4TQ9A

Crystal structure of a gdp-bound g12v oncogenic mutant of human gtpase kras
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
169
structure length
169
Chain Sequence
GMTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase KRas
publication title Biochemical and Structural Analysis of Common Cancer-Associated KRAS Mutations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 59
structure length 169
sequence length 169
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tq9A00
2OM2A 1Z0AA 1GDDA 2IF0A 3MWYW 1GP2A 1GKIA 5GADl 3CWZA 1L2TA 1UKEA 1XMVA 4Q1AA 4LBYA 2O52A 3W90A 3KB1A 3TBKA 3V4FA 2HYDA 2J0VA 5LD2B 4GT1A 4HYYA 4PSAA 1QHYA 4B3FX 3QXCA 3HP1A 1N2CE 1S9HA 1W47A 4S35A 3G82C 4TMXA 4ESHA 1CS4C 1YZKA 2FOLA 3H86A 3LW7A 4LI0A 4TTPA 4DSOA 4DB2A 5IK2D 1KDOA 3CNNA 2VBCA 4XD7D 2IUTA 2YV5A 1PLKA 4AY2A 1OV4A 4Y0AA 3AKCA 4GRAA 4A8JC 4D0LB 2IXFA 2GK7A 2IA5A 1DEKA 3VX4A 2CLCX 3U5ZB 4Q47A 3UWKA 1Z5ZA 2OLJA 5E95A 3CRW1 2FA9A 1XZQA 1KO7A 4FCTA 1W36B 3WMFA 3CWQA 2PCLA 1AZTA 1XPRA 1L4YA 1MO3A 1KK3A 5KDLA 1DTSA 4GP7A 4TN1A 2IYQA 4U7DA 5EJEA 1S9DA 2EFEB 2Z6VA 1XEWY 4KSCA 3AF3A 1T91A 3NBXX 5C4MA 3AH8A 1BH2A 2F3RA 2A9KA 3ECCA 2ONKA 4PX9A 2VQSA 1T8UA 2KJQA 1QVAA 1OFIA 4R7ZA 5AK0A 4B3DA 3CW2A 1PUIA 2JJ2D 4Z1MD 3T34A 3K0CA 4II7A 3CH5A 1T3LA 1DG1G 4M4SA 4WW0A 4ON9A 3K8YA 3SJBA 4BRWA 2H92A 4LDJA 1R0WA 2AKYA 4IFEA 4NP6A 3DHWC 4D4LA 2W83A 2JJ8A 1VIAA 5LB4A 3BB1A 3TNFA 1HYQA 4IVPA 1G7SA 3GLFA 1P4SA 4BLSA 1AS3A 3LQQA 1VTKA 4RCYA 4QGFA 1BIFA 2CBZA 1ZC3A 1QG2A 2OCBA 2W00A 1SVKA 1S1CA 5KSYA 1OKKD 4P31A 4A4DA 1E1RA 1GRRA 4KXFB 4HAUA 4FMDB 6Q21A 4DLWA 1NL3A 2AN9A 2FMXA 3AVQA 3GLHE 4EPRA 2QORA 2ZRPA 4BLOA 3ICEA 4PPQA 1SQ5A 2ZTSA 4Z8YA 1EFUA 1FMLA 4DLZA 5FH9A 3U3MA 3B78A 4IDHA 1L8QA 4DSNA 1R8SA 4ILEA 3DOFA 3NC1C 4FWIB 2OAQ1 4PC3A 4DKXA 3DKPA 4I4LA 4LYFA 4UJ5A 1U9IA 4HAWA 1A82A 2RKOA 2ZSDA 4V03A 3AP3A 4ACAA 1ZNXA 1LY1A 3TQFA 4BPBA 4D82A 4Q1CA 5SZIA 4MDFA 2AR7A 1N0UA 1QHHA 1SKYB 1IJEA 2Y8EA 4JLMA 4Z51A 4TSFD 2QNRA 3UMFA 5SZHB 2C9CA 1VHTA 1ZAKA 4I1UA 1M8PA 1KDTA 4IXNA 4EPYA 1VCOA 1W0JD 4EDHA 2HLDA 3BK7A 5FBLB 2NTYC 3KDSE 1G8PA 2AKAB 2KSQA 2WBLC 3QKTA 3IO5A 2ZI9A 1E6CA 3C4JA 1U94A 2OE2A 4QC2A 5ANRB 1SVOA 2F43B 4PAMA 3TUJC 4GDFA 1Z2AA 1GRQA 4AWXA 2QRNA 3OIUA 3SEAA 4XWOA 1U90A 2CHVA 8OHMA 2QI9C 4LJAA 1XZPA 2OFOA 3CF2A 3T12A 4CEHA 4KO8A 1PV4A 1P7CA 1NLYA 3DZ8A 1JALA 2ZM5A 1Q1BA 2ZQ5A 2ZITA 2ZRFA 3LBIA 1ZUNB 4KJZA 3HU1A 3LBNA 5EXPA 4B76A 4DUGA 5LD2C 3NVAA 1HQCA 3K0EA 4AYWA 3KUCA 4L8GA 3G0HA 2PCJA 2QMOA 4MGYR 2P3SA 5KNBA 4PC7A 3DO6A 1W4AA 3IGFA 4F38A 2DFNA 3VU9B 1XMIA 3TW8B 2BJWA 1P9RA 4QGHA 4FI3C 5J40A 5B58C 1F2TA 2H17A 4M8NE 5FOUA 3WNDA 1KJYA 1JI0A 2MSCB 3ND9A 3OAAA 3REGA 3A6PC 1CR1A 1O87A 2G0TA 4G3XA 3SYLA 3NG1A 4DCSA 4EJSB 1ZM4A 4TMWA 3MCAA 4RD2A 4V0LA 1KGDA 2FFHA 4HLDA 3IIJA 3LRPA 3QI2A 1VYUA 1XXHE 1ELOA 1DAEA 2AK2A 1CJVC 3PR1A 4BLTA 1AJEA 3B9QA 4EFMA 4Q19A 2ANBA 2H5EA 4RSGA 1G41A 1Z8FA 2GWHA 2RHMA 2HUPA 2JCSA 2RGCA 2XOKD 3L8ZA 1BS1A 2VSXA 2QA5A 1XEXA 1E2QA 2VHCA 3AUXA 4KODA 3T1TA 3WBKA 1E3MA 3TK1A 4Q02A 4AD8A 2GVDC 5FL7A 4M1TA 2GBLC 4LYAA 5LB2A 2GZAA 3NHAA 3RS7A 1ZM7A 2D4HA 5DIFA 2CL7X 2GAOA 1E94E 2GXAA 1XD9A 4G01B 5BN3A 4C2UA 1E2IA 2C78A 4OQMA 4BFYA 3VTKA 3EIEA 3AF4A 121PA 1OIWA 2IL1A 3N5CA 1ONBA 2NZJA 3NH9A 2EW1A 4Q4LA 3W5JA 4ASUA 4EPTA 5B64A 4IOMA 3ZQJA 4TTQA 3X2SA 4MQBA 2A5DA 4J0QA 5CM9C 3HR7A 3QF4B 4TWZA 5DO9A 3KQUA 2XNDA 4PHHA 1KMQA 2QAJA 5HTKA 2FPKA 2NO7A 1WBBA 2GCPA 2OXRA 4LV8B 2ZRMA 3I5XA 3ZJYA 1Z07A 1ZUIA 2JDIA 4OQFA 4LJYA 4IVRA 4Q7LA 4QXAA 4QL3A 1R0ZA 4RZUA 4HZUA 4BFWA 4RZ2A 2VHTA 4L9SA 3K9NA 3OIWA 3P27A 1JECA 4MRPA 4O25A 2ZYTX 1G18A 1FW6A 1N6HA 1XTSA 2HJVA 5FPTA 3QBVA 3QUSA 4ZDJA 1UJ2A 2XITA 3RRMA 5CB6A 4DIEA 1E2NA 2R6AA 3QPVA 5JHHB 2GF0A 1GSIA 1UBFA 1II8A 2JLVA 1HE8B 4BUJA 3PVSA 1TADA 1KDRA 1X3SA 2OT3B 3BE4A 2C2HA 2OZEA 1VKJA 1LV7A 2K5UA 4BECA 1E4VA 4JT2A 521PA 3ADBA 5DSZA 4LCBA 1G4AE 2WSMA 2JGNA 2GCOA 2IWRA 2RGBA 3AVUA 1R6BX 2BEKA 2OXCA 2OFWA 4PC2A 2V9PA 2KB0A 3GLGA 1Q1QA 4OHZA 4DSUA 4M9XA 2CJWA 4WAUA 4MUAA 1OPXA 2RGNC 1FFHA 4X8HA 3CM0A 4FMCF 5H1YA 5AJZA 4MUBA 4R2IA 3WP0A 1YU9A 1G7TA 1T9HA 3SQWA 1UEIA 1D8TA 2PLFA 2PX3A 3KXKA 2OFXA 4DLSA 2G3YA 1COWA 1XB2A 2ZUBA 2DCUA 3MMPA 4XTCS 1FTNA 5HKKA 1TQDA 2F7SA 2F6RA 5C18A 3L8YA 2W2XA 3BORA 1MR3F 3IIMA 2W6JD 3IPYA 3TKLA 4IRUB 2OV2A 2JJ1D 4YQFA 2QBYA 5KUTA 4XH9B 3IQXA 4JS0A 4UNRA 4ZCMA 2CHGA 4TMKA 5D3MB 1VG1A 2FGJA 3VR5A 3EPHA 1KY3A 1ZMXA 2XZPA 3GLIA 1II9A 1UM8A 2DPXA 2Z43A 3C41J 2IXGA 3SU8A 2YHSA 3F8TA 4C7OA 4EJSC 4LYHA 3ZVLA 5JI3E 3TUZC 1OFHA 2BEJA 4UNSA 2QMEA 4D4KA 2P5TB 3FMPB 4OK5A 5IHPA 3BFKA 1IY0A 3I5YA 1YR6A 1PVOA 2G1JA 2G9NA 5DHFA 2QT0A 3A4NA 5DYGA 4N0EA 1OB2A 2J45A 1M34E 1A7JA 4HATA 3R9IA 4M1SA 1WMSA 3U7HB 1JEDA 1LNZA 4WZ6A 1KO4A 3CX8A 5EP2A 5CB8A 3ASZA 3THWB 3MLEA 4UNQA 3EW9A 2CVHA 4NCJA 4XWKA 2BCJQ 1OH8A 5CITA 1EFRD 2ZROA 1W48A 1P2UA 1OHHD 3SJZA 5IT5A 2NO6A 1U8YA 4OI0A 4DDVA 4H9GA 1JPNA 1XF9A 3HU3A 4A1FA 4F4IA 5SZKB 4JSYA 3ZIAD 1JB1A 1SVIA 1CIPA 3FVQA 3UANA 3IHWA 1SGWA 4PR0A 4UXIA 