4KKVA

Crystal structure of candida glabrata fmn adenylyltransferase d181a mutant
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
308
structure length
295
Chain Sequence
GAMVMRLGDAAELCYNLTSSYLQIAAESDSIIAQTQRAINTTKSILINETFPKWSPLNGEISFSYNGGKDCQVLLLLYLSCLWEYYIVFPLTKLPTVFIDHDDTFKTLENFIEETSLRYSLSLYESDRDKCETMAEAFETFLQVFPETKAIVIGIRHTDPFGEHLKPIQKTAANWPDFYRLQPLLHWNLANIWSFLLYSNEPICELYRYGFTSLGNVEETLPNPHLRKDKNSTPLKLNFEWEIENRYKHNEVTKAEPIPIADEDLVKIENLHEDYYPGWYLVDDKLERAGRIKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Similar to uniprot|P38913 Saccharomyces cerevisiae YDL045c F
publication title The "Super Mutant" of Yeast FMN Adenylyltransferase Enhances the Enzyme Turnover Rate by Attenuating Product Inhibition.
pubmed doi rcsb
source organism Candida glabrata
molecule tags Transferase
total genus 92
structure length 295
sequence length 308
ec nomenclature ec 2.7.7.2: FAD synthetase.
pdb deposition date 2013-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01507 PAPS_reduct Phosphoadenosine phosphosulfate reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4kkvA00
1O96A 4HK4A 5LM3A 1N2EA 4ZT2A 2DETA 3P0IA 1KH1A 2XRZA 1QU2A 1WQ3A 1I6LA 5DK4A 3UK2A 1EFPA 3FDXA 4KR7A 4ZT6A 4NX2A 4PBSA 1N78A 5TGTA 5JBNA 1JZSA 1WY5A 3RBAA 1ZJWA 1FYDA 2I1LA 2X1LA 1K4KA 3TZLA 4E1AA 3I05A 3X1KA 4AQ7A 3F3MA 2JAXA 2VXOA 3PRHA 1Q19A 5H16A 1M8JA 4JXZA 1VLHA 1NUQA 4ZCRA 4ZCPA 3KT6A 5K0SA 2H29A 3G5AA 1K97A 1ZUNA 1S4MA 4KR9A 3G59A 1PG0A 4J75A 2A86A 4NAUA 2GM3A 1N2JA 4OUDB 1QU3A 5LFAA 1O0BA 1JEDA 2J4DA 3ELBA 4I6JA 1H3NA 1LI5A 4EG1A 1GTSA 3Q12A 1P7PA 4MW5A 2QUJA 1Q11A 1IRXA 2ZP1A 4JXXA 1GN8A 4NDAA 1OD6A 1J1UA 1GPMA 2IP1A 3C8ZA 3BL5A 4H3SA 2A4MA 2PXHA 3H9CA 1QTQA 3CVYA 1H3FA 4DDMA 4MUJA 4KPUA 3HZRA 5HUHA 3SEZA 3N9IA 3N8HA 3CA8A 4WSOA 1Y42X 4DDKA 2XRYA 3AG6A 3RJZA 3TS1A 1YULA 1KQNA 3SDBA 4L2IA 3ND7A 4MQ6A 5LLTA 4I6EA 2PZ8A 2Z08A 3DPIA 3FWKA 2JA2A 4K03A 2EJCA 2YXNA 3IOBA 4Q93A 1NUPA 5IJXA 3KFLA 3JXEA 1JIIA 1EFVB 2VTBB 5J58A 4YP5A 4QREA 4QRDA 4JYZA 1OWOA 3UMVA 3CVVA 1FFYA 4S1OA 3LOQA 3VGJA 5DEOA 1ILEA 1N2IA 5KCMA 1H3EA 2CV1A 1H1TA 1VBNA 2WQ6A 2O5RA 2NSYA 4PBTA 2DR2A 1IQUA 1MB9A 4EG6A 1YUMA 4MLPA 1N77A 3CLUC 2CV0A 1KAQA 2DLCX 1EJ2A 1R6XA 3FY4A 1O96B 4HJRA 2QTNA 3IVGA 3K32A 3CLUD 1XNGA 4ZT3A 4MWCA 2J07A 1MC1A 1WXHA 2D5BA 1WXFA 4G5YA 3HGMA 1WQ4A 4XFJA 1EFPB 4HJXA 3GLVA 5DASA 3INNA 4MVYA 1NUTA 1MAWA 5KWVA 1TEZA 1N2HA 1O5TA 4DLPA 4U63A 3CVWA 2JANA 1M83A 2E18A 4YP7A 1MAUA 4YMIA 2RE8A 3P0HA 4G5FA 3D6VA 3CR8A 4MUIA 4MW2A 4YBRA 1J20A 2AG6A 2QJFA 1U3DA 4EGAA 3MLAA 1X6VA 1OWPA 2PG3A 1M8FA 1OBHA 4EF6A 1XNJA 2A1TS 1SURA 5TEVA 3VU8A 3ZIUA 1YI8A 4MW9A 3P52A 2WSIA 2GKSA 3H97A 3TQOA 3QTBA 3K9WA 3OTWA 4CDMA 2NZ2A 3CVUA 1MOPA 1ZH6A 1GZUA 1J09A 2CYAA 1NI5A 3COVA 3MXTA 1A8HA 3KT8A 1UFVA 3PXUA 3MUEA 4EG3A 1MJHA 1O95C 1WJGA 3N05A 3X1JA 3GMIA 1M1ZA 2HZ7A 3SYTA 1T6XA 5AHWA 1U7XA 4DDHA 3IVXA 4XFDA 4PBRA 1O97C 3IDFA 4KPUB 4MVWA 3FNRA 1WKBA 5BNZA 3AL0C 3ZGZA 4MULA 3SEQA 1U7DA 4QBTA 1O95D 1IFXA 2X0KA 2E0IA 1GAXA 2ZUEA 3P0JA 3ND6A 1O97D 4L2IB 3AIIA 1WOYA 2HMAA 3X1MA 2DXIA 1QJCA 2AKEA 2A1TR 3KT0A 2CYCA 1IVSA 3IMGA 3DV2A 3IUEA 4TS1A 1MB2A 1KH3A 3PNBA 1TYCA 2O8VA 4ZT7A 2DUMA 2CT8A 2PZBA 1KP3A 2V0CA 1IQ0A 1TYBE 4R2MA 1JIKA 1ULHA 4EG5A 1VBMA 1T9GS 4MAFA 4K0RA 2ZUFA 3ZXIA 4F4HA 1VBKA 2H2AA 2CUZA 2QTMA 5EKDA 4ZT5A 3RK0A 5IHXA 1DNPA 3DLAA 1WXIA 1PFVA 4R0NA 3D6UA 3IVCA 3H05A 5K0TA 1WXGA 1G8FA 2QTRA 1N2GA 4DNXA 2Z3VA 3FETA 2B7LA 1LW7A 2YWCA 4ARCA 4EFKA 1KKUA 3IMCA 4DE5A 1EXDA 4MUGA 4MWDA 3AKZA 1PG2A 4ZCSA 3COYA 1NUSA 2G36A 1MBZA 3PNVA 2C5SA 4MUKA 1OWLA 3IUBA 1JGTA 3COZA 4CQNA 4WNYA 2A88A 1K4MA 3FI0A 1F9AA 2IJGX 2IELA 2A1UA 1NZJA 1N3LA 1JIJA 4A91A 3ISJA 1U3CA 3ND5A 1IH8A 3SP1A 1OWNA 2E89A 2A7XA 3QE4A 1I6MA 1NP7A 4MVCA 4Q16A 1CT9A 3RK1A 4EG7A 1GTRA 4U8HA 2YY5A 1PFYA 1NYLA 4MW6A 1O6BA 2DERA 1JHDA 1R6UA 1WXEA 3ZJVA 3A2KA 3LE8A 3MMXA 3NBAA 1GLNA 2R5WA 3NV7A 4J76A 5FO1A 3ZUGA 1QRUA 1TYDE 1JEEA 3M5WA 4MUEA 3RFFA 1QNFA 4KR6A 2BYTA 3TQIA 4I6GA 1F7UA 1M8KA 1IQRA 2CSXA 3OP1A 2BTEA 5J59A 1VL2A 5TS2A 2QJOA 2QJTA 2PFSA 3UC5A 1TFUA 4HPWA 1NURA 3H99A 2WQ7A 4NZPA 1KORA 1XNHA 1IHOA 2DPLA 3TZEA 4MUFA 4RUKA 3Q4GA 3VRHA 3ZJTA 1JMVA 3LCJA 2D54A 5FO0A 2PIDA 3ZXSA 2DEUA 4ZCTA 5J5AA 1V47A 4ZCQA 4KKVA 4R2LA 1N2OA 1YIAA 1KR2A 4EG8A 1WZ2A 3L93A 3HL4A 4UZFA 1MRZA 3PNYA 2HGZA 1HYBA 3AFHA 4RPIA 1TQ8A 2D13A 3A04A 4FZJA 3HV0A 5F23A 3GUZA 3ZJUA 1EUQA 3CLRC 3UY4A 1J70A 3COWA 2WB2A 1KQOA 1T6ZA 4MUNA 5DB4A 4ZT4A 3UOWA 4BWVA 1YUNA 2A84A 4AS1A 1M8GA 1TYAE 5FNZA 1JZQA 5HUJA 1PFWA 3IODA 4MW4A 3TNJA 3CLRD 1J21A 1G8HA 1YIDA 1NUUA 4MWEA 5HG0A 3IOCA 4ND6A 4MVXA 1PFUA 1ZH0A 2Z09A 3HMQA 3Q10A 4NATA 4PY2A 3N2YA 1U0BB 4XSVA 2PZAA 3S3TA 4NAHA 3DO8A 1M8PA 1KAMA 3FG9A 4OUDA 4EG4A 1QRSA 1KP2A 2RD2A 1OWMA 4GU5A 3A05A 3AG5A 1N2BA 2OQ2A 4YP6A 4GRIA 4X0EA 2A1UB 3CLTC 1I6KA 1B6TA 1F4LA 2J08A 1NSYA 2J09A 3IMEA 3ILVA 4JZYA 4MUHA 4ND7A 1N75A 4MW1A 3U1VA 1V8FA 3A4IA 4U7JA 4MW0A 2E21A 2YWBA 5KHAA 3CLTD 1QRTA 1JILA 1T6YA 4CDNA 3H9BA 2OV4A 1RQGA 1X8XA 2TS1A 1F7VA 2CFOA 1G8GA 4OJMX 3SZGA 3L92A 1T9GR 4JFAA 2QUKA 4UZEA 1D2RA 4P2BA 1O0CA 3HFJA 3IH5A 3FIUA 2J5BA 3FOCA 1N1DA 2QUIA 3G6KA 2V0GA 1LI7A 4ARIA 2CYBA 3IOEA 4CT0A 1EFVA 2VTBA 1R6TA 1KH2A 1COZA 1Q15A 2GOYA 1J1ZA 3QTTA 2X1MA 1Q77A 4DJAA 1O94C 1I2DA 3NBKA 2CV2A 2AZXA 1K92A 2QUHA 1G59A 1JECA 3CLSC 5TEWA 1KQPA 1QQTA 1XJQA 4MWBA 3SZ3A 2EL7A 3RHSA 3MLBA 3KT3A 4F3RA 1BS2A 5H7XA 3FH0A 1O94D 1EE1A 3FHJA 3CLSD 4MW7A 4G6ZA 1EUYA 2X3FA 1OBCA 3CVXA 3E27A
