2CL5A

Catechol-o-methyltransferase in complex with an inhibitor
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
214
structure length
214
Chain Sequence
GDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords CATECHOL O-METHYLTRANSFERASE
publication title Comparative Study of Ortho- and Meta-Nitrated Inhibitors of Catechol-O-Methyltransferase: Interactions with the Active Site and Regioselectivity of O-Methylation.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 81
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2006-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2cl5A00
4PIMA 3JWGA 3I64A 2GLUA 3FYCA 1N2XA 2H1RA 5E9JA 4CKBA 5KVAA 4PCLA 3BKWA 1OR8A 3IV6A 4RVHA 5CVVA 3DH0A 5C0OE 1SUIA 3NVMB 3KPJA 3G5TA 4RSRA 2ADMA 3B3FA 4JXJA 2PWYA 4HGZA 5DX8A 3AXTA 2P35A 3KPWA 5K0NA 3TM4A 1D2GA 2IBTA 5FADA 3NDIA 4Y30A 2FYTA 4ER5A 2HR1A 4ISCA 3LBYA 4AZSA 5HOQA 2YXEA 3P9IA 3SX0A 1P39A 3BGIA 3OU7A 2O57A 3P9KA 1WY7A 3HVIA 3EVCA 2P8JA 4YV2A 2V74B 4E70A 1JQDA 1O9GA 2G8NA 2IP2A 4V0QA 5T64A 1P1BA 4QPNA 5LQKA 1RJFA 5EZQA 2P1DA 2XYRA 2ZBQA 2QRVB 5BW5A 4X41A 1XDZA 2CMHA 5EIFA 3PX2A 3FTFA 5FUBA 3KQVA 4KWCA 3DXYA 4PYQA 2Z6AA 1X19A 5DM1A 5GIPE 4QVKA 1KR5A 2YX1A 4RTSA 5DXAA 3BGVA 2QY6A 2ZTHA 5DRTA 3LX6A 4C07A 1KHHA 2PXCA 2P7HA 5CVJA 5K01A 2EX4A 3HEMA 2NYUA 3KPYA 2JHPA 2CKDA 3DULA 4QTUB 3SGLA 1RJGA 1EJ0A 2AOTA 2PT6A 3AY0A 4EKGA 4RWZA 4EVIA 4RTQA 4NECA 1SQGA 2BR3A 5K0LA 3BWMA 4XUCA 4PYLA 3FUWA 3B5IA 3PVCA 3EVGA 3KQTA 3LKDA 4PCAA 5CVEA 3TM5A 4KDRA 4DQ0A 1KPIA 3P2KA 4RTLA 3KQWA 1O9HA 3NWEA 3MHTA 4P7GA 3O4FA 4ER6A 2ZZKA 3DMGA 3OZSA 5GINE 3TKYA 1D2CA 2IGTA 5K0JA 4DCMA 3FYDA 1X1BA 3T7RA 4YUWA 4RTJA 2C7QA 3BWYA 4DCGA 3ELWA 5DM4A 3I53A 3TPZA 2H00A 4CKCA 4HC4A 3R9XB 4LWOA 1H1DA 3HCEA 4X1OA 5DSXA 3HCAA 3ER9A 1R8YA 3M70A 3GU3A 3NVKI 3C3YA 2ERCA 4PYOA 2B2CA 2BM9A 2PX8A 4PNEA 4GOLD 2BM8A 4RTRA 2OKCA 4K6MA 3TKAA 2NP7A 2PWPA 1ZKDA 2HV9A 3M6VA 3NJRA 3ELUA 2CMGA 3G7UA 3KHKA 5GM2A 5K0BA 1AV6A 2QRVA 3TRKA 3KR0A 4WXHA 3CC8A 1FP2A 3GJYA 4LECA 4C4AA 3O7WA 5DXJA 1RI4A 3SSNA 1JSZA 3K6RA 3OZTA 2JJQA 5E8JA 3S68A 5HIMA 3FPFA 1BOOA 1ZGJA 4LWPA 5GWXA 3P2IA 5D1NA 2B9EA 4BP1A 3EVAA 5EMKA 1YFJA 4U7TB 5EKUA 3M6WA 3VC1A 4RTKA 1N7IA 1F38A 1NW6A 3P9NA 5H02A 3P97A 3ELDA 4KDCA 4RTNA 3NTVA 1YZHA 1XTPA 1D2HA 4KIFA 4OQDA 1KPHA 5DTMA 3B89A 2GS9A 5GOZA 2I6GA 2O0LA 1KPGA 4EMSA 2ZSUA 3KR2A 1ZGAA 1KXZA 1ZHFA 2FHPA 2JHAA 2PX4A 4KIGA 4QQNA 4ZTBA 5EVJA 2P3LA 1BHJA 2GAFA 3PFHA 4R05A 4G56A 3C6MA 5E9WA 3HVKA 3UBTA 3I5UA 1SKMA 1R74A 1QYRA 3JWHA 3UJ7A 1X1AA 1KP9A 2XBMA 3CJTA 5DX1A 1QAQA 3GXOA 2IPXA 1SVUA 3FRHA 5FHQA 3OE4A 3GO4A 5DTQA 4H0NA 2AZTA 3EGEA 3FZGA 4PINA 1FJXA 4IV0A 1QAMA 4YMGA 4P7JA 3KR1A 5P8WA 5F2KA 3BUSA 2UYCA 2PSSA 2Y1XA 2VDUE 3FPJA 5F2OA 3IEIA 2I9KA 2IH4A 1Q0SA 2ZZMA 4O29A 5G02A 2ZIEA 2JH8A 1RI2A 3HA5A 3OE5A 4YUVA 4GC9A 1TPYA 5U4XA 3FTDA 3E05A 3MTEA 5T67A 3HVHA 3BKXA 2ZWVA 3HCFA 4E31A 1RJEA 3FUVA 4Y2HA 1YZ3A 2WK1A 2G1PA 1R00A 3C0KA 3UWPA 1G55A 4E32A 1AQIA 3G5LA 3LBFA 4IV8A 5FCDA 3AJDA 2NXJA 3P2EA 3QOXA 5EHGA 3MCZA 4YV0A 1RI3A 2HNKA 5HZMA 3G8BA 1ORIA 5C9ZA 2IH5A 2UYQA 3KQMA 3PS9A 3OU6A 2ZIGA 1VLMA 4PYJA 3B7PA 3HM2A 4L7VA 4PWYA 4PYMA 1O54A 3LDUA 3OU2A 1JR4A 2OB2A 3VC2A 2PX2A 5EHIA 3GIWA 2V7EA 2VDVE 2YR0A 3LCVB 2I7CA 4A6EA 4ATNA 1FBNA 1XDSA 2EG5A 2EFJA 3FPEA 1HMYA 5E1DA 2JHCA 4GOND 3UJAA 4BP3A 2OPBA 3KPUA 4QQKA 4BLUA 3KPVA 3A25A 3O31A 2PY6A 2UZ4A 4DKJA 2XYVA 3GGDA 4DF3A 4EK9A 2PV0A 3GRRA 3V97A 5IKMA 1G38A 5DTRA 3UA3A 5B1SA 3NWBA 4R6XA 2AOUA 5LSAA 3EGVA 5EQJB 1G8SA 3OZRA 5EGSA 5ERGB 3HNRA 5LR6A 4RVGA 4C06A 3TMAA 3A7EA 5K0EA 2LD4A 3UJBA 2R6ZA 3KQPA 2ZWAA 5GP1A 4P58A 2ONYA 5FWAA 3ORHA 1ZQ9A 1YB2A 3NW9A 2OXTA 3SMQA 2IH2A 2NP6A 4GUAA 3EMDA 3QOWA 1QZZA 1VE3A 5FQOA 3TLJA 3KQSA 3OPNA 4PYKA 5CCBA 3FTCA 1ORHA 7MHTA 1JG4A 5FA8A 3LSTA 3G2OA 2EJUA 5FQNA 5EPEA 2GPYA 5DLYA 3EVEA 3LPMA 4RYLA 4RV9A 3EEOA 4AUKA 3PLAE 4GOMD 3T7TA 9MHTA 3UJCA 4E30A 3F4KA 3JWIA 4GF5A 3X0DA 3Q7EA 3R0QA 4ER0A 3REOA 4CTJA 4IWNA 3DTNA 2R3SA 3OFKA 5KQSA 2FK8A 4OA5A 2ZULA 4UOEA 3DMFA 1R8XA 4FT2A 1KYWA 4HGYA 2AR0A 3PB3A 1DUSA 3MERA 3E8SA 1N7JA 1WG8A 3ID6C 1XCLA 3FUUA 2AN5A 2B25A 4QPPA 2ONZA 5E2AA 4E2XA 4YUYA 2GA9A 5KYGA 5E8RA 4KVZA 2C7PA 2NXEA 4FT4A 2YVLA 3LECA 4GOOD 5BW4A 1FP1D 2I62A 3THSA 1WXWA 4FS8A 4CKEA 1XDUA 4FGZA 3G2PA 1JG3A 1P91A 2PVCA 5EMMA 4HTFB 2ZIFA 3M4XA 5HIKA 4CWAA 1L1EA 4X60A 1F3LA 3EVDA 4E2ZA 1EIZA 2AVNA 5GM1A 4RTPA 5EOVA 3NDJA 2ZW9A 4OX9Y 3QV2A 4P7FA 2XVAA 2F8LA 2GB4A 3PFGA 4F85A 2C7RA 5FHRA 2Z6UA 2O06A 4QDJA 2N47A 3GDHA 5DM0A 1M0EA 1L3IA 1XVAA 3CJQA 1G8AA 3LDGA 3PT9A 4RVDA 5GIOE 2IIPA 4GEKA 3G2QA 5HILA 2VS1A 3EMBA 5CD1A 3EVBA 4PIPA 3CKKA 5DT2A 2HTEA 4AZVA 4M38A 1EQAA 5CVDA 4MHTA 1WS6A 1UWVA 2IDKA 1QANA 2IDJA 2PKWA 3HP7A 5HEKA 3UJ8A 5EKXA 3FRIA 4YUXA 2CL5A 2UYHA 1B42A 3ER8A 3E23A 3CCFA 3JWJA 3RODA 4YMHA 3HTXA 2OY0A 5ICFA 3GNLA 1AQJA 4QVGA 3V8VA 1NV9A 4GQBA 4BLVA 2DULA 4FSXA 3DUWA 3KKZA 3IHTA 1EAMA 5EG5A 4E2WA 2ZBPA 2QYOA 4LG1A 2G71A 4QTTB 2DPMA 3DP7A 5ICCA 1G60A 4AZWA 5ICGA 1NKVA 5KQRA 4PGGA 5E9QA 4CXMA 4F86A 