3K8OE

Crystal structure of human purine nucleoside phosphorylase in complex with datme-immh
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
283
structure length
283
Chain Sequence
NGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Purine nucleoside phosphorylase
publication title Crystal structure of human purine nucleoside phosphorylase in complex with DATMe-Immucillin H
rcsb
source organism Homo sapiens
total genus 92
structure length 283
sequence length 283
chains with identical sequence Q, S, T, U, Y
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2009-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3k8oE00
1RYZA 4TXHA 4BMZA 1B8NA 3EUEA 2Q7OE 2I8AA 1OTXA 1PR4A 4DA7A 2QTGA 1M73E 1FXUA 3LBAA 3OOHA 4FFSA 2ON6A 1PK9A 4IP0A 4DANA 5EFOA 1V2HE 1TD1A 4WKBA 3GB9A 1PR0A 5F78A 4F3CA 3OF3A 4TXMA 4L6IA 3EUFA 4LDNA 2H8GA 1NC1A 1PWYE 1A9SA 3DP9A 5F7XA 1RR6A 4JWTA 4LNAA 1K27A 3KHSA 3NBQA 4BMXA 1Z39A 3UT6A 4LKRA 5CCEA 4U2KA 1A9RA 4K6OA 3U40A 4R31A 2QPLA 1LV8A 3KVRA 3NM4A 3MMSA 4DA6A 1A9OA 3OZCA 5ETJA 3ODGA 1N3IA 2P4SA 3UAZA 4PNPA 4X24A 1ZL2A 4DA8A 3C74A 4GLJA 4OF4A 4D8VA 1A9TA 3TL6A 1SJ9A 4TTAA 3LA8A 4H1TA 4WKPA 4DARA 4TYMA 1PKEA 3NM5A 5F73A 1Y1TA 4DAEA 2GUWA 4LZWA 1SD1A 1T0UA 1ZOSA 4NSNA 1YQUA 2HN9A 1V4NA 1RSZA 3OCCA 3P0EA 1I80A 4L5AA 1OVGA 3PHCA 1V48A 5CYGA 3EMVA 4L5CA 3GGSA 3SCZA 4F2WA 3UAVA 1JDUA 4D8XA 4DABA 5B7PA 1RT9A 3OZBA 1PR6A 4M7WA 3O4VA 4QASA 5F7JA 4TXJA 1JDVA 3KU4A 4I2VA 1U1EA 1Z36A 2BSXA 5JPCA 1T8YA 3O6VA 1C3XA 4RJ2A 5B7GA 1VFNA 1TGVA 2A0YA 3QPBA 1V45E 2A8YA 5I3CA 3FUCA 2AI1A 1LVUA 1Z33A 3FAZA 1PR2A 1PF7E 1YBFA 2XRFA 3FWPA 3MB8A 3P0FA 5F7OA 3ONVA 5CCDA 1TCVA 1NW4A 1JP7A 2OC9A 1JYSA 2I4TA 4D9HA 4OGLA 4KN5A 1A69A 3F8WA 5F7ZA 4D98A 2IQ5A 4QAQA 5KB3A 4QEZA 4QARA 4QFBA 3UAXA 1CB0A 4F3KA 5FAKA 4G8JA 1Q1GA 1ULAA 1CG6A 2ISCA 4OEHA 4GMHA 4G41A 1A9QA 4OY3A 1U1CA 1ODKA 3PHBE 4LNHA 4MARA 1VMKA 4WKNA 4TS9A 4UC0A 1T8SA 4JOSA 1Z5NA 2QDKA 1JDSA 4M1EA 1TCUA 5EPUA 1Z5PA 1Z34A 1V41E 5CYFA 1PR1A 3E9ZA 3PNPA 5B7QA 4WKOA 2B94A 3DPSA 2HSWA 5F76A 4MCIA 1PW7A 4OJTA 4WKCA 3T94A 2A0XA 1ODLA 1RXYA 1A9PA 1Y1RA 3LGSA 1TGYA 1SQ6A 1YRYE 1ECPA 5K1ZA 1ODIA 5B7NA 1OV6A 1QE5A 1OU4A 2OXFA 1XE3A 4EB8A 3KVYA 1JPVA 3DDOA 3FB1A 1RXCA 1U1FA 1VHWA 3PNSA 3D1VA 1Y1SA 3E0QA 1NC3A 4GLFA 1Y1QA 2AI2A 3K8OE 5DK6A 1WTAA 4F2PA 1ULBA 1Z5OA 2A0WA 4QATA 3K8QA 4R2WA 1JE1A 4F1WA 4PR3A 1Z35A 2OC4A 3DF9A 1YR3A 4TTJA 4BN0A 5CXSA 5EUBA 5CXQA 4TXLA 1T8RA 2AI3A 3BGSA 3UAYA 1Y6RA 1T8WA 2RJ3A 4E1VA 3OZDA 1ODJA 4L0MA 1RFGE 3BL6A 4G89A 2AC7A 2HRDA 1YQQA 4BMYA 1VHJA 4YNBA 1OTYA 2QSUA 4YO8A 1Z37A 3KVVA 2QTTA 3OOEA 4GKAA 4JP5A 1LX7A 4L5YA 3BJEA 4TXNA 5C80A 1RXSA 3FOWA 3E9RA 3ENZA 3UAWA 5F77A 5IU6A 1G2OA 3DJFA 3INYA 4P54A 4MCHA 3IOMA 1PK7A 4YJKA 4TS3A 1Z38A 3BSFA 1JE0A 4YMLA 1U1DA 1SD2A 1RCTE 5IFKA 1V3QE 4TTIA 1U1GA 4R2XA 3EEIA 1PR5A 4OGKA 2OECA 4NY1A 4EARA 1RXUA 3IEXA 4DA0A 1JDZA 3NM6B 4M3NA 3KUKA 4DAOA 1OUMA 1PBNA 1B8OA 4D8YA 3FNQA 1Y6QA 2HWUA 1JDTA 3OZEA 4NS1A 1K9SA 1K3FA 3OPVA 2PGAA 4ECEA
chains in the Genus database with same CATH superfamily
2D7CA 2FHPA 3GFSA 5P8WA 1H5UA 4WDQA 4AJ4A 2O9JA 4KQ2A 5E3IA 3QFSA 3ZDFA 2GXAA 3F5DA 3QIAA 4OXQA 3OLVA 2HJ9A 3U3OA 1YS1X 1QDUA 621PA 3G0IA 5AHRA 4QUAA 1J99A 1QO0D 1TEXA 4CG1A 2HDWA 1U7XA 1UKEA 4HWOA 2COEA 3HO6A 1R0ZA 3RVPA 3F5FA 3KEGA 4BMPB 4DCVA 3PTLA 1F2DA 1KI9A 3PGKA 4DSUA 3SD7A 3UHJA 2XTZA 1H9CA 3DAOA 3KQLA 1UPTA 1T0BA 4FFPA 4WKBA 4EBFA 5JT1A 2HU5A 2B98A 5C1OA 3U56A 2DE0X 3H84A 2J07A 5T6MA 4EZBA 3OTHA 4F3CA 3RTCA 4KYIB 4ZYVA 3NGXA 4TXMA 2G77B 3EUFA 3L0OA 5JATA 2GM4A 3MFQA 1KZ4A 2GRAA 1PWYE 4MDHA 2ZI3A 1V35A 3LY8A 4BO0A 1XVUA 3DT9A 3GG9A 2XGSA 5EE9A 4DZRA 2QTZA 2ZSHA 2HCTA 3NIBA 3B3FA 5BURA 5FO0A 2REXB 3GMIA 1AQ6A 1WY7A 1Z8FA 3Q7PA 5DGTA 3HYSA 1C8LA 4U7HA 4EGQA 1SUIA 5JSHA 1T10A 1UZLA 2CBZA 2CLCX 2I1WA 2QD2A 1IULA 2YV4A 3N0TA 3OAAD 4Y2YA 2V8BA 2VCHA 2MT9A 4O8ZA 5D5QA 2I2AA 4B7CA 2BKAA 2ATVA 3GJXC 1Z28A 5A0TA 1RVDA 3FUXA 2I2CA 1E6MA 2P40A 3AUYA 4LSMA 2IX3A 3AJ8A 3TQHA 1XVLA 2BFCB 2W6OA 5IXSA 4KI7A 4FJ2A 5AH0A 1LV8A 2OCPA 3AMVA 3CM0A 3S2FA 1IBRA 1P3Y1 3JRXA 4KQKA 4OH7A 4W9MC 3FHTA 4I9HA 3KWLA 1NHWA 4BJ1A 2QQ0A 3VH3A 1U0EA 3B48A 2HIGA 5JS8A 1GDTA 2PZAA 3H5WA 4NQZA 4GWLA 3R7BA 5JRDS 1K4KA 1N3IA 5FL7D 2FUKA 3V9AA 5IKMA 1JDBC 5TEVA 2Z56A 4MS1A 3IR7A 4HSEA 2FPUA 2BKLA 2ACVA 2I7DA 3V6LA 2X0KA 1IYZA 5DGHA 1T3SA 3JALA 5GIOE 2QTVB 4P0QB 1WP9A 2B8EA 1WXHA 1NUAA 1W59A 3ZI0A 2CXPA 4PLFA 3AF2A 1ZGBA 3ZS9A 1O5IA 3ACDA 2VQEB 1J70A 5ALNA 1E2MA 1KYYA 4EFLA 5CB6A 3E05A 2HREA 3H11B 1O6BA 1UQUA 3OEEA 4MUHA 4XQCA 1N1DA 4WGFA 5C31A 3RASA 4JUBA 1OGJA 1UPCA 3BDVA 1Y37A 5AUPB 4LFAB 1US8A 3BHIA 3UV7A 3G7SA 4ITUA 1XYYA 3TFOA 1GQYA 2F9MA 1TJNA 3LXRA 1HFJA 3D8UA 3FY4A 3JYHA 2XRMA 5AKKA 1QRTA 3ABQB 2QG6A 1V1RA 1QBGA 3GN2A 1N6NA 3O03A 2C31A 3WGLA 2PEYA 2V3WA 1J97A 3H5NA 2FG7C 4TX1A 2NSLA 4F4CA 3D02A 4I4LA 3D1LA 3FYHA 3NAQA 3MBIA 5K0ZA 3GLIE 2CEKA 4Z4IA 3MJHA 4IFEA 2CVHA 4Q7JB 4ER0A 1JG1A 1RHQA 3SDSA 1E61A 2YNMD 4AF6A 4BAGA 4J8PA 4NATA 4RD4A 2KSQA 1E0JA 1V8PA 5MGNA 1IUNA 4LRTB 