4BFSA 3VNUA 1WF3A 4Q9KA 1G8YA 3P26A 5FTJA 2YZ2A 3RC8A 2WJVA 1VCNA 3BERA 2PZGA 1FX0A 5CLQA 5J4VA 1JR3A 4PHFA 2QMHA 4KU4A 2IEZA 3W6NA 1SXJE 4JL8A 4C2TA 5CK5A 4D6PA 2Q9AA 2JEOA 2Q21A 3SZRA 4ZV4A 5FTLA 1YE8A 3VKWA 2EFCB 1UDXA 3BH6A 3HR8A 2CCJA 1OIVA 3LVQE 5EXTA 1DELA 3MUFA 4FINA 2W58A 2YOHA 1UF9A 3TW4A 1FPMA 3QPWA 2ERYA 4A2WA 4D4MA 3W34A 2YC2C 4HLUC 2ZIAA 1XD2B 4F4JA 3W9YA 4B74A 2F3TA 2IYZA 2GEVA 3K0FB 3PUYA 2IF2A 5JJKA 1AS0A 1XU4A 4G5GA 4P4UA 1ZBDA 4AK9A 3IBGA 5FBQB 2GETA 4HAZA 1MRNA 3QKRB 4IDNA 1WP9A 4Z54A 4M1WA 5FUYA 2ZRAA 2FU5C 4HB3A 2FG5A 4LHYA 4UXHA 4R71A 2B21A 1HV8A 3AUYA 3R9XA 3SFZA 3FTQA 3QY0A 621PA 2W6ID 3L0IB 2EYQA 3UXMA 1R0XA 3CNLA 5JRZA 3W6OA 2PJZA 3I61A 1NVUQ 5KTYA 2J7PA 1KJZA 4GBMA 4GMXA 2QAGA 1N6PA 2X19A 1XP8A 3ICQB 4F91B 4KYIB 4OI4A 2GHIA 3EPKA 1AKEA 5C2JB 4Q18A 1WE2A 5KPJA 3KKNA 3QKSB 1RRGA 3JVVA 3OEEA 4YMVA 2VRWA 2IW3A 2EFGA 3R20A 1K5GA 2ZRBA 5J4KA 2O0HA 4CGZA 4QNRA 1P2TA 2DFTA 4DRZA 4W5JA 1GKUB 3L0PA 1GIAA 3WHLA 1F48A 3KKQA 3KQNA 3KQLA 2VL7A 2Q9CA 1F60A 4WOPA 4EFNA 2WJGA 3X1WA 1UDWA 1A2BA 2J0SA 2VP6A 2WWHA 1YRAA 1VCMA 4YDSA 5DN6A 4HB0A 2AXPA 1E1QD 2YWHA 2ZPTX 3CRMA 4NYMQ 3REFA 2AWNA 2O8BB 4MGIR 221PA 2X2EA 1G6HA 1KMHB 2VP0A 4KLNA 4A8JB 1KNXA 1Z29A 5TARA 4KVAA 3DZDA 1OXVA 1E2EA 2FPMA 2WJIA 3WBJA 3VAAA 1PUJA 1QF9A 4Q4HA 2IT1A 4ARZA 4LY6A 3WNCA 1OF1A 3O8DA 1TQ2A 3L0OA 2X8AA 3QSYA 3SE0A 1N5LA 4Q01A 1RYHA 3B1XA 1A4RA 3U3JA 3W8RA 3F3YA 1RIFA 5FPHA 2ONJA 4ZCIA 1WRBA 2WKRA 3SJAA 4URXR 3KJGA 3MD0A 4WA7A 2HEIA 3L0SA 1KSFX 4ITRC 1US8A 1W0KD 3ONWA 2ORIA 4KCGA 4PC1A 5BW8A 1G291 3U60B 3SOPA 1YZLA 3KUDA 2GRJA 5JHGB 2GILA 5JS8A 2DY1A 4HUQA 1CU1A 2EWWA 2CCKA 2WM9B 4PO1A 2VF8A 2P5SA 2WKPA 3AF2A 2VIIA 2GVZC 1YR9A 1HT1E 1N6RA 2PZFA 2QM8A 4E5UA 1W4BA 3VKGA 3H84A 1GOTA 3B13B 3RS3A 5K8TA 2YC4C 4HLCA 4NYJR 2WVJA 4R9UC 4US1R 1W2HA 2IX3A 4TMVA 4HZIA 1RRPA 2AK3A 1S4QA 1BMFA 1ZNWA 5P21A 3TQCA 3P1JA 5FOWA 1NIJA 4PXAA 3H1TA 1XNJA 2B8TA 1JBKA 3AB3A 4IFBA 4MDEA 1IY1A 4ZO4A 3X1ZA 1FTSA 1KKMA 3I73A 2WPDA 1G7RA 4E03A 3HDTA 1E96A 4M2LA 4FD2A 2ZRNA 2O8CA 4B35A 2RGXA 1N6KA 4UXJA 2W0SA 3N2IA 5J47A 1ZVQA 4CEJB 5EQTA 1V43A 3BWDD 5EP1A 5G41A 1QDEA 2SHKA 1OFTA 4D25A 3LXXA 821PA 4M9ZA 5KSPA 3SR0A 2VHQA 2FDCA 3NWJA 2GEDA 3EAQA 4M1OA 4TL8A 3AVTA 3I8XA 1DAHA 4XIGS 3MG9A 1ZP6A 4PAOA 4GZLA 4M53A 4R2HA 5GVSA 3LXRA 1NVWQ 4PTLA 4LJ8A 4JIMA 1Z0IA 2FEMA 3W6PA 4B2LA 2ZVPX 1H65A 4QJ5A 2WSSA 4PC6A 2LKCA 3C5CA 1LF5A 3ADDA 1ANKA 1KOFA 1G64A 4PZYA 1UBCA 2Q3HA 5TV2A 3UKDA 4M9QA 1NN5A 3BB3A 5AUPB 3TVTA 4JLVA 1XFAA 2L0XA 4LHVA 2CDNA 1Z22A 2ZJAA 4HAXA 4PANA 4EUNA 1KO1A 1S0UA 2XTZA 1GFIA 2PJRA 5FBVB 4A0GA 3LA6A 1OLOA 4OK3A 5AWFC 1XCMA 1R2QA 3R9WA 5D3QA 3VKHA 1E99A 5KNDA 3BFXA 2CK3A 5GJCA 3P4YA 2FEOA 2PEZA 4D80A 3WY9A 3KJHA 3IQWA 3DVLA 4IHQA 4QG7A 1K5DA 1OXTA 1NSTA 4NMMA 4PQFA 2ZI7A 1E1RD 3GLHB 5EE1A 2QM7A 1EK0A 4AC9A 5A4JA 2DWQA 1XPUA 1QG4A 4RFVA 4HUTA 4NYIR 2J0QA 4P0TA 3Q5EA 1S1MA 3M1IA 1HEIA 4QM6A 2ZSEA 1CJUC 3T1OA 4JKIA 3HU2A 3PCRB 3NTUA 1L4UA 4LHXA 3RWMB 2GBLA 3K70B 1VMAA 1BOFA 2JLWA 1E2KA 5L3SA 2BHRA 1KAOA 4AYTA 2HV8A 3P4XA 1Q1ZA 3W5IA 2ZR0A 3BH7A 4WXRA 1G19A 4Q00A 4MYCA 4US2R 1DS6A 2ZI4A 3C14C 2QZ4A 1B0UA 1T5LA 5CIQA 5FUVA 4JBWA 3BD9A 4QGGA 4D26A 2JIZA 3KL4A 4KBFA 3TR5A 3TSWA 3SQXA 3ZDQA 3B1YA 4BEJA 1KNQA 3LH5A 3ZD7A 2ZSAA 2HLDD 3LO5A 1IN6A 3KFXA 3RYTC 4AI6A 3EASA 2V1XA 2JLZA 2VTKA 5FOTA 1EGAA 3PEUA 1WB9A 3L43A 1OXUA 5L3SB 4FMCB 3QXXA 1KK2A 4I81A 4I1OA 1TQ6A 4YMWA 4HEJA 2MSDB 2HYIC 1GL6A 2ZE5A 4FXPA 1XBTA 3T1QA 4GI7A 1K8RA 1TAGA 2QRZA 3K9GA 5LPNA 3VR1A 4DSTA 1ZC4A 3CKLA 2Z5FA 3U3RA 1NVVR 2C8VA 1EG7A 3MGCA 1TUIA 4IDOA 1YZUA 2WWWA 1MRSA 3EPJA 4QFMA 2IC5A 3FWYA 3P20A 1OH5A 2QY9A 4OBEA 4BFZA 4A9AA 2ODBA 5CDFE 1E79D 2HCJB 2IBMA 4JVLA 1U98A 3CPEA 4ERNA 2F43A 4TL7A 5DYIA 1IXRC 3A8TA 4BQSA 4LPKA 5IK2A 2DWPA 4I99A 1W5SA 4BFVA 3U6BA 1Z47A 1Z83A 4LHZA 4GOKA 1EESA 3EG5A 4JVNA 2ODNA 4FN5A 1OE0A 5TY0A 3GJ5A 4MKGA 1XXHB 3OAAD 3WMGA 1F5NA 4DB4A 4C4PA 2A5JA 4FMBB 3T61A 2O8DB 3GFPA 1CJMA 1TUEA 1YZTA 3FMIA 3DKVA 1ZNYA 1G3RA 1NMZA 1IBRA 4BFTA 1EFTA 3QVUA 4JL6A 5GJVC 4P3YA 1DAIA 2DFKB 1YHNA 1KTVA 3MJHA 4RD0A 5CJ2A 1DARA 2O0JA 3AF0A 3U44B 5JCZA 1CLUA 4GZMA 4PQYA 4LOAA 1MABA 4OHVA 1AS2A 1AA9A 1J7KA 1KI8A 4RD1A 5SZJA 1E2HA 4JYCA 4KVGA 1A5TA 1MT0A 2VYFA 2GNOA 2PLRA 4XVRA 3VU9A 2D7DA 2JLXA 2C99A 3NBZC 4NCHA 4B44A 3BGWA 5TB5A 2OG2A 3HYRA 4OHXA 1J90A 4TYPA 1Z28A 3UPUA 3VR4A 5C46F 1QZXA 3Q8XB 4OL0A 5FL7D 1XEFA 4EJSA 1E69A 2WMNB 2ZJYA 2ODEA 3B5JA 5UKDA 1PZNA 3EC1A 1I2DA 1G17A 4B34A 5AUQA 4DT1B 5EE0A 5EXSA 2BMFA 4KFUA 1PLLA 2QPOA 4ASUD 2DYKA 4XTRA 1MABB 3A1VA 4ZKDA 2HF9A 1OKKA 2YJTD 4D0GA 2WJHA 3VX3A 4HB2A 1IXSB 1Z3IX 2ZETA 1NKSA 2JATA 4JYBA 3B6EA 3F5FA 2PEYA 3DM5A 4S2EA 3RRNA 4CYMA 3QQ5A 1S8FA 2DB3A 3C16C 5KSOA 1KK0A 3Q7PA 4G5OA 4XVQA 4DC9A 5DNYB 1KSJA 1DAGA 4JKYA 4E09A 3SHFA 1E32A 3K70C 5KO2A 1IN7A 1HE1C 4DLUA 4LYJA 2D74A 1XTRA 4E07A 3IEUA 3EIHA 1Q12A 2G88A 3LWNA 2FX3A 3THXB 1SXJD 2DBYA 5TDHA 1UBEA 1QVRA 2R9VA 1G8GA 2TMKA 4IJMA 3BOSA 1XD8A 2UZIR 3CRRA 4Q9JA 4KFSA 3IO3A 4C30A 3GLFE 4B33A 5G40A 