4KKVA

Crystal structure of candida glabrata fmn adenylyltransferase d181a mutant
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
308
structure length
295
Chain Sequence
GAMVMRLGDAAELCYNLTSSYLQIAAESDSIIAQTQRAINTTKSILINETFPKWSPLNGEISFSYNGGKDCQVLLLLYLSCLWEYYIVFPLTKLPTVFIDHDDTFKTLENFIEETSLRYSLSLYESDRDKCETMAEAFETFLQVFPETKAIVIGIRHTDPFGEHLKPIQKTAANWPDFYRLQPLLHWNLANIWSFLLYSNEPICELYRYGFTSLGNVEETLPNPHLRKDKNSTPLKLNFEWEIENRYKHNEVTKAEPIPIADEDLVKIENLHEDYYPGWYLVDDKLERAGRIKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Similar to uniprot|P38913 Saccharomyces cerevisiae YDL045c F
publication title The "Super Mutant" of Yeast FMN Adenylyltransferase Enhances the Enzyme Turnover Rate by Attenuating Product Inhibition.
pubmed doi rcsb
source organism Candida glabrata
total genus 92
structure length 295
sequence length 308
ec nomenclature ec 2.7.7.2: FAD synthetase.
pdb deposition date 2013-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01507 PAPS_reduct Phosphoadenosine phosphosulfate reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4kkvA00
4BWVA 2DUMA 2O5RA 2CUZA 3CLTD 3FIUA 2E0IA 3MLAA 1I2DA 3DPIA 4K0RA 2Z08A 3PRHA 1ZJWA 3NBKA 3CLTC 4MW0A 5FNZA 2V0CA 4MUIA 3L92A 1J70A 1OWLA 1KQOA 1UFVA 3TZLA 4MW9A 3MXTA 4EG6A 2TS1A 3HL4A 1EUQA 2D54A 2VTBB 3GLVA 3TQOA 1T6XA 1TFUA 1A8HA 1M8PA 4KKVA 4Q16A 4ARIA 4KPUB 1N3LA 3ELBA 5DK4A 3MMXA 3E27A 1Q77A 1CT9A 4DE5A 2OQ2A 1XJQA 3RK0A 1HYBA 2A84A 4UZEA 3FOCA 5KCMA 1LI5A 2QUHA 3AKZA 2DETA 1NUPA 4CQNA 1I6LA 3X1KA 4ZT6A 1VBNA 5LFAA 4L2IB 1KR2A 2X1LA 4F4HA 1O6BA 1N1DA 1LW7A 1I6KA 1O95D 3IVXA 1YI8A 2CYAA 4OJMX 3VRHA 1NURA 3OP1A 1ULHA 1U7XA 4MW1A 3AG5A 3F3MA 1K92A 4NAUA 4G5YA 1XNGA 4TS1A 1F9AA 3HMQA 1O95C 1N75A 1U7DA 1H3NA 4U8HA 3ZGZA 2QJOA 4DDKA 1GAXA 4EGAA 3RBAA 3CLSD 3FNRA 1OWPA 4MWEA 1WQ3A 1Q19A 2WB2A 4ARCA 3CLSC 4ND7A 3KFLA 5HUJA 4NATA 2A1UA 2BTEA 3NBAA 5HG0A 5IJXA 2X3FA 1JIIA 2Z3VA 3PNBA 2YWCA 2ZP1A 1IHOA 3HZRA 1JIKA 1O5TA 3LOQA 4QRDA 5TEWA 3RFFA 1ZH0A 1N2BA 3ZJVA 1QQTA 3CVYA 3IUEA 2A4MA 2DEUA 4NAHA 3A04A 1IRXA 2QJTA 4ZCQA 3N8HA 4DJAA 3BL5A 2V0GA 3IVCA 1PFVA 3Q10A 3FI0A 5FO1A 1KP3A 4I6EA 4CT0A 3FY4A 3LE8A 1YUNA 1T9GS 3FDXA 1JECA 3DO8A 1VBKA 1VLHA 4HK4A 4RUKA 3SEQA 4J76A 3ZUGA 3H9CA 3ND5A 1M8JA 2ZUEA 3IMCA 1IQUA 3KT6A 5DEOA 5EKDA 4MUFA 3KT8A 1JZSA 2AG6A 1IQ0A 1N2HA 3IOCA 1GTSA 1IH8A 1PFWA 1GZUA 2E21A 1QRUA 2GKSA 1EE1A 1EFVA 3FHJA 2CSXA 3N2YA 4MAFA 1J21A 2YY5A 1ZUNA 3M5WA 3N9IA 4MW6A 3X1MA 4DDMA 1H3EA 1MAUA 1ZH6A 1H3FA 3HGMA 2VTBA 