4TQ9A

Crystal structure of a gdp-bound g12v oncogenic mutant of human gtpase kras
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
169
structure length
169
Chain Sequence
GMTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and Structural Analysis of Common Cancer-Associated KRAS Mutations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords GTPase KRas
total genus 59
structure length 169
sequence length 169
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tq9A00
1OYWA 1K6MA 1RFLA 1RW4A 2CL6X 4GMDA 3U3RA 4HYYA 3TMKA 1XCGB 1R5OA 3X1XA 1JAHA 3C15C 2AK3A 5G3YA 2UKDA 1XTRA 2CHVA 2JLWA 3R20A 2NOAA 2X1VA 2IYLD 2G6BA 2IS2A 1E4YA 1VDZA 1G8FA 3QF4B 1PUIA 1TUIA 3DMDA 2Q21A 3B1XA 4URVR 2J0QA 4JS0A 2QA5A 3RNLA 1M7HA 2J9RA 1CR4A 1CJTC 4QGHA 4CVNA 1V43A 2ZJ5A 2C98A 1KK2A 1XD2A 4CRWB 2XNSA 4D25A 2FEOA 1NKSA 3THOA 1ZAKA 5FBLB 2BMFA 1COWA 1SQ5A 5DGXA 2QORA 4A2QA 1DVRA 1E1QA 2N46A 3WNCA 5TV2A 3H2YA 2O8EA 1CR1A 4TLCA 3VHLB 3H86A 2B7CA 1AGRA 2WJVA 4LJAA 1IY1A 2ZI3A 3CZQA 2Q9AA 4BGDA 1VCIA 4HLQB 5KSPA 1HT1E 2GZHA 4ESHA 4JLVA 4TZ0A 3IIJA 2FN4A 3FKSA 2D2EA 1XZPA 1FNNA 3W9YA 2ZRKA 5HZHA 4HZIA 2V8OA 4C30A 4M9SA 2W6ID 2AK2A 2JLXA 1YR8A 3IKJA 1I2DA 3QKTA 4ASUA 2YZ2A 3GCGA 4YXWD 1SVSA 3EASA 5IF9A 1X1SA 4QGFA 3DZDA 3ZIAA 4DLSA 1Z28A 4TLBA 3NEJA 4DKXA 3RC3A 1QVAA 5KSYA 4QM7A 1U8YA 2FFBA 4BFYA 1QHHB 2OCYC 3KQUA 5FBQB 1DAKA 3GFOA 4NBSA 3EIHA 1JQJC 1JQLB 2RGBA 1N2CE 4LYFA 1BMFA 1H65A 3F5FA 4OHYA 3KKOA 1RRPA 4QM6A 3CNNA 2NTYC 4PX9A 1NF3A 3N5CA 2GCOB 3HDTA 2QGNA 1U99A 1UBGA 3RANA 3Q85A 4LHXA 3P27A 3ZS9A 1NG9A 2HYIC 4H1VA 3GFTA 4O25A 1TEVA 2CNWA 1XPOA 2ZPTX 3ND9A 2GXUA 4G5OA 2XEXA 4C7OB 1QHGA 4URWR 2CVHA 5FOTA 4Z1MA 3K1JA 2YNMA 4DCTA 3NKVA 3FMFA 3R9WA 4MYCA 2XZOA 2D62A 1X86B 2O0HA 2XTZA 2FMXA 4N1AA 1N6OA 3T61A 1FNMA 4UKDA 2XB2A 3GLHB 2OO7A 1G5PA 4B33A 2GCPA 1E3MA 4JLNA 4RSGA 1GL7A 2W2XA 1VG8A 3GJ3A 1E9RA 4WIAA 1G3QA 4IFBA 3TK1A 1G7RA 5E7MA 5BXQC 1NBME 2QZ4A 3K53A 1N5JA 4A0HA 1T4GA 1UDXA 3GEIA 1DE0A 2QSYA 2IWRA 1KAOA 2QMOA 4EJSB 3PFIA 4A9AA 3LFUA 4QFMA 1Q12A 4QJ4A 4Q19A 4MDFA 5KHOC 3EZ9A 3LBHA 5E95A 3QUSA 1DOAA 1IAQA 2BM0A 3KZ1E 4BFUA 1N6RA 1Z0KA 3IUYA 2RGCA 1P60A 3L0IB 3LBNA 4M1YA 4DLVA 4US2R 1EX6A 4IEEA 2KWIA 1G41A 1DARA 1ZVQA 3KJGA 2KB0A 1ZYUA 2RGAA 1VHTA 4QJ5A 4Q9HA 1HV8A 1W2GA 2Z43A 2OE2A 2QQEA 3BB1A 1OXTA 1I4LD 4AYWA 5A4JA 1N0UA 2QGZA 5HCIA 4AG6A 2ATVA 2A2ZA 4A8JB 3VX4A 5BYJA 5CK4A 3U3MA 2F1RA 1F48A 4OQFA 2HLDD 1RRFA 1NIJA 4LBVA 3A4MA 2VPPA 3AF4A 1PUJA 1FUUA 3DEFA 3TUZC 2YKGA 2B21A 1E9EA 5BN5A 2JDID 3QPWA 1ELOA 2Z4SA 4C0AC 1ZJ6A 2XGJA 1E2LA 1W4AA 2H57A 2QMEA 2D4HA 4OJKA 1II9A 3QF7A 3U44A 1LV7A 1YZTA 2OSBA 3AVQA 2PL3A 3T06B 2BJVA 2P5SA 4EAQA 1OLOA 1CJMA 4I99A 4DT1A 5C2JB 3CRRA 4DC9A 3KFVA 4FINA 1KI6A 1KI3A 3L8ZA 2Z0MA 5EE5B 3R8CA 3CH4B 5C18A 2FSFA 2EVWX 2ZE5A 5FPYA 4JVMA 4MYHA 1CKEA 2C99A 5FOVA 1Q57A 4B74A 1O87A 1MT0A 5LBIA 4F91B 3NBFA 1QRAA 5DSZA 4D4MA 2GAAA 2ODEA 3CRMA 1F2UB 4DCSA 3NG1A 4KV9A 4A0RA 4DJTA 5JS7A 4F92B 1S0UA 5UKDA 4ZV4A 3UXMA 3K9GA 2DWOA 3QE0A 3X2SA 3CWZA 2LCFA 2YOGA 1YQTA 1NBMD 2NPIA 4C2UA 1P7CA 2GCNA 4HSEA 5JCZA 3K0AB 4RD2A 1ZUHA 3X1YA 4DIDA 5FTKA 3HJNA 2GA8A 4C2TA 3TUJC 3CKLA 5TMPA 1P75A 1Z22A 4PPQA 2ZI4A 3THYA 3PQCA 4E09A 1M7BA 4Q01A 2I1QA 2AL7A 2H1LA 1YHNA 1DS6A 2GZAA 1GWNA 1N6NA 2IYXA 2C77A 1DG3A 1UF9A 2F43A 1JB1A 1N25A 1E9SA 3LWNA 3WHKA 5JHGB 3RVBA 3V4FA 1IXZA 1U9IA 5GJCA 4HAVA 4Q1DA 3UPUA 4Q4AA 4LI0A 3ZZUA 3LY5A 5JSZA 3GJ7A 3EX7C 2BWJA 2VSXA 4PHHA 4TSFD 3SDZA 3RDPA 5KDOA 3SI7A 2D74A 4Q02A 3I3SR 4G3XA 5DI3B 1UBCA 1WRBA 2G83A 3TAHA 2ZYWX 1Z63A 5HKKA 3I73A 1G6HA 2ZJAA 3ADDA 1OXXK 3B13B 3AGPA 5CDFE 1ZNXA 5ELXA 4IDNA 2KJQA 621PA 3AH8A 3GLHE 2C04A 1DAIA 4DSUA 4KBFA 2I3BA 3FB4A 3D6TB 3QBVA 4PFSA 2WOJA 1Z83A 3T5GA 3BC1A 3GLIA 4BLOA 1CJVC 2ZTSA 4M0LA 4OBEA 1G8PA 3X1WA 1KNXA 2W58A 1J90A 3RRNA 1EFUA 1H8HA 1Z47A 4PTLA 1J99A 1P61B 2ZJYA 4TYWA 2QU8A 3D31A 1YRBA 4QBFA 3FTQA 5BWMA 1NP6A 1NVUQ 3UMSA 1RYFA 3I8SA 2V6IA 2FF7A 3OFNA 2N1BA 2H16A 1Z2CA 3R7WA 2OUKA 1Z0JA 5EQTA 5AJVB 3B5JA 3JZAA 4IDQA 2WSSD 5JI3E 1WMSA 1MO6A 5AJZA 4DRZA 1R8QA 2ZRGA 4RJLA 3WHLA 3EIEA 5J4HA 5DN6A 3CF6R 2GJ8A 4Q66C 1RC8A 1QBKC 4G1UC 5D3MB 4QJ3A 4AIIA 2C03A 1E0JA 4EIWA 1W5TA 4YDHB 1XMIA 2XNDA 2IYVA 3PUWA 1Z8FA 2VHQA 5DI9A 5FBRB 4IVQA 2PJRA 3NDBB 4MKIA 1EK0A 4RD3A 1K5DA 1OE0A 1QHNA 1E9BA 3CPEA 4JBWA 4L9SA 5KSOA 2TMKA 3QXSA 5E7IA 2ZRBA 5CM9C 4K8OA 1OIXA 3WP1B 2UVQA 1S1MA 4UJ3A 4A36A 1Z2AA 3GD7A 1A82A 1TF7A 4RD4A 4PR0A 3MWKA 3PV0A 3QQ5A 1UKVY 1A4RA 2ZJ8A 3GJ4A 2GF0A 3TRFA 3LVQE 2ORIA 5K8LA 5DLQC 1MABB 2QM8A 1EFCA 4JT2A 3H0KA 3NEYA 2CHQA 4KO8A 4HUQA 4RFVA 4WXRA 3W8NA 4LCBA 1HEIA 4P4SB 1AS0A 4GNKA 2BKUA 3NBZC 4RCYA 1OB2A 1KI1A 3X1DA 3IEUA 1KGDA 1OXVA 2ODWA 2AD5A 3KJEA 3VU9A 2V1UA 4GP6A 3B7GA 3WNBA 1RRGA 3WMGA 3VNVA 2JLSA 2BVNA 3SYKA 3R9XA 1FPMA 1W44A 5FL7A 4OL0A 2ZSAA 4CW7A 5JCPA 3NH6A 1DAGA 1ZUNB 1IOZA 4OQXA 2NG1A 2ZRFA 2GTPA 5FFMA 2R44A 1W4BA 1E2NA 1N5IA 5AWFC 1VYVA 3IQXA 2QAGA 4PC1A 4HATA 3G0HA 3ICQB 1QDEA 5FOUA 4BPBA 1P62B 3PVSA 5HPYB 3AB3A 4M9XA 1HH4A 3KKMA 