4TQ9A

Crystal structure of a gdp-bound g12v oncogenic mutant of human gtpase kras
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
169
structure length
169
Chain Sequence
GMTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase KRas
publication title Biochemical and Structural Analysis of Common Cancer-Associated KRAS Mutations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 59
structure length 169
sequence length 169
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tq9A00
5KNBA 1FOEB 3GLHA 4TYYA 3HR8A 4Q4JB 3LVRE 4UNNA 4EQ6A 4TZ0A 1E98A 4PO1A 5JJKA 1LF0A 3K0AA 4GOKA 1UEIA 3FYHA 1SVOA 3T1TA 4NZYA 3TAHA 3KQLA 4LRWA 421PA 3WRYC 5KUTA 2ZR7A 2B6HA 1NY5A 2VP9A 2ZRKA 1R10A 1KJZA 2VA8A 4MH0R 4DCTA 5JECA 2QI9C 2GNOA 3V4RA 2HCJB 4UJ5A 4D4MA 2Q6TA 3CX8A 1XD8A 4M53A 1GKIA 4PTLA 3I62A 3CRRA 2WOJA 3T35A 1XEWY 3FHOA 4TQAA 1G8GA 4YQFA 1HQYE 3ASZA 1ESMA 3KFXA 2XNDD 5JS8A 5JWOA 2GAAA 3W5IA 2QSZA 4KFTA 4ZO4A 5IF9A 4I1VA 2GAOA 5FTMA 2IEZA 3IKJA 2HJGA 5KSOA 3I92A 5JFGA 4OI0A 1IJEA 2VHJA 2IS4A 1JALA 3U6BA 3QOFA 5FBWB 3BJIC 5FTJA 3NIBA 4OK3A 4KLNA 3ZH9B 1DEKA 3MRSA 4B2LA 3VHLB 5KNDA 4YDSA 3AUXA 3Q7PA 4OQMA 1UKZA 3GFOA 5JHHB 2YZ2A 2O8EB 1T3HA 1XEXB 1SKYB 3U3KA 4B35A 2ORIA 2HT1A 1ESNA 5HCNA 1TNDA 4G0NA 4AKGA 1LNZA 4BFYA 5KHOC 2OBLA 3FFBA 2AKAB 5EXTA 2REXB 2RHDA 1U2RA 2P5TB 1IN4A 2QTFA 3P20A 3IIMA 4Q4AB 1NBMA 1WRBA 4Q1FA 2ZE6A 3P1JA 4BFWA 3THXB 1Z2AA 2C95A 3X2SA 2BJWA 3ICQB 2WZQA 1E9BA 3KXIA 2ATXA 1G3QA 1CR0A 4CVNA 2HUPA 2GXQA 1TPZA 1II8A 2MSEB 3CH4B 3OIWA 4M1TA 1CJKC 4RFSB 1OH7A 3BOSA 3LY5A 4NONA 1B0UA 1EX6A 4UNSA 1II0A 721PA 1Z6YA 4TL6A 4M4SA 5KDLA 3A1SA 1DO2A 3WHLA 2QTHA 3TLXA 1GNQA 4WXPA 2JLWA 3FHTA 4LGMA 3EIEA 4C9BA 1S1CA 1E9FA 1DELA 2WSMA 5EE0A 4OHZA 1CU1A 4R98A 5TARA 1CJMA 1E69A 1L8QA 5DI3B 1NMXA 2VSXA 4TT3D 5EJEA 1VHTA 2RGCA 3ZS8A 4QFMA 2OE2A 2V1XA 2VF7A 1OXVA 1RYFA 4AG5A 4L15A 3KB1A 2BMFA 3FWYA 3ZIAD 3U44A 2GTPA 1W46A 3D6TB 4B2IA 4DC9A 1CRQA 2AK3A 3L0PA 5C46F 621PA 3H4MA 1CR2A 2ZREA 5LB2A 3ZYCA 4ARZA 1G8PA 4Z1MD 2YOGA 4W5WA 1XDBA 2E87A 5TMPA 2ZI3A 4V0MA 1OYYA 1KGDA 2LCFA 3ZDQA 2O0HA 1HUQA 1NF3A 3HDTA 1F3OA 1A1VA 3NDBB 3P4YA 1L7VC 2QMUA 4JLKA 3SDZA 3K53A 3U2QA 1PJRA 4JL8A 1ZD9A 2GK6A 2WWWA 2ZRHA 4BZPA 1W0KA 2ZJZA 2ZM5A 3IDQA 4BFUA 3QPVA 2MSDB 3CWZA 4A1FA 4IOJA 2ZYTX 2NIPA 4DVGA 2ZS7A 1KY3A 4AKIA 2XTNA 4PAOA 2NG1A 3IPXA 3IQXA 1CR1A 3QJYA 4MRNA 4YC7A 4L16A 3U4QB 3LX5A 1Z0DA 3THYB 3UG6A 1FFHA 2NGRA 3DM9B 1W44A 3AF1A 1Z63A 2A3RA 3Q9LA 4E5UA 4O3MA 1Y3AA 2WPDA 1XFAA 4JBYA 3UG7A 4B47A 1S4QA 4JBXA 5HCIA 3QKSB 1VKJA 3HPRA 3HR7A 3QF4B 4EPVA 1UM8A 5HR5A 2HYDA 2A5FA 3IBYA 3L0IB 4KYUA 4C2UA 1P9NA 3LA6A 1BOFA 1AGRA 3F5FA 3UWKA 4HUQA 1D6JA 1GZSA 3CNLA 1LVGA 1Q1BA 3KKOA 4P4TA 4PSKA 5LB4A 2YOFA 3FKSD 4ZDIA 3QXCA 1BKDR 4Q4JA 3TMKA 3RS5A 3DMNA 3TQFA 2O8FB 2B7CA 1NI3A 1TF7A 5AJYA 4E09A 1XTKA 3AVWA 1SXJE 3DO6A 4FD2A 4LX0A 4OJKA 1U98A 1TU3A 1XCMA 3HPQA 4WAUA 1GTVA 4X8OA 4Z8YA 3U7GA 2HV8A 2G0NA 5J4LA 3QE0A 1SZPA 1E1RD 2QUZA 3UK6A 3KKQA 1W5TA 3LVQE 2Q9CA 2GXSA 3MSXA 2JIZA 2IYUA 4HAYA 1OIWA 3U60B 4U7DA 3D3QA 1JB1A 1UAAA 2HLDD 2KWIA 2XNSA 4WZAE 5DN6A 5LBIA 3LXRA 1D9XA 4ZDKA 4B34A 2IYYA 2PT5A 5IHPA 1S3SA 1X3SA 4BRUA 3KQUA 4JLJA 2QT1A 3VR3A 3RLFA 4UXHA 4OHXA 5FBVB 2A5GA 1KZ7B 2G6BA 4OI1A 4B3DA 1UADA 4FMBB 4B71A 1MKYA 1GL6A 5KDOA 1P62B 1RVDA 2ZTSA 5FPHA 5TVKA 1FZQA 2GJKA 1E2KA 1NSTA 2AK2A 5ANRB 3L43A 4LC0A 2CE7A 1E4VA 4GP6A 3CF6R 2PJZA 2GK7A 4PPQA 4P3YA 4A0FA 4A0RA 1ZM2A 3GEIA 3KTAB 2JJ2A 2RGBA 3LAWA 3NBXX 3ADCA 1P3JA 1X1RA 5E3HA 2IF0A 2DR3A 2O52A 1CF4A 1KOFA 5EZ6B 4K46A 3QBTA 2O8EA 5JEEA 2PBRA 1YR9A 1OB5A 2WBLC 2EYUA 2O8BB 3RANA 1PUIA 1XMJA 4DIEA 5C2JB 3WYFA 4C0KA 4LYJA 4IVPA 3HU3A 5CK5A 3SEAA 3A4MA 2QN6A 4US2R 2OXRA 1SXJD 5J4YA 3GLGE 2F43B 3SU8A 3MWYW 4QJ3A 2J7KA 5JWHA 1AS2A 3JZMA 2IYRA 4RFSA 4US1R 5F98A 5FTKA 4GDFA 4CGZA 2BVNA 4CEJA 4WBSA 2PZGA 3X1YA 5DISB 3O8BA 3NHAA 5P21A 2WMNB 3C5HA 4D80A 2XNDA 1X8LA 1IN5A 2ZI4A 3I32A 4GL2A 1XP8A 3WNCA 4QGAA 1Z0AA 2OZEA 4U02A 1SVKA 4MGYR 4LPSA 4M1SA 5DI3A 3CRW1 2PMKA 5FUWA 1VTKA 2WSSA 1TL7C 1K5GA 1R8QA 3N5CA 2AD1A 4GSYA 8OHMA 3LQQA 4Y0VA 2WJGA 1MH1A 3WP1B 4A92A 2CCJA 1E2QA 2CNWD 2GWHA 3DKPA 3OEHD 1E2IA 3V9PA 3HYTA 3GLFE 2YC2C 4Q7JB 1N5KA 2X2FA 1CJVC 3WRXC 2OBNA 4LJ5A 3X1XA 1G6OA 5KYKA 4PHHA 1U9IC 1ZD1A 1ZCAA 1CULC 2WJJA 3Q5DA 3GJ3A 2QQEA 3IEUA 3K9NA 1GRRA 4P4SB 3QXXA 1W4BA 1ZU4A 3QY0A 1QHIA 3R7WB 3MFYA 3MJHA 3IBGA 3V4FA 5M04A 2AR7A 1WBBA 1PLJA 1VG1A 4DWJA 4C7OA 1VECA 3QBVA 3U4QA 1UBCA 3B1XA 1W36B 3OZXA 1DG1G 1QG4A 4DCVA 3KDSE 1HV8A 3B60A 4Q9JA 5KOYA 3HU2A 4DLTA 4K81B 2F55A 2IYLD 1MO4A 2FEOA 1QHYA 4IDQA 2D2FA 4NU0A 1M7BA 1GG2A 4F4JA 1RJ9B 3AP2A 3EPHA 3QKSA 3R9XA 2XXAB 4AC9A 2ZQ5A 1Z5ZA 1GRQA 2V6JA 5L3VA 1H65A 1IOZA 2X8AA 3GCGA 1JAHA 2XJ9A 2BM1A 2PZEA 5DE3A 2V1UA 5AJXA 1HTWA 1XCPA 5E7IA 1IXZA 1CIPA 5J47A 2O8DB 2A5DA 1EG7A 2EVWX 4ZCLA 1XJ0A 2R6DA 2FEMA 2O8FA 1WQ1R 2ANCA 2ODBA 2OT3B 2D4HA 1VHLA 1QHGA 4CZ2A 5IT5A 3ZZTA 4M1WA 2YNMA 4G5GA 2V8OA 5FFMA 1AZTA 2ZETA 4JLBA 4RD1A 2XZOA 3IO5A 2HYIC 4JKIA 1EFHA 2P5SA 4FW9A 