4MW7A 4R2MA 3ILVA 4AS1A 1KAMA 1KKUA 1IFXA 4MUEA 2NZ2A 5H7XA 1XNHA 1WOYA 1OBCA 1G8FA 3RHSA 1VL2A 2QTNA 4NZPA 4EG4A 1IQRA 1KH2A 2B7LA 4GU5A 4U7JA 2WQ7A 2YXNA 3CA8A 3IMEA 1KQPA 5FO0A 3KT0A 3G6KA 1NSYA 3NV7A 2XRYA 3KT3A 4MUHA 4ND6A 3JXEA 2X0KA 1WQ4A 1WXEA 1WZ2A 3N05A 3UK2A 4JFAA 3UY4A 2GOYA 4ZT4A 4NDAA 4DDHA 1QRSA 3A2KA 3PNYA 4XFJA 1KQNA 5IHXA 1QTQA 4JXZA 2A1TS 4EG5A 1G8HA 2J08A 3ZIUA 1EJ2A 2C5SA 2IELA 2IJGX 3RJZA 2CT8A 1N2JA 1KH1A 4PBTA 4R0NA 5DASA 4EF6A 1K97A 1D2RA 1MBZA 2X1MA 3AIIA 1S4MA 1J1UA 3G5AA 1U3DA 4DNXA 3DV2A 3A4IA 5TS2A 4MUNA 1LI7A 1MAWA 2EL7A 3COVA 4ZCRA 1X6VA 3CLRD 1KAQA 3IUBA 4MUJA 1OBHA 1KP2A 1MOPA 2J09A 3D6VA 4CDMA 4QBTA 3PXUA 4JZYA 4KR9A 2I1LA 4EG3A 3CLRC 1JILA 2A88A 3P0JA 3HV0A 3A05A 3SZ3A 1EFPA 2JA2A 3QTBA 4MVXA 1YUMA 1WXGA 4YP7A 3MLBA 2CYBA 1N2EA 2J07A 3MUEA 1O94D 2YWBA 2D13A 3ND7A 3IODA 4PY2A 2CFOA 3TZEA 3H97A 1NUQA 1WY5A 3IH5A 4ZT2A 2CV2A 1Y42X 5F23A 5JBNA 4MVWA 1N2OA 2E18A 2WSIA 3CVVA 2QUIA 4EG1A 2Z09A 1F7VA 1O96A 1XNJA 2QUJA 1Q11A 4G6ZA 4KR7A 3ZJTA 3H9BA 2AZXA 4HJXA 2H2AA 1V47A 4XFDA 1F7UA 3FG9A 4KR6A 1MB2A 1JGTA 3LCJA 4NX2A 1GLNA 2D5BA 3ZXSA 2RD2A 1QRTA 2A7XA 4MULA 5TGTA 2QUKA 1GN8A 2A1UB 2A1TR 2HMAA 3TS1A 3TNJA 3Q12A 4FZJA 3H05A 1PFYA 4Q93A 3P52A 3PNVA 1OWNA 1YIDA 3GMIA 3X1JA 3VU8A 5LM3A 3ZXIA 2PIDA 3FETA 1SURA 1M83A 2GM3A 1O0CA 2G36A 3K9WA 4DLPA 1R6XA 4OUDB 1M8GA 2RE8A 2HGZA 4E1AA 1KH3A 4CDNA 1BS2A 3SYTA 1OWMA 2QJFA 3UOWA 5K0TA 1KORA 4GRIA 4J75A 3COYA 4U63A 4P2BA 1TQ8A 2DLCX 1JEEA 1B6TA 2J5BA 4KPUA 1NZJA 2QTMA 1YULA 3GUZA 4YMIA 5KHAA 3VGJA 1NUSA 1K4KA 2R5WA 1JEDA 3P0IA 1X8XA 2NSYA 3INNA 3CLUD 1COZA 2QTRA 1FFYA 2PZ8A 5J5AA 1EFVB 4A91A 4EFKA 3CLUC 3UC5A 3C8ZA 3QTTA 1PG2A 4RPIA 3ISJA 4YBRA 1DNPA 1MB9A 4HJRA 1FYDA 2EJCA 3IOEA 4QREA 4L2IA 1YIAA 1P7PA 1N2GA 4XSVA 1MJHA 1N2IA 1NP7A 1M8KA 3D6UA 5BNZA 2PZBA 3ND6A 1I6MA 1T9GR 3P0HA 4AQ7A 2CV0A 2PG3A 1QNFA 4H3SA 3CR8A 3G59A 3RK1A 4F3RA 3U1VA 4MUKA 4MW5A 3CVUA 1O97D 3I05A 2JANA 4YP6A 1NUTA 1PG0A 1M1ZA 5LLTA 3QE4A 3SDBA 1O97C 1J09A 3SP1A 1MRZA 1K4MA 2CV1A 3ZJUA 1GPMA 4ZCSA 1TYCA 4MUGA 1O0BA 4S1OA 3COWA 4UZFA 5KWVA 4I6JA 4YP5A 3K32A 3IVGA 2J4DA 1N77A 4MW2A 1VBMA 2BYTA 2E89A 2HZ7A 2O8VA 3IMGA 1G8GA 2DPLA 4ZCPA 1T6ZA 1EUYA 4JYZA 1WXFA 3TQIA 1QU2A 3AL0C 3CVXA 4MQ6A 3UMVA 5AHWA 3IOBA 4HPWA 1O94C 1PFUA 3SEZA 4EG7A 4MVCA 3DLAA 4PBRA 4PBSA 2ZUFA 2XRZA 1NI5A 1M8FA 1NUUA 2PFSA 1TYBE 4K03A 1IVSA 1RQGA 1TYDE 4MWCA 3AG6A 4MW4A 1U3CA 4ZT5A 2PZAA 1V8FA 1QJCA 3IDFA 1EXDA 2DERA 1JIJA 2JAXA 1WXIA 1WXHA 1J20A 1JHDA 1EFPB 1R6UA 