5CCXA 4ER7A 4M36A 5ICEA 5EMJA 5MHTA 1PJZA 3P8ZA 4HG2A 5EEGA 1JG1A 2WA1A 2OO3A 3HCCA 3M6UA 5FULA 3SXJA 1YF3A 5E1BA 3UA4A 2P3QA 3DXXA 3LHDA 3WSTA 3SVZA 5DWQA 2HWKA 1JQ3A 1Y8CA 3VYWA 2YUIA 4CTKA 3U81A 5BP7A 1INLA 1YFLA 3GRYA 3MB5A 1V39A 5D1HA 2BZGA 3ME5A 2NXNA 3B3GA 3UZUA 2B3TA 1YUBA 5CVUA 3B3JA 3GRVA 5IH3A 3G88A 4HSGA 4PYNA 5FTWA 3SSMA 5JR3A 4AZTA 5JUWA 3KQQA 3H2BA 4C05A 3THRA 2AN3A 4FSDA 3A7DA 1JQEA 4YUZA 3CGGA 1UFKA 5HIJA 1R18A 3MAGA 5HIIA 1L3BA 4MWZA 3NMUF 3R6TA 4OQEA 3DR5A 4RVFA 1RJDA 2G70A 3LGAA 5K0CA 5LQUA 3ANXA 1VP3A 4RTOA 1VL5A 2PJDA 3MTIA 3EPPA 2ZFUA 3TFWA 3ERCA 3SSOA 2PXAA 3DXZA 4C04A 5K09A 3LCCA 3HCDA 5EIWA 4AX8A 4ER3A 2C7OA 4OA8A 1IXKA 3BWBA 3BT7A 2E5WA 5LQRA 1KIAA 3BZBA 3DOUA 1SG9A 2AS0A 2JH9A 1BKYA 2FK7A 2PT9A 5E1MA 5LQNA 4RTMA 4PONA 1NV8A 2FPOA 3FTEA 2ZBRA 5DM2A 3T0IA 1VP9A 2QM3A 2YTZA 4MQ4A 5F2NA 2AN4A 1VQ1A 2ZVJA 1I1NA 4M7RA 3EGIA 5CM2Z 2P7IA 1JTFA 2YXLA 4DM3A 4KRGA 5BXYA 3HCBA 5EC8A 2VZ9A 3M33A 3KR9A 3UFBA 3RW9A 1WZNA 4WVLA 4OBXA 2OB1A 3HA3A 2KW5A 4RX1A 2ZCJA 1AF7A 2G72A 1BC5A 2PX5A 5C1IA 5CUQA 3SR4A 4PYIA 1L9KA 1JG2A 2ZLBA 1Q0TA 1XCJA 1RI1A 2JG3A 1XXLA 3K0BA 2OBFA 5T6BA 2QE6A 1TW3A 4V0RA 3IYLW 2WA2A 2NNWB 3C3PA 3E7PA 1JSXA 3CVOA 3G2MA 4R8SA 5HFJA 3D2LA 4GBED 4EQZA 3I9FA 3GRZA 1ZG3A 1NT2A 2AOXA 2IBSA 1NW5A 5DSTA 4HRAA 2B78A 3A27A 2XYQA 3FPHA 3A4TA 3AWIA 1NW3A 4XCXA 3TR6A 4GC5A 1U2ZA 3C6KA 1NE2A 3DLCA 3Q87B 3G89A 3ELYA 2ZZNA 2Q41A 3DMHA 4C08A 4IKPA 3MQ2A 1DL5A 2BR4A 2H11A 3LL7A 1KYZA 2BH2A 10MHA 3UJ9A 2BR5A 5CIYA 4X61A 4B17A 3TQSA 4KW7A 4Z2YA 1RI5A 4FZVA 2O07A 5DPMA 4P7KA 5DRYA 1I4WA 2OZVA 3MCTA 3SM3A 3CBGA 3P71T 2GH1A 3PX3A 5LQCA 3I58A 1VBFA 1DCTA 1MHTA 5K05A 4EKIA 3GWZA 4BLWA 3LKZA 2P40A 2P3OA 1EG2A 5K8VA 5EMLA 1WXXA 3BWCA 3EEYA 5FWDA 1X1CA 2HMYB 4E2YA 4C03A 1QAOA 2XVMA 3TOSA 2Y1WA 3UJDA 1PRYA 2NXCA 5LQJA 2O05A 2P41A 3KU1A 2A14A 3FPGA 3GRUA 3MGGA 4PGHA 5K0GA 5LQAA 2K4MA 2UYOA 3P9CA 1VPTA 4X63A 2FCAA 1HNNA 3PTAA 5M5BA 2AOVA 2VDWA 4HH4A 4FP9A 2EJTA 4F84A 4FR0A 4DZRA 1MJFA 1FPQA 3LDFA 4R6WA 4DA4A 2ESRA 5FA5A 2PBFA 1X1DA 3DLIA 4QDKA 2AVDA 1TW2A 2FRXA 4POOA 1IY9A 1M6EX 2VP3A 3A26A 2YQZA 5EZSA 3CJRA 4M37A 3BGDA 4OBWA 2IFTA 3FUXA 2YXDA 1NBIA 2AOWA 4XUDA 2PXXA 3UJ6A 3KQOA 1SUSA 4R8RA 1P1CA 4MIKA 4DMGA 1G6Q1 4U7PB 3FUTA 5DX0A 4E33A 3OFJA 3HVJA 1VIDA 1R6AA 3GCZA 1M6YA 3BXOA 3RIEA 1JTEA 4A6DA 4XUEA 4YV1A 3L8DA 2PLWA 5EEHA 1Z3CA 1NW7A 3R24A 5E2BA 5K03A 1UIRA 1I9GA 1XJ5A 3T7SA 2AOUB 4HTFA 1L3CA 3LCUA 1EJ6A 1IM8A 3OCJA 3KQYA 3AXSA 2ORED 1NBHA 3M6XA 5K0FA 2PGXA 2Z6QA 2OYRA 8MHTA 4BY9E 3EVZA 3R3HA 2AOTB 4MTLA 1T43A 3EVFA 3VSEA 5E1OA 1NW8A 5KS2A 2CWWA 3G8AA 1SQFA 3HA7A
chains in the Genus database with same CATH superfamily
2D1QA 3MWFA 2GLUA 2HF8A 3FYCA 4CKBA 1FVOA 3DHWC 3E7WA 4R40A 3RK1A 4RVHA 1XRJA 4QU5A 1IBMB 3I3OA 1T8RA 4V3CA 1C4XA 2W2NA 2J09A 3QYAA 1W29A 2YN2A 4NDAA 3JQ9C 4Q48A 5AIAA 3RWMB 1CYEA 1HDOA 2EF1A 4MUFA 3SZMA 1TYDE 4URFA 5HQ3A 3UAVA 3FCSB 2VP9A 3SKYA 3U4DA 1EDDA 1ZI9A 4CIBA 1KI1A 3BGIA 1WZIA 4IIYA 2X0RA 4J6EA 3SS9X 3O8CA 4NV0A 1A8HA 1N9GA 3EC1A 3ZNOA 1FNBA 4D56A 2FPPB 3QEJA 3K3PA 4J9VA 4BO3A 1F6WA 5HQJA 3UMCA 4QBHA 1Z4JA 2QUAA 1C5KA 3VU9A 2VPIA 4OK6A 4A0QA 1U3WA 4MR7A 1ORRA 4GWLA 3RVMA 1SKUA 3GPBA 4EO4A 1KSFX 1NNLA 4IRMA 5HE8A 3VR5D 2QRVB 4I1IA 2XB9A 2BUBA 4YROA 3UPTA 4BL5A 4EB3A 1E6CA 4JYMA 2NV0A 1M10A 5J47A 2B21A 1XCMA 4GKBA 4RY8A 5GVRA 1WMFA 2QMHA 1AQUA 1UJ5A 3PX2A 4DQKA 3DEZA 1XMJA 3KB1A 3KQVA 3TQIA 4WASA 3HACA 1QGUA 1DELA 2PWAA 1F7UA 3NATA 2R8XA 1LU9A 2J9ZB 5AFSA 2G36A 4JZYA 5DN9A 3OC6A 1X19A 3OQJA 4PAQA 5EIEA 4FOTA 4G1VA 4FMCB 4KTVE 5EWMA 4ENSA 5HM6A 1CRWG 3RYFA 3ILSA 3SQNA 1MC4A 2PXCA 3KNZA 4ZOAA 1NLZA 5I9MA 2YMMA 1YS2X 3SBOA 1S3IA 3RG8A 4ZI3A 3I1IA 1KO4A 1N9ZA 1TM2A 3ZI4A 3IODA 3FOEC 4RWZA 1P74A 1TO6A 1ZI6A 4F4CA 4GMGA 3MC1A 3BWMA 4HO1X 1UDCA 2NU8B 3FUWA 3B5IA 3G0GA 1ZVQA 2A5FA 1VKJA 3LKDA 4ITRC 2XTMA 3KEQA 1VYTA 4BE4A 5DK4A 4EQ6A 1TUIA 3OZSA 4RH1A 2IS1A 1NJ1A 3NTXA 3OFVA 2RIRA 3NHUA 2PZGA 3EZXA 5GGXA 4YRBA 4XTRA 2B8JA 4QXAA 3ZCTA 1IAQA 3D6AA 3CLRC 4UUOA 3ZWDA 4CTMA 4LTNA 4Y0NA 2QTVA 5ESWA 1GFSA 3ZU3A 1Q11A 3U2QA 2NUAB 2YASA 2O2ZA 3EBPA 5B4VA 3B1WA 4JSTA 1X9HA 3G1WA 4H59A 4UASA 2PZ8A 4QDOA 4NC9A 1G9TA 1PVDA 2IYXA 3RSCA 4CI0B 4DJAA 3NOOA 2GNPA 4EVRA 2QUBA 1Q12A 3TRKA 2BTEA 5BT8A 2C96A 2YFYA 4XR4A 2QJRA 1G8JA 1NNI1 2R87A 3IV9A 3I2KA 5IVDA 3K15A 4N7MA 1LD3A 2CC2A 1GLNA 3EVAA 3F4BA 1YFJA 2P27A 1DUVG 2FPGB 1CRLA 3K0CA 4MWGA 2Z4TA 1EA5A 3AETB 3UAYA 4QASA 3CZPA 3IDOA 4XQ0A 2V59A 3AUAA 3DL2A 5K4GA 1RKVA 4HX9A 5EZ6B 1ISIA 1M1YE 5JSUA 3B1VA 1ZR2A 3PL5A 4W1QA 3RJ5A 5M3BA 3VJLA 1PW7A 3E8XA 4LNUA 1KPGA 1LJUA 4PCUA 3S7TA 4B87A 4DM4A 4O02B 4Y2TA 3IJRA 1T2EA 1ZHFA 3M3HA 3FDXA 4MRSA 3LD9A 4TYMA 2JGNA 1CT9A 3PFHA 1XMOB 4L8GA 5DNDA 1I30A 1A4UA 3U4IA 2V7VA 3QPWA 3U7HB 4RACA 2DFPA 4TUYA 4DXDA 2I4OA 3PWZA 4DLPA 3GXOA 2A86A 3DMPA 4C7XA 1QIFA 3QQ5A 4TLDA 1QP4A 3TOVA 1OT3A 4I1VA 3IXMA 1E8DA 2IPLA 1KK3A 4FEYA 1HE5A 4NPCA 2GFHA 3QFTA 1GARA 2ORVA 3SJBA 2IHNA 2ZJOA 3BFJA 1DJQA 3TI9A 5F2OA 2XRZA 3JAKB 4FDLA 1Q0SA 1X7XB 3KJXA 3PKZA 4J0FA 4J94A 