4B3BA 4M2LA 1HE8B 5CITA 4BPBA 4AWXA 4PQFA 1SVSA 4TMXA 2IF2A 2IXFA 4LV8B 4PC1A 2OFXA 2R62A 4IHQA 2A2ZA 5H68A 4C4PA 2YOHA 2Y8EA 1S9HA 3KB2A 5A0FA 1G3UA 4XTRA 2ZJAA 1SVMA 2HF9A 3KJHA 5FOUA 4IDOA 1G41A 3L2OB 4G5OA 3SI7A 3QVVA 2C99A 2VP2A 4DDTA 4DLXA 3I73A 1CXZA 1XD2B 5KSYA 3C14C 1ZM4A 1TTTA 1ZM9A 4X8HA 4Q7LA 2PLRA 1EFRD 2NO7A 5G53C 4EPXA 2ERYA 3EG5A 4WIAA 5JBQA 4I4LA 4MUBA 5LD2B 2FPKA 1E79A 1US8B 4LJ9A 1P72A 1ZJ6A 3VR4A 2RCNA 1NL3A 3K09C 3BGWA 4EJSB 2RH5A 2V54A 4LJAA 2B8TA 2QMOA 4PC3A 2ZI9A 2VO1A 5ELXA 4D25A 2QAGB 1BYIA 3FKSA 4A4DA 4A2PA 5BN4A 2CL6X 3GPLA 1OPXA 1AZSC 4IOLA 4MKIA 2G0TA 2FN4A 2IC5A 3GLFB 2IYZA 1Z29A 3K09A 4I81A 4OQXA 3T34A 4GMDA 3W34A 4EFNA 2R65A 2VH5R 1ANKA 2F43A 5FL7D 1G8YA 4N0DA 3GLHB 2FZLA 2IW3A 5E4FA 2R6GA 3AUYA 3E2IA 4N0EA 1GAJA 4PHTA 1R8SA 2YJTD 2W2VA 2KB0A 4JLAA 1GKYA 5E7MA 4JLVA 2ZRCA 1V5WA 3A8TA 4DLVA 4KVGA 1OT3A 3IIKA 2QY9A 1ELOA 1NG1A 1ZCBA 4QOSA 5AUOB 2X77A 3RYTC 3FOZA 2IS2A 1E4YA 4Q03A 2IHYA 1NN5A 3GJ6A 3IEVA 1DS6A 1G3MA 3DPUA 4HDQB 3AF3A 2FZ4A 1FTSA 3K0FB 1KY2A 1JJ7A 2TMKA 2Z4RA 3AB3A 1R0ZA 2IXEA 2GILA 1R5BA 2A9KA 4QHYA 3ETLA 1VG8A 4NHOA 2WKRA 3PFIA 4M1MA 2RGEA 2JASA 4B3XA 4H9GA 4PX9A 3IILA 4URUR 1NKSA 4O0MA 1T8UA 5JJLA 5FI1B 1N0WA 1N5JA 4RY2A 2G83A 2GESA 1KSJA 2C78A 2WWXA 2JLYA 1S0UA 1A2BA 2ODEA 3QPUA 3VMFA 3ZQ6A 3G0HA 4Q1DA 4JLPA 2XAUA 1Q22A 2BBSA 4MGKR 2CL0X 2D7CA 3KXLA 1J90A 1SXJC 4ZV4A 2BDTA 4W7SA 5BW8A 2ZRDA 1BS1A 1GVNB 3K0CC 1KDRA 5CJPA 1XJCA 5JCZA 4FI3C 3WBJA 4MKGA 1OHHA 1KTVA 2OEPA 2WJVA 1OW3B 1T91A 2WIAA 1GIAA 5FTNA 1W7AA 4GI7A 4P4SA 1NLYA 1W2GA 2D3WA 2CHGA 2PT7A 1SXJA 1G4UR 1HH4A 4IOMA 1OXXK 1D8TA 4JVLA 1XJQA 3SFZA 5A5GA 5JI2E 4GBMA 4P0TA 3PG5A 3BFKA 4JYBA 3W5JA 4LV6A 4JS0A 4CEIB 4TMVA 3EWSA 1XPUA 1WMSA 1E9RA 3KL4A 5B58C 1RJ9A 2OCAA 2J7PA 3PUYA 2XXAA 3TKLA 4O2LA 3L82B 4ZI2A 2ZSAA 4PHFA 2NPFA 3VX3A 4NP6A 5FOVA 3QG5A 1KSFX 1NVVR 1SVIA 4I99A 2LWIA 3BH0A 3U7EB 1OH6A 5BYKA 4TTPA 2GF0A 4MRPA 5JWRA 1RPZA 1DE0A 5G41A 1E99A 3Q3JB 1JEDA 1ZU5A 4EPRA 3X1DA 2CNWA 2V7QA 3OEHA 4KFSA 3B82A 3AH8A 4L9WA 1Z0FA 5CLQA 3B1YA 4EAQA 3OE7A 3TUJC 2Q9BA 2RGDA 3B8HA 2YINC 4KHZA 3U7FB 4ABYA 4B3GA 1E6CA 4MRSA 3GJ8A 4JYCA 2XSZD 3U44B 2BJVA 2ODNA 1VG9B 3LFUA 2KI5A 1WXQA 3GJ4A 4Q9KA 1JI0A 4NYJR 1L2TA 3CNNA 1X8JA 1MRSA 1YVDA 4P33A 5IRCD 3RWMB 3W8RA 4QXAA 2QRZA 4URVR 1NRJB 2BBTA 5KPJA 2EU8A 1KKMA 1OH5A 3C41J 4JBWA 1M34E 3GP8A 1KO4A 3CZPA 2G9NA 3GLGA 3W90A 2F1JA 1E2FA 4HZIA 1S96A 2QPTA 2R8RA 4DLSA 1UEJA 2AXPA 4OI2A 2PH1A 1X8KA 4XIGS 1ZM3A 3BRWD 3R20A 1ZAKA 3RSOA 2XITA 2QROA 1II9A 3RS4A 1XD2A 3JZAA 2UZIR 2JJ8A 1Z0JA 4WOPA 4Q18A 3U3RA 3D7MA 1KSHA 4H1UA 1ETUA 4L5BA 4OI4A 4DLWA 5GJBA 1N5LA 1UKYA 3CX7A 1L4UA 2OILA 1VPLA 3QEOA 5GADl 4S35A 2QRNA 3AF2A 2ZVQX 3OEED 5G40A 4BLRA 2GJ9A 4EJSA 1H8ED 1Q21A 2PJRA 1GOTA 3IIJA 4HAZA 4BFTA 1J8YF 4DEXA 2QORA 3Q8XB 1NN3A 3PUXA 3T1VA 1RKBA 2QP4A 3TW4A 3AP1A 2W2TA 4NYJQ 4B3FX 3EA0A 4DCUA 3GLFA 1J2JA 2DBYA 3ONWA 1GRNA 1Z07A 4MITA 2J9RA 1CJUC 3R8FA 1YR8A 5L8VA 4OKSA 3W8NA 4V02A 3LBIA 4TTRA 2KJQA 5CIQA 1E2JA 1IHUA 1Z08A 1DAGA 2WAYA 3VR2A 3CZQA 3Q85A 2KSQA 2NPIA 3PXGA 5HPYB 1BMFD 5EZ5A 1CS4C 1FPMA 3N70A 2JLSA 4WZ6A 2G88A 6Q21A 4DB4A 2NO1A 4LYAA 1KO1A 4G5SA 3SYLA 2UZ3A 3AVUA 3K0FA 2GCOB 4WZBE 2DWQA 2FFAA 1Q57A 1Q3TA 1YJ5A 2GEVA 3IGFA 5EE9A 2DB3A 3NBYC 4HLUC 5HKKA 1U99A 1J70A 2ZSEA 4LWZA 2P65A 5FOSA 4IJMA 1LTQA 3QXSA 4LI0A 1G8FA 3QXHA 3B78A 4CRWB 2ZVPX 1EFRA 1XU4A 221PA 5B30A 3BORA 3CLVA 2DFKB 3FB4A 3HYRA 1QBKC 4YXWA 3W6NA 1G7SA 1FUKA 4HLUA 3BB4A 2HCBA 4DSNA 1P6XA 4AY2A 3IUYA 1KI6B 1ZC4A 2RMKA 3A4NA 3LV8A 4RZXA 5DIFA 4JJZA 3R9WA 3I8SA 1QVRA 3IHWA 4H1VA 5DGXA 4EFMA 4QNMA 2OO7A 4Q5IA 2ZJ8A 3I5YA 2XB2A 2J0QA 4B44A 4DJTA 1N6OA 2P67A 2CE2X 2YC4C 3P27A 3FE2A 4XVUA 2QG6A 3SJCA 5FL7A 4OHVA 5JSZA 3GLIE 4IRUB 4W5JA 1WE2A 4NE2A 4EDHA 4O2RA 3DL0A 3VR6A 1G5PA 2IS1A 1DO0A 4RFVA 4MYCA 4GP7A 4CEIA 2DY1A 2PLFA 1E2MA 1PZNA 5GJVC 1Z6AA 2GVDC 2V6IA 1TF2A 1VYVA 1JAIA 3B7GA 1YE8A 2FFHA 1T5LA 1ZNWA 1F2UA 2QBYA 4CEJB 3RC8A 3ADKA 2ZRGA 4UNPA 5EUMA 4MRRA 2HXYA 2OHFA 1FMJA 1CLUA 3LW7A 1Z47A 5AR1A 3T61A 1TUIA 4OJQA 1U8ZA 2WV9A 1X86B 3F0TA 4L4UA 4HZUB 2ZAMA 5HZKA 1UPTA 1M74A 1Y63A 3T1OA 1XXHB 3I1FA 3B9QA 1IBRA 2IUTA 2ZR9A 4PC7A 2C5LA 4A8JC 2REBA 3RS0A 4F92B 1GUAA 1G20E 1O87A 2C9CA 5G3YA 1IAQA 3AVOA 3LBNA 3K70D 1TMKA 4GPTA 4NYMR 2XTZA 2R44A 1XPRA 2J0SA 3ZD7A 4P32A 1E0AA 3BC1A 2ZU6A 5JS7A 3ASYA 2CHVA 4CYMA 1P61B 3B13B 1JNYA 2PEYA 2HJVA 3K9GA 1KK3A 1KJYA 4PANA 3DZ8A 1SULA 1MABA 2ZUCA 1P2SA 1KI1A 1RFLA 2GJSA 1EFCA 4DKXA 2PZFA 2MSCB 4Y0AA 3UIEA 4F93B 4D0LB 3FHCB 4DIDA 1ZW6A 4KSCA 2QP3A 3NDPA 4TL9A 4ESVA 1OFUX 4QJ5A 4KFRA 2D2EA 4FMCB 3LLMA 3TJZA 4TYQA 4C7OB 2V55B 1YU9A 5CYOA 1MO5A 2QMHA 4RJLA 1Z2CA 1UKVY 2AWNA 4DLUA 4KO8A 1U90A 3NC0C 1A7JA 1ZUNB 1W49A 2VP0A 2R6FA 1FTNA 1M1YE 1A5TA 2GRJA 2ZI7A 3P32A 4Q4HB 5CM8B 1RRCA 3TAUA 5JRZA 2FU5C 1E3MA 1P2TA 2EFCB 3PEUA 3FFAA 2ZITA 5L3SB 3KXKA 2XGJA 4NYMQ 2JCSA 3U3MA 3N2IA 2FSIA 5TXGA 2Z4SA 5AUQA 4B75A 3TRFA 1PVOA 4I1SA 2H92A 4HLCA 1N0VC 4WVFA 4BECA 4UNRA 3EPJA 4TYWA 1E9EA 4F7WA 1V43A 3I5XA 3PCRB 