1H1TA 1OD6A 1ILEA 2A86A 5J58A 5DB4A 1MC1A 5H16A 5TEVA 3OTWA 4EG8A 4ZT7A 1OWOA 2VXOA 3L93A 2DR2A 1WKBA 4MWDA 1JZQA 1Q15A 3AFHA 3FWKA 1J1ZA 3Q4GA 4MWBA 4OUDA 3HFJA 3SZGA 5HUHA 2DXIA 5K0SA 3FH0A 1JMVA 5J59A 3CVWA 2PXHA 4ZT3A 1U0BB 1QU3A 1O96B 4WSOA 2IP1A 1F4LA 2OV4A 1TEZA 1N78A 1T6YA 4G5FA 1TYAE 1GTRA 4MLPA 1WJGA 1G59A 4I6GA 4ZCTA 4JXXA 1NYLA 4WNYA 2H29A 4R2LA 4MVYA 3H99A 2CYCA 3COZA 4X0EA 2WQ6A 2AKEA 1R6TA 3S3TA
chains in the Genus database with same CATH superfamily
2P9EA 2R4UA 2IYUA 4IQFA 4TQ9A 1HSZA 4M1QA 4JU9A 1WUYA 1HE8B 2ZJOA 4KX3A 1P8JA 3KSBC 4BO9A 2OGWA 2DUUA 1ZICA 2IU0A 4E5YA 3IAAA 4KWCA 5JQGF 4FSXA 4R3NA 4ZK2A 5HPYB 1GTL1 1ESMA 2I55A 3C7AA 4C3ZA 4DNOA 1FQJA 5IAGA 5AFSA 1W0KA 2PGNA 4G0WA 1YR7A 2O1WA 2HWWA 3IAXA 3MMPA 4CCWA 3FAZA 1OWLA 3CW8X 1EP1B 4V1CA 4GL2A 3WZLA 1SQGA 1XEFA 2HRDA 4AECA 4CKBA 5F9FA 1FMFA 3WB2A 2NXEA 1TVEA 1ZH8A 2FKNA 2P41A 4FM9A 4DABA 4S1NA 3UNXA 5KNCD 4J1TC 4JENA 4E15A 2ATIA 4YDHB 1E2GA 2GNAA 3U5TA 5G3YA 3WMFA 4G1VA 3VPCA 2HRRA 2ZJ2A 4XUGB 5FV7A 1A8HA 1C7IA 3OIDA 1FSPA 4RTLA 4LOAA 1W4BA 1IZ8A 2AF4C 4Q3EA 3E7FA 1YD7A 1JWAB 3IEUA 2A0XA 4ZV9A 2M6KA 3RYHB 1WS6A 3MMXA 4HQLA 4XSGA 3T3OA 1ZLYA 2PQ6A 3CU5A 3DH0A 2J9ZB 1I5OA 2I7DA 5G0UA 2GTHA 3T5GA 3U26A 3ZQKA 2R6R1 1PQPA 1A1SA 3I8OA 1LSJA 2HLDA 4ROSA 3V00A 1FZQA 5JASA 3TRKA 2VA9A 2WNIA 3DZGA 4PPNA 4PZCA 4TL8A 1RJGA 2HA7A 1C9MA 4DY6A 5EJIA 1SBZA 1CR6A 3HR4A 4E70A 5GAJA 3I1FA 1R6BX 3GFVA 1KSHA 3DAOA 2W42A 2NU8B 3ANXA 3LRXA 3O0TA 4B46A 4CIYA 2EZTA 3BXEA 4BVKA 3VHXA 3HBAA 4EYQA 3K8ZA 5DHSA 1QANA 1YE3A 2ZR0A 3H11A 1RJWA 4TXLA 1AMOA 3MJ4A 1P77A 1KYYA 3F47A 4IV8A 4PX9A 1UBLS 3R24A 4X3PA 5DM2A 4WBSA 3N28A 2GEKA 1V1MA 3O1IC 4P7BA 3ZHTA 4ZI3A 4MWGA 1C0EA 1PHPA 3B9RA 3P9CA 4UDOA 5AJWA 3OE7D 4N82A 3LL7A 3I6ZA 1ZJYA 3R40A 4RHCA 1E59A 5LXTF 1Z15A 2DQ4A 4TS1A 5DBOA 1OLOA 1IOLA 1I2CA 1V9LA 3WTCA 2GXSA 2AXQA 4IEEA 2REOA 3GF4A 4ZAGA 4ZYYA 2NZYA 5AWFC 4XQEA 2PJRA 4I1SA 3B82A 3TL2A 3ESCA 3ZGZA 1RM3A 1MEOA 4MIKA 2BMAA 2V45A 1YGPA 1DX6A 4GUDA 3DEZA 4URFA 4ZOCA 2JGIA 4C43A 4CYMA 4BQSA 3HSSA 4FWIB 4ARCA 4WI1A 4AP6A 3OFNA 4MGKR 3KSUA 4B3RB 4P81A 5LKAA 3VVLA 2CF6A 3WWCA 2WEKA 5LZ5A 1XZIA 1Z73A 2DHQA 4FB4A 4HAWA 1WZEA 2YWCA 1Z0ZA 2QEQA 3M5PA 1YZ3A 3RC9A 3LO8A 4I14A 1JIKA 1A7AA 1R64A 3G02A 2WJYA 2LZ0A 2I4RA 5HKOA 1FU4A 2VJMA 1TYZA 5AW9A 4D82A 4JY7A 1WO8A 2Q0QA 4TKZA 2QJTA 4NBTA 2QNIA 2WYVA 4KO8A 5CM2Z 1EFLA 1BFUA 2PS1A 4MJ7A 1IPHA 4FGJA 5JATA 1P3Y1 2F1HA 3G68A 2PT5A 2DFVA 2JH9A 3MN1A 3O2SB 3G5UA 3OTIA 3U44B 4Y2PA 5CK4A 5B1DA 