chains in the Genus database with same CATH superfamily
1SBTA 1OW3B 2F90A 2Q50A 1PZXA 2P6NA 4QGBA 5KTRA 1VGVA 3HPRA 4ZAXA 4ZDIA 4ZEWA 1K2WA 3OUUA 1SHKA 4HLNA 5DLYA 1GITA 2C7QA 4ZMSA 5CYGA 2FPIB 2REQA 3D4OA 1VKOA 2EP8A 1WQ3A 1VMIA 1I6LA 3UW3A 3AL3A 4YDHB 1NU6A 5BPFA 3FDXA 1XTJA 1Z08A 2VPQA 3B2NA 4V1CI 2OXRA 4PXSA 3WMXA 4E2FA 5LP6A 3U4GA 1AE1A 3KZOA 1NBME 2HSDA 5HF5A 2I1LA 3O1LA 3VGPA 4CM9D 4CKCA 1MD9A 3U6BA 4W9MC 1MDFA 3FYUA 4TKUA 1UMDB 4ZDKA 1WF6A 4IUDS 3PPYA 3QWFA 5K6RA 2Q0QA 3GJ6A 5HR5A 3I05A 4X90A 5LYJB 3ZZTA 3GLFA 4DGSA 1HE8B 5KVSA 2VXOA 2FMTA 4BNUA 1J23A 2GWRA 2XAUA 3OSUA 2OBBA 2VDUE 3PRHA 1N3BA 4MYHA 4N0PA 4BZZA 4X97A 3ZW8A 2YS6A 3OE5A 4H1WA 1NSFA 5BOSB 3OT1B 3S8YA 5K6TA 2OORC 3AI3A 3GUUA 5G41A 1NVDA 1RXYA 4HFNA 2FWRA 4RC9A 3WDSA 3UM9A 4ZGBA 5I9IA 1L5VA 3H5TA 3Q3VA 4A7PA 3GGOA 1NVGA 3L05A 4UREA 5CJJA 3SYRA 4QXPA 3DMNA 4DILA 4N0EA 4ACAA 3C4QA 2BI7A 4B6RA 4WXYB 2CDNA 4A6XA 2QS9A 5B1HA 1XEWY 1XD9A 3NEPX 2OQIA 4HDMB 3I39X 1XD2B 5F2KA 5LVAA 2XNHA 3U48A 5LR6A 2WU4A 1PG5A 3K94A 3ZXYA 2WIGA 3KSBC 4OBXA 2OZKA 2EIXA 4DLSA 2XW6A 3OSZA 1H3NA 1PEAA 2MYUA 5DTQA 1VL1A 1OVGA 2TRSB 4FMBB 1Q11A 1YTLA 2WBLC 3N2GA 3AH8A 5EVCA 4EI9A 2A59A 3THXA 4AMBA 1FNDA 4H3SA 3AVVA 3Q72A 1M0SA 2A4MA 3EGXA 4LDQA 1DS6A 1YZFA 2VTDA 4FQ8A 4KVAA 4XD2A 4E0BA 1PUJA 1NJ2A 1IG0A 1KAHA 1M1YA 3MMSA 5E0KB 4KPUA 2C61A 1KO7A 1LV7A 1QHFA 1Y1RA 3HZRA 4KC0A 2QVXX 5HUHA 4GFDA 1WXQA 3E9CA 4IIJA 5ALIA 1E4VA 3MBKA 4QOEA 2H6EA 2OB2A 2OD7A 2WAXA 5CJ2A 2HQ1A 1R5BA 2PQMA 3SDZA 2Q7XA 1ZAYA 3CH5A 5ARBA 3HV2A 1ETHA 4M36A 5FTJA 4MUYA 3NYIA 4MPRA 1YJXA 2Y6UA 1J9EA 1DQSA 3IP7A 3LIPA 4O4IF 1YR2A 5REQA 1QBKC 3ZBQA 4YAJA 3R3YA 3GJTA 3W5HA 3KQUA 1V16B 2Q6OA 2OO5C 1NR7A 3PKIA 2HDWA 2REBA 2X5NA 3FPSA 3GJQA 1AU9A 5AI9A 2RG1A 3STHA 5JYDA 3AVXA 1G3UA 1DJOA 1RWKA 1B8PA 2OG1A 5KTTA 1BKSB 4YRDA 3ZHSA 4Q3DA 4QRDA 4NXNB 4OQQA 2FPWA 3TZ6A 4IYRA 4UNIA 2JJ1A 3HB1A 3OZ7A 1ESZA 4IW3B 5DEOA 1XLTC 3DD5A 3KHTA 5CDGA 4FE3A 1HRDA 5BSWA 4IIFA 2FUKA 2X2EA 3UCFA 2LPMA 4WFKA 4YRLA 2XAAA 3WAJA 5BV2P 1PSWA 1JJFA 5AD1A 2FW1A 4ND3A 2RGXA 3A3NA 4PHFA 4FTWA 3OLVA 3G9XA 4NH4A 1TAUA 3B53X 2DLCX 2V7EA 1JEAA 1NFFA 1RKBA 2F1RA 3BMQA 3OIWA 4DNFA 2PUDA 2XQGA 3AL2A 1O96B 1SKQA 2AJBA 2SBTA 4HJRA 2NU7B 1E3LA 1WMSA 2BGUA 1M1XB 2OOKA 1ZRHA 2XVAA 2C9MA 4L9AA 3W9UA 5A7FA 4FMCB 3ROMA 1WXFA 3DVAA 2G1AA 4GWKA 5GMOA 1RT9A 2GZ1A 3DT6A 5E1MA 3RYCA 1WQ4A 4CMJA 2OCAA 1BC5A 2F1IA 3GUYA 2UV8A 3NTXA 4U7HA 2OVBA 2F2TA 5AM1A 5EJ4A 3EEBA 1S3SA 4DSOA 3RS0A 3U2QA 3PP8A 3UMSA 2QRKA 4KREA 1K06A 1CJSA 1OKKD 4E5KA 4YDSA 4OLHA 1ESEA 4IEFB 2RE8A 4UU7A 3GRCA 1B2RA 3T0FA 1YOBA 1ITZA 1H4SA 1L3BA 1ARZA 3S28A 1EXNA 1Z8HA 1Z6PA 1ZC4A 3HABA 1RWXA 5JRDS 1Z17A 2DX7A 5ESDA 5DX8A 3ZZ0A 2I66A 4M55A 3DAOA 4LBYA 2H2FA 3ZLJA 1EWTA 4P33A 2NO9A 4NEGA 4R68A 4N6NA 3WHLA 3WIVA 4YHBA 4EJSB 1NKTA 3QP9A 2WJAA 1TXGA 4M1EA 5A5EA 1GD1O 3BRWD 2A9KA 4V0QA 1GZSA 1SURA 2G1JA 2WT4A 5ED0A 3I5UA 4KV9A 4BBPA 4U7WA 1G42A 2WSIA 2GKSA 3DF9A 1BQ3A 2GARA 2G67A 3CU5A 1GARA 4EFDA 1AHNA 2EATA 1TLLA 3LYUA 1JT9A 4QECA 1MN6A 2Q2QA 4DPMA 2BDEA 4ZO4A 5SYNA 4EATA 3IYLW 4RELA 4RF3A 4D1YA 3KT8A 4UDOA 2I4NA 3PJDA 3MUEA 1XD8A 1HLPA 1VA5A 3L79A 4MQEA 2F1HA 2WC1A 2IL1A 1J4AA 1E4YA 2FI1A 4EGJA 3QKUA 3PIDA 4ZOAA 5COAA 4R84A 1DXYA 1MRNA 2DSNA 5EZSA 4A2PA 3SS9X 2VDLB 2BFMA 2CMKA 2CE7A 2ATCA 1QZ3A 1N0VC 4AMVA 4ZKDA 5KPDA 2KI5A 4ICIA 2JCBA 5LUAA 3EJ6A 1DE0A 3RVJA 3VPHA 1O97D 1GNPA 1BJRE 2FK8A 1BCSB 1EA5A 3AKDA 4REOA 4BQEA 2VK2A 3BN3A 1P0PA 3N1UA 3E7WA 1Y3DE 3QEMB 1G4HA 4BE4A 5HM6A 4ESHA 4ZYUA 1GTMA 1CUAA 1HH4A 1QAMA 7REQA 3T7EA 5AI8A 4I4IA 5CA0A 1QTRA 5LYJF 4MEJA 1BROA 2EKLA 4NYIQ 3VSBA 2O8VA 3RRXA 4EI2A 2ANBA 1WZNA 2Q7DA 4EY5A 1ZLXA 5KTPA 4B74A 1Q7CA 5D8DA 4AYTA 2F8TA 1UDRA 2PYZA 3F5FA 3HFRA 4R2MA 4BEWA 1E2KA 1WX1A 2V7GA 2XLBA 3AT1A 3DT8A 5C8XA 1U5BA 3WC4A 4TXJA 1U9IA 1I2ZA 1DI0A 1L0BA 2GQ0A 2IU4A 1U3GA 4EAAA 3TRDA 3HFGA 2DFTA 3RK0A 4B45A 3R3SA 3QLUA 1NNLA 3T5AA 2WOOA 4R0VA 2VCHA 4KIGA 3M8KA 1A69A 1PLKA 1SEVA 1WXGA 1OFUX 2AK2A 4Q03A 4EYEA 4Z3KA 2QLLA 5BV8A 3G9QA 1XELA 4WRRA 4HVCA 4LNHA 1T8RA 3ETGA 3TJRA 4QDOA 1YQWA 3V8PA 4BRWA 1JKIA 4F6CA 5AUPB 5JCPA 3PK0A 4RFVA 1Q7RA 3S27A 5I48A 4ARCA 2E82A 3SIRA 4NXMB 2CVPA 3W5SA 1UIRA 1TI7A 1L4BA 4INAA 4C6SA 1FU7A 2H8GA 2PT5A 1LSSA 1E3SA 2GT1A 4HR7A 1ZA2A 4PG6A 2XCSB 1JT2A 3QJYA 3LUBA 5HWSA 3C41J 3NM4A 5J1SB 4J0HA 5ITZA 3COZA 3NHZA 1IBRA 4X5OA 1TZCA 5HYVA 1VJRA 2A88A 4DTIA 2XITA 4LXHA 4EMTA 5KHOC 3JAWB 1AGYA 1DC7A 1QWOA 2OBMA 3ND9A 3DDCA 3VYWA 1FDTA 4WCDA 2O7VA 4D4GA 3GFGA 3ECSA 3G2LA 4GXTA 3QUBA 3FE2A 5DO9A 1I4OA 5ICCA 3PR3A 4GYYA 1W5FA 3V8BA 4BBJA 4EG7A 3U7HB 3PNLA 1A1VA 4UVIA 3V2UA 4K9DA 5FI3A 3I42A 4LTDA 5EIHA 2IP2A 4GPAA 4U9IS 3LYLA 2GVNA 1LQ2A 4LHYA 1E2QA 1PZEA 4FYVA 1SKYE 