4FMDB 4YYZA 1AO0A 1M2OB 1NNEA 3NOXA 3I53A 1FMLA 1PV1A 2RGAA 2CJYA 3W4IA 3ZG6A 3ZV4A 4DR2B 3S1AA 1V48A 4NMMA 4F8EA 1EWKA 1SBHA 2F62A 4DUGD 4NNPA 1I0LA 3JATA 1XROA 4NCKA 4G8CA 1I8TA 1D07A 1TW3A 4B79A 3LBYA 1R4MB 1DHRA 1L8LA 2ZCVA 1ZINA 2Q4EA 4ZAVA 1KEVA 3EDOA 4FGJA 1QIFA 1E2FA 2RI6A 3A7EA 1NVXQ 3N5KA 4LJ6A 4MUFA 4XIFA 3K0CA 3V8BA 1Y8ZA 1A5AB 2QR2A 3OMWA 1N34B 1I3LA 1KA9H 1I1HA 5GZ6A 3TO5A 3ELDA 3GWZA 1PTJC 3HHPA 1ZUD1 4I50B 3ZNNA 4C1BA 4AXBA 4B3MB 3NETA 1IB0A 2YVQA 2I6GA 5HYVA 4UE6A 5A3JA 3K6KA 2CZQA 16PKA 2R25B 4RVHA 4B3JA 1BIFA 3JQ6A 2XOXA 1AVTA 2YDYA 1M2VB 3Q9NA 3ZE6A 2YMLA 1QONA 1N6IA 3I64A 3NV9A 3EPRA 2ZIWB 4PX9A 3X2SA 4KN8A 4NMXB 4PNEA 4QD3A 1JEYA 3UVEA 3KJNA 1E7YA 3KU4A 3DE6X 1O3YA 2I7CA 3WNCA 2QQFA 2G7MC 2H1WA 4CGZA 1Q6YA 3U09A 3STVA 3FH0A 1N6OA 2BH9A 3BTSA 1P6UA 2H5JA 2XVXA 1C50A 1RWVA 1FRVA 4FT4A 7REQA 1IXYA 4BNDA 3TJRA 2IBMA 3AYXB 4Z3KA 2P4EA 3F3KA 3ZBTA 4YMTA 1R4NB 5CLLA 3RTAA 5GV8A 2P7IA 4FOOA 2AK2A 3TR5A 2IWRA 5AICA 1RU3A 3SR0A 4JSTA 3QPBA 3RD5A 4EPXA 1E6EA 5FO1A 3VNAA 1RLUA 4MR8A 4MMZB 4LY3A 2OBXA 1P2FA 1JIQA 1P1KA 3PR1A 4ZTUB 2QG4A 3KQWA 2YCBA 3DLTA 3BH7A 4KW7A 4L8WB 4U4AA 1O03A 3PIDA 4HI0E 3E2MA 4N6OA 2H2FA 3GAZA 3Q11A 4ZVRA 3I6MA 3N8NA 2D1YA 3P0FA 3WDSA 2NZWA 4A7PA 5JALA 4OI4A 5CITA 3PJDA 3CF6R 3V1UA 5KNDA 2WLSA 4C0AC 1NBWB 5CX1B 4QUEA 3LI2A 4I4IA 1DAMA 3NALA 3R5SA 1V25A 3DOHA 4I66A 3VPGA 4BV2A 3SHFA 3AG6A 1N5KA 4IOKA 4D9HA 4MPRA 5GINE 3LVFO 4MR7A 3ZDBA 4DR7B 2J45A 1PYOA 3AF1A 4XKJA 1PG5A 1I3NA 2PEZA 4BVGA 1SC9A 5K0JA 3CLSD 4MKGA 3DTVA 3PUYA 5BQ5A 1JUDA 2W71A 1KRWA 1Z2EA 1DWQA 1SU6A 3FFWA 5E4YA 4BUCA 4UHDA 8ATCA 3WLLA 1RKBA 4H16A 5CRIA 3TUZC 2AK3A 2FFHA 3NT2A 2Q1TA 2YS7A 1J2UA 1XHLA 4HDNA 3AEXA 4UOZA 1G60A 2G5PA 3NRJA 3OZGA 2HU8A 4RXTA 2YJNA 5FPTA 3NVDA 1GAQA 2WU0A 2OCBA 3N28A 4LJYA 3TIXB 5DTRA 1KU6A 2WZQA 4UCQA 4WZBB 2Z98A 3HU1A 4TRJA 2P68A 1UXIA 3H65A 3VO9A 2O2XA 3HSKA 1JLRA 1RYEA 3QOYA 4IFTA 5JHGB 1R8SA 4OXRA 2IYTA 2O2JA 1NVBA 2BBOA 2FEWB 3RREA 2A9OA 4X41A 1I3OA 1H66A 1GSIA 1RJGA 1EVLA 5FTKA 1KIMA 1RD4A 5KHAA 2ZUTA 3WZMA 2BPOA 4N5MA 1VMKA 1C3LA 1XD9A 2BLLA 2FVYA 1H2AS 1JR4A 1XFDA 1HSOA 4RA6A 3FRJA 4DQKA 4DCMA 3HA2A 5F5LA 3OQIB 1GG8A 1T6XA 1Z5NA 3PWTA 1KYTA 1M34E 2DXIA 3ZCQA 1LNSA 4U9HS 4EEZA 3D7MA 3RSGA 1K08A 1EUCA 2XMZA 4HQFA 4WBNA 4RCYA 4Z3DA 1RQPA 3CZCA 1FNBA 1LTKA 2EBWA 2W6JA 4KODA 3GFQA 2C00A 1L5LA 1GZ4A 4KAJA 5CYFA 4HXGA 1PNVA 2UZ1B 3DXZA 3VVBA 3K9GA 4FHEA 2REQA 2B94A 3UG7A 4D2IA 3DBRA 2VDLB 1CUEA 1QQ5A 2B8WA 4FILA 4G0MA 4ZREA 4AJ2A 1U94A 1VI5A 1RXWA 4FBLA 1SCUB 2HF8A 2XNSA 3CEPB 2E87A 1C29B 3ZNPA 2Q3EA 4PZZA 3WRXA 3EGIA 3RRXA 2VTVA 4DIOA 1JVNA 3OY7A 3QKSB 3U0VA 3L7DA 4CFSA 1M9NA 1DFGA 2HHCA 3D64A 3ZHYA 2H9YA 4A03A 4B87A 2ORIA 5D85A 2HEGA 3F73A 4XB1A 1CUUA 1IZ9A 4EX6A 1ZCFA 2GPAA 3Q7RA 2CKMA 2OVFA 1U6JA 3K30A 4BEVA 4KWHA 3NT5A 3PHHA 5LOVB 4BZWA 2VLIA 3LT4A 3FYUC 1C8VB 1ABBA 3JXEA 3JAWA 4C07A 3MJSA 3T34A 4IAOA 1QH0A 4M0KA 5C81A 4ARZA 1CW2B 1UWLA 4Y1EA 5FADA 2R00C 5PNTA 3MWDB 3D5QA 1G2PA 1H2RS 5DM70 3ZZUA 4FZJA 3I3OA 4EUKA 2YJTD 4FS3A 3BKWA 2JI6A 4UVDA 3U4GA 3M3PA 5DZSA 1XZPA 4C78A 4WNAB 4EKNB 1ZGGA 3RRBA 3H1TA 3HJHA 1XYGA 4JKOA 2AKYA 3IAFA 4CLHA 2FOIA 3EZXA 5SZJA 1CCWA 4HQNA 2MSWA 5KYXB 5B1HA 1UZNA 3JPYA 3OG9A 4KOEC 5DSTA 2PJZA 1M7BA 1N6RA 5EZYA 2XNDD 2XKJE 1VZ2A 4J7UA 1O6CA 4QLOA 2YDXA 3ZWCA 1EIWA 3T52A 1PV4A 4HWGA 4MQ4A 4XWGA 1E5TA 1PNQA 2JGLA 2FY8A 2LKDA 4XE5A 4YREA 5TY0A 5KS2A 1L7QA 1P2DA 2ZYUX 5EESA 5A9SB 1G20B 5AOAA 3DA8A 2FZGA 4AJOA 1IMJA 4F84A 3TNYA 2QW0X 4MQMA 3UOWA 2X0JA 1O9BA 2GK4A 4AURA 1NU8A 1JE1A 3F74A 4WPGA 4Y67A 4C4OA 2YQ5A 4LS3A 3EDRA 3PKJA 3SIPA 1MW9X 2GA8A 2VHUA 2QTCA 1LDNA 4OHBA 4MWEA 4Q5IA 3HL0A 1CP3A 4DNQA 1N6KA 5AW6A 1NN5A 3FDFA 5FOXA 3TM5A 2ZIGA 1GAXA 3WGKA 3STWA 1KSJA 2A5DA 4AS3A 1KJQA 5K8JB 5A71A 1Y7IA 3CX3A 1N2HA 1WV1A 2AMFA 1I4DD 4WXEA 4O29A 1RABA 5ALYA 2H54A 1RYHA 1EE1A 3X0DA 4YT2A 2ZRKA 2NSDA 3ILSA 4I8XA 2RJ3A 2REBA 4EI2A 4ETMA 2XTMA 2J9RA 1XLVA 2BJHA 3CF4G 3FZQA 1AB6A 2I6UA 1R6DA 2YVUA 2N1BA 3DW3X 4JBLA 1A4UA 4BGVA 2I33A 1VKHA 1F0KA 4D44A 4QFDA 2QUKA 4MRMB 1F9EA 2AR9A 3U4MA 2FPGA 4MUBA 1LDBA 1TVKB 2P2NA 1CY2A 3SXJA 3TDKA 2IYAA 3MJFA 1NUQA 5KOIA 3BH6A 2H7YA 1KY3A 1SUAA 2F6RA 4L5YA 4QTTB 4QUJA 5JROA 1X7YA 2QTNA 4FYWA 4FDTA 4YA6A 5E1OA 1UMDA 4B4DA 3IBFA 5DYIA 2I9PA 5KJ6A 4HZGA 3PLRA 5GJVC 3A9TA 1RXSA 1NBEA 1BYIA 5HKKD 2Q6VA 4OXXA 4UU1A 2IRWA 1I1NA 1WRBA 3LWNA 3WQHA 5F77A 3BTVA 4TVBA 3CX4A 1YZYA 3T1NA 2E4WA 1Z2OX 4AW9A 1A9ZA 4N3BA 3VGPA 5D87A 1KTIA 1XJQA 3I5YA 1AUOA 3AETA 1SD5A 2PUWA 2ZT5A 2CC2A 4GRAA 2O1WA 4P54A 5CDYA 2RD2A 2W2KB 2ZTSA 1HO3A 2P75A 4C03A 3LUDA 4G1MB 1XZCA 3FPFA 1KJYA 2RGEA 3LLUA 2P41A 5IC6A 3TTYA 1GUFA 3OPNA 4AECA 5AUOB 3MK31 1U11A 3DNFA 4IIHA 4LY6A 1DG1G 2WIDA 3H05A 2YHIA 4JEMA 3ULKA 1KAEA 4IYRA 4X97A 3SYKA 1M2JA 2VNJA 3JPWA 1CTQA 2JEZA 4HG2A 3VYVA 1KDTA 2BFDB 4TUYF 2VBFA 1Y3IA 3WJ2A 1FW8A 1MP0A 4B84A 2PD4A 1RLJA 1T8PA 3IRVA 4E5PA 3G1UA 3MMPA 1E6CA 5FORA 3FTDA 3TOCA 1BS2A 1E66A 1JYEA 1G7RA 1N7GA 1YB2A 2XAAA 3M6WA 2UV8A 1HK7A 1IXZA 1BMFD 4ZJZA 1Y4ZA 1Q7EA 3DT8A 2COKA 3O8BA 