2DWQA 5EP1A 1ANKA 1XMJA 4FI3C 1EESA 3EXAA 5LD2C 4Q21A 4Q4JA 1Y63A 4AWXA 4ZO4A 3W6PA 1Z0AA 4IHQA 2FV8A 2ECKA 2HXSA 4KODA 4V0LA 5AUOB 1COWD 4P4TA 4MRVA 2ZJBA 4TT3A 5C4GB 4YMVA 5FTLA 1JJ7A 1XB2A 2F3TA 5KU1A 2QEQA 3PENA 4M2LA 1HT2E 1Z07A 1XEWX 2C9YA 2QG6A 2ZS7A 2IT1A 3C16C 4M21A 4CYMA 3THXB 3AP3A 1UM8A 4DB4A 2HXYA 1XTJA 3OIUA 2QQ0A 4CZ2A 1WP9A 2RGXA 3QKSA 521PA 1CRQA 2RCNA 2EQBA 2VP6A 4M1WA 4IVRA 4TL7A 1VCOA 2Q6TA 3QXHA 2R2AA 4I1OA 1J70A 1WCV1 3RWOA 4KU4A 4W7SA 2BBTA 4HB2A 3UG7A 1AA9A 4Z8XA 5B58C 3NIBA 2EU8A 1Z0DA 1XXHE 3O8CA 4P3YA 3EZ6A 4O0MA 1W48A 2CBZA 2CJWB 2YJTD 3OFND 4MKHA 1DADA 2FSIA 4LJ7A 5BQ5A 3SJAA 1P4SA 2OFXA 3IEVA 4A8JC 1B0UA 3FHTA 2YWEA 4GFDA 2GEDA 1H8HD 1AKEA 2X77A 2OESA 3CX8A 3LVRE 4NCJA 2AX4A 3AVYA 3CX7A 4RZXA 2CEAA 3RSLA 4HLCA 4BFSA 2WWWA 3T15A 2YYZA 2AKYA 2D7DA 1IN5A 2CHGA 3QKRB 1AZSC 1KI2A 2AFIE 4WZ6A 4UQOA 4JLMA 4PSVA 4B6EA 4EQ6A 4FCVA 1W4RA 2J45A 4BZXA 3TAUA 2GXSA 4F38A 2CCGA 2O0KA 2MSCB 3K70D 1FX0B 4QKQA 1T0JB 2A5YB 2RGEA 4D0GA 2NO6A 4PPGA 2IS4A 4RD6A 3LH5A 1PLKA 3DM5A 1CP2A 3LRPA 2BJWA 2ZVQX 3I1FA 4P0TA 2VQSA 2VRWA 4BQSA 5TB5A 1ZIPA 5EE1A 4X8MA 1TL7C 4JZKA 5TDHA 2J59A 4XWOA 1NN5A 3OIWA 4GI7A 1JXMA 1NVVQ 2NZ8A 2RGGA 3FWYA 1Z3IX 5CK5A 4DDVA 1FX0A 2SHKA 5L3QA 5CYPA 1CEEA 2A3RA 4NTZA 5IK2A 1YU9A 2FX3A 2RAPA 1XBTA 2HUPA 2XAUA 1KIMA 3HWSA 3A1WA 3RHFA 1X8JA 5JLJA 1X8KA 3IIMA 5F9FA 4YXWA 1U81A 2OZEA 1MOZA 1XXHB 4TMKA 1L4UA 2IEZA 1YE8A 4MRPA 1HUQA 2YV5A 2QT1A 3BB3A 4OQMA 5HR5A 5FOXA 1XU4A 2FPLA 1R6BX 2V7QA 4V02A 3CH5A 3NBYC 4AC9A 3T35A 4II7A 1P2UA 3RS0A 4BFVA 1RRCA 4DDTA 3CX6A 1M6NA 2F9MA 2FFAA 3GLFE 1P2TA 4GOXA 4HDQB 1XTKA 1M74A 2ZU6A 2XJ4A 2CJWA 3IILA 3I5XA 4BE7B 2GDJA 4QBIA 4ACAA 1GOTA 2B6HA 2ODNA 4OHZA 2OBLA 1EFTA 5CJPA 1YRAA 2WJJA 1PJRA 3LD9A 4JKYA 4B35A 4OHVA 3BXZA 3EG5A 2P6UA 4US1R 4BUJA 3K09C 3AVWA 4QNRA 4Q5IA 2PCLA 1ZC4A 4OQLA 3I4LA 1E2EA 2HEIA 2ZAOA 3QKSB 5CB6A 4WZBE 5KTYA 5HCNA 2ZRLA 3KTAB 2BC9A 4Q9JA 2ZRCA 5FPSA 3VAAA 1GILA 4DCNA 1QF9A 2AXPA 2JJ2A 3THXA 3GJ5A 3DHWC 1AK2A 4G5RA 3NC0C 2ZANA 2EWVA 1FFHA 3GLGE 4NKRA 4HAXA 4I1SA 4HLUC 5DE3A 1J7KA 4LDJA 4LHYA 4G0NA 4Q4JB 4H1UA 1V5WA 4XSGA 4ZDJA 2WTUA 4A2WA 4JBYA 1BOFA 4XD7A 5KSZA 4IVPA 1SHZA 2YVUA 4R98A 1FZQA 4OYHA 4XH9B 2FZ4A 2WPDD 5HTKA 1T3SA 4LJ6A 5E3HA 3DOEA 4TLDA 3A4LA 4LYHA 1OFHA 5CITA 4FMCB 3U6KA 1GG2A 4J0QA 4UNPA 3K0SA 3JVVA 5FL3A 1N0VC 4LYAA 2J3EA 3TQFA 3B6EA 3K0FB 3P26A 4DWJA 2OLJA 3BERA 4NYMR 2FZLA 3Q7QA 1CF4A 2JDIA 3MG9A 1VCNA 4CEJA 3MSXA 2WKQA 4DHEA 5JZVA 3SOPA 4MKGA 4IOLA 1LW7A 2QTHA 4FIDA 1UEIA 1E2KA 3SYLA 1P9NA 3VU9B 1SKYB 1T3HA 821PA 2OBMA 2QRNA 2ORWA 1IY0A 2OILA 1E96A 5KOYA 3CO5A 4HUQB 4L5BA 4X8LA 5JHHB 4LJ4A 1MABA 2GILA 2CMKA 2OXCA 5JWRA 1YZQA 1R0YA 4GMXA 2JA1A 4HB0A 3A6PC 1W1WA 5AJWA 1CU1A 5FBVB 2QP4A 2JCSA 3ADBA 2A9KA 3BRWD 2GF9A 2QM7A 1J8YF 4N3NA 1G3MA 5EXSA 5G53C 3KJHA 1KSJA 1KO7A 3LA6A 1ZNZA 1TMKA 2J7PD 2VP0A 4FMCF 4Z1MD 1FP7A 1VECA 2WWFA 2VL7A 1MRSA 1S9DA 4U5XA 1S1CA 4AYTA 3T5DA 1XCPA 3ADCA 3GFPA 3OEHA 1PLLA 3LXXA 4R7ZA 2B7BA 3B9QA 3LQQA 4D4JA 3OZXA 1E2IA 1E6CA 3IDQA 5GJBA 1QHXA 3GPLA 4A15A 2VP2A 1IHUA 4U00A 5K8UA 1GITA 4Q7JB 1DPFA 4URZR 2YC2C 1NJFA 2ZSBA 1ZM2A 1G64A 3KUCA 5EUQB 5EP2A 2E87A 2WMNB 2DB3A 4OK5A 1Q22A 4A6PA 4OJQA 3CWQA 4NYIQ 2W2TA 1II8B 4OHWA 4RKEA 1BMFD 1N5KA 1PV4A 1Q3TA 1N6KA 4CT4B 1SVOA 4NP6A 1Z08A 5L8VA 4B3XA 1IBRA 1N0WA 2Q9BA 1WBDA 2Z6VA 2ZRPA 4NCNA 4DUGA 1VCMA 3AVTA 2VHCA 3H84A 2GNOA 2GXAA 2J41A 2IF2A 3CF0A 3DO6A 5JRJA 2QE7D 1KOFA 3A37A 2J7PA 3BJIC 3DL0A 5GJWC 1G5RA 3C41J 4Z51A 3ZS8A 1JXOA 2ZYVX 1R8SA 1XEWY 3B2EA 4JJKA 5G40A 1N6HA 1YZGA 1IONA 3I72A 2IYTA 2REXB 2ZI6A 4W9MC 1Z0FA 4JLBA 1HY3A 1E1RD 2C9CA 4C0SA 3DDCA 2MSDB 1SGWA 1AS3A 4U02A 1SVWA 4WVFA 4U7DA 2J0UB 2RGDA 1XD8A 2W6JA 1OKKA 3OIVA 2G88A 4D82A 1KI8A 1W0KD 3R8FA 1XZQA 1SVLA 3BH0A 1FTSA 3TSOA 4ZDKA 1FQJA 2JASA 5DI3A 4UJ5A 1D6JA 1R0WA 4POAA 1L7VC 2AN9A 3MWLA 1S4QA 4YMTA 1E0KA 3TW4A 5JSZB 2FU5C 1Q1EA 4YMSA 4K81B 2IXEA 2JLYA 4OK3A 4BFTA 4TQAA 4B73A 1SKQA 2X2FA 4FD2A 2F43B 1M34E 5BYKA 1DAFA 4TLEA 2OV2A 4RD1A 1DO0A 5KYKA 3KFXA 2HF8A 4TT3D 5E7JA 2FH5B 3U3JA 2CLCX 1OT3A 1S3GA 2WMOB 2FE4A 4OI0A 2ZUBA 3KL4A 1LS1A 1JJVA 2ZITA 4GOKA 4LUCA 2BMEA 5A5GA 5JS8A 2C96A 4TLAA 4BFWA 1TQ6A 2ZR0A 2IYRA 4CDGA 3E5HA 5SZHB 4B71A 1W4CA 5JEDA 2JGNA 3PUYA 1LF0A 4MGKR 3CBQA 2ZRJA 2BCJQ 2IBMA 2VLIA 1CRPA 4KFUA 3U5ZB 3BH7A 4JYBA 3T1QA 1OFIA 4LV5B 3OIYA 1VHLA 4B47A 1W0JA 4PC3A 5FI0B 2BIFA 3PUVA 4XWKA 1U8ZA 3SFZA 2IS6A 2XZLA 4LHZA 3CNLA 1P9RA 1UKZA 1T8TA 4FWTA 1KDOA 1Q1QA 1T5IA 3RS7A 1SVKA 3CIOA 3EWAA 4BRUA 1KI6B 1T8UA 3TVTA 4NDZA 4V0MA 3MRSA 3GP8A 3BFKA 4DT1B 3PIRA 1JR3A 3FFBA 3GJXC 2WM9B 4DSOA 1I4TD 2RKOA 4LX0A 4US0R 4RZUA 4DEYA 2IYUA 3HR7A 3U2QA 4NPHA 3FE2A 3Q3JB 4BLTA 5AUPB 1EGAA 4YQFA 2WJIA 3A1VA 1AIPA 1G3IA 1TU3A 2XTMA 3AUYA 4B2IA 4XD7D 5KUTA 2BMDA 3GEEA 3KX2A 2GVZC 2D7CA 2OFWA 4TN1A 3LXRA 2R6AA 4NMMA 1NJGA 5GVSA 5JI2E 2OCAA 4A8JA 3FHCB 3SR0A 2MSEB 4M1MA 3A1UA 3AKDA 1OFUX 1PZNA 2CLDX 3C5HA 4M8NE 3PEWA 4NCHA 4BLPA 1VKJA 3O8RA 2R6GA 1SVIA 1K5GA 2VSOA 3HPRA 2CXXA 4JL5A 3BGWA 121PA 4F93B 