2RMKA 4Q1FA 3BC1A 3VNVA 3THYB 3TUIC 2IS2A 2ECKA 3GQBA 3QF4A 4MRSA 1LW7A 3FFBA 3OESA 4G5RA 4HI0E 2WV9A 3E70C 3PV0A 3SBDA 3LY5A 3TAUA 2FF7A 1SKYE 2IYSA 3RS5A 1MO4A 1MV5A 1T8TA 4ZIRB 4TMTA 1ESMA 2ZANA 3WRYC 4M21A 1ZYUA 5TXGA 1YZQA 1KI9A 1ESNA 1KI4A 3VHLB 4V0MA 1M74A 1HA3A 1ZM3A 1KO8A 4IXMA 2V54A 1C1YA 1FQJA 2G0NA 2NO0A 2V4ZA 3VR2A 1I2MA 3QXHA 5JWHA 4PZZA 3RDPA 3C7KA 4UNPA 4B6FA 1E98A 2A5FA 4JLDA 2ANCA 2Z83A 4Q48A 2OLKA 4C0AC 4N1AA 2ZRHA 1RJ9B 5J5CA 4US0R 3SBEA 2J41A 3Q7QA 2ZAOA 1GL7A 2X2FA 2P6UA 3IBYA 4GL2A 2DWOA 2CVFA 2OCAA 2GESA 3CR7A 1RVDA 2RGGA 3CZQA 1COWD 3Q72A 1VECA 4JLPA 4LC0A 4A0RA 5HKKD 1A1VA 1Z0KA 2HDNB 3KXIA 4B3CA 3LVRE 4LBWA 3KJIA 4RD3A 1E0SA 4HB4A 3BRWD 4DEXA 2OESA 3K0CC 1Q57A 2QQ0A 2IHBA 5TMPA 3OF5A 2VP2A 4Q7KA 2V6JA 5J4LA 1Q44A 1U0JA 2G6BA 2XB2A 1NJFA 1EX6A 2QPTA 5FOSA 5DHAA 2ZSBA 2H1LA 2BBOA 4URWR 1T0HB 1N6IA 3X1DA 4CEIB 1Z63A 1CRPA 4YC7A 1Q1EA 1D9XA 3EPLA 5KU1A 1OIXA 2IS1A 3VQTA 5AR1A 5M04A 4WXPA 1ZU4A 5DI3B 2QP3A 4A2QA 3OE7A 1G3UA 4JT4A 3UIEA 3M4YA 5J4HA 4KFTA 3FMFA 2JAQA 1KYIA 1ETUA 3GD7A 4NU0A 2OO7A 3IHLA 5D3MA 2B7CA 3U4QB 1G5TA 3GPLA 1E2FA 1J8MF 2ATXA 3CPHA 2C96A 3FPAA 3UG7A 1NSFA 3RSOA 2OUKA 4TQ9A 1NBMA 3GJ3A 1TU4A 3AKYA 5KHOC 2DFLA 1ZNZA 2KBFA 4MYTA 1RZ3A 4Q1EA 4RKEA 2FSGA 3SJCA 2VP4A 2BWJA 1SZPA 4NH0A 3RC3A 1TL7C 4UQOA 2XSZD 1UKVY 5JMTA 1IHUA 1SXJB 1RYFA 2HXYA 3K0AA 4NPHA 3KQKA 2O8EB 1G8HA 4PPNA 3KKMA 4DLXA 2EYUA 4Q1BA 4A92A 3VR6A 2IYTA 2A30A 5FOXA 1JR3D 5JWRA 3V00A 3QKUA 2F9MA 2FH5B 1W5TA 4L9WA 3THWA 4Q4AB 4QBIA 3FHTA 4QBHA 3GMTA 4JBYA 1NKTA 1YZNA 1M6NA 1ZU5A 1IY2A 1F2UA 2BV3A 2JLQA 4DEYA 2WOJA 2OBMA 4EPVA 3K0SA 2YKGA 2P67A 2AFHE 2P6NA 2ZS8A 4LPSA 1WQ1R 1EXMA 2GJSA 2Q6TA 2QG6A 2QEQA 2C98A 4PSVA 2NG1A 4H1VA 2ASEA 3NHBA 3LX5A 3QG5A 3FGNA 4B43A 2IS4A 4BLQA 1ZD1A 3GJXC 3C15C 4A82A 2V7QA 3K0AB 1XJCA 1WXQA 1N6LA 3MWJA 4Q4JB 1FL9A 5FTNA 3RS2A 1OB5A 2E9SA 4KFRA 1E2GA 1D5CA 4RKFA 3QEOA 2FZ4A 3SS8A 2MSEB 4IEEA 1F2UB 1KSHA 2J1LA 2G83A 2XZOA 2ZJ2A 4QGAA 1DG3A 3FDIA 3RRZA 2V55B 3DL0A 1JJVA 2X77A 3TH5A 2ZYVX 1P72A 5JECA 4LJ9A 1XRJA 2QQEA 4L15A 5FTMA 1TX4B 4B2IA 1YVDA 2D3WA 3GJ7A 2GF9A 2KWIA 3OFND 1G16A 1GUAA 1E9BA 1S3GA 2C77A 1XD2A 2I3BA 1HY3A 1VPLA 2J7PD 4PO8A 4Z8XA 2G1KA 2VSFA 4LV6A 2CNWD 3U3OA 4F4CA 3KQHA 3D7MA 1N25A 2OEPA 3SI7A 1TF7A 4W5WA 2W2TA 5KOYA 1W49A 4A15A 3K0FA 1HQYE 2IYUA 1CEEA 4URZR 5HZKA 4XVUA 2FV8A 1DBSA 2NO1A 2FGKA 3OEED 1H8EA 4RJLA 4AG5A 3AVYA 3KTAB 2FSHA 4EQ6B 5FFMA 4ZDIA 5F9HA 3QKRA 2GJ8A 2WJJA 1Z6YA 4CF7A 3L82B 1II0A 5GJBA 1E0KA 3AVXA 3EC2A 2JJ1A 1N6NA 2D2FA 2P65A 3BH0A 2CE7A 4HDCA 1ZIPA 4JLKA 3ZS9A 4FCWA 3HPQA 2FSFA 2ZEJA 1AQUA 3GLGE 2ZUCA 1W7AA 2O8FB 2VH5R 4OHWA 1NN3A 2EWVA 1NN0A 4RZXA 1D2MA 1RFLA 2P0EA 4TT3D 5EE9A 5H8WA 3QKSA 3TVDA 1X1RA 3M0EA 2VA8A 5HCNA 4BZQA 1I4DD 3AVWA 2REXB 1FQKA 3CB4A 5JSZB 2WJYA 3GFTA 5EE5B 3TGPA 2BKUA 4W5HA 3T1VA 2WWYA 1XJQA 3QOFA 1E2PA 1EFHA 4LHWA 3SN6A 3IILA 3SC3A 1CR2A 3T06B 1CTQA 4G0NA 2HT6A 4U02A 1N0WA 4LBVA 2IEYA 4V0OA 2QPAA 3E1SA 3TJZA 1E2DA 1NIPA 2OBNA 2B7BA 1CULC 4M0LA 3A1UA 2AWOA 3AM1A 1G5RA 2R44A 4IOLA 4Q9IA 4DIDA 5KNCA 4MKFA 1KO5A 2R62A 4IOJA 1EFRA 1KZ7B 4BFUA 5JFGA 1ZIOA 5BWMA 1JPJA 3GLIE 2F1RA 2O8BA 1J70A 4QRHA 3ZQ6A 1KI6B 3BFVA 4OJQA 1KMHA 4K46A 4HAYA 1SXJC 5E7IA 3ZIAA 4A8JA 3QF7A 3SDZA 2IYLD 3KFVA 4K81B 1P6XA 1YKSA 4G5QA 4DDWA 1UEJA 2E1RA 2GKSA 4GP6A 2WWXA 5HE9A 4KHZA 3KB2A 4FCVA 1J99A 2XX3A 2CL0X 1IONA 4JLNA 3SFVA 1KK1A 1Z2CA 4JSTA 3QJYA 2H7VA 2OCPA 1JQLB 1Z0DA 5LDDC 2IWHA 1BMFD 4ESVA 1XDBA 2BJVA 4D2IA 3M6AA 5E7MA 5BYKA 2HXSA 3ZGXA 2XTNA 2VLIA 5JJIA 2WPDD 4C0KA 3FKQA 2HT1A 3FKSD 5BQ5A 2FN4A 4P4TA 4Q9HA 2BMDA 3QG1A 1RPZA 2IYWA 4Q5IA 2CHQA 1CF4A 2VEDA 1VDZA 3K1JA 2CE2X 1TQ4A 3BB4A 3FFAA 4MGKR 2BKEA 2C9YA 1X6VA 4YMUA 1LVGA 4OQXA 3J81k 3PENA 4JBXA 3C8UA 3QNUA 3AF1A 1JR3E 5KDOA 3SYKA 2Q3MA 2BMEA 1G3IA 1S3SA 1EFCA 3HYTA 2CLDX 4GFDA 4TTRA 3T35A 2J0UB 1G9XA 4PHGA 3MSXA 2GZHA 5E3HA 3LBHA 4GPTA 4FIDA 4YONB 3CH4B 3FHCB 2WSSD 1Z06A 3LD9A 2W6IA 5IF9A 3UMSA 2QL6A 2C03A 1E2MA 2YVUA 2ZYWX 4CEJA 4BLRA 3A4MA 4WZBE 5AJYA 2ZXUA 4IW3B 3A1SA 4O3MA 1IM2A 1P9NA 2R6CA 2ZI5A 4D4JA 2JLUA 1JAHA 2FE4A 4DLYA 5JS7A 1G3QA 2ZREA 1DE0A 1QHIA 1SVLA 1TF5A 2Q3FA 4G1UC 2XEXA 5FR1A 1GAJA 2NPFA 1W36D 2UVQA 4UJ3A 5ELXA 4ZKEA 3PEWA 2AX4A 4DCUA 2CK3D 4RFSB 2P6RA 3ZVRA 3NDBB 1P60A 2PT7A 2VSOA 1Q22A 1NP6A 2BDTA 1AIPA 4WBSA 1U8ZA 4DCVA 2ZS7A 5JI2E 2QTHA 3TAHA 5KPDA 2BBTA 3CF0A 5JEDA 1W46A 2NIPA 1K6MA 2ZRGA 5HCIA 3THOA 5K8IA 1FUUA 1JQJC 1T4GA 3QXSA 1CXZA 1KKLA 4BEBA 2ZUDA 4PFSA 2A5YB 4M1YA 3ZZUA 1OT3A 2WAXA 2YINC 4P4SB 2XJ9A 3FB4A 2OAP1 4C0QC 1WA5A 2QN6A 2RH5A 1NY5A 1JJ7A 1CJTC 5GJWC 5AJVB 1TEXA 2ZRLA 1Z6XA 1TEVA 2BM1A 2AHOA 4LJ4A 1DADA 1KAGA 4TQUS 4YLGA 5E4FA 2XAUA 1GL9B 1G8FA 2O0KA 2IYRA 2F9LA 1YJ5A 2RB4A 3A4LA 4C0HA 5BN5A 2Z0MA 3H2YA 3AGQA 4KAXA 4QBGB 3KKOA 1N6OA 3EX7C 3I8SA 3GLHA 1E4YA 4NCIA 2CLSA 4CVNA 2NPIA 4NTZA 4EPXA 5FPSA 3GEEA 1SVMA 1H8HA 3U7EB 3AVPA 4Q66C 1W0KA 1JXOA 1U81A 2XJ4A 4P32A 2REBA 3EXAA 5JBQA 5JWOA 4NCNA 5EUQB 3DDCA 2YNMA 2G77B 4QHSA 5JEEA 3K53A 3AKEA 4LWZA 4MA4A 1CKEA 1G1MA 