3PUXA 1Y4AE 4EG5A 1DQPA 4S05A 1JDNA 3PICA 1NBIA 4XGKA 4MO2A 3LY8A 2BKVA 3GAMA 3FR7A 3KB2A 3WFZA 2GGSA 1RBZA 2AFVA 2QR2A 1J56A 4M88A 2UU9B 2W6ID 1DAFA 1C8VB 5IWAB 3DTTA 4O29A 3H2KA 3KEGA 5SZIA 1L9XA 2R9VA 3OPQA 2F4NA 3UAYA 4OJQA 1M8KA 2EBWA 2GTPA 5AKEA 2RGEA 1KI6A 4RWZA 1TA4A 5FI5A 5C37A 4HDNB 1C9MA 3CNEA 2H1FA 2DJIA 1AF7A 1VL2A 1YZGA 3ENZA 4H7IA 4JOQA 4AJNA 1VI5A 2HRBA 3GGDA 4G5OA 2VT2A 1B23P 4P86A 3ESRA 1HE1C 2OD2A 3HDJA 3NPAA 1WCWA 3T3MB 3TDKA 5TQ0A 1HORA 2Y68A 4EI7A 2HR1A 5DU2A 3NHPA 5E4JA 1NMYA 4O4HA 2V4ZA 2GFHA 3K53A 4ZRDA 3SJ7A 2AVNA 1OVMA 4FMCF 3Q2OA 2FR0A 4DLBA 3Q9NA 4FDUA 5JAUA 1JMVA 4MQMA 3BWVA 2PIDA 2WSSA 3R3HA 4DR5B 4LYGA 1RJGA 3RYHA 1I10A 1O9HA 4MA0A 3L4JA 1X15A 4R5HA 2V7VA 3QLJA 4BIIA 5FV4A 1NQAO 3AGPA 2OGWA 3IDSA 4JX8A 1PFQA 1EFDN 3NEYA 1FTNA 4H2DA 5HM8A 5JCJD 3NHWA 3TL2A 2IX3A 2YMPA 3OCCA 3BZBA 4N03A 4KX5A 3Q1LA 4Z5XA 3M34A 1GSOA 3FGOA 4Y9RA 4F92B 1WHSA 4NMHA 2UUCB 2I1QA 4HAIA 5D6NA 5H1YA 3S2FA 4LYEA 2P8SA 1UWVA 1M2VB 3C74A 2H92A 3EVCA 4KIWA 4PSUA 5TT0A 1FBTA 2ZBPA 4IGEA 4LZJA 4BJHB 4H1UA 2BONA 4P22A 1W59A 4IGKA 3A6ZA 3UOWA 1RBYA 1WTCA 4Z51A 2RI0A 1REQB 2B36A 3PGA1 4ONEA 1S9DA 3AR9A 3PENA 5FNZA 5CFNA 2R4TA 3GVPA 4ITVA 5ICFA 4W5RA 1XP8A 1C9EA 3D4NA 3ZDEA 3RU7A 1N1MA 2JAHA 3QKSB 5KSWB 3WIEA 1P0MA 1DELA 1C3LA 1SHZA 4L4ZA 2FRDC 1WMEA 4WN3A 3IOCA 3MJVA 1Q22A 1V3VA 3AEKB 4Z4HA 2DB3A 1ZD3A 1CBUA 3KFXA 1VJ0A 1ZESA 4PVCA 1T4GA 5BRAA 4HN9A 5JLJA 2PMFA 3HWSA 3ITNA 3D8RA 1CR0A 1VKHA 3WIBA 4EH1A 4F3NA 2ZWVA 5BVHB 3S8EA 3VDXA 5DIZA 1KBZA 2I7XA 3AR5A 2XGOA 4ZI3A 2H4HA 2QP4A 3FHCB 5P8WA 3UCEA 3RTGA 1YR7A 5HJ2A 3V97A 5JAOA 2NUTA 1S01A 1KAMA 2JI4A 1IDOA 2QN1A 2X2PA 3L0OA 4HAZA 4UUPA 2CUKA 2KE5A 1USKA 4GNRA 4QQ8A 3TIXB 1FXSA 3DXXA 1NBMD 2Q4OA 4M8KA 3VBEA 3N3BC 3O5AA 1MNAA 1QO0A 2ZRHA 3NWBA 5COQA 4EKGA 1P2VA 2P9ZA 3GNSA 3MGCA 4GRIA 4WXMA 4E2YA 2A1UB 3VSAA 2O8DA 1IN4A 5THKA 5F2EA 5BR8B 1NGSA 1GA1A 4JQZA 4J94A 4ND7A 1UJNA 4YNBA 4H7HA 5FUMA 4IQ0A 1VIVA 4Q00A 4F3YA 2ID7A 3M89A 4HWTA 3FCSB 4YRMA 3EWSA 1PUXA 4QO7A 4EL0A 3T15A 2CVOA 1P33A 4MVJE 5DX1A 1H9BA 4FFBA 2Z3WA 2R8EA 3HDQA 4JR0A 4RW0A 2FVXA 3MWEB 2O2EA 3GXOA 5EE9A 3T9BA 3TIIA 4DKJA 1NVMB 4JYAB 1KGDA 2CNKA 4B2YA 4D3YA 3HXPA 3IMFA 1Z7EA 2D06A 5BMVA 1EX9A 1L5GB 3ADBA 3QF4B 2QUKA 1V5EA 2YQZA 4D81A 3M82A 4DMHA 1E7SA 4HLUC 2QN6A 4MYDA 1EP9A 2PH3A 4EUEA 2JATA 2HQOA 3E15A 3F4LA 1EE9A 4IGIA 5C1BA 2GO7A 3F67A 5JAQA 1I0LA 3GAAA 4QEZA 1JR3A 2FZEA 1P0QA 1RPTA 4OKNA 1P1KA 1YBFA 3O8OA 5IN4A 1SHJA 2WF5A 1I3OA 4DJJA 4EY6A 2QUHA 5C52B 1DAEA 3DULA 5BO5A 4YP1A 3ZVRA 2ZRDA 3ZVLA 4DBZA 2AFIE 1VIYA 3RHSA 1NKSA 2FMHA 1P7ZA 1W7AA 3QFRA 2VWHA 3TFWA 2Y67A 3I1IA 4IIVA 3AVYA 1R0LA 3QRWA 1KDRA 4YC7A 2VWQA 3DL2A 4BO5A 3O4RA 3RSQA 4XWTA 1QH8B 1T4DA 1YB2A 3KQOA 2B94A 1U7UA 3NP7A 3KKLA 5JFTA 4OU4A 2XE4A 5HFAA 1NVVQ 1SXJB 2VDPB 3E23A 2QJWA 4R1SA 5DYTA 2E4ZA 4E3WA 1EDZA 3LUJA 3N2ZB 3BQNB 4GWLA 5AHRA 5GM1A 3CUTA 1GSIA 3BB4A 1PR5A 3ENQA 3KSRA 3AV0B 4M7PA 2PNJA 1R0SA 2FPOA 2DWOA 1VSUA 3R40A 1G9TA 1YE5A 1YQEA 2QRVA 3JQPA 2X1LA 1XQ9A 2JAOA 2CZQA 1Q7TA 2WPDD 2FKNA 4QYIA 1WMFA 4CU2A 3B6ZA 3ZBUA 4A2CA 4AQ7A 5IASA 4L5IA 3JR7A 1E1CA 2XNDD 3AIOA 2BMDA 2ZB4A 4JJIA 3A4MA 4MS4B 1BVYF 1QFMA 1JFVA 3NNNA 2IDKA 2PQ6A 2JJ8A 4P82A 1MAAA 3BIOA 3EBLA 1UAAA 4AF7A 2O57A 4PYJA 3QFSA 2BGWA 3P94A 1W581 1V7ZA 3EIEA 3SQNA 3TQCA 1T2CA 4JLBA 5JO0A 3ZDDA 3P27A 3C5EA 4OGKA 3NNSA 1RKVA 5TGZA 3AEZA 2B7BA 3VX4A 2IYFA 2H29A 2C3OA 5ER6A 3K9HA 5C7YA 3T52A 4OK6A 2PTHA 3L02A 4JEMA 5DM2A 1GZHB 1XAIA 1H2FA 4MYCA 2CHQA 1JLHA 1ZONA 2B4KA 4EJSC 1TF5A 4KFUA 4OM7A 1Q7GA 1DT5A 2ROQA 5DM0A 1HTBA 1S7CA 4D44A 5HSGA 3D1LA 3EASA 4RM3A 4B44A 4I6JA 1SCKA 3CJTA 4R7TA 5SZJA 2BZGA 2P7HA 4ZVVA 2GPAA 2HIGA 4OUKX 1P75A 1WUIS 1SXIA 2CN1A 3O7MA 3X3HA 5LZ9A 4LE0A 2QUBA 2Q2VA 4JJ8A 1J1UA 1Y5IA 1HYQA 4C2BA 2D7JA 1YB6A 4JOSA 3DQZA 3HJHA 3O1IC 1G4UR 1JU9A 1F48A 1P1IA 1H3FA 1UXOA 2GYVA 2W00A 3EISA 4WERA 3BK7A 4GGOA 4YJ2B 2XCTB 4BPBA 1LFDB 4MV4A 2FHSA 2ZETA 4J0KA 1R00A 4HGRA 5ALPA 4BLUA 3GLIA 1F5SA 1Y1SA 4MWZA 2P62A 5E1BA 3JZDA 3RFUA 4XCXA 2VPXA 3VHRA 3BH7A 3CVOA 2TECE 4J9VA 3PHIA 2G28A 2QLNA 4JJAA 5AHOA 2PZ8A 1H9AA 1PJAA 5HP4A 2O9JA 3RLFA 4C6HA 5B55A 1PNTA 4JDUA 4ZC8A 5GTDA 3JYLA 2WIBA 4BLOA 5EWMA 2P5UA 1ZVMA 2JD1A 3D02A 5BWCA 3AHFA 3PCTA 3UNXA 5BN3B 1P44A 3NDIA 1A5SB 3Q0TA 2OMKA 4NR0A 3L4KA 4OOEA 4CLDA 3FHLA 2X0EA 2BEUB 2X2FA 3QKRA 1ANKA 4GIBA 4OHWA 5ECYA 4B0PA 1H3EA 2I1VB 4TSRA 3VBCA 1N0WA 5FUWA 1P5ZB 3KUXA 2O5RA 3I04A 1L5FA 4Z0NA 1KI2A 4YCJA 2J6CA 2UUOA 4RD1A 1CNMA 3W78A 2YJ6A 4B2PA 2QTHA 2DR2A 4CVNA 2Q6IA 4MTCA 1FTYA 1IXYA 3KQLA 3C87A 3DZGA 3VH2A 4TTQA 2GAOA 2LWIA 6CHYA 3DE2X 3HKDA 2QG4A 2HT6A 2WPNA 2IV7A 2VF8A 3ZY6A 5GZ6A 3TTXA 4F2DA 4DRXA 2VK8A 5ALXA 5J2TA 5G0UA 4A8JC 1G8JA 1NPYA 3C3EA 1ORWA 1MNQA 3ZUPA 1DG1G 3I2KA 4HNSA 1JFLA 2UYYA 4HNRA 5JAZA 4Y30A 4CFSA 1XMVA 2XV1A 1Y1LA 4LFAB 2GHTA 3NEAA 3FOZA 5EERA 3DWGA 1X38A 4MX8A 4QICA 3IRUA 1N0HA 1XALA 2C78A 4UTVA 1P1JA 3NG1A 3P19A 1H8EA 1F6DA 1SKAA 5J5CA 4UNSA 5IULC 2ORWA 3CLHA 3UAXA 3TQSA 1PJCA 1ZIDA 1RPZA 3D2CA 4NPAA 5FXMA 1SMKA 1OIVA 2D1SA 2EF1A 1W46A 3AHCA 3KEFA 1E1QD 3K35A 3VU9B 4AUKA 1RIIA 4Q4CA 