4QBGB 1AXEA 1FYEA 1Y5MA 4XQGA 1P2GA 4FFNA 4IDBA 1L5OA 5LDGA 5BT8A 3VPXA 1QP8A 2ATXA 2XZLA 2QDKA 3ND5A 1TKBA 1XTTA 1S2NA 3KS9A 4I50A 1R6AA 1IHYA 3UW1A 2KHZA 1SOMA 2HCBA 2WM9B 5F2KA 2Z56A 3U3XA 4AXBA 4EHIA 4U3JA 5HGXA 5I01A 4LDNA 2OGZA 3NWJA 3I6MA 1OFIA 4IMJB 1RHKA 4DMHA 3G9TA 5BNIA 4RXUA 2E21A 4Z4IA 1NW6A 3H5VA 1AHPA 4P6VF 1U8XX 2JFFA 5TSDA 3FLEA 1Z3IX 3WIOA 2X77A 4BLTA 1CY8A 1G6HA 4A1OA 2ZSAA 3S8EA 4LVOA 4MV8A 4C0HA 2DR3A 4TXMA 3FOAA 1A72A 2Q7OE 4F4JA 4JLVA 3N9IA 2ZT7A 2BI4A 2PNFA 2IV3A 2Z6UA 1VRWA 1KSGA 1IULA 2VQSA 3IUMA 5K0BA 4ONEA 2OFPA 4D74A 5D87A 2Y66A 1Q95A 1NLMA 2VBIA 5EKUA 2VHJA 5GONF 2I3DA 3S1AA 4EZBA 3VR3A 4ZYVA 4OMFG 1XV5A 4BBJA 3U7QA 5IJ9B 2ZBDA 1WZUA 3TQQA 3ABOB 1NW4A 2WTNA 3LY5A 4CFZA 1YRHA 5ENVA 4UAJA 1V7PC 1KY2A 1U9JA 3OAAA 4PYJA 1KH2A 5CMLA 2B8WA 1MTZA 3H2BA 5CPFA 5HMMA 1JJFA 3A2NA 3QVMA 3CA8A 2WQ7A 1YR9A 1F60A 1QG6A 5HP4A 1LTKA 2PJDA 1SA0B 1JXAA 1N8KA 3LC7O 3PI6A 4LOKA 4KREA 2ONCA 2QGFA 2B4AA 3DEHA 2ZYRA 5EYPA 5EESA 1FA9A 3L7BA 3CKYA 3WYFA 2WWXA 3AB8A 5LQSA 1EDBA 4LJKA 1E69A 3ZW8A 2AF3C 1JLKA 1RLJA 1TJPB 3GJYA 1CC1S 3KWLA 4RY8A 5KSOA 1J9ZA 2FHPA 5JHGB 1J5XA 5CM8B 4V1CB 1UL1X 2FZLA 3GR6A 5F98A 1A5ZA 2IHNA 2Z95A 2H08A 4GRDA 4YJDA 3HXQA 4DA0A 5DZSA 3EOBI 2O06A 2HD4A 1S3GA 3QEMA 4Y1EA 1R8XA 1UOQA 4M3NA 5FXMA 4DRXB 5DASA 3IAS1 3DS8A 3LKZA 3KSZO 4YR9A 1ZD8A 2GN1A 3L8GA 3G5AA 2VDPB 3QX8A 4I1YA 3PK0A 2ZWIA 1KFCB 5T4HA 2Q27A 4UBIA 2F8SA 3R9XA 4RA6A 4Y2HA 3H2YA 1YMQA 6PFKA 3CISA 3QELA 5F3WB 1BE1A 2HHCA 2HLHA 4EI9A 1UK9A 3X1XA 3ZYCA 3G3EA 3PXEA 2JASA 3K9GA 4I4NA 4KQ1A 1YDGA 3JYQA 4UHDA 3KQUA 2AG5A 2V98A 2ZIFA 1EHIA 1A5SB 2ALJA 4LJYA 3TM4A 3R5TA 2QZ4A 1BDIA 2WZBA 4WXRA 1ZGGA 3CLRC 1PEKE 3KCQA 4PCLA 4LZPA 5DRYA 4RLFA 4NEQA 2ZUCA 3LUKA 2FZGA 2X9NA 4RZXA 4UAGA 4XOUA 3QE3A 3E53A 5BMVA 4RTNA 2H4FA 1EK6A 4QYTA 5A4KA 4Q1VA 4J2TA 3ETJA 5IULC 5BQPA 1HE5A 3VHXB 1KNXA 4ADSG 1I13A 1T2VA 3KPUA 5A0FA 1RMYA 3H11B 6GPBA 4DB2A 3MT9A 4M0MA 4RJTA 1NXPA 2BHNA 4MITA 4RKWA 5HILA 1QYVA 2VPIA 4J0FA 5AJXA 5TQJA 3EA5A 1V1MB 2VZEA 4QFDA 4ARZA 3EDYA 3TSYA 2FSGA 3IH5A 4D99A 1JLSA 5GPBA 4FR2A 3L6RA 1QCDA 1ECGA 3EPLA 1NXXA 4PINA 1SHZA 1P2DA 2IA5A 3ADDA 1JQKA 3CVVA 1H8ED 1OREA 2Y1FA 1M5TA 3PD7A 3M4XA 3PWKA 5LOVF 3PC7A 3S81A 3KP1A 2PUFA 1W4CA 1GPWB 5H81A 3RSSA 1E63A 1K6MA 4AMVA 1HGXA 2QG6A 3MELA 1C29B 4HLQB 2CCGA 2NWQA 4E33A 3MGKA 3TG8A 4RC9A 1MB2A 3L6CA 4X64B 4ALNA 4IZHA 2C7OA 4HFNA 1TO2E 5CTAA 2I9KA 1WBBA 4A7PA 2W58A 4IZOA 2VKQA 1M75A 3ZXSA 1WUHS 3SYMA 1ZJZA 1WEKA 5JZSA 4E2XA 2AXEA 3AONB 