3WKAA 1B0AA 3BGDA 1L8OA 1E9DA 1E1RA 1JQKA 2FUNB 2GBLC 3NYRA 1C1YA 4KGXA 4XZ3A 5H5JA 3HEBA 4N0PA 3VZRA 1ZR2A 1SOMA 4NYMQ 1J23A 3AIKA 2BGUA 1WULS 3KLPX 3O47A 2FSIA 1UPUA 2JK1A 1MC8A 2GXQA 2PPLA 4JYPA 4FB5A 1GTG1 1T5LA 1XK6A 4HT3B 5LQUA 1ZDMA 2HDHA 1M0TA 1T0JB 3PSHA 3SBEA 4BP9A 1OXSC 3M8KA 1TJ5A 3UC5A 2ZJBA 4URFA 3RYIA 1SXGA 4AK9A 3AZQA 1WCIA 3L7AA 3C3BA 3PDIA 1U2TA 2HWUA 3CNNA 4RY9A 5GJWC 3W9BA 2H4XA 2VNIA 4U2EA 3ZHBA 4KUGA 3HDVA 1NQTA 4H6VA 4HUQB 1ZBQA 1I6LA 1KF0A 2D8AA 4B7XA 4F4FA 4EY5A 2C0QA 3KK0A 3D1JA 4Y98A 1NVEA 2CUKA 2FOLA 1KYIA 1K63A 4JQSA 3UWDA 2X0DA 4HDCA 1ORDA 2C9OA 5D3MA 5BN4B 1N2OA 5HK8A 3TL2A 2WEKA 5B6IA 2ZAYA 2PANA 2QEQA 2XYQA 1V1JA 2FMKA 3LKDA 2GX6A 1J0BA 1X0VA 1W4ZA 4NENA 1BA3A 2V1UA 4Q4AA 2GCEA 3LO8A 1TIKA 3D4OA 4KIJA 3PDJA 1QV7A 2BLNA 3L07A 1ONSA 5A4DA 3GT7A 1CS4C 3ESZA 3GIDA 3PC6A 4MV4A 5K99A 3GLGB 4U6SA 3UFBA 2A9QA 4DM3A 4H1VA 5KDDA 1C3OA 1HL7A 2O8CB 5KYYA 5FUYA 4II2A 1TAGA 4M53A 1MKYA 3GR6A 1PQWA 4BFUA 2WIFA 4PLVA 3Q6NA 4FSDA 4MWCA 3C3EA 4HFJA 3P2MA 3AVWA 2O8DB 4RQUA 2NU8B 3Q9UA 3AHGA 4KMMA 4LGMA 4DDTA 3N2GB 1BQEA 3UANA 2II6A 2OT3B 3L4SO 4PXSA 3TM4A 3EW7A 2QX9A 4EHHA 4ETIA 3G13A 4KWEA 3NIGB 2JJYA 4Y1RA 2JKZA 5FCDA 4ENRA 5DU2A 2WAMA 4GOXA 4IH1A 2BWJA 3BQNB 2FZ4A 2YNMC 3THRA 5FA8A 1E9SA 3HYNA 2FFQA 2E7ZA 2I3ZA 4GI5A 4ON9A 4ZOLF 3KAKA 3VMFA 1T4CA 2JZNA 3HYCA 3PNMA 5HF6A 4XR9A 4E5DA 1LS6A 2PK3A 2IYSA 3T0IA 3PFKA 1EVJA 1Z2PX 1LFDB 4KQXA 1L5RA 4QDXA 5AK6A 3OT5A 2CFSA 2VAWA 3IE2A 3KOZA 1PDVA 3CGWA 1G38A 5ECDA 3V1LA 3CCBA 3CLRD 4ZV9A 1QYRA 2SKDA 4GRIA 5K4AA 1CUYA 1PP4A 4AJIA 4YT5A 1G4AE 3CH7A 1KH2A 3U3DA 3RU7A 3U1VA 3WLJA 1CR2A 1JR3D 3IPXA 2OLEA 2AE1A 2AFIA 2B5VA 1WM1A 2PX6A 1TCCA 3ZY6A 3INGA 5AHWA 1FBTA 4K40A 4G5XA 2CF5A 1CUJA 3PFBA 1FX0B 4FFOA 4NYIR 1R0LA 1Z6ZA 1ZGAA 2O14A 1GTVA 1VSUA 2QQGA 2TS1A 4OF4A 4D6XA 4HNUA 3WV5A 4KGDA 3EA4A 3ZXXA 2PYIA 5J2UF 2PZMA 4JQCA 5T4EA 1DJPA 1TYBE 3DEHA 3JQ9C 4Q48A 1HNWB 2J3EA 1ISHA 3OKCA 5LNK1 1H4SA 2A35A 5ESWA 1TW2A 3T6KA 1WPGA 2VJYA 1PJZA 4DARA 5SYMA 3IV7A 1WCXA 1YR9A 2O52A 5IC5A 5L3ZA 1EXMA 2QD5A 3V7FA 1GPWB 3GNSA 3REFA 2B37A 3OE5A 4Z5XA 1D04A 1JLMA 2H4FA 4GQBA 4F92B 5L4LA 1QG2A 4XUCA 1MIHA 3A4VA 1DAKA 2DPLA 2OXTA 4WA8A 2QR3A 2BFEA 2O5VA 4QT4A 1SU7A 2P2CA 4QWWA 4PNHA 2R11A 4TM8A 4FXPA 4PX5A 3RTDA 4RD1A 3CVOA 2F4NA 5HJ5A 5CLIA 1RSZA 1F2TA 3NBFA 3OEWA 4Y7CA 2MWMA 3RVLA 2JLRA 4ONEA 1Z8HA 4KJZA 4ZI5A 1SUWA 4IX1A 5CFPA 2WNHA 3EYAA 5FHQA 5A03A 1MA3A 4UCFA 3A4IA 1OH5A 3KQTA 4LZNA 1IBKB 6ABPA 4F93B 1BX3A 2V1XA 2ZUFA 3TLCA 2C7BA 4MQEA 4G5GA 4C20A 1WB5A 2Q46A 4ND7A 3O9VA 1H8ED 3E5RA 4GKVA 4NBLA 1DZIA 2Z30A 3W5SA 4QULA 4BX3A 2Z3WA 1P6QA 2GLXA 1VG8A 1Y1PA 2JLZA 2Y9MB 4G2NA 4KX5A 1HFEL 3E5NA 4HNAB 2O3QA 1KH3A 3ZYZA 1EXDA 2OPBA 3CPEA 4CCWA 3WOVA 1JDBB 1ORTA 1R2QA 1MB4A 3CLSC 4QTZA 3R0ZA 5THXA 2GN2A 3LC2O 1L9XA 1TF7A 3M2TA 4RIIA 5JPIA 4QOSA 3VZBA 2OQIA 5JTTA 1XQ6A 3HFSA 1M1UA 2GF9A 3PHJA 1PR6A 4RLQA 3E84A 1XEXB 2JFPA 4KO1S 3CA8A 1HDYA 1U5AA 1Y4SA 3K9WA 5BUCA 1U6KA 1KZGB 4PNZA 2WFMA 5IJXA 5C8YA 5FLEX 3E03A 2H9AA 1WMFA 4N18A 1ENOA 3F3MA 4JQZA 1VE7A 3QY0A 4WV3A 3GFFA 5KYNA 5EEHA 3W6OA 3K0FA 4CETA 4Y0AA 2BEKA 3EDCA 2CLMB 2PUAA 2ZANA 2PU5A 3C7AA 4N03A 1CF9A 5TMPA 1J5PA 2OO7A 5FT9A 2HLDD 2GFIA 1LK5A 5FAXA 4YP7A 1EVKA 1HE4A 1RAFA 3FGNA 3ROTA 4KZKA 4GWGA 4BZXA 3CVWA 3DC7A 1CUGA 1U0OC 3BL8A 2IHTA 3GRYA 3GC6A 1KQ3A 3NI2A 3TSAA 3CO5A 2J30A 1U9JA 3KOOA 2EFJA 5LZ5A 1ULTA 1Q12A 1V16B 1O08A 2QN8A 1JN0A 3C85A 4J03A 4JYBA 4TUYB 2IZ7A 3B78A 4JBXA 4O4HA 4NCAA 1I1QB 1EFRA 1S2OA 2PMKA 4YRQA 1PZHA 2QJRA 1OGYA 3NBXX 2I6TA 3O31A 3F9CA 2AEEA 3IBGA 3P9XA 1SXJE 2WJJA 3KCQA 4JXKA 4LJ7A 1JEQB 2CY0A 2ZDHA 3OICA 3W34A 3QITA 4QE3A 1LNZA 1VPDA 2GZSA 1C1XA 3DBLA 3OCJA 4AZ3B 1X1CA 1ECGA 1QYVA 2AMVA 4FDLA 4AYWA 4K6KA 5F1PA 1WKCA 2LIPA 2NP7A 2WJ4A 3ITDA 2VR1A 2QVBA 5GZ1A 4F7DA 3EVGA 2OFPA 5CJ2A 1M2EA 4OK6A 5ALDA 2G6TA 3HZRA 1YJCA 4MDFA 2XIJA 4WINA 4WN9B 4RTSA 1MRSA 1Y7PA 2HL6A 2PH3A 1MFZA 4FZ5A 1EFUA 4II3A 3HJUA 3JR7A 3MXOA 3SKYA 4MROA 3GLUA 5HGJA 4IIGA 4ZTZB 5D3QA 1E8NA 3TSCA 3HE3A 1KZYC 3F9IA 1PUIA 2NUAA 4QARA 1L5HB 5TGTA 1EVZA 2W6QA 4HNQA 4BNTA 1QS0A 3KLBA 3SHOA 2NTNA 3EOBI 3IMEA 4YH1A 1P62B 1Q1GA 2WVAA 2FH5B 2Z58A 1ULAA 4M8IA 1R66A 1RHKA 3D3JA 4QJ4A 1CE8B 3PFIA 3OA0A 1MB9A 3VVLA 2I62A 2R97A 3QBDA 1ZLXA 3AU9A 3AFGA 3LT0A 1A9QA 2HRCA 4FSHA 1P1JA 4ZT4A 4NFYA 3JQGB 3STTA 4CIVA 1M74A 4XSGA 1OILA 1RI5A 3H42B 1RZ3A 3GP5A 3HPRA 1DG9A 4Z7JA 3PD7A 1QCCA 1UBCA 1Y4DE 2G9ZA 5TS3A 3JRNA 1FRZA 1E3SA 2O2HA 3H1GA 2E4VA 3IE0A 3LPDA 5E9JA 1E1QA 4PS0A 5DGIA 4KXYA 3E9NA 2HIAA 1IY8A 2H4WA 2QWXA 3TKYA 2OEPA 1E3JA 3AY7A 1N9GB 1PX2A 3HNPA 1Z0IA 2FPLA 3WLHA 1JDSA 3DBHA 3LX6A 4AT1A 4D46A 2VJOA 2HXGA 1HC7A 5EPUA 4PYQA 1Z62A 4N01A 1T9KA 3S29A 2RAUA 4X60A 4C3VA 2VL7A 4O4JA 4FD2A 1ZD3A 4LXHA 2AYZA 3AR9A 3PHIA 3MAJA 2CHUA 3PNPA 4MLCA 4P58A 1FXWA 4GMGA 4QXMA 2ID7A 1CUVA 3X1ZA 1KEUA 1OA0A 1QCDA 1R4ZA 3SZOA 5CH3A 1NXSA 1KEEB 2GGSA 4MRAA 4WFQA 1S4QA 3N0VA 3RU3A 2G3YA 1AX9A 2AUTA 4K2AA 4K9KA 3TQRA 1WDMA 4ARBA 1LBIA 4ID9A 4LZJA 3TOXA 4DLLA 4RKFA 2GR9A 5FYDA 1YE8A 4I5DA 1XALA 