4TQ9A

Crystal structure of a gdp-bound g12v oncogenic mutant of human gtpase kras
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
169
structure length
169
Chain Sequence
GMTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GTPase KRas
publication title Biochemical and Structural Analysis of Common Cancer-Associated KRAS Mutations.
pubmed doi rcsb
source organism Homo sapiens
total genus 59
structure length 169
sequence length 169
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tq9A00
1R0WA 4PTLA 3FKSA 1QHIA 4AYXA 2FV8A 2F7SA 2VP6A 4XTCS 2IBMA 1E3MA 3RS2A 1J7KA 2AL7A 3ZIAA 2PEYA 4MITA 5AK0A 1XZQA 4BFXA 4TZ0A 2AD1A 2XX3A 3MCAA 1JNYA 1P9NA 2GNOA 2CMKA 4NMMA 4B2PA 1I4LD 3OE7A 1G8GA 3IO3A 4LBYA 2GK7A 4FN5A 4GOXA 4G0NA 1IXRC 1GRNA 1KDPA 4MUBA 3T1TA 2J0SA 2F3TA 4YONB 2LKCA 4JKYA 2EYQA 2ZRLA 1NN3A 4TQ9A 4DCSA 2B6HA 2FJUA 2GCPA 4Q47A 2UZIR 2B7CA 5SZHB 5C4GB 5D3MB 2PH1A 3GP8A 5FOWA 4D81A 5B57C 3KB1A 2RGDA 3DPUA 4TMTA 1G64A 2ZYWX 3I73A 5BN5A 1G19A 1RIFA 2IX3A 1KNXA 3K9LA 3ND9A 4NYMQ 4B2LA 2GJKA 3CWZA 4TL7A 2I1VB 2WWHA 2G83A 2R6AA 4RD6A 4MYCA 1N3BA 4B3BA 3IILA 4LWZA 4G5QA 3BIFA 3ZZUA 1X3SA 1FUKA 1ZM9A 3L0OA 3CONA 3AKYA 5KYKA 2JEOA 4A6PA 5JI3E 2XOKD 1XNJA 2UKDA 2MSDB 3FTQA 2PT5A 4PPFA 1VYVA 1OFUX 3QKRA 1UKVY 5FOVA 4P4SB 2EW1A 5F3WB 1XMVA 3SNHA 1TU3A 2P2LA 4C2UA 3ADCA 2GKSA 3K0AB 2YNMA 3U5ZB 3A1VA 2A5GA 1J70A 2BKUA 1W4CA 3G0HA 1OIXA 4DSOA 2FFAA 4CIDA 3K70D 1F6BA 3ZVNA 3DMDA 4JVNA 4GZLA 4RD1A 4E03A 1ZIOA 2GBLC 4QHYA 4EIWA 5JECA 3NEJA 2VPPA 1NVVR 2O8CB 1G7TA 1G17A 4RCZA 2ZAOA 2P6UA 3SFZA 4ABYA 3D31A 3ASZA 1XBTA 5F9FA 4IW3B 1G4AE 1QHYA 3GLGB 1NN5A 3AGPA 5FI1B 1S4QA 2OBMA 5CB6A 4JZKA 3RHFA 2ATXA 3C14C 1VCIA 1CULC 2W6JA 3AUYA 3RRMA 4CGZA 2EWWA 2PZEA 5DO9A 3SN6A 3R7WA 5GJBA 1D8TA 2P65A 4PSVA 5ANRB 1VG1A 1FPMA 4D0LB 1RRPA 1RW4A 1F48A 1QDEA 1FMJA 2GJ8A 1H8ED 3BFKA 4ZKDA 2D4HA 1KI1A 2JIZA 4JBYA 4JT4A 2REBA 4TMZA 2BCJQ 4U5XA 3K9GA 4IOMA 2RGCA 3GQBA 3C5HA 3NHBA 2X1VA 3WYGA 4A6XA 4C0AC 2ZETA 4HUQB 1KSFX 2F1HA 2A78A 4MRNA 1VCMA 3RS0A 1CJMA 4QBHA 2JJ2D 3RWMB 2WPDD 4HDOB 4NHOA 4DT1A 4X8LA 1E98A 1MH1A 4TLDA 2VRWA 3EAQA 4C0HA 5C4MA 1G3MA 1JXMA 2ZRHA 1ESMA 1G6OA 4PR0A 4UNNA 2NO9A 3LNCA 2QU8A 2CE2X 1Z83A 1XPUA 3VR5A 2KJQA 2E9SA 3VHLB 2QL6A 4HB0A 4HATA 3T35A 2ZAMA 5GADl 4Q1AA 3DM9B 4BLPA 3M0EA 1GVNB 2GDJA 3PEYA 3RSOA 3MMPA 3GLIB 4BLSA 1H65A 3W5JA 4LJYA 3CO5A 1NVWQ 2ODWA 2KB0A 4IXNA 2ONKA 5CJPA 1CJVC 4TWZA 1U0HC 3RNLA 1II8B 4M1WA 3F3YA 2EFEB 2H18A 3AF1A 5DYGA 4B3XA 4B6FA 2O8BB 2R2AA 5LD2B 1NKSA 4GPTA 4EFNA 4Q21A 5KPDA 1IY2A 3RDPA 1UBCA 4Q03A 4B74A 1CRQA 1KGDA 1XB2A 1L7VC 1AZSC 2W0SA 1XTIA 3EWSA 2CNWA 1SXJD 4B2IA 3R8FA 1R5OA 1D5CA 2HEIA 3SI7A 2IYWA 4G1UC 1ZRHA 4L9WA 1DAGA 3F8TA 3K9NA 3OEEA 4Q4JA 2IK8A 5DN6A 3PEUA 4AKHA 3T5DA 1VYUA 4LUCA 2J5XA 3LWNA 4WBSA 3LH5A 5JSZB 3A1TA 5KDLA 4DLUA 3ZH9B 3K09A 4EQ6A 1TL7C 3OIVA 1KIMA 2QRNA 3UANA 3OAAD 3UK6A 2JLRA 4PO1A 4UXIA 1A7JA 1T9HA 3C8UA 4M1TA 3TAUA 1KMHB 5KUTA 3KXKA 2NOAA 2NIPA 3HU2A 2YWFA 5AJXA 1Q20A 1UBFA 3VR1A 4ARZB 2J45A 3CW2A 3AKEA 1XFAA 3FMPB 1U98A 2GJSA 2ZYTX 3KQLA 1R7RA 2OBLA 1E4VA 3FFBA 1K5GA 1LY1A 5FBQB 2ODBA 1TMKA 2ZPTX 2R6CA 1UPTA 4ASUD 2VHTA 3FOZA 4WIAA 1M1YE 3LO5A 4Y0AA 3EZ9A 2H7VA 2OZEA 3K0EA 1SVIA 3FKSD 4N0EA 4LZZA 2IW3A 1UKEA 1OXSC 4HI0E 3ZIAD 1GKIA 3NWJA 3W8NA 1SGWA 421PA 4BLRA 3EPLA 3NIBA 3OIWA 1SVKA 1Z07A 2FPMA 5JWRA 1O3YA 2GEDA 2V1XA 2OFXA 1QVRA 5GJWC 3EZ2A 2ZRPA 4JMPA 4DXAA 1QHGA 4QXAA 2RMKA 3SJAA 1NLFA 1VHLA 3K9HA 3Q5DA 5G41A 2WJHA 4LK2A 3ADKA 4Q1FA 1WF3A 2ZYUX 2MMGA 5CITA 5JRZA 4TMKA 2C9YA 1UAAA 2HCBA 1Z0FA 3QEOA 4OQFA 5JS7A 2ZE8A 2W00A 1DELA 2WBLC 3NBYC 1DO2A 3AVTA 3GFPA 3AVWA 1NP6A 3JVVA 2F1RA 4OQMA 2ZJBA 4BFZA 1XXHB 1PLJA 4RZXA 4ZO4A 1OV4A 1TEVA 3MWLA 5TARA 1F2UA 2GF9A 2ZIAA 2IWRA 2QBYA 3LVRE 3B6EA 2BJVA 2J9RA 1KO5A 2NZ8A 2LKDA 3R20A 4GP6A 4L9SA 2NGRA 2O8EA 3AVPA 4TLBA 3EA0A 1TEXA 2J3EA 1BYUA 2G3YA 3WNDA 2H8KA 4GSYA 4N1AA 1A2KC 3L0IB 4TL8A 3K0CA 1KDOA 2PEZA 3LD9A 2WJYA 1XTKA 2X2EA 2OE2A 4ILEA 1CRPA 1VG9B 1XRJA 4M1YA 1HUQA 3C4JA 2EQBA 4YXWA 4IHQA 3AP1A 1YZKA 4LHZA 1QHHB 3TMKA 3W6NA 5JHGB 1WB9A 3KQKA 2PMDA 3MWYW 2Q3HA 2QAGA 5JCPA 3OHMA 1JXOA 3UWKA 3GJ3A 2ZRIA 4Y0VA 1KSGA 1YZTA 5A5GA 2BIFA 3DEFA 1LFDB 3BB3A 1HTWA 5KSPA 1JAHA 1FQKA 2JAQA 4A36A 1BKDR 3BXZA 1N5JA 4LX0A 1O87A 1DAFA 3T1VA 4E07A 1OFHA 1P9RA 2AKAB 1W4RA 2CJWA 2W6JD 1ANKA 4L16A 3FMOB 3QF4B 4V0NA 3NBZC 4LPKA 1I2DA 1R6BX 1M8PA 1IM2A 2XTMA 5E95A 3I72A 4QHSA 4IEEA 1AS2A 2FGKA 3NEYA 1U0JA 4OI0A 1IN7A 1E2JA 5EXTA 5LPNA 1VKJA 2ODEA 3ZD6A 1YZQA 2J87A 2YWGA 3B1ZA 1W0JA 2QP3A 3QKUA 4II7A 2IWHA 2QEQA 2JIZD 721PA 5L3VA 3MRSA 1B23P 3A4LA 1YR6A 4XIGS 1CR1A 3B2EA 3WP1B 1M74A 4FD2A 4KLZA 1GNPA 1QF9A 4JLJA 5KDDA 5IT5A 4BPBA 1JJ7A 1XDBA 4YC7A 1OE0A 1YJ5A 4TYNA 4AC9A 1RRGA 3B60A 1MO5A 3UWOA 1E2GA 1NKTA 3AGQA 2H57A 5BN3A 4M22A 4DEYA 5HTKA 4D6PA 4FMCF 4LBVA 4PAOA 2RH5A 3SQXA 4DLWA 2ZRFA 3SJZA 3DHWC 5B58C 3C41J 2J0VA 4NTZA 3L43A 4JL6A 4KFUA 3GJ0A 2H17A 2PX3A 4CEJB 3LVQE 2FZLA 2WM9B 1BMFD 3U7FB 4KFSA 3B82A 2O8FA 2CHGA 2FNAA 1EWRA 2IYVA 1W36B 