4RQBA 3N8GA 2RBGA 3I9V6 2X0FA 3TS1A 1BFKA 4KWIA 2EAUA 2QMZA 2VRCA 4UQLA 4HB2A 4P3YA 2RGNC 4KVFA 3EFHA 2I0FA 3NHPA 1E5DA 1W6UA 2PQ2A 1EDDA 1EXNA 2HIMA 2YZNA 3I2YX 5ALFA 3WMXA 4OBEA 4C78A 1O94A 5CB0A 1C0LA 2VJMB 3B2EA 3IURA 3ACCA 3PENA 1AKTA 4FGZA 4JROA 2IHYA 2HHJA 1A9ZA 2WMNB 3BMNA 2LCFA 4HEA6 5AI8A 4CLHA 3BZWA 1N6IA 4TT8A 1JHOA 1O6CA 2AEJA 2AR9A 4H4DA 2VDWA 4EAAA 5JAOA 5C3UA 3TLGB 2W0SA 1SXPA 4HNGA 3GBSA 4YONB 3EPKA 1KH3A 4G86A 2R44A 3ZI7A 5AKGA 2ZIZA 1EEHA 3UA3A 3ZJ4A 3BHNA 4K9LA 4Q4HA 1P9WA 3RQIA 2O54A 3U39A 3OO1A 1KU0A 1PR5A 2QBYA 3W1WA 4I50B 4EUFA 4NDNE 1O5OA 1SC1A 3D0KA 5JBQA 4X60A 1W44A 3CVOA 5J4HA 1OHHD 3GUZA 4EA7A 1RADA 1F2TA 1X1BA 1UBEA 4X6LA 4XD7D 1BQ3A 1ISJA 2D3TA 3IAUA 5ARDA 3ZVLA 5BN5A 3GJRA 3MILA 2J30A 3DUFA 2G5PA 3FDZB 5CLIA 2O1XA 3KZCA 1GV0A 3FGNA 2O2GA 1DAGA 1WW2A 2QTFA 5FPTA 3GLSA 2VF4X 3GD7A 3I4LA 3S99A 3U2QA 2VPZA 4PAGA 2YJNA 3O7WA 3AJAA 3RARA 4Z1OA 5HOQA 1BSVA 3RC3A 1XTKA 1DNPA 3FJ1A 3AKEA 2Z9DA 4KDRA 4KBYA 4IIJF 3AF5A 1Z36A 5F51A 4YCMA 5B3KA 3QX7A 3ZQ6A 4XSVA 2HX1A 2IUYA 3DKKA 1MJHA 1G291 4A0QA 4EY6A 3PTZA 4JEIA 1P19A 2C5LA 4IPTA 3ZWNA 4L4UA 5TY0A 5BNZA 1EX9A 2QRPA 3VNUA 3OSZA 4NI5A 3S1AB 1V8BA 1KK3A 5FUMA 1XAHA 1EMDA 4FYKA 4M55A 2Q49A 1R5BA 1S7CA 4F5EA 3L4JA 4DV0B 2QT0A 1T9HA 2PUJA 1CUDA 3KEOA 3MPUA 4EQ6A 1I51A 5CIWA 2WF6A 4B34A 5BN4A 3AMVA 2W6MA 1DTSA 3SFVA 4B40A 4RE6A 3W2FA 3SEAA 1UDCA 3F2VA 1XKXA 4CCSA 1FNMA 2NVBA 4HDNB 3T9BA 3ZXIA 3LLSA 2FB9A 3BWBA 1QPBA 3P9SA 3H9GA 3PX2A 3SDBA 1XIVA 1KFJB 1QVZA 1UWCA 1KU6A 2ZDGA 4ZRNA 1FP2A 2CD7A 3DEAA 5T4FA 1NVAA 5EYPB 1VMKA 2DE0X 2IY8A 4HY3A 3SM9A 2R96A 1NBEA 3I62A 3Q6MA 4TSRA 4KE8A 5K0JA 5A0TA 1QQAA 3ZGNA 5KYGA 3PFNA 3K9HA 1LK7A 4UZFA 3T3GA 1KHHA 1W2WB 1XMOB 2BBWA 3C48A 4UNPA 5E3JA 4C7VA 2ACKA 1VBMA 2PRIA 4RIIA 1RR6A 1HMYA 3SSMA 3IMGA 1VSBA 1USGA 4JP8A 3QEMB 3I0NA 4N3AA 2W2LD 5IVDA 3DR3A 4KLAA 1YBHA 1I14A 1OYVA 5LL6P 3HVRA 3HN6A 4IJMA 1BROA 2ZI7A 1PV2A 3W78A 4BE4A 2GERA 4MKXA 1NDUA 4RIGA 4REQA 2NO4A 3P8ZA 2BMDA 5T64A 1XCJA 2LDBA 4RA6B 2VNAA 3PL1A 3QELB 1C8VB 1M5UA 2OT3B 4L5BA 2ZI3A 2QB5A 2GD6A 2C82A 1U2DA 1NI5A 3ETEA 4XLZA 4E5KA 4EOGA 1TYBE 1QGUA 4KO3S 4WECA 4QQKA 2FUCA 3NW9A 3TK1A 1XVVA 3UXEA 3V2IA 3WQQA 3W5DA 1V9SA 1V25A 2QUBA 4R4JA 1IJFA 1TM1E 1W87A 1X77A 5CXQA 5IC4A 1T0JB 2H2WA 3HY6A 1Z74A 2XMGA 5E1MA 2YDYA 1WXIA 4Y2RA 1ZRSA 1WXHA 1KEUA 4K6CA 4B8ZA 3HYLA 3PWZA 2OILA 4FQ7A 5FL7A 3R2JA 1ODFA 3ZJ5A 2VDOB 5BSEA 1BU5A 4LFBB 2X5NA 3AR3A 3R7BA 2BZGA 4CLDA 5BR1A 2QI9C 1P7ZA 1YONA 3ROKA 3RTGA 3KTDA 5GZ6A 