1ZIPA 2XSZA 3AVPA 4UJ3A 2W6JD 4G1UC 2NTYC 2PCLA 3QSYA 2WTUA 4IOKA 3O8RA 4QC2A 3K9HA 4G3XA 5EE1A 4YMVA 1XEFA 1EESA 1CBUA 2JLZA 1XB2A 2IYVA 2AD5A 2VHCA 2NZJA 4P31A 3BBPA 5HTKA 3EX7C 1F2TB 4GMXA 3CR8A 5UKDA 1G16A 1HT2E 4IEIA 2GCOA 1N6HA 1BO6A 3IPYA 2C77A 3M0EA 4QGGA 1D2NA 2PX0A 2ZRPA 1G5TA 4I1UA 3SNHA 3VR5A 1AA9A 3C7KA 4KSBA 1UBEA 2C8VA 4XSGA 4XWAA 4BLPA 1EFUA 1N6IA 1TQ6A 2XZPA 2N46A 1NP6A 3O8DA 3WXMA 2VQSA 4QL3A 3ZVRA 4TYNA 1KI7A 3MWKA 4I1OA 3UWOA 2C04A 4IEEA 4AK9A 4PPNA 1KNXA 3EWAA 3W3AA 2DPXA 4LBWA 4QGHA 2R9VA 1N6LA 1E0JA 2FWRA 2VSOA 3H1TA 3NG1A 4BEJA 1RC8A 3RC3A 1KI6A 1I4TD 1XTSA 1ZBDA 2OCBA 3OFND 4G5QA 1P2VA 3W6OA 2WJIA 5E7JA 5F9FA 1AM4D 4A82A 4C0SA 3P26A 1J7KA 1MT0A 2JAQA 5CDFE 1RRFA 2CK3A 1R6BX 1J8MF 2BEKA 3DDCA 3H0KA 1COWA 1DOAA 3U6KA 3AEZA 3SJBA 2OESA 4D4JA 1A2KC 3LLUA 2ZYVX 3TQCA 3TNFA 4M0LA 5FPTA 3WYGA 2EFGA 3AF4A 1ZD8A 4D6PA 1OKKD 4DLYA 4PQYA 2CXXA 1QHHB 1E94E 1KKLA 3E5HA 1QF9A 4YMSA 1E0SA 2EFHB 2NQ2C 3PUWA 4Q47A 2Q21A 2FSHA 4DZZA 4R2IA 2WM9B 4B33A 2YWHA 3EZ2A 1ZM7A 2F9LA 3Q7QA 4V0NA 5SZHB 1Z6XA 4B3CA 4EFLA 3MCAA 3TIFA 1NLZA 4HB2A 4HZUA 4A9AA 4BZQA 1C9KA 2JDID 4EKDA 2Q0HA 2FFBA 1XXHA 2IEYA 4G01B 1W4AA 4IDNA 4E22A 1P5ZB 2FSFA 5C18A 1G17A 4K8OA 4DHEA 5J4KA 5FTLA 4DEYA 4PFSA 5LDDC 4MDEA 1QDEA 4XVRA 3NH9A 4D26A 1G7RA 1H8HD 4MRVA 4NCHA 4TSFD 2ONJA 4JVMA 3AGQA 2NMVA 4M9SA 3VKGA 1JBKA 2A7QA 2H57A 2ZSDA 1UDWA 2N42A 2N1BA 2NO9A 3GJ0A 4A36A 3SC3A 2ANBA 4D4LA 4ZCIA 2BM0A 4HAXA 4B6EA 2JLUA 2GVZC 3F3YA 3JVVA 3SYKA 2B8WA 1G18A 4URWR 3THOA 1JR3E 1FNMA 1ZUIA 2ZRNA 3DZDA 3K1JA 3GD7A 3QQ5A 4JT2A 1NMZA 4A15A 4JIMA 3GMTA 1VYTA 4TQ9A 5FI0B 1TADA 5D3MB 1G1MA 4AYWA 2BEJA 1ODFA 2W6ID 4U00A 5J4VA 4C0BA 1SXJB 2CDNA 3EXAA 3Q72A 1AKEA 2OAQ1 4PO9A 4OK6A 1U9IA 1E9AA 2F3RA 3NXSA 2QPOA 1N6KA 3ZD6A 2RGNC 4Q4HA 3TUZC 2G1JA 1TUEA 3ZQJA 3QXJA 4CEHB 1T4GA 1W2HA 3H86A 5EXSA 3RS7A 5CB8A 5L3SA 3K70C 4KFUA 2ZPTX 3K8YA 3BAFA 1TQDA 2BCGY 3NTUA 2XZLA 1NVUQ 1XZPA 2RGNA 1CEEA 2QSYA 2ZRLA 3B6EA 3OIYA 3CIOA 4TT3A 4LJYA 4MKFA 3DHWC 2XX3A 4Q1CA 1RE0A 4BQSA 3WP0A 1TQ2A 1F6BA 3ZIAA 4M22A 4RD3A 3R8CA 1P2UA 1RZ3A 4B43A 4OYHA 2NZ8A 1T0HB 2ZRJA 1Q20A 3A6PC 2IT1A 2B21A 4Z1MA 4PO8A 4BRWA 2ZE8A 5DLQC 2ODWA 4ILEA 4D2IA 4NKRA 5J5CA 3VAAA 4LOAA 1JR6A 1R0YA 1RRPA 2J87A 4ZKDA 1GDDA 4W9MC 3ADBA 3CUEF 1F2TA 2ZAOA 1YZTA 4AYTA 5HZHA 2QNRA 4TLDA 1P4SA 2AFIE 2OFWA 1JR3D 4C0AC 4Q19A 2A5JA 2IA5A 1HY3A 5C4MA 2YKGA 4LSGA 4HI0E 2KBEA 2SHKA 3GLGB 3AGPA 2VIIA 1FQKA 4B32A 1F48A 2Z83A 5JI3E 3T15A 2D06A 1LB1B 5A4JA 3SN6A 4DRZA 3PENA 1G3RA 3NBZC 4LJ6A 5FR2A 2QEQA 3SZRA 1KZGB 4DLZA 5AJVB 4C2TA 4KXFB 3THWA 1M8PA 4LHXA 3TGPA 2FNAA 1LS1A 1K8RA 3AV0B 1YRBA 4NBSA 2AL7A 4KBFA 1IY0A 1QHXA 4IXNA 4NMMA 5JHGB 3T06B 4ERNA 4C30A 1W48A 2AWOA 4LUCA 4Q02A 4ACBA 3RS3A 1KK1A 3A58B 3VTKA 2FMXA 3PIRA 1ONBA 3EPKA 4TTQA 3QF7A 2IXGA 1HA3A 4WW0A 1T9HA 3PITA 2EW1A 1F60A 1GL7A 1FL9A 1RIFA 2JLQA 5BXQC 3LW8A 1NLFA 5LPNA 1P73A 4M21A 3QKRA 4Q7MB 4RD0A 1OV4A 1QHHA 3SYNA 3SHFA 3TSOA 4B76A 5TDHA 1E1RA 2C98A 2IYQA 3BK7A 2EFEB 3UXMA 2ZR0A 1IJFA 1PLKA 2VP6A 2IL1A 2JATA 2RKOA 2HEIA 4DDUA 2HLDA 4D81A 1DVRA 2CBZA 3AP3A 1GITA 2YVUA 3CONA 4AKEA 1DAIA 3C8UA 4LV5B 2VYFA 1QHSA 2J0UA 2J3EA 3U61B 5KDDA 3EC1A 2VEDA 3CB4A 3IHLA 2CVFA 1MRNA 2J1LA 4PC2A 3T5DA 1P60A 4FMDB 4QBGB 4B74A 3BB1A 4ESHA 4TZ6A 3OFNA 2V3CC 3NEYA 4EPYA 3BERA 2IBMA 2D62A 2BWJA 2XOKD 1OB2A 2PX3A 3CKLA 3O47A 2REOA 5FPSA 1K6MA 3TW8B 2QAJA 4CDGA 4LBVA 4KVAA 2BV3A 1S9DA 5AJWA 5JMTA 3TSZA 2RGGA 2GJ8A 4MKHA 1Q44A 1DADA 1G7CA 2JEOA 4KJZA 2J59A 1EFTA 4GZMA 1EX7A 2CMKA 3E70C 4MDFA 4IW3B 4FWIB 3MWLA 4TMTA 5AUPB 5D3MA 2ZRIA 1VCNA 2P6UA 5BWMA 1AN0A 2C96A 1KHTA 1OIVA 121PA 1OKKA 3MMPA 1AQUA 2LKDA 2PCJA 1R7RA 4LBYA 4HYYA 1T0JB 1CTQA 3JVUA 1VG0B 3K0CA 4QRHA 5JSZB 2OFOA 1YQTA 1KJWA 5TY0A 5H8WA 4MYUA 1IN7A 5FPKA 4JSYA 5EE5B 4ZPXA 1R5OA 1YZQA 1AJEA 1UDXA 1W4RA 1WDTA 1NNEA 1N5IA 2FOLA 1KK2A 4IVRA 1KO5A 4XTCS 2ORVA 3GJ5A 1PV4A 4YONB 4CEHA 4GT1A 4LHZA 2KE5A 4OHWA 2Q3FA 1R0XA 4CT5A 4TMWA 1F2UB 2QBYB 2FSGA 2FX3A 4XWKA 1HEIA 5EP1A 2BMEA 3SBEA 3RSLA 3EASA 1A82A 3BXZA 2ZI5A 4TMZA 2O8CA 3B1ZA 2FFQA 2QENA 3UATA 1U8AA 1Z6TA 3TBKA 1W0KD 1IN8A 2IWHA 2MMGA 3FDIA 3PJRA 4HB3A 4TSFA 1CJTC 4ZI3A 1E0KA 4HAUA 4NCNA 3CO5A 4C3ZA 5IK2D 1TAGA 1IY1A 1XTJA 2D74A 4RZUA 1N6NA 2R6CA 2VHUA 2C03A 3QEJA 1VCOA 1Z3IX 4O25A 4PZLA 2W83A 5CJ2A 4HDOB 2WPDD 1HE1C 4JZKA 3UANA 4A8JB 2WWGA 2GZAA 4R9UC 2FF7A 1XRJA 3EARA 4TN1A 3UMRA 5K8IA 3FMIA 2RAPA 1RRGA 4LY6A 1UBFA 4X8LA 4UNQA 2H8KA 1AKYA 3S1AA 1SKYE 3PQCA 4C0QC 4PSAA 3B85A 1MABB 2ZJOA 2F1RA 3BH6A 4IFEA 5FUYA 4E07A 1NJFA 4PC6A 2CL7X 5HE9A 4LC1A 1E2PA 4OQFA 2OCPA 2ZI6A 3DKVA 4NYIR 3B5JA 4HDCA 1NVVQ 4RKEA 5JEDA 1KSGA 2Z43A 1G21E 4GZLA 2GEDA 2ZE7A 3EC2A 2PMDA 3A1VA 4TMKA 4BWYA 5TB5A 2GBLC 2I4IA 3DVLA 2X2EA 3KKNA 3LQRA 4TQUS 3D8BA 3ZLJA 3AVVA 4DCNA 5CYPA 2P0EA 2G3YA 3QUSA 2WICA 3PUZA 1QHNA 3QI2A 4PAMA 4Q1EA 5H1YA 3C5CA 3TSWA 3EZFA 1OF1A 4M9ZA 1ZNZA 2QTVB 3QKUA 4ASUD 5J40A 4BASA 2CCGA 2ZIAA 3PEYA 1GWNA 2J45A 4CW7A 4QM6A 4JVNA 3FMFA 2C9YA 1EK0A 2WVJA 1FP7A 2RGAA 2FE4A 1U0HC 3QNUA 5FUVA 