4DLSA 3SEAA 1JPJA 3DMNA 3VFDA 4D2IA 2YJTD 2B8TA 3QVUA 3SHFA 2ZROA 4EPVA 1GZSA 2GF0A 4ZIRA 5L3QA 3AF4A 2VP0A 3TSOA 1A5TA 1OYYA 3THXA 3I3SR 4OYHA 1R0XA 1SVMA 3A58B 4NYIQ 1AZTA 2CK3D 1D6JA 4LHWA 5F9HA 2QSZA 4CEIB 1JECA 4QGFA 1KY2A 2QPAA 3BJIC 5AUNB 3U4QB 1OH7A 3ZYCA 2CNWD 2Q0HA 5D3QA 2ZI5A 3T61A 4B71A 4LHYA 5J4KA 2IYYA 1MABA 2OV2A 4RD2A 2Z83A 5K8LA 2QMHA 4URUR 2VHCA 3OEED 2C78A 1XEWY 1ZVQA 2HUPA 4CZ2A 5DN6D 5JI2E 4RFSA 4ZPXA 1FW6A 5BYJA 1LW7A 3Q72A 1QBKC 1U8AA 5L3SB 3RS4A 3EG5A 3W3ZB 1DADA 3CPEA 3U3JA 5HZKA 5F2EA 3SFVA 4Q9IA 4NKRA 4B35A 5SZIA 1E9CA 1KZ7B 2C04A 5CDFE 2ONJA 5IF9A 3ADBA 1IN4A 2D2EA 4OK5A 1P2VA 3RWOA 5FR1A 5JWOA 2F1JA 2FN4A 2J7PA 4NP6A 3QNUA 3B85A 3CZPA 2VSFA 3OESA 4JLOA 1KDTA 2JLZA 2NO1A 2CLSA 3K8YA 1DE0A 5GJCA 3UMFA 2J41A 3W90A 1D2MA 1RJ9B 3ZS9A 4PFSA 1UJ2A 2WOJA 2ZJ8A 4LJ7A 5D3MA 3TQCA 4OQNA 3CRQA 3TNFA 3ND8A 1G291 4EFLA 4MRPA 4MKHA 2FWRA 2DHRA 4GDFA 3V4FA 3ZVLA 3PQCA 3HPRA 3I92A 3PUZA 4Q7JB 1RPZA 2J0QA 2QMUA 2R6DA 3F5FA 5FPHA 4Z51A 3FE2A 4AG6A 1F60A 5FTLA 3VNVA 1P7CA 3CF6R 1UEJA 3AM1A 1U94A 4G5RA 1G5TA 2O0KA 3IQXA 1FZQA 4KI0A 4LBZA 3AF0A 3SBEA 3QIAA 1OH8A 1U9IC 3U7GA 4C0KA 3GJ6A 4P4SA 4JKIA 2A30A 2R9VA 4KBGA 3VKGA 2V1UA 4HUTA 3K0AA 2HT1A 4Q66C 3EZ6A 2ZQ5A 3B9PA 3WXMA 3ETLA 3T34A 2ERXA 1Q0UA 1YZUA 5GJVC 4MKIA 4Q7LA 4QRHA 3VU9B 4C7OB 2WV9A 2OXCA 2ORWA 4AKIA 3ZS8A 2IS1A 3T1OA 3CUEF 2DY1A 3ZGXA 4RZ3A 3GJ5A 2Q9BA 1ZM7A 3H1TA 2O8CA 2NPFA 2ZITA 3IIMA 1JI0A 2ZRKA 2RGNC 4BE7B 3ZDQA 3C5CA 5JJIA 1R5NA 1ZM2A 1ZW6A 1VTKA 3GLGA 2VA8A 5AUQA 1S1MA 4ZDWA 1K8RA 5CM8B 5B30A 1UF9A 3EZFA 3MUFA 4RD4A 1XPOA 2IXFA 1HEIA 2YYZA 3VKWA 3WHKA 2R44A 3EIHA 3TJZA 4D0GA 4RCYA 1A1VA 3B7GA 4YXWD 3NXSA 3VX3A 3S1AB 2PL3A 3BFXA 1OHHA 3QOFA 3THWB 1NY5A 4X8OA 4ZCIA 4W5HA 1JAIA 5FTNA 3I61A 1FNNA 3EC1A 3K0FB 3H4MA 4NU0A 2H1LA 3BC1A 3RANA 1WQ1R 4DDTA 3NDPA 3PUXA 2V3CC 1U8ZA 3QE0A 5DISB 1GKYA 3MSXA 2ZM5A 3RLFA 3GEIA 2P0EA 3CNOA 3LBHA 2FFHA 2VLIA 1IJFA 4HUQA 4Z54A 1NN0A 2ZRCA 1CS4C 3FKQA 1OB5A 5LB4A 4JBWA 3RC8A 4LJ8A 1FP6A 4JS0A 5C46F 2OFOA 2ZSFA 2YINC 2F43B 3CZQA 4Q02A 3ECCA 2VSXA 1GWNA 4EJSC 4JYCA 1SULA 4TMWA 1EFCA 1GIAA 2QTVB 1VG0B 1W0JD 2G1KA 3L0SA 4EPYA 1N0UA 1D2NA 4G5OA 1RKBA 4LJ5A 1Z3IX 2XJ4A 4IVQA 1AKEA 2GJ9A 2ZJYA 4H1VA 2HYDA 3QXXA 4LJAA 2H92A 4HLUA 4QNMA 4DJTA 2ANCA 3U3OA 3M4YA 5E4FA 4C3ZA 3G82C 3GLIA 1XF9A 2GHIA 2FEMA 3OAAA 4KV9A 2PCLA 3VX4A 2YWHA 3ASYA 4DB4A 1YVDA 2A9KA 2ZVPX 2AKYA 3B1VA 4OQXA 4RZUA 3TGPA 3PEVA 1II8A 2Z0MA 3QF7A 2O8BA 2WMNB 1M2OB 4Q19A 5DGXA 1IBRA 5J47A 2CLDX 5KPJA 4B6EA 3QUSA 4FMDF 1SVLA 4LBWA 1HQYE 4XWOA 1UM8A 2I3BA 2F1IA 4RSGA 1KTVA 2XGJA 2JCSA 4MGIR 1PV4A 3VMFA 3X1WA 4F4CA 3PUYA 4RKFA 1L4YA 1QG4A 4N0DA 3D3QA 3GLHE 3RRZA 5J4HA 5JSZA 2D06A 4B32A 2A5JA 3JZMA 4FINA 1VIAA 4RKEA 3CRMA 4C4PA 5HKKD 5F98A 2IYUA 3UIEA 2QUZA 3ZZTA 1JBKA 1LVGA 2DB3A 3P32A 2EWVA 2J1LA 4EKDA 4DLZA 2FU5C 3H84A 2ZI6A 2ZI4A 5JHHB 2WZQA 1XD2B 2Q9AA 4B47A 4EFMA 1KMHA 4NCKA 3TKLA 3KL4A 2YC2C 4JBXA 1Z6AA 4HEJA 2QP9X 4DZZA 5FPKA 4Z8XA 4ARZA 3TW4A 2X8AA 3T1QA 5G40A 3N5CA 5C1BA 4TSFD 3WY9A 4Q9KA 1R0ZA 3PVSA 1G3QA 1GITA 5GVSA 3LLUA 1NJFA 1EFTA 2KE5A 3Q7PA 3GEEA 3BH0A 5HE9A 3IEUA 4BASA 4IOJA 2FA9A 3KQNA 1AGPA 2QT0A 1XTSA 1FOEB 2NTYC 1II9A 2JLXA 2JLYA 2QGNA 4NONA 5TY0A 1JR6A 2WSSA 2KWIA 1XJ0A 1Z8FA 4JLKA 4UKDA 5EZ6B 3SR0A 4A0RA 2HT6A 1ZD1A 4Z1MA 1TPZA 4PZYA 1AA9A 1EX7A 1QHSA 4NL4H 5J4YA 2RHDA 2AWOA 1COWA 1T3SA 3CNNA 3LFUA 5E7IA 4D4KA 1P6XA 3CRW1 3SOPA 2J7PD 2V8OA 2ZEJA 1OSNA 4U7DA 2QTFA 1GG2A 2EFCB 1OXTA 2QN6A 2AFHE 3MWKA 4DSUA 4RD3A 4DEXA 4FMDB 3BE4A 2XNDD 4DC9A 1EXMA 1J99A 1KY3A 4JVLA 3PUVA 5M04A 5DSZA 4AG5A 2IUTA 3QBVA 2OCPA 3BAFA 4MH0R 2WAXA 1N6NA 4LYJA 1NBME 1CP2A 4LDJA 4XD7D 4TT3D 3WP0A 3L0PA 2FZ4A 5G3ZA 4V0OA 3I5YA 2R6FA 3F0TA 4IDOA 5JCZA 5EP2A 3Q85A 2QNRA 4DLRA 2WKRA 4MGYR 3V00A 3UMRA 3GFTA 4OI4A 5JLJA 2WSMA 4PHFA 1E9RA 4MRVA 1OH5A 1T3HA 4X8HA 3RC3A 1AM4D 1XXHA 4TTQA 3SU8A 2WJJA 1NG9A 2RGGA 2Z43A 3W6PA 3GLFB 1E9AA 4S2EA 1N5IA 3KDSE 4WW0A 2N42A 2F9LA 3NG1A 1Z5ZA 1ZM3A 2OM2A 1GL9B 2WVJA 1EFUA 3LBIA 3W9YA 4MGKR 1NVXQ 3BB1A 2D3WA 1GL6A 5AWFC 3BH7A 4Q9HA 3M6AA 3IBGA 3LLMA 3FMIA 4DRZA 2JLVA 4K81B 2V9PA 5KNCA 4LOAA 3EX7C 4DIDA 4O3MA 3HU1A 2VF8A 2W58A 1XMJA 4I4LA 3TQFA 4BEJA 3BOSA 4M21A 4TL9A 3U6BA 2OO7A 4PANA 3CPJB 4TN1A 3QBTA 1QHHA 4NCIA 1Z29A 2XB2A 3K0SA 2ZE7A 3IHLA 5GVRA 3AVUA 3MJHA 2BKEA 5EXXA 5BN4A 1KAOA 4NYIR 4Q4AB 2XTNA 4IVPA 3KX2A 2C95A 3PFIA 5DIFA 4Q4HB 2IF0A 1S3GA 3K53A 4D26A 2YOHA 3ZVRA 3P20A 4MKGA 2C9OA 4V03A 3EXAA 2NG1A 4PAMA 4XOIA 4LRWA 2QSYA 2ZI3A 4R2HA 2QE7A 3QF4A 1Z0KA 4QJ4A 3PITA 4Q1DA 4A0HA 3MLEA 4KJZA 2OLKA 1OHHD 4IDQA 2PJZA 4JSTA 4TLEA 4XVQA 3C15C 1GNRA 1RRFA 4IXMA 2B7BA 1BMFA 3JVUA 2FPLA 3E2IA 4M9ZA 4Z8YA 1BS1A 2EFHB 3RYTC 3IQWA 2ZR7A 5DI9A 1XD8A 3EA5A 1E2KA 3U3KA 3PG5A 1P9WA 1E1RA 3Q7QA 2O5VA 4HAXA 4G5SA 1KYIA 4I1VA 4LCBA 2OBNA 2ZYVX 2ZREA 4M2LA 4LYAA 4CEHB 2H5EA 1XCMA 1PLLA 2ZJ5A 5IRCD 3NH9A 5K8TA 2AN9A 2JA1A 3K70C 1EWQA 4W5WA 2CK3A 5EE0A 1KKMA 4KVAA 3QPVA 2IS4A 2FH5B 2IC5A 2ZSBA 4GI7A 2A5YB 2JASA 3I8XA 2OAQ1 1VDZA 4MGZR 1R5BA 1GOTA 1VCOA 