2HWUA 1P1RA 3OE4A 3MWDA 1L8LA 1PW5A 2UYHA 2J0VA 1AKMA 1VSQA 2QSUA 1ID1A 4QLAA 3WIVA 1NN0A 4F7DA 4O4IA 4AY5A 1NY6A 1FSSA 3F8SA 3UV7A 3MLEA 3A1WA 1UC4B 4DQ0A 1GPH1 2HLNA 1Q15A 4ARZB 1XA4A 5AVQA 1KXZA 2CVFA 1S8OA 3QV1A 5DSZA 1AH2A 1TT7A 2GN6A 3CJTA 4MGZR 4DCMA 1S5PA 1Z5ZA 4FYYA 4P4NA 1UJCA 1IAQA 4RZSA 2R1TA 2QE7D 2HI0A 3OZSA 5GIOE 1NP3A 2YYYA 1U2PA 1CX9B 2PX5A 1JHYA 2VPQA 3I2GA 2OQIA 2B4QA 3Q7QA 2BHSA 4PO9A 3ML1A 3Q7EA 3T12A 2NXNA 4KB5A 1TEZA 1R9GA 3QPCA 4GPAA 3OLQA 4X20A 4XQCA 3NETA 3MWJA 3TVYA 1H23A 4B1FA 3KZVA 1LLDA 3CX7A 5EZYF 1J6UA 4NICA 5E1BA 1TUIA 2C07A 4R2LA 3G2IA 1KRWA 2Q0SA 2QMUA 1G6KA 4L02A 3W06A 2C54A 4HH4A 3HM9A 2PU5A 3ZK8A 1XTBA 1XHFA 2CUZA 4TV9A 1OC2A 4ZVQA 2YZ7A 1IBCA 1SPBS 1GFSA 2XW6A 4KXMA 3N5CA 5FI3A 4ARAA 3LX5A 2IHZA 4Z1MD 4HZUA 3F5QA 4LMPA 1NULA 1RNLA 3BTUA 5DLPA 4K5QA 5FQOA 4W82A 4Y2YA 1N5IA 1V7QA 1R0CA 1RBMA 1VLJA 4JVMA 3RHZA 1RXWA 2VDWB 1N5JA 1OVGA 1H6AA 2IZ0A 3TI9A 1Z6PA 5AI9A 1JS1X 1ZA2A 5E8JA 2I62A 2DRIA 4PGHA 4C76A 5A05A 2A58A 4QTXA 1XQ6A 3WNVA 4QYSA 5DWQA 5CVCA 4A27A 3ZHCA 2FP4A 1W5EA 3PQ5A 4IDQA 4DV2B 5KNDA 3JALA 4Z0TA 4Z0NA 5IW8A 3CZAA 3A28A 4QNRA 2XT9A 3ZDFA 3ZTYA 5HKAA 2W6NA 4BJ3A 4BLWA 3GJ8A 2QBYB 3QU7A 3V1NA 2YKGA 2FWNA 1TX4B 1VG0B 1WZNA 4QTUB 4BTEA 1MIOB 1GQFA 2LCIA 5JCJA 2J3EA 1DJNA 4DR4B 1YMUA 2F55A 3HCOA 3A1NA 4O4JA 1SVWA 1OFUX 1RC8A 4IS3A 2V8BA 5BN5B 2Q3BA 3FDJA 3DUFB 3H4TA 4ZVUA 4WXPA 4INOA 4FN4A 4DLAA 4IFBA 3ESQA 4XYLA 4S04A 2M9MA 3E61A 4D9EA 3TF5A 5D3MA 5FLYA 1B43A 4NU5A 1CRQA 5F1YA 4C2UA 2X8AA 4R41A 4NPHA 4FFMA 4PZUA 4L50A 2QU8A 3I5YA 1JR6A 1EJBA 3C4JA 1G5RA 1MFZA 3WL6A 1UR5A 2E7ZA 2W4MA 1ZCJA 4UBJA 4F4HA 3AUSA 2ZSKA 1LEHA 4GRAA 4AY2A 1T13A 3RV3A 3WGZA 4B3JA 3E5MA 1GUBA 2YMLA 2A9FA 2GBCA 2P4SA 3ZGLA 2QJRA 4YEDA 1USKA 3UB2A 5KYNA 4EQ6B 1H05A 3BA1A 1AGRA 5BN4B 3TSOA 2P4UA 1FLNA 1O95C 1HC7A 2IOHA 3JASA 2ERXA 4MMZB 1KVRA 5A3QA 5LQAA 4M1TA 5HXAA 3L7IA 3WS7A 5JXJA 4DADA 1GR0A 2O6HA 4RQUA 1VIYA 2FMTA 4AAYA 2ZKIA 2GYYA 3RBZA 2YW2A 1TVCA 1R27A 1MLDA 1T4GA 3GK3A 4MWEA 3QJ5A 3W1VA 1OH5A 1QFJA 1Q0LA 1L5SA 1W76A 4PZLA 4H59A 5EP4A 3RUPA 1AS0A 4CF6A 2W70A 4QQNA 4C88A 4DCNA 1XKTA 4UW9A 3KFLA 1SKMA 4DMUB 2MYNA 2A1UA 2ZB2A 2B82A 3ZGXA 3AI1A 1QORA 5AI0A 1L5GB 3T0FA 1Z63A 1RBQA 5B1HA 3MMNA 3L79A 5H02A 5JQGA 1PDVA 3PQ3A 1MOSA 1QBKC 5B1EA 4CTOA 3A9WA 2W2OA 1BTOA 2CXXA 3GNSA 4OXRA 1FE8A 2KX7A 4X5OA 3B3GA 4FKBA 1SUSA 4MS4A 1LB1B 2IZ5A 1RHUA 3DBVO 2EU8A 1Y6JA 1BRTA 1U7WA 2IRWA 2J46A 2V54A 2V0GA 2G04A 2VHCA 1G19A 1XMJA 2CHVA 2PBFA 2EGGA 2V5VA 4JIMA 