The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
92
|
sequence length |
308
|
structure length |
295
|
Chain Sequence |
GAMVMRLGDAAELCYNLTSSYLQIAAESDSIIAQTQRAINTTKSILINETFPKWSPLNGEISFSYNGGKDCQVLLLLYLSCLWEYYIVFPLTKLPTVFIDHDDTFKTLENFIEETSLRYSLSLYESDRDKCETMAEAFETFLQVFPETKAIVIGIRHTDPFGEHLKPIQKTAANWPDFYRLQPLLHWNLANIWSFLLYSNEPICELYRYGFTSLGNVEETLPNPHLRKDKNSTPLKLNFEWEIENRYKHNEVTKAEPIPIADEDLVKIENLHEDYYPGWYLVDDKLERAGRIKKK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
The "Super Mutant" of Yeast FMN Adenylyltransferase Enhances the Enzyme Turnover Rate by Attenuating Product Inhibition.
pubmed doi rcsb |
source organism |
Candida glabrata
|
molecule tags |
Transferase
|
molecule keywords |
Similar to uniprot|P38913 Saccharomyces cerevisiae YDL045c F
|
total genus |
92
|
structure length |
295
|
sequence length |
308
|
ec nomenclature |
ec
2.7.7.2: FAD synthetase. |
pdb deposition date | 2013-05-06 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01507 | PAPS_reduct | Phosphoadenosine phosphosulfate reductase family |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | HUPs |