2OSBA 3UKDA 3KKQA 3WMGA 5CYOA 2D2FA 4LV8B 1T5IA 2BMDA 5B64A 2C96A 4CEJA 4IFEA 2BMFA 2WWYA 1E96A 1OXXK 1ONBA 4W9MC 4S35A 4KYIB 3AV0B 3LQRA 3RS5A 2TMKA 1MRNA 1MR3F 4LGMA 1KK3A 2BEJA 4TLAA 4QL3A 4Q9LA 2HDNB 1I4DD 4GP7A 3AVYA 2O8DB 1NLYA 1P60A 1NL3A 2IL1A 4NDZA 1W2GA 4DCVA 4HZUB 4QM7A 4D25A 4UNRA 1DARA 1ODFA 2VP2A 1TF7A 1E79D 4V02A 1AJEA 1CJTC 1CXZA 2ATVA 2JDIA 3GFOA 5EZ5A 4TQUS 2BMEA 3VTKA 4CEIA 4C0BA 1E9DA 1Q22A 1UFQA 3U4QA 5LBIA 3CM0A 3DL0A 1J2JA 1ESNA 1QZXA 2G6BA 4M53A 3AP2A 4URZR 5DHFA 3V4RA 1KOFA 2IUSA 5DE3A 4CDGA 4NYJR 1IY0A 1JB1A 1FFHA 1WMSA 4O2LA 1RYFA 1YKSA 1P3JA 4OHVA 2IYXA 2AK2A 5LB2A 3ONWA 3GPLA 2DR3A 5L3SA 1E0KA 5CM9C 4OK3A 4FMBB 4QJ3A 3X2SA 3U3RA 3NVAA 2ZE5A 3QXCA 4B3FX 2PMKA 5E3HA 2BBOA 4GT1A 1LF5A 4DWJA 2GAAA 5FR2A 4QKQA 5FBVB 1GM5A 2OESA 2Y8EA 3MD0A 3Q5EA 1DAMA 1XU4A 1VHTA 1YR8A 3AP3A 4PC7A 4DKXA 3IPYA 4R71A 1YZGA 1G3UA 3BRWD 2XTZA 3NH6A 4NCNA 4PX9A 1T8TA 1TADA 5G3YA 3GEHA 1HE1C 1T0JB 1L2TA 2CVHA 1RYHA 2GJAA 1ZMXA 1EK0A 5FBLB 1P72A 2YC4C 1RJ9A 2WSSD 2W6ID 4QGAA 1KO4A 1E2EA 1E2HA 4TYPA 3UG6A 4A8JC 3WYFA 4Z1MD 1SHKA 1SXJC 4A92A 4D0NA 2QTHA 1WE2A 1COWD 3GJ7A 5HE8A 2PLFA 4IJMA 5TB5A 2A7QA 2DYKA 1M7BA 3T15A 1DO0A 2FMXA 4DLXA 2IA5A 4FWTA 1CF4A 3AH8A 2OCBA 2REXB 2ORVA 4QGGA 1CJKC 2PZFA 5JWHA 1W49A 5JBQA 4E22A 1VCNA 3TW8B 4FIDA 4OHXA 1E99A 2YWEA 3KFXA 2IHYA 4C0SA 1A2BA 4OQLA 1EFHA 3RS7A 3PXGA 3OEHA 4D4LA 3FMFA 3T5GA 4DSNA 4JLPA 2WIBA 1TQ6A 4MRSA 1KO7A 4QBIA 4J0QA 4BLQA 2A5FA 1HT2E 4KODA 2R8RA 5TXGA 1Z47A 2GXUA 1NIPA 5J40A 2FE4A 3SYKA 1EGAA 4LYFA 2GXSA 4EAQA 4EPTA 4HDCA 1SVWA 1G4UR 4GBMA 3LXXA 1XX6A 5TMPA 5TVKA 3VU9A 2QA5A 3KQUA 4C7OA 5K8IA 3KJGA 2D74A 1ZC4A 2ZU6A 2BM1A 3HYRA 2WKPA 1N5KA 2QPTA 4JLNA 2WMOB 2Z4RA 3GJ4A 4N3NA 2XXAB 5KTYA 3BBPA 4V0ME 5JRJA 1IHUA 1KDRA 1OT3A 3GMTA 1W46A 5FPYA 2NO7A 2DFNA 1JR3E 4K46A 4OHWA 4B3CA 2OFWA 4PC6A 1MRSA 2P5TB 1HQCA 2A5DA 3TUIC 2J7KA 1HE8B 3N2EA 4R2IA 2E87A 4BFUA 3GLHB 4KU4A 1OW3B 1W4BA 2CLCX 4A1FA 1CR4A 4WXRA 2ZS7A 2D7CA 4UNQA 3THWA 4XJXA 4BWYA 1Z6GA 1ZBDA 1CR2A 3TSWA 3E70C 4BRWA 2BJWA 1KI4A 4JL5A 4QNRA 2RCNA 4LV5B 2L0XA 1X1SA 3AKDA 2NPIA 3M1IA 4GNKA 4DIEA 1M34E 1T6NA 4OK6A 5BYKA 4JLAA 5FUYA 3T12A 4A0GA 2XSZA 4P4TA 4XVUA 1BOFA 3SBDA 5FBRB 2XZLA 1WXQA 2CCGA 3QEJA 1SKYE 3GLFE 2QE7D 1FP7A 2ECKA 3LW7A 1FX0B 4M9QA 2OEPA 4KVGA 2F43A 2P6NA 3AF3A 3DZDA 2NO0A 4P3YA 1F5NA 2DWQA 1Z63A 1S9HA 5H1YA 4P32A 5FL7A 4NYMR 4TLCA 1BYIA 2C5LA 3AEZA 4ZV4A 1Z0DA 2CVFA 1NSFA 5KU1A 2ZU0C 4IKEA 1G3RA 4UXJA 4YLGA 1Z22A 4F4IA 2GCOB 1E1RD 3K1JA 3TSZA 5EE3A 1J8MF 3REFA 1E9BA 4YMSA 1RFLA 2AD5A 1J90A 5HKKA 4HAWA 2GWHA 1VMAA 2CL6X 2GBLA 3SE0A 1ZD8A 1IN6A 1N6PA 3GJXC 6Q21A 2DFLA 3KZ1E 3CB4A 5KNBA 1LS1A 4XWKA 3QKTA 1Z0AA 1P2UA 2AXNA 1DAKA 2IUUA 4ITRC 3RVBA 1R0YA 3RRYA 1L4UA 1WA5A 3X1DA 3L82B 3ZVMA 3N70A 4JLMA 4R7ZA 4TSFA 4AI6A 1US8B 4B73A 1QHXA 5CIWA 2WHXA 2CL0X 4AYTA 4P4UA 1W36D 3KJIA 1DS6A 2QY9A 3QPWA 2A2ZA 1N6HA 4XH9B 4Q9JA 2JLUA 1KJYA 4DB2A 4PC3A 1IOZA 2N1BA 2WJIA 1XWIA 3OF5A 2LCFA 2H16A 3PR1A 3TUJC 4QFMA 3KUDA 1MO6A 1OIVA 1XEXB 3CLVA 4GOJA 3AVXA 4UXHA 2VBCA 4JL8A 2JDID 1X86B 4FMCB 2GESA 4O25A 3KKNA 4PO8A 1XD2A 4TTPA 3GCGA 3LQQA 3WRXC 2PLRA 4CT4B 1P2TA 4B3DA 2VHJA 4B3GA 2CCKA 1GL7A 5FTMA 2E1RA 2XNDA 1N6LA 4UJ5A 4PSAA 1II0A 1Z0JA 1PZNA 1ZUHA 1HURA 1S2MA 4KSBA 1TNDA 3A8TA 5HR5A 5EP4A 4JJKA 4EJSB 3WRYC 2ZJ2A 1E2PA 1KMQA 4MYTA 1U81A 1YZLA 2OUKA 3QI2A 4TT3A 4XD7A 1JQLB 2HLDD 3ZJYA 4E5UA 1ZU4A 1NIJA 1VECA 5CLQA 4HB3A 1E32A 2YV5A 8OHMA 1NF3A 3TVDA 2I1QA 4OJQA 3KXIA 4NH0A 1E1QD 1C4OA 3W6OA 4QHTA 4V0MA 2XZPA 1JEEA 1ETUA 2GVZC 2SHKA 4IRUB 3WMFA 4OL0A 3SYLA 4AWXA 4JLDA 4DHEA 2EU8A 3HR8A 4KHZA 4Q1BA 4C30A 3U6KA 2K5UA 3SJBA 4Q18A 2X2FA 2OLJA 2HCJB 2CHVA 2LWIA 3TRFA 4KFTA 5LDDC 3U60B 2IF2A 2OXRA 3A1WA 3BORA 3KQHA 1NNEA 1DVRA 4G3XA 1TTTA 4LC1A 5AR1A 3U3MA 4MYUA 3U7EB 2AX4A 5CLLA 4XSHA 1DTSA 1W5TA 3WBJA 3HPQA 3QKSB 1Z6XA 5FPSA 1I2MA 1RZ3A 1YQTA 2D62A 1AQYA 2QT1A 4H1UA 3EARA 2RB4A 4JVMA 4M0LA 1KSHA 4PO9A 4M1OA 2BDTA 2B8WA 1S0UA 4Q4LA 2ANBA 2WKQA 1P73A 4QGHA 5EXPA 821PA 5KSYA 1TU4A 3B13B 4YQFA 2GK6A 2Q3FA 2R65A 5H8WA 4OHYA 4C0QC 2CHQA 3LRPA 5A4JA 3AUXA 1NY6A 1TQDA 1W4AA 1TAGA 3K09C 1KJZA 4UJ3A 1HA3A 3I4LA 3I32A 4V0KA 3NC1C 3GLFA 1G6HA 4HLDA 3OEHD 2FSIA 1WP9A 2QMEA 2ZJOA 3U61B 1A82A 4CYMA 2CXXA 1KNQA 4FW9A 4MDEA 1GRRA 3BK7A 1KSJA 5JMTA 2ZUCA 3H0KA 3O8BA 1S96A 3THYB 4URXR 4JT2A 1G7SA 2IS2A 1KO1A 4HLQB 2YZ2A 2BVNA 5KSOA 1DBSA 3DOEA 2QENA 1CEEA 1E2MA 3CR7A 1IXZA 3U44B 2NO6A 3E5HA 4GFDA 4FCTA 1T4GA 4NCJA 1R2QA 4PHTA 1CKEA 2BBTA 3TR0A 4GRAA 1IAQA 3W34A 4DLTA 2X77A 3CKLA 1Q44A 1NMXA 2C98A 4Q4AA 5C2JB 2QMOA 4MA4A 4OBEA 2QRZA 4HZIA 4MUAA 3G5UA 3TE6A 4Q4HA 1CR0A 3RRNA 2O0HA 1VYTA 2WWFA 3VR6A 2FFBA 3ZLJA 1LNZA 2FX3A 2VP4A 3GJ8A 1R8QA 4ESVA 4BLOA 1VIYA 5FOUA 4MDFA 4ZI3A 2AXPA 2FEOA 1HYQA 1NMZA 5JEEA 4BZQA 1OFIA 5DHAA 1XTRA 2BCGY 4ZDKA 4TTRA 621PA 4TZ6A 5AJWA 5JJKA 2P6RA 4RY2A 3TBKA 4B75A 2HV8A 3W3AA 5HPYB 1NJGA 2ZVQX 4CT5A 2DBYA 3LX5A 3A1UA 3FVQA 1OKKA 2CEAA 4OI1A 5CDFA 4DDWA 1G21E 3HYTA 1CLUA 1EESA 2XSZD 5DYIA 4CEHA 2F9MA 2ODNA 2R62A 4Q1EA 