2JLXA 1C1YA 1PUJA 1D2MA 3GQBA 5FPYA 5FL3A 1CR4A 4UQOA 2CEAA 2QAGC 4B48A 4EPWA 1XMIA 2HF8A 1QRAA 2OCYC 4QGFA 1YR7A 1ZNXA 3TUIC 4E03A 4DUGD 1JR3A 2BBWA 2GA8A 2IUSA 1N6PA 5EXXA 4NTZA 1UFQA 1QZXA 2ZJ2A 5GVSA 4P4UA 4AD8A 4B73A 3MG9A 3WBKA 5FBLB 4WA7A 3TE6A 3KKMA 1JXMA 3VU9A 2CJWB 3RRMA 4URZR 3LX8A 3WNDA 3QPWA 1XWIA 1YHNA 4BFVA 2AHOA 2CLSA 3AKDA 3CF2A 4V0KA 3C4JA 4B6FA 1AS0A 2DFNA 2BKEA 2VSFA 4FCWA 1IXSB 3QKTA 1GP2A 2IS6A 4NDZA 1G19A 3ZVNA 4PZYA 1DG3A 5BN5A 1OXTA 4HLDA 4R7ZA 4HAVA 2J41A 4TYPA 1D5CA 3QIAA 3SJZA 1G7TA 2GEUA 4BFSA 3FVQA 4C0JA 1ZNYA 1JECA 1KMQA 2DWPA 4HLQB 2I1VB 1P75A 1IQPA 3LWNA 2WOOA 4ACAA 4YMTA 3ND8A 5AUNB 3IQWA 3A4LA 3AF0A 4QM7A 2ZRAA 4FXPA 1S3GA 2OM2A 4BZXA 4TLCA 5F2EA 1Q1ZA 3WMEA 4JT4A 4BUJA 1JXOA 4DLRA 2XB4A 1SVWA 2A78A 1TX4B 2DYKA 3KFVA 4V0LA 4XVQA 2GXAA 4NCJA 3KJGA 1N25A 1E32A 2WSSD 2P6NA 5C1BA 5SZIA 4D0NA 2ZROA 1UBGA 1E1QD 3KQKA 4LBZA 5SZKB 2CCKA 2GDJA 1K5DA 1DBSA 1VMAA 1WP9A 4N1AA 4C0LA 1B23P 5DYGA 2Q9AA 3SBDA 4FMCF 1XEWX 1R0WA 1KO8A 2AX4A 3FPAA 4S2EA 1YR6A 2GJAA 3CPJB 4A0GA 2BOVA 1W0JD 3PUVA 3M4YA 4PAQA 3RAPR 2VLIA 2ZE5A 4DB2A 3LXXA 3SE0A 4UXIA 3PV0A 4YMUA 2WKQA 1HYQA 3I72A 2XOKA 1AGPA 1XX6A 3AQ4A 2BCJQ 3N2EA 1E9DA 3B9PA 2KBFA 3WHKA 1I2DA 1MOZA 2OV2A 2FDCA 1NY6A 1U0LA 1R5NA 1TEVA 5DH9A 2OLKA 1YRAA 2P6RA 2ZXUA 4ZKEA 2CVHA 3U7HB 1XF9A 4A8JA 4HATA 2V9PA 1AS3A 1VIAA 3CBQA 1LF5A 3I8XA 3VR1A 3AKCA 3V00A 3EAQA 3SFVA 3VFDA 4PZZA 2QM7A 3QENA 4LK2A 1E2NA 1EGAA 4Q9LA 4IFBA 3CR7A 5EP3A 1FX0B 4IXMA 2IYTA 1FUUA 1E2LA 4BLSA 1DPFA 2ZSFA 1KI2A 2DFTA 3TK1A 1I4DD 2IYWA 1XTQA 2L0XA 2MMCA 2WAXA 3LO5A 5GJCA 2HXSA 2H1LA 4RD4A 5FOWA 1IXRC 5CLLA 2FGKA 1Z8FA 3MD0A 1W47A 1G291 4FCTA 3U3OA 3EZ7A 4D82A 4DCSA 1OLOA 2DFLA 1P9WA 4KU4A 3RVBA 1MV5A 5EP4A 1CRPA 4MQBA 1T3LA 4PXAA 3I61A 1T6NA 1UF9A 1CKEA 2CLDX 4Z54A 2D7DA 5KSPA 1NJGA 1VCIA 2EWWA 2G1KA 2VF8A 4RCYA 2AN9A 3CPEA 2YWGA 4KAXA 4GFDA 1VIYA 4XSHA 3U3JA 4F38A 1DARA 4AIIA 3TH5A 1FMLA 5IK2A 1Z22A 3HP1A 3TR5A 2FV8A 3K70B 4WXRA 4D0GA 1JPJA 2IK8A 4RZ2A 1KDPA 1M7HA 1TEXA 3RRZA 2JJ1D 2WJHA 5FOTA 1ZIOA 4BFZA 2J46A 2GZDA 3NEJA 5L3QA 2YYZA 2O0JA 2AFHE 2IWRA 1L4YA 2ONKA 4LYHA 5FUXA 2IHBA 1G8HA 3WMGA 3LRPA 4XOIA 1E79D 3M1IA 1OE0A 3D31A 3KKPA 2OG2A 1JQJC 4BLOA 2CJWA 2FPLA 1CP2A 3GLIB 2I1QA 3I4LA 4KI0A 5D3QA 1U81A 2FH5B 5CM9C 4A6PA 2JGNA 1U0JA 1ZC3A 1A4RA 3REFA 1DAHA 1GILA 1EXMA 2BBOA 2QT0A 2F1IA 2GHIA 2OAP1 1IM2A 3EA5A 1NVXQ 4BFXA 2OBMA 2QE7D 2A5YB 2VP4A 2DHRA 3SR0A 4QKQA 2Z6VA 2BC9A 2QA5A 3NBFA 2VL7A 3OEEA 1BIFA 4A0HA 5K8LA 4BE7B 1H8EA 5EP2A 3THWB 4IDPA 1O3YA 2Q3HA 1FNNA 1YZNA 2ZYWX 4ASUA 3CW2A 3VKHA 2W0SA 4MGIR 5G3ZA 4URXR 1S1MA 1UJ2A 1GNPA 1Z0KA 1YZUA 2GKSA 1C4OA 4TL8A 4TLAA 2O5VA 2FPMA 1I4LD 3DOFA 4D4KA 3WY9A 4ZIRB 2ATVA 1E2EA 4CF7A 3BD9A 4KV9A 3HU1A 2K5UA 1G6HA 3E1SA 3H2YA 1XBTA 4US0R 4EUNA 2ZRBA 1E2HA 1VCMA 5EXPA 2YV5A 2OSBA 3UMFA 1LS6A 1WF3A 4DUGA 5B57C 4M8NE 5JJIA 3MUFA 3A37A 3OAAD 1G5RA 3AVQA 4Q00A 4XD7D 3NH6A 5L3RA 3QKRB 2ZUDA 3L0OA 2WWIA 5E95A 1HQCA 1MO3A 4FCVA 1BMFA 4AG6A 3KUCA 1Z83A 5GJWC 3LBHA 2J5XA 1XEXA 2ORWA 2GCPA 2QGZA 2QPAA 1JEEA 3GJXC 3MLEA 4TL7A 2H5EA 2A30A 1OFTA 4X8MA 2GXUA 1Q1EA 1OFHA 1SKQA 1OHHD 2H17A 4NPHA 2J0UB 4PSVA 4Q4AA 1YZGA 3THXA 3RABA 4JVSB 3ICEA 2VTKA 1N6RA 4NCIA 3PEVA 4Z51A 1FP6A 4PPGA 2RB4A 1XMSA 2H18A 3GEEA 4Q48A 3W3ZB 3J81k 1G4AE 2W0MA 5B2ZA 3KJEA 3ZGXA 4DDVA 3K9LA 1J99A 4URYR 4PQRA 1KDTA 2HDNB 1W36D 3NHBA 5F3WB 4MA4A 4AI6A 1JQLB 3IO3A 5KO2A 2ZS8A 4ZCMA 4EIWA 3T1QA 4L8GA 4RCZA 1XCGB 4Q66C 1DAEA 4XJXA 4OQLA 5B64A 1T8TA 3CF0A 4G5RA 4IVQA 4BEBA 2QZ4A 2WWFA 3CRVA 2J7PD 2NOAA 3RNLA 3CM0A 1AQYA 2VRWA 1GFIA 4JKYA 3TVDA 2W00A 3C15C 1FX0A 3A1TA 4A2WA 2BMJA 3OESA 4M1KA 2ASEA 4PPFA 2F1HA 4FINA 1E1QA 4CIDA 3EIQA 2C9OA 2EWVA 1F5NA 4HEJA 2V7QD 1PLLA 3OF5A 1FQJA 2BKUA 2QQ0A 3OE7D 1XZQA 4Z8XA 2YWEA 3PR1A 5KTYA 2Z5FA 4U5XA 4RSGA 2WHXA 1KIMA 4KCGA 3U5ZB 3C16C 5EUQB 1LV7A 2JLVA 3GLHE 3UKDA 3UPUA 1KO7A 1Q3HA 4JL6A 3B1WA 1N3BA 2QGNA 4HUTA 4TWZA 4RD6A 4YLGA 1Q0UA 2NO0A 1T5IA 1W0JA 2XTMA 4DSUA 4RD2A 5H70A 3UMSA 4HB0A 4NCKA 2H7VA 1KI8A 4KLZA 1ZRHA 3L8ZA 4LHVA 5FR1A 2J0VA 4YDHB 2QMEA 3FMPB 2QP9X 1NSFA 3KUDA 3T5GA 4Q9HA 521PA 1E2GA 4DDWA 4Q21A 1NVWQ 2CHQA 3L0SA 4PR0A 4RVCA 2O8CB 4BGDA 3RRNA 3MWJA 2ZJBA 3THYA 1KI9A 4QHSA 3AVYA 4Q1AA 3R9IA 3PEWA 4A2QA 2OUKA 1D9ZA 3W9YA 3SQXA 2ECKA 1WA5A 2GZHA 3M6AA 3A1UA 1KAOA 1D2EA 2F3TA 5DYIA 2R6AA 3QF4A 2VHTA 2VBCA 3QG1A 3ECCA 1EWQA 4OL0A 2G77B 5SZJA 4KITB 3AVTA 3CRQA 3ZJYA 5KNCA 3GLIA 2IX3A 2P3SA 4NL4H 4JLNA 3ZZ0A 1U94A 1X6VA 1ZINA 2DWOA 1KNQA 3I3SR 4QG7A 1E9SA 1NIJA 2AXNA 3S1AB 3FTQA 3X1WA 2GCNA 3VQTA 4DSOA 1TQ4A 1W5SA 1Z0IA 3ZZUA 3CH5A 4V03A 3VNVA 2VHQA 1IN6A 4XH9B 5BQ5A 1OIXA 2BHRA 2XEXA 1SHZA 3AKYA 5BYJA 4GNKA 1NBME 2UVQA 2VPPA 2LKCA 2VP5A 4OQNA 4FMDF 3ZS9A 1JJVA 2JLRA 3TVTA 4W5HA 3BWDD 1KMHB 4R2HA 4QBIA 5DO9A 4DT1B 3BIFA 1OXSC 1KK0A 4DSTA 3FKQA 5DSZA 3K0SA 1M6NA 5IDVA 2ZUBA 1U8YA 3G82C 4UXJA 3B1VA 4Q1BA 3ZVLA 1Q12A 2O0KA 3EZ6A 3PVSA 2EFDB 4ZIRA 3BE4A 1WCV1 4C0HA 1KI4A 2W6JA 1G9XA 4A6XA 4CT4B 2JJ1A 4F91B 1IY2A 4ON9A 4M1OA 5HKKD 4OK5A 4IKEA 5KPDA 