4YBRA 2O0LA 2G72A 2FXVA 4RENA 4BN0A 1HOTA 5AVUA 1U9CA 4W1SA 1UDAA 2ZANA 4XM0A 2KYRA 1KMNA 5KNCH 2II6A 2NU9A 4G2NA 4L4XA 3CF4G 1SU8A 5BR1A 1N7GA 3FDZA 1ZUNB 1ORHA 4WVLA 3JQGA 3T3OA 1S2OA 4D25A 3N76A 4FHEA 3VPGA 3AJDA 3M6IA 1LRLA 5FWAA 3PI7A 4PFKA 3NDRA 3ZK7A 2FOIA 2BMFA 4RY8A 3QOFA 4WOPA 1GVHA 2C8KA 1IE3A 2G25A 2IOFK 3OTWA 1MZPA 2NZ2A 3BMCB 3WLOA 1NSTA 3PC2A 2QSZA 5EIAA 1W4BA 1IEXA 1UKEA 4Y2RA 5JV5A 3AINA 5BP7A 1ODIA 1U0NA 3EY4A 1L1RA 4OFZA 5KTMA 1MJHA 1K7XB 1RW4A 4BNFA 4FMPA 5GM2A 4PN7A 1SQSA 2J0UB 3LBAA 4ZI2A 1CZHA 3IHKA 3GF4A 4XA8A 2Z8XA 1O97C 1HKHA 1T2FA 4IJWA 2X40A 4Q19A 4YJFA 2NM0A 3GLSA 2DLNA 3TYXA 2JLRA 2VNIA 5HZKA 1ZH2A 4PRZA 2B20A 4Z86A 1Z0JA 2IPXA 1DC6A 4YRRA 1GL9B 5CMLA 4HUTA 4AJ4A 3H65A 1MKYA 1R50A 1W5AA 2QZSA 3M4NA 5EFOA 2JFWA 2XCRB 2DXIA 3K5WA 4W6ZA 5J63A 3VZQA 4NJOA 1LBQA 3K8YA 4YJHA 2DFKB 2QRGA 4CJXA 1DWPA 3EFOA 2XLCA 3M49A 3JWHA 3KKEA 1Z45A 2HNBA 4CETA 5CDFE 5FBVB 1O7JA 1SD1A 2GJKA 3CC8A 4LSGA 4R2WA 2AR0A 3A58B 4ND8A 2O3JA 5ENVA 2CBXA 1KS2A 3DUFA 4K28A 1CV2A 1MH9A 1PD1A 3H2HA 4DLUA 4JB3A 5G0WA 5IAGA 1E61A 4F5DA 8ATCA 4CDRA 3K0SA 2JFGA 2F9MA 3FPEA 4J16A 3HBJA 1Z6QA 2VJAA 3CRVA 3FB4A 3KHSA 2XTZA 4K0RA 4OY3A 5F1YA 2ZUFA 3RAFC 2D2VA 1QHIA 2OBXA 1OHHD 3O8QA 4KGXA 2O2IA 3O90A 2HUNA 3OEYA 4WBXC 1YS1X 4YJDA 3VR3D 3QU4A 1Z0UA 2N0SA 4WK0B 1JI3A 2B83A 3WP0A 5FI1B 3M33A 4A03A 4EHDA 4Q9LA 4IG9A 3D81A 4FC6A 5AM2A 1X8KA 4MZDA 5EWLA 2A0XA 2ZE6A 3JVIA 4QQRA 3V46A 3I6YA 1VG8A 3D2LA 4RPCA 2ZTVA 2SCUA 3OAAD 4F8JA 3QKIA 1D1PA 4Z9AA 5DWQA 4JBWA 3HB4X 1RXIA 3CT6A 3LBNA 3PLRA 5LMZA 1SOVA 2IRWA 2HMVA 3JQAA 2ZXEA 1SVIA 4YJ2F 3RC8A 4UBNA 5IDQA 1S6YA 2QX9A 2QM0A 2W6OA 3I3SR 1GRNA 1ABEA 5DCLA 2V65A 1KMMA 1JHXA 2HJWA 4MRMA 3TR5A 3E8XA 2R8RA 3NB0A 1R4MB 3BMOA 2WZBA 5BVGB 2VDQB 4HDKA 1OWNA 1UOOA 2A7XA 4MDHA 3IAHA 5EYPA 4WNAB 4TVOA 3E3LA 1AGNA 2QEQA 4ZODA 3GJZA 5JXGA 2IE0A 1H2BA 4UNRA 5D00A 1PFYA 4B1FA 5G0TA 2HHHB 4CMCA 1IIBA 2NOAA 5AOCA 2J3IA 2RIRA 2X5XA 5IJ9A 3G5LA 3HXKA 4H1TA 5LZ2A 1DIOB 3TPCA 5A2QA 1TU4A 3EODA 3RR2A 3WGQA 3SY8A 1EK6A 3MQ2A 1GG8A 3BIFA 3KOZA 4FKMA 3ILHA 4HVTA 2W43A 1PV2A 4KR6A 2P3LA 1PE0A 1ZNWA 3EGOA 1D4OA 4HXEB 4TLBA 3TQIA 2W58A 4FNMA 4NQRA 1JHVA 3AOEA 4DG9A 3GOHA 3MUNA 4PONA 2V7WA 4RGYA 1E4OA 1Y7PA 2G5TA 3OP1A 1NWHA 2V45A 4YQZA 1X1EA 3JYHA 4RE6A 3UWMA 5I7RA 4QQKA 1EXMA 1OZHA 1L7RA 3K6SB 4R7GA 4V1CB 1TPYA 1DLJA 3H2YA 3UMCA 3ZU4A 2J5XA 2QW8A 2ZRGA 4I1PA 3NR2A 2FVYA 3B7GA 1EUCB 3PXAA 1FMLA 2JARA 1OOEA 5JJKA 4CIXA 1LZLA 2ECPA 1RPAA 3UT5A 4E70A 2IHKA 3REQA 4CTKA 4F85A 1KL7A 3QOXA 4AWBA 3UJAA 1J49A 1MJ5A 1JJAA 3CMMA 4R8MA 2IEIA 5EWJA 5TXGA 3WFJA 4D3DA 3ZJTA 4JBLA 3B36A 2WI8A 5F7JA 2R8OA 1QX3A 1J0CA 2A14A 3PUJA 2WJGA 4KKVA 2PR7A 2MYPA 3FR8A 3LA8A 5IWCA 2YTZA 2YN4A 1Y4ZA 1NRIA 3K0FB 3K1TA 4CCYA 1GPJA 3OQHA 2QRJA 3L93A 2QD4A 4Q3AA 4RV4A 2IFTA 4LF8B 3AXSA 3Q5DA 4XVUA 5HF6A 5KNBD 1CXZA 1AV7A 3JARB 5B7NA 3QMMA 1YWGO 3H8SA 1IVYA 3ELWA 3B8EA 4B40A 5CM8B 1AA6A 4PFSA 1KI7A 1T3ZA 3SOZA 1HE2A 3CRNA 2Z6AA 2PL3A 2JLCA 4DSNA 5DN9A 3G85A 4IIGA 1ZHHA 4KRFA 1JKJA 1Y3BE 2PGIA 3OECA 4L3VA 3EC1A 3ANXA 1UPBA 2AFHA 3FYCA 3MW8A 1QDEA 3TXYA 4JJZA 2LP4Y 1UADA 3ZKWA 1IZ8A 3NTVA 4RTPA 3FJ1A 3OT4A 4IS3A 2J3EA 4N3GA 4WESB 5EXEA 4PYQA 2QGZA 4D9IA 1PJBA 3BX1A 1BX3A 3LFTA 3D2BA 1TUGA 4GPD1 1DKOA 4IX1A 1KY3A 2N1BA 1T8UA 3DZIA 3GR6A 5L3RA 1AMNA 3DT9A 1EGVB 1NW9B 1YQXA 3RT9A 4W8GA 2Z09A 4I55B 3DOEA 4X3CA 4DYVA 1XV5A 1RYYA 2OCYC 1V26A 2NTNA 1U0LA 1RRKA 2PKCA 3CR3C 4TS4A 1X1CA 4XB2A 3ULKA 4XIIA 2ZRJA 3N70A 1K98A 1AKQA 1Y1KE 2WFLB 4L0DA 5AVOA 4MHSA 1U99A 1LBSA 5KX5B 1ATZA 1HQKA 2B2NA 2OUKA 2VJQA 3NWOA 4OGGA 3LLVA 4DV7B 4WWHA 1ZN9A 3H6HA 1RYDA 4YCBA 4XM2A 1Z16A 2CY0A 4LMPA 3FTQA 5AUOB 1YSCA 3WRVA 2BKAA 2ZYUX 1CRZA 5G53C 5FP0A 4EUKA 3PUIA 2J6HA 2QLBA 1XRJA 2BWJA 2Y99A 1C1XA 4QE3A 4D41A 1T9ZA 1BA3A 2JGAA 1NMQA 1QYVA 1XA3A 2WR8A 4HG2A 2ZVJA 1PWYE 1D9XA 1GV1A 1MG0A 2C59A 1G21A 2NNWB 1FDRA 4UAJA 3G0IA 1EFLA 4Q4DA 3TM4A 2R00A 1GQYA 4YUVA 3V80A 2EJTA 4MS1A 1JPVA 1KYIA 5BQ3A 1ZCJA 3OPYA 3QEJA 1CUUA 1QCCA 2EF0A 2JCXA 2PRYA 3GFBA 4G0YA 4AUMA 4BV8A 1WCV1 4YAOA 1PF7E 2OKGA 3VZCA 5CX1A 2RGAA 1D2RA 3MYYA 2OCBA 3UTCA 2YVAA 4C4OA 3WAGA 2XXBA 3AC0A 2UZAA 3TLMA 5LKRA 3AVUA 2Q0XA 2PGOA 5BOVA 4CYMA 3UN1A 2BC9A 1LI7A 2FWNA 3DV0B 3GCZA 3H87A 1UT6A 1G2QA 5CAEA 3ED1A 3INGA 4MWOA 2X2OA 2PX2A 2ZITA 1IZ0A 1TNDA 1L5LA 3QTTA 3W2TA 1DFIA 4I8DA 2LNDA 2XWJI 5GIPE 2QP3A 2ORYA 4NDNE 4ZJZA 1ULTA 3PNOA 3OKPA 3ZVMA 1A95A 1RR6A 1GPDG 2LXNA 3LTEA 2QY6A 1UQUA 3E22B 3BULA 2VQ6A 4UHHA 3ZH9B 2VPZA 2RCNA 3GLRA 3HSYA 3EXFB 1UFKA 4PLTA 5IKXA 2O1SA 1P45A 1XIVA 1ZVQA 4Q6WA 1TYEB 5HF9A 4ALJA 4DLKA 1ZZGA 4JSYA 4CQLB 1FTSA 1LJLA 1EEXB 1J7JA 2X3FA 3GG9A 3OHMA 4M0KA 1FSSA 5HF8A 1W6RA 5M3BA 4YX9A 1XEXA 1A71A 2GK3A 1FTQA 2QNBA 1WW8A 1JIUA 2DMRA 2P9EA 4JBHA 1TMOA 2HO4A 2IIVA 1QYIA 4KE6A 5H5JA 3MN1A 1N32B 2AFIB 2MJLA 4RA9B 1X13A 4A0QA 1MVLA 5C46F 3ES9A 4RZIA 1WBBA 1K4YA 1Y9JA 4ZEMA 4X61A 3IE1A 3DM9B 3HC7A 4NV0A 4I4CA 2RHRA 4OFWA 4O4JB 1RI3A 3T0GA 4ZGGA 2B99A 4F0JA 5IJAA 3PPVA 1Z0SA 4YMVA 4Z4EA 2HH9A 1H0RA 2ZIAA 2PUVA 2OR3A 3AYZB 4B7ZA 4LZPA 1J2JA 3UHPA 4LDRA 5ISMA 3TLYA 2Q2OA 4X62B 1J97A 1F4PA 