1XYVA 2O8BA 4TN1A 3UK2A 1ZVJA 5L3VA 4TSRA 5HJ7A 4JA2A 3V8PA 4ZOLB 3ZLUA 3HCEA 1WXQA 2F1JA 4ZOAA 1PFKA 5AW9A 2VF4X 3FB4A 3SJBA 3A9UA 1T35A 1TGYA 4NJMB 3O38A 4PQEA 1SQ6A 4WNCA 3EWAA 1R8XA 1MPTA 4LHSA 4PV7A 5ITWA 3N39C 5JCZA 5JYBA 2NV0A 2YCLA 3FZYA 2BI8A 1O0BA 1GA6A 1SVKA 3C6MA 3LP8A 5ECGC 3JZFA 1ZGJA 1EAYA 1DDIA 5K3EA 1QH8B 5B37A 3EY9A 4DE5A 2BKXA 3QMMA 1JW9B 4GEKA 3DUFB 5LBTA 3VPDA 2IGTA 2Q5HA 3KYCB 4NOLA 1UL1X 3GU3A 3V4PB 5HIAA 4B45A 2JIMA 3L6OO 2I3GA 4PWZA 1WQ4A 1JLLB 4MX8A 4QM6A 4TGLA 2EOAA 1L5MA 1JPVA 1QRDA 1S3IA 3CT4A 5I9LA 3NXSA 4YRFA 4DL9A 1NMQA 5GVSA 2PNFA 3RYCA 4EY8A 2CLDX 3ESDA 3M4XA 1P2VA 1Z6XA 2QAGC 3PNSA 4FZVA 3EH2A 5J2UB 1XNHA 4E5YA 5DULA 3D4PA 5FR1A 1CUDA 4Q3LA 3QUTA 2PV7A 3D2CA 1N0VC 4C06A 2H2HA 2HPAA 4UREA 4OA5A 2Z4RA 4MAMA 4YECA 4I1OA 2ZM6B 3MJCA 4H4DA 5JMOA 4C2UA 4F5WA 4UNNA 3OCZA 2JAPA 2ZEJA 3LRPA 4L50A 5KTRA 3KDSE 5AJZA 2CLEB 1N0HA 3ESAA 1L5FA 3UHFA 5C3UA 1RRMA 1TM3E 3M1AA 1NJSA 5U4QA 2VPWA 4RVGA 4EZEA 2IZ0A 4R2WA 1KI7A 1NBAA 3SE0A 2JFVA 4F4HA 5JOQA 1WNTA 1E3WA 2XTAA 2ZATA 1MVLA 4D3YA 5I3ZA 2IYYA 1LI4A 1C4WA 1KIFA 1PJQA 2XAUA 4Y6RA 5CTJA 5C0OE 3UJ6A 1NHGA 3IDZA 5SY9A 4MKHA 1PTJA 1N2ZA 3ROPA 3HTXA 5GJCA 3HXMA 1KOLA 4JELA 3GJQA 4NCBA 1EZ1A 4C4RA 4CL2A 2VPYA 4OXYA 4REMA 2PLNA 3C5EA 3VU3A 3BGSA 5LLTA 5LSAA 5AFSA 2PT6A 4MW4A 4YJGB 1Z47A 2PR7A 2ZE8A 5B4UA 4DPMA 2AOXA 2JFBA 2SCUA 3DAPA 3FYUB 4J91A 4L0MA 1X15A 2ZROA 2HRDA 4TT3D 1T4DA 4RH3A 3SQLA 3V1YA 5IABA 1D2EA 5F1OA 1E3QA 3EY4A 3VNRA 3H3JA 1O4VA 5AK0A 1D2RA 4YR7A 3IVRA 3IAAA 1QLHA 2ZYWX 4XD7A 4CZ2A 2GRJA 1ABEA 2QTTA 3OEHD 1E9FA 2Z6VA 4PZLA 2PMEA 3C24A 2ZJ2A 4OQFA 2YVKA 4JQOA 4DIUA 3E7PA 1DRUA 1BW9A 2QZJA 1W0JD 4F9FA 1A04A 1NXPA 3GMTA 2VH2A 3B6KA 4Y8VA 1YR7A 2IIVA 2JBAB 2ZAGA 3FETA 5C80A 3EA5A 1J2EA 2PQMA 1EDEA 3EIHA 2QX7A 3ENZA 1GSAA 1WW8A 4KXMA 3WBFA 4GMXA 4ALKA 821PA 2HDOA 1D6MA 2XDQA 2XXBA 3UCFA 2XOKD 3PDWA 1DDGA 3TW6A 3DZBA 3WK8A 1U2EA 3KZKA 5A6SA 4P93A 3P19A 1ECLA 4MTLA 2HPVA 3ROEA 4C7MA 3FBTA 4EW3A 3G8BA 5BV7A 2ZSIA 1EGAA 4KXFB 1V1MB 1PGPA 1X3SA 2CXTA 2Z4TA 4YRJA 4MUMA 4Y2PA 2VP4A 3BA1A 3GVXA 3HR4A 2OB1A 1U7PA 3HWRA 4LY0A 5K3FB 3UMVA 2YMPA 3BB1A 2P30A 4KAFA 4OL0A 4DEVA 6PFKA 1UDAA 1TTQB 2O48X 2Z9CA 4MUYA 1AXRA 5LNK6 4W1SA 1SD2A 2R1TA 3IH5A 4RF4A 2X9VA 3SOZA 3NC1C 1QAMA 4OOEA 3TZLA 2JD0A 4L5IA 2PZLA 4ZTBA 1JMKC 5FOVA 4DRXB 1IZ7A 1OLSA 3IVCA 4ZAXA 1MIOB 3WGQA 1LV7A 1THTA 1H3FA 4PYLA 1FFXB 4KG7A 4OGKA 2QZPA 5EIOA 3W5UA 4D9GA 1NFRA 3HV0A 1QLWA 1XMVA 2HU2A 1CLEA 2C1EA 1OWNA 1SBTA 2OECA 4XGKA 4AJKA 5A4AA 1PWXA 3M6IA 4IEIA 1ISMA 4RX1A 3CEMA 1X87A 5HFJA 1YFJA 2PRYA 1LWNA 2C4UA 2QV7A 3BYZA 2UYHA 1QG0A 2RBKA 1ZNXA 2VQFB 1H5QA 2G1UA 2XWBF 3WWZA 3C5HA 3HDTA 3QKRA 3G9TA 4B82A 2JB9A 2G40A 2NXWA 4KLAA 5H68A 3K71B 3I28A 4HDAA 4Z0TA 5HTKA 4B7AA 3ZZ0A 3RUHA 4MUNA 1Z5ZA 1KC1A 4D74A 1EFVB 1R88A 3UICA 1T2EA 4RPGA 3REGA 4D43A 3HRIA 4LHZA 1U0BB 3K72B 2VDOB 3UV6A 3GF4A 3MTBA 5CBPB 4LGYA 5EEGA 4HNTA 3KJZA 3DDWA 3WYGA 5EUQB 2BFNA 1YS7A 4FYJA 4CPDA 5I9IA 3BEOA 1ND6A 4XFDA 3CLRC 2VJNA 5BQFA 4RTMA 3N2LA 3VKUA 1TKRA 1WB4A 3LUFA 1W36D 4QAJA 1ZGCA 2RB4A 3QU4A 1PR3A 2NYVA 1UFRA 4XGIA 1E69A 3RR2A 1FNSA 2P5YA 2ZZKA 1JHUA 2PJUA 5FI3A 3UH0A 2CN1A 2OAQ1 4IMIB 4PIMA 2BTQB 1X0XA 5HJ2A 3GOQA 2QTGA 1ISRA 1YJXA 2HQ1A 3NIFB 4HDMA 4HLUC 1Y5MA 1I4OA 3UJNA 1ZJWA 3CSDA 3SSNA 2ENWA 4N1AA 4X1KB 2YRXA 2CWWA 4O2BA 2R96A 4M98A 2P9TA 4O5AA 1PR0A 4UCWA 5LB4A 4DRYA 1XUOA 4LF7B 3K4PA 3RQSA 2XXAA 4KRFA 1SBZA 4ARUA 1QHHA 1JECA 1W47A 1P73A 1YKSA 1Z7BA 3OF3A 1WMDA 4EFDA 1KZ9A 1S7GA 1SCQA 4GOJA 3WYCA 5DHUA 2HMSA 4GX2A 2R3SA 3E7DA 2PR2A 1LA2A 5A0VA 2XF2A 1W5EA 2ZUSA 4GHWA 1OX5A 4K9QA 3I83A 5JSYA 4Y2TA 1OPRA 2FRDC 3AP1A 4D8UA 1RQ2A 3HLKA 2VRCD 2QDXA 3EN0A 3W3AA 1N2XA 4NABA 5FDFA 1K27A 1UXJA 1ZM7A 2HBRA 4LY9A 2XADA 4DT1A 3MSXA 1XRRA 4FCCA 5CDGA 1BXGA 5KNCD 4BMNA 1P4RA 4K1XA 3OHPA 4P35A 1ORIA 5AP9A 1KO7A 1KI6B 1AUQA 4RTRA 4PZUA 5EJ9A 1S3GA 4RC9A 1Y9EA 3NQ41 5H3CA 1SOUA 1D4FA 3MIIA 4OK5A 3I6BA 3QX8A 2NUPA 3IT0A 3CW2A 3W5JA 4OFXA 3WGTA 3EVEA 1G5IA 3WGYA 3P0IA 3WL8A 1J5EB 3ESYA 4P1ZA 3H5RA 2FEKA 4DGQA 5I7UA 3DB1A 2Z8XA 1OZGA 4QGSA 3KPYA 4Z4CA 2BCGY 4FFLA 1F51E 1Y9AA 1Y7TA 1FFBA 2D1QA 3V55A 4MZDA 1DT3A 4ER5A 1EFAA 1TJ3A 1JLSA 3H1PA 3EXHA 3T3PB 2J9ZB 3Q0TA 3SNHA 5A5FA 4AJ1A 4K87A 4G9BA 5F51A 1JSCA 5KPDA 1A9XA 3FMGA 1UMKA 2BMFA 1L5SA 1PQ4A 4DIBA 2ID4A 5IHPA 4OLAA 2PH7A 2EIXA 2XUJA 2ZSAA 3G9QA 3ZN2A 2BR3A 2G9VA 3KTOA 4V0QA 2G1JA 4NOMA 2HWKA 2DF8A 3WQSB 3ROXA 2HNKA 2EC5A 4KAAA 5FUQA 4J1SA 3H9EO 1HLDA 2PXHA 1P9LA 4QBFA 1YL7A 1MOQA 3RB8A 4XEUA 4TTAA 3UMSA 2GZRA 4FDMA 3BUSA 4RJJA 4LTNA 1YI8A 5JZMA 2IKQA 2CK3D 4IOMA 1NOKA 1YBVA 4EWLA 3FCUB 4JOCA 4MWZA 2C7QA 1OAOC 1ULUA 4D4GA 3PIRA 1G16A 2FEPA 2EBHX 1ZJ5A 2ODBA 4LYJA 2AW5A 3S2EA 3QOWA 1E18A 3UJBA 5JYEA 3S2YA 1E9BA 3DQPA 2D1TA 1H8HD 2GUWA 2ZJ4A 3IT1A 4QDJA 4NNOA 1Y9DA 1YS9A 2GD0A 4MGEA 1UMCA 2I55A 3LPCA 3OIFA 2GAAA 3ID6C 2X3YA 3OKAA 4Q03A 5FBVB 3A4TA 2Q4RA 2WU1A 4XASA 2QGNA 3D3KA 4UM5A 1QH1A 1SG0A 5FEMA 3FGOA 1G9SA 2ECPA 2GD1O 1NPDA 3MERA 3N58A 4YWJA 2P78A 3S44A 1JPUA 2Q5LA 4UTZA 1ZWLA 4A92A 2QRLA 