3DE6X 1UPCA 4DILA 4OQFA 1FW6A 4FEAA 1P33A 3N53A 4D42A 3H1TA 3FTDA 3N3AC 3ODPA 3UV3A 3F5MA 3MTEA 4BIIA 3G5MA 4AX4A 4R3NA 4P5PA 2HCFA 4YYZA 1RJEA 1X86B 3VISA 4MW9A 5T3YA 4DWJA 1U5BA 3RUCA 1GZUA 1F1BA 2F1HA 2TECE 5EXXA 3MCZA 3I1JA 4KU4A 1NN5A 4X6XA 4D46A 2DB3A 1CB7A 2MMCA 4FLFA 1TJPB 4HVLA 1TZJA 1N8TA 3H6GA 4YV0A 2MOKA 3OQPA 4CM6A 5C9ZA 1B0ZA 4EG5A 1XCPA 2HMSA 1NSTA 1YL5A 2XMRA 3IT2A 4HYQA 4N12A 3D8SA 3FSEA 3R3YA 2QU8A 1MW9X 1OIVA 2ZM5A 3C16C 4LZLA 4BO8A 5A6SA 1JR4A 1SBIA 2FOLA 2HSDA 1X3LA 2VT2A 3NHAA 4QYTA 3QBVA 4UM9B 3BEDA 3IVAA 1GGHA 4CQMD 3C7TA 1I9CA 1FBNA 1A9SA 2EG5A 2EHDA 3EJ6A 4IIJA 1YS9A 4C4XA 8AT1A 5L3SA 2D2IA 2DTDA 3R7WA 2OPBA 2ZVDA 3O31A 2WIDA 2QVYX 2G1AA 3A70A 2ISSD 4YPFA 5SYMA 1FSFA 1N5LA 3ZW8A 5EE5B 4DF3A 4IQ4A 1ZICA 1WP4A 2B8WA 1KMHA 2QPTA 3PVZA 4N3NA 1OWMA 3OF5A 4M0EA 4RA9B 2FTKE 3OZIA 3X43A 2R44A 2V5UA 1FTSA 2WDZA 3MMZA 4MAMA 3U4HA 1C9JA 2QRUA 4DT1B 2AC7A 5CP8A 2IZ5A 1JMKC 4KWIA 3ND8A 3OAAD 2YXPX 5CM8B 3VHXB 2HMUA 4RMHA 5JNLA 5FLKA 4MW0A 3NW9A 3DCJA 5DCYA 3SZGA 3VYSB 1JLHA 4QLBA 5ITZA 4XD7A 4V02A 3EQ8A 2N1BA 4HMOA 1T8SA 5IT0A 3R7AA 1U02A 2VXCA 3OOSA 4NTZA 4HGRA 5FA8A 3UB2A 1QVRA 1CJKC 2B20A 2V98A 4RU1A 2PMFA 5E3HA 1OLXA 1Y6FA 4RV9A 2FLWA 3HNOA 3HYRA 3PLAE 2FG7C 3V4SA 4AYTA 1N6PA 5CFNA 3RKUA 1YQEA 2HWUA 3MRVA 3X0DA 4R0VA 4EX6A 2LW7A 2AC4A 4ER0A 3TB4A 2DT8A 3HMQA 5KNCD 1S01A 1DMRA 1X8KA 1R6TA 1U4NA 3KFLA 3OMWA 5JLJA 4C6TB 4OFZA 4KPUB 3TLYA 2ENWA 1U0JA 3BXPA 4HB4A 3AUKA 5DP2A 3DBRB 4O2AB 3DKKA 1O5OA 2ZRBA 3QX7A 4AJKA 1ZS9A 4HB3A 2C7PA 2NTJA 1YVDA 4GOOD 3CF4G 4RH3A 1FP1D 4IO1A 2QVCA 3EPHA 2H5LA 3AK4A 4UTRA 3V8NA 1S3SA 3A1CA 4FGZA 3QVVA 1P91A 4K9DA 4Z9XA 5H5JA 4JYZA 1IPHA 4RJ2A 4CWAA 2PJUA 4PZLA 6NULA 3NETA 1F14A 1JUDA 1T9CA 2PU5A 1LLQA 4TMFA 3NDPA 3AJEA 5G1PA 3QUTA 2NVUB 2GM9A 4BFWA 2XQGA 5JVDA 2MHCA 3R74A 3O3MB 1G5HA 5JMOA 2XVAA 3GH1A 3IAAA 1Y7HA 1CV2A 1SHTX 1Z56C 2X2EA 1JR3D 1L4MA 2GZ3A 3R5KA 4NABA 4WERA 4WIAA 3GFVA 1XVAA 1G3UA 5EXPA 3R0JA 3ZQUA 4WMLA 2FWIA 1L5VA 2NIPA 3OX1A 1DXOA 4IINA 4TZTA 3FOFC 2AMFA 2E37A 5CD1A 1NBMD 2VNIA 2YOHA 3KTAB 5DNYB 3CLRD 4M54A 1L7BA 1EQAA 2EATA 2IP4A 3PF8A 4NESA 1YR1A 3SOPA 5AJZA 3IB6A 1JEYA 4LDZA 3WJ7A 5JC8A 4YECA 3OESA 1RPNA 1N3YA 3CX3A 3HTXA 5E4JA 1EPUA 3GF4A 2WTUA 4P3PA 2OHHA 3NM6B 3MAAC 3GNTA 4DSOA 4JL5A 1LSOA 4QFBA 1V16B 1U28C 2FFRA 1GUAA 4UHEA 1R6BX 3DBOB 3NUZA 3F6SA 4G2TA 2IPOA 4DV6B 2DPMA 4RE5A 3AILA 4DMRA 5KYUB 2DRIA 5TE9A 3SR0A 5TPWB 2X86A 3WRWA 3ZKWB 4B74A 3PHJA 5EP2A 3H9EO 1QYIA 4ER7A 4XYEA 1KI2A 5K6AA 2RKOA 2F8MA 3DE3X 2RGNA 4LHZA 2HJ9A 2HXGA 4QGHA 4Q1EA 4RSGA 2AFIE 1B43A 2YQ5A 4ISBA 2WIAA 4AKEA 1QJ4A 4FJ1A 5CXUA 3UA4A 2QSYA 2ZYWX 1O03A 3ZD8A 2UV8A 4J90A 1KJJA 4P22A 4BMNA 2RBKA 1B8PA 4LE0A 1PNRA 3PE4A 3L05A 1AOXA 5M2QA 3PRYA 3U3XA 4J4TA 2Q1UA 2BEWA 1U3VA 2XXJA 2CBGA 1NQXA 1X42A 2G04A 4EPWA 5JQGB 4WA8A 5CB4A 1V6SA 2QVXX 5AVTA 5DB4A 5A03A 4L3WA 3OEHD 4AWAA 5AESA 3WL4A 3EHEA 4Z3OA 4XEHA 1KYTA 1U0EA 4B4VA 3CGGA 4DIMA 4EM6A 3VH3A 1CUVA 1CQJB 3HS3A 121PA 2BF7A 2BGJA 4MYSA 4YQYA 3U3ZA 3VNSA 2G77B 2IKSA 1J0BA 3ANYB 1AKQA 2ZRDA 1KR2A 4PGAA 2YZNA 1T2AA 1VGRA 3V8RA 1Y6RA 3Q1LA 3EA0A 4JBXA 2O2DA 1ISJA 4ARUA 1Z2PX 5JBNA 1ONPA 2O2IA 1DDGA 3O92A 2G4VA 1T5HX 1EFHA 2OZPA 2BTOA 1S8NA 4R1LA 4DPMA 4KAJA 3UHFA 4AJNA 1C0LA 5JLAA 3RK4A 5K2OA 5DM60 3SFZA 2QY9A 4G1UC 5MN5A 2YV2A 3M49A 4AJHA 2O1EA 1UBMS 2B35A 4KLNA 1YRWA 1JQJC 1FUKA 3U6BA 3IELA 4XJTA 2OUIA 3OQIA 2AG8A 3ZV6A 1HE3A 5JXIA 2H48A 1HKHA 3D0OA 4MKXA 4AD8A 3KS9A 5BXYA 1FFBA 4HUTA 5D5PA 3EUFA 5KJ6A 2AE2A 3K09C 1JH8A 2E5FA 4UD6A 4S1OA 4X93A 1NP6A 4MB2A 1K6JA 3D3JA 4GPD1 3LVQE 4C5CA 1QV7A 2KW5A 2OV3A 3GEMA 2FPIB 2X3UA 4K9SA 1P72A 5BNWA 4DR7B 4HVTA 1SBYA 1N3LA 1SZCA 1FNMA 3TBHA 4Q39A 1Z38A 4PYIA 3SQDA 1RWWA 1E7RA 1TQDA 4REQB 2GILA 3EDOA 3ZY3A 3SDBA 2ZI4A 3Q41A 2AUMA 4QPCA 1T0UA 4ZA2A 1J25A 1S2OA 3W5AA 3RVLA 2ZTSA 3F5SA 3RSFA 2IY7A 4MKIA 2PZEA 2Q0SA 3TW4A 3B8HA 4OQMA 3AM1A 4XWGA 1SRQA 1AKRA 4BBAA 3RBVA 4L6AA 4RLSA 4CZ2A 2ZQ5A 1LVUA 1PV1A 3G2LA 1FK8A 5FUVA 2X2PA 3H84A 2D4AA 2QVGA 5C80A 3GLUA 4BWVA 3NHPA 1D09A 3K5PA 2IXAA 1HGXA 2WUFA 5G0UA 4O4IA 1KJIA 4FGKA 2V96A 4BX8A 1RRPA 3H18A 4L50A 1YBFA 2Q41A 4WBSA 2HBRA 4X7RA 2H1SA 1FNDA 1GZSA 2BR4A 2MSNA 3LL7A 4HDSA 1DXQA 2X13A 2FLKA 2FN3A 2RK3A 2V7BA 3UJ9A 4ZZ3A 3H1GA 4JSYA 2L17A 1VM6A 4BZZA 2OORA 4TYWA 1U7XA 1UMDA 2PSDA 4NCBA 4IXMA 1Y5MA 2JA1A 3O2SB 3SJ7A 3TVDA 1OZFA 1AH2A 4BNFA 1JZSA 2VBGA 5I51A 1EK5A 1TNDA 3MBIA 4DLRA 1OLOA 4Q24A 4E2YA 1NC3A 3RS8A 1DINA 2JGMA 2W58A 4V2UA 1JRLA 1ORVA 1NI4A 3GJ0A 3DBVO 2C57A 1CF2O 3VR0A 1SMKA 5A04A 4QAJA 1MA3A 1Q84A 2O2EA 2P30A 4GGMX 2Q2NA 3BWDD 1E3DA 5IJZA 1SU6A 1CXZA 5KYXB 1O7JA 1XKTA 5T4EA 2QQEA 3ICVA 1EWTA 4EITA 2K5UA 1E0DA 4JWKA 4G5YA 4P93A 5REQB 2AZMA 1UBOS 1WXHA 3L8ZA 3NLLA 4DJTA 1PWXA 5AI4A 3ZDYB 3OD5A 2EP8A 2WJIA 1JLLA 5KKCA 3IMCA 4QDKA 1ZCJA 4HDOB 3RAEC 3ZLBA 1GQSA 1GPNA 4N7JA 4WOKA 2O23A 4OBWA 4N39A 3CFYA 3FUXA 4IUBS 4ZVMA 2WOOA 3FGNA 3WGOA 4A2WA 5INTA 2Q6IA 1IEXA 2ZR8A 3IDZA 2ZDHA 4FMDF 1R0YA 3HR4A 3ZLTA 3CNLA 4DJJA 3KQLA 2BRUA 3OT5A 1MQAA 2B7LA 1U7WA 5FJJA 3TB6A 