4BZQA 2NPFA 2KI5A 1XTQA 3CRVA 1E2HA 1P72A 2F1HA 1BIFA 1UKYA 4PAQA 2ZJ2A 5E4FA 2CCKA 4R71A 5C4MA 2MMGA 1Y3AA 2IA5A 3ZJYA 3EC2A 3F3YA 4H9GA 4C4PA 3M6AA 3BFVA 3CW2A 1H8EA 4B44A 2REOA 5FTNA 1P9WA 3CM0A 5F2EA 1GKIA 3AKCA 4DDWA 4XSHA 2EFGA 1S3SA 3RSOA 1R4AA 2O0JA 2F7SA 2J87A 1HE1C 2J0UA 3VKGA 2PT5A 3CF2A 3DMNA 3G82C 2V3CC 2XX3A 3KKPA 1KDPA 3GLHA 5FI1B 2PEYA 2J1LA 1W2HA 1S2MA 1YR9A 2F1IA 2ZM5A 4LRWA 2OT3B 1A5TA 2IYQA 2BEKA 3N2EA 3CRW1 2A30A 3EC1A 3KJIA 4JLJA 5GVRA 4BRWA 1XPUA 2EWWA 1DO2A 1G18A 2D2FA 2BMJA 4Q1CA 2ZUDA 4EPVA 2LKCA 3PEVA 3G5UA 3PITA 4C7OA 3SS8A 2NQ2C 5FTMA 1FUKA 2GK7A 5AUQA 5LB4A 1NI3A 2C78A 4KVAA 5DNYB 2EFCB 2QMHA 2XSZA 2Q9CA 2QROA 3CR8A 4L8GA 3EPLA 2ZROA 3GJ6A 4CIDA 1II8A 4IDPA 4AYXA 1ZM3A 2H17A 2OXRA 1CULC 2VP5A 4Q7MB 3E1SA 5B30A 2ANCA 1N6PA 3NDPA 2WBLC 2WSSA 3IO3A 1F60A 2HF9A 4TTQA 4OI2A 2EW1A 2X19A 3WRXC 2PEZA 4Y0AA 2B92A 1SXJD 3TW8B 1FOEB 1QHHA 1E2JA 3NXSA 2ZSDA 3WRYC 4JT4A 5TVKA 4LZZA 2JLUA 3U7GA 2WWIA 3CPHA 3TH5A 4Q7LA 3DZ8A 1YZLA 4PAOA 4WW0A 1Q20A 1ESNA 1ZC3A 5AUNB 1IN8A 1F5NA 4Q18A 2ZEJA 1G20E 1HYQA 2GJAA 4WAUA 1UJ2A 4HI0E 3UMRA 1E9FA 4MQBA 1Z6XA 4QGGA 4EPXA 3CB4A 2WZQA 3ZZTA 3C7KA 1KI9A 1KY2A 2JIZD 2JJ8A 1OXSC 4ZI3A 3NWJA 1T6NA 2OAQ1 1RIFA 4TMZA 1XTSA 2O8EB 3EARA 3RABA 2AHOA 1MO3A 4PAMA 5EZ6B 4FMBB 1A7JA 2P3SA 1W36B 1DG1G 1X3SA 2QPOA 4B3GA 1XMVA 3SQXA 1U98A 2C8VA 1OXUA 4MRNA 2V6JA 2FFQA 1Z06A 2J5XA 1I2MA 1XD2B 2YWGA 3P4XA 5CDFA 4CEJB 2ZIAA 5EZ5A 4RCZA 3HU2A 1XP8A 3K0FA 2XOKA 3T1VA 4URXR 5JJKA 3QY0A 2IYWA 2NZJA 3SEAA 3UKDA 4EKDA 3AKEA 4C0HA 2GEUA 3QF4A 5GJVC 5BW8A 5LDDC 4YDSA 4OI1A 3KB1A 2VO1A 3B85A 1Q44A 1ZM9A 4JKIA 2ATXA 3UG6A 2ZR7A 2FPKA 4P32A 3TE6A 2QRZA 4X8OA 3SFVA 4A6XA 2WAXA 5KO2A 1E69A 1SULA 3KDSE 3IBYA 1X6VA 3Q5DA 2HLDA 3ONWA 4EUNA 3EPHA 4WOPA 1XJCA 2RGNA 4ESVA 4B3BA 2AD1A 5J47A 2DY1A 4QL3A 4X8HA 1GTVA 3FOZA 3LW8A 4ITRC 4OQNA 1NLZA 5CYOA 4KAXA 4LOAA 2KE5A 3EIQA 4IXNA 3W3ZB 2VA8A 4TMVA 2CLSA 5JFGA 4A2PA 5IDVA 3LX8A 5H1YA 1GKUB 5KPDA 3KTAA 1VIAA 1ZCBA 4Q48A 3TSWA 4ACBA 1RKBA 3MWJA 1G17A 4HZUA 4BEBA 2QP9X 3O47A 2ZYTX 4GOJA 2P6NA 3AP1A 4XIGS 2QP3A 2WV9A 4K46A 1FW6A 4L9WA 1L4YA 2EFHB 2IXFA 5J5CA 3CNOA 3T1TA 4UXHA 2WICA 4FMDF 3L2OB 4B3CA 1KO1A 4B6FA 2HV8A 4PQRA 3R9IA 5HE9A 4QOSA 3W90A 3TGPA 3N70A 2IC5A 2UZIR 1IXSB 4XJXA 3I92A 3BORA 4F4CA 1G8GA 2JJ1A 3AKYA 3NTUA 4B76A 5CLQA 5FUYA 4D4LA 1BS1A 3U3OA 4I4LA 1G4UR 4OKSA 1KI7A 2ZRIA 1IXRC 2GJSA 2VTKA 5BN3A 1XXHA 3T12A 4NYIR 1P2SA 1Q1BA 4HDCA 1EFRD 3NH9A 2GJKA 1N3BA 4ON9A 1G8YA 2NO1A 2V54A 1LF5A 3H1TA 4KSCA 2DWPA 2GWHA 1M1YE 5L3QB 3ZZ0A 4LV6A 3SQWA 4TTRA 1F3OA 2FWRA 4BECA 5LPNA 5CJ2A 4BLRA 1TF2A 1YZNA 3HYRA 2GEVA 4GL2A 1MRNA 2ZRHA 4FMDB 4MUAA 1OHHA 1A2BA 3AVOA 3W34A 1KY3A 3IHWA 4BLSA 1QG4A 4DEXA 3MD0A 1KSHA 1E4VA 1ZINA 1G21E 1VIYA 2O8BB 1XRJA 2O52A 5J40A 2NMVA 4EQ6B 1M7GA 3ZIAD 4MUBA 3VFDA 3DKPA 3HU1A 3TNFA 5L3VA 1Z29A 2ODBA 3QPVA 3QKRA 1KZGB 4UNQA 4C0KA 4ZI2A 6Q21A 2EYQA 3AQ4A 1E32A 1NLYA 4DCVA 1IQPA 2F3RA 3ZVMA 2KSQA 4XTCS 4KFSA 1R0XA 3ECCA 2N42A 1UFQA 3B60A 1F6BA 2V55B 4Q1EA 3LNCA 3L0PA 4Z54A 2QTFA 3ZD7A 3M0EA 1BKDR 2ZI7A 2B8TA 2RMKA 3BK7A 1DAHA 3EZ7A 1II0A 3KQKA 1KYIA 2ZVPX 4I1VA 1E2PA 1MO4A 5DHAA 1IN6A 1EWQA 2IF0A 2HCBA 1ZNWA 3QNUA 1JEDA 1CTQA 3UATA 1MH1A 2ANBA 3THWB 4RD0A 5JJIA 2WIAA 4EPRA 1U9IC 2G1KA 3E70C 1XTIA 4NHOA 4ZCMA 4WZAE 5FOWA 2H18A 2YOHA 1QG2A 3P4YA 3VQTA 3MAAC 4MYTA 1O3YA 4LHVA 3VHXA 3AF2A 2BV3A 4I81A 4TYYA 2LKDA 1DAMA 5J4YA 5SZJA 1KO8A 3W5JA 1AQYA 3LX5A 3OAAD 1BYUA 1EFHA 5ANRB 3OEHD 1CS4C 3QXCA 3OE7A 1WA5A 1Z6GA 2DCUA 3U6BA 4JSYA 2BM1A 4RZ2A 1W0JD 2Q3HA 3HYTA 4V0NA 3GLGB 1XDBA 2V9PA 1WF3A 4QHTA 4OI4A 3N2IA 3QG5A 2VH5R 4EJSC 3CPJB 4HDOB 1ZD8A 4CF7A 1X1RA 4RZ3A 1P2VA 5KDDA 3IPYA 1IM2A 2K5UA 2R6FA 5H70A 1RE0A 4LJ5A 1FP6A 2QAGB 4R9UC 4QBHA 2MMCA 4MYUA 3A36A 4JLKA 3BB4A 3K9HA 5KNBA 1ZD1A 2ZUCA 4JVNA 5AK0A 2ZE6A 1GNQA 3L82B 1KKLA 3Q7PA 5JWHA 3RAPR 4E03A 1U90A 3TVDA 1KI4A 2DR3A 1KO5A 1E2MA 4IEIA 4KFRA 2HJGA 4KJZA 3PXGA 4DLTA 2IX3A 1OPXA 4Q47A 3SZRA 2W0SA 1WE2A 1DEKA 1C4OA 1OSNA 1AM4D 2ERYA 3FMOB 3VR4A 5CB8A 3I62A 1VTKA 3RS4A 2P6RA 1DBSA 2VYFA 3C14C 1U0HC 5FPTA 2ZE7A 1OJLA 4P4SA 1HA3A 3KXIA 3OESA 1MV5A 1CXZA 3A8TA 4F4JA 3QEJA 4V03A 3TBKA 5F98A 3C8UA 3LLUA 3BFXA 3WYGA 1W0KA 1E98A 2XB4A 3HR8A 2F9LA 1IJFA 4LBZA 4QBGB 3RYTC 2B8WA 3UANA 4G5SA 4BZPA 5KNDA 1W49A 3WBJA 1E2DA 1G4AE 4FXPA 4P31A 4JSTA 1UDWA 3PCRB 3REGA 1T5LA 4DSNA 2VHUA 4URUR 4JJZA 2FNAA 2PX0A 2QBYB 2Y8EA 3M1IA 3QKUA 1P73A 5H68A 1E9DA 1EX7A 2ZRAA 4EPTA 4JIMA 1HE8B 3FPAA 3VKWA 2GXQA 3B1ZA 3VR5A 4QRHA 3TUIC 2OCBA 5EXTA 4NE2A 3K9NA 2L0XA 1CIPA 1W36C 4AURA 2CDNA 4PC7A 1KZ7B 3P20A 1OH7A 4G01B 3QBTA 3I61A 1XEXA 3U7HB 2WWXA 1NVVR 3O8DA 1FL9A 1G7SA 1ZM7A 4A92A 3OEED 4N0EA 1ONBA 3EA0A 1N6LA 3KB2A 5D3MA 5EXXA 3TR5A 3ZDQA 2WWYA 4KLZA 2VIIA 1ZM4A 2FEMA 4A4DA 3WYAA 1CLUA 5TARA 3QXXA 1WBBA 3SJCA 3AUXA 2WKRA 4HAUA 5FOSA 4PPFA 3K70B 2FSHA 2FGJA 4PZZA 5FPKA 1NMZA 3R7WB 4TWZA 1T91A 3RS5A 4L16A 3W3AA 5A0FA 3OEEA 5FUXA 3AP2A 2V4ZA 2KBEA 2QNRA 5BN4A 1IY2A 2ZI5A 4BWYA 1XPRA 3J81k 1VG9B 3A1TA 3Q9LA 2IUTA 2D06A 4GP7A 