4M1SA 3WYAA 1E9SA 3NKVA 1E79A 1X8LA 2QQ0A 4PAQA 1OLOA 4AK9A 3EPJA 4KXFB 2MMCA 1E6CA 2UVQA 4OI2A 4HDQB 3LY5A 5FOSA 3E1SA 4QBFA 1NSTA 5DI3B 2WOOA 2FF7A 1SKQA 2XZOA 1K5DA 1ZU5A 4QC2A 4RJLA 1FMLA 1ZINA 1PUJA 1U90A 1G8YA 3B78A 5FL7D 4BFYA 3MWJA 2JLQA 1E2IA 5KNDA 4HB4A 3TK1A 1YR7A 5CYPA 4I1UA 2ZANA 2BBSA 3K0CC 2VP5A 1G18A 1PLKA 1W5SA 1UBGA 1YRAA 2OHFA 4E09A 3A4MA 1E0SA 5KOYA 3SZRA 5IHPA 2FSGA 2IYZA 2G1JA 1R8SA 2O8DA 2C77A 4A82A 3BERA 2G88A 2ZJAA 3L8YA 4HZUA 5HZHA 2XJ9A 4Q7KA 4BRUA 3IO5A 4KLNA 2QAGC 5KO2A 3P1JA 5FUWA 3QENA 1OJLA 1XMIA 1MOZA 4LYHA 2G0NA 3TH5A 3QXJA 2OCAA 2GZDA 4AKEA 3FB4A 3A4NA 4BZPA 3O8CA 1W2HA 5HCIA 3MJRA 3HDTA 4B33A 4M1KA 3ICQB 1IN8A 4WZ6A 2G9NA 1KK2A 4BUJA 5J5CA 2W6IA 1SQ5A 5DH9A 1MV5A 1N6RA 4IDPA 3LX8A 3HWSA 1FUUA 4MKFA 1E0JA 1QVAA 1N25A 2V6JA 4I81A 3VNUA 5AJVB 1RE0A 4H9GA 5BQ5A 2XEXA 4BZXA 5JZVA 3R9XA 2IEZA 4TYWA 3CX6A 1AGRA 1NRJB 2Q9CA 3K70B 3I1FA 2P3SA 2OG2A 5UKDA 4XWAA 1OFTA 4MRRA 3VR4A 1T0HB 4A2QA 3NHAA 5FUXA 2R6GA 3SC3A 2YHSA 2B92A 4DSTA 3KKMA 4M9SA 2WJVA 2Q21A 4KFRA 4LY6A 4P31A 4US0R 2GXAA 3KUCA 2C2HA 4Q48A 1KI6B 5KSZA 2ZRNA 121PA 3NC0C 1DG3A 4LC0A 4Q01A 2JLWA 3N2IA 5FH9A 5FFMA 1OXVA 3V9PA 1DPFA 3WHLA 2ORIA 2D7DA 2IYTA 1WCV1 1SKYB 5B2ZA 1TX4B 1JR3D 1Z6TA 3VR2A 1T5LA 3PUWA 4PQYA 2JJ1A 3QVVA 4CVNA 4PC2A 1Z28A 2ZRBA 5BWMA 1JQJC 2ZR9A 2KI5A 4HAYA 3CX7A 4B34A 2RHMA 3CH4B 1UKZA 3B5JA 3U2QA 2EFDB 2PZGA 1W47A 4US1R 4IVRA 3CH5A 3QSYA 2HJGA 2QM7A 5EXSA 2BMJA 2V7QD 4IDHA 2HYIC 2PX0A 1SVSA 2F55A 1FL9A 4TMXA 3UG7A 4XTRA 1DOAA 4F91B 4K8OA 3R8CA 1TUIA 3AF2A 1M6NA 1UDWA 1K6MA 2VO1A 4UQOA 2IYRA 1FTSA 2WWXA 2Q6TA 1HT1E 3VAAA 3EW9A 1D9XA 3BS4A 4ZKEA 1P62B 4GOKA 4IEIA 1H8HD 1KKLA 4ACBA 2XXAA 2BM0A 5HCNA 1TQ2A 1Y3AA 4CRWB 1W48A 2VTKA 4F92B 3J81k 4DBLC 5CK4A 3C7KA 3FHCB 5E7JA 4B76A 4LJ9A 2HXSA 2J0UB 3MG9A 4A2WA 3EZ7A 5JS8A 3EPHA 3VQTA 2W83A 5EE1A 1HV8A 1SHZA 2BBWA 3CRVA 1S1CA 3FHOA 1VG8A 3GLHA 4UNSA 1GNQA 4PPGA 4B43A 3EASA 4KAXA 5A0FA 3NBXX 2V55B 2J46A 3MFYA 1PJRA 1XZPA 2ZSEA 2OILA 3KKOA 1L8QA 2CCJA 3IUYA 3PENA 4A8JB 1SXJB 4EUNA 2WWIA 5SZJA 2DFKB 3VR3A 1E9FA 2BV3A 3D8BA 4DVGA 2QZ4A 4OKSA 3KTAB 2GCNA 3B1WA 5FBWB 4US2R 1U99A 4JYBA 4IOLA 3D6TB 4LV6A 4F7WA 5TV2A 1T3LA 2W2TA 3SYNA 1FX0A 4DUGA 2MSEB 5H68A 1U9IA 4IOKA 1V5WA 3KKPA 5BW8A 3X1YA 2BC9A 3TLXA 2KBEA 1MT0A 1TF2A 1S9DA 2ZRJA 2VYFA 4KO8A 2GXQA 3EPKA 4U00A 2GZHA 1OKKD 3IGFA 4PQRA 2IXEA 4RD0A 4B44A 1F2TB 2GCOA 5L3RA 4HAZA 2C03A 4R98A 2ZRAA 1KAGA 3CNLA 1Q57A 1ZUIA 1GFIA 4YMTA 2C99A 4LPSA 3DDCA 2DWOA 1KZGB 4ERNA 2W0MA 2RGNA 3AVVA 4D82A 2Z4SA 1NBMA 2GZAA 1ZCAA 3DVLA 3L8ZA 2HF8A 3I8SA 4A9AA 3AKCA 3HP1A 3A6PC 2WAYA 4GMXA 3FFAA 2N46A 2VH5R 1US8A 2HF9A 4WA7A 3LV8A 1ZCBA 2XAUA 4JVSB 5AUPB 2AR7A 1X8JA 5TDHA 1BIFA 1GSIA 2HLDA 1KI2A 3CIOA 1G20E 4BLTA 2ZI9A 5KHOC 1LF0A 1IONA 1Z08A 2EYUA 4URVR 4YDSA 1E1QA 3ICEA 2VP9A 1X1RA 4LHXA 5IK2A 4Q00A 1XEXA 4ZCLA 1KO8A 3AQ4A 4BGDA 2GILA 4NBSA 3OFND 4WVFA 5JFGA 3W5IA 3REGA 3HR7A 3OIYA 5DNYB 3P4YA 1B0UA 3FYHA 1JALA 4W7SA 4DCUA 4P33A 2QGZA 3CX8A 2WJGA 2B21A 4QOSA 1Z2CA 2XB4A 1XTJA 1KI7A 1XPRA 3OE7D 4TL6A 1V43A 4EJSA 1E2FA 3QKRB 5EJEA 1U0LA 4U02A 5EP3A 4HLCA 3SDZA 3MAAC 3FHTA 4V0LA 3QG5A 3U7HB 4QG7A 3DOFA 1E0AA 1DAHA 3A1SA 2W2VA 3WMEA 2QQEA 3DM5A 2NQ2C 4HLUC 1WDTA 1G7CA 4LJ6A 1C1YA 1PUIA 4AD8A 2HXYA 4NZYA 1EFRA 1W0KA 4PZZA 1ZC3A 4EPXA 2IS6A 5EP1A 2G0TA 2PT7A 3AVQA 3KJHA 3OIUA 3UPUA 5CJ2A 3O8RA 2ZUBA 1UADA 3P27A 3CR8A 1YZNA 3GD7A 5LD2C 4CW7A 4O2RA 2FSFA 2RKOA 4YMWA 3QKSA 1VPLA 2YVUA 4OJKA 5ELXA 1WBDA 3VKHA 1OYWA 3CWQA 1Z06A 1YU9A 2CE7A 2AK3A 5H70A 3SQWA 1NN1A 4DCNA 1N6OA 3H2YA 5FOXA 3R7WB 1U2RA 2ERYA 1N6KA 2RGEA 2WTUA 1N0WA 3LA6A 2JJ1D 2DPXA 3IIJA 3WNCA 1MO4A 1ZP6A 4TYQA 1I4TD 3CPHA 1G16A 2JLSA 1BO6A 2AFIE 1NVUQ 4WOPA 4EDHA 2PBRA 2QG6A 2Z6VA 4A0FA 2FFQA 2I4IA 4C0JA 4HAUA 1IXSB 3O8DA 1Q21A 3UATA 2MSCB 4KYUA 1AN0A 5AJYA 5EUMA 4PXAA 1TUEA 1CIPA 1N0VC 4P0TA 2JGNA 4DT1B 2VHQA 1XMSA 4M4SA 3RAPR 1T8UA 1PVOA 3THYA 3S1AA 1Y63A 4RZ2A 2DWPA 4RVCA 3ADDA 1JJVA 4JJZA 1G41A 4WAUA 3K0FA 1P2SA 2WIAA 1IY1A 2QAJA 4I1SA 1NLZA 2BHRA 3U44A 4EPRA 3Q9LA 3IKJA 1YRBA 4D4MA 2REOA 3OZXA 1E2QA 2FG5A 2QPOA 5CB8A 4QJ5A 5JEDA 1XP8A 4LJ4A 4ON9A 4BFSA 2V4ZA 4FWIB 2G77B 4JLVA 4HB2A 4TMVA 2AWNA 3IDQA 2ZRDA 3EIQA 2IXGA 2RGAA 1ZM4A 1CU1A 2FDCA 2VQSA 3QXSA 3X1XA 1NVVQ 1T91A 1Q3TA 2KSQA 2ZRMA 1R10A 2JATA 1G5RA 4MQBA 3JZAA 2ZXUA 3NBFA 2UZ3A 4JIMA 1CJUC 1EX6A 4C0LA 5FOTA 1M7GA 2ZSAA 2GA8A 3PV0A 1X8KA 2ZR0A 2IHBA 2QORA 5G53C 4ZI2A 1M7HA 3WBKA 3GLGE 1Q1BA 4AURA 2ZJZA 4A2PA 2BWJA 1X6VA 4Q4JB 2IYQA 3EC2A 1R4AA 4IDNA 2P67A 1GP2A 1AK2A 1G3IA 1Q1EA 2ZI7A 1KJWA 4L8GA 2PJRA 4EQ6B 4UNPA 4D80A 4F93B 4OHZA 1GKUB 4NCHA 2O0JA 1C9KA 1DAIA 1XTQA 1F3OA 2VF7A 4A15A 2X19A 2ZE6A 1KI9A 1TF5A 3SHWA 3CBQA 4DUGD 4FI3C 1AKYA 2KBFA 4AYWA 2OAP1 5DI3A 2EVWX 2BOVA 4KITB 4I1OA 5KDOA 3B8HA 1IJEA 2GEUA 3L2OB 3EIEA 3CF2A 1IN5A 3BWDD 2FGJA 4URYR 2ZTSA 2ZS8A 1KI3A 3BH6A 1D9ZA 3BB4A 3B1XA 1P75A 4X8MA 4FCWA 3KXLA 3IIKA 1E69A 4PZLA 1G5PA 2IEYA 4AY2A 2RGBA 3NTUA 3FPAA 2XITA 1P4SA 2ZRGA 2CBZA 2QM8A 3QG1A 4LI0A 5P21A 3RS3A 4ZCMA 5JJLA 2VSOA 