4D9EA 4PFKA 4AXXA 2A86A 3QXJA 4I08A 2PDAA 2CL6X 2CLKB 1COZA 3HU2A 4RV4A 2OYRA 3U62A 5BRAA 2W0SA 3ZH2A 1XA3A 1ZSNA 2AYYA 2KB0A 4ILEA 4L5CA 3ZU3A 5JBNA 4OQEA 2VDRB 2W6ZA 2YX1A 3ABZA 2DFTA 3SIRA 3MA0A 2YWHA 3A9CA 4IDNA 5IK2D 3HVRA 1PYDA 4B1FA 2RJOA 4D4JA 4KN6A 1PFWA 2HA5A 3AM1A 2CVOA 3C7DB 3EGOA 1TQ2A 3U17A 2VA8A 1AGRA 1GTZA 2PLFA 3WGIA 2XUFA 1FP7A 3CRQA 4LMAA 3VPHA 3ZCXA 1G8AA 1WOYA 2JLUA 3H2YA 1I10A 1TRHA 1QO0A 1QTNA 1NTOA 1FQWA 5KSWB 4CM4A 1TF2A 4W5TA 3ZWNA 1UINA 1XCMA 2Y67A 3PNOA 4PR0A 2PUFA 4LRQA 1P0IA 4UDOA 3ZHTA 4LF4B 1I4EB 3U0BA 4FPXA 1E2PA 4U2FA 4YYEA 1GPUA 4HOYA 3DKIA 2Z04A 4YJ2A 3M5CA 2YJZA 1T34A 3Q88A 2BSXA 3A11A 5DRYA 3EXIA 3ECSA 1QFZA 3THWA 2IQIA 1QAOA 2X77A 2PSDA 3C3JA 3HFGA 3U5TA 5LJLA 3IUNA 3UUFA 4G0NA 1RS0A 1GZ7A 2ZQ5A 3Q5DA 4ZVPA 3R8CA 5JXGA 3T5CA 4DR3B 3Q8MA 2H5IA 1H23A 3FDZA 1FPMA 1UEIA 5I7SA 3A14A 4FINA 3VHRA 5KNBA 1X1DA 1A4IA 1DC7A 1QR6A 1PJ4A 2VPZA 3EOZA 2A0YA 3MT8A 4IIEA 3RRMA 1ZFNA 1DMRA 5CLGA 3H5OA 2H4HA 1A1SA 3JQFC 4IDOA 1XKLA 4LJSA 5IT9A 2QM7A 5CFMA 3RRJA 4M37A 2AI1A 2KX7A 1UQTA 1THZA 4HNHA 1RWNA 2M9MA 3B9QA 3HR8A 1EHYA 2IU3A 1P80A 4ND4A 1AKWA 1XVTA 3MINB 5LVAA 3KZMA 2IEYA 2WG2A 4L28A 3UK6A 4AZVA 1AS0A 3HXPA 3VV2A 3KETA 4DLBA 3D3QA 3IVGA 4BXOB 4AKIA 7GPBA 2Q5QA 1VCMA 1PJCA 2A4MA 4QQFA 4CF6A 3GUCA 2FNAA 5HMLA 2IXAA 3DFIA 4JB8A 2W0MA 4Q1DA 3T9EA 9GPBA 4UARA 3NJ4A 5MN6A 5F3WB 1PTKA 4BQRA 3W6UA 2X42A 3CZ9A 3A06A 4PQYA 2GO7A 4WNIA 4MDEA 4RH1A 5LQSA 5DTEA 3F8WA 1R10A 3G6WA 1GUZA 3AHDA 3I9V1 3LHIA 1XX6A 3W4JA 2V7PA 1W49A 5H0IA 2PBRA 1LDEA 2V74B 2IHJA 3A1CA 4LMPA 4JP3A 1DQYA 4X7RA 3M49A 3SBOA 3A10A 1CR0A 1PQUA 4MPJA 3PEFA 1L4UA 1XTVA 4EPTA 4L3VA 1FYDA 3LPLA 1ZUIA 1CV2A 4QFBA 3WNBA 3SX2A 3B38A 3R0VA 2HLHA 4QPCA 2SICE 3VSCA 3O8NA 4F3KA 4JI6B 3F5QA 4HSGA 5FAKA 1P18A 3LCVB 3OIYA 2XUOA 3MEQA 4BNWA 1P5ZB 2OUIA 1I33A 3P52A 5HW0A 4LV8B 3ZLJA 1NGSA 4PGGA 5IHXA 4QQNA 3BOSA 1GUDA 4U7FA 5FTJA 1U9IC 2XV1A 3EXFB 3MMNA 4HH4A 3OZFA 4HUJA 4CUKA 4ZN6A 5A6VA 1JWBB 1B0UA 2D5IA 3OCVA 4J0KA 2A9KA 2PWAA 1HLPA 3U1TA 4UZEA 1WB9A 3K6JA 3CYFA 2DKFA 2X5KO 3A6EA 4ZVKA 2HK6A 3C16C 2P8SA 3UW1A 1YULA 3SSOA 2NG1A 2WJIA 1IY0A 2ZJOA 1GOTA 4HL6A 4R41A 5BN5A 4YV0A 1RAAA 1U2GC 3LT1A 5KWVA 3UMBA 4E15A 2JGDB 4RCVA 5CM8B 1TCUA 3WIVA 2B30A 3NRBA 1LPNA 5ITSA 1A9XB 4O4IA 1QPBA 4RGVA 4CNBA 4AIIA 2K6GA 4L4SA 3KJFA 2FAXA 3K5HA 4REQB 4HWTA 3TTVA 1H6CA 5B7QA 4TTRA 1D9XA 3MPOA 4MV6A 3FIJA 3M5PA 3K5PA 5DV9A 3GI1A 5EKSA 2F3SA 2RG1A 2RH4A 4MVJA 5D7BA 4MJLA 5I7HA 3VTFA 2YC4C 1OXTA 2PKYX 3IODA 4PANA 1U1IA 3NWEA 3CW9A 4FYHA 4WERA 4MQ6A 4F38A 5M04A 2KS6A 1PW7A 3X1KA 1TVEA 2BP7B 3UTCA 4I2NA 5CB8A 1AQIA 1JEAA 3LQ2A 1LPMA 5JCJA 3MGGA 1EDOA 1ODLA 2HKIA 5HF5A 1HDZA 1IXSB 3N76A 2HWXA 4Z9AA 1NX6A 2ZJ7A 5ELMA 3VTAA 4BJ3A 1Y1RA 3R9IA 3FA2A 4P3XA 3WMEA 4BIMA 3HRKA 3NH9A 4C6SA 3D8SA 4KMOA 2O23A 5FYQA 3UMFA 4EA9A 1TYAE 5B7NA 4BLRA 5H80A 5E3HA 4LJ5A 2YFKA 5AJUA 2VQDA 1T3LA 1GUYA 3TPCA 4N54A 2VWQA 3FRHA 1BFUA 3CRNA 1TX4B 3FF4A 1MJNA 3ONEA 3QVUA 4TWIA 3JQ9A 1NRIA 3PEEA 1IM5A 2R6HA 4FS8A 1GL6A 2EX4A 4Q7EA 4ZEXA 4F12A 1W5FA 1JL3A 2ACWA 3MJVA 4J2TA 3PK0A 4R1NA 4U02A 2ZBRA 3NGMA 1ZMBA 2C9DA 1JI3A 3QFRA 2WJPA 2PXXA 3Q87B 3EGVA 3ZE8A 3WAKA 2QT9A 2WA2A 4MEAA 2IYRA 3BMCB 4ERXA 5JAHA 4C2AA 3NHYA 2JGAA 5DM1A 4U7PB 3DV0A 2BM1A 3H9JA 1VHWA 4DG5A 1JWLA 1QR2A 4I4TA 1JHZA 1T6ZA 1FUYB 2ZSBA 3VOTA 1KKLA 2NZYA 4XX0A 2J46A 1SVLA 1WG8A 4K6GA 4CQLB 1FTNA 1GARA 3CPSA 2ZTVA 1IJKA 2AA3A 1F7VA 2V0GA 1D9ZA 1JG6A 1FSFA 2WUFA 1YSCA 2JFNA 4WZZA 2ZB8A 1S5PA 2HIHA 5JQGF 5JR3A 2Y0CA 4GMDA 2P0YA 1BMTA 3SEQA 1H69A 2QNBA 4Q4LA 4PPGA 2VSXA 5EJMA 3OJCA 2KWIA 3KJHA 3H5TA 1T5SA 4PLZA 4Z0HO 5EXSA 4IO0A 2BKEA 2A0WA 4LHEA 4US2R 1AKTA 2VXBA 2Y77A 4DR4B 5IWAB 4F11A 1NW3A 4EQZA 4M8NE 4WZBE 2IZ1A 5CNJA 3LUKA 4NMWA 2DEUA 2OC4A 1FZQA 1U7UA 3VR5H 2QSYA 3K9QO 2VUHB 1VM6A 1DTSA 2GAIA 3DYBA 5CXQA 3LCCA 3QYAA 4FFWA 4LDAA 1NMYA 4AUKA 3O7WA 2C5BA 5F33A 4ZZ0A 2E4AA 2IEIA 1QK4A 3FZEA 4X1YA 4TXLA 4J3NA 3OZAA 4HUTA 2W6NA 1KYXA 3F4KA 1II0A 2QRVA 4QODA 4CL3A 4TV9F 1ZRSA 3IB3A 3UK1A 5CT5A 2A9JA 1Y7LA 4DMGA 4J0DA 2AI3A 1QDLB 2QUHA 5LKRA 5B3JA 2OA0A 1I30A 1ZD2P 4LGCA 3DF7A 3BBLA 2GEDA 3LBNA 2W58A 3NYWA 4OCZA 3CUTA 3T9AA 5C35A 1CQIB 3CFYA 3PGXA 1KVRA 4N40A 3KCNA 5HRAA 4TRRA 3OM8A 4UUPA 4LSWA 1VL8A 1LQTA 2PCJA 4YQZA 3CLHA 4Q4HA 2F8MA 1SQ0A 3UMJA 4BBJA 2FUEA 1SXIA 3AR5A 4EYKA 1Y8QB 3A36A 1H9AA 2ZWVA 2DFDA 2WZBA 4GKAA 2AIRA 1Z5UA 1X1QA 2KBEA 1W85A 2ADFA 3OPYB 2PGIA 3QRWA 3GLSA 4JJ6A 3VU9A 4YPFA 3WLIA 4FMBB 5CEJA 4RMHA 2X0NA 4Z0NA 5A3QA 4M0LA 4LCJA 1G2IA 3BQMB 2UZIR 3QUAA 4HDSB 1PS0A 4RE5A 1YB4A 2QAGB 4F96A 1RACA 4E2FA 2FCRA 5IYZB 4KLZA 1D8TA 2CNDA 2GZ1A 2OZLB 3TLZA 1W36C 1IRXA 5TF0A 2EFCB 3QBEA 1XDZA 5A9RA 2R1VB 2QRGA 1GG2A 1OPXA 3OQHA 3DC2A 3LQRA 3ZDCA 1M1YA 3WGUA 4JI5B 4EATA 1E2IA 1A5BB 1GKIA 1ORRA 4YRIA 1OR8A 3AVTA 1Q1NA 1Z83A 1ZVKA 3UXYA 1AT1A 1B3RA 1I2ZA 2V0CA 1QCYA 2B4QA 3TW8B 5BN1A 3GW8A 5HDQA 4C5AA 3HMKA 1NJ5A 5KEIA 1D1QA 5K3DA 3RS4A 1O54A 4Z8YA 5E4TA 1YR6A 1BCRB 1MO3A 1ZOPA 3AJDA 3CSUA 3IXLA 3SGLA 1GQOA 5DNDA 2JA2A 4LX8A 4EIWA 5EKDA 3JY6A 2WOOA 2O0LA 