3OIUA 4QBFA 5AWFC 3EZ9A 3LD9A 3KTAA 5J4HA 1QVAA 2FJUA 2Q3MA 3F8TA 3O8CA 1WB9A 1RW4A 1W1WA 4YXWD 1G3IA 2BIFA 2UKDA 2WKPA 4N3NA 3DOEA 3LH5A 4FIDA 1LFDB 1BYUA 3NWJA 1AK2A 3LNCA 3REGA 4HSEA 3SQWA 4OHYA 3ND9A 2O8BA 1SGWA 4GOJA 3BS4A 3HWSA 1ZP6A 4FWTA 3RS2A 4BLQA 1TF5A 2F7SA 3FGNA 1WBDA 3EPLA 2FG5A 3A1WA 4DBLC 1NN1A 4V0ME 2ZEJA 3G5UA 821PA 4F4IA 4DXAA 3VU9B 2F9MA 2QM8A 1I2MA 2QE7A 4L9SA 4V0OA 3W6PA 4EPTA 1NMYA 3OIVA 3DM5A 2FGJA 4EQ6B 5K8TA 4MYTA 3K0AB 1NBMD 2W2XA 1FW6A 3H84A 2WWHA 2YWFA 2B92A 3SHWA 1OFIA 5FH9A 2ZJYA 1VDZA 1XTRA 2ZRMA 1NIPA 1T3SA 3VNUA 3EIHA 4JJKA 4JL5A 4B2PA 4ZDJA 5GVRA 2WWYA 1YZLA 1R2QA 4GRAA 1OH8A 3SJAA 1EWRA 1UKEA 1Q1QA 2FA9A 5TV2A 3L8YA 1N2CE 3RWOA 1GM5A 5DHFA 3GFTA 3OHMA 4JLDA 1NKTA 3AKEA 1Z28A 1MO6A 3OAAA 4LPKA 4ZDWA 1NG9A 4QBHA 2XJ4A 3GJ7A 4XD7A 2IYSA 2F6RA 2CLCX 1OJLA 3P4XA 3KX2A 1XTIA 2YHSA 5FBQB 3GFPA 3CNOA 3X1ZA 5CB6A 2EQBA 1AIPA 5KSZA 3K0EA 2ZRFA 3BFXA 2ZU0C 5C4GB 2E1RA 5DI9A 3RDPA 4R71A 1W4CA 1DAMA 4LYFA 4KBGA 2X1VA 1E9CA 3VKWA 1W36C 1GKUB 1XPOA 3BFVA 2ZSBA 4QHTA 3AVXA 4POAA 1S2MA 4M9XA 1R4AA 5HE8A 3A36A 4OBEA 1XMVA 2JDIA 5F9HA 3R7WA 3LDAA 4JSTA 1ZYUA 4JLMA 3VHXA 1DAKA 2C2HA 1VYUA 3B2EA 3CWQA 3NKVA 4MYHA 3CX6A 2OXCA 2WMOB 3RRYA 1M7GA 1E2DA 1ZUHA 1KI3A 4QJ4A 1YZKA 1H8HA 4Q9IA 3AM1A 1KAGA 2NO6A 1SQ5A 2GETA 3CRMA 4LJ4A 1P9RA 4MGZR 2PEZA 4TLBA 1NN0A 1II8B 2ZANA 4LHYA 5JLJA 1SHKA 3T12A 4F4CA 1Z6GA 5CDFA 3BH7A 4LCBA 1OYWA 3GEHA 3KQHA 4AYXA 2ZYUX 1MR3F 5DNYB 4ITRC 5CIWA 2OLJA 4II7A 1YKSA 5EQTA 1GNRA 2ZS9A 2O8DA 1N0UA 1X1SA 4HB4A 4J0QA 2AKYA 1GL9B 3NVAA 4KYIB 2W58A 1DTSA 2W6IA 2HT6A 4AURA 4Q7KA 3RHFA 1XNJA 2IYXA 1KDOA 1S8FA 2H16A 4LZZA 2JA1A 2DCUA 4IDHA 3TR0A 2EYQA 2BMDA 1JPNA 1G64A 1OSNA 2P2LA 4KODA 4M9QA 5AK0A 4GOXA 5FOXA 3SS8A 2WIBA 3MJRA 1KMHA 4ARZB 1IONA 2QL6A 4DT1A 4NH0A 5EE3A 5KU1A 3FMOB 4JMPA 5K8UA 3CPHA 1LW7A 3DMDA 2V4ZA 5AJZA 2WJYA 3NC1C 1P7CA 1OXUA 2JIZD 1E96A 4LJ8A 4Q4LA 4QNRA 2I3BA 3DEFA 4PHGA 5DN6D 1DAFA 4LJ7A 4RKFA 3EW9A 5CK4A 2GF9A 2Z0MA 3WMFA 2QU8A 3WYAA 5LD2C 2GBLA 2R2AA 4TLEA 3ZVMA 3VX4A 2ERXA 1KYIA 2E9SA 4XWOA 4MUAA 4EJSC 1XXHE 3BB3A 3MAAC 1RYHA 1Z06A 5JRJA 3QVUA 1BH2A 2X19A 4JLOA 5FBRB 2PL3A 1US8A 3KZ1E 1LY1A 2ZJ5A 1GSIA 3WNBA 4RZ3A 1SVLA 4M1YA 1HT1E 1ZMXA 4LHWA 5JCPA 1XD9A 1M2OB 5BN3A 1HURA 4HAWA 2IUUA 5L3QB 2JJ2D 2QAGA 3ADDA 4FN5A 4Q01A 4NYIQ 2B7BA 4AKHA 5DHAA 1QG2A 4UKDA 3MGCA 2RHMA 2CK3D 2RGXA 3HJNA 3KQNA 3SOPA 4BLTA 1TU4A 4YMWA 1ZVQA 5JZVA 4HUQB 4LDJA 3KJIA 1COWD 3Q5EA
chains in the Genus database with same CATH superfamily
5KNBA 2ZDQA 1FOEB 4B6RA 3OZDA 1A3CA 1SB8A 3HR8A 3OZSA 4JEHA 1HLDA 4YT5A 4WUVA 3SIPA 1NUUA 3V3KA 4PO1A 4TZ0A 5JJKA 5IF3A 3FYHA 4UBJA 3T1TA 3VR6H 3BWBA 3VUFA 4NZYA 3TAHA 3KQLA 1SXHA 2IYEA 4MCIA 1EUDB 4C4OA 2V7XA 5AM5A 2YV3A 2CV2A 3R75A 5CIYA 2PLAA 5BSFA 1CF9A 1RABA 2ZRKA 5GM2A 2XD4A 5HILA 1ILEA 1R0RE 3RYCA 4B3RB 4FU0A 1NVFA 2VQDA 2ZQYA 3GF4A 1FXUA 2HJWA 5JECA 1G2QA 1J0DA 2NO4A 5DYWA 5EXDA 5K3BA 1UDAA 2EF1A 3JD0A 4BNVA 5JYCA 1AV7A 3UXEA 3V4RA 1MAHA 5F51A 3CX8A 2Y1OA 3ICOA 2R11A 1GKIA 4OJMX 3HM2A 4Z0HO 2JI8A 3BHNA 1W6UA 2LCIA 2WOJA 2BYTA 4Q37A 2X2PA 1JFSA 4EX7A 4IJVA 3ACBA 4TQAA 4YQFA 3ESBA 1ZH2A 1I1QB 5IBPA 4LSWA 3DEJA 2FQWA 1Z56C 2XNDD 1GCAA 3TLJA 3V1NA 4BRSA 5IULC 5JXWA 2HAEA 2CB9A 2QSZA 1AUVA 3AV3A 2XRFA 3PS9A 3MIZA 5IF9A 3FAKA 2WUDA 4FE3A 1NFFA 4ZZ3A 4CFSA 3T7IA 1ZLXA 4DZRA 3Q2KA 5JFGA 5LYJA 4G1BA 2OORA 5I7SA 5FBWB 1NJ2A 1HDOA 5D86A 4IY1A 1DKNA 2FQ1A 5FTJA 4DV1B 4MQEB 1TOAA 2XYQA 2O59A 3L84A 2ECQA 4MZXA 1M2EA 5CU7A 4ZT3A 4YDSA 3Q7PA 1UKZA 2DPLA 1OI4A 1W76A 3AFIA 2O0LA 3JASB 4I14A 4NE7A 5GONF 1XEXB 3EVAA 3URMA 2O8EB 4XJVA 2PZAA 4ZT7A 5HCNA 2ECPA 4BMCA 4AKGA 1LNZA 2ALJA 1VJCA 1CW2B 3MLBA 3FFBA 2JFFA 3GL9A 3JVIA 5EXTA 3T0GA 4EUKA 4C1BA 1U2RA 2P5TB 1TIKA 2QTFA 2WHQA 3IIMA 3KU4A 1NBMA 3TM5A 1VM6A 2ZE6A 2HK8A 2WR8A 3BL5A 5AHRA 1J23A 2A3NA 3AFNA 4KBYA 3I2KA 3NFRA 3STHA 1E9BA 1CHNA 2LPMA 2PS0A 5AI6A 1G3QA 2VK8A 2QD2A 2PVCA 2TSYB 3GIDA 1KQNA 5H9VA 4CVNA 3O73A 3AR6A 1E7SA 1TPZA 2XNKA 4M1TA 1MGPA 1NQVA 3DEKA 3NTRA 3BOSA 3HN7A 4NONA 1U8CB 1R8JA 5FBKA 3AEUA 4G37A 3U37A 4F3TA 1R16A 3D3JA 3K0KA 1T2EA 4M9UA 5KDLA 8ABPA 3A1SA 2OZLB 3WK6A 1BD4A 5JT1A 3CV3A 3WI7A 3JYLA 1WU7A 4GKAA 2GPAA 1E9FA 2WSMA 4M0UA 5TGTA 4OHZA 1QPZA 2IV7A 4P3NA 1E69A 4G8JA 1BN6A 2VAWA 4U1RA 3H5VA 1R4MA 1TKCA 4AL4A 5EJEA 3KFLA 2JIBA 4QFMA 2YN2A 1OXVA 4AG5A 1NQWA 3KB1A 1V96A 2QW0X 4L15A 5CM2Z 3RSGA 5K0BA 4G1CA 3U44A 1W46A 5KYYB 1CQPA 1ODTC 3UJ8A 2DFDA 3H4MA 1U9CA 3G2PA 3B9BA 3CE9A 3ZYCA 4ARZA 2VPWA 2V5AA 2X40A 2DLDA 5BPHA 4OX9B 1JQ3A 4LNUA 3SMVA 3AJAA 3AYZB 4M1EA 3JALB 5TJHA 1VYHA 4HS4A 5TSDA 2ZI3A 1QX3A 1EINA 4V0MA 2OK7A 4AJ9A 3ZYZA 3T1NA 3HDTA 1NF3A 3H5IA 2W6ZA 3QEKA 1ZFNA 2WUWE 1KAEA 3T7EA 4Q16A 2QMUA 4JLKA 3SDZA 1KMMA 5DBFA 3U2QA 1PJRA 2LW7A 1ZD9A 1NYLA 3QV2A 1STOA 4JL8A 3VRHA 2B4KA 5HA5A 5HKOA 4DAOA 4D8WA 3ISVA 5K0ZA 3UMMA 1SJ9A 3VR5H 5HXAA 1YZYA 2QZSA 1SG0A 2QMYA 3E35A 1XZNA 4X7MA 2HTEA 4IOJA 5ARCA 3CCBA 4U7FA 1V11A 4AZWA 4B7XA 2ZS7A 3ZLTA 4B9AA 1KY3A 3MS2A 4LQ4A 5C5IA 3T3NA 2UUCB 4PAOA 1JT2A 3E15A 3HA5A 