1GTJ1 4H18A 1BX0A 4QJ4A 1U81A 4N65A 3M70A 2O7NA 1UBEA 5KS2A 3TTWA 3DZHA 1X1QA 4ALMA 5ALJA 2CNOA 5HQTA 4F9EA 3RT7A 1DUIA 1DDGA 3V8RA 1D2AA 1PRYA 4NCNA 5IF9A 4B3XA 2A5FA 3HHEA 1NUQA 3RSZA 4ZCPA 3IUMA 2VHYA 5DIFA 4H6PA 4P98A 4WDQA 4LDJA 4Y2QA 1NPTO 3IEPA 1CVIA 2HCRA 4YJKA 4BO7A 2NZ8A 5KTOA 3GP8A 2KW5A 1K97A 4DV5B 2Z30A 3K9NA 4HDCA 1S2IA 4HNAA 4JELA 4JROA 1KDVA 5TLSA 4KLCA 1HFWA 1YUBA 1AC5A 4HB0A 5ALGA 4FFOA 1RE0A 4KQCA 2FE4A 1X9IA 4WTOA 3VX3A 2Q7OE 3S8MA 2DH5A 1JBEA 1ADBA 4KU4A 4ZANA 1RDFA 4YDQA 1SQ6A 2BPOA 4BLWA 4Y2XA 3MJEA 1PNRA 1GTSA 3N2KB 2EGUA 1I51A 4YXFA 3EZLA 1AN9A 3QXSA 3BHIA 4UE2A 4YAWA 5AJTA 2NUBA 3V42A 2AIRA 1RAHA 2PLFA 3BL5A 5E4YA 4R1NA 3TKLA 4HV4A 3E3AA 4AB1A 4IKPA 1QC5A 2V5AA 3KZ1E 2JPDA 4RTQA 3EEQA 3I4FA 5D51S 5HCIA 5KSYA 1BMDA 1FP7A 3OZXA 4L6CA 1U02A 3DBRA 4MAAA 4J3FA 4XB6B 3BMNB 1ZCFA 3GFSA 3N9IA 3EGDB 4NU8X 3WNVA 2X9GA 1ZGZA 4BFZA 5ALMA 1E3EA 5CEJA 4IPTA 2AV6A 4G0OA 3F73A 3BIJA 1RSZA 5F1PA 1CVRA 4H7EA 1S7GA 1H5UA 1V48A 3ZD6A 2G88A 1T5IA 1G17A 2ZRNA 3OMLA 4LX0A 4IXTA 1V9SA 2NUAB 2Y77A 3VR4H 3PC6A 4RKFA 1HDEA 2O07A 4CKEA 4D96A 3AM1A 1Z06A 1MGOA 2PXXA 2QRNA 3BEOA 3H16A 4DM7A 1MA3A 1GUYA 1D0VA 2VP5A 5IAAA 4UMEA 2JK1A 1IOVA 1TKRA 5EY5B 5B1SA 3GNTA 3RTCA 4DV6B 4FJ2A 3ZGNA 1HKUA 3BXGA 4TYQA 4YP5A 4L9WA 2FRXA 3W5UA 1T9CA 3A9RA 4JYZA 1OWOA 1IY1A 3KUDA 2R6GA 4N7JA 2J5QA 4S1OA 1BTOA 1DXHA 1P4GA 2A0WA 3UJPA 3IQWA 4M8IA 3A4YA 4NEHB 3VKVA 4E1BA 3ZHBA 5KQLA 2WQ6A 2UZ1B 2LV8A 3AONB 3FF1A 2XX3A 1E94E 1LPPA 1S3FA 3DEAA 1AOXA 2IY7A 3QPBA 4I55F 2HHAA 4KXVA 1KI4A 3DVQX 2EHJA 4ZO7A 2OGZA 1JB1A 2XZPA 4IDAA 2BHLA 3EG9B 1JX6A 3LL7A 3M6LA 2FFRA 2OHHA 1ECFA 2Z0MA 3HACA 5ERGB 1QIDA 3S1LA 1UH5A 2QTNA 1WHTB 3HKEB 3JQ7A 4JHLA 1LTHR 5B53A 5KX5F 4TMYA 3O91A 3GJ7A 1J22A 4EF4A 1RI1A 3OI7A 3EXG1 3OIDA 1S96A 2MSLA 1Q20A 3I9NA 1BWSA 2JFBA 1RRGA 3S29A 3GLVA 1CRPA 1XQ1A 2MTBA 4HYEA 3P9ZA 2I7DA 1OZAA 2QUZA 2GCOB 4PXAA 2C57A 5KWVA 5E0OA 3VPCA 2WSBA 2ZCJA 4MHTA 5ED4A 5EJ2A 1AKUA 3M4XA 1SWVA 1OFVA 4KG7A 2J0QA 4G4IA 4HT3B 1XKTA 2GTIA 3HU3A 3MT0A 4MB6A 1BHJA 4MGEA 1IBLB 1HYGA 2PTGA 3KQQA 5H0IA 1AZTA 2GI4A 2YDXA 4QM7A 4RMIA 4MRNA 1J2TA 4HLCA 3ZXXA 5JANA 1AB5A 5FNVB 421PA 3KQHA 5AVKA 4LHZA 1ZPDA 4AKSA 1VCHA 4KI0A 4PV7A 3OCZA 5L53A 3ZDCA 4XKJA 3CKYA 3RB8A 4GI2A 3ABIA 3I76A 3K9FC 4BECA 3CX6A 3OZWA 1VG9B 4MVJF 1N92A 3LLCA 3W1VA 3NC1C 1CHDA 3DJYA 1SUBA 2J3LA 2IS1A 1H65A 1YMUA 3LDUA 4WLNA 3PXEA 3T3DA 1K89A 1R4AA 4UPVA 2V6BA 2MT9A 3L7NA 5FPQA 2UYCA 2C5AA 4LCEA 1NJGA 1Q16A 5CH8A 2BLNA 3AVOA 1DKLA 4B4VA 5BQOA 1QIGA 1F6WA 1ZL0A 4TLDA 1O95A 4X00A 3OX3A 4CDMA 5JWOA 5EINA 2JJ2D 1TKBA 2GXAA 2O4CA 3TLKA 1A88A 3ZOKA 3COVA 2GPSA 1NI5A 2DVMA 1SBQA 3D3JA 1IY0A 2PE5A 4K9SA 3HLTA 3F5MA 2BMWA 4EG3A 4MRPA 1ZY2A 2DTDA 2Q9UA 2X22A 2W2QA 1T6XA 4G0VA 4F21A 4E4RA 4RULA 1S2DA 4NBWA 4PX2A 2FPKA 3SBDA 5JR3A 3BCHA 2P77A 3EIHA 3FFBA 3F4KA 2R8PA 3IDFA 1WP4A 3LBIA 1XTQA 3PFBA 1RQRA 2BMEA 3F8SA 4P80A 4DR3B 4IYJA 2HIMA 4CM4B 3AL0C 1ACJA 2OZLA 3H8VA 4G63A 4TKVB 1U7DA 2J5KA 3WKCA 8AT1A 3ZGZA 1QHGA 4DLRA 5EHXA 1QCYA 3JTEA 3OESA 4GPEA 4MMYB 5TS3A 1JEQB 4O0MA 3UHFA 8ABPA 1YRAA 8MHTA 1MPTA 3IAS6 5KWIA 4LC9A 4OAOA 1WOYA 3IA7A 4LYHA 3HR8A 4QAJA 1MXHA 1QJCA 3CSSA 2FN9A 3TQFA 2A1TR 3OZRA 2R5FA 3IO3A 1XRQA 1GOTA 3S6JA 1FA9A 3CFYA 4BWYA 5JC8A 1L4GA 6ADHA 2R0QC 2R6JA 3DZ8A 2C4WA 1JLSA 3HYNA 2ZIZA 2YWXA 3DBHA 5LQMA 4K6HA 1RVV1 3GWGA 2X4IA 1ORTA 1Z83A 1RS0A 4FLFA 4G5QA 5C4IA 1LLCA 2QD5A 4EA9A 1HT0A 2LZ0A 2WG1A 3JWIA 1KP3A 4R3NA 5U4XA 4K0KB 1TYBE 1E9VA 3EXAA 5KDOA 2N42A 4YCDA 2D5AA 4K5QA 4NBRA 5DLPA 2HW8A 4O3FA 5E7JA 2GVZC 4S2EA 1LWNA 3HUTA 4IDPA 4Q66C 5FA8A 1I7PA 2EZUA 1T6NA 2QENA 4I5IA 1A98A 3H5WA 4PCAA 2W2LA 3RROA 3UJ3X 4YUAA 2QRZA 5KIAA 3GQBB 5JMTA 4B2LA 4BB6A 1NXVA 1ZIXA 2OFWA 3BGSA 5FHQA 1X9HA 4MUMA 4CMKA 5IJ0B 5DN6A 1PI3A 3LPMA 3O4JA 1YQGA 4TN5A 1FLDA 4ZO6A 1PZHA 2NZVG 1K6MA 1PAUA 3AHEA 3Q9SA 4GOJA 4JJGA 4WGGA 5AVQA 3LFHA 4Q3NA 5ITVA 4KSBA 3A6HA 3PVZA 4YTEA 1KVQA 1CERA 4BVFA 4ZCMA 2GLUA 1KZ7B 3R6DA 4CL8A 3AUXA 2F1KA 3BJIC 3IV9A 2V4UA 4NHEA 4RQAA 1PEDA 1PVDA 1BXGB 3DBVO 2A5JA 2GJSA 4G5SA 1QIJA 2TYSB 2ZEJA 2P78A 5EXSA 3WFIA 2H08A 3TBHA 3K1ZA 1CD5A 3ER8A 2FETA 5DHUA 2YR0A 4WNYA 5LZ4A 1M6VA 2VBCA 3ZTYA 3EBPA 2R4UA 3LT0A 4NOJA 1NZJA 2WU3A 5E4FA 4B3FX 2CLFB 1G60A 1UXGA 5IUKC 1CZKA 1E0SA 3Q3HA 4YRFA 1SU7A 4ZQEA 4YHHB 3R3VA 1LRKA 2BZSA 3LQ4A 1KFJB 2R2GA 1JL3A 1NASA 4BZWA 3VJKA 5TDHA 1JTVA 3L7LA 4N9WA 1RMTA 5HCUA 4AZWA 4D42A 5JCXA 1IB6A 1SAYA 1UANA 4HGZA 4JI1B 1SVUA 3U7IA 1DTWB 3UJ8A 3VHLB 3WYAA 1MORA 1OGIA 4GG1A 1FFEA 3C3CA 3NBAA 2VDVE 5DBIA 3KYDB 1B1CA 3BH6A 5BYBA 2ZUUA 4BNKA 1QUEA 1RRCA 1NR5A 5DYIA 3ZUGA 2BFFB 5SICE 3BREA 1OAOA 1U0GA 3H86A 4EPYA 2XNKA 1NP6A 2RGNC 1J5XA 5JNSA 2VSNA 2FN7A 5IJWA 1BVUA 2M2IA 3WL6A 4X7RA 4PAOA 3RAPR 3H3JA 3R5JA 4XIYA 2H5JA 3I58A 4WXHA 3LQ1A 4LY3A 4RDHA 4ZIRA 4BL5A 1JV2B 1IL0A 5JSFA 2KB0A 3RFCA 1Y89A 4HH0A 4XUDA 2ALJA 1CEQA 1LFAA 2GEVA 4KMSA 5HBRA 2JK0A 3C3BA 3WLRA 1VGQA 4BV9A 5JNLA 1LBHA 2YN2A 3T4PA 1T8YA 5AVZA 1XCLA 3C5VA 3RAEC 1Q7EA 2J5RA 2NV6A 4BXOB 5JQGB 4D3FA 2BEKA 3WHKA 4ZQFA 3D4IA 1BFDA 4TV8B 5TQJA 4YIHA 1A8IA 3SOPA 3D9QX 1KTIA 1I4EB 2H59A 