1C1YA 1SZPA 2WJHA 1TQDA 4NYJR 4IDHA 5DYIA 3SNHA 4KHZA 2WHXA 5FUWA 4TMXA 3W8RA 3I5YA 2ORVA 1TPZA 1YKSA 4UXIA 3GLIB 5DYGA 3A1SA 3MLEA 1J2JA 1R5BA 1YR6A 3UIEA 1NVXQ 2ZE8A 2HCJB 2QE7A 1SHKA 1KJYA 3L0SA 2W0MA 3S1AB 1KSGA 1EFRA 2ZU0C 1GL6A 1E2FA 4L15A 4DUGD 2XTNA 2PCJA 4BFZA 2NGRA 2Q0HA 1BO6A 4TQ9A 2BOVA 3MWYW 4DSTA 1OH8A 1XMSA 2F55A 4CEIA 4Q1AA 4Q1BA 2VP9A 2QT0A 4F7WA 3GLIE 5DO9A 2GHIA 4ZDWA 2G77B 5DIFA 4B2LA 2G0NA 1OV4A 2A5GA 2BEJA 1KTVA 1Q3HA 1TAGA 3O8BA 2XZPA 2HT1A 3D3QA 1TQ4A 1E79D 4Q4AB 1JR3D 1G5TA 2ZRNA 3MMPA 4M1SA 4MA4A 3AV0B 5D3QA 1GSIA 2CE7A 3ZVLA 3B1WA 3GJ0A 3WY9A 3C5CA 3ZLJA 2C5LA 2IK8A 2HYDA 2QI9C 3WMFA 5J4LA 2P67A 4PANA 4G5QA 1FQKA 1BYIA 1EXMA 4B34A 2ZAMA 3THYB 2ZETA 1FTNA 4E22A 4V0KA 3P32A 4F4IA 3ASZA 3Q72A 1ZP6A 3GQBA 3K0AA 4Y0VA 2XXAB 2I4IA 2Z83A 4YC7A 4PHFA 4EPWA 3MGCA 2IXGA 3KKQA 1T3LA 2IYZA 5AR1A 1HQYE 4KYIB 3SN6A 2J0SA 1LY1A 1NG1A 2IHYA 4CGZA 1DAEA 1F2UA 3B82A 4DLWA 3I8XA 3GEHA 1AQUA 3JZMA 2OEPA 1WDTA 4UNRA 2JATA 1T9HA 1YZKA 4R2IA 4QNMA 1G7TA 1Z6AA 2ZR9A 1W36D 3B8HA 3FGNA 3CLVA 4LHWA 3SBDA 1TU4A 2OFOA 1LNZA 2VHJA 1KMQA 3U60B 4DDUA 3NC1C 3OAAA 3VR1A 1GP2A 3VTKA 4E5UA 4JMPA 3K0CC 4GDFA 1NVWQ 5EE0A 1Q0UA 4LJYA 4PHTA 1AZTA 1JAIA 1TF5A 4PC2A 3VR3A 3BAFA 4KCGA 1G1MA 1T0HB 5FTJA 3WP0A 4CT5A 1E79A 3AVPA 1SKYE 4IRUB 2RH5A 1KJWA 4URYR 2E1RA 1IJEA 4QHSA 3U44B 4O2RA 4C0JA 1XEFA 2G1JA 2O8CA 3VX3A 1ZW6A 1KDRA 2ZS9A 2IWHA 3LO5A 5EJEA 1UAAA 1WQ1R 4MITA 3T34A 4JL6A 3PEUA 4MRSA 1KMHB 5EXPA 4KI0A 3SU8A 4AKEA 3QVVA 2PLFA 3BH6A 1NSTA 1NNEA 1G19A 1OYYA 2ZRDA 4PC6A 5G3ZA 1W46A 2V7QD 1U8AA 4NCIA 4AG5A 2GAOA 1WB9A 3AF1A 3EZ2A 4D4KA 1US8A 1RJ9B 2GETA 2PLRA 4HB4A 2JIZA 2FPMA 4PO9A 2CCJA 4B32A 3K8YA 1GIAA 1XJQA 2O8FB 1D9XA 4NCKA 1UPTA 2QTVB 2ZS8A 2J7KA 1D8TA 2PMDA 4JVSB 4PO8A 3PJRA 4DXAA 3UWOA 5LD2B 1Z6YA 3QOFA 2PT7A 3ADKA 3BS4A 4EPYA 1JI0A 5EE9A 3VMFA 4EJSA 4LJ9A 5JWOA 4AI6A 5H8WA 2VF7A 4HLDA 3WNDA 3K09A 2JJ1D 2DFKB 5DH9A 1Q1ZA 1NKTA 3MCAA 2PZGA 4AD8A 2XNDD 1RVDA 3QEOA 4KVGA 1AJEA 2FOLA 3B78A 1ETUA 4M9QA 5FBWB 2YWHA 1JR3E 1U2RA 2W00A 4TYPA 1R7RA 4IOJA 1A2KC 3DPUA 1M8PA 3K70C 3U61B 3AM1A 4DLRA 4B2PA 221PA 2OM2A 1UADA 2YWFA 3GMTA 3HPQA 4IFEA 1KAGA 4BEJA 1GRNA 1NRJB 3C4JA 4HEJA 2P0EA 3CZPA 4TMWA 1GUAA 2YC4C 4B3FX 4DLYA 3QSYA 1HTWA 3W6OA 4E07A 1N5LA 3KQLA 3KQNA 1DTSA 1FMJA 5IRCD 1UEJA 2AXNA 2WOOA 2FA9A 3ZQ6A 5J4KA 2O8FA 4P4UA 1IN7A 2CL7X 1Z5ZA 2EFEB 4D80A 1JECA 1KK3A 2GJ9A 3QPUA 2DHRA 3FMPB 1RJ9A 1QVRA 1US8B 1E2QA 4MRRA 5HZKA 4JL8A 2WWHA 1JEEA 4I1UA 4Z8YA 2GCOA 4YMWA 1E2GA 3VKHA 1ZU4A 3CONA 5DN6D 2CK3D 2RHDA 4NZYA 1KMHA 2ZI9A 3VR6A 2WVJA 4JYCA 2DFTA 2QUZA 3V9PA 2Z4RA 4PXAA 1E0AA 2IL1A 2OHFA 4Q1FA 2VHTA 3A58B 2R6DA 4Q4LA 3OF5A 2H7VA 4HUTA 1RZ3A 3ZQJA 2ERXA 2VEDA 2O8CB 4AKIA 2A5JA 4LPKA 4LY6A 1ZRHA 4IOKA 3EA5A 3OE7D 1UKEA 1U94A 1KDTA 4DBLC 1OH5A 4XVUA 3A4NA 4ZDIA 3DM9B 5GADl 2G9NA 3W5IA 3FVQA 3EPJA 3I32A 1LB1B 1NN3A 3WXMA 3GJ8A 4MH0R 3RS3A 3UWKA 2GRJA 2YOFA 4IDOA 4LYJA 4QC2A 3KKNA 4ILEA 3IGFA 2AR7A 2JLQA 1S9HA 2AKAB 5HKKD 5IT5A 2HT6A 3KXKA 2WJYA 1JALA 1G3RA 1R10A 1TQ2A 4D2IA 1QHYA 4ZKEA 2LWIA 3FMIA 1G8HA 1R0ZA 4DZZA 4MGIR 1NN1A 1YVDA 4HLUA 3FHOA 3L43A 4UNSA 3RWMB 4PZYA 1X8LA 5EE3A 4UNNA 3MUFA 1D2EA 4IJMA 4KBGA 3PR1A 4PHGA 2DYKA 1E94E 2I1VB 1HURA 2XXAA 5JRZA 2DFNA 3BBPA 4QXAA 2Z5FA 3DOFA 4B75A 5CLLA 4HB3A 1WXQA 421PA 3TIFA 3DKVA 3D7MA 2OAP1 4HAZA 3TKLA 1L2TA 2WKPA 4NYJQ 5DISB 2XOKD 3FYHA 3EAQA 1OF1A 4LK2A 1KO4A 1ESMA 5G41A 4EDHA 3FDIA 4XOIA 5FL7D 4RFSA 4PZLA 1GDDA 5KDLA 4WXPA 1GL9B 2CL0X 1Z0IA 5TXGA 1PVOA 3Q5EA 1D5CA 1CR0A 1P5ZB 1D9ZA 3HP1A 4FCTA 5KNCA 1ZNYA 2CVFA 4BFXA 5K8IA 1B23P 4W5HA 1OHHD 1NY5A 4Q4HB 2ONJA 1K8RA 2D3WA 4LBWA 1E0SA 3U3KA 3KUDA 3M4YA 2ZREA 4O2LA 3ICEA 5B57C 4ZCLA 2GESA 4DLUA 1VPLA 2Q3MA 4A0GA 3KXLA 4YMUA 3B1VA 1SXJC 4S35A 4CEIB 2O8DA 4EFLA 4FWIB 1BH2A 3CUEF 3BWDD 4C0LA 1G291 4GZLA 5JMTA 2J46A 2QY9A 1QHIA 3CR7A 1F2TB 2ZYUX 2GBLC 1CJUC 1ODFA 5L3RA 2R9VA 2BCGY 3S1AA 5AJYA 5FR1A 3SYNA 4ZCIA 1SXJA 2IEYA 2RGNC 3IBGA 5IK2D 2P65A 1S8FA 1OB5A 1XCMA 2PZEA 1GNRA 1NMYA 4WBSA 2AFHE 3PEYA 2ZRMA 2QN6A 2EYUA 5AJXA 4C0QC 2WJGA 3AVXA 2W2VA 2XJ9A 1G7CA 1Q21A 4A82A 3ZD6A 1W7AA 2ZSFA 5TY0A 1U0JA 1JPNA 1LVGA 3AVUA 1NSFA 2EFDB 2X8AA 5LB2A 2ZJZA 3NBXX 5B2ZA 4DCUA 5JJLA 1SXJE 4CEHA 1A1VA 2BKEA 3SC3A 1YJ5A 1N6IA 4V0ME 1J8MF 2HJVA 5CIWA 2REBA 4ERNA 4ZPXA 4TMTA 3TQCA 1S96A 1ZCAA 2A5FA 3VNUA 4OK6A 2FG5A 1HQCA 2R8RA 4LPSA 4KSBA 4ARZA 5JEEA 1E9CA 1KKMA 1GVNB 4OHXA 3SHFA 1XFAA 1G6OA 3KQHA 1AGPA 1NN0A 4ZIRB 4D0LB 4GRAA 1XEXB 2A7QA 3EW9A 3PUXA 2WAYA 3PUZA 3WBKA 3AVVA 4C3ZA 4N0DA 5L3SA 2H5EA 2PJZA 1JNYA 1OW3B 2QAJA 4GT1A 3ASYA 4V0OA 3FKQA 1E9AA 2QBYA 3X1ZA 2IUSA 2VP4A 2BDTA 1GNPA 1GAJA 2A78A 4IW3B 3UMFA 3AF3A 1VYTA 1NLFA 4QG7A 2OLKA 1H8ED 1TUEA 1XX6A 2PMKA 2QL6A 4DVGA 2PX3A 1JBKA 2QENA 3F8TA 1UBFA 2XITA 4FW9A 4QHYA 3RRMA 1PLJA 2GVDC 4MGYR 4P33A 5K8TA 3V4RA 4EFNA 3IIKA 4M53A 5SZKB 2KBFA 1M2OB 2YHSA 1W5SA 2DFLA 1TTTA 2BBSA 2PH1A 4M1KA 3U7EB 3IPXA 2IUUA 3IQWA 2UZ3A 3U4QA 3QIAA 4MGZR 2QPAA 721PA 4MKFA 5DHFA 1DELA 1E99A 2WWGA 2JLZA 3MJRA 3ND8A 4YLGA 1EG7A 3D8BA 