3IQXA 3QJYA 4K9KA 5D6OA 2QSJA 4AP5A 1A8QA 1OXBB 5DEOA 4V24A 1AV6A 3DMTC 1KPIA 1VFPA 3ZWAA 1W44A 3AF1A 1EEHA 4WY2A 2A3RA 2YWRA 5I8ZA 4KQXA 1HO3A 3I6ZA 4O3MA 1YFJA 2MT9A 1U7UA 1Y3AA 2R0QC 5A3JA 1YDFA 1XFAA 2E4XA 4B5LA 1M2OA 3R5SA 1VKJA 2BGJA 2EJVA 3EIXA 3HR7A 4D96A 2ZIFA 1KETA 2Q7XA 1L4LA 5HR5A 1I7NA 3UWPA 3QI7A 2V7UA 3L0IB 3C6XA 1K0UA 3QELB 4QRDA 3HY3A 5GV7A 1NA5A 2D1QA 1BOFA 1IC6A 1AGRA 3C3CA 4MI9A 2FUG1 5AKLA 4HUQA 1K6XA 1D6JA 4EJFA 1GZSA 2X5OA 1RR6A 4LZWA 5KKNB 1LVGA 1Q1BA 3KKOA 4RMGA 4XUEA 1XZAA 4PSKA 4FW8A 5DGTA 5LB4A 2YOFA 1RBZA 3ZTWA 3QXCA 4Q4JA 3TMKA 3K96A 3A4VA 3F7OA 1TF7A 4GX2A 3RJTA 1LNQA 3ZJ4A 1SXJE 4FD2A 4YJGA 3S2EA 1TU3A 1OR8A 2VXOA 3D02A 3QZUA 2VJBA 4X8OA 4CGYA 1LUAA 2HV8A 1FP2A 4OBBA 3VHRA 2F67A 3R44A 3G2LA 2A1IA 1HZZA 4MB6A 1E1RD 2QUZA 5TQ2B 4UMVA 2IV3A 4C21A 3NKLA 3I64A 2GXSA 4X1KA 4U7DA 1SUWA 4R8VA 4LA4A 1K5HA 2PGIA 3DMYA 2WIJA 3NTXA 3VVBA 4EGCB 1WXGA 4XSVA 1IVSA 4H3VA 2EERA 3CGWA 5ADWA 2HDHA 2PT5A 2XNCA 1OAOA 2K2WA 5IHPA 4BRUA 1P3DA 4JLJA 2F62A 3VR3A 3RLFA 3HFSA 2PX8A 5FBVB 4JSRA 2OR3A 1U3FA 4Z3KA 1UPXA 3ITKA 4FMBB 3TLZA 3D3WB 2P9ZA 1RVDA 4UFPA 1OVGA 2IV2X 2C42A 5FPHA 3DOCA 3THRA 3PLAE 1FZQA 2GJKA 1ECJA 2AK2A 5EFZA 5FEUA 3L02A 3QE3A 2OHOA 1TIPA 4LC0A 1JE0A 1E4VA 3NNSA 3K5PA 1NXPA 4BN0A 1SUAA 2IY9A 3CF6R 3IERA 5K4GA 4FQ7A 4Z4GA 2I03A 2Q27A 4E88A 3GOHA 1PK7A 3I9KA 1X1RA 1XTUA 3H5TA 5E3HA 2IF0A 4RV9A 2DR3A 4RQTA 2H7XA 2QR3A 1KOFA 4TV8F 4BAUA 2JFGA 1NQAO 4OLBA 5JEEA 2E2WA 4KAJA 3FHLA 3SAJA 2PBRA 3FDZA 2ZB4A 3RRXA 1UOEA 3FNGA 1T0BA 5CTJA 5DNEA 2O8BB 2AFVA 3MUNA 5CW1A 2ZSUA 1JU4A 1SRRA 1XWWA 2BGTA 4F9EA 1OCEA 2YDXA 1FDOA 4LYJA 3C7CB 5IAJA 1RMTA 3IS3A 3NAZA 3EBLA 4B0PA 2DC1A 2PH7A 3L6CA 4G4IA 4PX3A 3HXQA 4DSZA 1PG5A 1Y4AE 1IH8A 3IR5A 1CUBA 1YZFA 1SXJD 5A9RA 4HN4B 1I5EA 3R5TA 1ZIXA 4NZOA 4L51A 4QPCA 3WL7A 2QVXX 2IYRA 5F98A 1Q3KA 2ZIXB 2XECA 1LRJA 4CI0B 2PE5A 3ONVA 1KYVA 4DCMA 3IYLW 1FU8A 1YR1A 2BTOA 2ACWA 1RAGA 5CTAA 3ZEAA 1JX6A 1O5IA 4LOHA 4AN4A 4YUYA 3IJRA 4ZO8A 1GYQA 3IP6A 3E7XA 1Z2NX 3R2JA 4DM3A 2I6QA 2VJPA 5BNZA 2G82A 5DWQA 1IN5A 3QWFA 2D4AA 3V7UA 1JG6A 5AOBA 4DWWA 1SUFA 2B8JA 4LF7B 1A2QA 3UOWA 5H16A 3FYSA 1MX9A 1DDOA 3C48A 3QVKA 1FYXA 4MGYR 4P54A 3T4XA 5DI3A 5GGXA 4JFAA 2PMKA 3LK7A 3O91A 3DFKA 5FUWA 4DF3A 2WSSA 4UBMA 1K5GA 3IMCA 1O2DA 2WJGA 4BEWA 2XZDA 4LOLA 2M9MA 1UMBB 1E2QA 3DKPA 4L02A 4MYRA 4WXEA 1E2IA 2ACKA 2Q2NA 3C1OA 3UMVA 3GLFE 2UU9B 3OPXA 2YC2C 5EJ2A 2XWQA 3KT3A 2HD4A 2IHZA 4GYJA 4UMEA 3DVAB 4DRXB 1T36A 3ESAA 2YFQA 5D1NA 3WRXC 1ZXLA 1MQ9A 4URFA 2OBNA 2XDQB 2YY6A 1XRPA 3L6RA 4RKYA 2CFOA 1ECFA 4W4TA 2CKDA 4LJ5A 1C9EA 1G6OA 1I2AA 3KR2A 3UNXA 1SRQA 4PHHA 4DBVO 3FR8A 3UQYS 2Y93A 1E3WB 1TTPB 1BX0A 2YWCA 5FLKA 2QK4A 3DEYX 5AI8A 2WJJA 2HZ7A 1GQYA 1L4NA 4E46A 2GR9A 3ZW7A 1FNBA 2RONA 3K9NA 1A69A 1GRRA 3E8MA 4P4SB 5ED0A 4UDYX 3QY0A 1CV2A 3R7WB 2GB4A 3BJEA 3K05A 3IBGA 4NFLA 2AR7A 1VA4A 4TOIA 4C7OA 2H59A 4JC4A 3KYCA 2EEZA 3QBVA 3U4QA 3B1XA 4RLSA 1NBHA 1TGYA 3DAGA 3B60A 4Q9JA 4DCPA 3DBRB 5DKFA 2ZWIA 4DLTA 2F55A 5TQVA 1X39A 3A9SA 3H5AA 1WDKA 3PF9A 1UP6A 4NU0A 4BQIA 3WKDA 4AKSA 1M7BA 2DUJA 4S2UA 5KOIA 1FSPA 3S44A 2GN2A 3GEGA 1RJ9B 3NHSA 3DL2A 3DFFA 1Z5ZA 1GRQA 2FHSA 2V6JA 3WBFA 1H65A 1AGNA 4BQFA 1YA8A 4WEOA 3ZV4A 3KKLA 5I9NA 1K98A 2VUTA 4R2KA 2IY8A 3V6MA 5DE3A 1J22A 1HTWA 1E1NA 2BUBA 1XCPA 3VV3A 3ZDQA 3SKVA 3T38A 2WTNA 1CIPA 1MIHA 2A5DA 3ACDA 1G6Q1 1QQTA 2DT5A 2FMKA 1ZD4A 2P5UA 4K9NA 3OD5A 1JEJA 1CT9A 3OFKA 2R6DA 5F1PA 4UOEA 1KFCB 1MMFB 3TSCA 1WQ1R 1KYXA 4H08A 4IDGA 3WMXA 4ARUA 4PICA 1KEEA 3UHOA 3T9FA 4WNCA 3ZZTA 2YNMA 1KH2A 3PC4A 4UEJA 4JLBA 1PL0A 2XZOA 2HYIC 2AR9A 1NYQA 4WBNF 2IBTA 3OKAA 1T3TA 1PQ4A 1H2WA 8ATCA 4NOMA 1JHZA 1FVHA 4NOLA 4M2LA 1HE8B 3VH3A 4KO2S 1OWOA 3R3SA 4MEJA 4LV8B 4EYGA 2A2ZA 2Z09A 4WADA 2M6RA 3H1GA 3KB2A 1M0SA 4E11A 4PU0A 1CC1S 5IYZA 3BXGA 3GP5A 2JVJA 1UINA 1YCGA 2ZJAA 2UVDA 3WC4A 4BGEA 3MERA 2HF9A 3JTEA 3KJHA 5JDIC 3T9EA 3WLLA 4Q12A 4EG1A 3HU5A 3L2OB 4G5OA 1J2EA 5ER6A 1KEKA 1DC7A 3F6CA 4ML3A 3NMUF 1GPDG 2VP2A 1ZGCA 1XVTA 2QE6A 2OMEA 3BWYA 3ZHVA 2I80A 4U7WA 2OD2A 4HNVA 2E6UX 5EMMA 3CCFA 1KYQA 3B1FA 3R6TA 4HTFB 4G23A 1T0IA 1EFRD 4RQUA 5G53C 4KGDA 3FOFC 2CV0A 1BU5A 2PH3A 4RNCA 1XDZA 2I91A 1TO6A 3F97A 2PZKA 5JBQA 1K66A 4MUBA 4NK5A 5JCOC 5LD2B 1ZVVA 1KY4A 3GRPA 4LJ9A 1P72A 1TQHA 5E9WA 4CODB 1TGVA 4EJ2A 1NL3A 4O59O 3OQBA 4MO2A 5JD5A 4MR9B 1R15A 1TM5E 3RS8A 3WLKX 2YZNA 2V54A 4L50A 2B8TA 4LJAA 2QMOA 4DJFC 3IDFA 1FP1D 5ELXA 4HDMA 1WLSA 2NZ2A 5JPDA 3HCWA 4D25A 2GPSA 3KC2A 1OPXA 3DOIA 4FBLA 1AZSC 1DQPA 5JTTA 4HGOA 2FN4A 3K09A 1X7WA 4I4NA 4IIBA 4OQXA 3T52A 3MMXA 1OUMA 4AO8A 3T34A 3JQAD 5KB3A 2TMYA 4EFNA 2VH5R 3N7UA 2HHCA 4I46A 2PNJA 1ANKA 2F43A 4POOA 3WKBA 5FL7D 1AN9A 4Y6OA 1G8YA 5EQFA 2I76A 2R6GA 3AUYA 4JNKA 4EVRA 2GYYA 3KJFA 3EDMA 5DTEA 5BVGA 5IAOA 4PQGA 5E7MA 1GKYA 3C6MA 3JV7A 1ORHA 2A0WA 2QLMA 3IIKA 2QY9A 2ZT5A 1ELOA 3VPSA 1NG1A 1ZCBA 4Y7DA 3N87A 3RYTC 1VB5A 3N59A 5AUOB 2X8JB 5ITZB 3FOZA 2BGNA 4U39A 5ALEA 1NN5A 3GJ6A 1B6SA 1DS6A 1G3MA 1T1JA 3HO8A 4HDQB 2F90A 3SFTA 2CFTA 1E2UA 1FTSA 4AWBA 4QULA 1O96A 