1P73A 2H1VA 2ODBA 1KU0A 1NXPA 1RU3A 2B34A 1BDHA 2ZQ5A 1YGYA 5JJIA 3FYTA 3F1KA 1O8CA 2R11A 5GONB 3FFAA 2TMYA 4YROA 3GWZA 3T9DA 3IKVA 3THRA 2OXCA 1P31A 3ER6A 3KKQA 1Y7HA 4IMRA 3ELDA 5EMHA 5IDWA 3LFUA 5G1NA 4AM8A 2AD5A 4B47A 4GC5A 4CMIA 4UXHA 3KTOA 4MS4A 2Q5QA 4FPXA 3E03A 1KYWA 4JWKA 2VAPA 2IHBA 1XJ0A 5G3YA 1DP4A 1IZZA 5TE9A 1ESMA 1XYVA 4UNQA 5FNVF 2X0FA 4I3HA 4DNPA 3LF1A 1ZUIA 3FAZA 1ZRMA 3LZ6A 4DV4B 3F6PA 5ER9A 1XTPA 4YUWA 4NIMA 5J2UA 2BL4A 3NXSA 1OF1A 2PZEA 4LV5B 2ES4A 2QAGB 2YFQA 4LPSA 4EOGA 1T6ZA 3OZBA 2NZUG 4HAYA 2ZSUA 1Q21A 4ZT4A 3B9PA 3CBGA 3GT0A 3AEQB 3N58A 4C3UA 4FMDB 3SZRA 1H1LB 4ZDWA 4RORA 4G5HA 1UK6A 4GOKA 1G8HA 1ZCBA 1SUAA 2R1UA 2O2XA 4S1VA 3VC3A 1Y5NA 1YVRA 4Y0VA 5JSKA 1W2WB 1ELOA 2AI3A 3I34X 3Q2IA 3V8VA 5L3QA 1KJ9A 3NWPA 3HXMA 1MQSA 3HMQA 4B4WA 5FPHA 2NIPA 3F3YA 3Q10A 1G38A 4LYDA 3CUYA 2YFHA 2VRWA 1PR6A 3TJZA 2MSCB 2PZAA 1MRSA 4YRBA 3MMZA 3JQQA 5EUQB 2FPGA 2EW8A 2IPLA 3I9LA 1P0FA 3EZGA 3N7AA 3X43A 4C0KA 4NCBA 4DIFA 4FFSA 4YT2A 1Q0TA 4JGGA 5JJLA 3PU6A 4YREA 2I78A 5E7IA 2RD2A 4P0QB 1NRWA 1FRVA 4OH1A 4JI6B 1DJLA 4O33A 4LZNA 3KDAA 2WWHA 1Z22A 3N3AC 3ZHRA 1D8TA 2GXUA 3ILYA 5JZSA 3H75A 2OOSA 2IZOA 4GMFA 2X9QA 5CLIA 2POCA 4HTFB 1JRLA 2WUFA 2C97A 4HNQA 1X1TA 3GLHB 3NLLA 4JI8B 4E03A 3IXLA 3A4IA 1JIVA 4UHJA 2DE0X 5FL7D 2VJBA 4FKZA 3TLZA 3EDOA 3KUKA 2NU8A 2PJDA 4KTTE 2QPTA 1SC3A 3OX1A 1R37A 1XF9A 5KAPA 1GUBA 2J48A 4CDNA 2WMDA 4YV7A 5EHGA 1XTKA 3DOOA 3TF5A 3TNFA 4JENA 3WWDA 2Z2XA 4I08A 4CM5A 5HKKA 4DV0B 2C00A 2DBVO 4W1RA 3CEAA 4OXQA 2P4UA 1NN3A 1P18A 4RVHA 1T2NA 4JFAA 5JW6A 1GGVA 1I4LD 3CNBA 4ZVRA 3NHAA 1TK2A 5GGXA 1ECCA 1PDWA 3CJRA 3TPZA 2VPWA 3UC9A 4Z4QA 4E08A 4Q37A 1QOZA 2COEA 2DG2A 4NYIR 3FHTA 5DW3A 3O3CA 2JGNA 2Z8YM 3C43A 2HHLA 2KSQA 4RVFA 3V4VB 3VTFA 3RVKA 5NLLA 4BO1A 2BHSA 3KLOA 4G65A 5ALZA 5CK4A 2I34A 5E6UB 1B6SA 3P2KA 4OG2A 2CV2A 3PUYA 4CNBA 4F06A 2AZXA 1GL7A 4A8HA 3OEED 5D84A 4RD3A 3D4LA 3E6AA 2RSLA 3P0FA 1CQIA 3HZOA 2EL7A 3HUEA 2JFFA 3CCBA 4I14A 5EJGA 1ZMOA 5FOQA 4JGBA 4GUDA 5KNCD 5BW6B 4EQZA 3PFKA 2VHUA 4FYXA 5FBQB 4EUHA 1RABA 2O3UA 5IT4A 1USVA 2XYRA 4KK3A 3SVTA 4D8TA 1WB9A 2V6JA 1SBCA 3GEGA 2XB2A 3NKLA 3K6RA 2OFXA 5DTMA 4KO4S 2XUHA 4J6EA 1PGQA 4WLUA 5DKFA 3JYNA 3I2YX 1W4ZA 2QIPA 3QHAA 3HWX1 4YO7A 1NQTA 3HJGA 2Q8QA 4E22A 1NLMA 1CRLA 3NQ41 4PGGA 4UVHA 5DOZA 1SIWA 2G6TA 1Z7GA 3IEMA 4FDLA 3L8EA 4GOXA 4J0GA 5BN4A 3SSNA 2FRVA 2OC4A 2RGYA 4D9CA 4B5KA 2NO6A 1E0JA 2WYVA 2C3MA 4DDUA 5A5DA 5JBNA 2OHIA 4QHSA 4ZP1A 3QPAA 2XF8A 3A3YA 1CUHA 1SA0B 3ETDA 4B17A 3EEOA 1YBVA 2FH5B 3TAHA 3Q7EA 4YMGA 3LC0A 2PKRA 3UFBA 1WQ1R 4HI0E 4Z8XA 4V39A 1LD3A 4ND4A 4D0GA 2XE6A 1UWCA 4RJLA 3NHUA 1GUZA 3IQDB 1W5SA 1X8LA 4N7MA 6PFKA 3TB6A 1ULZA 1LLDA 2AEMA 4H7JA 2F17A 3KT6A 1II8A 1KEVA 5BYAA 3BIWA 2HRQA 1JKXA 4MR8B 1LDYA 1HETA 1ZK0A 2C96A 3HDHA 4K2HA 1SVOA 5G4LA 2JI9A 3FTCA 3WIOA 2BH9A 1G7TA 1R0ZA 3V4OA 1ENOA 3OEHD 1KVTA 3LW8A 4Q9AA 5C1IA 2X6QA 3A9TA 4JX9A 1X92A 5AXDA 3VO1A 4TLLB 3FBTA 5EJ6A 3MIZA 1Y4SA 3KPUA 4TXNA 3EPJA 1KIAA 1C3OA 1FUYB 3KKNA 1KBOA 1CQPA 3ROFA 4EZIA 1DKUA 4M1OA 2FPLA 1LI5A 4TQAA 3I1JA 1GGHA 2OESA 1Y3AA 1EAYA 4FSHA 2HSZA 4HLQB 4Q3LA 4TV8F 3LCMA 4YRPA 2ADFA 2EW1A 2KBFA 3KKMA 4G0PA 2PJZA 1RAGA 1STOA 3CWCA 1J25A 2C2KA 2FDRA 2IP4A 3L1IA 1JQBA 3UJCA 3H9CA 2R1TB 3UEOA 1R8XA 3D7MA 5GONF 2D1RA 1D07A 4EY7A 4EJFA 4ZI7A 3VSDA 5GZ3A 4XEUA 5EMMA 4IMJB 1NVTA 1QXSA 2ZATA 4QPJC 2B78A 1DWQA 1YAHA 4XJVA 1K6EA 2PQ2A 4FIZA 1C30A 1O6FA 3I01A 4XX1A 4YACA 3U4MA 1BJKA 1E60A 2GF9A 1VMAA 3A36A 3ZX5A 1L1QA 4L07A 3CB2A 4QAQA 3EDRA 4H59A 4KW7A 1M1NB 4ML3A 4D4IA 1AV6A 1KQNA 4AJPA 3NPMA 2OO5A 3W06A 5F3RA 3L1UA 4FILA 4ZQGA 4DVJA 4Q21A 1F51E 1FYWA 1T43A 2H52A 2H3EA 3KWLA 3EIUA 1Q6YA 3CUEF 1V3QE 1CUGA 3O94A 4Z0TA 4AG6A 4N5IX 3CKKA 4B6JA 4NBNA 2C4HA 3T5GA 3G88A 1K2VN 4OMCA 2OXTA 1OBFO 2B8JA 1XLTA 3ORHA 4IQ4A 3BAFA 1JIIA 3F49S 4M7OA 3UMGA 4Z1MD 3DTYA 3K16A 2CLDX 4XM1A 1E3WB 3ZLVA 4BQFA 2JFXA 2JW5A 3BT7A 2GO1A 3NRCA 1GEEA 1J99A 2I6UA 3HYSA 1HNZB 2IIPA 2RDMA 1UDWA 1ABBA 3QX3A 1H1TA 1UPFA 1XT6A 2E6UX 4NH0A 4DM3A 2AQIA 4LGMA 2WK1A 2PQ0A 1AQNA 2DBQA 3ESQA 4LG1A 2O3TA 3A3PA 5FFMA 1VI6A 4L5BA 4AMUA 5C81A 3CZAA 1YTUA 3P2EA 1O57A 3P4YA 5TSDA 3JD4A 4GP7A 5FR2A 3WLTA 3GP5A 4EW3A 2HGSA 1L7QA 3NMUF 2Y4OA 3ELYA 3A1WA 1G7SA 3M2TA 3MCVA 3R6TA 1LSJA 1FJGB 2JGJA 3D3WB 5AIAA 3UUGA 3AETB 3KOYA 1DXOA 2TMDA 1YHNA 3BE8A 1NJ5A 1ZJJA 2IQIA 3QA9A 4MARA 5GWXA 5AICA 1WXHA 4GX5A 3HVJA 5AI4A 4XFJA 3EF0A 1X86B 4IRUB 4NABA 1SUFA 2QQEA 3BGDA 3NYWA 4J7UA 3RG8A 5LXTB 1RYZA 1THZA 2FX3A 1YS6A 1FNBA 4LHXA 5GAJA 2WEKA 2I6FA 3UFXA 2MOKA 2WILA 3MCWA 3OE1A 2GEFA 4C7KA 4GAEA 1WCIA 2I3GA 4LHVA 5BNIA 1XZBA 2VUHB 5EIWA 2JGFA 1QZZA 2O2CA 5GV8A 3FOEC 4PG5A 1X7XA 1IMJA 3R0QA 4K26A 1N9GB 2WTBA 2NZWA 1PR4A 2IXAA 5EC8A 5LJLA 4NJEB 2C0QA 3OU7A 1XCBA 2ZB8A 1WPXA 4L8WB 2YJTD 1SOAA 1TO2E 1I2BA 2OHOA 5A71A 3SM3A 3VPFA 4RDXA 3BGIA 4Y6OA 2XMDA 5C8VA 1USGA 3I5AA 3SG0A 1UC9A 4Q7MB 4OJNA 1T34A 4GGMX 1FY2A 1N9ZA 5DTJA 2VHTA 4ZXFA 4EDFA 5FDFA 5EPOA 4DC1A 1U2GA 2IXDA 1D2CA 1UPXA 5L9AA 2FPPB 1XQYA 1TVMA 3BJMA 1WDKA 1A9OA 1AGRA 4TMZA 5TEVA 4MUBA 4M0FA 4H1VA 4FOPA 1SCAA 4MQBA 1O77A 3FUUA 5CGZA 2DR0A 