5J4LA 5JRDS 1FDSA 4N18A 3BTOA 3NIDB 1NVUQ 3LE8A 1U8ZA 1QGUB 2EQBA 2QS9A 2D1RA 5HIAA 1MU0A 2PZJA 4ZFNA 2AC4A 4MVJH 5CNJA 3IEKA 2VZ9A 1XPUA 2ADMA 1NN3A 4M0KA 4II3A 3WRWA 1V4NA 3T34A 1NV9A 2AHRA 3CRRA 1M1YA 4MIEA 4BGVA 2H3EA 4N8EA 4MK4A 4P9NA 2WWYA 3M6IA 3AWDA 3M81A 3G2MA 2RB5A 5FNVF 1E2LA 4MGEA 5FOWA 1XG5A 2VDMB 3MWDB 1HI9A 1TTPB 4H7DA 3HBMA 3K72B 5K05A 3DV0A 3TMAA 4J4HA 3E23A 5KNBD 3PQEA 5C7YA 4YJ2A 4O4IB 5M2QA 4Z3OA 4LEIA 2FQWA 2JLVA 1RHQA 3RVJA 2JLUA 1OPXA 4MAFA 1BVHA 1CJCA 3LXUX 1MEEA 4NU8X 1LI4A 4OXIA 2ERYA 2UVQA 5AKKA 4IQGA 3TG2A 4OKIA 3W4IA 6LDHA 4HG2A 2BAGA 3WKEA 2R1TB 4YAUA 1Z2NX 2I71A 3LFUA 1RLIA 4MGIR 3HGMA 4GI2A 5FORA 2GA8A 4MR9A 2OPHA 1GU7A 3WE7A 4PE5B 3N0TA 4X20B 2I2XB 1ZD5A 3OZEA 2B4YA 2ZSBA 1R16A 1WPXA 3IUNA 4WDRA 1C3XA 1NMXA 1PJ2A 3D8UA 5EXXA 4BMDA 4WESA 4BO5A 2BFWA 4V0NA 3JZFA 4YRJA 4F4IA 1WOYA 1E20A 4M37A 4HCJA 4Y67A 4KUHA 1ZMTA 3D3KA 5ESDA 2REQA 1XMIA 3H5LA 4WASA 5D86A 1PL7A 1GUDA 2EKLA 2G06A 3IALA 1OE0A 2VJBA 3IMEA 3STTA 2Z8XA 1E2BA 3DTNA 4TV9B 4GXTA 5LB2A 5KQPA 4JI8B 1XA3A 1JJIA 1GL7A 4NVRA 3TXXA 4D6XA 1LSUA 4JC5A 5DTQA 4HZUB 4ZALA 2AI1A 3OUTA 1JA9A 1O4WA 5DF1A 3UY4A 2AW5A 4ZT4A 1NW9B 2DHCA 4BZXA 3GFFA 3L0CA 3HN7A 1XD9A 4QSHA 3AXSA 3OD5A 3TLEA 4CMCA 1ZONA 4Q18A 2A1TS 3NYIA 4QXPA 3KU4A 3IIMA 1HT0A 2IOQA 1TMKA 4TSFA 2NV6A 4X45A 3LHIA 4YTEA 2I29A 1FB5A 2QTLA 3QFSA 4QASA 3RJZA 4AF7A 3ZNOA 4YMHA 1FFDA 1JQ3A 2Q6LA 3CNEA 5K0ZA 4R0NA 4AF6A 1KDTA 1K97A 2FP4B 2QL7A 3VOBA 3JU3A 1IVNA 4DB4A 2XQKA 3EIHA 3JALB 3PZRA 1MO3A 1GCUA 2GDJA 1E62A 3TQFA 1WKVA 4RWEA 5HZMA 1VMEA 3A4IA 3CTMA 1ACMA 3ORSA 4AVYA 4YLYA 1ZN8A 2CY0A 3OO0A 1AQNA 3GCWA 5JXHA 3COVA 5JTUA 1BA2A 1DO2A 1SVKA 2GAAA 4O4JB 5B3JA 4J0JA 1RPZA 4DR7B 3LT0A 2Q6OA 4O2RA 5IMBA 1W0JD 1LFAA 1E8DA 1MOPA 1RAAA 2GEVA 2QRMA 4GGMX 4HD8A 4PXYA 5ICEA 1E4VA 2JA1A 4Q1FA 3K96A 3T9DA 1RLOA 2O0LA 3JCZA 5TQ2A 2OXIA 3A06A 4RKQA 1JXOA 4R6XA 3B1ZA 5D3MB 4N5IX 4EO9A 3JARB 2G9VA 3ORQA 4PLCA 3QEBZ 1EK2A 2AUMA 1QKIA 2QF7A 3RIGA 1PYOA 1X7DA 2OZKA 2VZ0A 3AUKA 4NQZA 4FGWA 3AFNA 4DMFA 1G0OA 1P74A 2O7QA 3DMTC 4K81B 4WLFA 3RU3A 4YRNA 4JUAA 1JKJA 1GSAA 2GAIA 3K6JA 3ND7A 2G08A 4IDFA 1PJLA 4UHBA 4AU1A 1AMNA 3IEMA 2JHFA 2ESRA 2VPWA 2FWBA 5DT9A 1JMKC 1M2GA 4H1UA 3KVNA 5TNXA 3VO2A 2BC9A 1OUMA 3EXHC 4DM7A 4FJ2A 4ZT2A 2GJ4A 3WK6A 2B8JA 4JYMA 2YRXA 1GPLA 4PX2A 2Z8YA 5C2JB 1NKSA 3VR5A 2GZ3A 2WAAA 4TYYA 1KMNA 3E7WA 3NASA 2BFOA 1O96A 3JASB 3LDUA 1AQYA 4Z7OB 3BICA 4K9PA 3BDAA 4L5IA 5GONA 3RABA 2VWHA 4B8WA 1XT6A 1ZRMA 2WMDA 2CB0A 2NXCA 4NPAA 4J9UE 1UPUA 