2FJUA 4IOMA 2O5VA 3RS2A 2VF8A 4LV8B 4D0NA 4PO1A 4JLDA 1D2NA 1EWRA 1Z6TA 4ASUD 3QXJA 1VG0B 2G0TA 2ZQ5A 3GLFA 3TLXA 2W6IA 1I4DD 3K0CA 4EFMA 4UXJA 3LLMA 4HAYA 4AKGA 4NL4H 4TTPA 2CE2X 4NH0A 3ZVNA 2JLVA 2OG2A 1KNQA 3IHLA 2VSFA 1G16A 2FDCA 3DVLA 3V00A 1R5NA 3TSZA 5CM8B 3RC8A 5EP4A 4Q9LA 4FCWA 1TX4B 4Q03A 2ZXUA 2NO0A 4JBXA 4Q7KA 2BHRA 3SHWA 4WA7A 3OHMA 1E1QD 1JR6A 1AKYA 2FGKA 1OH6A 4TYQA 4TZ6A 3GLGA 2F6RA 3MFYA 4JLOA 4JLAA 2QPTA 2QSZA 3ZYCA 3NHAA 4C0BA 2P5TB 5C46F 4W5JA 4XVRA 4XWAA 3CRQA 1P6XA 1LTQA 4LWZA 1XF9A 1OIWA 4DLZA 4TL6A 1CBUA 1ZU5A 4TL8A 4D81A 3U7FB 3L8YA 2C95A 5JBQA 5C1BA 2NO7A 1KJZA 3FKSD 3EWSA 1YR7A 1KHTA 1NBMA 5KPJA 3H4MA 3QVUA 4C9BA 3T1OA 1FMLA 1G9XA 2G3YA 3NHBA 1QHSA 5B64A 2BBWA 3LV8A 4AY2A 2WPDA 2DBYA 1GFIA 4ABYA 4LBYA 4NONA 4XTRA 1OKKD 1JPJA 3SE0A 3QI2A 3B9PA 1NL3A 5EP3A 2XSZD 3LW7A 3SJBA 4TYNA 4RKFA 3GLFB 4O3MA 2ZSEA 1OIVA 4Q9IA 5JECA 4GPTA 4LC1A 3VR2A 3ZVRA 2WIBA 3BOSA 4B3DA 2R65A 2J0VA 2ZJOA 1GKYA 1LS6A 1VYUA 2DPXA 4KFTA 3TR0A 1NMXA 4M9ZA 4KYUA 4D6PA 1IN4A 8OHMA 5IHPA 4PPNA 5HE8A 3L0OA 3BE4A 3K9LA 3U4QB 2OBNA 2JJ2D 3BIFA 1VMAA 2R6CA 4L4UA 2VBCA 1KK1A 1ZMXA 3WMEA 3RRZA 1ZUIA 5CIQA 3ZGXA 4LJ8A 4RVCA 2E9SA 5FH9A 5J4VA 3SJZA 1L8QA 1MKYA 3BD9A 1NIPA 1U0LA 3THWA 1R2QA 2NO9A 4W5WA 2O8BA 2RHMA 5FUVA 3RLFA 1KK0A 4M1OA 1GM5A 2W6JD 4AK9A 1SVMA 4BASA 1XJ0A 5FR2A 2HDNB 5F9HA 1P3JA 4R2HA 2IW3A 2FSGA 3QJYA 2JEOA 2ONKA 3RRYA 2JAQA 4XVQA 4LSGA 2JLRA 2FFHA 3PG5A 4JLPA 4PQYA 2CK3A 4BLQA 3LBIA 2IYYA 2GBLA 3IO5A 5L3SB 2V1XA 1GZSA 3LQRA 3MJHA 3P1JA 4PSAA 2QAGC 2C2HA 1XWIA 4D26A 2OCPA 1E1RA 2ASEA 4MDEA 3EPKA 3B1YA 3EZFA 3Q8XB 4ZIRA 1GRRA 3WYFA 1C9KA 4IKEA 3ZH9B 3NVAA 4NU0A 1LFDB 1RYHA 1AN0A 4PQFA 4AKHA 2X2EA 1CR2A 4ARZB 4GZMA 4TQUS 1D2MA 2PBRA 2F1JA 2IS1A 3LDAA 1KSFX 2W83A 1MR3F 4QGAA 5M04A 1OFTA 1YZUA 4M22A 4S2EA 1ZIOA 2AWNA 4CEHB 3JVUA 4KLNA 3F0TA 4TSFA 1NY6A 4YONB 4NYMQ 3UK6A 1XNJA 5P21A 3AF0A 4G5GA 3AGQA 1VG1A 1ZD9A 3SBEA 2YINC 4FN5A 1AS2A 3ETLA 3QG1A 2R62A 2H8KA 2IYSA 2GK6A 2C9OA 2WSMA 2GKSA 4TL9A 1TNDA 4DIEA 3QENA 3AEZA 4KXFB 4HZUB 1SXJB 4LGMA 3E2IA 3HU3A 2NIPA 5FPHA 2IHBA 1F2TA 3K0EA 5SZIA 2A5DA 1ZBDA 5EUMA 4B43A 2CNWD 2Q3FA 2BBOA 1G3UA 4LC0A 4DB2A 4GBMA 4A0FA 1TEXA 2O8DB 1W47A 1CJKC 4B48A 2AWOA 2GZDA 4M4SA 4Q00A 4IXMA 2H92A 1UBEA 4PSKA 4JVLA 4Q4HA 4Q9KA 1GRQA 2P2LA 2PZFA 4HAWA 4GSYA 3W6NA 1TADA 3TJZA 1QZXA 4RY2A 4ZKDA 1XD9A 4KITB 2RB4A 3REFA 1RPZA 4DLXA 3LAWA 5F3WB 3FFAA 2QMUA 1MO5A 4M1TA 4RFSB 4A1FA
chains in the Genus database with same CATH superfamily
4BKQA 4DMUB 1FS4A 2IU6A 2QZ9A 4MROA 2CL6X 3G79A 1QUEA 2W2OA 3D3EA 4HYYA 3RUPA 4YJHA 4B7XA 1R5OA 4H7DA 4YPFA 1JAHA 3T7SA 3X1XA 4Z4FA 5G3YA 2H4YA 3CX3A 4X65B 2IYLD 2F64A 2G6BA 2ROQA 3AY7A 3EB9A 4I5EA 2HNAA 2OMEA 1E3JA 4UE6A 2I65A 1PUIA 4URVR 1ZWKA 3B1XA 5ICSA 5E2BA 1EG2A 4MUKA 2LBPA 4UZFA 4JS0A 3USES 1PGJA 2BFEA 3RNLA 2C7PA 1CS0B 5D51S 1NP7A 4RY0A 5KYXA 2YXNA 3T7TA 3S8YA 1WB6A 1XD2A 1FXWA 5AP9A 2AZDA 1E6UA 4LYGA 1NKSA 3TL6A 1N57A 1TXGA 3JV7A 4LDQA 2R8ZA 3MNFA 3RS9A 4W5NA 2J32A 5E9QA 3PDIB 1X94A 3DDZX 1O58A 3BWCA 3L0YA 1E1QA 4ZQCB 3WNCA 3WYCA 4DMLA 2VOJA 4FZVA 3RIGA 1WETA 3WK4A 3FBWA 3LHDA 3F2IA 2D00A 1UZUA 2ZR8A 3H2YA 1SOUA 4TLCA 5IEBA 5TSDA 4CUZA 2B7CA 2XODA 4ZK2A 1AGRA 2WJVA 4UHFA 1R0CA 1IY1A 5BSFA 4NNPA 4BGDA 5CVEA 3RQIA 1VCIA 3C6KA 1R15A 1W9HA 1SURA 2B5OA 2GZHA 4L74A 2G5TA 4TZ0A 3BF8A 3UJ7A 4BVFA 4YV1A 1SC1A 4OGGA 1C3VA 1JHQA 2VKTA 5EAIA 5G1PA 3FPCA 1FNNA 1U0EA 2ZRKA 3JQPA 1QRDA 2FEPA 3W9YA 1NUPA 4G37A 4H3SA 2BEWA 2W6ID 3H9GA 4P7KA 4UU0A 1HWYA 4MOWA 5KQLA 4RMIA 1YR8A 1K7FB 2N1MA 3IKJA 4R2LA 2UYCA 1CP3A 5IF9A 3MEQA 1J9GA 1IBMB 3ITKA 2ZCJA 2ETVA 1TQ8A 2BM9A 2IXBA 5E4JA 1SD2A 2YHAA 5FP0A 3RC3A 5KSYA 2D1QA 2FFBA 4RESA 1C9NA 2VG8A 3RJMA 3WIDA 4F6CA 5MGNA 3OQNA 2VOEA 4HVTA 3GFOA 3ZW7A 2RGBA 4XQEA 1W94A 1VKZA 2XLBA 2QUIA 4MW0A 4IV5A 3ZCXA 1KWGA 1CUIA 3LJKA 5DM4A 2ZIGA 1RRPA 4KIUA 3CNNA 3ETGA 3GFGA 3KVOA 2QX6A 4NVRA 4RZQA 2NTYC 4QM6A 1X0XA 3E9EA 3N5CA 4F3CA 4EB0A 4ONEA 5CMLA 1E3EA 1F12A 4AKTA 3K2EA 1T9GS 3E22A 3TBFA 1K06A 3ZS9A 3OVMA 1ZGJA 2ORED 5B1EA 1MO2A 4HYEA 4H1VA 4F4HA 2CNWA 3DKKA 2ZPTX 3GN1A 3ND9A 3NR2A 4JY7A 4ZEOA 4G5OA 4Y6SA 3SGLA 4JI5B 4QDXA 1E6WA 5KX5A 1KR2A 2D5CA 4KI7A 1QXSA 4ZRDA 4EJMA 5M34A 1L5KA 1T1RA 2ILTA 4G1MB 2AJTA 4DZRA 2JVKA 5EIFA 4R8RA 3R9WA 3E0XA 3PTLA 1TD1A 3GUHA 4RFLA 4V38A 5GGYA 3AIIA 5A5EA 3LC1O 4EHIA 3UXHA 3T61A 1FNMA 1XCJA 1T2UA 2OO7A 4ZZ2A 4ZVQA 3GP5A 3ANNA 3WWZA 1AE1A 1YCHA 2CYBA 5BR7A 2DKNA 3DXYA 4JLNA 4RSGA 3RV4A 2QVBA 4KN9S 3H04A 1BA2A 2A9PA 1E9RA 1DC5A 4TS9A 4WIAA 4EI8A 3GGPA 5JRDS 4CI0B 2QV7A 3TK1A 1Y3FE 2Z8ZA 5BXQC 2ERCA 3EVFA 4IR7A 1N5JA 2PKWA 4MPDA 2JHPA 8ADHA 2QSYA 2PBFA 4FD3A 3V7FA 1Q1GA 4A9AA 4OREX 2A58A 2PPVA 4QJ4A 5D8DA 3NM5A 4P58A 4DMCA 2H1HA 2OGSA 4AM8A 5DNVA 3IYLW 3EZ9A 5JNUA 5KHOC 4YCNA 1ZH4A 1PFUA 2RHRA 1DOAA 2QTVA 3O73A 3QX8A 5JYBA 5BQ3A 3R24A 5IW8A 4TZKA 1Z0KA 2J4CA 1MB9A 2NUPB 2WJWA 3EGVA 3PICA 5ITZA 2Q5OA 1VMKA 4GZ6A 2A4KA 5BW6B 1P60A 3ZD8A 3LBNA 3ADPA 4M1YA 4BP3A 3HO8A 4DLVA 2VNKA 4US2R 2GASA 3KKLA 2FPXA 4CM3A 5BV2P 3G9QA 