1EU1A 4MJXA 4GPTA 1C1DA 2P4HX 2C9YA 2UVPA 4RHFA 3HJFA 3IP5A 3FW1A 4H1HA 4MCAA 3EXEB 3W6NA 2IHYA 3EAGA 4FJ0A 2XWQA 2H2HA 3WQRA 3O0TA 4FI3F 3UTDA 1YJCA 1R27A 3AKCA 1GZUA 3T7AA 4YMTA 1BDIA 2JCGA 5KYYB 3LD9A 1L8AA 4GL4A 1JBKA 2IZ1A 4EB6B 1G3QA 1KEZA 5DGHA 5FWXA 1Z74A 1OLSA 1WR8A 2L17A 4QOSA 4C4ZA 2JD2A 4WK2B 3P8ZA 2COKA 1P29A 4RTRA 1PTKA 2CHVA 1F12A 3DE3X 3EOBI 3IT0A 5J9FA 1UODA 4Q47A 4DB4A 1X39A 1AK9A 4XWWA 1JFRA 1HZJA 1SBNE 1Q84A 2WYHA 3NJRA 3PNQA 4DABA 3CWQA 4EKYA 3DBOB 2ODPA 1MO5A 2OL4A 3V32A 4EVSA 4ZOQI 1GAXA 5AW6A 1MOZA 3R76A 5T3YA 3ZWQA 1J8MF 3GLGA 1I1NA 4D97A 1AG9A 2P65A 2YHIA 4B34A 1NVVR 4DLVA 2JFVA 1OA0A 4R01A 3IEVA 2H06A 1SHUX 1TVCA 1WL8A 1E9RA 3QELA 4RF4A 1C50A 4KAFA 1QYWA 1W4RA 5EESA 5AVJA 3GY0A 1UJ4A 1EJ0A 3GROA 4FCWA 4W7SA 5LB2A 4DCNA 1LPNA 4O4IA 5EP3A 3KQPA 4F2GA 1JFFA 3MC1A 1AZWA 2QRMA 2AQHA 3CCCA 1SZCA 1FFHA 2W93A 3EH1A 1OYYA 3WGMA 1SXPA 1JIKA 1HY3A 3BILA 3PJFA 4G4SO 3A9CA 1T9GS 1QMGA 4KQKA 3VYTB 2N46A 3LPCA 5JPIA 1KMHB 5HQ3B 2H85A 3QXHA 2PSJA 2XDYA 4G9BA 4YDRA 1IXSB 1XQ6A 4YQFA 2H2AA 1P7CA 3SJBA 3IB3A 3OICA 1Z2OX 5IHXA 1VE1A 2AGVA 4JDPA 1T4CA 2PHZA 3B7WA 3CNQS 3CRRA 3GJRA 1XTBA 2PAAA 3CZ9A 2QTRA 1XYGA 3DJFA 2YV5A 4E3ZA 3DL4A 3GJXC 1NFQA 4DMRA 4BNHA 1NW6A 2C7BA 2E4XA 1D4AA 1IXRC 4P58A 5LBUA 4B79A 1UBHS 4RK6A 3ANMA 3UHJA 1X3SA 2PAFA 4DJEC 3IEXA 3RU9A 4RSHA 5JDIA 4NEQA 1KEEA 2IW1A 4MV8A 3E3NA 1UL1X 3R75A 5I7VA 3HTXA 2BFDA 2FR8A 2PUFA 4TMFA 3HCBA 2GBLA 3ZV4A 1VHDA 3KOMA 3GAZA 1E58A 4JIMA 2ZZKA 2B4RO 3SF8B 4IOKA 1FXWF 2PA0A 3QJGA 5ECWA 4PZZA 3WYDA 1ZICA 3H7IA 5D01A 3VOTA 3GH1A 1TGYA 2A7QA 2PMWB 3ZWKA 4ERXA 5KOHB 4YJGA 1E79D 2C1XA 4RPLA 4ZV9A 3RS2A 1BS9A 3T4UA 2BGGA 1I5OA 4Q15A 1UBFA 2OKCA 5I9BA 3M9WA 3SQXA 1JJVA 1KZ6A 3IIIA 3GT4A 4KK4A 10MHA 1G6Q1 3OT5A 3VR2D 2YY5A 3BH0A 4IBOA 4PICA 4TTSA 3U4DA 5HJEA 1NQVA 4XCVA 4Z4FA 4FZ3A 4RD0A 2IVZA 3PIIA 2ID8A 4UVGA 2FUNB 1LCIA 1GLNA 3CTMA 1SUEA 3LGSA 4H15A 4HH3C 1YQUA 1TC1A 2GJ8A 5M29A 1AKNA 4NICA 5AI5A 1JLMA 3IUQA 4BNJA 4H27A 4D9HA 1V2HE 2ZS8A 4DSAA 5A4FS 5FL3A 1EX1A 2WM3A 2HMYB 4R9UC 4AROA 4A3SA 1YXMA 1SIUA 1T2VA 4HYTA 3O26A 3R41A 4WKNA 3W2HA 4AYXA 1JR3D 4GZ6A 3S81A 1RHKA 2XMPA 1EFRA 1QHHB 1Z0DA 1AXGA 2ENUA 3QFHA 1ZQ1A 1YCGA 3F96A 5I7SA 4Q9IA 2LUOA 5ICSA 4JT2A 3A4LA 2WQ7A 1EK2A 2GEDA 1ZWLA 1LBTA 1JA1A 4DIUA 2RI1A 3BE6A 2D8AA 3P9YA 5K99A 4D0RA 1DGQA 4MUFA 2EQAA 3DEZA 2OE2A 4XVHA 3GZNB 3W8NA 3U3OA 1W1IA 2CD9A 4FI3C 5LXTF 4B6OA 1ODJA 2FZ5A 3CW8X 3I8XA 3L4EA 3OOYA 2GASA 2QX6A 4HQOA 4K9LA 5TMPA 5HRUA 5KYUB 2ZULA 1A7KA 1GAQA 1WNTA 2HCTA 3FUVA 5FADA 3EOAI 4DDVA 4BX0A 2Y8EA 2HLDD 3D5EA 4Z4IA 1U6JA 2FPIA 1WM1A 3KR0A 3TSCA 2BCEA 1T9BA 3FYUC 3AUUA 2R2AA 3E9NA 5B3JC 3V2HA 3AFHA 4HMQA 2CCJA 1L5NA 2NT4A 4RJKA 2C54A 5AW1A 2PUBA 3DDSA 2ZVDA 2JF0A 1AK1A 3W6UA 3UGJA 2HWYA 4JB2A 3PHHA 1LDBA 4NJMB 1UMDA 4FLEA 2UYQA 4GX1A 5LYJA 1KEKA 4AS1A 1JE0A 4CTOA 1G6HA 3FOBA 1LWOA 2B0JA 2G8NA 2VNAA 3IODA 3OE4A 3WP1B 4EI8A 1XZ8A 1E5TA 2CHEA 4MDFA 2WE7A 2HX1A 3SLGA 1Y0BA 2IEGA 1NUUA 2MSNA 4YRGA 5BOSA 4LYYA 5HG0A 1CUEA 3KIPA 3OT1A 1DV2A 1AKVA 4MIKA 5EJFA 3TAUA 3DC7A 1XZKA 1CPYA 3CG0A 3OE7D 1EDEA 1P4AA 3K2QA 4KFRA 4RK7A 3MS2A 4WKBA 3U3XA 3ECCA 5DNYB 1ISSA 3U56A 2DQ4A 4ND2A 1PS9A 2RG7A 1WZEA 5FBLB 3U4HA 3T5PA 4TYMA 4WXRA 4HDMA 2DGDA 4KCGA 1XD2A 3WMRA 5HS4A 1YK0A 3HM9A 4G89A 4KXFB 4NZOA 5F4ZA 3HCWA 3NDBB 1RM4A 2RBEA 2AG0A 2IVFA 3EVBA 1K0UA 2CHFA 3IQGX 4IMIB 3CRW1 2RKOA 1V8BA 3GDHA 1KAEA 3GH3A 3JALB 1ZK4A 3HZZA 3K1JA 3LW7A 4IMPA 4X0EA 4F7DA 5JQGA 3I8OA 3UMYA 1F2VA 3LX4A 2KPOA 4HDSB 1CS0B 3I23A 4MPTA 3A2LA 4CNQA 2X3YA 1LH0A 1X7WB 2PANA 4IL5A 4FX2A 1TLFA 3IIKA 3U1VA 2RHLA 2WVGA 1DBVO 4HDAA 2WHXA 1Z8FA 2SKDA 3LZCA 3QOWA 1T2AA 1UIMA 2JEZA 4M9UA 2HNKA 5CURA 3SJAA 2ZJ4A 3WYFA 3B13B 5KSOA 3QE9Y 4GKKB 1N5DA 2V7PA 2CFOA 1Z47A 3P1JA 3N07A 3SVLA 4HLUA 5B58C 1OH8A 1PVOA 1GA6A 3MJRA 1ECPA 3LBHA 4L28A 3OZTA 3LWNA 2WNIA 3CX4A 1SH7A 4OXRA 1GZ4A 4Z9YA 1V16A 4EUSA 3RFTA 3NT5A 3DTVB 2SICE 3WWCA 3CNNA 3EQ8A 1SUCA 4D7AA 3B38A 2C94A 2GOYA 1P81A 1J1ZA 3V8QA 4IVNA 3ZDXB 4X45A 1G98A 3QE2A 1EIZA 4CHTA 2PVCA 1RM0A 1X19A 4Q4AB 3UT6A 2HUPA 4RLQA 5TEWA 3R5HA 1AF4A 1ICEA 1KAGA 2GS9A 4N3BA 4F6LA 1T91A 4KR3A 1FFSA 1QG0A 3GJ3A 3AUSA 2CL6X 2QYTA 1YZNA 4YB8A 2W2KB 1ND5A 3DKKA 2ZBVA 3MBIA 4R31A 1ZCAA 1TF7A 3M9LA 4QUKA 3F2VA 3P9RA 3UKDA 2EDCA 5ULLA 4CM9A 1AQLA 2Y2UA 3DOFA 3ZCTA 1KERA 4I50B 4ZVTA 4EITA 5K8IA 1OBCA 4RA6B 1R8QA 3H2BA 4J1SA 1O96A 1V8PA 5D5PA 2BISA 2HU7A 2JFNA 2NU7A 4FZVA 1U1DA 5EHIA 4C88A 4O2RA 5IANA 4RL6A 1V6CA 4QTUB 5BSMA 721PA 5M7EA 1ZW1A 1DKMA 4DR6B 2WHPB 4N18A 5KKAA 2X5JO 4L6IA 4TTPA 1YNSA 3ZDYB 4QU8A 2QLMA 3E8MA 5EZYB 2R1ZA 4TZ0A 2YS7A 3KYIB 1FFGA 3UATA 2AX4A 1WKCA 4F60A 4JBGA 4WKPA 3S4YA 1G7CA 5DPMA 3RC7A 5K09A 4B46A 4J7AA 2C4MA 2PRKA 2XYVA 3GV0A 1DAPA 1JHOA 4N54A 1FJHA 3NBFA 3QE3A 2AYYA 3RSSA 2CMGA 3UB2A 2Q3FA 3VDRA 4OYHA 4AW9A 1ZL2A 2IOYA 4ZGWA 2O8BB 2R8YA 4QUAA 4GBGA 1EUZA 2YQ5A 3JPWA 3P0EA 4HQNA 3U7QB 5KNBA 1E8MA 1M76A 1K8QA 2Y92A 3BC1A 3O7WA 1AKTA 2QMQA 3QIAA 4ZU1X 5H16A 2MCFA 1N5KA 2J9YB 3DDUA 3ELUA 3IJEB 4CG1A 4NE2A 1ENYA 5CU7A 5IZCC 2QQ5A 1XFDA 3LXMA 4DY4A 4EJSA 4DS3A 4A8TA 5B5SA 4CKBB 1BGVA 1C7EA 