA 5B7PA 1XD9A 4EK9A 1XXHE 3FMOB 1H9CA 2VKQA 2AFIA 2R0QC 4GKBA 5IBRA 3TQSA 1DVRA 1FDUA 2HL6A 1T8TA 3EFOA 4DT1B 1WY7A 2NZXA 3BSWA 4O59O 6YASA 2PSHA 3GELA 2WV7A 3C3JA 3N5CA 2LW7A 4LVNA 4O33A 1FDTA 4RULA 2QN7A 3UJ8A 5A6SA 2PRIA 1O95D 4GNRA 1KMIY 2ISSD 5FNVB 2Y67A 1P33A 4ZCLA 3MWEB 1TI7A 3GOHA 4FMCB 1FQOA 4NARA 2QAGC 3QSYA 3BIFA 4QOFA 3TIGA 2YWDA 3TSYA 4CKYA 1HLGA 1YA8A 2VC2B 3U3RA 5ERXA 2JNWA 1X2EA 2PY6A 1BHJA 1EA5A 4JODA 1GEEA 1R27A 2NQ8A 1HLDA 1P0MA 4OGFA 1CZNA 1NRIA 4AJ1A 3GR6A 1VCIA 1QNFA 2ZVQX 4BB0A 1TGVA 3OLYA 1TMYA 4UJ5A 3ESRA 3I5MA 3TXXA 3IAM1 4RM3A 1M6VA 4DUZB 4LOAA 5ELMA 3QHAA 1YJQA 5E38A 5JECA 1C80A 3RAFC 2BGTA 3ZGLA 4R7TA 5I7FA 5L7TA 3ZWPA 4X94A 1W44A 3L5OA 4MVYA 5TS3A 3ADKA 3EDMA 4MWDA 1O9BA 5I7UA 5JW6A 4H7KA 1MZVA 5JBQA 3P4XA 1GU0A 1L9KA 3K73O 1TLFA 2JGKA 3ZDYB 2R66A 4RSGA 1ECLA 1T10A 1VKJA 2NVUA 3JSXA 1F2UA 4FE3A 4C1BA 4Q7EA 1H22A 1A50B 1MKYA 4HXGA 4EPWA 4BCBA 3TH5A 5EGSA 2AA3A 3HVKA 2VATA 1XDZA 4O4HB 4O4LA 5D85A 5IEBA 1SOWA 3F1KA 4FQ8A 2VNHA 3BFVA 2YY7A 3E5HA 4IG9A 4MPDA 3L0CA 2EARA 1OV6A 4Y0NA 2QNIA 1V95A 3RT7A 4EF6A 3LUDA 1QIGA 2I65A 1G2OA 3D3QA 3P52A 4RXTA 4TTIA 1JB9A 3PPIA 1P3Y1 4Q4JA 3FGNA 4R8RA 4FYVA 2G4VA 2J0UA 1GKIA 5D84A 3SVZA 4EH1A 1YQQA 3VC1A 5AK5A 4DSOA 5KTYA 1G8KA 3RVMA 5L3VA 3GD7A 2AX3A 1PK9A 3EF3A 4KVAA 2X0FA 1OZFA 4KI7A 2ZUEA 4ND2A 5K4HA 2I4LA 1E63A 1TCBA 3BRSA 4QPPA 3SN6A 5CM8B 2YWJA 1NRWA 2GK3A 2RD2A 4G37A 5C7YA 2F3PA 3TAUA 1C3EA 1M8GA 1STOA 1EFLA 5CIQA 4GQAA 1P74A 1A5SB 4IWXA 2NNWB 4BN5A 3PWKA 4ZKEA 4WXYB 3EVDA 2HIHA 1JIJA 4C7KA 5KC9A 1OPRA 2ZTMA 3CUYA 3TGLA 1O2DA 3A2KA 4ZYWA 1J2EA 1N2OA 1IZYA 3CUUA 3PFBA 3QOXA 3SK0A 4B3DA 1BH6A 4XYGA 4OJMX 1BSVA 2DX7A 3SEFA 2XITA 4TSKA 2D7JA 2RGAA 2VQ3A 3IP5A 4W5OA 2FJ0A 2VT2A 1E9FA 1FCJA 1WXIA 5AW8A 1QF7A 4L5AA 1GGNA 2CJPA 1XCMA 1CIPA 1QCYA 2G9ZA 6NULA 4RNCA 1GKKA 1SBYA 3LA8A 3W06A 1XD2A 4U3JA 3SWWA 4IQ4A 5LUAA 1VMIA 1JJFA 3QEMB 3L4BA 3VDQA 5KYTA 3FLAA 3S2ZA 2AN9A 2ZYAA 1PUXA 1VMAA 1RJ9A 2PU5A 3JWHA 1C7QA 4Y2SA 4YONB 3K0SA 1IBLB 2ZU0C 1RYNA 2ONZA 2BHNA 1CZOA 2CF5A 1EVQA 1K7CA 1Q22A 5ADUS 5AW6A 2K7ZA 1HNWB 3K9NA 4LZZA 4DCSA 2O3QA 1SHKA 1EJ2A 2XIJA 4EO7A 2ZJ0A 3F47A 3E1SA 3WJ1A 2VWPA 2ZAIA 5BRJA 2HXYA 3EPJA 3AUKA 2I5PO 3O8DA 1CF4A 1FYEA 3KYIB 3OCXA 1AIPA 4MROA 4QODA 5CAEA 1GQ2A 3G6WA 3HVHA 3LCCA 5JJLA 3BJZA 3FPAA 2H4YA 1SHTX 2FEMA 2OPBA 5EHIA 5SYAA 2NVOA 1SBIA 4LZPA 3RTEA 1GYQA 3GRFA 3TTXA 3EIWA 4XM1A 1YVEI 1HA3A 4KVGA 4X5OA 5IK2D 3M9XA 3PHGA 4TLLB 4OYLA 1M34E 1NKTA 4IVNA 4P7KA 4EPVA 2IDZA 2ZE6A 4YCCA 3B38A 4E2XA 2ZUTA 1MABA 4F92B 4LF4B 1A9TA 5D01A 3SFVA 3NVDA 2Q6LA 3EMKA 3RC8A 4G5SA 2XVZA 1BOOA 3GNSA 2OBMA 1RXYA 1IN1A 4C4XA 4JUDX 2GN0A 2QP9X 2FSUA 2PFGA 4X3PA 1OLSA 1K75A 4M46A 1AKEA 2B9VA 1IY0A 2UZ1B 1VLZA 3FXAA 1ZAKA 3NWJA 1GM5A 2V6FA 4HGQA 5JH7F 2P2DA 3I0NA 3I37X 4EG0A 2X42A 2F17A 4RXMA 1BE6A 4QHYA 1IYZA 1E3WA 2R6JA 2DBQA 2WF7A 2XAUA