4C0SA 4A6XA 3FE2A 4O0MA 1GITA 2WMOB 2RCNA 4LV5B 1SVWA 3MWLA 1VYVA 2AD5A 3NDPA 2I1QA 3B1ZA 2PZEA 4RZ3A 2XXAB 3EZ2A 3DPUA 1BO6A 2EFHB 5FBWB 3GCGA 3U2QA 5H68A 4KYUA 1IXZA 2I4IA 3R8CA 4LBZA 1E9SA 2B6HA 1TTTA 4NKRA 4DCTA 1M7HA 3CR8A 2J87A 1EWRA 421PA 2BIFA 1P61B 3WYAA 4BRUA 1C4OA 3CIOA 3NEJA 4PPFA 3ASYA 5K8LA 4OI1A 3WP1B 4F93B 1HH4A 3LLMA 2QENA 1NMXA 3TIFA 2GK6A 1ODFA 4LUCA 3S1AB 3PEVA 1EX7A 4Q21A 4EPWA 2QAGC 4D0NA 2BVNA 4G5SA 2Q0HA 4OYHA 1W2GA 4DVGA 2ZRCA 2J3EA 5A0FA 3PQCA 4DDUA 1IAQA 1P3JA 1W44A 2A3RA 1GKYA 2UKDA 4TLDA 5HE8A 4NHOA 1XX6A 2QGZA 2C95A 1VG0B 2ZRIA 2NZ8A 3WNBA 2R2AA 4QHYA 5LBIA 1Z0FA 2QE7A 3WXMA 4M1MA 3CZPA 3TE6A 2ZJ8A 4NDZA 2H8KA 1HTWA 4TL6A 1G21E 4B6EA 1NY6A 1NF3A 2GJKA 4JVSB 2J59A 1RE0A 3RWOA 1P73A 4YXWA 2F55A 1M7BA 1O3YA 1E9AA 1YQTA 2C5LA 2ZU0C 2R6DA 3AV0B 2R8RA 2GDJA 2ZJOA 2RHDA 5CLLA 2FPLA 4RD4A 2NMVA 3OEHA 4NYMR 5FL3A 2KBEA 1XXHA 1QHGA 2OHFA 2ZR9A 3CF6R 4PAQA 4PHTA 3UG6A 4F7WA 3EA0A 2ZRKA 3IDQA 1IQPA 2O8DA 4KSBA 3EZ9A 4HLQB 3PUZA 4BE7B 4R98A 4DUGD 1OYYA 4LJ7A 1U99A 2GXQA 2IYYA 3E5HA 3QEJA 4QHTA 3CX7A 3L2OB 1W4RA 1OXXK 1X1SA 2W2VA 4C0JA 3U44A 4MH0R 1FNNA 5IDVA 3H0KA 4BFXA 2WIBA 2PMKA 4TYQA 1R4AA 3ZVNA 1CR0A 3N70A 2A5GA 5B2ZA 2H16A 2V3CC 3LDAA 5JZVA 4UNNA 3T5GA 3ZLJA 3QVVA 1ZM2A 2BBSA 1VG9B 3ZYCA 3K09C 2VO1A 4XD7A 1PLJA 2J46A 1ZINA 2E87A 5CYPA 3LAWA 5EE3A 2ZI6A 4WZAE 3CX6A 5FTKA 3RABA 1NI3A 1A2KC 2IXEA 2RGNA 1VIYA 3ADKA 2KI5A 3I1FA 4B32A 1P9WA 4JVMA 5DE3A 3WHKA 3I4LA 4DT1A 3GLFB 2VP5A 2GCNA 1DAKA 4YMSA 1JR6A 4NL4H 2ORWA 1Y63A 3BJIC 3NBFA 4RD6A 5FUXA 3CPJB 2DR3A 1TMKA 5GVRA 2R6GA 2FFAA 1NG9A 3W8NA 1G20E 3UMRA 3WYFA 2QSYA 1OFUX 3B82A 1MO5A 2JJ2A 4KLZA 4Z1MA 1Y3AA 2JLYA 3Q3JB 2FSIA 5J4YA 3KXLA 5IRCD 4A2PA 2QP4A 4M1KA 1NMYA 5FPKA 3EA5A 3QXJA 3DEFA 3JVUA 2AL7A 2EU8A 2AFIE 4TL9A 4C0BA 5KDDA 4JJKA 3U6KA 1LF0A 2W0MA 2PMDA 1OSNA 3DOEA 5EP3A 3THXA 4B47A 2XZLA 1P2VA 1D2NA 2CCGA 4LZZA 2EQBA 1R7RA 2UZ3A 1E9FA 2V1UA 3U7FB 3RRYA 4X8LA 3WRXC 1QHHB 4CT4B 3GJ4A 2FJUA 2NOAA 3NEYA 3PFIA 3ZZTA 4B2PA 2I1VB 3RVBA 3THYA 2XNDD 3W3ZB 2ZRDA 3PITA 3CONA 1Z6AA 3FHOA 3R7WA 4CW7A 2Z4SA 1MOZA 3HWSA 1G4UR 4HDOB 2FNAA 2XB4A 1KSGA 1BKDR 3C5HA 2JDID 1OJLA 1X86B 4ZIRA 3CLVA 4H1UA 2XNSA 1MKYA 1P5ZB 1LS6A 1SHKA 2J7KA 3AGPA 1E79A 4EKDA 1G7CA 4AKGA 2WICA 3AKDA 2HJGA 2CEAA 1AKYA 4CRWB 3MFYA 4AKHA 1NRJB 2WIAA 5DH9A 3D6TB 3ETLA 4O2LA 1R10A 1DAMA 1F3OA 2ZJBA 4CDGA 4CEHB 2JLSA 1W36C 1RJ9A 3GJ6A 4OHYA 1GTVA 1M2OB 2BC9A 2ZRJA 4TSFA 1NVXQ 3R7WB 1LS1A 3O8RA 1NG1A 2LKDA 3EZ7A 2VPPA 1LTQA 3RANA 1W0JA 3OE7D 2V6IA 2ORVA 3AEZA 2IS6A 4B3GA 4POAA 4MRRA 4WVFA 3SHWA 2WWFA 3T15A 3ZH9B 4PSKA 2MMCA 3I3SR 4KI0A 5L8VA 3TLXA 1FOEB 3I32A 1OXSC 2OSBA 4KBGA 3GEIA 5FR2A 5HR5A 3B85A 1F2TB 4HLUA 3UATA 5KSZA 1TPZA 1GNQA 4A0FA 2ZR7A 5AUOB 4CEIA 1NBMD 3B9PA 5K8UA 2OILA 1F6BA 3EARA 1G5PA 1P2SA 1Z6TA 3NKVA 3ZD6A 4OK6A 2B92A 1E9DA 1ZCBA 2ZS9A 5DI3A 5FI0B 2ATVA 2NQ2C 3DMDA 1IJFA 3EIQA 3JZMA 3OZXA 2ZE6A 3H4MA 1SKQA 1UFQA 1VYTA 1M1YE 4QJ3A 2H18A 4AURA 1G3MA 2IYVA 2ZVQX 2HF8A 5B30A 1CBUA 2HCBA 2OCYC 3T5DA 2GA8A 1KI3A 1T3SA 2LWIA 1HUQA 3CBQA 3CNOA 4MKIA 1YR7A 2FZLA 4I1SA 2BM0A 1XEXB 2ZJZA 5DI9A 3U4QA 2LCFA 4GNKA 2EFDB 3PUWA 4TYYA 5DLQC 2GJAA 2J9RA 4TLBA 5JJLA 4MRNA 4A0HA 1DPFA 5EXXA 3I72A 1BYUA 2Q9BA 1FNMA 3MJRA 2ZU6A 4BASA 4JZKA 1QHNA 1DO2A 2V7QD 1UAAA 1W1WA 2O8EA 1SXJA 4N3NA 2QTFA 3EZFA 3ZZ0A 2OBLA 2R65A 4YMTA 4BLPA 1J8YF 4DXAA 4CIDA 4EAQA 1KJWA 3O8CA 5F98A 4L5BA 2PBRA 2XOKA 1DAFA 4Q4AA 3Q85A 3AVVA 1X8KA 1E0JA 3TSOA 1XMJA 3CRQA 1Q3TA 3A1TA 4MGZR 5AJXA 1DO0A 3U7GA 5C1BA 2GXSA 3PIRA 4TLCA 3QE0A 4A6PA 3NBYC 3TR0A 5JCPA 3E2IA 1KI2A 1WDTA 3FYHA 3KKPA 1U9IC 1GVNB 2QUZA 3G5UA 1XTKA 1IN8A 2VP9A 1GNPA 4WIAA 4HZUB 4BWYA 4ACBA 4NONA 3F0TA 3B60A 1T3HA 4V02A 1XWIA 3FOZA 4Q4JA 3PJRA 4LC1A 1UKYA 3JZAA 4V0KA 3LW8A 5JLJA 5FOVA 1BYIA 1XTIA 1AGPA 4HAVA 2C04A 3RNLA 1II8B 1RRCA 2F1IA 1H8ED 3I92A 1AGRA 1RKBA 1DVRA 2X1VA 2D7CA 2ZE8A 3U61B 5HZHA 1VHLA 1KHTA 5KYKA 3QPUA 4JLJA 4FMDF 2GCOB 2WKQA 1GWNA 1D9ZA 4Y0VA 1AZSC 1GM5A 3Q5DA 2IHYA 3D3QA 2BOVA 1E2JA 1ZM9A 4N0DA 1U2RA 3IIKA 3GLGB 4W7SA 5E7JA 3NC0C 3MRSA 4F92B 3OHMA 1FMJA 3LQRA 2V8OA 3A36A 2YOGA 2CJWB 3CRVA 3AVOA 1HURA 2KE5A 3NXSA 4UKDA 4V0ME 3RS0A 4NYJQ 5HPYB 3EWSA 2PX0A 5CM8B 2ZAMA 4QM7A 5JRJA 1ZRHA 3GJ0A 1FUKA 3MWKA 5BYJA 4RCZA 4FW9A 1NNEA 5CK4A 4LRWA 1RW4A 2GJ9A 3KTAA 4V0NA 4B71A 4ABYA 1LB1B 5EP4A 4EQ6A 5AUNB 2QROA 4Q7JB 4B73A 2D62A 1D6JA 1PJRA 3LX8A 1Z08A 2RAPA 2WHXA 2WZQA 3WMEA 4KV9A 2QBYB 1CP2A 2C9OA 1OW3B 2BCGY 1J2JA 1GG2A 1E0AA 4MRVA 3GLIB 1TF2A 3V9PA 3VFDA 4DHEA 1XCGB 4C7OB 4QKQA 2O5VA 2O8FA 5AJWA 1E9CA 1XTJA 3B8HA 1JEEA 4LSGA 3B1VA 4B75A 4DLTA 5L3VA 3WYGA 3N2EA 2B8WA 1W4CA 4QOSA 1YRBA 1EWQA 4OKSA 2A78A 4XSGA 2YWEA 1CRQA 3AQ4A 5JSZA 1KDPA 4U00A 2XSZA 3O47A 3GP8A 1SHZA 4JJZA 1KI1A 1FZQA 3R8FA 5F9FA 2XTMA 1R5OA 1NN1A 2PL3A 2W6JA 3QENA 2N1BA 2J5XA 4AYXA 1IN5A 1CR4A 4JMPA 4GOJA 4TLEA 2ZE7A 1ZCAA 4JL5A 1S2MA 4JLBA 3OIYA 1X8JA 4K8OA 5DN6D 4IVQA 3O8BA 2Z4RA 5FI1B 4O2RA 4QBFA 1ZD9A 2QU8A 5FBRB 1Q20A 4MKHA 4TZ0A 2QMUA 721PA 2RGAA 4TMZA 1HT2E 1NLZA 1IN4A 4Q9LA 