2Q7OE 1UQUA 2KWIA 3H5TA 1DARA 1ZVQA 5KAPA 1B6GA 3ZCRA 1UWVA 2KB0A 1ZYUA 3OIGA 2X2PA 1ACLA 1HV8A 1KZ6A 4MVJI 1YASA 2PUTA 4L73A 4YT5A 1IHOA 2XA9A 4AYWA 5A4JA 3KZMA 4HEHA 5HCIA 4AG6A 1HE2A 3UJBA 2PD3A 3VX4A 1TKAA 4TXJA 1V6AA 3U3MA 4GZ5A 4OQFA 4IZIA 4PLWA 3CURA 5BOVA 1P4HA 1NIJA 1RRMA 2QWXA 3L7OA 1H42A 1LU9A 4OGKA 3GNLA 3H17A 3R3JA 1K92A 3WWYA 4D9FA 1E4EB 4J1TC 3QPWA 3RIYA 4I2VA 3TIVA 4GDMA 1ZJ6A 2VK2A 1DRUA 1E2LA 1Q1NA 2QMEA 2XEDA 3FR8A 1KVQA 1II9A 2IJGX 3IOBA 3JD0A 1ZO8A 3L6UA 5BSHA 5KTTA 2GNPA 2H54A 2DR0A 1IBLB 1QZ3A 3OPQA 1V37A 4PLVA 3DCNA 5F1YA 3WSWA 2WVAA 4DC9A 5IBCA 4H6PA 1C3XA 5AXAA 3C3PA 5DTJA 2B6NA 2RH4A 2QAIA 5FPPA 1BEZA 1KI6A 3L8ZA 1DFIA 3DWGA 4X7MA 3LI2A 2EVWX 3GLRA 3GZJA 5FPYA 4H59A 4JVMA 4W8HA 6ADHA 1I8TA 4ALJA 4I9UA 4D4GA 4J3JA 1O87A 4ITVA 4MMYB 4YLEA 4JQZA 2X8BA 3NBFA 3GJTA 4LY3A 2RONA 1SHTX 1S4MA 1WMDA 4XI9A 2FPSA 3G59A 4OLHA 4DV5B 1EK1A 3CRMA 4XDGA 3F8SA 2I1LA 3BCUA 3C6XA 4KV9A 2WE7A 3U17A 3ERCA 1FFBA 4GM0A 4XM1A 1QGAA 3P9CA 4XPZA 5EMJA 4DJTA 1ZOPA 1NMEA 1BU8A 1S0UA 3F46A 1HFEL 2J3KA 6NULA 4OH7A 3D2AA 5AHRA 3QE0A 3UXMA 1UBUS 2XUHA 2BR3A 2LCFA 2ZKLA 2ZDQA 1MN6A 1QQ6A 3Q2IA 4JQCA 3RV3A 2XPCA 4G2TA 4HSEA 3D3WB 4HVAA 2ZCVA 4Q05A 4HVLA 3HXMA 2QS9A 4RD2A 2NTNA 2I6XA 2V98A 4LS3A 4QUKA 2FPIA 1NF2A 1DZIA 3IR5A 3Q12A 4Z0TA 2X9NA 5HBRA 3VBEA 3HJNA 3X1YA 4OSPA 3P52A 3TUJC 3CZMA 4C7KA 3FSJX 4I36A 1Z22A 4JU9A 4TWJA 4E09A 3RU3A 5I4BA 2HU7A 2FOXA 1SAYA 2PXHA 2GZAA 3BL6A 1Z4LA 4NFYA 4RV5A 4UBKA 3Q4GA 4W1SA 3EUWA 3VPBA 5E9WA 1UBNA 4HEA1 1JB1A 1XRLA 2WJ3A 3RVBA 1R1DA 4P38A 1IXZA 2N47A 2AN3A 5GJCA 1Z2DA 4ENVA 2Q5EA 3MMSA 3NHSA 4CFZA 2RI6A 1C7FA 3KLOA 5CDTA 1P2FA 2OB1A 2WZDA 1LCIA 2BWJA 4PHHA 1FYWA 2OOSA 3OPYI 1N7HA 3TBHA 1RKQA 3IJEB 2H2WA 3RDPA 5HFNA 2PWZA 4G3XA 5K4AA 3WV4A 5MF6A 3R0ZA 2NUAB 1I9CA 2ZYWX 4BWGA 4CQNA 1Z63A 2JIOA 3MAGA 3VYSB 1QOPB 1KEUA 1DT3A 1YS4A 1KJ9A 4B6JA 1BQEA 1J9ZA 5FCDA 4DBVO 1I4OA 3GGJA 3ADDA 3BDVA 3VH3A 4ZHQF 3F98A 1F51E 4CQMA 4NZNA 4DCCA 3GLHE 4TSRA 2C04A 4NH4A 3O90A 2I3BA 4KPUB 3QBVA 3DHEA 1AUQA 2WD7A 2Z2XA 3R7LA 1AKTA 3UUFA 1BJTA 5JAMA 1Z83A 3ZDCA 3BC1A 4Q0MA 3NGXA 3MIZA 4BO1A 5K1ZA 1CJVC 3ZWPA 3AB7A 3H11B 4J3FA 3ZGNA 4OBEA 4YO7A 1IU9A 1XYVA 1J0BA 1G8PA 3HKCB 3GWZA 4WZBA 4JB2A 3ZKWA 4HWKA 4CM8B 5ECYA 2FWIA 3E1GA 2E21A 1J99A 4MR8A 3KYIB 3OOJA 3RBZA 4X64B 1IAVA 2VYNA 4KMOA 4ZPJA 1SRQA 1NVUQ 1PTJC 3I8SA 4ZVSA 2FF7A 3N0RA 3OFNA 5MN4A 2H16A 1W4LA 2ZTUA 4K3VA 3W6ZA 3DBLA 4BLVA 3I6MA 4OLAA 2EHDA 1QX4A 3PWTA 4TRRA 1K4KA 5IJZA 3SVZA 4RF3A 5EQTA 5JNSA 4IDQA 3JZAA 4KQ2A 2BGKA 1WMSA 3R6DA 1NW3A 4ZU1X 4DRZA 1VMEA 2O19A 2AOUB 2ZRGA 5LIRA 3ZI0A 4UM8B 1FTYA 4E5SA 3FF1A 3RADC 3CF6R 5KKNB 4Q66C 4ZXFA 4FCCA 1TZJA 3MMZA 1E92A 1YQQA 2V65A 1IHXA 1PX0A 4YDHB 3UUGA 1XMIA 5EHZA 4E5DA 2XNDA 2IYVA 5LQKA 1Z8NA 3E6AA 3KKKA 5FBRB 1JH9A 3NLLA 4UU7A 2QDKA 2IIVA 3PNQA 3D5TA 4X20B 4MKIA 5CCEA 3IVRA 2VYVD 4OU4A 1YIAA 2DOKA 1H5UA 3PA8A 3TYXA 3DVSX 1Q16A 3CPEA 2CVPA 3JVDA 2VWQA 3H2IA 4L9SA 1DMRA 3LRXA 1O8CA 3IDZA 3QXSA 4P86A 2I6FA 2ZRBA 5AW8A 4ZYLA 3PNMA 3WP1B 3F96A 1YVRA 1S1MA 1JLLB 3IP1A 4H1HA 2G72A 5FB3A 1Z2AA 1Y37A 1PR9A 4JOBA 3A31A 4JP8A 3GFQA 4R2JA 1EQ2A 3MWKA 1A4XA 3QYJA 4MR7B 3DLBA 1B3RA 2CFTA 1A4RA 3I04A 1SA0B 1E3WB 4MVJG 4ND7A 2O2EA 2ORIA 4WJZA 3VDRA 2ZIFA 3EE6A 1E3TA 2QM8A 1EFCA 1A2QA 1QO9A 3IEXA 5GV8A 1B0AA 2JI6A 3GDWA 4OSOA 5ITWA 1W96A 4N54A 3T7DA 1J7JA 3W8NA 4AUEA 2VF2A 1A5AB 4AF8A 4P4SB 1OBOA 4Y1FA 3O7WA 3OSZA 1AS0A 3AETB 4QQKA 4GNKA 1ZR4A 3NBZC 1JU4A 3PF9A 2QE6A 3X1DA 2ODWA 2AD5A 2DUNA 1XU9A 1MAAA 3HJBA 1KH2A 3WNBA 4AZVA 4Y7CA 3G2OA 1L9XA 3EYWA 4K9SA 3MT7A 4KQFA 4FLMA 1SKUA 2JLSA 4JC5A 1CLEA 3ICOA 2P41A 4CODB 4OFBA 3ZEAA 3RARA 4JJGA 5I7UA 4JHLA 4OL0A 4NCXA 2Y67A 2ZSAA 4NJOA 2F1KA 3NH6A 1ZUNB 3BJZA 5C3UA 4Q82A 1IOZA 2A0WA 3JVEA 1V0JA 3IMCA 4RJKA 3IPAA 1QV7A 4KIWA 4M54A 5B3AA 3N8HA 1W4BA 5IM4F 1N5IA 5AM2A 5EA2A 3BA1A 2H5LA 4ZT3A 2QAGA 3W1EA 2EEZA 2BY4A 3NBMA 5K0NA 3MWDB 1SCAA 3G0HA 3EZXA 1QDEA 4EW6A 4PG7A 3L0CA 1XZEA 3AB3A 5I9IA 4XVHA 5FF9A 4E88A 3GMIA 4M9XA 3SX2A 5F23A 3DLPX 2PWAA 1UPBA 2DWQA 4QGBA 1AGXA 1XMJA 2C0CA 5EP1A 1ECCA 2R97A 5LD2C 3HB0A 3FR7A 2G7MC 4AWXA 5EJ7A 4E5PA 3C6QA 4RSRA 4IHQA 2FV8A 2HXSA 2MTBA 3I3OA 5EG5A 4MRVA 5KU1A 1QE0A 2F3TA 2PZLA 1R66A 2QEQA 4YXWD 2OV3A 4WK2B 2CMDA 2H7XA 1XEWX 2GPNA 5JAOA 1AT1A 5BQPA 4WNAA 3RTEA 2YWXA 4CYMA 3WK6A 5CFPA 3CXUA 1XPJA 1F4PA 3VR3D 4UDYX 1ABBA 4DB4A 1XZIA 4N40A 1NNUA 4PE5B 3R3HA 1RXIA 2NSDA 4LGCA 2PSSA 1U2SA 2QQ0A 2R6JA 3AR4A 3IB3A 2RGXA 3P4UA 3GH3A 3QKSA 521PA 4CZ2A 1CRQA 2V7VA 3RVNA 4I8DA 4U2BA 4FHDA 2ZUEA 2FR1A 1SUEA 4NQZA 3TOSA 4AJIA 4C43A 2C84A 5C1OA 2GZ3A 1D2AA 1TO1E 3N7UA 2DPHA 4UDOA 1NW9B 1TE2A 1J70A 3RWOA 3T8YA 4KU4A 5JSUA 3UG7A 4Z8XA 2AI2A 4CUJA 1L5HB 1RQXA 1H2ZA 1XXHE 2PMEA 4B6GA 1BMTA 1NQVA 1W48A 3DT9A 2YJTD 3OFND 4HR7A 4MKHA 2QIPA 3SJAA 1P4SA 3IEVA 2OHJA 3ZDYB 3ICWA 1LPNA 4LQCA 1B0UA 1S2OA 2O2IA 4BZZA 2PMCA 2ZYGA 2M9MA 2JLCA 3S7ZA 1AKEA 4YUWA 1J22A 2OESA 2XRFA 3NDJA 3D8NA 4I4TB 1YS6A 2NXWA 1G8MA 3CX7A 3WVNA 1IH8A 4J0IA 4RZXA 3FGPA 4V3CA 2BSQA 3RSLA 4HLCA 2WWWA 