3PUZA 3HUUA 5BNFA 5KOJB 1ZW6A 2NPIA 2I80A 3UNXA 3AINA 3TNLA 4IQ4A 1BX1A 3P2KA 1LEHA 5FIUA 1X7GA 1SCIA 1TXGA 2NPOA 4LN1A 3RK0A 1JGTA 3AHJA 2WT9A 2VT2A 1D2MA 1X80B 3MRSA 2B9EA 3TD2A 3CF0A 1FIUA 5DYNA 5FBRB 1AKNA 2DY0A 4WX2B 5COQA 5DLQC 4L8VA 3EIWA 3P9IA 2DR2A 5I51A 3PJGA 4IDQA 2BFWA 2P7HA 1YHNA 3FFXA 2IEZA 4ARCA 5REQB 2HSZA 4EYEA 4KR0A 4CM9D 4DAOA 1CK4A 2ODNA 3ISVA 3OPYI 4JN6B 4G56A 2PIDA 3BICA 1VYUA 2F9FA 4QBKA 4BVLA 2P8JA 4FGZA 3CKMA 5DXFA 1N4DA 1JAYA 2BGNA 1VGVA 1G20E 4ZJUA 1Z6TA 5LP6A 4JI8B 1OLUB 3ZE9A 1QWSA 3A6ZA 4A0HA 3L7IA 3IOEA 1Q0QA 2GN6A 1JDTA 5CK4A 1KYVA 4B3DA 3OEYA 3GL9A 5B7PA 4XPIA 4RV5A 2HO5A 1MGPA 1O5OA 1DZ3A 3K1YA 1LPBB 4HGNA 4DWWA 1H05A 4EABA 1KK3A 1T4BA 5FQOA 3WB9A 3PE6A 2EP7A 3GCGA 4XX1A 2WYWA 2F17A 3OT4A 3EUEA 4C14A 1MZPA 2PRJA 1F0NA 2VAMA 1E8MA 2YN2A 3SJAA 5LQDA 5KMGA 1XP5A 2DUMA 2DBRA 2WABA 1HFWA 3BD9A 4XLTA 2JDIA 3A6HA 2O2CA 4BX0A 4M7PA 1AURA 5F64A 1KJJA 1QV9A 4A6XA 4ZCTA 5AD1A 2QLTA 4C9BA 1WW2A 2C20A 2GPNA 2VNAA 3FOBA 3G17A 3C4JA 3SC2B 1JXOA 1TD1A 3ZE2B 3GB9A 1W94A 3WHPA 4EMTA 3ZX5A 1E7MA 5F78A 1Y8CA 4XLLA 4MWOA 5DNAA 1HT1E 1UBJS 3ZE0B 1JH8A 5IVPA 1RI4A 1JIIA 1ILEA 1H1LB 2ZSUA 3KKKA 2NYRA 4EBBA 4RS4A 3ZWDA 3GCDA 3KJEA 4GYKA 1SQFA 3GQBA 4MIEA 3TG8A 4C76A 3M70A 2G6BA 3O2JA 5AI5A 4KLRA 1XHEA 1NP3A 1TEVA 2CLHB 4GZMA 4R3WA 4E3ZA 3WMFA 2GXUA 5BVHB 2AVNA 2XBUA 1XLTA 5IP5A 2ZTMA 3E8MA 3CJQA 4FYYA 3SYMA 4KQ1A 3WO1A 4MYSA 4J16C 4B3HA 5AXCA 3OI7A 1KOJA 1U63A 5EJIA 3DYIA 4MPDA 1ATIA 1M0WA 1YO6A 2QJTA 3O1IC 2IPMA 3DMYA 3H11A 3ESBA 1WKBA 2D59A 3ND8A 1LK0A 4KGZA 4S12A 4BO8A 4K6OA 4O59O 1R0SA 3O4IA 3RTBA 4RJLA 2VWGA 1GLNA 2IYEA 3RVNA 2GZDA 2FA9A 3COZA 3WLEA 1AGYA 1CNMA 2JPDA 1TECE 3C3DA 2VXOA 3I6QA 3KVRA 4WASA 1Q14A 3U49A 2W22A 5EZQA 4A16A 2VP2A 5ETJA 1XI2A 1U0NA 2IV2X 3ODGA 3T8YA 1P5HA 2PLAA 4JD5A 1ECCA 2VDKB 2IL1A 3C4QA 4HO1X 1B7GO 3EGWA 4RO0A 1DARA 2VPIA 3AQIA 5ALFA 4ZYZA 5BNWA 4RTOA 5DMHA 4OQZA 3FTQA 4JGBA 3S6JA 1H9BA 4D4KA 1XZFA 3F5MA 2XPCA 3K5IA 4P4TA 4TT8A 4XYMA 1XU7A 3ME5A 3T1OA 1NUSA 1NE7A 1RFLA 3LO5A 3G2LA 3X43A 3TL6A 1VIDA 3HB0A 1Z26A 4MLDA 5FOWA 4EYGA 1H85A 1VB5A 1QOZA 4MW7A 4PGFA 2R6R1 4PCVA 1M2OA 3PNLA 4RXUA 2HADA 4AZWA 4HMPA 4JR0A 1BO6A 2MOKA 3LA8A 3R3VA 3R6LA 4MYHA 4UHFA 4WKPA 4ETNA 1FOEB 3WI7A 4UBKA 3L79A 5JQGB 1BHSA 3P9RA 2NUBA 2D7JA 3PX7A 5F73A 2GQ0A 3L1KA 4JLAA 2WWGA 4ZO6A 1PVOA 4QLAA 5HZKA 2XW6A 1ZKDA 2XZDA 1RTTA 4DB4A 3VXKA 2QHXA 5C1IA 5CVDA 2B25A 1WX1A 2UVPB 1NN0A 4MP8A 1ODSA 1X13A 5AJYA 3CZQA 4I50A 2XBMA 3JQRA 4XUEA 1FMTA 5B55A 3L40A 4PQRA 3RHZA 3PXUA 5C1PA 2CNBA 4OGWA 4O25A 1N6PA 2Q6LA 3GFBA 3QVGA 5TSDA 3JVEA 1U2DC 4MGIR 5EG5A 3OTWA 4LYHA 1QBKC 1USGA 2GEVA 1EEHA 2ZSJA 2QXYA 3AKYA 3G2PA 3H8VA 1OH7A 1XLUA 5DTQA 4TKVA 1P31A 4IPTA 3SBDA 3MTJA 3GFGA 1XD2A 1BJTA 4FWTA 2MMCA 3A7DA 4C05A 1VE3A 3D5EA 1BCSB 2PRSA 2EV9A 2CXOA 4PFJA 4LFBB 3WKEA 2WLTA 4K9MA 2BTEA 2YINC 2Z95A 4XSVA 4BDTA 1P77A 5JNWA 3G79A 1IATA 3HBMA 4UEQA 1F12A 3LQYA 4EY7A 5KOYA 2NO5A 1E0DA 1XXHA 3GLGE 2O0MA 3GJYA 3GRUA 1XPRA 3DD1A 3A04A 5IZCC 3CVXA 1EFKA 3GJ6A 1E79A 2VJQA 4F6CA 4IGEA 3FAKA 1R4NA 2H2IA 1JQ5A 2WHQA 5B3AA 1S96A 2OUKA 4UTVA 1YUNA 1PGOA 1X8LA 3HADA 2ES4A 1GPDG 1JKIA 1GU1A 1V8OA 2Z8ZA 1JT2A 1P3DA 5D6OA 5AKLA 2RHBA 1FMCA 5IASA 2HMAA 1EFPA 5CFRA 2A1UB 1RPZA 1PWHA 3QXSA 3Q41A 1POXA 2ERCA 2PX2A 4ER6A 4W4TA 2QN9A 1OSNA 3O3OB 4CMEC 1V8ZA 4Q37A 2C2ZA 3TNJA 2GZ2A 3QFTA 4HD8A 1K8XB 1EXVA 1OYVA 4TXJA 4IV0A 4BBAA 3MQFA 3ETDA 4JY7A 2WWXA 2EJVA 4EB3A 4TL9A 2PT5A 3PZRA 4FGLA 1Z4PX 2NZ2A 5HPYB 1XAHA 3Q7EA 2ZU6A 2Q9AA 5I9BA 4C43A 1UR5A 2YWRA 1Z5VA 5T4HA 3ETLA 2A0KA 4ZRMA 1MEEA 5KINB 4ZVUA 5EHXA 4P31A 5DT9A 1RZVA 2ZTHA 4G4SO 5L53A 1VDZA 4S2UA 3TW4A 1M1XB 2FX2A 1TGVA 1SVOA 2H2AA 3HJNA 4QXOA 4NEQA 4MVJM 2IT1A 2N1MA 2AXQA 1L5NA 4G0UA 3ZNOA 3IE1A 5ALLA 1C7FA 1V11B 3C39A 1Q3KA 2AJDA 2C0PA 4OHKA 2EYQA 5EJEA 3B1KA 1IWBB 3ED1A 3LHKA 6NULA 3PQ8A 5I47A 2R9VA 1YBFA 4RELA 2XRFA 4OYYA 3ROFA 4HZUB 4XJVA 3FN4A 5ESDA 1TM2A 1SXQA 4WZBA 3OE7A 3URMA 3IXMA 4TMWA 1J33A 3CRVA 3HV2A 4TV8F 2BUCA 3OLXA 4A8JC 5HSGA 3CKYA 3DE2X 3I2GA 5FPKA 2PA0A 1VLJA 3W7BA 3DZIA 2E4UA 1V6SA 4YAFA 5JFOA 1ATZA 4JGIA 3TLMA 3PQDA 3O90A 5AJVB 5HZGA 4TYNA 4XCQA 1JG3A 1UKVY 3QJYA 1L6IA 4QX6A 4NBKA 4ZMBA 3K1AB 5BXQC 4INPA 3H2GA 2PO7A 1L5VA 4D9BA 1PSDA 4I99A 5IS2A 1G59A 4CKCB 3CRRA 4RA9B 4LYGA 1XC7A 4DWJA 4E46A 3E8SA 4JLMA 4CLOB 4ZYTA 3R5XA 5D1NA 1RXVA 2VF8A 1SBQA 1KBZA 2P5SA 1G17A 3JWGA 3LXUX 1TU0A 2QMYA 3ZGOA 3GJ4A 2UZ1A 4HDQB 1YT5A 2P9JA 4WK4B 4BOYA 5JU6A 2XH8A 4YRLA 3IAM1 1TU4A 4O0MA 1Y1LA 4HX2A 1P1CA 5TGDA 5K9ZA 4DLYA 1E7QA 1ULSA 2FMTA 1MAVA 3AF5A 3MS7A 2O4CA 2C9YA 2BTOA 1RWOA 3CWCA 4BC1A 1G4UR 2CJFA 4WFIA 3S40A 4BMCA 2WOJA 1DSSG 4BX2A 4DYVA 1T0IA 1P8JA 2YV1A 1S02A 2HX1A 4Z51A 1H1DA 4QOJA 2ZWMA 3QLVA 4JMPA 3JYQA 4IDGA 2Z6AA 2RMKA 3PBKA 3TDMA 2B20A 5K3OA 4OH1A 4LXGA 3RT9A 1FYWA 1QX4A 4YJFB 3R8FA 3K9BA 1VHLA 5LOVA 2P1ZA 4BB5A 1V7QA 5I7WA 5LYYA 2NO0A 3MJDA 5LDDC 4DCCA 1X1AA 2D8MA 1SUFA 2I6QA 3TE6A 5JFGA 2PO5A 1UPBA 2VXCA 4DN6A 5A4JA 3JW8A 3R0QA 1ZIYA 3MWDA 2VAVA 1NKVA 4OHOA 5ALXA 1H8EA 4ZYLA 5B3KA 3RBZA 3DSRA 