4TYYA 2QP4A 5FUVA 1W1WA 4L15A 1SXJE 5FI0B 4AIIA 4B48A 3CF0A 4WZBE 2QROA 4Q1CA 4BEBA 1NBMD 1W7AA 1ZAKA 3I62A 3TR5A 1YE8A 3PCRB 1DEKA 1UBEA 4YDHB 3PEWA 1Q3HA 521PA 1G8FA 1P61B 4BECA 3ZD7A 4PPNA 2HJVA 3GLIE 2IYLD 1GDDA 1FQJA 3P4XA 2FSHA 5FTJA 3DKVA 4YMVA 1TQ4A 1XCPA 2P5SA 3IEVA 1ZNYA 1HH4A 2XOKA 3NDBB 3TUZC 3B1YA 5IK2D 1YR9A 4GZMA 1DG1G 3X1ZA 3AB3A 1RRCA 4RFVA 2YOFA 1SVOA 2W2XA 2VL7A 1JR3A 3IBYA 1ZIPA 4PHHA 2VEDA 4A4DA 4JSYA 2F6RA 3QY0A 4Q7MB 4O0MA 1QG2A 3B9QA 2QI9C 1LB1B 3BGWA 1BH2A 3QJYA 3BD9A 2CL7X 2XNSA 3P26A 2WICA 1F2UB 3DZ8A 1YHNA 5E7MA 2QBYB 4BFWA 4DCTA 2ZS9A 2Q3MA 2O8EB 1XEFA 3HU3A 3SJCA 1IQPA 2IT1A 2WWGA 3LW8A 3QQ5A 5FPTA 1G9XA 1QHNA 1N6IA 2VIIA 4POAA 4QM6A 4XSGA 1KI6A 2V7QA 4ZDJA 1ZUNB 4GMDA 1S8FA 4KCGA 1XD9A 4L5BA 1JPNA 1Q12A 1ZYUA 2C9CA 4ACAA 1ZNZA 2NZJA 1GRQA 1MO3A 4NPHA 4EPWA 5C18A 1G1MA 1XCGB 4G5GA 5L8VA 1E94E 3RABA 3HJNA 4HAVA 2V54A 3Q8XB 3THOA 1W36C 3WNBA 2FOLA 1Q1QA 2YOGA 4MYHA 3RSLA 3I5XA 4I99A 3AVOA 1EFRD 1H8HA 1W0KD 2GVDC 3IHWA 1KHTA 3FWYA 1E2DA 2Z5FA 4NYJQ 4CF7A 1CTQA 1OIWA 1UKYA 1S3SA 2QAGB 1MKYA 2RAPA 1H8EA 5J4LA 4DLYA 2GRJA 3LXRA 4M9XA 2V6IA 1E2NA 2EFGA 1OXUA 4ZDIA 4HYYA 1WRBA 2JJ8A 3FGNA 3A36A 3SS8A 1AQUA 1U8YA 1GUAA 1NG1A 3QPUA 3R9IA 1KI8A 4BQSA 5EQTA 2PCJA 1WBBA 2CJWB 5CK5A 1XJQA 4PQFA 3ZQ6A 1ZJ6A 1W44A 1ZNXA 1LS6A 2OT3B 2JJ2A 3W8RA 2WPDA 1ELOA 5AUOB 4PPQA 1J8YF 1NI3A 4LSGA 4D4JA 2O52A 4XVRA 2ZUDA 1FTNA 1UEIA 3O47A 4M8NE 3KB2A 3LBNA 4W5JA 1KK1A 2FPKA 4JLBA 4PC1A 5AJZA 3QXHA 1E2LA 2VHUA 2NMVA 3T06B 1N5LA 4C9BA 1E9EA 1OPXA 1LTQA 2CDNA 3DO6A 3MGCA 2OCYC 1UDXA 3H86A 3ZQJA 5J4VA 2RGXA 4BFTA 4QBGB 2GEVA 1RC8A 2J0UA 4FCVA 5FTKA 3TIFA 1GTVA 3C16C 2ASEA 4KBFA 3ZZ0A 2A3RA 4FXPA 1HY3A 1Z0IA 1XJCA 1XXHE 1CBUA 2C8VA 3CRRA 3TAHA 4DDVA 1OB2A 5SZKB 4URWR 4DLVA 4Q5IA 3LDAA 2IYSA 3TVTA 2GTPA 1AS3A 1EG7A 1Z2AA 2J59A 1NMYA 4BFVA 1D2EA 4G01B 4NE2A 4C2TA 4A8JA 1OF1A 2GAOA 3LAWA 5DLQC 3UXMA 4L4UA 1SXJA 4GL2A 2O8FB 2BEKA 1Z6YA 1KK0A 4R9UC 3DKPA 5CIQA 1OH6A 5EE5B 4KSCA 4AKGA 1Q1ZA 2AHOA 1GAJA 5EUQB 1GILA 4ZIRB 5L3QB 1N2CE 3KTAA 4M1MA 2DCUA 1G8HA 3THXB 1G8PA 4F38A 1G7RA 2YKGA 5IDVA 3EWAA 1XEWX 1DAEA 4WXPA 1FNMA 2F3RA 1AS0A 3IPXA 3KFVA 2DFTA 3D7MA 2WWWA 221PA 4YMUA 4PHGA 1E4YA 3R9WA 1ZD9A 1MABB 1ZNWA 2GETA 3FDIA 1QRAA 3UMSA 1A4RA 3Q3JB 4F4JA 4DDUA 5BXQC 5EE9A 4PSKA 4WZAE 4LHVA 2ZSDA 4HSEA 5FL3A 4ESHA 5K8UA 3PJRA 1F2TA 3VHXA 1AIPA 3BFVA 3A37A 3KJEA 4RFSB 3PIRA 4ASUA 1JEDA 4TQAA 3OFNA 1LV7A 1SZPA 1RVDA 4IFBA 1P5ZB
chains in the Genus database with same CATH superfamily
1R0WA 2VC2B 1SBHA 2F48A 4PTLA 3RWBA 1E3MA 2IU6A 1PJTA 3G5MA 3HGTA 4FHCA 1U6JA 5HKLA 5JD3A 1J7KA 1YS4A 3RS2A 3ZIAA 3PT5A 3SF8B 4JBGA 3UBTA 3UT5B 4UVDA 2GRUA 3KAPA 1K2VN 1JNYA 2Z56A 3MCAA 5ITWA 1P9NA 2P75A 4J76A 1G8GA 1ABEA 2FK7A 3TZCA 4NJEB 5EPUA 1RACA 3GZNB 4NOLA 3EXFA 3SSNA 1GRNA 1KDPA 4JP8A 1IFXA 2XGGA 2DFPA 5BSKA 4YONB 4D8XA 2GEKA 5HM8A 2LKCA 2G8NA 2MSLA 5E2BA 5ALOA 1GARA 2AFIB 2B6HA 3AUJB 3DOIA 3OUZA 3DDUA 5MGBA 5D3MB 3VU3A 3W2HA 1QH8A 3BCUA 3FF1A 1JQEA 3SIXA 1FX1A 2OHOA 2ZYWX 2O59A 4K2HA 3V8MA 3QH4A 5JAHA 1G19A 2VF4X 3QU4A 2WWRA 1KNXA 3ND9A 1L5LA 2UYGA 4B2LA 2I1VB 4EYQA 1TE2A 1PJ8A 4OATA 2WWHA 3R3WA 1H2WA 1PO7A 2R6AA 4MYCA 1PG5A 4FOSA 3IILA 4RD6A 3OFJA 5F73A 3SP1A 4ZZ1A 4G5QA 4C43A 5I9NA 3JRXA 3ZZUA 4B80A 1Q84A 4G09A 1X3SA 4OBXA 3CIFA 1WCWA 1VJ0A 1KQFA 2UXCB 3TI7A 4QDZA 1GCOA 3AKYA 2JEOA 1FDWA 1TM2A 2O05A 3CO0S 3QWIA 3U0BA 4BVKA 2O7RA 1QF7A 5J1SB 3TLAA 4KMRA 1XNJA 2UKDA 3IL2A 1ADJA 4PPFA 1VYVA 1OFUX 5JE8A 1JX6A 1M73E 3PJEA 3NAZA 5FOVA 2KM1A 2NU7B 3ED1A 4P4SB 4ZT6A 3KEFA 4FX5A 1TU3A 2P2LA 4QATA 1OU4A 2GKSA 4Z4EA 1JHAA 3K0AB 3W7VA 3ZWXA 4KGVA 2G0AA 3A1VA 3CA8A 2A5GA 3BA1A 1XO1A 4EHBA 1P45A 1JDVA 5HIAA 4DSOA 3H4VA 2OG1A 3C7CB 1HR0B 5T6BA 2H8GA 5JDCA 3K70D 3DMDA 3ZVNA 1XPJA 1Q7TA 1S2IA 2GBLC 4AF6A 5I8PA 5IULC 2WU3A 4BKUA 4QHYA 2WTNA 4PM4A 4IGEA 2EP5A 2XT0A 4N39A 2OHJA 3VVCA 3ZU6A 1POXA 2AE2A 1NVVR 4YVFA 1G7TA 1PRYA 5A6SB 4MVJI 2PA3A 1R6VA 2Q3DA 3HKBB 4ABYA 1IULA 1M2EA 1AHHA 3D7NA 3ZU3A 2FMFA 1IIBA 3KYIB 2XUJA 1JDBB 3LP6A 2DPGA 1C29B 4K1LA 3ZY6A 4F3YA 3AGPA 5J2TB 1KBOA 5C8VA 5TF0A 3LFTA 5FI1B 5B7GA 4EG5A 2HD4A 2VF5X 2XIQA 3E7XA 3DMFA 4JXZA 4CR8A 2VVTA 4FNGA 3EGXA 4UUNA 3RRMA 2HDWA 1CULC 1IZ0A 1W88B 1OLXB 3QU2A 2WZDA 1PR4A 3FLEA 4TGLA 4CV1A 5A7GA 5BWCA 2JVKA 4RGVA 5DO9A 2O5RA 2FW1A 4WSOA 2K2WA 1KIAA 3E2PA 2BFEA 2DMRA 1D8TA 1N92A 2WK1A 3GGOA 2C4VA 4OOEA 4PYNA 1KVUA 4AJNA 3F3SA 4PSVA 2PZMA 3OWXA 4BNZA 1RRPA 1TOAA 2PD6A 4KQJA 1QDEA 2Y67A 3UC5A 4L07A 1KDZA 2Q0SA 3CUWA 2BGWA 3WDLA 5B4TA 1ORWA 3K5WA 3OPYA 4UCFA 4TMZA 4IO1A 4U5XA 4Y9UA 1Q1AA 4OUDA 1RVV1 3UB2A 2VDQB 1PBTA 2ZIZA 4RPIA 1L7PA 2C92A 1JYFA 3HB9A 4NE9A 4R05A 1IHXA 4ID3A 5LUAA 4IH1A 4DG5A 4NHOA 4KTVE 4TLLB 1SBQA 4DT1A 4X8LA 1E98A 1MH1A 1PFGA 4H7KA 3KT0A 3EK2A 3FOAA 3EVBA 4C0HA 2L69A 1QGUB 4Y2VA 4EG3A 2ON6A 1G6OA 5EMMA 1HNWB 1K98A 5IBCA 3PRKE 2Q8PA 3KUXA 2GBFA 5A3QA 2CE2X 2H5LA 4WZBB 1XPUA 1A1SA 3KR1A 3X2EA 2NNWB 2OV3A 3FPLA 2KJQA 4Y2UA 1RYNA 2IP1A 1QWSA 5B55A 2QL6A 3STWA 3LJKA 1YBMA 4HATA 4Q1AA 1CX9B 1Y1LA 