3NHUA 3GRFA 3UWMA 3A9SA 1HETA 4ZHQA 2XB6A 3M1YA 3ABIA 2AFIE 2ZT8A 2X8JB 3WISA 1UZNA 2FMFA 1Z7GA 1Z39A 4B6EA 3G8CA 2J45A 4FCVA 1XELA 3Q2OA 2GXSA 3TAUA 5CDSA 3EOBI 3EULA 4N65A 4F38A 2MSCB 4ZEVA 3CJRA 1PIWA 1RQNA 1FX0B 3OZCA 1WP4A 1JHPA 1UKCA 4WNCA 4CTOA 5JC1A 5LR6A 1WVGA 3O1JC 5D86A 1NPDA 3LO8A 2XHZA 4I46A 2V8BA 3IMGA 4EABA 1XOIA 2H4ZA 3DB1A 1CR6A 2N3ZA 3DM5A 4WESA 3IT0A 3N07A 5J2UB 3U7JA 2CKMA 2I78A 1Z35A 2IHKA 3M9LA 3PC4A 4UUMA 4B6RA 1W93A 3CVVA 4BQSA 5TB5A 4F6RB 1ZIPA 4ND6A 1RSZA 4HTAA 4X8MA 2D2VA 2VHWA 3OQVA 2Q62A 3E0QA 3HCPA 1X70A 2J59A 1ORRA 1TVMA 3FWYA 2RGGA 4TV8F 3GPDG 2IU0A 3U3ZA 5J43A 1OB2A 5CYPA 1QX3A 2AMJA 4EH1A 5IK2A 1A9PA 2FX3A 1QR2A 4E70A 2ACVA 3HWSA 2AG1A 3RHFA 1BXRA 4X41A 2A5LA 3IIMA 5FADA 3I12A 1NMSA 5G4KA 3V1KA 5F9FA 1R8XA 1ISJA 1UPXA 5EIHA 1ECGA 1GGJA 1ZQ9A 2BFFB 3SSOA 3CZCA 4MRPA 4JMLA 4YRRA 1HUQA 1W75A 5HR5A 3BB3A 2JS7A 5JISA 1ESCA 1Z5PA 4HO1X 2E55A 5HW0A 4IPTA 1HLGA 1R6BX 1MJFA 5AW3A 4AC9A 3T35A 4DLNA 3RH0A 4ETMA 2WWRA 2NT4A 3F5SA 1CNEA 1TUGA 3A6FA 1PR4A 3KQTA 3QA9A 2XUAA 2B2CA 4L02A 3I0MA 3RAGA 3TZEA 1B76A 1PQUA 3BAZA 3GCWA 1MEEA 3IVMA 3R0VA 1FRVA 3GLFE 2FUKA 3IILA 4BIMA 3VISA 4PBSA 2AUMA 3G5MA 3VJMA 3T3OA 1C8KA 2ODNA 1GFSA 2OBLA 1YRAA 2WJJA 3N0VA 1IHDA 1J09A 2HU5A 3ZK7A 2G1PA 2PIAA 4EF6A 3GJQA 3TQQA 1U2PA 4ALNA 2HUNA 3WC4A 1TJNA 3IUBA 4W8GA 4QNRA 2Q3EA 4C87A 3UQZA 1ZC4A 1TECE 3Q40A 3UJ6A 3MCVA 1E2EA 4MWOA 2R1VA 1LPSA 4JOSA 4MJLA 3GBPA 2GEBA 5EMHA 5B3JC 5CB6A 3KTAB 5AHXA 5KJ1A 4FBLA 3OF3A 2PXCA 2O0MA 2EZTA 4OJYA 1LPOA 3FJ1A 3PCTA 4LY9A 4DCNA 4BHTA 3D6MA 2XUKA 3GJ5A 3THXA 1BE6A 3FNQA 3TXYA 4R9NA 2D2IA 1UODA 3NC0C 2EWVA 1FFHA 4L9AA 2HTFA 4QODA 1L3IA 3RBXA 1GPMA 3IELA 1J8VA 3I6ZA 4LDJA 4TGLA 3KOWA 4CNQA 2FLWA 3SCZA 3IAFA 4H1UA 3VOTA 3ZX4A 1V5WA 1H94A 4XSGA 4S05A 1UBMS 2I4OA 4K28A 4LC9A 4NENA 2BGWA 3BRWA 4MQEA 2J3IA 4AZ3B 5CYFA 3H1AA 1GEGA 1ZGAA 2ZJ7A 1BOFA 3KLNA 1DQYA 1U28A 3SX4A 3WLPA 3RVPA 3RW9A 4DG5A 3DUFB 3EVCA 4XH9B 5F5XA 2FZ4A 5HTKA 2O5EA 1T3SA 5C32A 2EJBA 3C3XA 1X7GA 4LJ6A 3A4LA 3I04M 4FMCB 3K0SA 1JSCA 4NDNE 3Q3IA 4CLOB 2XVXA 5I3ZA 3TQFA 3P26A 2OLJA 1JHYA 1WDMA 2FZLA 1CF4A 1XA0A 3RM3A 2P2ZA 1NVKA 2P62A 1DQZA 1OX6A 4QOIA 4F11A 3W77A 4OQ4A 3DBRA 3SOPA 3ETDA 4DNXA 2YVLA 1UEIA 1V5IA 3GFVA 3SYLA 1P9NA 3LBYA 3VU9B 3WL4A 4TN5A 4ZZ1A 4L4SA 4WMLA 3THRA 4DQVA 2OBMA 5AVJA 1B8OA 2QRNA 2EAUA 1M1ZA 3ELUA 3QE2A 3RLIA 1H4QA 3V4SA 2PUGA 1KZHA 1JDJA 2GN6A 3KOUA 3DQPA 5JY1A 3H7IA 1Z4IA 4HUQB 4CNBA 1NDHA 4LJ4A 2Q3LA 4UVHA 3PT5A 1YZQA 2Z5VA 4AQ7A 1E2BA 1OD6A 1IJKA 5IANA 4JI0B 1ZSNA 3FOEC 2JCSA 5KVVA 1QP7A 3BRWD 1NDQA 1E7QA 1RJDA 2IY7A 2PMWB 3AJRA 2HY7A 1G3MA 2XNJA 1AHPA 5KX5F 2HDHA 4RJ2A 2CNDA 1OLXB 4HRVA 4BCCA 2DHDA 1FFXA 5G53C 2UUCB 1PEKE 3GZNA 2VP0A 2J7PD 2C31A 3BE5A 4J29A 1VLVA 3PXXA 1VECA 2WWFA 3WOVA 2VUHB 4AYTA 4OHBA 2AJBA 4JBGA 8LDHA 5FHRA 2I2XB 4BV8A 1PLLA 3ROQA 1XQ6A 2R6HA 2OD2A 2GRUA 3B9QA 3IFSA 5SV2A 3ZHSA 4CMAA 4D4JA 3BFJA 4RDXA 1XDZA 3HADA 4FFLA 5B1SA 5HQJA 4RF2A 3NAZA 1QHXA 2ZYAA 4A15A 1R37A 1T5OA 3FNIA 4HNUA 4X00A 1GITA 2QD4A 1NJFA 1ZM2A 4RYLA 3VVBA 3E15A 1QYCA 2WMNB 3NC4A 3UA3A 1IULA 5ESRA 5L4LA 1Q22A 2ZWAA 4OJQA 1I3MA 3DMPA 4BMPB 3CWQA 5JS2A 4N3GA 2PSHA 2M1XA 1JDNA 4WWHA 5DFAA 5K3OA 1II8B 4G81A 3LF2A 4UTXA 2WYIA 3TGWA 1PV4A 3C8DA 2BONA 4CT4B 2FF5A 5DM2A 5I4KA 4L4ZA 4NP6A 1C1XB 3HM9A 4KKVA 3ZN2A 3NHYA 1MU0A 1NXXA 2Z6VA 3DVAA 4IBOA 2ZBEA 5KEIA 4DUGA 3AVTA 1YGPA 2VHCA 2GNOA 3L5KA 2C2MA 5SYMA 4TTTS 3CF0A 4J07A 4IGFA 1EDDA 4NK4A 4QPCA 3HVKA 4OH1A 2H5JA 4BVJA 1T9CA 2ABWA 2OV4A 4LAFA 3M6XA 4Z51A 3RO7A 2NVUB 5GJWC 5IFKA 5JRJA 3C41J 4M1EA 4MGEA 2VT3A 3MTIA 5A6SA 4EKGA 5LQJA 2XKJE 3OJCA 2IHTA 3LUFA 1RXUA 1Z38A 3WLMA 2P35A 4F8EA 1JDSA 2IBSA 4K26A 2ODPA 1PK7A 4FOOA 4KQJA 5IC6A 5CXUA 2BFDB 2ZI6A 4LCJA 5CB4F 4KGDA 4JLBA 4W9MC 1E1RD 1U8XX 4Q24A 2QIOA 4RPCA 4I50B 3OZSA 3VYTB 4U7DA 1IQ0A 5AMXA 1U7DA 4NFHA 2V58A 3ZZNA 5K05A 4MINA 3UHPA 1TUBA 2GCEA 1J21A 1ESEA 2VVTA 1LXCA 2G88A 2GZ2A 3PS9A 1TTPB 1W0KD 4HFRA 2NUBA 2DMRA 4AJLA 1G2OA 3INGA 3BH0A 4QASA 3IHTA 3QFRA 4B4WA 2F8TA 4ZDKA 2RH9B 3PWZA 4MV6A 4OMCA 3VYWA 4IIYA 4B6QA 2ZYIA 2NSJA 1E0KA 4BNJA 2P6PA 1LBTA 3L7YA 3TW4A 1GPDG 3EEQA 3E7XA 4J0HA 1PUXA 4RNDB 5DBFA 2WLTA 4OXQA 3D7KA 4KOAA 5G02A 3SVTA 1ZR2A 3EFOA 2F43B 3IA2A 1GNVA 1X15A 4I0WB 3ZHVA 5I6DA 5BYKA 2OV2A 5K8VA 4V1CA 1F0KA 1UINA 4C07A 1QP4A 1TLTA 5C3MA 3MW8A 3AILA 2CLCX 3FNEA 2NU8A 4GS5A 4YEDA 3FLBA 4J91A 5FO1A 2HA6A 2ZITA 3MINA 4IFIA 4LUCA 2RE8A 1K9VF 5A5GA 1ZCFA 4KXUA 3BTUA 4RK1A 4O1HA 3WDKA 1BXGA 2GN8A 2JH9A 3LWDA 3VI3B 1TQ6A 2QN3A 4CDGA 2IYRA 5SZHB 4GLJA 4IYJA 2GOYA 3CNBA 1MF7A 4B71A 3V2IA 1EWTA 4ND2A 5JEDA 3KAPA 1VA5A 4L0QA 3UMCA 1ZK2A 2ECQA 3V97A 3CBQA 3LQKA 4EHDA 2ZRJA 4PRZA 2VLIA 4OP3A 4BNDA 3KVNA 4DTCA 3KWLA 3BH7A 4JYBA 1MQAA 2A6PA 2XLCA 3CF4A 2FZKA 1VHLA 1XRSB 2Q46A 1UPCA 2YR0A 4IO0A 5FI0B 3NJRA 3CTPA 4WINA 1NBAA 3MILA 4HRYA 2H07A 2JCVA 3KZKA 1Y80A 3OCXA 1U8ZA 4D9JA 3OOYA 5H4HA 5BMOA 3LUCA 5H3HA 4KPYA 1AKUA 2D8AA 5F76A 3ENNA 4DC0A 4E11A 1Q19A 4G0YA 1UKZA 4FWTA 1O9GA 1KDOA 3UTDA 1T5IA 2OYRA 1SVKA 4P7FA 5HXAA 