1MX5A 4OLFA 2CHVA 1EZ1A 4RS4A 1L5HA 5KX5F 4N3CA 4ENWA 2I6FA 1YUNA 3L1JA 2WVHA 1I4EB 2QBYB 4KBYA 2WUEA 1C29B 1T5OA 4OXRA 1V7CA 2WF7A 4Y2PA 4YV7A 2GZ1A 2YINC 5BSRA 5K0FA 1T36B 4J9UE 4GX1A 1E2NA 1THGA 2V9ZA 3C74A 5IKOA 3WNCA 3QX9A 3FNRA 3IIJA 3COJA 5BYBA 4Z53A 3VDQA 4TTQA 4ALMA 2ZRKA 2E21A 3ZGYA 1SQFA 1C1YA 2W6ZA 5B1IA 4MZXA 4WVFA 4P5EA 4A2PA 4NY1A 1DC7A 4QC2A 2GVZC 1MOQA 3BKWA 1V43A 3PQ7A 4J0DA 4QBIA 1NVAA 2IXTA 2FPKA 1BS1A 2Q5OA 2FZVA 3AKZA 3B3FA 4IEEA 2VR1A 2BEVA 1P4AA 3KPWA 6LDHA 1FDVA 4YPOA 1N6HA 2Z43A 1U0OC 1SBZA 3IULA 4AZSA 4BLOA 2YV3A 1BFUA 2IEZA 3FN4A 3AO0B 2Y4NA 1S0UA 1U9ZA 5DI3B 2IJGX 4LJYA 3EG9B 1R37A 1UM8A 4E70A 3O8QA 2VEDA 3O3CA 4X8OA 3PIDA 1MORA 2BGUA 3AQ4A 3R3WA 4A4DA 3I2IA 3JALB 1JX6A 2GOYA 2P6UA 1PL6A 3A6FA 1YE5A 1L4NA 1PFKA 5LNK6 2WB2A 1EMDA 3AEZA 1A0OA 3GVHA 1MO2A 4K26A 4P3YA 2PMBA 4BBJA 3C97A 2G5GX 2I6TA 2H52A 3GGGA 3IQWA 4EJFA 5EIXA 5CA0A 3ZYZA 3WB1A 5IT4A 1ONOA 1SVSA 4OFXA 1DTWA 2HSZA 1EFDN 3G7NA 3OQBA 3AR4A 1JIJA 3NYIA 4D9BA 3OTOB 4IMRA 4YS6A 4ETNA 5TV2A 4OYLA 3VO1A 4C4PA 4BUJA 3AI3A 3F3YA 3MIZA 5C18A 5ALSA 3A2KA 3U4QA 1GR1A 3BGVA 3RVOA 5MDHA 5DNUA 1DKRA 4KJXA 3OOWA 1Z13A 4RJLA 3OCCA 1ESZA 621PA 1KSJA 1TQ6A 1K6IA 4ROTA 2VUUA 1SUAA 2EYQA 2BR3A 2O3UA 3GDOA 1H2XA 1C0PA 2QZ4A 1NL3A 4JLKA 5I9TA 5TB5A 2YC4C 3OECA 1T5LA 2YHAA 3Q7SA 3QY9A 3G9ZA 5EPUA 1IBSA 4D57A 1O96A 1R12A 3MCUA 3UJHA 5HXAA 4XWYA 1XRSB 4ER6A 2O0JA 1T5BA 3FLEA 4XH9B 1ZN7A 5DNWA 1KWGA 4F3KA 4XGIA 4KPGA 4LZPA 4K28A 3BWYA 4XVRA 2CLIB 3R23A 5B58C 3HBJA 2QJFA 4NJEA 2JI6A 3R9XB 3WLNA 2PBZA 4JLJA 3AJRA 3THYA 2O6HA 4B4OA 2CJWA 3AKYA 3BHJA 3KJIA 2ERCA 1ZY2A 2QD4A 3EUAA 4NBLA 4D9NA 3RANA 2J9FB 1UBJS 3IBCA 3O26A 1F2TB 3REFA 2C7BA 4RH0A 2GN4A 3IVGA 2C88A 4BQEA 2WFAA 1SIUA 3OJ0A 2PLRA 1DEOA 3D7MA 1W4LA 3HJCA 3RYIA 3ZTYA 4YASA 1P2FA 3ZUPA 1XIVA 1I8TA 5H7XA 2V0NA 3VJKA 1FP2A 4N6NA 1G8GA 2RGEA 1QO0D 1OILA 2G09A 3FWHA 1WAMA 3IEKA 2D5BA 4P82A 4NSNA 3ZJYA 4C0LA 3T5DA 1ANKA 1KYQA 3OE1A 5KTOA 1SVIA 3BK1A 2VOEA 2BGNA 3C3JA 3WZ2A 3G9UA 4M88A 4BLQA 1J33A 1Z18A 2GERA 1OHHD 4EF5A 2FU5C 2XZPA 1HLGA 3ZHVA 2Q2WA 5LP6A 2XGJA 3WLSA 3LP5A 2NQ8A 3D4OA 4R3WA 4ZP1A 1GYPA 4O4LB 5DTMA 1FNSA 1DEXA 2GO7A 3IESA 4ZOEA 3DWIA 3M6FA 3LV8A 3V55A 2J48A 2ZWPA 2WHPA 1URPA 3GEGA 3HE3A 2CYAA 1V1MB 3GH3A 1CUJA 3U1VA 4QQNA 1Q7EA 3T7IA 3OZBA 2IEBA 1NVVR 4AKHA 1G20E 5JNVA 2ZG6A 3F9CA 4R2WA 2WV9A 2WJ3A 3WDMA 3EXFB 2NSJA 2R8EA 1ECJA 3RIYA 4BJ1A 1NNEA 5ALOA 2PRYA 3UKOA 3UMVA 4HV4A 1S9HA 1ZK4A 2R8ZA 4ZYXA 1G16A 2QVBA 2ZRPA 1QKJA 3TTTA 1PG2A 3ZZNA 5IJ0B 2AJTA 2RH8A 3EA4A 4YMLA 4HQNA 4RVNA 5H80A 5F2KA 5FWNA 3OEWA 4S1VA 2OSBA 4OJMX 4ESHA 1E8MA 4OHPA 4PXAA 1XF9A 1Z06A 3QFRA 4PNPA 4D5EA 1IH8A 2CVQA 2OBLA 3HA5A 2WD7A 4YRNA 2YXBA 2I2AA 4LPKA 1R1DA 1ZRHA 4Q7EA 3IA2A 5K3FB 4P2GA 5F52A 1VJ0A 1HLPA 4H77A 5A2QA 2FKAA 4TKLA 3W4IA 1FB5A 1MQSA 5JOQA 2OCYC 4U8GA 2F6RA 2AL7A 4ZCMA 5IZ4A 2IL1A 4IV8A 3BICA 1L4EA 3R8XA 4D44A 2UZ1A 4HWSA 4BX2A 4D3SA 4Z7JA 4OJYA 2WWGA 1AU9A 2R4QA 1GPDG 3ZVRA 4MYCA 4YGXB 5D3KA 5JSFA 1EDBA 2I91A 3C6YA 3MJ4A 2UYQA 2JLAA 1TM5E 2YWDA 2O7SA 2PS0A 3WQSB 5AW6A 3FMFA 5L3QA 3CSDA 1S2MA 2E18A 2YRXA 3FYTA 1WQ1R 3JYQA 3LWDA 4MS1A 2ONCA 4M1KA 4UOQA 1VMEA 4B43A 4QIHA 4AP9A 1H2BA 5E0OA 4B45A 1QQ7A 4LNAA 4DVJA 2AYZA 4PSKA 3U7JA 3UJAA 1Q3KA 2HYDA 1HMYA 3HYTA 3OPYI 4PC1A 4J3NA 1XTUA 2YMPA 5ENDA 4ZXFA 2PUAA 2GN2A 1GZ5A 3HU3A 4XQ9A 5CMLA 5ILOA 1BMDA 1TCUA 1SCJA 4V0SA 3ZW7A 3IEVA 2JIZD 2O14A 5DTRA 1ISPA 4TX1A 3U0VA 3UA3A 3AEKB 3CEMA 3FF4A 1UC4B 4LQCA 1DBQA 3N5CA 3T94A 1DIGA 4K7JA 3GA5A 3OFNA 4MDHA 5J59A 3GP5A 1K6EA 1XAGA 2A58A 4HI0E 1KFEB 4KI7A 4ARZA 1L8XA 3A6EA 4KQ1A 4LZAA 2O2YA 3ZE1B 2NP6A 1WY5A 1ZVJA 3DLAA 3GLIE 3UGKA 1QHYA 1RTTA 1I14A 3KQSA 5KU7A 1PGPA 5TGTA 2CJFA 4Q47A 3LSTA 1EM6A 4Q01A 5FTMA 3LDHA 1XO1A 4YJ2B 3RAJA 3WQQA 4D4GA 1ZJ5A 2B5VA 2RSLA 2ZJ0A 4Z7OB 4GOMD 1XNGA 2C0CA 2GBCA 1ESNA 2J7PA 3CH5A 4PZYA 4Z8XA 4Z4FA 4MDEA 1B6SA 1CDDA 1GLVA 1RMQA 4EL5A 4NFSA 3HXLA 2Y8EA 4MVXA 4OQYA 1G17A 1U3GA 1GCUA 1ENOA 3DMFA 2OFXA 3IP6A 3T4EA 5JMWA 1DUSA 3EW9A 1JBKA 2WM8A 2PUCA 2FPPA 1WPRA 4E15A 1Q19A 1BDJA 1F9EA 2R6JA 2AI3A 1R0CA 3FTQA 1D6SA 2CB0A 2QPAA 1M75A 5BW4A 3TJMA 3BJIC 1YDWA 3N2ZB 2V1XA 4WBXC 5AQEA 1PQYA 3WGVA 1EVQA 3HBFA 4IVRA 2GHIA 4G23A 3RTBA 3FPCA 3BIFA 3W78A 2K7ZA 3T7AA 3LYHA 4BEVA 1JAIA 3DHVA 3L79A 5FHRA 5H83A 3HWWA 5CM9C 4IZ6A 5JTUA 2QZ9A 3Q8XB 1CUFA 1IXZA 2NQ2C 1ST3A 3KJHA 3F74A 4KEAA 4QDJA 1G3QA 3P9XA 4QYWA 2A0XA 3JARB 2CDAA 1UQRA 2WUGA 5FI0B 3NBYC 5B55A 1CRPA 4CN8A 2RDMA 3SYLA 4ZAFA 4QU8A 4K87A 4RGBA 4MHTA 1UWVA 2NU8A 1HM5A 1HUQA 1NDQA 4MMYB 4NMXB 2F1IA 4JI0B 4G0OA 4FYMA 4TWIA 1WPXA 3OCUA 3VR3D 5DYWA 2J9YB 4HLUC 1V3TA 1ZMXA 4JJGA 2OVFA 5C52B 1HQCA 4JCCA 3V46A 2V4MA 5HF6A 1WULS 4P4SB 4GQBA 4JBLA 4KTTE 1YXMA 1V11B 2CK3D 2ZJ8A 3IVRA 2XE4A 3DAGA 3PF9A 4YWJA 3UENA 1D4OA 4YRSA 4LTMA 4KQIA 6GPBA 3FXAA 3RVPA 1XZIA 1XMQB 1GVHA 1XV5A 1WDLA 3ZHZA 3NH6A 2O5EA 4JEIA 1RHRA 2CWDA 1MDFA 3PUJA 4M36A 4PO3X 1BWSA 2UUCB 2WQ7A 1W4BA 1EWKA 1RQLA 2AFHB 2QNRA 1D6JA 4BFZA 3O95A 3SF8B 5KYWB 5HP4A 5DJ5A 5FRDA 2PSEA 5FULA 5KREA 3DXXA 5EHQA 