4D81A 1OH6A 1KI6A 3B2EA 1NBME 4IKEA 1N0VC 1UPTA 1SULA 5A5GA 3BXZA 2CMKA 2IYXA 3PUXA 3QIAA 1ZD8A 4L16A 2QSZA 4IDPA 4NZYA 5G53C 3I62A 1FX0B 4OJKA 4ZDWA 2MMGA 5EUMA 3BIFA 5L3QA 1CJKC 4PPGA 1OH7A 3RHFA 3IUYA 4NYIQ 1TNDA 4Q03A 1M7GA 3FMOB 4DZZA 3PXGA 4B48A 3RSLA 2QT1A 4E22A 1E9EA 1OHHA 2RGDA 3KJEA 4HSEA 3VHXA 1OYWA 4LK2A 1QHXA 4Q7MB 1LFDB 2PT5A 2YOFA 4DJTA 3W3AA 1WCV1 3IPXA 2N46A 3D8BA 3OFNA 4HDQB 5B57C 1E9RA 1UADA 4NE2A 1Z0JA 4MYUA 4QJ4A 4DDTA 4URYR 4L4UA 5F2EA 1Q3HA 2ODWA 4DLRA 4RY2A 1U0LA 3GEHA 3BAFA 5FUWA 1MH1A 1XMSA 2CNWA 3A1WA 3CUEF 4GSYA 2YWGA 4IDQA 5L3QB 4I1VA 2CXXA 3EZ6A 1XJ0A 2EVWX 3IKJA 3MAAC 4TLAA 3TRFA 4EFLA 1ZUHA 2QTVB 3BBPA 2JA1A 2ZYUX 4ZPXA 4YDHB 5G3ZA 4U5XA 1X8LA 3VR3A 5DISB 2ZI3A 1IOZA 4AKIA 1SVSA 2J0UA 4ZI2A 4NBSA 1T0JB 4JLAA 4AIIA 1Q0UA 1FP7A 4XOIA 2A7QA 4MITA 4LX0A 4A36A 4B3BA 2P2LA 2D2EA 4ZCLA 2FFBA 2ERXA 3LV8A 3Q9LA 4BGDA 3B1WA 1R5BA 1GNRA 4DLVA 3HPRA 2VHUA 4IEIA 1VG8A 2QAGB 1I4TD 5EZ5A 2FFQA 3X1XA 4X8MA 4TQAA 1JNYA 3BS4A 5H70A 2IK8A 3DM9B 1NVVQ 4EIWA 2CL6X 3LNCA 4TT3A 4URUR 1B23P 1G6OA 2BBWA 3AP1A 4PZLA 3TSZA 4AG6A 4TYNA 1R5NA 2GXUA 4OI2A 4C3ZA 5EZ6B 2F1HA 4RFSA 1S96A 2GTPA 3PEYA 5C4GB 1KZGB 3KZ1E 1JAIA 1QRAA 5FPYA 1RRFA 5TVKA 1NJGA 2RGEA 2AXNA 3SYNA 4KITB 3V4RA 1E2LA 1GRNA 1H8HD 4GMDA 2FWRA 4CZ2A 1UBGA 5L3RA 1N5JA 4OQLA 1I4LD 1UKZA 4B3XA 3NIBA 1RC8A 1P62B 3K09A 5F3WB 1T6NA 3U3KA 1R0YA 3SNHA 4P4SA 1YR8A 1YZGA 2WWIA 4M22A 3PG5A 2JLRA 1KY2A 3RLFA 2WTUA 2WWGA 1N3BA 4QNMA 4C0LA 2BMJA 3LLUA 4LGMA 4Q4HB 1QHSA 4ARZB 3K70D 3ZVMA 1R8QA 4NCKA 1L7VC 2REOA 1N5KA 2VF7A 1XPOA 1N5IA 1C9KA 4BZPA 1TU3A 3DMNA 2R6FA 3PUVA 1XTQA 3A37A 1AK2A 2GZDA 2WOOA 4CT5A 1AM4D 2VHJA 4GOXA 3QBTA 2XGJA 4DCNA 4AKEA 1US8B 2AD1A 1E1QA 3UK6A 1D2EA 4PO9A 1Z6GA 3AP2A 4XSHA 4JLOA 3NH6A 2QP9X 1AQYA 1ZW6A 5CYOA 3UWOA 3ADCA 2D06A 1Q21A 3B7GA 4RVCA 4URVR 4TZ6A 3GJ8A 2ZJ5A 1FP6A 3FKSA 1XCPA 1QBKC 2GEUA 4HUQB 4XWAA 1KI7A 1P75A 4BZXA 2YYZA 2NGRA 1AN0A 3RS4A 2N42A 2PH1A 3KX2A 3ND8A 4MYHA 4PQRA 1JXMA 3IEVA 3EWAA 2XXAA 1T5IA 1V5WA 2DHRA 3LFUA 2ZSFA 4ZDKA 2JASA 3K9LA 1U0HC 1WBDA 2IUSA 4C9BA 3D31A 1KIMA 5BN4A 4TYWA 4FWTA 3HJNA 2JIZD 3P32A 4P33A 4ZI3A 2QE7D 4IOKA 4LJ6A 5CDFA 4OQNA 3X1YA 4W9MC 1XEWX 1VCIA 4LJ5A 2YWFA 3K9HA 5G3YA 2O8CB 1MO6A 3S1AA 3VMFA 4X8OA 1NLFA 4XJXA 5CJPA 4DWJA 3CO5A 3OIVA 4DBLC 4YXWD 2IUUA 5BXQC 1U8AA 2A2ZA 3TMKA 1DOAA 3ZS8A 2GAAA 2WAYA 4Q1DA 3GFOA 5CIWA 2H57A 1GZSA 3A58B 2F1JA 1ZJ6A 2QGNA 3OEHD 1GILA 5DGXA 2NO9A 3RAPR 4M9SA
chains in the Genus database with same CATH superfamily
1J09A 4DJEC 4MEBA 2IF0A 1GZ4A 1XCBA 3MWYW 1NOKA 2WFAA 3H9UA 1H0HA 3GP3A 3WO0A 4BX3A 2WA2A 1KZ6A 1K6JA 2O52A 4LBYA 4UZFA 2VZEA 3RHTA 4B5LA 5IYZA 1BFDA 2YBDA 3H83A 3PDIB 3STHA 1O7JA 5HM8A 2FYTA 3OOEA 4GXNA 4ESEA 1HL7A 5ALNA 2BGUA 2PL5A 4E31A 1QHYA 4B3FX 4TMXA 4HNVA 1Z2DA 3H86A 3GHYA 3GL9A 1X80B 3UWMA 5KHLB 3ISVA 3CNNA 4DIUA 2PGDA 2V9ZA 4XD7D 2IUTA 2R7MA 3L4JA 3MGBA 4Y0AA 3AKCA 2WFZA 4FFRA 4GW3A 4QOEA 3VKVA 4AFNA 4BKOA 5K45A 1DEKA 1IATA 5FLXA 4N5DA 4MVJI 1KQNA 2QTAA 1WIWA 3UV7A 1HFKA 1PS0A 2FA9A 2I1LA 2MINA 5EWLB 5GWXA 1FS6A 4FCTA 4ML3A 1FX1A 1J23A 1Y3BE 1W36B 2Q4TA 1I6MA 3PWTA 4L5JA 4L4SA 1EZ1A 5KDLA 1G20B 1PFKA 1C4WA 4GP7A 4WLEA 4B6SA 5KNLA 1IULA 3ICPA 4U7DA 1S9DA 2EFEB 4KSCA 4UOQA 5JNSA 3TG8A 3RUFA 1T91A 4KX3A 3TEMA 4AUEA 5KAPA 5DNAA 2F3RA 4P34A 2ONKA 4PX9A 1T8UA 1ODLA 1QVAA 1RWOA 5E0OA 1F1JA 1ABEA 1C7ZA 2IIPA 1P1KA 3AHGA 3HWRA 2HSEA 1XTBA 3MRXA 4M4SA 4XQEA 1NPTO 1LX6A 2Q6IA 4LRYA 2A33A 1HKHA 3DQQA 4ON9A 4WY8A 4EZIA 1BEUB 3OQNA 4D4LA 1R0WA 4IUDS 4OP3A 1LRJA 5EZQA 3UMCA 5LLTA 1NZJA 2W83A 2ZTLA 3L6OO 1W19A 2BZSA 5I9MA 4XFDA 3TNFA 1HYQA 3NHRA 5E1DA 4KMMA 3WNVA 3D8UA 3EK2A 4EUSA 1C7EA 4KPYA 5JD4A 2Y4NA 5CM2Z 5MN4A 1AS3A 1H94A 2QR3A 5EEHA 5BWCA 1VTKA 4S05A 2CBZA 1GUZA 2VOEA 3NCHA 4E15A 4QDZA 1KDVA 1L7NA 2PBFA 4P31A 5EJMA 3TXXA 2ORED 2FK8A 1GRRA 5FNVA 5KVAA 4KXFB 1PQUA 4HAUA 4FMDB 2Q2WA 3H1BA 1N57A 1NL3A 2AN9A 4X95A 1KQGA 2QMZA 3M2PA 2YWBA 3C85A 3GLHE 2QORA 2ZRPA 4R8RA 4CDNA 4BQIA 4PPQA 2HRRA 2ETXA 3BQMB 4U6QA 2X2OA 5AQEA 4IDHA 4Y6OA 3DVAA 4J4TA 4DSNA 4UTOA 2C61A 1HLGA 1UC9A 4KPUA 1WMFA 3DR5A 2Q4OA 2VAXA 1UBJS 1YVUA 1ZIXA 4JROA 2OXFA 4DILA 1NVAA 4V03A 5KQPA 1DC6A 2FEPA 4R3WA 3ISJA 1LY1A 2A0KA 3VO9A 4LIPD 3FSRA 1TFUA 1S01A 1I4WA 4Q1CA 5SZIA 4F4HA 4DG8A 2GZMA 3LWZA 4CMIA 1OLSA 2ZIGA 4NHEA 2JD2A 1SKYB 1THMA 4O02B 1IJEA 2V6BA 4YJ3B 1CNFA 1KAEA 2BZGA 4HH3C 5AW5A 3SICE 3ZEIA 4DF3A 4BMCA 2XRZA 2OVFA 2KYRA 3ABSB 3DH0A 4OQQA 5SZHB 1VXOA 2LRHA 1U3WA 1ZAKA 3C3EA 3FDZB 5DBFA 1L5GB 4EDHA 3T3PB 1YBHA 4BMOB 3O73A 1Y8CA 2X5OA 1TIKA 2KSQA 3RFCA 3VH2A 3KUXA 2ZI9A 1VMEA 4QJBA 3C4JA 4YGYA 1SC4A 4JZYA 2QRMA 4QC2A 4TXHA 1FNSA 4DV0B 2CHFA 4NFSA 4XPIA 5E6SA 1Z16A 1EK1A 2X86A 4P3XA 4AWXA 4EUKA 2EC5A 1DQNA 2LXNA 4X93A 1NP7A 3DF9A 2GSWA 4BUCA 3SEAA 3SFTA 3IDFA 4WBNF 1XZPA 3CF2A 2CLMB 4L75A 3U17A 3HY4A 4LY9A 4KO8A 2F62A 5GP1A 3B6KA 1P7CA 1M2OA 1JJBA 1RMYA 1NLYA 3G0OA 1O54A 3TM5A 3W05A 2M6KA 3JRWA 2ZITA 3MWDA 5CNKA 4RS3A 1OVGA 2Y0DA 2I99A 1A9ZA 1JDBC 2YMPA 3GLRA 4F9TA 5IFKA 3HU1A 1UZUA 4DUGA 1SU6A 