2PD6A 1LJUA 3SPXA 2A86A 1B0AA 1R5BA 1UK8A 1VG8A 5ALUA 2GZ1A 4E5NA 1QM5A 1Z4IA 3OQHA 4PYKA 4B3XA 4H9GA 4RTPA 4IQ4A 1HE4A 1D4OA 1DZIA 3IILA 3X1KA 3DTYA 3OTHA 1Q83A 2NZWA 3VNQA 1M2GA 2Z08A 3PPVA 4LNAA 4R1SA 1RXVA 5L9AA 1W73A 2AE2A 2C78A 2Z3VA 4JJGA 4CM3A 1S0UA 2AFHA 2UAGA 4CTOA 2ODEA 3VMFA 1BS2A 2ZYHA 3HO6A 2F9FA 1YKGA 2D7CA 2YV1A 1J90A 1I8TA 3KXLA 3TJRA 2ZRDA 3H11B 1RWKA 1BS1A 1IG0A 3CRZA 3EF0A 4RJJA 3COWA 1O8BA 1XJCA 3GHHA 4PLWA 4TT8A 1V35A 2N1MA 4FNGA 3ZHXA 5DNUA 2H1OA 1T91A 3GGSA 4HEQA 3TTSA 3MT9A 2HY7A 1RCFA 1XDDA 2PT7A 3ANMA 4JP3A 4RMHA 4WA8A 1EK1A 1JILA 3QA9A 2PBLA 1Y8CA 1FUEA 1ODCA 5IABA 3SXPA 4OQPA 5JSHA 3EXEB 1IHDA 3G2OA 1Y33E 3PG5A 6PFKA 1QNLA 2HR1A 4M6WB 3KR0A 2H9AA 4NQZA 3HCFA 1VPDA 5A04A 4CEIB 1N3LA 2Y1KA 4JLUA 4TMVA 3A6EA 3O9VA 4GEKA 3T3GA 4B3SB 3OTOB 2G4LA 1RYEA 2Y0DA 4KYTA 3BGOS 2ZDGA 1V1MA 2Q46A 3WGGA 5B58C 2DECA 2J7PA 3PUYA 3D59A 4HO1X 1GPBA 4N76A 2AG5A 2XXAA 4MO9A 4TMFA 1PCXA 3I9V1 4ZI2A 2FAXA 4NBRA 2XQKA 2DM6A 5B7NA 4GQIA 3PXXA 3QG5A 1NVVR 3OJCA 2LWIA 2ZFUA 4LQDA 4ZVTA 3IIIA 5AW5A 5J9FA 4CMIB 5BYKA 4L8WB 2XB9A 2G6TA 1PJZA 1DNPA 5AOVA 2V6GA 3GA0A 2FP4A 3DAFA 4WCFA 3OEHA 3GPBA 2F3PA 4NPAA 5L40A 1T34A 5FQOA 2AOVA 2HMAA 1Z0FA 4Q9DA 4RYDA 3GYGA 3IODA 1DFIA 3B8HA 1X9HA 3BTVA 4YPFA 4PZDA 2YRFA 4UE6A 1QO0D 4WTOA 5FBZA 5AFSA 4G2TA 4MRSA 3CQ9A 3GJ8A 4Y2PA 2PMCA 5EJ9A 3D0KA 2XSZD 3P45A 1E64A 4FGKA 3VSAA 2RSLA 3W1EA 5DLEA 1JAZA 1M5TA 4G41A 3HYLA 1NOKA 2KI5A 1TYEB 1WXQA 4X1YA 1RXEA 4Q9KA 1JI0A 1NUAA 3CNNA 4NYJR 4WXHA 3S99A 4YCMA 1MRSA 2AYXA 4AAYA 4P36A 3LOQA 1NVAA 4IJWA 1GNTA 4K9PA 4X97A 4WLVA 3VH2A 4YUXA 1YRLA 5JY6A 4URVR 2E4YA 2BBTA 2PGLA 2EU8A 1KKMA 1Z37A 1LDMA 1XLUA 1XHLA 3C41J 3IOYA 5AHXA 3RODA 1ZMRA 4Z9AA 1M34E 1PHRA 3JAKA 4F96A 3GLGA 1D6NA 1J56A 3GFSA 1YBMA 2O57A 4QGSA 3BN3A 3G2KA 3FDFA 4JASB 2UXBB 2Q3EA 3QLUC 1J97A 1ZAKA 3MCZA 2XITA 2B25A 2QROA 3PD1A 4CIVA 4UDNA 4B6OA 1UBTS 3ZE1B 2C9BA 4CKZA 2JJ8A 3H8WA 4ETMA 3BMCB 4WOPA 4M55A 4Q18A 3U3RA 4D9HA 4YT2A 4H7EA 4KO3S 2ZM6B 1G8JA 3AEQA 2QRVB 4HRYA 3PHIA 4OHRA 4U0KA 5C3UA 4L5BA 4DGSA 1H2YA 1VL2A 1E3EA 1IRIA 1N5LA 3CX7A 3I6BA 5AW4A 2P0YA 3ZHZA 2EEPA 5GADl 4EMSA 4EJ6A 4LHSA 3SC2B 3UTDA 1VHWA 1XF1A 1GOTA 3GVCA 3IUSA 1N2CB 1J8YF 5AHOA 4DEXA 2QVCA 2QORA 3Q8XB 3F47A 4NENA 3OJWA 1NN3A 3PUXA 3T1VA 4FZVA 2QP4A 4EH1A 1MA0A 3JWHA 2W2TA 4JR1A 4NYJQ 5JD4A 4L2IA 1JIJA 4TROA 2V9CA 1AKWA 2DBYA 1RRKA 3ONWA 3CWCA 4H77A 3CUSA 1Z07A 1P8JA 4MITA 2J9RA 5HNKA 1ZNQO 1YR8A 1IPFA 3JWJA 5C8YA 2GYWA 3NHZA 4MVJE 5H82A 3IAXA 3W8NA 1X1DA 4FFOA 4MMZB 1MB3A 2CVPA 4UE2A 1UH5A 3LBIA 5DF1A 1WVMA 1E2JA 1Z08A 1DAGA 2Y77A 2KSQA 2I3DA 1V9LA 1HDYA 5E1BA 1SKBA 1BMFD 1Y5MA 3N70A 1EVZA 1H9BA 2FZ5A 2G88A 4MCAA 3TLGB 4YP9A 5C32A 1G63A 1UR5A 3NV9A 3MT7A 1KZ9A 1PT5A 3K0FA 5IJ0B 4QD3A 4WASA 1L5GB 4YLYA 1Q57A 1Q3TA 2OY0A 3B1KA 3HN6A 4JUDX 2COKA 4J3NA 2EDCA 5ITSA 1NGSA 1XZCA 3I9JA 1U99A 3PKZA 4DIFA 2ZSEA 5FOSA 4BVAA 4XIFA 5E1MA 3QXSA 1IFXA 3EUFA 5EA2A 1YVPA 3QXHA 1GL3A 2HQ1A 4RANA 4CRWB 4I4TB 4DLBA 4TTJA 4COKA 1GLGA 221PA 5B30A 3BORA 2DFKB 3INGA 3AOEC 3HYRA 2GFQA 1CNFA 1XT6A 3G8AA 4DEVA 2I6GA 3B3QA 2DR2A 4HRAA 1YE5A 3RUFA 1PZHA 2DQSA 2PLWA 2RGUA 1ZC4A 3A4NA 1GGFA 3LV8A 4RZHA 1UZLA 3A0RB 5DIFA 3R9WA 3PC8A 3QGMA 1DKPA 1TA9A 2AGVA 2EP7A 1KMNA 1SBHA 2QTWB 3IHWA 4UEOA 5A3RA 5HQTA 4MEBA 3O3NB 3HI6A 3HI4A 4E08A 4EA8A 1NFQA 1N5MA 3MB5A 3VO8A 2Q2VA 2ZJ8A 2J0QA 2PWBA 1WZUA 4DJTA 4OOFA 5K45A 5CHYA 3NUGA 3P27A 7ABPA 3A1FA 3M82A 4FUQA 2R8BA 3F3MA 1MB9A 1EFVA 5KKAA 3RYFB 4XVUA 4XVCA 3M9WA 4KXYA 1QGOA 1T8PA 3O8OB 1ZS9A 3EDYA 2A94A 1YTUA 3GJZA 3ICQB 3FLEA 2XUAA 4MVJD 1E89A 5IBRA 2HN9A 3DL0A 4BEVA 3DG9A 4WL0A 1I10A 1G5PA 3REFA 3WAGA 2IS1A 2W6QA 4GP7A 3RR2A 3TNDA 1GQSA 2DY1A 3L40A 2PLFA 2V0GA 1TT7A 5AW7A 2AG6A 2G5TA 1JAIA 3B7GA 1Q7BA 4TLMB 2HQBA 1V3VA 3LQKA 4HDRA 4JI6B 2VDWA 1T5LA 4JT8A 1YDEA 3ZGVA 1WUJS 3PHLA 1QK4A 2QBYA 4CEJB 4DHWA 1FQWA 3U9SA 4I55B 3ZV5A 3RTAA 1N2XA 4ZOAA 3LNTA 4OJQA 2PZ8A 4JZYA 1Q15A 4NMLA 1HYHA 1K4MA 4MGEA 2OXIA 4A5OA 2XUOA 3F0TA 1QONA 3SLKA 3WL5A 4BXOB 1T9KA 5G02A 1UPTA 1M74A 4CQMB 3LSTA 4OMDA 4MUFA 3DYIA 4S1VA 2LIPA 4KLRA 3I1FA 5F7ZA 3B9QA 1K3UB 5I7WA 2C5LA 4A8JC 2X6RA 2FN8A 2NUAA 3I6IA 1GUAA 2GZRA 5G3YA 5KYTA 5JDCA 4FVTA 1UC4B 2GLXA 3AVOA 3LBNA 3MAJA 3WYNA 4C4SA 1O03A 4RY9A 2XTZA 2DU8A 2W2LD 4QWWA 2VDMB 4Z9XA 1GR0A 4ZRDA 3ZLBA 3N8IA 4FFBB 1AKMA 3TCKA 2RGRA 3DZFA 2FMUA 2IU6A 1RXCA 5AYVA 3W8FA 2Q1XA 3T3EA 5KOJB 2X3UA 3X43A 3C6ZA 1E3TA 4KMSA 3ZJUA 4GMKA 1NDQA 4PANA 2WM3A 1BS9A 1P0IA 4OQYA 4YY3B 2VQFB 1L5MA 1XQWA 4LMRA 1ZD2P 2F4NA 1P2SA 1JRLA 2HU7A 1KI1A 3CG4A 3FGOA 3DUWA 4RHCA 5K6TA 2XQGA 4DKXA 1D1TA 3HUEA 5L51A 3UIEA 3FHCB 3WKAA 1ZLYA 3KOZA 5TS2A 3QFSA 5DSTA 3FN4A 4NBNA 3L77A 2D2EA 1ZK4A 2QLJA 4KFRA 5EZYA 1Z4QA 1QRUA 3OLCX 1PL7A 5AVOA 1S2DA 4I3GA 5HCUA 1WNFA 3JSAA 3R6WA 2CUKA 2WE8A 4TYQA 2PHZA 4JQZA 3UK7A 1PWHA 1CUGA 1YU9A 2IVZA 3U49A 1NI5A 3KHSA 4WVLA 2QUHA 4RJLA 1RLOA 5CYOA 4CHGA 4QEKA 4EF4A 3AEYA 1KQPA 2W2PA 3B6KA 4NMHA 3IXMA 1ZOPA 1W49A 4Q4HB 5CPFA 1M1YE 3UYLA 4OGFA 1UP4A 1B26A 1C50A 2W98A 2TS1A 1EA7A 5JRZA 