3FBWA 3UHAA 2B69A 3DEHA 4O0LA 5AW9A 2Y68A 3V00A 3M34A 5AUOB 3IALA 2VOJA 1X8XA 2BZGA 4NWIA 3UZUA 1ZNXA 3C6XA 1X80B 3VHRA 2BEJA 5CVUA 4CM5A 4CEJB 2PH7A 3K32A 3T4UA 2FPGA 2WILA 4B6RA 2G9NA 4WT7A 4LI3X 2X4GA 8GPBA 3A7DA 3AETA 1LBIA 1F6DA 1NBWB 1L3BA 1UXHA 3HWSA 1E2LA 2MSCB 1I33A 1U31A 1VXRA 4XGRA 5C34B 4D2IA 3GLGE 2G70A 3QYJA 4NS1A 3ZDAA 1VP3A 3AUSA 1IATA 2WP0A 3JYHA 4R9UC 4F8YA 3F5FA 2H5JA 5IZCA 1MX1A 1V8DA 2OCAA 4G4IA 4AX8A 3N59A 4FFWA 4C4TA 2W4QA 1AGPA 2BJWA 3WXBA 2GCGA 1IFXA 2PVSA 5LLTA 4H7IA 1OYYA 2BUCA 2DHDA 2OESA 2R8RA 1K86A 2VPPA 4NL4H 4X7MA 2D2EA 2EEZA 1JNXX 2IGBA 3KYJB 3O74A 4D8YA 2FK7A 2ZT6A 2XE7A 4TMKA 5ULLA 1ESCA 4KFSA 3GIDA 1NRIA 1LEHA 4B3SB 1TQHA 5KWVA 3DV9A 5CAEB 3T3NA 2RARA 3BSYA 3FFTA 4R0MA 1X7YB 3MIIA 1SD1A 4TM7A 4ZD6A 2XNDD 2OAGA 4IDQA 3MS2A 3WA6A 3ZVLA 1AA6A 3UV7A 1DXYA 2Q3FA 5LUBA 4EABA 4DYVA 4OI0A 4C14A 2PGJA 2JLWA 3UB4A 1IN4A 3RJTA 2XDYA 3AJ8A 5FV4A 1E2GA 1ZW1A 4YBZA 3WLTA 3SHTA 2JL1A 3FVQA 3IA7A 4HP8A 3R5HA 4FD2A 1EWVA 3SBDA 4E6EA 1KI6B 2PO7A 3LQRA 1NFRA 4HN9A 1XAHA 2EKDA 2PT5A 3MHPA 5CTJA 3PL1A 3PC3A 2A9KA 4E3ZA 1E2MA 2JLUA 1YQUA 4JQYA 1FLVA 1DJPA 1W94A 1X9GA 1Y1LA 4N0QA 2YBEA 3IR6A 3Q9LA 3QJYA 2IBSA 4E1AA 3EASA 1D9ZA 2PXHA 4X8MA 4AJ9A 3NG1A 3WYEA 4RMJA 1GQFA 2ZIXB 3GLFE 1QOPB 4RY2A 4AB1A 4MCAA 2WY2D 4HGOA 3IR7A 1TJ5A 1NE2A 1SOWA 2AFVA 3AHGA 2C0QA 1HFKA 4M1SA 1WKVA 2AE1A 4C0QC 4IKPA 1X1RA 3OJWA 4OHVA 2OFOA 1MN6A 1U9IA 2BH2A 3BQ9A 3S2IA 3TIFA 3TOZA 2GCEA 4G89A 3TXXA 1IULA 3I6ZA 3TQSA 2GRAA 4DBLE 2ERXA 3ILHA 4N5MA 1CEEA 2GSDA 1U6KA 2X0NA 1E0SA 4BVFA 1O2DA 2X6QA 4RA9A 1VBFA 1OBOA 1T0BA 4MR8B 3OWHA 3FLBA 1MHTA 5C3UA 3VKUA 2QV0A 3R9KA 2P40A 3WIOA 2D06A 2Z3WA 5IAEA 3FYSA 1SY7A 3GUVA 4S0XA 3SIXA 4MLCA 3TSWA 4C03A 5IUKC 5IT5A 1IDN1 1Y9AA 2Y1DA 3WRYA 1XHEA 1ABFA 2A14A 1NN1A 1V41E 1MQ8B 4R54A 1IL0A 1J2EA 4FXPA 2GYYA 2FCAA 3TZCA 5JBQA 5KTNA 5M34A 2HPZA 5E3IA 1X2EA 1M6WA 2YN4A 5MN4A 2A9JA 1E1RD 3KXLA 4FZ3A 4DANA 5FX2A 1QNLA 4R6WA 3JQFA 2NUBA 3H1BA 5CFRA 3VR5A 3VH2A 1LI4A 3LUDA 4P92A 3SXUB 1XWIA 5CLGA 5EYPB 4C6TA 5I6DA 3H2GA 1FLAA 4KPUA 3TXYA 1PWZA 3ETDA 3PGJA 5TVGA 3UJ6A 5BUZA 3GEIA 3DBRA 1X1QA 1M2GA 1W4CA 1FUIA 4KWHA 1V1RB 2FB9A 5D7BA 3DV0A 4PZPA 4X85A 1R6AA 3IPYA 4U2CA 4BNMA 5IULC 2QLJA 5AM1A 1CNMA 1VSVA 4S35A 1P1IA 4GVPA 5IVHA 2H31A 1HDEA 1KEEB 2WICA 3UCXA 3L7KA 1I2ZA 3LQQA 3GRKA 1KIMA 4RC9A 1DWQA 4I9UA 1IRXA 1O6CA 1Y8RB 4JLWA 1I7QB 3HV2A 4P0TA 1D9XA 3IHKA 4O3FA 1OFIA 1H6AA 3OQMA 5EJ9A 2IY9A 1K8ZB 1OZ0A 4JVMA 1ENZA 1E6KA 5C2JB 3ZBPA 5PNTA 3RRFA 2FEAA 5HS6A 3DA8A 1BX1A 4IDNA 1XALA 2GEKA 4I6EA 4D96A 2QG4A 1FQJA 1IYZA 1AQLA 4GGPA 1XD8A 3T9CA 4CKZA 2IYUA 4G5SA 3TTVA 3H2YA 1UJMA 3STHA 3W3AH 4PCLA 1DZIA 1ADGA 5CVVA 4I5EA 5C0OE 3KTAA 3MHTA 2PUGA 4D8XA 3DEJA 4YCLA 1XMPA 1NAIA 3DUFA 5AICA 2EU8A 4X64B 4UM7A 5JFGA 3B13B 3C41J 3NP9A 1SVLA 2HQOA 4KV9A 1M54A 4HWOA 5ALGA 3HB5X 5G1OA 3RSOA 3SX0A 2O8BB 1JHAA 4DVGA 4DV7B 3LUCA 2L69A 2FR1A 2QL9A 3AL3A 3MWGA 5LP1A 1GRQA 3K05A 3VVCA 1ZNQO 2P8JA 4FDTA 2VJAA 2SNIE 1C3EA 1F0KA 1A1VA 5JYBA 1KFBB 4GS5A 1O95C 4OMUA 2O2GA 2VATA 2GUGA 1RXCA 5L8VA 5LQKA 3ZHSA 5KYUA 2BHRA 3MZ0A 5TPWA 5BW5A 4Y67A 5F1YA 2Z2XA 1E62A 3EXG2 2ZM6B 1DBPA 1UP4A 3D4IA 4IQFA 2GN6A 2YZMA 3ZW9A 2CXRA 3P32A 3TNDA 1KDPA 2VYVA 4OGFA 3UT5B 1QIJA 1G21A 2HMWA 1LDYA 2QTLA 3DEAA 3O4GA 4FFRA 4IMPA 3ZCPA 5HJ5A 4L7QA 2WRZA 2GEBA 4P53A 2HQRA 5DXAA 5DRTA 3W06A 3VR2D 5HR5A 4MPDA 2NV2B 3USZA 4BC0A 3CIOA 5JQGA 4NXNB 1US8B 5FBQB 2ZJBA 2IPNA 4D8VA 3OPXA 4BVJA 2Y77A 4KZPA 4NECA 1SQGA 2QS9A 5EXDA 1QRRA 3WWZA 3NRJA 3RFTA 3KT3A 2NW6A 4TT3A 3CKLA 4FHZA 4I3GA 4NBWA 1ULHA 2OZLB 5FUQA 1IIBA 2JCYA 2ETXA 3AEUA 4M9SA 1L5LA 5L3ZA 1HEIA 3E6AA 1SCBA 2HHJA 3ESBA 5D2CA 2R5NA 4H1WA 2B1JA 3ELWA 4WZZA 4K0KB 1SVKA 4IYRA 3GP8A 1SKMA 3A1EA 4RF5A 2COUA 4DXAA 2IUEA 1Z9BA 5G0TA 1SK9A 1H1DA 2Z98A 5TEVA 5K8TA 2I65A 3A4LA 4PCVA 1AZWA 3C3YA 3E3NA 3LC2O 3MD0A 2F3RA 4I55A 4IV5A 3CN7A 1NXOA 4YB8A 3OZCA 4FYPA 1TYEB 3PQ2A 4AS1A 3SZRA 3SM9A 4NFLA 2XITA 3EPRA 4CIYA 3WV5A 2VP0A 3AERA 5K0BA 4UTPA 1CZLA 2YVKA 3H9CA 1NUTA 3QKWA 1BCRB 4G0MA 4BMZA 1IQ0A 4XUGB 2O20A 1A4IA 2XOKA 2E4AA 1GPH1 2OOSA 1V8BA 4GM0A 4HRYA 5DNAA 5FD8A 3ZE2B 3AHIA 3IBFA 4LWPA 4DLSA 4K6KA 1P1JA 1XJWA 1JIUA 4BQNA 4YRKA 3IBGA 1EGQA 1VG8A 2NG1A 2DFNA 2V6BA 1QYCA 4NZ9A 1QNFA 3DW1X 3ANLA 3CYFA 3RDPA 3QEBZ 2Q7XA 2ZU0C 3RVBA 3MF4A 2HU5A 4H1VA 3TEMA 3LX5A 3W9SA 3AR6A 3JS5A 2AEFA 3KG2A 3AESB 3HKEB 4GX5A 2WNIA 4WADA 2EJCA 4D43A 3O38A 3EFOA 1AGXA 2O0LA 3KT6A 4JB3A 4JBIA 1QH8A 2VJDA 3PNBA 3KZ1E 4U9HS 2Y1GA 5SY6A 2NM0A 1PZXA 3FPLA 5A0FA 4BGUA 3DDSA 1NBAA 4LJ5A 7MDHA 3NU1A 1Z68A 1V6AA 1OY1A 4J4HA 1QYRA 3JZFA 4WCVA 1KP9A 4TV8F 1HNZB 3KLBA 2CD9A 4HYTA 3JQ9A 3UANA 1OGYA 4F9TA 4LFAB 1XRMA 2X5XA 1UZNA 3OJXA 1XZQA 2J4DA 4IV0A 2VEOA 4F5WA 3FGOA 3ISTA 4G0QA 4TTAA 1Z5ZA 2C04A 4QHSA 3P0RA 2PSSA 3E1KA 2ZZMA 3QUQA 1W2HA 4AQDA 1DQZA 2LDBA 1HDGO 3I45A 3SWWA 3WTCA 4JIMA 4PQFA 1RI2A 4FIZA 3QU7A 1XEFA 1H2WA 2QN2A 4G41A 5CTAA 5CFMA 5HYVA 4L2IA 4PAWA 4QYMA 5BO5A 1KDYA 3LQYA 3TW8B 4LA4A 4PHHA 5AKYA 2H4YA 1ZU4A 1DJNA 2Y99A 2DP4E 2XY4A 4ML3A 4Y6PA 4C78A 