1C5KA 3KYIB 3LIIA 4HHEA 5AK3A 4ETNA 1HQCA 4AYWA 1NKVA 2PCJA 4C7BA 4MGYR 4KE8A 3GN2A 4NU8X 2P3SA 1FFXA 3KG2A 3PR2B 4W1SA 3MYRA 4PC7A 1OFGA 1OA1A 3WMRA 3DO6A 3VNAA 5BUCA 2DPMA 6ABPA 2HI0A 2PYZA 1I1NA 3IGFA 5HMLA 4F38A 4KKXB 4PY2A 5JC1A 5EHZA 4M0CA 1B16A 3MWEA 4QGHA 3R23A 1F2TA 3WNDA 5JV5A 2C7VA 1J97A 2VHYA 4HX5A 1ZJYA 2CUTA 2XLBA 1WEHA 2XWSA 1GSHA 3ED5A 4EUFA 5ALXA 3A6PC 4J29A 1O87A 4EJSB 3HDQA 1CY0A 3NPAA 3ZI7A 4DCSA 3U1BA 3L0ZA 4NZZA 2DUWA 1G9TA 1KGDA 2FFHA 4IRMA 4NWIA 1I5OA 1LDEA 4JUAA 1ZR4A 4DR4B 3DO5A 2VJNA 3R2JA 4H3KB 4V24A 4BLTA 1DRWA 3ZWMA 4C88A 4F6RA 3B9QA 4EFMA 1PGOA 4Q19A 2ANBA 4MUJA 3PT5A 1G41A 4MW6A 2JL1A 3OLQA 2RHMA 4ED9A 1USKA 3MS2A 4AROA 2HUPA 4R84A 1C7IA 1CS0B 3MN1A 5JCJA 4B3TB 4G97A 1E63A 2IEDA 4QU8A 3A2MA 3P0EA 3PNMA 2IHUA 3K1AA 4KODA 4G0OA 1NTRA 3H4TA 3WBKA 4AJKA 3T1TA 4YJFA 3JQ7A 4E70A 4BV8A 3G6WA 1AD2A 3FYTA 4LKOA 3G0CA 4FT4A 3CLRD 4HDNB 3SZMA 1LD3A 3GGPA 2GZAA 1MN6A 1K3TA 2D4HA 3QPBA 4P93A 1XD9A 3IS3A 2YJNA 1F20A 2VA9A 5HKLA 1R6AA 1OIWA 3N5CA 1FA9A 1GPH1 1MIOB 2I4MA 4RANA 4ASUA 1UFRA 5KKNB 3P0RA 2PIAA 3EGXA 3OC6A 2P2NA 3O3OB 5CFRA 3SC2B 2A5DA 5E6UB 1ZAYA 4M8LA 2JGLA 4OHPA 3G2NA 3EVDA 3EQ2A 3QF4B 3HO1A 1TYBE 2QAJA 1WD7A 4JJ4A 1JWLA 2NXNA 5HX7A 1UXJA 5HDBB 4PCVA 3FSGD 1HRKA 3DNMA 2OXRA 3FCSB 3H8JA 4IKPA 4LV8B 4UDNA 1UZLA 2QRGA 1CUZA 1S2OA 1ZUIA 2B78A 2GHQA 3IAAA 4P8RA 1RAIA 4IVRA 2ICAA 2Q1YA 1HDEA 3K0HA 3Q0TA 1C1DB 3IPCA 2JAXA 5TR9A 1C30A 3PQFA 3BRQA 4HZUA 1QQTA 4B81A 2Y68A 5B3LA 1KEKA 4QREA 3QVLA 4FFWA 1YS9A 4FI3F 3OIWA 4MRPA 5JNRA 3WDLA 3QUCA 3ETCA 3CLSC 4O25A 1KDZA 3AIKA 1G18A 1FW6A 1U1DA 2I6GA 5IVPA 4Q1VA 3L4EA 3R7BA 5DWVA 3U19A 2HJVA 4ID3A 4KH0A 3WL8A 5MFPA 5AIBA 1V1RB 3PHJA 3VGJA 1E2NA 4DGQA 3QPVA 1GSIA 1P1BA 2VNSA 1II8A 3A4IA 5E4JA 1HE8B 5B6JA 4BUJA 3DFFA 3JRNA 2Q0SA 1TADA 1KDRA 1RM0A 1KQOA 1RHUA 2C2HA 2OZEA 2PTHA 3BE4A 4QUDA 3OJ0A 4WN9B 4HQ0A 5B7GA 2K5UA 4YT5A 4BECA 4OOEA 4J2OA 2J6CA 5DSZA 1Y1SA 3ECSA 2GWRA 1XTUA 3AVUA 3JQBC 2BEKA 2JLAA 5G0VA 3J80A 2V9PA 3B3JA 4HX2A 1R12A 5DHSA 5T7BA 2XQIA 1AK9A 4L0CA 1Q1QA 4A73A 2VJAA 4OHZA 4MR7B 4DSUA 4BX9A 2VDOB 3F2IA 4HGQA 4C01A 3AWIA 3TR6A 4XB2A 1H2RS 3GU3A 5TE9A 3LNTA 1F0PA 2RGNC 2PVSA 3C3YA 5I7WA 4JV5B 4FMCF 4QFBA 4CG3A 5AJZA 2VK4A 2BE7A 3QMWA 1YL5A 4R2IA 4MWTA 4ZALA 3WP0A 2N75A 2PGLA 2P69A 1OXBB 1U7ZA 4NOLA 1NTOA 3V1NA 2HWYA 2PUTA 2WJ3A 2Y1OA 3M6UA 4RH3A 1SQ6A 3N2NA 1XB2A 2EZTA 5BOSA 5HKKA 3CMCO 3EFHA 1TQDA 1GPDG 2CJPA 2F6RA 3FUVA 4ID9A 4JLSA 3I2YX 2W2XA 5CNIA 1MR3F 2QMQA 3MUEA 4ZAXA 3H3FA 3H2SA 1HZJA 4IRUB 2OV2A 4DCJA 2QBYA 1O6ZA 5KUTA 3IQXA 4JS0A 4TMKA 4JGBA 1C80A 1IE3A 2QX7A 2GN6A 3B3GA 3G7SA 3VR5A 4Z3OA 1ZMXA 4GGOA 1Z56C 2OORA 3TSCA 1WW3A 3KELA 1N7JA 5GGXA 1PK7A 3L79A 1UT8A 2ZIUB 1KQFA 1CT9A 5JI3E 2BEJA 2QMEA 4CU2A 4D4KA 3E7XA 4OK5A 4ND5A 2ABWA 4L22A 4TV9B 3M5WA 3UEOA 3I5YA 2G9NA 1SJ9A 2EKZA 2QT0A 3QU9A 2DUUA 1BW9A 2J45A 4PRKA 4FYJA 1JV2B 1JEYA 1YU6A 4Z7QB 3MLAA 2PWPA 3CN9A 3H2HA 1WMSA 3Q87B 4EBBA 1JEDA 4V38A 4L9AA 1LNZA 1BE0A 1HO3A 4WZ6A 3ZBTA 3ZZMA 1Q0ZA 1T1JA 2JFZA 3CX8A 5AOVA 1BXGB 5EP2A 3RK0A 3TTTA 4P22A 3UAYA 5CG1A 4DMGA 3PVCA 1SVNA 3ROFA 4EGAA 4ZYLA 1GUBA 2OHXA 1RBMA 1UZMA 4N7MA 4DMMA 4WTOA 4XWKA 1R88A 2ZROA 3L1KA 4PV7A 5IASA 2MU1A 2GVNA 1P2UA 2NV6A 3IFSA 4XQ9A 2NO6A 3EDOA 1VZ2A 2GCEA 2B8JA 4PG5A 4DQLA 4FBGA 1JIIA 2H07A 2BGMA 1XF9A 5JSFA 2IQIA 1LSOA 5JXJA 5I7AA 1NF8A 4KR3A 1OU4A 1W6RA 3FVQA 3UANA 1SGWA 4FJ1A 3RIHA 4OA5A 3IVGA 1O57A 2XBUA 4FILA 3H11B 3ICWA 3ND7A 1LW6E 2AJLI 4FOSA 2OYCA 4ER6A 2WJVA 1JDUA 3PP8A 4O33A 5KTPA 2PZGA 1FX0A 1X1QA 2RAVA 1JR3A 4G25A 3CV3A 4KU4A 4PHFA 2IEZA 4OY3A 2GASA 1SXJE 4PX3A 4WCFC 2OA0A 3TIIA 1E6LA 3U0BA 2ETVA 1WB4A 4JHLA 2Q9AA 2JEOA 2WIJA 2Q21A 4Q3OA 4RF5A 4BO2A 1ILEA 1WPXA 2P68A 3LZDA 4GR4A 2Z8YA 4NESA 5CP8A 4RK7A 3IULA 4TSFA 1F06A 1H6CA 5AKYA 1UDXA 1Y0BA 3GR6A 1YQUA 1G8KA 3A0RB 1Y9JA 4KYVA 1OIVA 1BHSA 1XYGA 3LVQE 4K6MA 5EXTA 1DBRA 4HG2A 4CIBA 1AQLA 5JAMA 1MVNA 2ZKIA 5IAOA 1JDNA 2PUCA 3OCWA 5FJJA 2I8LA 3CO0S 4A2WA 3IHKA 4HLUC 2ZIAA 4M8IA 5DCWA 5C5EA 4TX1A 3JASA 4ECAA 4F4JA 2C8LA 2X15A 4EVRA 1QKKA 3MXOA 4U2KA 3RS9A 4P7KA 3SIPA 1J8VA 1GAQA 1W0CA 2F3TA 3EAGA 5FEUA 1LLCA 1LNQA 4PO3X 1QCCA 3KKZA 3Q7SA 2G07A 3DBHB 2ISCA 4X61A 5JJKA 4FOPA 5IKXA 1Z5GA 1GQRA 1D1PA 4QICA 5FV4A 4P4UA 4WACA 4YHBA 3PKZA 1L4NA 1RDFA 2GETA 1A5SB 1NPYA 4WASA 5EXDA 3K6KA 5FKJA 3ZHUA 3N2KA 3QKRB 3U81A 4QT4A 1PKEA 1T35A 3WB9A 3ZCQA 2VDPB 1T43A 4Z54A 1U6JA 4RGVA 2DHDA 1YT5A 2ZRAA 3L49A 4HB3A 4M6WB 4PG7A 3U4AA 4LHYA 2DQKA 1GO2A 4OUDA 3VAYA 1HV8A 3R9XA 1D2RA 4RPCA 3FTQA 2Q1SA 1Y5LA 4CL3A 1GARA 3UXMA 1YB2A 2EYQA 2JIOA 4YA6A 3QYJA 3I61A 5CW1A 5KTYA 1KJZA 3GA0A 4GBMA 4GMXA 1MVOA 5L6MB 1ZJWA 2DUNA 5K01A 4X3CA 3ICQB 3JQ9A 1RWNA 4F91B 4Q34A 1PD0A 3HCDA 1E7MA 3NWPA 1ZA2A 4Q18A 3ZD8A 2H2FA 1ADCA 3JVVA 3QKSB 3WIVA 5LQCA 3R20A 3SR3A 4AJNA 1LBIA 4X6UA 1WXWA 1Y34E 4QNRA 3N2GA 1P2TA 2DFTA 3R4CA 3T3HA 5F3RA 2RHTA 4O4LB 4W5JA 3D6VA 1LNSA 3W2EA 6YASA 3W04A 1PBTA 1AKWA 5KREA 3CFYA 2DETA 2Q9CA 4L27A 4O2BB 3GGCA 5HUQA 5AVUA 1F60A 1Z88A 5AI8A 3TVYA 4EFNA 1HT3A 5DN6A 1YRAA 