5DGCA 4QRIA 3LY5A 5BORA 1T1EA 4PZAA 1CFJA 1UEXC 4GXNA 2NU6A 5LYJF 3RGWS 4C08A 3IUYA 3B6ZA 1DNPA 1TM4E 4R1TA 4WNAA 5E9QA 4R71A 1R8YA 1WXEA 2UUCB 4LV6A 3ND7A 1BD4A 2B7LA 4ND3A 3VR6A 3GP8A 5H3HA 2AS0A 4N8EA 3VNQA 2IZ5A 2C2KA 3I2FA 1GKKA 1BMDA 2C29D 3PVZA 4J1TC 4LJKA 4YCDA 4O2AA 1ECPA 4RD0A 4WK6A 4BLPA 4CCYB 2HK9A 5DBFA 3V4RA 3QBJA 5HS6A 2VPQA 3OY2A 3WWDA 4X00A 2JLXA 4I8DA 4HLQB 2K2QB 4UJ5A 3P0HA 4J75A 3OSZA 1C7RA 5KKNB 2P77A 2DYKA 4GLOA 3RU9A 2Y2VA 4DQDA 3L8EA 5A9SA 1HQCA 1QIMA 5K0CA 3TBKA 3WA7A 2AEFA 3PPVA 1GCUA 5GGYA 4AWBA 4N47A 4NICA 1YKGA 4N39A 2LCQA 3R3ZA 5JV5A 7REQB 3U5ZB 1MJHA 5JAUA 1ZA1A 4FFDA 3I8OA 4OREX 3HY3A 3FB1A 4IIJF 4CTNA 5ED4A 1AO3A 3I5AA 3IOCA 1R8JA 4DCJA 3ELWA 3ZXIA 1KS2A 3EAFA 4YAWA 5J40A 1XV5A 1U8UA 1ZICA 2RONA 3C7CB 3HKBB 1Y1SA 2MHCA 1LDMA 4NDNE 2NN3C 3D7SA 4ID3A 1NQVA 4N5DA 4ARSA 5I7VA 3PQEA 1HOXA 1N5LA 1RVV1 5CA0A 4WSOA 5HKAA 3ANLA 4CI0B 1QC5B 1HT2E 3NT4A 2Q5EA 3WLQA 2YZ2A 5IDXA 4MXDA 8AT1A 3EZ9A 4A5OA 1L7BA 1H6AA 3IQXA 3LT2A 5IVIA 4WMLA 2KBFA 3TLXA 2PAAA 2VKTA 1DRVA 2L18A 3K8QA 2MR6A 3F96A 4G0PA 1IDOA 4TQGA 1PE0A 2D0IA 1SPXA 2HJSA 3NKFA 3T1QA 3V7YA 4I5EA 5GADl 3RG8A 1KEWA 2IYLD 3QEBZ 3ABRB 4N41A 2G08A 3H87A 1KI1A 4RACA 1SRQA 3WKDA 2VSOA 1PI3A 4ABTA 5CXSA 2IHNA 1TT5B 4DV0B 4BQFA 4JLPA 3DE1X 1LQUA 3S0JA 4LZLA 1ZEJA 2CLOB 2ZPTX 1V8DA 1Z12A 4QSHA 3MFYA 5FWXA 3O26A 4MQUA 2OYCA 1E2UA 1YA4A 1T8RA 1W4BA 1GR1A 2R5WA 2RFLA 3DO8A 1FYEA 4IY1A 3UAYA 2ST1A 3F3SA 4Q9NA 4CKWB 2BGJA 4NS4A 4N3NA 2OPHA 3BL6A 1M2HA 2QXUA 3T9FA 5ADHA 3L4EA 4JNCA 2X2PA 4HNGA 1WY5A 4ZVVA 3V3TA 2W2KA 4JJZA 1R6TA 1EQUA 3I30X 4H0FA 4KXUA 1Z6YA 3GFRA 1YL5A 3FVVA 5HE9A 2HV8A 2FRVA 1J49A 1H65A 1NG1A 4WW0A 3X1XA 1ZAYA 2EG5A 2XUKA 4LWOA 1XBTA 4K46A 4YV7A 2VTEA 3MELA 5IBRA 1Z6QA 3K70D 2CJPA 3F78A 2GCIA 3LNTA 3NC0C 1AIPA 2FPKA 4ESHA 4QJ3A 4FYVA 3IURA 4NYIQ 3WIEA 1MOSA 7AT1A 3FOWA 5ALIA 3NHRA 3WFJA 3WNDA 4JEHA 3TMYA 1NT2A 4DADA 1O6ZA 5IJ0A 2FR8C 4KWTA 4YXWA 1S3FA 3I4LA 2IITA 2C99A 1H2HA 4X3PA 3WTBA 7ADHA 3OETA 2HA2A 4ER7A 1K3TA 3INYA 1OASA 4CJXA 4TLDA 1A4XA 3DMTC 3AILA 1PK7A 4R2LA 2FLWA 3SLGA 2BONA 1CJCA 2HK7A 1ISPA 2QE6A 5YASA 4X7MA 2CHGA 3O91A 5LM3A 4AZSA 2AJBA 5AKZA 1NW7A 3LBIA 2D2IA 2INGX 4UOEA 4PZCA 4B9AA 5JD4A 1TTHA 5DXAA 1JA9A 3IFSA 4IKPA 4JBNA 1U1GA 2JHGA 2NT4A 4HAZA 1R0KA 1FUIA 5HK9A 2VRWA 1MAAA 2Q5FA 4JDUA 1P1IA 1QHSA 2GD6A 4PIPA 1W46A 1Q22A 4LI3X 5EIBC 4C7JA 1CUHA 1EGQA 1Z18A 1ZQ1A 2QXTA 1J2YA 1IBCA 3LOUA 4TV8B 4ALJA 4YIKA 4RPKA 1HWYA 4LQCA 3WC4A 1SG6A 3QNWA 2J0UA 1FP6A 1ML4A 4M3NA 4XH9B 5EWLA 3PUWA 1N8TA 3GGOA 4UTOA 5B53A 5KAPA 3QA9A 1SKUA 3JU3A 3W77A 7YASA 3U7FB 4Q3CA 2GCGA 2Q45A 3L4BC 1BDBA 2DH6A 2YHSA 2VPXA 3PXCX 2FSVA 3BXGA 3DT6A 3I58A 4UXIA 2AV6A 4D8YA 1CS0B 1M67A 3PDHA 4Y6OA 3WKBA 4KDFA 4XYGA 3KU1A 4RHEA 1X7WA 1Y7HA 4EPYA 3D43A 1B3BA 1FVHA 1W19A 4HWPA 3BIWA 2I7XA 2OGZA 3LK6A 4V0SA 2I4RA 4QBIA 1N5JA 3DG9A 5A5GA 3MD0A 4CMCA 3ADOA 3HZOA 1U2GA 4IG9A 4NH0A 4GQAA 2YY7A 5K3CA 2C84A 4AMUA 4E5NA 1W36B 3DVQX 1J0DA 1XN1A 4WLUA 1YCGA 2NU8A 5AKIA 3FJYA 3FPLA 5KYVA 1DKLA 1T1RA 3C3XA 3AR7A 2F90A 5ALRA 5LMUB 3HYLA 2V65A 1GPNA 2E4YA 2CKDA 4GMFA 2GKOA 1JDNA 2IYWA 2RHOA 2OHOA 1HDOA 2BD0A 1ENZA 1ZXLA 2ZBGA 2D5BA 2EQ5A 3CEJA 3QQ5A 4IP0A 1YR2A 4UFOA 4ZZ1A 4M1QA 3HKCA 4DXAA 1QRSA 1UAAA 1F14A 2BGKA 4JJGA 1W52X 4JT9A 4S0XA 4UFNA 5DW3A 1UAGA 4FW8A 3X1YA 1E7SA 3TCXB 5SZHB 1XNQB 2O8NA 2QGZA 1KEKA 4F5DA 1WBJB 3RFCA 1WOMA 5ALVA 3WWOA 3IPCA 3KB6A 3OX4A 4C7OA 3EZGA 3V5NA 5T3YA 3J7AC 5DN6A 4MYUA 2VIIA 3DCIA 3L0DA 1HM5A 4L5JA 1R0XA 3IQFA 3ZW7A 5JAMA 1DS6A 3DLCA 3JTMA 3PR2B 4RBNA 3T7CA 3NVKI 3VJRA 3I1JA 5KTSA 4G09A 2VNKA 1Z16A 2GAFA 3IPYA 3L1HA 2A30A 1RQ7A 3MS4A 4MUXA 4RTKA 2BDUA 2Q5JA 1W75A 4J0HA 3TDNA 1I2AA 4ZDKA 3BGWA 5THKA 2CDAA 2PQ0A 1UKZA 1GY8A 5D00A 3AESA 3M1YA 2QLLA 3OLYA 3S55A 1AUVA 5LYJB 3PEWA 4KR7A 1RMYA 3SKVA 3HKDA 4IHJB 4JLNA 1R6UA 1MX1A 1Q0ZA 3KKOA 3MLAA 3ZHRA 1HRDA 4FYIA 3EFHA 5FFNA 3RC9A 4NZMA 2PVSA 4H17A 4Z99A 1V37A 2O4UX 3JV7A 1UT8A 2V0NA 4RENA 3LP6A 3SSMA 1XMPA 4ACAA 1UAYA 2NVOA 1P0PA 3KJGA 4D8WA 4EY4A 5D5PA 3VC3A 2RI1A 2O1SA 1GYQA 2BFOA 2ZWIA 3L82B 5T4BA 4ED9A 3MTGA 1D0SA 2XCOA 3CR7A 2VF5X 3WQBA 1WJGA 1IM8A 2DLNA 5ESRA 3G68A 1N2IA 2C83A 2Q4TA 3CUWA 4JK3A 2AZ4A 4G07A 4DPKA 3FE2A 3TRDA 4P38A 3EW9A 1S2LA 2D54A 4RTNA 3CR3C 4YAJA 5B30A 2X40A 1ADBA 5EE1A 4D41A 4TYPA 3DNMA 5AW1A 5IM4F 4JLDA 2XHZA 4IWNA 3L05A 3WBKA 1N92A 1R1DA 3RT1A 1GNVA 5E2IA 4IIJB 4IH4A 1DGQA 2CMKA 4EB0A 2J85A 2J3JA 1E99A 2ZUBA 3UJ9A 1DQZA 2QU7A 1C7ZA 2I6SA 4PAQA 1B8VA 5JFTA 4EUHA 3D8RA 4NPAA 4HYYA 2TMKA 2C7RA 4JDPA 2I4MA 3BXEA 1LVGA 3LKVA 4DYDA 1DL5A 1NQWA 2JI9A 2J67A 5G0TA 5JNTA 1W48A 3TS1A 3VDQA 5EHIA 3ZVLA 5MFZA 3HCRA 3USES 5AW0A 1ZUNB 1AN0A 2I3DA 4IKEA 1RRVA 4EA7A 5IN4A 1BRTA 2FWJA 1WZIA 5EFZA 2X0EA 4Z7NB 2JA1A 5C1DA 3VPBA 1GTRA 1Q17A 1R50A 4DWOA 5A04A 3AXSA 3W90A 4LC9A 3ZCRA 1F8YA 3MUFA 4WOJA 1EUZA 1DAHA 4NEGA 3FFBA 1GUAA 1LD3A 4P5EA 4DILA 3SVTA 5HIJA 2GN8A 1G5TA 1U4OA 1XPOA 3A2KA 4HB2A 2IPAB 4PHCA 2ONJA 2EQBA 1FB5A 2G9RA 1XEXA 3LPNA 1T9GS 4TYWA 5JXJA 5EMJA 3OCUA 4JIMA 5C8XA 2YKGA 2D5LA 5BSFA 3A9VA 