1QRSA 4Y2HA 1YZ3A 4U2GA 5KNCA 1HDCA 1I7NA 2Z83A 4MUKA 1ECLA 4KVGA 1H9AA 3IBSA 4Y6OA 1NSFA 4LFCB 2HJRA 1LPOA 1SCAA 4MW7A 4PANA 4XX0A 2R6FA 3TS1A 4A2QA 4BFCA 5IBCA 5DLQC 3TRFA 3CZCA 4YHBA 3SHWA 3CUUA 5MFZA 1QFMA 3UWOA 2PFGA 1TPZA 5J2UB 2C1EA 3B3QA 1JL3A 1ONSA 2C95A 3OMLA 1Z29A 4TLAA 2ZRLA 4U4AA 4PX2A 4ZHQB 4EJ2A 5HKAA 1JJAA 2B5OA 3MLBA 3HGMA 3Q8KA 1ZJWA 4QUKA 4ZREA 4Q9NA 4D0SA 4M9CA 4N6OA 4DV3B 3HWRA 1DRWA 2HPHA 3HB0A 2ZE5A 4A27A 1IY0A 4BNTA 2X4DA 1J90A 3H3JA 3S4YA 5EHXA 4HFMA 3N3BC 5FOWA 3K70C 4LRTB 4WY8A 3EC2A 4ZYWA 1P2BA 2WHYA 3OOJA 1QQTA 1A9XB 1JR3A 4NQRA 4H7PA 5D87A 4EMTA 4I1UA 4Q21A 4E5NA 3N0WA 3KOYA 2ZAIA 2ZI3A 2P5YA 1ZMRA 1M2EA 1OXVA 4RULA 2AX4A 4WKBA 3JVEA 3IOCA 1SXJB 1GU1A 4IM7A 3A7EA 1RM3A 1NBMA 3P1JA 4GKAA 2AQ8A 1T36A 3UXHA 4JUFA 4B7XA 2ZYVX 4O08A 2XUZA 3A06A 4XIYA 3RC2A 4URVR 1GA6A 2C5FA 4HX5A 3KOXA 1JDZA 1L9XA 3QOWA 3T3OA 4DXHA 4R16A 1MEEA 2QRGA 2YHIA 3TLJA 3VI3B 4JCOA 3OQNA 1S2LA 1JPVA 2QU7A 4UMEA 5C5IA 1LZLA 3SYTA 3JQ8B 4MLDA 4LJ9A 1O95D 3ED1A 3DPIA 3QKRB 2AKYA 1W36D 1Y3AA 3FDZA 1DRUA 3GEBA 4PX9A 3TTUA 3EDQA 1Y7LA 2E82A 1JSRA 2P79A 5EWLB 1KY4A 1XYYA 3EEQA 2C8KA 3DTNA 2P4QA 4NPHA 3EZGA 3ENQA 4FBMA 5CT9A 4UOEA 3RBXA 1XZ8A 1JA0A 2ARKA 3OIGA 3WGKA 3ZEAA 4KXUA 3B1ZA 3EG9A 5E2AA 5J40A 4DLWA 1XELA 2N75A 3AKDA 4X5OA 3DGEC 3PZRA 3OZWA 4FVTA 3QNUA 4JMLA 5IYZB 3W6UA 1Q2UA 2TYSB 1FIUA 4MQ6A 3WGGA 3C45A 1ODTC 1ZH2A 2RH4A 3U44B 3UG7A 1K9VF 1YC2A 3MTGA 4WKCA 4NNJA 2KE5A 3RH0A 4WNAB 3QMPA 1GRRA 1O8BA 2NTEA 3EGWA 3ESYA 4YRQA 2QT9A 2XF8A 4R7GA 3EW7A 1PHRA 3FW1A 4P7FA 1MJNA 1OIWA 2AJLI 3TRIA 5AW0A 2GCIA 1LPMA 4AF6A 3PC6A 3DM9B 3F47A 2CV2A 3RIXA 1ODFA 2CZGA 4I8IA 4R1QA 1GM5A 1GTZA 1HTWA 1QHGA 3G2QA 4QRHA 4Y9UA 3K0SA 1Q91A 2JKYA 3R8CA 2HLHA 2PKXA 2RI6A 3LW8A 3VV3A 1ZKMA 1TUEA 3X3HA 2PKWA 4QJBA 1OI7A 2BMDA 1T0IA 2JFZA 4BBPA 2B83A 1EIWA 2HUNA 1NHGA 2AR7A 4DG9A 4QDZA 3E2PA 4K6CA 3QI7A 4M53A 1DT3A 2JBHA 3WYGA 3KYCB 2FLVA 3JQDA 1IWBB 1DAGA 4KQFA 5KDOA 3HDYA 4YRZA 4EY8A 3ACDA 4EP1A 4AS3A 2C5BA 1C1XB 1QCDA 2BAGA 4JB8A 4UPEA 5CVTA 5JAPA 2VDLB 3QG1A 1QK5A 1KNQA 3OY7A 3NHYA 3R9XA 4LVCA 3PD7A 4FGWA 2X1VA 4D9HA 5C1OA 2B61A 3N70A 1P7PA 2JIQA 3S2EA 2GEDA 5FF9A 4MJXA 2Z1MA 1GSOA 3NYWA 1XA0A 2L82A 1XZLA 2VYND 4XTCS 1YQXA 2J9FA 4OFWA 4A8JB 4B7AA 3IOBA 3O8DA 1NULA 3NPAA 4C5AA 1GU0A 3A4MA 2YJ6A 1QDUA 5AM0A 2ODQA 4RLQA 3PPVA 4TOIA 4D3DA 1YKSA 3PJFA 1WX1A 3B2EA 1RD4A 1HEUA 3LHDA 4PLHA 4YC7A 3WWYA 3QVJA 4BNDB 2JRCA 1JQ3A 3RKRA 1I36A 3OJOA 3MB5A 3ZI0A 1JVNA 3TK1A 5I9LA 3CISA 1A4XA 5LBTA 4PYNA 4NCNA 3GQBB 4ZEMA 2BLLA 1AB5A 1E5LA 1USGA 1XZHA 2CYCA 3DB2A 4NDZA 1N1MA 3VX3A 4FHDA 4OVKA 1FE8A 2WHQA 3SKXA 3E58A 2ZIVB 4FFBA 1RQ7A 4UU0A 3ETLA 3ZIDA 3O75A 2C5EA 1W4ZA 2DECA 3TCKA 2AQIA 3V1NA 3KX2A 3QEKA 2VAPA 3BULA 2ECFA 4O4LA 4F1JA 4BO0A 2X40A 3ANXA 2FOIA 5JYEA 2IDMA 3NH9A 3IGFA 2LTAA 1YJXA 3EH2A 4Y9DA 4G24A 4ZN6A 1SCUB 2PK3A 1NJFA 2GK7A 2QSJA 5UKDA 1WOYA 5B57C 3WRXC 4ZVRA 2F8SA 2R2GA 5IX8A 3MELA 5B1HA 1NE7A 4MPJA 2I54A 4RZSA 1R5BA 1CUYA 1K3TA 1USUA 2GZHA 3W5SA 4Q1DA 4KPYA 3ST7A 2J87A 3EXFA 1TUGA 2CJXA 2PT9A 4DYHA 4IAOA 4Z9BA 5IN4A 5HJ7A 4GECA 2QM3A 5IJ0A 5H82A 3J7AC 2AN4A 1R6XA 2OVBA 3IKTA 2AG5A 1P9RA 2AZ4A 2P7IA 4J7CA 5LOVB 2B82A 1FRVA 1P2GA 1JLMA 1YZVA 2WYWA 1A72A 2VK2A 2W6ID 2WEKA 3DT9A 3FCCA 3PC8C 3ZJVA 4MW1A 4QXRA 1E0AA 1I5RA 1CERA 3RW9A 2CUTA 5F78A 2O7VA 3MAJA 5J23A 5F1KA 5TT1A 4CETA 3LZDA 1O6BA 1VLVA 3DVRX 5B37A 2AXQA 4RHFA 3A11A 3RUHA 2BPOA 4GP9A 1FXWF 3S2YA 1O58A 5KSWB 3M1YA 2K2WA 1EK2A 1TVEA 1WXDA 1RC8A 2OGWA 1YZLA 1SHZA 3CVUA 3QELA 1IBRA 2C4TA 4D8TA 4CE6A 3NHMA 3PE3A 2PCJA 2D0PB 2CXSA 4QUHA 5J1SB 1QUEA 2CNDA 1YZUA 2A59A 3D7KA 3FGPA 3IUMA 3KUXA 4MWTA 1J8DA 4QEKA 4XW2A 2OHGA 4XIFA 5FP0A 1W1WA 4I50B 3WL6A 2O8CB 1NLUA 1XL1A 1SZPA 2B78A 5BQPA 1VCOA 2OZKA 1JAZA 4B2PA 1NYTA 4KK4A 4I4TA 2WBLC 4ZT4A 4BFYA 4M8KA 2MR6A 1H9BA 3HYCA 3I52A 1M72A 3S28A 1KAOA 3LF2A 4ZQIA 2F00A 4JT9A 4K1LA 4YCCA 2XOEA 3CPHA 3K9FC 3SQWA 3T4XA 4B17A 2YL2A 1QVZA 1YRLA 3IOMA 3ZD9A 2QMUA 4JITA 5DNCA 2W6NA 4HLNA 4LE1A 4FZVA 5AVJA 2IPMA 5J5VA 3RSLA 4D4JA 3BA1A 3SM3A 5JD5A 2CV1A 1C4KA 1J8FA 1ELOA 3PX3A 1RRFA 1JKXA 3AEKA 5IXSA 4O1HA 4DLNA 3CVWA 5K05A 3LKZA 1QIIA 2EGGA 2NSLA 1WXXA 4MVJF 3UG6A 2QUHA 3SIWA 4LHYA 1I2CA 3VVMA 4I99A 5AW7A 3ZJ4A 2NN3C 3I5YA 5G0VA 2YVUA 1KH1A 2R86A 5K9ZA 1OFGA 3KU1A 2J3MA 3U5ZB 4RKYA 1DWPA 1X70A 1ZNWA 2OO5A 2OP1A 1K4YA 3HDQA 3IB3A 4KRYA 4TSFD 1GZHB 1Q1AA 4NYJR 2BTQB 3CVYA 1MOZA 3BG5A 4LXXA 3T3EA 1U8AA 1WXQA 4KZKA 1OTHA 4ZQBA 4BEJA 4YJ2A 2BFFB 4JJAA 1IAVA 3FROA 4B0OA 1G0NA 1O77A 4HH4A 1WPGA 4PY2A 2EJTA 3AVPA 4BQQA 3BDAA 1C7RA 4F84A 1UWLA 2HYIC 3R5FA 3CF0A 2BOVA 1QPZA 5EE1A 4Z4EA 4GSLA 2IODA 2JAXA 2OLKA 4OTZA 3A26A 1UOPA 2OAP1 1YI1A 1UJBA 2OO7A 2O3RA 2Z9BA 4RD2A 4M37A 4YO7A 3PGVA 2XA2A 4YP5A 5ALDA 4EIWA 3C1UA 2YN0A 5HPYB 2XUFA 3CUKA 4QFDA 2QX8A 3GR6A 3ICOA 3IE2A 2P4HX 1FSZA 2FUG1 3COZA 4Y6LA 4EZBA 1KTVA 4TSKA 1QF7A 1V37A 5BV8A 1OFUA 3QTLA 4HRVA 5JADA 1A04A 1N5JA 4YGYA 2WJJA 2JK1A 3F67A 1ATIA 4HDCA 3KTDA 4UZSA 5EAIA 2FSVC 2BFPA 2EJWA 3GMSA 1J0DA 2PT7A 2OK8A 4M3NA 5JPIA 4Q1VA 4LJRA 