4TS1A 2APJA 3W1VA 3J81A 3O74A 1TM4E 2AQ8A 1ZHFA 2FQYA 2NM0A 1MC1A 1XC7A 4PXYA 2BD0A 1E1QD 1XYYA 2YWHA 3CRMA 1IDN1 3AX6A 3REFA 1TRHA 3S2YA 3TB6A 5I48A 2FB9A 2FLKA 4LVCA 2IVFA 2WU4A 4J1TA 1SCUA 2Z08A 2X2EA 2QQGA 4NMXB 1KPHA 4DNFA 3D7SA 4QPZA 3MW8A 4RNCA 3JVEA 3DZDA 2XT6A 1SXIA 5DHUA 1J07A 1GKKA 2EG5A 2IY8A 3DW3X 3UJ8A 3WBJA 1EDZA 1D4OA 4OEHA 4CLRB 2FN8A 3VNVA 4FNGA 2C3YA 4Q4HA 2VJCA 2VKQA 1U1FA 4EGQA 1J4AA 2AOXA 4RIEA 4Y6QA 4J0DA 3OMWA 5ELMA 2X8AA 1H3FA 3G02A 4BTEA 4LFAB 4Q01A 1ZDMA 3G5AA 3Q8WA 2XUQA 4M83A 2NVWA 2IPMA 1B41A 1M5TA 1NQOA 4EYKA 2J4CA 3F3YA 4Q7QA 4G5FA 1K9SA 5FPHA 2WD9A 1QWSA 2ONJA 1WRBA 4HV4A 1AH2A 2PRKA 3KJGA 3MD0A 4WA7A 3FOEC 3BIXA 3ONWA 3GNTA 5D1HA 3DO8A 2ODPA 5KVQA 4KCGA 5T5QA 3ZV5A 4A10A 5BW8A 4LXUA 1Q2UA 2G76A 1CUBA 2FFJA 3JQ8A 4FBLA 4M76B 3TMAA 5LU8A 2JLCA 2HRDA 4FOLA 1JG1A 1QZZA 3BREA 5LDHA 4BV9A 5EA2A 2DY1A 3ZW7A 2I3DA 5K0LA 4MO2A 1X7ZA 2CCKA 1SCIA 5BMOA 3ILYA 3ANNA 3CB2A 1N9KA 2VF8A 5AXDA 3SVZA 3FUUA 3K2BA 3STYA 1Z33A 2IPLA 2VIIA 4Q3EA 4IKOA 1P2DA 1TZCA 2PZFA 4KUEA 4HEHA 4E5UA 1W4BA 4KTTE 4W8OA 3RS3A 1PFVA 2WMYA 4GNRA 3T95A 4RA9A 4XEHA 4IS2A 4TMVA 1RI5A 3WISA 2BH9A 1G21A 2AK3A 2Z1NA 5P21A 1MHPA 5JZBA 4RORA 4I1YA 5B1HA 4KQ9A 4DJAA 4PXAA 1VCHA 4D57A 3AB3A 3KWLA 3TLKA 2ATCA 1IY1A 1UPAA 3ENVA 4MGHA 5A3VA 2WPDA 3PXUA 1LRLA 4X1YA 4D7AA 3VNQA 3HDTA 5K0SA 1E96A 1FU8A 4FD2A 5E6RA 1YRLA 1KBQA 5F4BA 4DNPA 3OU7A 3KD2A 2RGXA 1N6KA 5REQA 1IL0A 3SKXA 4UXJA 3RKRA 2CVZA 2A1IA 5J47A 5HS4A 1IUOA 4CEJB 3INNA 3FTEA 5EP1A 1EX1A 4TV9F 3GK3A 4D25A 1SURA 821PA 3MIZA 1L8LA 4J0CA 2VHQA 2CFCA 3NWJA 2P5YA 2ZPUA 2A84A 2YWJA 1C3XA 2PMWB 4R8SA 5E8RA 4TL8A 1WVIA 4CQMB 3AVTA 4FT2A 4FPXA 3I8XA 4QU0A 2B0JA 4I9GA 3BMQB 1Y3FE 4EHBA 4CG0A 4GZLA 4M53A 2I2BA 2VXOA 3OQIB 4NRDA 3OHPA 3KSRA 1FUEA 4BQQA 5G2OA 3W6PA 1C1HA 1WULS 3AK4A 3G1UA 3PDIA 1Z0SA 4IY1A 4B2LA 2FMFA 3C5CA 1BDHA 3WK6A 2E21A 2D0PB 2YIMA 1V37A 4PZYA 3QE9Y 4BB0A 2IOHA 3W2FA 1X80A 1BVYF 2ISSD 3NORA 3I6YA 5TV2A 3MJVA 3UOAB 3MCVA 2QTCA 3TVTA 3WK7A 5JAIA 2VJQA 2E5WA 4HAXA 3HR4A 2NUBA 4WXYB 4C0XA 4EUNA 4EECA 4INJA 4QAQA 4YCCA 1E6WA 3D8SA 3EOBI 4BNMA 5EWLA 5GOTA 3LC0A 4HUJA 1AHPA 4OK3A 4QG3A 4QD3A 1XCMA 2BFWA 1R2QA 3R9WA 1F1BA 1G20A 3LCRA 3BFXA 2CK3A 2W43A 1MX9A 3L02A 2PRIA 5F7ZA 1JDBB 3DXXA 3W7VA 5JAHA 4K7JA 4KN9S 4NS1A 5K3SA 4LQ4A 4QG7A 4UU1A 5BQXA 4NMMA 1BQ3A 3QBEA 2ZI7A 4NNJA 1KKUA 1D4ZA 2R6JA 2A9OA 2QM7A 3CNBA 5ERYA 1EK0A 5A4JA 2OZKA 1U2DA 2NADA 5EESA 3F6PA 1QG4A 4RFVA 1Z5NA 3FNGA 3ZBUA 4HUTA 4EHJA 3HA5A 3HDGA 1MC8A 1KFCB 2IU4A 1RYNA 1N8SA 4QGBA 1I3CA 3ZDFA 2C42A 2J07A 3VNSA 3ZWXA 3GOQA 4CLHA 1CJUC 4GOMD 1F4VA 1U0GA 1PTKA 1L5ZA 1Z4PX 4DQ0A 3K6JA 3PCRB 3UHOA 5SICE 4CT0A 2NZ2A 3RD5A 5ESWA 4IZ6A 2G1AA 3BTVA 1TT7A 4LHXA 4F3CA 2ZXFA 5F23A 4CNQA 1BOFA 1QPBA 1E2KA 1Q16A 3BXEA 5ITWA 5L3SA 2PA0A 4G0VA 1KAOA 3M4JA 1JHDA 4JFRA 2A0XA 1JMYA 4Y6RA 3RV4A 3P4XA 4FEGA 3HZZA 3KHTA 4JVOA 3BH7A 3PDHA 4V1CB 1G19A 2XF8A 2XTJA 4X6YA 5HZMA 2ZI4A 1RP1A 3OZDA 3C14C 3JD3A 4B1FA 1RBZA 2Q50A 1G66A 2EEZA 2CLLB 2QZ4A 2ZWOA 1B0UA 3P96A 3OKAA 3R5HA 4FUTA 1OI7A 3R3UA 2Z56A 1ISIA 4KMSA 5FUVA 5B4VA 1FF9A 3GWZA 4H3VA 1KU0A 2VUHB 3FCOA 3LUHA 3P2OA 3NETA 2HNKA 4KBFA 4YP7A 3LTEA 4BWFB 2VCHA 3SQXA 5DTJA 3B1YA 4BEJA 3LH5A 2V3WA 1IN6A 3BF8A 1KORA 1SBHA 3ZEAA 2ZIZA 4AI6A 3DNFA 3EASA 5FOTA 4JR2A 4BV2A 3MTGA 3L41A 1ZD3A 4PYKA 4G2NA 4FHCA 4DYVA 5KC9A 1E61A 2R2GA 3QXXA 4GL4A 1BS9A 1KK2A 4YRCA 3L8MA 4YI3A 1B74A 3JXEA 2JHFA 4YMWA 1XIVA 3LPLA 2MSDB 3HYLA 2O50A 3QFTA 4GQAA 4MHOA 1U7OA 1GL6A 3NFRA 2HGSA 5DYYA 1DBPA 5LCXA 2XMPA 1HNNA 5I8WA 3K9GA 5DASA 4FYYA 2ZJ4A 1C2TA 4DSTA 5LYYA 1YTUA 1I7PA 3CKLA 2NWQA 3H8WA 1M10A 2IDKA 3HXPA 2RIRA 1WWKA 4RA6B 4AJLA 1EIWA 3AIOA 2DBQA 4L4RA 3WNQA 3FDZA 1TUIA 1Z6QA 4DUPA 5IDQA 4FW8A 4IDOA 1MRSA 3DQZA 2I7TA 3P20A 1OH5A 2QY9A 4TVKA 4ZJPA 6PFKA 1L9XA 3ISTA 3WKDA 1H4SA 1YZYA 3KRTA 1NWCA 4TZTA 5CDFE 2HCJB 1V4VA 3QKIA 1U98A 1K8XB 1T1EA 1U0FA 3PGKA 2X7XA 4ERNA 1Z82A 1ZK2A 4QDXA 2CL5A 3NCTA 1TLTA 4GPD1 4TTIA 2DWPA 4I99A 4C89A 1KF0A 3VYSB 1Y3IA 1Z83A 4BFVA 1PR3A 5H7XA 2RHOA 1EESA 4X60A 3GA7A 2YIVX 1ND5A 3EG5A 3GJ5A 1ADFA 4GX0A 1Y5RA 2PKQO 3WMGA 4JYAB 2VQEB 2A5JA 1KY5A 4WECA 2O8DB 2Q3DA 2BMAA 1RXUA 1TUEA 1YZTA 3PNQA 1TXGA 1G3RA 3GUCA 2FJ0A 3KEFA 4GLLA 2R1TB 4RHYA 4CETA 2H9AA 1X2BA 2WF9A 3HXLA 3PHCA 2CFRA 2I2AA 5CH5A 1WCXA 3R5KA 2O1SA 5CJ2A 3KB8A 3AF0A 4AS1A 1JEQB 1J5XA 1N2BA 4RE5A 1V3QE 2EBHX 4PBTA 4X71A 4YAKA 5C7LO 3E9EA 5BW6B 3F3SA 4RD1A 2GN0A 1J7KA 1DUIA 4W7HA 5EWMB 3TG2A 4G4SP 1A5TA 2ZYDA 1BC5A 1E7WA 2GYWA 4HAIA 2DQYA 2XE4A 3UPDA 5LKAA 2R84A 3OZGA 3EMBA 3HCCA 3VTZA 2P2DA 3ST7A 4KLCA 5KYWB 1Z39A 3C74A 5GIPE 4X7RA 4OXYA 3UPUA 2WM3A 3BDAA 3OUZA 4FDLA 5C46F 5FL7D 5T67A 5KC8A 1KOLA 4RV5A 1PL0A 1JX6A 4EJSA 3WGKA 3AEXA 4EY5A 3HADA 3NOXA 2WZDA 5UKDA 4D74A 1UM9B 3EC1A 1MGOA 1I2DA 5BSRA 4D56A 2WD7B 1SHLA 2M6SA 3ZDRA 4CQJA 4KFUA 5I7RA 2Z2KA 3IB6A 2WNIA 1Y6GA 1S2DA 2DYKA 4FJ2A 1EBBA 3R3HA 3O8OB 4ONEA 1MABB 3A1VA 4HN9A 4I2VA 2R11A 3WLPA 4G4JA 2OWEA 1CS0A 4TS4A 2WJHA 4X7MA 3VX3A 1CQWA 4Z2AA 2Y0PA 1SC9A 3DEAA 1NKSA 2JATA 