1JU3A 2RGUA 4M7WA 3MMPA 4Y6RA 4BLSA 2XD4A 4LJYA 4CQJA 2B99A 4Q3DA 2NLOA 1WW3A 2BUAA 2ODWA 2ZGVA 3E7FA 3RQSA 3ZU2A 4RA9B 4D0SA 2DQ4A 4EFKA 1XQXA 4TWZA 4RYLA 3RNLA 1GY8A 1RJFA 1XXLA 1H9CA 4KTTE 5MFZA 3F3YA 2I6SA 5JZSA 2EFEB 2H18A 4B3XA 3GFGA 2PX5A 4DUYB 4IJKA 2R2AA 4MQLA 5LD2B 2P90A 1GTG1 1XLTA 3JQBA 4GPTA 4NPCA 4Q21A 1W25A 5DT2A 1NF8A 3SXPA 1UBCA 1T1GA 3AEQB 3T3HA 3V6LA 2BE7A 1KGDA 1XTIA 1A8UA 1AF7A 5EAIA 3SI7A 2IYWA 4G1UC 1ZRHA 2B1QA 4L9WA 1DAGA 1XVVA 4TX1A 1SBYA 4Q4JA 1XQ1A 1ZEMA 1A04A 3PEUA 4UATA 3T5DA 1VYUA 1DXYA 3M3HA 3A1TA 3K5PA 2BI8A 1M72A 3REQB 2ECFA 3IALA 5AO9A 3E82A 1I0ZA 2UZ1B 1OAAA 5J5AA 1EPUA 3ANNA 2ZT5A 4PO1A 2IQ5A 1RQXA 4NECA 4NDAA 1A7JA 1SUSA 1VCHA 2JFWA 4M1TA 1KMHB 4N82A 4OB8A 3F8WA 3CN9A 3KXKA 1J0CA 1DIAA 4JNCA 6YASA 3HU2A 5AJXA 4P3NA 1HT0A 1Q20A 3JATA 4YAFA 3CW2A 5HGJA 3EXEB 4IILA 1RHRA 1E8DA 3ZTYA 1K5GA 1LY1A 2E4WA 1SOUA 5FBQB 3RK0A 1TMKA 3V2HA 5B1IA 4ATNA 4YRRA 3FGOA 2JFZA 3FOZA 4WV3A 1SUPA 4WIAA 1F8YA 1SJ9A 3MNFA 3CVYA 1EXWA 16PKA 2JIDA 2NUPB 3AR9A 3EZ9A 3I23A 3ZHOA 2OZEA 5IKEA 5D8DA 4MIOA 1Z4MA 1H1LB 4TSKA 5WRFA 5KI6A 2MINB 4D79A 5A06A 1AKVA 2PXHA 1L5KA 5KTTA 2I9KA 2CJYA 4CG1A 4RMNA 1GKIA 1NMQA 3NC4A 4YGYA 1XI2A 3W8NA 3ZI0A 1N1GA 4OUKX 421PA 4FGKA 5C3MA 1YJBA 3IA7A 1B4DA 2FPMA 4XX0B 5JWRA 1O3YA 2GEJA 2GEDA 3DE3X 4R31A 1KOJA 3HCBA 1ACMA 2VAMA 3NBKA 3NHJA 4IJ6A 4K9PA 5AXAA 1A9YA 4YMHA 2H52A 4DXAA 1NPYA 3UH1A 2G6TA 2QE6A 1V47A 5KYNA 3TB6A 1A95A 2P11A 2IUFA 3MS2A 4U6QA 3UFXA 3K9HA 2WIFA 2RB5A 4UULA 2WJHA 2VTVA 3ADKA 2HHCA 3GUVA 4WKGA 1WF3A 2ZYUX 3C7DB 4Z9XA 3EEOA 3NALA 3EN0A 1SUDA 2BGMA 4A27A 1VJCA 3W8EA 1Z0FA 3TTSA 1RQGA 2BFBA 2AF4C 1PN3A 4OXNA 2GZSA 3WJAA 2GHTA 3OMLA 2NAPA 3TXAA 2VTEA 2QN1A 3F7OA 2ZCUA 2A9VA 4I2NA 1TM3E 1DO2A 1TGVA 3MK31 4YT8A 3MGBA 2B5WA 2F1RA 2WD8A 2IYFA 4RZXA 4ZO4A 2CDBA 3QVTA 1M5UA 1OV4A 2VUTA 2F4NA 4X20A 5TARA 2BR4A 1Z39A 4K1XA 3B6EA 4GU5A 3I0ZA 5KTSA 1T5DX 2PX8A 1NQXA 2J9RA 1T24A 1DBRA 1KO5A 2QI9F 4GP6A 4KKVA 4TS9A 1YVUA 4TSRA 4I9NA 1E6MA 1Q7EA 2FPOA 3G49A 2OL4A 4TLBA 2QYSA 5BV8A 4H35A 1AKRA 5EZQA 1S2DA 3D3EA 1LJ8A 1A27A 1OC2A 3L0IB 3R40A 1V7PC 2YNMD 3HJCA 3HMKA 3JWGA 3K0CA 4H59A 3PCTA 4ZVQA 1K88A 5ECGC 1L5FA 1GZ6A 1XTKA 3A27A 2OE2A 1H0SA 4ILEA 1VG9B 3ZJ5A 3CTMA 2ZDHA 4JODA 1IZYA 4M60A 4DABA 1LRKA 3K05A 5B7QA 3UMMA 3SQLA 2JD0A 3TMKA 5HX7A 3A0RB 3KQKA 4BDSA 2YJ4A 2Q6LA 2OXIA 2JHCA 5MFPA 1Y81A 5K3CA 2Q3HA 2X42A 3A9RA 2W6NA 3I1JA 3OHMA 5HA5A 4CMCA 3UWKA 2IFTA 5KQPA 3JSXA 5A5GA 1U1CA 2VAPA 4NWIA 3DEFA 4ID9A 1ZX1A 4X6YA 1JAHA 5JMPA 3EVDA 4H7HA 1CB7A 1LVHA 1N5JA 3UMGA 3WZLA 1DAFA 4JK3A 2X1LA 4E07A 3PCXA 3QLJA 4LWQA 2IY9A 4UOQA 1TEHA 1FFWA 2PKXA 3N6VA 4GOOD 4OH1A 4V0NA 5IAJA 5ICSA 1I2DA 3H2IA 1JN0A 1Y7LA 2BTQA 5ENVA 3WK4A 3WL5A 1YAHA 3LTNC 4DV7B 4FM9A 4RE6A 4IDEA 1NVAA 1UM9B 1AS2A 2FGKA 4KREA 1XDGA 2GBIA 3L6CA 3LUDA 1IN7A 1E2JA 1VSVA 7GPBA 1L4EA 4IXDA 4YHBA 3L6RA 4R6XA 2ODEA 4G2TA 4PRLA 3VZRA 1VB3A 5DTJA 1W0JA 4MI1A 1ECBA 4CBVA 4G63A 1E1CB 3OLVA 4D8TA 2NV0A 2O8VA 2ZZMA 5L3VA 3MRSA 3A4LA 3WGUA 1BEZA 2Z2XA 3I9V6 5AHOA 4QLBA 3Q8WA 1QWOA 1IK6A 4KLZA 1QF9A 5KDDA 5KOHB 1YQXA 1Q19A 2V96A 1QFYA 1NKVA 3V7NA 1VJ1A 1OE0A 4UDNA 4WK2B 2O8DB 4QEKA 3ZBTA 5DNCA 3GA7A 1QQAA 4M0PA 3B60A 3K1ZA 4S1TA 5KINB 1E2GA 1IAVA 3D6MA 4JB2A 1JEYA 4DWOA 3IP3A 4LBVA 1NNSA 2NX2A 1Z18A 1NW8A 3BMQA 1TIKA 4UEOA 1QP4A 2Q7OE 3O26A 4IMIB 3BJEA 4FK8A 2ONYA 4FFBB 3ROZA 3RFUA 2ZBVA 4JL6A 5SICE 4FC7A 2HRQA 1WWKA 4ZWNA 1RKVA 3FZQA 4L6CA 1LW6E 1ZN7A 3FZGA 5BWLA 3LCJA 2CHGA 3D2BA 4UM9D 1W36B 5F35A 1NXSA 2JGAA 4OQZA 4DY4A 4I5FA 3WMXA 3DMNA 3VFDA 1ENOA 4MROA 3AJ9A 3IMCA 3RASA 1GZSA 3WGHA 1YQUA 4Y6OA 4ZIRA 5FJJA 4WESB 2I78A 3TSOA 3THXA 1HDZA 4AMZA 3P0HA 4OYHA 3TSAA 5LNK1 3A58B 5CA0F 4YGXB 2QVXX 5T5QA 2QSZA 5F9HA 1P4AA 3RSQA 3G88A 1UBRS 3ZE9A 4I3GA 4IWXA 4YXFA 1PK8A 3W6ZA 2ZWIA 1OH7A 1IPFA 2CNWD 1C4XA 1V2HE 2ZI5A 5D3QA 4CM8B 2IOQA 4TKVA 2IYYA 1MABA 5J4KA 4RD2A 4KG7A 4HP8A 4BY9E 4DV5B 3VPCA 4RVOA 1KP2A 1U2GA 1P1RA 4UU1A 1B00A 1NXVA 3OEED 4L27A 3SG0A 4BMXA 1SKUA 1ZVQA 3AJRA 3DE1X 2HUPA 3OE1A 4MGEA 4NBLA 4CZ2A 5DN6D 5JI2E 3HKDA 3K6SB 4KN5A 4ZPXA 4GYKA 1FW6A 4ZP1A 3ZUPA 1QHEA 2J6HA 4C3UA 4UPEA 4DC1A 1SCUA 5LDGA 4RM3A 3L7DA 1EM6A 3EG5A 1U5AA 1UXGA 4GOMD 3CPEA 5GMOA 4RK0A 3DDSA 3H11B 1AY0A 5I47A 1RQ7A 5HZKA 2PZBA 1K7YA 2JZOA 1G8KA 4LHEA 4AZWA 1YO6A 3ZW7A 3T7JA 4KIGA 2C07A 3SF8A 5ES3A 5CDGA 2YCLA 3UT5A 4A8HA 3MRXA 2C04A 2ZKIA 3V4PB 5JVDF 4Z9YA 4K87A 3T3DA 1IN4A 3VGJA 4NFSA 2UUBB 3VO2A 2AI3A 3QVLA 5IWCA 5FR1A 3NJ4A 4MLZA 2J7PA 1HL7A 4QWWA 1FMTA 1VSQA 3PI6A 4IDCA 1ORHA 2WG1A 4NJEA 3FVWA 3UHPA 4EI9A 3GZNA 1KDTA 1XLWA 3N75A 3V2IA 3AFMA 4LE1A 1I7SB 2HZBA 2HHAA 5EGSA 4C14A 2BTEA 2CLSA 1DE0A 2CLEB 3V1YA 5DCYA 5GJCA 3UMFA 3ZS9A 1ZWKA 4CQMD 3A9SA 5IJAA 2AFIA 1FP4B 1PEKE 3RRXA 3V1TC 5IJZA 4MHTA 3JW8A 3ZGYA 3KEMA 4MPRA 3MUOA 5D3MA 1TCUA 5BUSA 2X86A 3GR6A 3ND8A 1G291 4NESA 1Q0QA 2J85A 2FWRA 2XOEA 4WD3A 3LMKA 3U9SA 4EFLA 5E6UB 3NBUA 3PUZA 3I92A 3O7WA 4Q7JB 5MGNA 1B23P 4GS5A 2QMUA 4Z51A 3UAVA 4QYWA 1XZAA 4OXKA 4AG6A 1VRVA 3OQ1A 5FTLA 1P7CA 3ZV3A 5LR6A 3CF6R 1ZIXA 