3O1JC 4MHOA 1YCHA 2X1MA 1NPTO 1SEVA 4JK3A 3QTBA 3T5AA 4RVUA 2Y71A 3IJ5A 3BH0A 1OV4A 2AOTB 2FFBA 4EZEA 4IFIA 2ZTUA 4B40A 3W6OA 5ER6A 4P9NA 1QHNA 3ILXA 5KS2A 2CYBA 3RS7A 4LXTA 2REQA 4D99A 1HYHA 4DLVA 3UWMA 1F8YA 3B6JA 3TIIA 1ABEA 3JARA 1N2XA 4PG5A 3FFWA 4QATA 1ZH8A 3KLMX 4ND2A 4W1SA 3V7YA 3G5TA 3GBSA 1TKCA 4BASA 1ACJA 1UPFA 1YZNA 4DNQA 5BR1A 2QGFA 1D2GA 3K09A 4LQDA 2C00A 5TQ2A 3RSHA 1YOVB 2R1ZA 1DG3A 1S2NA 2CCJA 1SAYA 2V6JA 3Q0TA 4TTJA 1KXJA 2H06A 1A2KC 1W0KD 1WCXA 4DJ5X 3JVUA 1ZW6A 2NT3A 1WY7A 4LEIA 3EVCA 4MOWA 4P4SA 4YV2A 1T4MA 4YQEA 4JLSA 1V11A 4CM7A 2Q2QA 1HQYE 4WBNF 2B6NA 4EB6A 3MS7A 4YMUA 1HZJA 4JJFA 4BTVA 1JZQA 5I9IA 2A9PA 4EUEA 1QO0A 1EHYA 2CCGA 4X41A 1MUUA 4RF2A 3RGGA 4KK3A 2CZQA 2J0VA 3T9FA 5B1DA 4C7KA 1GKLA 3GGOA 3THOA 3SF8A 2QIOA 5KYWA 3G6KA 1RHUA 1AKTA 1HTTA 1ZYUA 1W34A 4NCXA 1COWD 4FNMA 4E07A 1UP7A 1M6VB 1O4VA 4A1FA 1E2QA 3QK7A 4WCFC 3GGSA 4YRLA 1BVUA 3I4CA 2J0UB 3RJZA 1PS9A 2RK4A 1X80A 4A26A 2ZRHA 3HEMA 4NHOA 4BE7B 3O7MA 1EJ0A 3GMDA 3NBFA 4IJQA 4FHEA 5PGMA 3BCUA 3PNQA 2BM1A 1NPDA 3WIUA 1L7OA 4PFQA 5CVEA 1KJZA 2WF6A 2ROQA 3PD1A 3LXMA 3PWKA 2C97A 3NWEA 3IAUA 3TXAA 5B1EA 1E9AA 1QHEA 3MEQA 5FH9A 1JNYA 2D00A 2V7GA 2XCLA 4G84A 1Z2OX 2QRNA 4UHHA 4CLOB 3S8EA 3JATB 3LLSA 3FYDA 3T7RA 2XWJI 2DE0X 2ATXA 5DM4A 3V2HA 4KJZA 2NUPB 2VJMB 1RBZA 3ZOZA 1OBCA 1Q21A 2YW9A 4X1OA 4LJSA 1M73E 4MEAA 3M70A 4WN3A 2AJDA 1GPJA 1ZX1A 4HQOA 1NJ8A 1ZGHA 3GA0A 5JE8A 4BYMA 3DQZA 3ZNQA 1ODSA 2OGUA 5BW6B 1U2TA 2OYCA 1JKMA 1T9HA 2ZXFA 1I0ZA 3E8MA 1MT3A 1Y6GA 2A0UA 1J22A 3NJRA 2P4UA 1OTYA 1R4AA 1X7YA 3ELUA 1IEQA 4IJUA 4Q00A 4JOSA 1JKFA 1TADA 4K1XA 1BH6A 4OJTA 1NQWA 5BPFA 2B94A 2VTBB 3AEQB 3DPSA 3GOQA 2Q9CA 4GD3Q 2I1QA 5JISA 3SHFA 4N40A 4BKQA 2B9EA 3NUGA 5DEIA 3D7LA 4K9OA 1GUZA 4XSVA 2P6NA 1EGAA 3P9NA 1E2HA 4LC9A 4U7JA 5AKIA 2WKWA 1JN0A 2I4RA 4PF1A 1DCKA 3E5HA 2HRZA 2RGUA 3N6RA 1Y4SA 3NTVA 4H08A 3HP4A 2CD7A 1D2AA 1U2QA 4KIFA 2V55B 4V0KA 4E08A 1H6BA 1H65A 3QXCA 1PJBA 4NK4A 5AJYA 4A6PA 4L9SA 1T9ZA 4MUMA 3SLRA 2ZSUA 4BNLA 2GZ2A 3GV0A 3NXKA 3EDYA 3VNVA 2IHVA 2QAGC 4KN9S 1L7EA 4QTZA 4UPVA 3T7EA 4WKGA 2GN0A 3DJFA 2ANCA 3FPSA 3IP3A 1UXIA 4TL8A 5JTTA 3U09A 3GD5A 2KBEA 2O54A 1IZ7A 1LK5A 2IK8A 3LSYA 1FP6A 2OEPA 3G1TA 2C9DA 2QX4A 3GO4A 3OE4A 2VCEA 4PZZA 4RY9A 5IBRA 5F3RA 4DCVA 4F11A 3MMPA 1I10A 4F71A 3I2GA 2VP6A 1MF7A 1VLQA 5LKAA 5KZMB 4G0ZA 1R4NB 4UEJA 3RT7A 3FPJA 4MR8A 4PAGA 2FW8A 1JQBA 2Q1WA 3CRQA 5G02A 5LWHA 3INGA 1JEQA 3S99A 4JI2B 3I09A 3I05A 1OOEA 2HA0A 2WTMA 5TVKA 3MTJA 1TKBA 3R7DA 4EB8A 1FJHA 2C9ZA 2O4CA 3K9BA 3TCXB 1RYDA 1R0ZA 1XJCA 2X5JO 3GJ6A 4KYUA 4I08A 4NONA 5A5EA 3COYA 1SB8A 4O2BB 5FT9A 1MAHA 1W4AA 3VTZA 1HG1A 2VPXA 3CXUA 3QFCA 3PHLA 1M8PA 4BAZA 2I71A 3M2TA 3VPCA 3O82A 1MQ9A 4FNAA 1EX6A 3UAGA 1FMTA 2BSAA 3WLOA 1S5PA 4AF7A 4KOAA 1ZU5A 1YRYE 2H1CA 4JI4B 1BWQA 5EZYF 1FMFA 1YULA 3OKPA 4ZRNA 2BEUB 1TLTA 5FEMA 1JPJA 4QARA 2AHOA 3CO0S 3THSA 2D13A 3LCVB 4CTNA 3DWGA 1E2UA 4MUIA 1GUFA 1DT5A 1KAQA 5E4YA 4QKQA 1PFQA 3U56A 2VVTA 1LV8A 2W43A 3A25A 2PUVA 3BL8A 3H0KA 2ZSKA 1VE9A 3KPVA 4FOSA 2KLBA 4CG1A 3V2GA 2FNAA 5B1YA 1TU4A 3GRRA 3GPLA 5JWHA 3B6IA 2BFOA 2QQ0A 4GZLA 1F8GA 4LF6B 1CFJA 5CFLA 5JI3E 3K16A 1N34B 3ABQB 3SHVA 1T4BA 4C06A 1XCOA 5BVHA 1BQEA 2G80A 1ENPA 4XPIB 4NU0A 2Y6VA 5AI5A 4HK4A 3H2HA 4RIGA 5ARBA 1DEAA 1RLMA 1NA5A 1LDEA 2DUJA 3HU5A 4JU8A 2FRDC 3VR3A 5DGXA 2ATVA 1JGTA 4K88A 1YRQA 3PUVA 4LGVA 4AO8A 1RAAA 1M34B 4JBGA 4AKIA 5FWYB 2V7XA 4HAZA 1MB0A 2VDWB 4P3NA 3LPMA 5GADl 2CK3A 3THWB 5CDYA 3AM3A 4HXFB 5G41A 2XDQB 4KMOA 1RQ2A 2A1TS 1M2VB 1G2IA 3DFZA 1GADO 3TRJA 1CVLA 3G85A 3NDRA 3UK1A 1Y4AE 1E9FA 2WWRA 3QWAA 4K9LA 2G0TA 2HL6A 4HGYA 3T54A 3AZOA 4AZ0A 4ZKDA 1T9DA 2IV3A 1JEAA 1FNCA 3JASB 4I3HA 5JVDF 4BQOA 4E2XA 2GX6A 3W6ZA 3U4AA 4TWZA 3UXMA 4F93B 2ZUBA 4M0MA 5JI2E 2ZUWA 1WTAA 2R4TA 4FCCA 1KI8A 4EDHA 1VSQA 1VBKA 1YKFA 3LECA 5KOJA 3KAQA 1RMYA 2PKYX 5CBPA 1CUGA 4FS8A 3V1KA 1GWNA 1R8QA 4LYYA 3UB3A 3B6EA 2YYAA 4IS2A 4WLUA 4S0ZA 4XR9A 3KXDA 2A3RA 3GZTB 1T6ZA 2X0FA 3A0UA 3UHJA 2OR3A 1W48A 1OWPA 3UT5A 2ZW9A 2YWRA 3QV2A 4LYFA 5LIRA 4C0KA 2Q3HA 1AC5A 1CUXA 1T3HA 1U6IA 1KYXA 2JI4A 1CR6A 4MV1A 4URHA 4DG8A 1CPYA 3OMXA 3O5AA 3TNLA 3OIFA 4ALKA 1ZGZA 4DC9A 2GRJA 3CJQA 4FB5A 4PGFA 5KSOA 2IE0A 2E7ZA 3FD8A 3LT0A 4UUPA 5FO1A 2AZXA 4L28A 5K5EA 1EUCB 2BGTA 4A36A 4ZGWA 4AJ4A 1YZFA 3F1KA 3A6HA 1R9JA 2EVWX 3PKIA 5K99A 4UBNA 1Y42X 2ZIAA 5ISMA 1LCIA 4RSHA 4BGIA 1NRJB 4IBOA 2GT1A 3JQEA 2HJGA 1C7QA 4OK3A 3EGOA 1TCAA 1KERA 4L0CA 4OKNA 5L51A 1OX5A 2OY0A 2OZLA 2Y27A 3RVKA 3MGKA 4W63A 4C6RA 3W5CA 2WG1A 2YIDA 4IDDA 2WAMA 4YJKA 1Y3BE 1J2RA 3HXTA 3K6KA 4WK4B 2JHGA 3X1WA 4HFJA 4ZZ1A 1OZGA 1NZDA 3E5NA 3BTSA 4A73A 1ZL2A 4UAJA 3L0CA 4WDQA 2Z3VA 4QG7A 2XNDA 1KAEA 3WGNA 1P1RA 2FMFA 2JAWA 2ES4A 3L7DA 3DKVA 1EWQA 2OENG 3N8GA 1OQAA 1NLFA 4EYKA 1U9JA 5E9QA 4ZV4A 4CXMA 2JDID 3PQDA 4EA7A 2PE5A 1JLRA 1E9CA 2CLEB 3N8KA 1MV8A 3P8ZA 3MWYW 4XCVA 3G17A 2ZCUA 4ON9A 5LXTB 1CQZA 1U0BB 2ZJ4A 1R4MB 3SI7A 3PX7A 3L9WA 4B83A 5AW2A 2DUUA 3ZYCA 2F3UA 3SVZA 1KY5A 3K92A 5AVQA 3CVVA 4B3TB 1CY0A 3T7DA 2PZBA 1SU4A 3WLPA 4LIPD 2JFVA 4OHFA 