2PUCA 4WJKB 1P2TA 2EFCB 2XRZA 3CLRD 4LXUA 2O2GA 2XGJA 1LLQA 1D4FA 1MW8X 1P4RA 3LL4A 5IC6A 3WMRA 3Q7SA 3R9XB 1IJKA 2WU8A 3M49A 4TM7A 3RQSA 1JMVA 1PYDA 4YGYA 4DUZB 5A4MS 2IOHA 2BR3A 2YZMA 3IR7A 4L5AA 4U9HS 5G0WA 1AQ6A 2CJXA 3LKZA 4BECA 2GFHA 1Y5NA 4TYWA 2IHJA 3WGLA 1NOJA 4YREA 4E5SA 1KPHA 3PCRB 2AJDA 2HPHA 2IOQA 4MKXA 1ZIPA 2BL4A 3O95A 3W2HA 1I0LA 4UJ3A 4CG3A 2WU3A 1Y9EA 2O1EA 2HX1A 4G0XA 3E81A 1DBIA 3F3SA 1WNTA 3K9HA 4G3XA 4G56A 5JY1A 1XEFA 2B30A 5LQMA 3ICPA 1LI4A 2ZXEA 4I8IA 2JLZA 2H4JA 2V59A 3R9KA 3PEEA 4BWVA 1U7WA 4MUNA 2VHCA 2NZJA 3MWGA 4BC0A 1DCFA 4EMUA 1F2TB 1J7JA 2G36A 3CR8A 1TQ8A 4GMXA 4OHOA 1G16A 3E3LA 4IEIA 2GCOA 2FXIA 2ZGVA 3KR9A 4RA9A 2XUDA 4H7JA 2NUTA 4PR3A 4BFUA 3M0EA 1Z7GA 1NQ5A 5AVWA 2XPCA 4K26A 2Y0EA 4KSBA 2AOUA 1OFGA 4YRMA 3L7IA 4XSGA 4DY4A 3DB1A 5C7YA 3EEFA 1BQ3A 1TQ6A 2REQB 2N46A 4DLSA 1M1ZA 2VQSA 1OTHA 4KZKA 1H1TA 1OLSB 1KI7A 4ONEA 4UMDA 3UWOA 4ZPJA 3ETNA 3K1AB 5EERA 1KNXA 1PZEA 3W3AA 1HT0A 2DPXA 4F1KA 1LQUA 1PGOA 1E0JA 3NG1A 4F46A 2Z6AA 3ND5A 5EY5B 3RC3A 2X6QA 3CPSA 5HZMA 1XTSA 1ZBDA 3RAGA 2R60A 4Y2RA 5BV1A 3IKLA 4G6ZA 1SQFA 4CIXA 2WJIA 5FUMA 1T8SA 3LT0A 5E7JA 1AM4D 2UUOA 4PTZA 4AU1A 3P26A 5DSXA 3RAFC 4ZVNA 1BWPA 1NLUA 3ITNA 3RNOA 1F1BA 3WYDA 4DIUA 2CK3A 1U1FA 1J8MF 1SBCA 2BEKA 2H65A 3H0KA 1P0CA 3HE3A 4U2EA 1L7MA 2MINB 3IC5A 1H93A 1G20B 1W52X 4OHFA 3IAAA 4TKVB 5BN4B 4KXXA 3W2GA 4DGQA 5B2FA 1ORRA 2IZ6A 1U3WA 3TQCA 1N7HA 3VVLA 4DA9A 4DMFA 3DLCA 3AF4A 4DLYA 2XB6A 4PQYA 3K1YA 4HXFB 1J0EA 1FDIA 1E66A 2W2KA 3ENKA 3E2PA 4K9DA 1Y6GA 1AVTA 1V4BA 4FC6A 1E94E 1KKLA 5A7FA 5K7SA 4DV2B 1HKUA 2MWMA 4R6XA 1CUCA 3N2GB 2EFHB 4Q47A 2E3JA 3DXFA 1YAJA 2OB1A 4N39A 5F23A 2I65A 1ZM7A 3EXIA 4V0NA 3A3YA 2QL5A 3E4DA 5ALJA 3IMGA 3K32A 5ERGB 4DY6A 4EFLA 4E5VA 4MYDA 4EGFA 5K0SA 2GM9A 3ZNPA 4U2CA 4S1WA 1Q0HA 4HF7A 3A4YA 4FYXA 1OPRA 3BDAA 1IB6A 4E22A 2MSKA 5D87A 1GPUA 3ORYA 3L46A 2YL2A 4K8OA 5J4KA 2GVNA 2YY5A 4PY2A 2IHTA 3U7IA 5LDDC 4EO4A 4KQGA 1HDZA 3QY9A 4BFLA 2FUNB 3UB2A 4N8DA 2I2DA 1CF2O 2DTXA 3KKZA 4J76A 1JN0A 1C3VA 1AURA 3AGQA 4GX0A 3GDWA 3AK4A 4R9SA 5F12A 3VJRA 2YRXA 1AF4A 4C01A 4MVJP 1OROA 3A6KA 3I23A 3LK6A 1HR0B 2Y05A 2BGIA 2PAFA 4MOWA 4ZCIA 5AVZA 2BM0A 4KFCA 3BKWA 4B6EA 1VPVA 1M33A 1K8XB 1C7RA 4I9GA 3F3YA 4YRBA 4F85A 5AXAA 2B8WA 4Z9YA 4JA2A 1FNMA 1ZUIA 1LU9A 3RTBA 2WHPA 2Y9MB 3A6LA 3A6FA 2ZYSA 2V03A 3VNRA 4GXRA 4DMGA 5D3MB 1G1MA 4HFRA 4AYWA 2LIVA 2BEJA 2ZIWB 1UC9A 1JFFA 5CT4A 5EOVA 2X5XA 4RU1A 3D1LA 3NPAA 3ZHTA 3G7NA 3D0QA 3IB6A 2ERCA 4L08A 1U9ZA 2H5LA 3RVOA 3RHTA 2A1TS 5IN4A 5TLSA 3HVRA 3ZD6A 1GZ4A 4V39A 5JATA 4EY6A 1ZUNA 1ZI6A 2R6ZA 4TZKA 2BZ0A 1PZFA 4MJ7A 3C3MA 2OCKA 3JWPA 3RS7A 2YJNA 5L3SA 2QRKA 2X42A 1PR5A 3NTUA 2V7BA 4HWSA 1W5FA 1SIBE 1PK8A 2HIGA 2XZLA 3BTSA 1RDFA 1XZPA 3A6JA 4I50F 4Y2YA 5G1OA 1TM3E 2QSYA 4K6MA 5DGCA 3NBAA 3S4YA 3VTZA 2O2DA 1A5AB 2PUWA 2VDUE 3QU2A 2IELA 4XYMA 3GB9A 3DHWC 4GU5A 4JJAA 4IZ6A 2ZZNA 2OXTA 2XX3A 4Q1CA 1RE0A 4PG5A 4QRIA 4KHPB 2ZATA 1IZZA 1WU8A 3ZJVA 2OZKA 5IZ4A 3H9UA 4IEFB 4KKVA 1K7YA 3IIEA 4F86A 4GKKB 1Z4LA 2HBZA 2PUVA 2ZRJA 1T0HB 4AY3A 1FQOA 1YQGA 4OBWA 4PO8A 3KO8A 2ODWA 1WAMA 2QUIA 3QHQA 4ILEA 5DLQC 4D2IA 4ZI7A 4GECA 4GAEA 4LOAA 2GOYA 4BO7A 1SC3A 1LSJA 1GDDA 1RADA 3OLVA 4G0OA 2WUVA 1RQRA 3VR4H 4ZKDA 5TQJA 4UW9A 3JD1A 1NWCA 3PHBE 5HZHA 5D3KA 1JEAA 5INTA 2AFIE 4L4YA 2FKAA 3EE6A 3JWIA 3NXKA 4C0AC 5LP1A 3K4HA 1MORA 4RLFA 1HY3A 5CLGA 5L4LA 3BMOB 5C4MA 4EATA 3QFTA 1YACA 3UOGA 4RORA 4V0QA 1DCTA 3E9MA 3A7DA 3T4EA 4B1FA 4WLUA 1FLNA 3IVXA 1NKVA 1JDJA 3H5LA 4F04A 2Z83A 4EL0A 4AY6A 4DCJA 4GMHA 2O2ZA 3WIUA 1LB1B 3X1JA 3SN6A 4IMIB 4DRZA 5A4JA 4Y2VA 1YFLA 1WXIA 1Z13A 2H2WA 2Q6KA 2QD1A 2PKXA 4UBOA 1YHYA 5FR2A 2QEQA 1RS0A 3SZRA 5LIPA 4DLZA 3HDGA 3F5QA 1GHTA 4EF6A 4RETA 1LWOA 4CL0A 1CE8B 2F17A 3H0CA 3OZ7A 3TGPA 1T9BA 2XDYA 1XLTC 3O26A 5LKRA 2JLBA 2B4QA 4Y2UA 4JJ8A 2B1RA 1L1EA 1UBNA 3DJFA 2J9ZB 1CP3A 3NOXA 2E37A 3GJSA 3U1VA 1TM4E 2WHEA 3ET4A 3O5AA 4C30A 4LDPA 5CA1F 3D8UA 4Q02A 4W9RA 4ACBA 4Q3KA 3ROTA 1ZBQA 1QYWA 2HA5A 1DC6A 1NOIA 3U40A 2P9EA 2YWJA 1E58A 3PQ5A 3TF5A 4TTQA 4XFKA 1J2UA 2I2CA 2FG7C 3OZIA 4WW0A 1T9HA 7ADHA 5L6LB 1V39A 2EW1A 1F60A 4MXDA 1U1IA 4RMIA 3VDXA 1EE9A 5BXQC 1FIUA 1GQQA 2VCEA 5LPNA 5IFKA 4W8OA 3QKRA 4P4GA 1FRZA 2F1KA 3QUTA 3SHFA 3FOCA 3L4EA 5EWLA 1E1RA 2IYQA 3BK7A 2CHFA 2EFEB 2ZR0A 4JB8A 4GGOA 5EPUA 5ICSA 1OU0A 1U65A 3RW9A 1L5OA 2B7LA 3D4NA 3L3BA 4OSOA 3FUWA 1JSZA 2OXFA 2NXJA 3DBHA 3GFVA 2VCHA 3KSBC 4COOA 4P81A 2NU6A 1DAPA 4LV5B 4RA6A 4X54A 1HTBA 4JQSA 3HKEA 2J3EA 2HSDA 3LC1O 2Z3ZA 4C43A 5KDDA 1H69A 1XQ1A 4WCVA 3V4SA 1R6XA 4ZRNA 3EC1A 4EUFA 3AONB 4OXIA 3V2HA 2ZSKA 2C2WA 3CLTC 3P9NA 1PD1A 2FUKA 2JHPA 2RB5A 1Z39A 4PC2A 4RAOA 1BJRE 4XIYA 3T5DA 5A0TA 1XZFA 3MPOA 5AM4A 1YRHA 3DT8A 5AESA 2OYRA 1PP4A 2IIVA 3PX2A 4EA6A 4AMUA 2MDTA 2XRYA 3NU1A 3EMVA 4G85A 4ZCQA 1PV2A 3C87A 5K51A 3NEYA 2D1YA 3UBTA 1SZDA 1OB2A 1ZXBA 2JEZA 2CLEB 3FUXA 4N8EA 1H0RA 4OJNA 2A7XA 5IJXA 1VBMA 1G66A 4RIFA 5KI6A 1JDVA 1Q1AA 2G09A 2JCBA 1SEPA 2QAJA 2UYYA 3TW8B 3VHQA 2VNJA 3ZCXA 4PGHA 3TPCA 1C0LA 4Q7EA 2XMBA 1K27A 3LYHA 3WL3A