2FCAA 2BH2A 3QTBA 4G5RA 3G68A 1HKUA 4B0OA 2O0KA 4ZVVA 3IQXA 1VLZA 3K6KA 4KI0A 3KP1A 1IOVA 1Y1QA 2IOFK 4AQ7A 3UHOA 3SBEA 3QIAA 3D81A 3F6EX 3ZWPA 3U4HA 3LT1A 1U9IC 1OU0A 3QX9A 3IVMA 3T3EA 1IQRA 1D1TA 5LU8A 3IP5A 2PSDA 2YWBA 4URFA 3CTPA 4RENA 3HCEA 1WD5A 2NU7A 2PVCA 4P4SA 2R4QA 1CCWA 2QTAA 1JAZA 4OQYA 3VKGA 3OP1A 3K0AA 2EDAA 2ZQ5A 4IZIA 2OCXA 2WYVA 1C7EA 3EEIA 5AICA 3TNLA 3ETLA 4IUYA 2ERXA 5GJVC 4GMHA 2ZW9A 3PFNA 4GF5A 5A62A 3NM5A 2ORWA 2J6IA 3ZS8A 1JWBB 2HMYB 1DKOA 3RTBA 3T1OA 1FXWF 3UQYS 5G1OA 2DY1A 2LIVA 5F33A 1Z5UA 3DOUA 3S4YA 2Y6VA 1UC8A 3PNQA 3LX4A 3QJ5A 1BJKA 3A9UA 2NPFA 2ZITA 3X1MA 5A6SA 1U0FA 2ZRKA 2RGNC 3QU9A 1OAKA 1QAOA 3SS7X 3HKBA 4DYDA 3C5CA 1GA1A 4FHZA 1R5NA 3NHMA 1MC8A 1KAQA 3MRVA 4UU0A 1QK5A 1WZIA 1D7AA 2VA8A 2ZJ3A 5LJLA 5J2TA 3IAHA 1D4AA 1APBA 2BGJA 4A23A 3IERA 3QK7A 4I55F 2BFDB 4AY6A 1LU9A 3TNDA 4DNQA 3EZFA 2BMVA 3TN7A 4RD4A 5DLPA 1XPOA 1W88A 4V39A 1HEIA 1OLXA 3H87A 3VKWA 4BV8A 4D0GA 1H22A 5BV2P 1A69A 3IHTA 3GVHA 5I4KA 3QLEA 3NXSA 2PL3A 3PC7A 4O1MA 4RWEA 4YR9A 1IQ0A 2YTZA 4OL9A 5GGYA 1JAIA 1F6DA 3GV0A 3LPLA 3Q2KA 1NR1A 3TIXB 3UMJA 1KTIA 3RUPA 2C4HA 3H4MA 3NANA 1GJRA 2H1LA 2W2LD 5DBFA 5C0OE 1J8VA 3RVSA 1CK4A 2QLTA 3NDPA 3AJAA 3PUXA 4K7JA 3DLAA 2FHSA 1GKYA 3DGEC 4YCJA 3SHQA 3MSXA 4ZYUA 2GPNA 3C1TA 3GEIA 3P5SA 1VL2A 3CNOA 1CLEA 2FFHA 1WXFA 4RULA 1DLJA 1JA9A 5C1DA 4Z7JA 5LM3A 3KXPA 4FHEA 4GZ6A 2MHCA 2GTHA 2AYXA 4CF6A 4JS0A 2OFOA 4LJRA 1XIVA 3HL4A 2ZSFA 5FPQA 1SVUA 2HOQA 4OQDA 3ECCA 1QGUA 2AG1A 3DHVA 1GWNA 1B42A 3L02A 4JYCA 1YL6A 4IHAA 4DMCA 3OZRA 1MCZA 4ZAGA 1GIAA 2WD7B 2ZBPA 4G1CA 2G1KA 3TNYA 1N0UA 4WZBA 4G5OA 5BY2A 5ELMA 1V5FA 4LJ5A 4EL0A 2XJ4A 2PMFA 4B3MB 1E6EA 2PGNA 3OKPA 3OEWA 3DL7A 1GTMA 2D5CA 5LJIA 1PX0A 3HCAA 3K4PA 2HYDA 4ZK2A 1U11A 2H4XA 2ANCA 2BGIA 1J24A 3HXTA 1TECE 3M4YA 4L5CA 4DQXA 5E4FA 5EJ4A 4QU9A 1P17A 2R60A 1ZSVA 3VX4A 4FE3A 4F1JA 4WACA 5ERYA 4EUEA 2OHGA 1YVDA 4DB4A 2EKQA 3AU8A 2XGSA 4RA9A 5ALZA 1SKBA 3TGPA 3U4CA 1ENPA 3ZWWA 3EDRA 4L3OA 3ZHVA 1N3IA 5HXAA 2CT8A 1S8OA 1L4KA 3LHKA 1UXIA 1O96B 1O0CA 2WF7A 2FW0A 3SIWA 4ISBA 1M2OB 4M38A 5CT9A 1NBIA 4DIBA 4HD8A 5DGXA 2AJBA 3BIWA 1BKYA 4HOYA 3AEQA 3MOGA 5KPJA 1ILWA 1E1LA 2NQ8A 1SU4A 1HQYE 2AX3A 4P4GA 4XWOA 3BPSA 4XUCA 1YDHA 4Y2HA 3C4QA 1WMBA 4KGZA 5JT1A 4ZOAA 4DZTA 1CUEA 4MVXA 4F4CA 1OT5A 3B6KA 4MHSA 2W6PA 2ZUTA 1P9LA 2AVNA 1J0BA 3QVSA 2GFIA 1NNLA 3PUYA 1I6MA 1FLNA 1NXXA 2MR5A 3QVKA 3NFRA 5JY6A 5J4HA 3HUTA 2A5JA 5JVDA 5HKKD 3REQA 5F98A 1NRIA 3ZZTA 4GQIA 1JBKA 1L9XA 2UZ1A 1ZD5A 2ZDGA 3D8UA 1NJ8A 2G76A 3AJDA 3I2YX 4NG5A 2J1LA 1BWRA 2PGDA 3MWEB 2ZI4A 1HXHA 3COSA 1XD2B 5D5PA 3R76A 4W9NC 4JV5B 1QFXA 4EFMA 1KMHA 4NCKA 3TKLA 4OPMA 2YC2C 3TQOA 2WDPA 4HEJA 2Z2YA 4PFKA 4MB6A 3N8NA 4PXYA 4Z8XA 3VVMA 4Q6BA 1HG1A 4GVLA 1XR3A 3UUWA 3DP9A 3WOHA 3EXEA 3WK7A 2P9QA 3IE2A 1E8NA 2H31A 1R0ZA 5C1BA 5GPBA 3FSGA 4UTRA 1G3QA 1KPIA 5GVSA 3LLUA 1NJFA 1GG8A 4ETNA 2KE5A 3IEUA 2E5LB 3KQNA 2GO7A 1AGPA 1Y3CE 1A7AA 2J9ZB 2QT0A 4HWTA 2NUPA 3OZSA 1YR1A 2JZCA 2YVKA 4CIBA 1JR6A 4D3DA 1H1LA 1XHFA 2WSSA 2KWIA 2MINA 2Q0QA 3ZK8A 1RS0A 2W2MA 2IPMA 1GZ7A 2TECE 1JR2A 1YUBA 3TL3A 1FVHA 2V59A 5LLSA 1QHSA 3JVIA 2PKQO 2AWOA 3HRIA 1COWA 1LLCA 3UBMA 3DQPA 4G6ZA 4XX0A 4D4KA 5BR7A 1K1EA 3SOPA 4IKOA 1JA1A 5IVDA 5HOEA 2QTFA 2GPTA 1HLDA 3L7KA 1T6ZA 2RBGA 1O0BA 1KZ9A 1OXTA 2XAAA 2W6CX 1VE5A 4FSHA 4M7RA 4RD3A 2P2NA 5AJTA 1EHYA 5B1YA 2IE8A 1B6RA 1KFEB 1AHPA 4YRPA 3IOMA 5FJIA 2EBWA 1ADBA 2CKMA 5AI8A 3VTFA 1M6VB 4MH0R 4C5BA 2JFXA 1NBME 2FZ4A 5G3ZA 4V0OA 1A5BB 5IXYA 2LNDA 3F0TA 3OQVA 4JSRA 4NIMA 2XHEA 1P3DA 4WZZA 4BE4A 5JCZA 5EP2A 3NWBA 3Q85A 4ENWA 1YB2A 2DUMA 1BD4A 3RYHB 1I3CA 2QNRA 4R4JA 3TG2A 2MTBA 1QH9A 4QO7A 4OHKA 2A0UA 3WGZA 4UCQA 1FYVA 2X8BA 1R6UA 3KHTA 1OH5A 1AM4D 2M1ZA 4RMGA 4AJ2A 3MCUA 4KR6A 1GCAA 2Z43A 1PGJA 3JPYA 1E9AA 4C4AA 3D5EA 2N42A 5LZ8A 1Y5NA 4AO8A 5KC8A 3NATA 2X3UA 1JHUA 2IYNA 1ZM3A 2OHXA 2OM2A 3KWFA 4B7CA 1HLPA 2JI6A 3C48A 3GIWA 3EPHA 1H4QA 5F21A 2J67A 3IIIA 4S05A 1PG0A 3UGTA 1NBWB 4AQDA 3IESA 2V0CA 2MWMA 3NVMB 4IDDA 3NW9A 4ZI5A 1OQAA 2BUBA 1MV8A 4HVLA 5AWFC 4LRXA 4Q9HA 3BSWA 1QONA 4ETMA 1XRPA 4IJ5A 1H0RA 2VZ9A 1WXHA 1U2TA 1O95D 3CY6A 1W5AA 5I7SA 3HEMA 4CKEB 3CCCA 4O3MA 4V24A 3WHPA 1XMJA 4UBLA 3P52A 1GR0A 2XUHA 4M9CA 1JVSA 3A32A 2X6QA 1UXHA 2OO7A 4PANA 4UUBA 1Z26A 4L0DA 2XB2A 4UM5A 1KF0A 5LDHA 5GVRA 2XTJA 4CTNA 3W06A 3GJQA 1L5ZA 1DNPA 4PNEA 3CLHA 3R5XA 1Y9AA 2B5VA 3B5IA 1GGFA 2IXTA 4KPUB 2IF0A 4D26A 1X77A 2PNJA 3WK9A 3OLCX 4P53A 3P20A 1SC3A 1WULS 1KJJA 3SX2A 3RAGA 3VR5H 4XWYA 2NG1A 4PAMA 3ISVA 3F78A 3ZXUB 4URHA 2ZI3A 5TGDA 2ISQA 1DBIA 2WEKA 4R2HA 4ZZ0A 2Z58A 3C3AA 3OQNA 2CLKB 1TJYA 3PITA 4M86A 4NABA 4X0EA 4E32A 4I2VA 1ZAYA 5JAPA 1OHHD 1YRLA 1VXRA 1UM9A 1F8FA 1I13A 1RPNA 4IDQA 1U7XA 1XDWA 5F7XA 1M5TA 2VXCA 1BS1A 2XODA 2ZR7A 1GAXA 2YY6A 2DM6A 3QFHA 4M8IA 3MQ4A 4MWTA 4UUMA 3AUTA 1J2EA 1E1CA 3AR5A 5BNIA 5C37A 3LBYA 3L84A 4ZT7A 2X5KO 1KH2A 1P9WA 5ALIA 3IA2A 4I1VA 4J9VA 4DLAA 1AB5A 1XKLA 4LCBA 2ZREA 2CWDA 5HF9A 1A8IA 1PNTA 2I7CA 5C5IA 1PLLA 1FB5A 5TGZA 3TPFA 5KOHA 2ZUFA 4OU5A 3R09A 5HM6A 3H9CA 1MFZA 