2B3DA 4KR9A 1H5UA 4ZGGA 4WK2B 2ADFA 2NXNA 3B3GA 3ZWCA 4NZZA 1YUBA 3S6JA 4PO8A 3WB9A 1XZAA 2B98A 1TF5A 2F90A 2PS9A 2QNBA 4MQEB 3U9LA 3D3QA 4CKWA 4C05A 3RRBA 4Z4QA 4XVQA 4F12A 1CG6A 1GOTA 2OFPA 4FCVA 4FSDA 5ESXA 4DRZA 1PEDA 4XFDA 3FWYA 4P35A 2DUNA 4OM7A 5CLFA 4AJOA 1N78A 4MWOA 3DPUA 4RVFA 3T3PB 3HKEA 3SSAA 2OXEA 4L9AA 2BHNA 2VHYA 3LGAA 4KMSA 1U9YA 1VL5A 4R31A 4ZO8A 3EXHB 2HOQA 3QU4A 1JILA 5JS6A 4FONA 4IHQA 4B4UA 1N6KA 4J43A 5TMEA 2GESA 4M6WB 2NU7B 4RIHA 1I3OA 5TNXA 3WGIA 1RLJA 4CJXA 1OGJA 1TKRA 4PBSA 2ADOA 3BE5A 3DHEA 5IPFA 4YDSA 5DM2A 2PIAA 1VP9A 4MUHA 2A78A 4MQMA 5CYPA 4ZALA 3LUKA 2AI1A 4DKXA 3UAWA 1Q0LA 4ZMSA 1TT7A 5ELXA 1BN6A 1JXOA 1NVMB 4RDIA 1O0CA 1EEHA 1N6RA 1UJ2A 1FSPA 3PG5A 2XSZD 3V1UA 1IUOA 1MO4A 4UXIA 1FRQA 1LTHR 3UW3A 2RGWA 4ZAYA 4RX1A 2I7VA 4KNVA 4O8CA 1E1RA 1FX1A 3MTDA 4LX8A 5C1IA 2F59A 4LVOA 2VTDA 4N0MA 4O4IF 4ABTA 4CEIB 4LUCA 1CP2A 1MPTA 2PM8A 2WFMA 3LGXA 2BT4A 3DMTC 2AJCA 4C2BA 3HJNA 1KAMA 4TS4A 1YQWA 3P2JA 2H17A 2OILA 1RAHA 4OQLA 2QP4A 4RNCA 4WGFA 1A98A 1A27A 3AF2A 5T6MA 5DISB 5HUQA 2UUPA 4FWIB 4L4SA 4AW9A 1KFCB 2X7HA 2ZRQA 3B9RA 2VRBA 4Z1MD 4BN0A 4I0WB 2ZK7A 5J2UA 4ZHQA 3U26A 4ZANA 2HK8A 4YVFA 4CMKA 1MA0A 1FVFA 1GQYA 1UPTA 3KWFA 3DLCA 4RL4A 2XX3A 4RPJA 4PGMA 2ZR7A 3AKEA 3HVRA 4XRGA 3FTNA 5C46F 1KI4A 2QRJA 1UMBB 4EI7A 2ZI5A 3OQ6A 4M4SA 1OLSB 3B1JA 4UAGA 5K8CA 3ABIA 4HLUA 1J2JA 2VJCA 3DP9A 3QLUC 1A9XA 1CZHA 1DCTA 3C8UA 2Z4SA 4URYR 2PO5A 1T4GA 4D81A 3L1VA 5AKEA 3MSCA 4M49A 3IT0A 5A7HA 5ARCA 1SXJA 3HJFA 4DUGD 4S04A 1U2DC 3DYBA 1AXRA 2X9LA 3CUEF 2RKBA 1Q1BA 5FDFA 2IX9A 1YVRA 1HDZA 1Y3HA 3OJLA 4TS1A 3V5NA 2DLCX 3AVYA 1CS0B 3G3EA 1E2JA 4IIVA 4XSHA 4WZAB 5I7FA 1U5CA 3PUHA 4S1NA 1K4KA 1FW8A 5FPTA 4BFTA 3IVXA 2BP7B 4OP1A 2CB9A 1QG6A 3IR5A 3SX4A 3UMSA 2IVFA 1HNNA 1SB9A 3PKJA 4PRYA 1IQRA 3L84A 3UC9A 2I0FA 4B7ZA 5FWXB 3DOCA 1P3Y1 1U0TA 1PR1A 2I8LA 1MJFA 3EGXB 5TGDA 1W581 3JVVA 1E6EA 4KGZA 3LX8A 3H75A 4GMHA 4XGQA 5FR2A 5B2EA 2P6OA 1U0LA 1UR5A 2VKTA 5JANA 3UPDA 5FXMA 3KQOA 3LPDA 1G6Q1 1S1CA 3NBZC 2WTXA 1ZXBA 3QVGB 1L7PA 1U7UA 4I6JA 5IYZA 2OZEA 2W71A 1M6YA 1L4KA 1BHQ1 4UJ5A 1MIOB 2FWNA 1DS6A 1UDWA 4QOEA 4P5DA 1DP4A 4V2IA 4CL0A 1S2IA 3DZJA 1X94A 3UWSA 4YBRA 1V7ZA 3BGOS 3L8GA 3LCUA 4HNAA 3VR2A 4GSYA 1C30B 2D62A 3GCXA 4IWYA 3JQAA 4MO2A 3OCJA 4M98A 2MINB 5EL0A 4AIIA 4C0WA 3PR2B 4Z4CA 8MHTA 3RVNA 5A1TA 2A5YB 3V42A 1A50B 1TD9A 3EVFA 2HA2A 5BSMA 2ZSJA 4IO0A 1RAIA 3FNEA 4RVOA 3MVEA 1E4YA 4ZQGA 5AM4A 2WSIA 2H1RA 4YCAA 2IF0A 3MFYA 3PQFA 4NYMQ 1EI9A 2H4ZA 3HADA 4B5KA 2MT9A 2SCUB 2XUQA 3NVMB 1EVEA 1W5FA 3ZI7A 4G4SO 3AXTA 2P35A 1I2DA 1QM5A 3CLUC 4Q4AB 1M5UA 3L7LA 4GZ3A 4ALLA 3EK2A 1C81A 1QHXA 5BNTA 5BSKA 5LYJB 2EZ9A 1NVGA 4U63A 3KYCA 3MTQA 3KOWA 3KVOA 2QDXA 5GV8A 5C5EA 2XWQA 4Q1AA 1Z3IX 2YWGA 4DA0A 4DN6A 1C1XA 3HU1A 1Z5WA 3KUCA 1E0JA 5C7LO 1B23P 1D5WA 2G8NA 2IP2A 1FVXA 4X9XA 2XCSB 1CUBA 5ALWA 5L45A 1E1CB 4I4CA 1IVSA 1Z6YA 3P7MA 3ORYA 3SVTA 3EFHA 1FL9A 1GKIA 2P1DA 2IXDA 1RZVA 4IRUB 4NU6A 4CKEB 2ZREA 1NN3A 4BRWA 1PR3A 1LW6E 1JAXA 3PDJA 5JJ5A 1A9QA 4A8JA 2X9QA 3FTFA 2CNLA 2FPUA 5AMXA 3BOSA 5L3RA 3SEZA 1SJ9A 2IYRA 3MINA 1D1QA 3AFIA 1IZYA 1BMFA 1XSEA 3L02A 3Q3CA 2VXBA 3WB2A 2XAAA 1YA8A 1B4DA 3ITNA 3K94A 4RCZA 3RK0A 4PAOA 2ZPAA 3R7FA 1C1HA 1JAYA 1GNTA 1V26A 3ICWA 3U3JA 4LJ6A 1JMYA 2YS6A 2FWAA 3GBVA 2EX4A 4JL8A 1L5GB 5L3SB 4LS3A 5LQDA 4R1MA 1QGYA 2JARA 4KQ6A 2FQWA 1RJGA 1DKOA 1UPBA 1Z25A 4EKGA 4F7WA 4EVIA 5ETJA 3VR5H 2UVQA 4KITB 1B6GA 2F64A 1A2OA 1YGPA 2ZATA 3BERA 1XVVA 5BSVA 4PCAA 4JX8A 3TGWA 4ERNA 4J0IA 3OTQA 3P2KA 4C7BA 2VYQA 2GM5A 1HZZC 4OMCA 3VTKA 4P7GA 1AS2A 4Y9SA 3AFOA 1NTRA 3QBTA 3RFFA 3HUDA 5AHWA 1BYUA 3CRVA 2QSUA 3JQGB 1BGVA 5ERYA 2O2CA 2YJTD 3SHQA 1O94C 3UOWA 2AZDA 2FPLA 3ZGZA 1FDIA 1G5TA 3PVSA 1Q16A 1DKNA 4WE3A 3VSCA 4V1CA 2WE7A 3CPSA 4NBUA 4XD2A 4B6PA 3ZWKA 3DWFA 2XQVA 3IS3A 1GGMA 3KV3O 3L6RA 1Z28A 4MUNA 3GMIA 1JYEA 3PSHA 4GOLD 1C8KA 2HW8A 1FLNA 3STVA 5LP6F 3F5QA 3FM9A 3G7UA 1AV6A 2H2DA 1YZYA 3ZOKA 2DOKA 3LUGA 4CYMA 3B9QA 3ZGNA 1GLGA 4GYJA 4LECA 1J99A 2EOAA 1THTA 1LB1B 3MUOA 1JSZA 1FTWA 4OFBA 4C20A 3FPFA 1T29A 1EM8B 3JPYA 2PR7A 3L0SA 3NEYA 3FMVA 3H5WA 4FX5A 5CJ2A 2I6SA 2BFNA 3D0RA 4TXHA 3CXRA 3VM6A 3W6NA 3LFHA 1L7MA 1HO3A 4L8VA 4WTOA 1T34A 2VO1A 2SKDA 4RK4A 3C3BA 4L3OA 4DJDC 4U7WA 3WKDA 2W9XA 1NY6A 3GRPA 4Y1RB 5FBRB 3AP3A 1M1UA 1A9PA 3V7WA 4M1EA 2V65A 2Z9CA 3SC2B 3ESZA 3RJMA 1AN0A 1A77A 1MNQA 3K1YA 4OHOA 4DNXA 1XRNA 2GTIA 3RJ9A 2O8CA 4M7WA 1ZGAA 2PNJA 4KIGA 1VL6A 3B3AA 5B64A 1KOGA 4ZTBA 2YYSA 2NUTA 1MRZA 2UXDB 4GMKA 2P3LA 4H18A 1F5NA 5ENVA 5IC5A 3C6MA 3G2NA 2R7AA 4EGQA 3I5UA 1R74A 5KYVA 3TLGB 1CY1A 3INNA 1YWGO 3KOZA 5DNEA 5EJ7A 2PLFA 4KO2S 2JZNA 1AMUA 1WB5A 4G1FA 1IXYA 2IIVA 5A06A 1DAHA 1QAMA 4TVSA 3FR7A 1E8NA 1RIFA 2RH5A 2AYXA 1KSGA 2CT8A 1CRQA 1C4OA 2CNNA 3O91A 4GMFA 4XQCA 5TF0A 4DMHA 5BN5A 2J32A 4MKZA 1H42A 1LC0A 3PRJA 1DKPA 1NT4A 3DMYA 5HFAA 4GDMA 3ZIAD 4RHTA 4DZZA 3AEXA 3HM9A 4POAA 1USKA 3E05A 4HNSA 2Z2YA 3QA3E 1C0EA 4PICA 2CDNA 4D4HA 4D26A 3HCFA 3KEOA 4DLTA 1QIGA 1YRHA 2ENUA 1ZBQA 2R84A 3HG7A 4Q3NA 4Q03A 5JARA 3AHJA 4JJ8A 2BTQA 3IH5A