3KL2A 1XAIA 5J63A 5I7FA 3ZHZA 1L3IA 3ET5A 4L8LA 4EMUA 5ES4B 5J3JA 5FBKA 2HRQA 3TSYA 1XZKA 1WV0A 3AL3A 3BRQA 4DNFA 3TZKA 5DM60 2A5YB 4MPPA 3WGJA 3E7WA 3N2YA 3A6DA 4YR9A 5CA1F 2ZFUA 5CDFE 2PYZA 3PYXA 4DJAA 2P0AA 5EPEA 3AR2A 2EBUA 1EJ6A 2QX6A 3UJPA 3WG9A 1RADA 4NG5A 5CCEA 3WYEA 1THGA 3H1BA 4LJ8A 4GECA 3R9KA 3KS9A 1UP4A 2F3RA 2YH2A 1E1KA 1OU0A 3WGOA 4ATNA 3H75A 2A9PA 2PGXA 5ALSA 5JCOA 1VE5A 3GDFA 1YDEA 4YRSA 4MK4A 2AW3A 2A5GA 3ZR4B 4UFPA 1C3JA 1QO9A 1T1GA 2FEOA 3H5LA 2Y6UA 1BH2A 3HU5A 3VQTA 3RF6A 3QG5A 4EGCB 2A7XA 3R7WB 2Q99A 2OD7A 3K1JA 4HVTA 4Y7DA 5ADWA 3UHAA 3F46A 2FUCA 4B34A 1CQPA 2IH2A 4EUNA 3ENVA 1UXHA 3PFCA 3NHSA 4GI7A 1F4VA 5IARA 3DB2A 3D6MA 2WF7A 1CULC 4A5SA 1G98A 1GZ5A 2TSYB 4AS2A 4H3KB 1NE2A 4V0LA 4AICA 3QPUA 1H22A 2R7MA 5JG7A 3SXUA 4ESEA 4TYYA 3OZ7A 3KB1A 3KSUA 1KS9A 5G0SA 4TLEA 5JSQA 3U4DA 2R8RA 5G1PA 2X86A 4RK7A 2BGLA 2FWIA 2XY4A 4GZ5A 1KYWA 1E3IA 2ZCUA 2TECE 2M6KA 2PQ2A 4TQ9A 2WJAA 4KVAA 3TE7A 3AJEA 2IPLA 1ZMTA 1EESA 1YHYA 4B6JA 1YB5A 1Z73A 5J5AA 3FFTA 2Y2UA 4NQRA 3ONVA 4R1PA 4TWBA 3C7KA 1UZUA 4MVYA 1CE8A 3ZBPA 3W8EA 3A9RA 4P98A 3VSAA 5LQRA 8GPBA 5JSZB 3FJOA 1YMVA 4GP6A 4LPKA 4WESB 5ARDA 1F5NA 2VOEA 5AR1A 3EBOA 4OGLA 3H4TA 3HVIA 1UIMA 2QVYX 3NOVA 3WB1A 1R9JA 3D2LA 3W0LB 4CKBB 4LCBA 2G36A 4YUYA 5LCXA 1E9CA 4KKVA 3M4JA 4KR3A 1KJ8A 4OKSA 3GDWA 3OT1B 5MN4A 4YRAA 1PV2A 3IAEA 3KSZO 1GGNA 2VN8A 4M21A 2HM7A 4AB1A 4RJTA 4H1HA 3I23A 3I9NA 1RAEA 1YU6A 3I8XA 5FBWB 2JJ8A 5HTOA 4ND5A 1IPHA 2H1LA 2ZI5A 1KMHB 1AZSC 4DV3B 3KEFA 2J6CA 5JXIA 5AUQA 3B1YA 3KSRA 1ZK1A 3DWGA 1TQDA 3HP4A 4LRUA 2W2NA 3AGQA 1NP6A 3BX1A 3IPAA 5AJXA 3RC8A 1ODKA 4BLOA 1OZFA 1PNOA 2NXJA 1KORA 4YJHB 1KH1A 2AUMA 3DL7A 3PHBE 1NXWA 1SCDA 1W2GA 3IKJA 4PHTA 4GSYA 4UVHA 3AFNA 4XIJA 5AKYA 1N3BA 2XNJA 3DE3X 1YVRA 5FA6A 4FUQA 1YGYA 1DC5A 2FSPA 4J3JA 4NYJQ 5LBIA 4RSHA 3WRYC 2GBIA 3F2IA 4ASUA 3LYUA 4CLRB 4PRYA 3HR7A 2PM8A 1Q19A 1GXSB 2CHQA 2L82A 4EJ0A 3G2MA 4EVIA 9ATCA 2QL5A 4HPJB 5EYPA 4MQLA 1D1TA 1FJ2A 5EE5B 5EWJB 3LTEA 3W6NA 1OW3B 4NJMA 1TT7A 4XGRA 5CUQA 2B3DA 4IF6A 1N2JA 3F67A 2Y1OA 5JJ5A 3PNVA 3QU9A 2OB2A 5EQTA 3VYTB 4CHGA 3OEED 4DG8A 4ZDWA 5IBCA 4YUVA 1XXLA 4PO1A 5FOTA 2JBHA 3LC1O 3ZWOA 2DBZA 3SQOA 3SF8B 1Q0PA 2QMOA 3T1TA 5A3VA 3MCZA 2HWYA 3DMHA 3IOBA 3I0NA 4OXKA 3VKWA 5B6JA 1ZD4A 2H4JA 2OYSA 5ALMA 2XVMA 2YHBA 3V4ZA 1UM8A 4B2YA 4CQJA 4FX5A 3RFXA 2EP8A 3E22B 3H2JA 3AFHA 3MRTA 2QVLA 3KELA 4PEVA 1H3NA 4RU1A 3WGGA 1WZUA 3OX2A 4G4JA 4HC4A 4EG1A 4ENSA 4PO8A 4QGFA 1QORA 1JTVA 3T3IA 4A0GA 5BNIA 3JASA 1GGMA 1ZGHA 3ST7A 3LSYA 2FR0A 3QXGA 3JX9A 2BSAA 2WD8A 1NBMA 3V33A 4MNTA 1QE5A 2O2YA 3PHGA 2VBGA 3T7JA 5GM1A 3VGJA 3ICQB 3CVVA 2AXNA 4I5GA 3VX4A 4PF1A 1NMEA 4QWMA 5IT4A 2ZB3A 1KVSA 2XF8A 3KQKA 1IQPA 4NZNA 2EGUA 2R44A 1X14A 2R87A 4JR1A 4EB8A 2DVMA 4YONB 4H31A 2J3HA 1LFAA 2O0KA 2DG2A 4Q1BA 4BRWA 4JH0A 2FXIA 1VRVA 3WLKX 1NY6A 4HK4A 1OH6A 1R7RA 1U8FO 2ZTLA 1RM0A 1MT0A 4ND8A 3TZHA 2QJWA 3GLIB 3ER9A 2Y8EA 3R3SA 1F1JA 2WWVD 3UIEA 3K70C 3REQA 1B2RA 1HH4A 4HXYA 5I48A 5K0TA 2BHNA 2O0JA 4RQTA 1QFYA 1F60A 3ZDQA 1KFJB 4K0RA 4OJMX 5K2MA 2QUJA 4LBVA 1KO1A 4EHDA 5ARCA 1U2DA 3T4EA 2ZBQA 2GN0A 5EY5B 4C3OB 3AF6A 3AEKB 1ZI9A 3EWNA 4OHPA 1KXZA 4Q3OA 2ZIUB 3V1NA 1JFSA 2A9FA 1ZG3A 2W48A 4BJ6A 4N3GA 1DV2A 4GSLA 4LW8A 4Q6WA 1JFFA 1TADA 1ULBA 3IDAA 1KE1A 1MQ9A 4Y2RA 4BO6A 1RRFA 5E8RA 4URWR 2R68A 4P2GA 1VTKA 3CLVA 1RXIA 3PFWO 4QATA 1DLJA 3O7MA 5D3KA 5LZ8A 3V8EA 3LSTA 4X6UA 3T4PA 4P3PA 4BLSA 2OP1A 1WXWA 3RUIA 4POAA 4AYXA 2RGWA 4GP9A 3QEMA 3DF9A 4Q9HA 1TM1E 4JYMA 3VISA 1YR8A 3NTOA 5JADA 1QO7A 3PNQA 4QOIA 4N5HX 1NVFA 1MENA 1X9IA 1Z68A 3KP1A 2C4WA 1CZOA 2WD7B 4ACBA 3FPHA 2A6PA 1BNCA 1WHSA 4N3CA 2JBAA 4LQDA 4MW6A 3HJRA 3IXQA 5D84A 3V42A 2FJPA 4TTSA 4B7UA 3D31A 3GAFA 2G4LA 1BE0A 1XELA 1Y6RA 3DVAB 2HRZA 3KVOA 1UT6A 3HJCA 2QRJA 3OZDA 1J1UA 1KRHA 2F1RA 3C1OA 4ND2A 4WN3A 3A8TA 3AEQB 4C30A 3ZVRA 4CMEA 1CQJA 4QPJC 4F4DA 1IK4A 1D2AA 1UK9A 1UZAA 4Z4EA 3V4LA 2I4IA 2W90A 1SVSA 1N2SA 2QI9C 1CJMA 3JR3A 3LBHA 2C96A 3Q1KA 4Y2HA 5CA1B 5KNDD 1P8AA 1GZHB 4OQXA 2H59A 2HT6A 4KGVA 4D4LA 4L76A 1Z37A 1QP0A 4M0MA 1RI3A 2HHLA 1SB9A 2WPDD 2XYPA 4WLVA 1XRLA 3AVOA 5AVSA 1RRPA 1U6IA 4Z4FA 2JAUA 4Z86A 1EGVB 1K5GA 3PPYA 2ZWAA 1GV0A 3VYRB 4A2PA 5C5DA 2FFAA 2VTBB 4NBVA 4OAOA 5JJCA 1WB6A 4XM0A 3MGCA 2AMLA 3DTVD 4G01B 3I01A 3B2QA 3IEKA 1FFXA 3FTCA 4BKPA 1ZZEA 4G4SP 3QK7A 3UAWA 3WHLA 2FP4A 2YIVX 3LA6A 3GLFB 5DNUA 1Z3CA 3X1DA 2BMAA 2OY0A 1JHVA 4N5NA 4YAGA 3THSA 1S0UA 3PC2A 2UZ3A 4FYMA 3TKLA 5LXTF 1AA9A 1QGDA 4KIGA 4E5KA 2GAJA 4OQPA 4E5SA 3HXTA 2Q8PA 2HF7A 4IHQA 1R5OA 2NO9A 4HGQA 2XMGA 1W34A 3O4RA 4A8JA 2X8AA 3OFJA 3AJAA 5JVDA 5JH7F 2ACKA 2QTFA 2VP9A 3HUEA 3DWEX 2J9FA 2H65A 5JDIC 3RHFA 2RHCA 5KHLB 1EFVA 1ZOIA 2X7JA 5JASA 3BTUA 4W82A 4MV3A 1JVSA 3C8DA 1FVXA 2XD9A 4Y1FA 1F06A 2FPPB 4WZAA 5CBPA 4HB3A 3P32A 1C1DA 3G9UA 3RSCA 2JH9A 4EF4A 4OHVA 4FFBB 1LXCA 2NT3A 3T3HA 1DWUA 2J32A 5F23A 2QN1A 2QB5A 3S68A 1M0EA 2B1QA 3G3EA 3KL4A 2COUA 4YX9A 3PQFA 3NP9A 4LXXA 4URVR 5JAIA 4DA0A 3PNBA 1YASA 3BXZA 3R4CA 3MGBA 2WB2A 1SKBA 5TQVA 4DV6B 3AOEC 1PJAA 4DVJA 2W6JD 1G21A 2B3TA 2I3BA