3BA6A 1R27A 3B6EA 3F5FA 4O4IF 1GUFA 4Y1RA 5TPZA 4NBNA 5TS2A 2WYWA 5E0KB 4AJ1A 2G28A 1WP4A 1BX1A 1V7QA 2D7JA 3DAOA 4JA0A 1YA8A 3KK0A 4G5OA 2ZUUA 4XVQA 2B25A 3VZBA 4KQXA 4Y8VA 4C76A 5FWYB 5CXQA 5DNYB 1DAGA 3A6HA 4YNBA 4HDNA 4XEUA 1E32A 4N40A 2O19A 4YLYA 3CINA 4KR2A 1HE1C 3VYUB 5JZMA 3JWIA 3D3KA 2Z58A 3EIHA 3CVXA 4IIYA 4NICA 4BDSA 1K7XB 1WW8A 4Z7JA 1JIQA 1UBEA 3EQZA 2QZJA 3IERA 1MIOA 2R9VA 3U26A 2TMKA 3WYBA 1XJ5A 4K9NA 3UC9A 4C30A 1NJ5A 3GLFE 2VUTA 3L4SO 3SM3A 2P1DA 2XVZA 3FTFA 1FUYB 5E6UA 4HQFA 3SHVA 1RD4A 2ECKA 2OBBA 2DHEA 3GQBA 3QF4A 3FFBA 3K0BA 4MRSA 4PCUA 2C20A 1J0BA 5FF9A 4CV3A 1VIMA 2QLBA 4YCLA 4AG3A 3IXMA 3PV0A 3SBDA 4IQ0A 1ZIYA 3C7CB 4UM8B 1SKYE 1NX6A 5C1DA 5KYXB 1MV5A 1T8TA 1TMOA 1MJGA 3LQ1A 3ORSA 4ZIRB 1UODA 3E5MA 3EXEB 1RWWA 1Y1KE 3M6FA 4M21A 1ZYUA 4PLCA 5AOBA 3WRYC 4RDXA 1KI9A 1C1DA 3DEYX 3FTNA 2WQZA 4ZYUA 5LFAA 4ITVA 3LC2O 2ATEA 1KO8A 2JK0A 4IXMA 1UPFA 5D7NA 1Y9EA 2V54A 1FQJA 2PZKA 3LDFA 1I9GA 2NO0A 7YASA 2YJ5A 3WDKA 3WAJA 4U1RA 3LGAA 5H81A 4CXMA 1X1CA 1QR6A 1YS1X 2A5FA 1NNLA 2P27A 3T7JA 4CV0A 5BWOA 4US0R 4WCFB 1HMPA 1CJSA 3VDQA 3LQKA 3O2NA 1GL7A 2X2FA 3IBYA 4GL2A 5IVDA 1DXHA 4PVDA 3HZHA 1QIHA 3CR7A 1IU9A 3PUHA 2IOFK 1COWD 2FZKA 1VECA 3Q72A 4JLPA 4WN9A 2ZTUA 1APBA 4YPVA 5DK6A 1Z0KA 1ZRSA 3BDVA 1JHXA 2H2DA 3O7WA 3T38A 5BQPA 1T9ZA 4B3CA 3FROA 3KJIA 4YP5A 1V96A 2PUAA 3F1KA 1TKCA 1QE5A 2IHBA 4C7MA 4EG3A 3ZDYB 2DHCA 2VP2A 1Z4OA 4H16A 3K31A 4Q7KA 5J4LA 5EJ5A 1YIAA 5CNMA 2QPTA 3BSYA 2PXAA 2Q07A 2PS1A 3FNBA 3MTEA 3P5BA 4MWCA 5DHAA 5FEMA 5KNBH 3TDNA 5FTWA 1N6IA 2AVDA 3U40A 3U7QB 1J0XO 1VIVA 1YJBA 3KHKA 1EP9A 2YN2A 3WI7A 1A04A 5EC8A 3PC6A 2HMVA 3PZRA 4K6CA 1N77A 4AS2A 4ND8B 4DKJA 3NRJA 5EQJB 1BGXT 4WXPA 3CC8A 5CVJA 5AR1A 1ZU4A 1F2VA 1WVMA 5DI3B 2F59A 5AHXA 3IALA 4P3OA 4A2QA 3OE7A 4ZFNA 1QYXA 4LOKA 5IJZA 1NU8A 2QL7A 3QMPA 4FDUA 4MHSA 3UIEA 4XLZA 2ZJ0A 2FWNA 3ZQ4A 3GXOA 3THRA 2IXAA 2WEKA 2ZAGA 3K2IA 1JTFA 1LPMA 3FMFA 1SUBA 3A27A 4HDKA 1JWAB 1P4JA 4HN2A 4NU0A 3V7YA 5KOIA 2P1RA 4J0KA 3HHPA 1CIJA 2IOFA 4U3JB 1TVKB 3AUKA 4AMGA 3UNXA 3C3MA 3H18A 3W1EA 1IBLB 2C96A 1NSFA 5DBOA 1DEOA 4GYJA 1N5MA 3RSOA 2WE8A 3GFVA 3M6LA 4JDUA 3G0GA 5MFZA 3IUEA 4RADA 1LK0A 2DFLA 2KBFA 3WA7A 1RZ3A 4K9PA 3C7AA 4RKEA 3K73O 1CZKA 3V2IA 4Z7OB 3SJCA 4IXWA 4TV9A 2HADA 1LBEA 3GGSA 4WXHA 3QOYA 2XSZD 4RH1A 1RYFA 1G8HA 1BWRA 2BP7B 3KKMA 1DKRA 2EYUA 4Q1BA 4C4RA 1P3DA 3VR6A 4DLPA 2A30A 3SYMA 1WCWA 1O1YA 2V7VA 1BXGA 2E37A 4UCWA 1J0CA 4ZC1A 3WHIA 2H29A 1NKTA 3OZ7A 1IY2A 1HSZA 1W30A 2JLQA 4YBRA 4F04A 5TMEA 1CHDA 3W6UA 1O4VA 2P67A 2AFHE 2ZS8A 3FSGA 2X0FA 3T41A 1EXMA 1YI8A 4GD3Q 4ND3A 1GR1A 4R69A 4LK3A 4OMDA 1V3TA 3USCS 2VK8A 2W4MA 3LX5A 3UG6A 4AUMA 5BQOA 4MTLA 2IS4A 2H1RA 4X65B 2J9FB 3SXPA 4A82A 5AM0A 3CLHA 3K0AB 1XJCA 3ASVA 3KQVA 5D7BA 1VPWA 3H11A 5F7XA 1UJNA 4X00A 1B8OA 3M83A 3U9TA 4E7PA 3TAXA 2PX4A 3GLQA 2JH8A 4V0RA 4Q4JB 3RS2A 1P1RA 4KFRA 1PHPA 1D5CA 1O0CA 3OT5A 2IDZA 4RMJA 4L4XA 2G1PA 3JQDA 1BCSB 2C84A 2VHEA 2QD5A 3E1GA 2Z8YM 2J1LA 4FD3A 4FYKA 3GRVA 1IHOA 1U7HA 3S68A 2YHIB 4LXQA 1Q6YA 1TYAE 4QGAA 2VSYA 1WCYA 2V55B 3DL0A 3GZJA 1JJVA 3OKPA 3WGQA 2PFGA 4B85A 1QIGA 2ZYVX 4F9EA 3A6ZA 3UO8B 2E4XA 3MTQA 4B2IA 3FLMA 5I4KA 4AJ4A 2DZDA 3OFND 1DINA 4AN4A 1G16A 4LAFA 4DC1A 5C5CA 4RTRA 2FZWA 4WMLA 3E3MA 3WG9A 3AU8A 3IMGA 2BGGA 2LIVA 1RYMA 2NUTB 3KE8A 3BD8A 1QMGA 4RZHA 5JPCA 4F8JA 1D6MA 2I3BA 3U3OA 2G4CA 3B8EA 2J5RA 2VSFA 3EEIA 4BQRA 1L5LA 2P6OA 4GZ3A 3D7MA 4D0LB 1TF7A 3PF8A 1Q0LA 1M1NA 4P4LA 1YBVA 2W2TA 1W49A 4A15A 1DXQA 3F98A 3O8QB 4URZR 4GPIB 1SWWA 2J3JA 3DBHA 4HQNA 3ZTWA 1ODSA 4JJAA 3BTUA 5B58T 3OEED 4N7JA 3EVBA 1Q84A 3KQPA 1QO0A 1JE0A 3FPSA 1R16A 4EQ6B 5FFMA 2COUA 2C1EA 1PFUA 3PNYA 3CNQS 3QKRA 2GJ8A 4KG7A 4G1MB 2M1XA 5F7OA 4EEXA 3EMDA 5EJ4A 2JANA 1L4KA 2B69A 3IDOA 4FJ0A 1O0BA 1VPVA 2Y6UA 2WU3A 1WU7A 1ODKA 3EOAI 5K0ZA 1RNLA 4JITA 3BH0A 3EDRA 4PVCA 4TGLA 4IX9A 4FDMA 2VYNA 4FCWA 3NBMA 3WL4A 3HPQA 3VJKA 8LDHA 1F12A 1AF4A 1VXRA 2ZEJA 3DAHA 3ECAA 2CYCA 3QHQA 4PLFA 3GLGE 5AXBA 1QQBA 2O8FB 1OI4A 1NN3A 1YZ3A 1X9HA 2C2BA 1OX4B 4NE7A 1WDKA 1NJ8A 4K2HA 3W4KA 4BLVA 2QE6A 4TT3D 5BSMA 5EE9A 4MB6A 1N1MA 1VZ3A 3QKSA 4PYLA 5IC6A 2OZLB 4C4ZA 4DL9A 4FQ8A 2VA8A 3GT3A 3KLOA 3AVWA 1ECLA 1Y7HA 4GM1A 1HDGO 3HMKA 3QLVA 4MMXB 4IDAA 4MV1A 2W2MA 4ZT6A 4UTNA 4JP8A 3DUFB 1DOZA 4JXJA 4O4LA 2WWYA 5BSWA 1GTZA 4KQJA 1EFHA 4DMHA 3PUJA 1K8ZB 4MV5A 4KX5A 2NU9B 3RSSA 3SN6A 5A5VA 2GBFA 5CHYA 7MHTA 1GT91 3KWJA 3T06B 5KOJB 3BJMA 3TFOA 1DIAA 2BEUA 3AUFA 1N0WA 1RRMA 1ST3A 3HHEA 4O2BA 4P4GA 4V0OA 3C6XA 1KJ9A 1CULC 4HGYA 4OF4A 2AWOA 4IOLA 3PHIA 3PQDA 4HC4A 1T26A 3PYXA 4PLWA 1WHSB 5K4GA 1G6Q1 1X1EA 2YYSA 3AI1A 2E4AA 3O1JC 4G8BA 4OP2A 1Q92A 4UEKA 3WWCA 1N2GA 1U8EA 4BFUA 4INZA 3YASA 5BWMA 1QCYA 1JPJA 4EI9A 2Z09A 3VPBA 1QVWA 1E3TA 2J67A 3C3AA 3ZQ6A 4ZYTA 5DBHX 3UGKA 4BP8A 3TRIA 5FO0A 4OHRA 1O95D 4NFYA 1KJIA 3LQFA 1YQQA 1K63A 1P6XA 1RXYA 4CLRA 1ISMA 1F14A 3KJQA 4DDWA 2E1RA 3LIPA 2GEJA 1I51A 1VI6A 3E35A 3ORFA 1ENZA 1SKBA 3RAJA 3OUUA 1FBTA 4KHZA 1HR0B 3FRHA 5K0BA 2XX3A 4IRXA 1IONA 2BN4A 1CV2A 1Z2CA 2FPSA 4JSTA 2B4YA 2MR6A