2C77A 3T9FA 3CHYA 4C0JA 4KNVA 4ER3A 1ODTC 1UBMS 2JC3A 2X8LA 3EW7A 3LHKA 3OU6A 3BEDA 5L7TA 2AOXA 3KTAB 4MKXA 1P8AA 1RTKA 4LI0A 4G97A 1PWZA 4OUDB 3IELA 2XB4A 3TW0A 5CDUA 3IX7A 2E5LB 3K31A 1JEDA 3VAYA 5K4GA 2YIVX 1GSAA 1SQGA 2XDWA 2V97A 3DFKA 3M1LA 1XGKA 5A4DA 5JT1A 3K0AB 1I7LA 2DWCA 2VYVA 4P2GA 3MAJA 3WWPA 3ZHOA 4CW7A 4DLWA 1U5AA 1B0ZA 1NMXA 3N8KA 2UVDA 3ZHZA 3BD6A 2IP1A 3HSKA 4IV5A 2PXHA 3H5RA 5E8RA 5BSFA 1OGJA 3IAM1 1OZFA 2Q3BA 2V9CA 3Q1KA 4E30A 2P0EA 3D7KA 1OXSC 3HH8A 2ZSJA 1CIPA 4A73A 4LF9B 3S1AB 1ZOLA 3SEZA 4HL6A 5D5HA 5AVTA 1XO1A 1AKRA 4DCTA 1OASA 3S2YA 1QTIA 4FOOA 16PKA 3MINB 4RVDA 1VB3A 1DBWA 3LPAA 5HK8A 3H3XA 3BAZA 1XWIA 1HWYA 4HRYA 4IF6A 1Z3CA 1VLMA 1BCSA 4OHCA 1ABFA 1X80A 4DNQA 3QEMA 3O21A 5IG2A 1XTSA 4NYJQ 2YDYA 3LTNC 5JVDB 3FSRA 3BS4A 3V9AA 3TTTA 1HX7A 1UCFA 2X7JA 3B7PA 2ZJ1A 3IAM6 1QBGA 3ENVA 5KC8A 3HXQA 1IN1A 2OV6A 2R60A 5AW2A 3UGKA 3KSMA 1A82A 4MINA 4NWIA 2OZVA 4NFHA 2A58A 2BOVA 5C34B 1JSZA 1Z9BA 1NJSA 4CG3A 2BV3A 2JCVA 5BNTA 2GXSA 3EA5A 4OQNA 4Y0AA 4V0OA 4PSCA 1CP2A 3RVOA 3QLUC 13PKA 1DRUA 3M6VA 1L3IA 1YASA 5KCMA 4GZ3A 3CKLA 2I3DA 1Y8QB 3JZFA 2PPVA 1E63A 1W76A 2QTZA 3RJTA 1DOZA 2R7NA 4NLLA 4PEVA 3IBTA 3FSEA 1EWRA 1RWQA 1ZH8A 4I1IA 4JGIA 5D5QA 3RQSA 1RZVA 3HU2A 4EG6A 5CDYA 5K8TA 4UAGA 4N48A 2JH9A 2OK7A 3VNVA 1HFEL 2Q3HA 1PZFA 5TF4A 3S68A 1EM6A 2BY4A 2XH8A 5C7LO 5LYYA 2P4SA 3OQNA 3PR2B 3ZQUA 2HWKA 4CCAA 4HX5A 2OHXA 1RAEA 4AX4A 3V1KA 1OI3A 2EJUA 4X85A 1A50B 4LK3A 2A9JA 4MWCA 5JS7A 2J07A 1NUHA 4G8BA 1ILWA 1MC1A 2O1XA 2K5UA 4G5YA 2XUKA 3CV3A 2ZUSA 3GZTB 4AJIA 4A36A 4LYJA 1JAYA 1N0UA 4UKDA 3U7FB 3AO0B 4RMHA 1H2HA 3T1NA 1RKUA 4RMJA 5G02A 1L7DA 2C92A 2PBFA 3U3MA 3TIFA 3W04A 2H3HA 3NIGB 4FP9A 1N5MA 3EF1A 1O5TA 3E2IA 2GHIA 5K4AA 1Q3TA 3BRWA 3ONWA 3JAWA 4C01A 4XWKA 1E2BA 3KOUA 3TDNA 4EZEA 1FL9A 5CT5A 2ZR8A 5A6VA 5B1EA 3B1YA 2Q2NA 1TK9A 3INTA 4FNGA 4AP9A 1CDDA 4GDMA 1D7AA 5G4KB 3RCBA 4PPFA 4BO0A 4EO4A 2Q1TA 4F3CA 4YCCA 1HM5A 3EQ7A 1Z5UA 4QDJA 4CKXA 1RZRD 2G1KA 2OLKA 3KAJA 4JI0B 4BB5A 3C1OA 3ZCPA 4QT0A 5HJ7A 1OLOA 1BWPA 2EZTA 2WUVA 4BNGA 2BMJA 2NG1A 1TKCA 2XOEA 4UE3S 5B58T 2ACWA 4KLNA 1B3RA 3LZDA 4OFBA 3RIHA 1TO6A 1TJ4A 2Y1LA 2J9XB 2GZSA 4QXQA 4Q3CA 3H18A 1X1AA 1I3KA 4D9EA 3AUKA 2ASVA 3TW6A 5MDHA 5LNK1 1M34E 3BF8A 4JFRA 1EP3B 1Z62A 4EMUA 2ZAYA 4EQ6A 1CZUA 3KETA 1EKXA 4AK9A 2Y1CA 3QTBA 4PS0A 4U2EA 3EVFA 2DU8A 3K9WA 4XVQA 4DLAA 1C80A 1RPJA 1UOEA 3P9QA 2YJNA 3A28A 4ETMA 1J09A 4R8SA 3I83A 3N6XA 3TTVA 4HDNA 5EMKA 2ZBRA 3LDHA 3N2LA 1LSOA 3PXUA 4LHSA 3D64A 1WJGA 5EHQA 3LHSA 5DTEA 3IVXA 1GYQA 1A8UA 2WHRA 2PU7A 2V0NA 2W6QA 1UKBA 1SQ0A 3Q0EA 3OZIA 4M83A 4R1OA 5T6BA 1FDVA 4QOJA 1EB8A 3S7TA 5AJXA 2YC4C 3I2IA 3W9SA 2PJRA 1CUSA 5L6LB 3AEUB 2YCBA 1HEYA 2L0XA 4IHAA 1CP3A 1ODFA 1NE7A 4MGYR 3RTBA 4RIEA 1BXRB 1OBVA 1TZBA 2ZAIA 2D59A 2QX7A 4M9CA 5JHGB 2J59A 2W8BB 1WCYA 3IXQA 4M9ZA 4D8XA 1IXKA 4F4IA 5CBPB 3KT0A 4PC7A 3A37A 2LKDA 1P2DA 3C85A 1I2AA 2B5OA 1MXFA 4FSDA 1T5OA 4AKEA 1UBJS 3IMGA 3K09C 3DZCA 4Z7OB 2DHDA 5AM4A 4UQLA 3T7SA 1KH3A 4HPJB 3CPSA 4N5HX 3NW9A 2WYWA 4NBKA 4CGZA 3KSDO 4F8EA 3ERCA 5F9MA 3JVUA 4FR0A 4ZFNA 4PNPA 3TLJA 5B4VA 5IYZB 1NVFA 4DCOA 2HADA 1M2VA 1RBQA 5KQSA 1LPMA 4C4PA 1VBMA 3OX2A 1XVTA 2I6TA 3UMRA 3SX2A 3R9IA 1ZFNA 3NZEA 5JYBA 1REQA 4QNMA 4MR9B 4REMA 4F4HA 4EY4A 1KJIA 4N3CA 1EZ4A 2CUTA 2IS4A 4IEIA 1K7FB 1PFVA 1IRIA 2HRDA 3D6UA 1HT1E 4J49A 5K0JA 1WA5A 4O25A 3KJIA 4MCJA 4UUMA 3WGLA 3AEKA 1LPOA 3K5IA 2XTAA 1U8AA 3LXUX 3R5TA 4CQMD 4E09A 4DV2B 4JODA 2SKEA 5L3VA 2NLOA 3WRYC 3KKPA 2BVNA 3DEYX 4DA6A 2HJHA 3R7AA 3GEDA 1JPJA 3IMCA 4DR7B 1M73E 4JP5A 1YL7A 1NW4A 3B82A 2QRHA 3U13A 2RH9B 4W5NA 3IBYA 2GBPA 1C1YA 3QU7A 4MOWA 3UA4A 4BNIA 3O2SB 2G36A 2VHEA 1G1AA 4YRCA 1U1GA 1T0UA 3E53A 1YVPA 2R8ZA 1U80A 1LVHA 3U37A 4CQNA 4BUJA 3GGPA 4QHTA 2CXXA 2HREA 4GI3A 2ZRMA 2IU3A 3PQ4A 5IC5A 3V33A 2OCLA 4OOFA 4NK5A 5KVCA 4NTZA 4HXYA 2A1UA 1WIWA 4HO1X 2IH5A 1L7OA 4A91A 1YZYA 3BTUA 2AUNA 1MABB 3CIFA 4KKXB 3PD1A 3TRJA 1JJBA 2O2GA 1MAVA 2W6IA 3LX5A 7MDHA 2FZGA 2G70A 3OIGA 3QE4A 3QPDA 4MVCA 3RK1A 2Z04A 2ZWOA 4ZAZA 5JVDF 2IS2A 1E1KA 4J0JA 4FU0A 4MB0A 4V3CA 1GFWA 5EA2A 3SLKA 4DARA 3WZLA 2ZTHA 2GBFA 1P17A 3MWEA 4DQLA 4KMMA 3HKBB 1P19A 2G77B 3D54D 3PFHA 5ALQA 3T99A 3DC2A 4FKBA 2ID9A 4KVGA 3B6IA 3QF4A 3G2QA 4UNNA 1I7DA 3DHVA 1CB7A 1N2ZA 1R16A 1XE3A 2A5LA 1ZJ6A 2YX1A 3FVQA 1NULA 1PK7A 3P2MA 4ROSA 4BMCA 1VZ2A 3HVRA 1Z38A 3ZV5A 2YFKA 3KL4A 4O1HA 3LWBA 2ZFUA 3AGQA 2BF7A 1IQRA 2D8MA 4IGFA 4KQXA 1VYTA 1EB9A 2EIHA 1X14A 3GUHA 3I04M 2RH4A 5AT1A 1D7OA 1KNXA 3AERB 4RNCA 3C7KA 1RI4A 1ZI9A 2J3JA 3HYRA 5TS2A 3RC2A 2JB9A 4ALIA 4DY6A 1ZK1A 2CVFA 2ZJ2A 5DT9A 3QWAA 2UDPA 5J4KA 4QNNA 4HWSA 1DC8A 3TEMA 2CXNA 1G66A 4HPWA 4PYKA 5A4JA 1DC3A 3F71A 4JVSB 2AXQA 3E9ZA 5JCJA 3W2FA 4OQZA 1DIGA 2WZCA 4WMLA 2A94A 2GPBA 2WNHA 1I30A 1KJJA 1R6AA 2RHJA 4LRQA 4ENUA 3TSOA 1KARA 4YRJA 1T1IA 4EL5A 1JHYA 3BK1A 3KCQA 2IUSA 5FO0A 5KYWB 2JJMA 1QH8A 1Y4UA 2KM1A 1XZCA 1EINA 3HEBA 3TMKA 4RCYA 4R05A 4WV3A 4D3XA 1RLOA 5FRDA 3G68A 1SXJA 1E5VA 1GPWB 1PQUA 5CDSA 1PP4A 1YA8A 2PM8A 4EVQA 3F90A 2QQGA 1JKFA 4YALA 1TIPA 2B8NA 3N87A 4CQMB 4CIBA 3LG2A 2R66A 4C05A 1U04A 3AJEA 2PU5A 3OIVA