4P5DA 2HJWA 5LZ4A 1XVTA 5LIRA 3F6PA 3UENA 3L1VA 3EOBI 2I55A 3FF4A 2IC5A 2ZYRA 4K8RB 3FVRA 2ZSBA 2IDMA 3GAFA 2A5YB 3ESXA 4O29A 4UVIA 5ALMA 5JTTA 6ABPA 2G28A 1Z73A 1R5BA 3AHGA 1M2KA 1Q1GA 1YIAA 2FPUA 1NW9B 3PRJA 2X4IA 4HQ6A 3Q12A 2XT9A 4ZJYA 3TLJA 5LN1A 4FFBA 2HMSA 3H65A 1T5IA 2CNKA 3G1TA 1U2QA 1EUYA 1I33A 1ULBA 2XKBA 4AXXA 3IXQA 3H5WA 3WIBA 3LDUA 1P31A 4L85A 3W3AD 4KYIB 3AV0B 3ELBA 3DZCA 3HA2A 2E89A 2ZSUA 2NYRA 5C53B 2BJHA 4NICA 3ORHA 4LY9A 5CM2Z 3DOCA 4RNCA 2HDNB 1I4DD 3HWRA 4GP7A 4W1QA 3WGQA 1MHTA 4LF4B 4DA4A 1P60A 1NL3A 5JD6A 5TMEA 3JS5A 2HLNA 4QM7A 4HZUB 5EFZA 3PWSA 4PRYA 4WESA 5CPBA 3UV7A 1ODFA 2FUEA 2VP2A 3PL5A 1K08A 4PV7A 3SGLA 1CXZA 3P97A 5EZ5A 1P2BA 3IUBA 1EJ2A 1YC5A 5BWOA 1QV7A 4MVJF 2IUYA 4QU5A 5EN4A 5G0VA 4C0BA 1CG6A 1NR5A 4OX9B 4ZRDA 1NGSA 5B3LA 5JC8A 2Q5CA 3DL0A 4CM8A 1J0XO 1HPLA 4LVUA 1ESNA 5CW1A 3AP2A 5BMVF 2IUSA 2VDWB 3INYA 3IX7A 1JLRA 3NJRA 4C4TA 4RHTA 3I5MA 2IIVA 5MDHA 4RTJA 1JB1A 4C08A 1VBKA 3N53A 4MV6A 2COUA 2B36A 1GT6A 3BXXA 3SSMA 3TRDA 5HQTA 2ODAA 3H7AA 2NSYA 1E0KA 3H1AA 1CNEA 3KOYA 4PG4A 4OK3A 2CDCA 3IQIX 4TTIA 3H11A 4MDYA 4AN0A 4W1RA 1QO0A 3NVAA 1VP9A 1S7GA 4EARA 3WWDA 4GT1A 3EULA 1LF5A 4FUQA 4Y9RA 2OESA 2OOKA 2OR3A 2XY4A 1KH3A 3Q5EA 3SYTA 4MW1A 1Y9DA 1D2CA 1FDTA 5IJXA 3NJ8A 2QDKA 1ISHA 3UOAB 2CV1A 5B36A 4P84A 4TS1A 4L4XA 1G3UA 1U4OA 2FQWA 4J0HA 4NCNA 5ECWA 2WIJA 4PLHA 4GRDA 1I9CA 1P4RA 5G3YA 2DQSA 5C5EA 1L2TA 5SYAA 1FSSA 4YAWA 3HJTA 2GJAA 1EK0A 2DH5A 4CODB 2OV8A 1L4GA 1FP4A 1KO4A 3PQDA 3T9CA 3UG6A 4YUAA 4Z1MD 5T7BA 5GZ1A 1SXJC 2K2QB 3ZDFA 2Q45A 2B9VA 3RW9A 3A28A 1WE2A 4JP2A 4YACA 4OV6B 5DTRA 4D45A 3L7CA 2O7NA 1GAEO 4IJMA 4ML3A 5E6UA 2DTEA 1DO0A 1YSCA 5LZ5A 4FWTA 4MJXA 2IA5A 1YOVB 4BTLA 3M3PA 3EAFA 3UOWA 2YYSA 2REXB 5CRIA 3NM4A 4I9FA 4JR1A 1CJKC 4UZSA 2HRDA 3MIZA 4YCDA 4BO0A 2YBDA 4E22A 4L4ZA 3TW8B 2PTHA 4M88A 4UE6A 4OHXA 1E99A 3V97A 5EMLA 1GO2A 4UVGA 4EX7A 1XCLA 3OSUA 3C45A 2BHNA 1MXFA 3I4CA 3NGXA 1VOTA 1A2BA 2HIGA 3BX1A 4GBED 1IEXA 1UJNA 3PXGA 4B83A 2GPWA 13PKA 1Z4JA 3EQZA 4IDFA 3FMFA 4Y6SA 4JLPA 4KQ2A 3WV5A 2FR0A 2YL2A 2VWQA 4J16A 1KO7A 4MRSA 3AW9A 4DRXB 4J0QA 2CDAA 4E70A 4QAQA 4YIKA 4R0NA 3M2TA 5I7AA 2A5FA 2R8RA 4I50F 3IELA 3BK2A 2XRMA 1NIPA 4GPEA 5ECYA 2YWCA 3W8FA 1EGAA 2V5VA 1GPKA 5JC1A 4RWZA 1EK1A 3N3AC 2FEKA 4HDCA 4NEQA 1G4UR 3U81A 1KQPA 3KEQA 4KDCA 2M6KA 1X1EA 4XR4A 2ZJFA 4JI4B 1A9QA 2VSQA 4JLNA 1SD5A 1U3DA 1QE3A 3BBPA 4V0ME 5JRJA 1IHUA 2Z30A 5IP5A 2O54A 2BHTA 4TVBA 1KDRA 3QUTA 2A59A 2XDWA 1W46A 1UPUA 2IHUA 2NO7A 2DTDA 4DADA 1JR3E 4PCVA 5I7VA 3AUAA 1V4NA 2PVPA 2OFWA 4EGSA 1MRSA 5THQA 3F6RA 3WA6A 4Z1OA 5IKOA 1LBSA 1KBZA 3TTWA 1HM5A 2N9UA 4MO9A 3RR2A 2BFDA 3WGYA 1ZXLA 2QTCA 4EW3A 3IH5A 4P7JA 4BFUA 4DR2B 3GLHB 1U7ZA 4JYAB 3GUUA 3HXOA 2YRWA 1W75A 2Q3BA 3DTYA 2CMHA 3SS9X 4HNTA 3NKLA 1TC2A 1DINA 4FXOA 2ZS7A 4IO0A 2NU9B 2ZB2A 1CUDA 2QW0X 3D2CA 4XCVA 2C5GA 1WPQA 1N57A 4KV7A 4YV1A 5J58A 1GLVA 3U7RA 4B5LA 3E70C 4KRGA 5K3FB 3AY0A 2RCNA 1YKFA 1WZEA 1GEEA 3M1IA 2ZXEA 2QTBA 1YQEA 4KQ9A 3PNKA 1I0IA 1O7JA 4UZEA 2IPAB 4R3WA 4M9RA 4BVAA 2A8YA 3T12A 4XVUA 2VHVA 2CNBA 2MYUA 4Y6GB 3SBDA 1ARZA 3A6HA 3QEJA 1ZMOA 1UBJS 2DGDA 1W35A 1FP7A 4XCXA 3Q98A 1SXIA 2WYHA 4MP8A 2Y1CA 3C3PA 2GASA 3HI4A 2I6FA 1M66A 2B6NA 4L95C 1YVEI 4UUQA 1ZJ5A 3Q88A 2JGMA 3TRJA 5LOVF 2FOXA 4P3YA 1KDVA 1LLDA 1F5NA 1PK9A 1UWVA 2DWQA 2RG7A 4ETIA 3DO5A 4P32A 1VLVA 5KTNA 1B6SA 1BYIA 2WD7A 2WYWA 3PB3A 4YTEA 3NI2A 4WJLA 2XLCA 5IAKA 1G3RA 4UXJA 2D5LA 3ND6A 1Z22A 2XECA 2GCOB 3NZEA 3RTDA 5EE3A 4UHBA 4A8PA 3REFA 1ZMTA 2RKWA 1UPXA 2PRKA 4RSRA 1WVGA 3I9NA 3QFCA 1CERA 2AD5A 2XZTA 1EB9A 2Z3ZA 3GI1A 1G2PA 1F8UA 2XA1A 3QNMA 2AFHB 2NSJA 3OX2A 3ZHUA 2GARA 2CL6X 1R3DA 2GBLA 2NSLA 2WUGA 4OHFA 3R8FA 1IB0A 5LSAA 1F8GA 2FVYA 2DFLA 2QDXA 3JX9A 5IAGA 4LKOA 5HILA 2G9VA 4C7XA 4XWKA 5TS2A 1PR2A 3C6QA 3ND5A 1Z0AA 1P2UA 1MC1A 1O96A 4IS2A 2QZJA 2R8BA 4ITRC 4LTMA 3WSVA 1R0YA 5B6IA 1L4UA 1M2OA 1WA5A 3KK0A 4OYRA 2ILTA 3L82B 4WDQA 3PTLA 4QTYA 5A4FS 5FX2A 1JNXX 4JOQA 4I9GA 4R7ZA 4TSFA 5IJ9B 5LQCA 2A9RA 3SM3A 2YCBA 4FIZA 5PGMA 3WLTA 4PN3A 4WCFC 2XWQA 4BCBA 4ZQIA 1JR4A 2PZ8A 1NXTA 4RUKA 1Z4PX 4IGFA 4RFLA 4P4UA 1WW2A 3QPWA 4INAA 2A2ZA 3LUGA 3S7ZA 4G1BA 2C88A 2LCFA 2BGLA 4R2LA 4YAIA 1GGNA 2H16A 3PR1A 1WU7A 3KUDA 1XNHA 1OIVA 3O38A 4H60A 4LXHA 4E2WA 4YPVA 5CDUA 2X2PA 4D0RA 1CQPA 3O31A 4OOFA 3A2MA 5FTWA 4IGKA 2IEGA 2I0FA 4ZVUA 3I01A 1SC6A 2B2CA 4O25A 3MWEA 2R2GA 3ANMA 1NYLA 1E6WA 3QMWA 4J1QA 3VI4B 1XD2A 3LQQA 3B2QA 4DNXA 5T41A 1NJ5A 4ARIA 1BVHA 4EHJA 1T13A 3LSYA 2WYUA 2SICE 3LYHA 5TT1A 3H3JA 5E4TA 1PNRA 4X61A 4E5MA 3FYCA 2EKLA 2PWZA 4XEHA 1M2NA 1FZTA 4K2AA 1II0A 4V1CI 1ZUHA 2JIMA 1YUMA 3E9QA 3PD1A 2J33A 3QMVA 2HNBA 4P4LA 2P4SA 4JBLA 1TNDA 5A3VA 5TQVA 5ADWA 3MIIA 3KT8A 1P4HA 1E2PA 2OWDA 4MYTA 1HI9A 3T0GA 1U81A 1NA5A 1YZLA 3WLKX 4E5UA 3TBHA 2HLHA 6GPBA 1ZU4A 4XDYA 2B3DA 2GZ1A 1Y6ZA 2VAVA 1NFRA 3NTLA 3K31A 2QLMA 2I1QA 3KXIA 1E1QD 3ZWNA 1RLMA 3K96A 4ZRMA 1WXWA 2XZPA 2FZKA 4YP5A 3ZW8A 3Q0EA 3Q3HA 5ALPA 4ZGWA 2R25B 2QL9A 3SYLA 2X6TA 1QP0A 2EU8A 2G8LA 2HWXA 2XXJA 5FI3A 1NNI1 3RUHA 4AS3A 4I7EA