3UFXB 3OURA 2O50A 2VEOA 4WN9B 5AVTA 2B0CA 5LMUB 3HTXA 4UOZA 3GP8A 1DIOB 4YCCA 4PXYA 3FFBA 1Y8RA 3GJXC 1HDXA 1NT2A 4WFIA 4RZUA 3PUKA 1U0GA 1WZNA 4RF4A 4I9HA 4EZBA 3IP9A 2BISA 3HXLA 3HR7A 2Y4NA 3FE2A 2G1UA 2WJAA 3JAKA 4NEQA 4BNIA 1MJGA 3QXGA 3F74A 4P54A 3E3LA 4LYEA 3VSCA 3PXBA 2VJCA 3KX2A 2GVZC 4PZEA 5LKAA 4TN1A 3K96A 3LXRA 3OZIA 4BMNA 4W5OA 4TRJA 3MA0A 4CMIB 5JI2E 2OCAA 4A8JA 1VL8A 3FHCB 1KDZA 4LMPA 5F33A 3DF9A 1T2AA 3A1UA 3JD2A 3AKDA 2ZRQA 1YVPA 2SKEA 1M67A 3VMMA 4M8NE 2FR8A 3PEWA 4M0FA 3Q7RA 1VKJA 2Q1TA 3BM5A 1IPHA 1K5GA 1GG9A 5JQWA 2VSOA 3HPRA 1ZX1A 3A2KA 5K4GA 1Q6YA 2XQKA 3QVOA 2NPFA 4BZQA 1NI4B 3NP7A 1P72A 2WEKA 1ATZA 1FP4B 4W6QA 2HXGA 1QP8A 4MARA 2CCKA 2HD4A 3P8ZA 2MMGA 2IA5A 3C3MA 3QPDA 5ES3A 2C4UA 3MZ0A 3M6AA 3TLCA 4RH3A 1H8EA 2FPGA 3GJRA 1WHTA 2LW7A 3TECE 1P9WA 5A7GA 5KJFA 3MXTA 3CM0A 3E2PA 3I6BA 2XTJA 3HYNA 3WRXA 3BFPA 4XX1A 4DDWA 3WDSA 3PRJA 4Q34A 1KJ8A 4U39A 1S3SA 5KMGB 2W2LD 1HEUA 1H69A 1T15A 2EX0A 2HREA 1FLDA 1DV1A 2BHLA 3MGAA 2XX3A 4G0UA 2CXQA 2O8VA 4RA6A 4Y2SA 2PEYA 4BJHB 3HFRA 1W2HA 1S2DA 4R8KA 3PPXA 2OT3B 2ZM5A 2A84A 2PWBA 2IYQA 3N2EA 4PG6A 4AMVA 1MFPA 1UZMA 4ZCTA 3H2KA 5I48A 1R6UA 4QPPA 1SM4A 1NXVA 4W82A 1DO2A 1VRCA 5E6UB 1YJAA 2BMJA 2HRZA 4FYKA 1SCUA 1OYVA 2WU3A 4ZMSA 2ODQA 2NYAA 4EPVA 3ZXIA 2OMKA 3GVHA 3G5UA 1QYDA 3N2ZB 3RSCA 3DLTA 3T99A 2ATEA 4RDCA 4C7OA 3HCRA 1A8HA 1DQPA 3L9XA 1WWKA 1YRHA 5I9TA 3FM9A 5FTMA 5AOAA 5AUQA 2C78A 2EFCB 1BMQA 1FSGA 1B7GO 1GFWA 4HDNB 2QROA 4KO2S 4KUHA 5DLPA 3OCJA 1UMCA 1I1HA 2ARKA 4IXDA 4QDZA 4IDPA 4PW0A 2Y71A 3HFJA 3PQ7A 3U80A 1P77A 2AC2A 1CULC 3M4XA 3TKYA 1IUOA 1WXEA 1T9GR 2ANCA 3NDPA 1ZGZA 2QVGA 3JQFC 4FOSA 4YAFA 5EIBC 1NXWA 3R40A 2HSJA 4YAGA 5AVZA 4AW9A 2HF9A 5FAXA 1U6IA 2CUTA 3CLHA 5FXMA 4CHGA 1EVZA 2Q5FA 1ADCA 3AJ9A 1FF9A 1QTIA 4Y0AA 2B92A 2EHJA 5KOIA 1QHHA 3NXSA 3WRYC 4AROA 4ESOA 2UXCB 4OLJA 4KO3S 3W8EA 4LZZA 3U7GA 3W2GA 1Q7GA 3CPHA 4DF3A 2EARA 3DZ8A 4WW0A 3IERA 1ESNA 2QNBA 5AUNB 1IN8A 1K6IA 1GR0A 2HCFA 3OO0A 4UU1A 2ZK7A 3MAJA 4LX8A 1UJ2A 3NALA 4HI0E 1EVQA 1E9FA 3UMRA 4Z53A 3CE6A 1YACA 4D44A 2BJHA 3FDZB 5REQB 1IIBA 2BGRA 2W2KA 4RK4A 1UBSB 4HV4A 4R1QA 5ERYA 4GMKA 1J2TA 3QVGB 2DWUA 3DEAA 4FX5A 3HCCA 3PHIA 3U81A 1OGJA 2DKFA 4LQLA 3ZV6A 2OAQ1 3H4VA 5JJCA 1KOGA 1JKJA 2CD7A 1O96B 2R7AA 1EDOA 2D5AA 3D8TA 3U9SA 1TIBA 2J09A 3JCZA 4MA0A 4WN3A 2MSKA 1NUTA 2AHOA 3MTQA 3BTSA 5EZ6B 4GI2A 1A7JA 1XLTA 2OGTA 1X3SA 4DR1B 3BWEA 5DEIA 1RC1A 5K6RA 5CA1A 4BO0A 4GXTA 1N78A 2BE7A 1D07A 3C98A 4WERA 4Q3NA 4RL6A 4H0CA 4X91A 3D3JA 3O0TA 4ZC1A 1U1GA 3P4XA 3RYIB 1GCOA 5KTRA 5DHUA 2MU1A 1QC5B 2X5JO 1TJ5A 2XQJA 1N4DA 2QG9A 3L7AA 4RCZA 2XOKA 4PNZA 1LLUA 2D1TA 2WMYA 3OPYB 3QY0A 3RUEA 1CUCA 3LX4A 3AKEA 4MAFA 4J9UE 3QF4A 1J0XO 5CT6A 5BW8A 5LDDC 3COJA 5KKAA 4JEUA 4AULA 4W5TA 4LXUA 1E2UA 4JI4B 1ZM9A 1XF1A 1BGWA 2ATXA 2HMWA 2YJGA 4I08A 1HDEA 2DSNA 4WLEA 2AR9A 2JBAB 3GLGB 2PZ8A 3BN3A 3DNPA 4X8OA 1EE2A 3DJFA 1E69A 3GAZA 1I7PA 1CD5A 1X9GA 3ZE9A 1N5RA 1BJKA 5FO0A 5C37A 1R8YA 3IUJA 5E6RB 2A1TS 4MTLA 2H2DA 3H9QA 4B3BA 4AXBA 4KMRA 1H3NA 2DY1A 4BKOA 4OXIA 2OHOA 4Y6RA 2BTQA 3VYUB 3EGXA 3AZPA 3B70A 2XQVA 4OQNA 1DDGA 1A3CA 3CPSA 4NMHA 2O5CA 3W3ZB 1U1IA 1V11A 2VA8A 4TMVA 3PZBA 4D42A 2Q9UA 1Q0QA 1EYZA 2Z3VA 4KRGA 4OB6A 4LK3A 1QFMA 1TYDE 4G0QA 1OZ0A 1Y8QB 3E03A 5KPDA 1AHNA 1VIAA 4Q48A 4UBOA 3IS3A 4X84A 1EDZA 5B6IA 5G0SA 3R5SA 1G17A 1FDTA 4LTMA 2QTNA 3AXTA 4N7BA 3UXYA 4LF9B 2IEAA 3NV9A 1EXNA 3JD1A 3OETA 4C29A 4KUGA 4C21A 4GOJA 2P6NA 1V7QA 4RVFA 1F2DA 3QHPA 1PR3A 2BELA 5J5CA 3RFCA 3CNOA 1C4XA 2YWJA 1NBOA 3UUEA 4DBLE 3L2OB 2WY2D 1MCZA 1W8DA 5DHRA 4QVGA 1ECLA 4D74A 4FYVA 1Z0SA 1MTZA 2F62A 4LMBA 1T9BA 4JR0A 2HHCA 3DHVA 4J6FA 3A6LA 3DBIA 4AJNA 5LP6B 4OLBA 2UZIR 5EL0A 4JQOA 3HN6A 4JB0A 3T6KA 4EB6B 4F4CA 2JJ1A 1NPTO 2X1MA 3I83A 4B76A 1SC9A 4P6VF 4BP8A 1DJLA 4ND5A 1NW7A 5CCXA 5BPFA 1G4UR 4HGQA 5LQSA 3RFFA 3QJ5A 4RXTA 2H2AA 3V7NA 4LRSB 1KGSA 4QEZA 1DSSG 4HPJB 4P36A 1CT9A 1S01A 4DIKA 3OPNA 1XXHA 4MUHA 4QO8A 2LRHA 4QXRA 4ZI7A 2I80A 3BD7A 3PJEA 4MRMA 1EFRD 3NH9A 5EMLA 3WB0A 3HA5A 1T4CA 2PBLA 1E66A 3CLUC 3L0BA 4M86A 2JI4A 2NO1A 1EP9A 4WKNA 1LF5A 3OE1A 4RLQA 1OTYA 1GPKA 2GWHA 2VTEA 3QHQA 3QI7A 5LC1A 3ZXXA 4YJFA 5ALPA 2AEMA 2OZLB 3LVBA 3MT8A 5L3QB 3M5DA 3M5WA 1F3OA 4BECA 1XNQB 2QYOA 4BLRA 5JMOA 2CFIA 3N2YA 5AT1A 1DB3A 3MHTA 2FPPB 1MOQA 1YZNA 3IBTA 4R01A 4GL2A 1JLKA 1MRNA 2HNBA 5IHXA 4MUAA 5FEMA 4S2UA 3T4UA 1A2BA 1QCCA 5L4SA 1KY3A 3SM9A 2HPAA 3P45A 4BLSA 4BNHA 2VAWA 5AVVA 2EL9A 4R9SA 4DEXA 2DTXA 2I91A 1ZINA 3OPXA 2EATA 3ZCQA 2O8BB 1QS0A 1XRJA 2V7BA 4N4AA 5EXEA 2RKWA 5J40A 1XLVA 1UFOA 2E48A 1M7GA 3PR3A 2Q29A 3DKPA 2IYNA 4HUJA 3HCFA 4Q9AA 1MORA 1Z29A 4YCBA 3QKRA 5A03A 2IH4A 2OK8A 3ORFA 4FSXA 5G4LA 3GLVA 1PEAA 1YO6A 1VMDA 3HWRA 6YASA 2WUDA 4GKKB 5E9JA 5DBOA 4M0KA 2ZQZA 3KAJA 1NQUA 4G0MA 4KFSA 4XTCS 3G88A 4DA6A 1EB8A 1AKQA 5AHWA 4Q3LA 2DG2A 4CIVA 1V8PA 5BOSB 4FS8A 1J8FA 1D4OA 2PGAA 3CN7A 5B58T 1CYDA 2QTFA 4KQMA 3ZD7A 4IXWA 1AF7A 4NK5A 4QBTA 1BKDR 4YAKA 1OTXA 1OUMA 4ICIA 2RMKA 3BK7A 2PGLA 3DLCA 4QTTB 2CWDA 4JQYA 3HGQA 4F45A 1HXHA 4OUDA 4FSDA