2Q3JA 3DOCA 1DPFA 3AR6A 5FFFA 4YRLA 4ZPXA 5FAXA 3H2KA 3WO0A 4B3BA 5ITWA 1OA0A 3KLNA 4Z8XA 4LXTA 1N25A 1T24A 3OJLA 2RD2A 3DBRA 4H7EA 3LBAA 3C24A 1U5AA 2A1UB 3HTXA 2A1TR 3KJQA 2HMAA 1JEOA 2ZGVA 3HUEA 1IEQA 1E60A 1LDMA 1PT9A 4FZJA 1KTVA 4ACAA 1RQLA 2PMWB 3JQAB 4MLDA 3AX6A 1T1IA 3X1YA 5JQGB 1OWNA 3EQ9A 3LD9A 2AL7A 2GPNA 4G09A 5K0EA 2VUTA 2NQTA 4CN8A 4NSNA 5I7UA 4Z7JA 3RU9A 4U2GA 4LRYA 2ZDHA 1SQ6A 3DFZA 2A0FA 4ND1A 3I5UA 2AFHE 2LDXA 2V55B 4MS4B 3UTDA 3AVWA 1LLUA 3B20A 3DG9A 4W6ZA 3RS4A 3DBLA 4DLPA 1Z7GA 4KWTA 4V39A 4PZ9A 4X71A 4MHTA 3EZXA 1TGVA 4JP2A 1W19A 3INGA 1SK8A 4HS9A 2C8LA 2G9QA 1GNLA 1G3UA 5GM2A 3SYTA 3WX0A 4BL5A 1GSIA 3U37A 4GRIA 2DB3A 5PGMA 3COYA 4Q6WA 2X0RA 4U63A 5C8VA 1WMEA 3PCXA 3K9QO 4D0SA 2ONYA 4EA8A 3VYVA 2J5BA 1WNTA 4BAUA 4E31A 5AUPB 1DMSA 4G07A 4K6OA 3V4ZA 1X1QA 3PPWA 4AJ1A 3P19A 4IRUB 4HP8A 1Y7HA 5MHTA 3A32A 3M6LA 2IC5A 1QIGA 3LG2A 2XQJA 3OPYI 3S7ZA 2GT1A 3WB1A 5B1YA 2BE7A 3ZV3A 2JLYA 1COZA 1QK3A 4Q9HA 3DV0B 3V1UA 4CF3A 5CBPA 4J7AA 2O19A 3LUPA 4L7VA 1J0DA 3SX4A 1RWQA 2Q5EA 2DUWA 1L7DA 3QVGA 4V0RA 3RVSA 2IU3A 2ZRLA 3H8VA 1VPLA 5JCPA 1WTCA 2AFIE 2EFEB 5TMDA 1IZ7A 2Q2OA 1L5MA 1WHSA 2OCLA 4RKFA 2OK7A 1U7ZA 1T0UA 1JA0A 2Z04A 1CYEA 3PEUA 3HCBA 5LQNA 4I36A 2JJMA 1JT9A 3RC2A 3CCBA 1DARA 3T5CA 1K68A 2YY7A 1UMKA 3A4TA 1NP7A 2ST1A 4MR9B 1M8KA 2VLIA 3IV7A 4NU0A 3UJNA 1DZIA 2OWEA 3URMA 3AHDA 3GOQA 1DIGA 4OB8A 4Z9AA 5LXTB 4QUAA 1BZYA 5JI3E 1TA4A 4OQZA 3SQXA 3GGDA 3NP7A 2X6TA 2CXRA 1TZCA 2KSQA 1JDBB 3PD1A 3KPJA 4KIFA 3PJEA 5DX1A 5LOVA 3GDGA 4WK6A 4BO2A 2CJFA 1U1GA 2V7XA 4Q47A 5I8PA 2Q2WA 4GOLD 4QVKA 1OFUA 3V9AA 5FOXA 2ZZMA 1DGQA 4DJEC 4OHCA 1XJ5A 1EFRD 2I6SA 1ZN9A 4X9XA 5K4HA 1E9DA 1LKZA 1QYIA 2ATCA 4LDAA 5ARBA 2X8WA 3BN3A 3UEOA 1A8UA 4G0XA 2IIQA 2YQ5A 3WRXC 1FMLA 3L0PA 1KZ9A 1LWOA 2NUTA 4JR2A 3LC1O 2PN1A 3NM4A 4IIDA 1ZHOA 3WFZA 2HXSA 2ZLBA 5I9TA 4B32A 3PE4A 5E7MA 1IZ9A 5CU7A 4UVIA 2O8VA 3A9TA 4PG5A 2RHOA 3VKGA 1VCMA 2HWYA 4EF5A 4B3DA 2XMCA 2PUDA 3GPDG 3AW8A 2EG5A 1ADBA 3FJYA 3PNOA 2WTMA 3RS7A 1R0YA 4NLLA 3ZUPA 4BX8A 1WCXA 3U13A 4CMIA 2VHUA 2V9CA 3OE5A 2ZJZA 3NTVA 1DFGA 5DCLA 1KO5A 4YXFA 3KOYA 3GC6A 4X66B 3N3AC 1Z33A 3OMWA 4HI0E 1NVKA 2AE1A 2OECA 3CUYA 3ORRA 1J8MF 1B2RA 2IPMA 1SB8A 1SBNE 4JZKA 1DBIA 4PBSA 5DOVA 4QPJC 5HM8A 3IP6A 2PFSA 3U40A 2QYHA 2TMYA 3KXDA 4BQRA 2D59A 4Y2UA 3OJCA 4TZKA 1G4AE 1YS9A 7REQA 1SELA 3MMZA 2XXAA 4Q9DA 4JJZA 4YDSA 5TQ2B 1ESNA 1M9NA 5KTTA 3QPUA 2DLNA 1TU4A 4H18A 1M1NA 1ZVQA 3R5KA 3RS5A 2PY6A 4IIHA 3RAPR 2DFLA 4LGCA 4N7RA 2V7EA 1L7RA 4D43A 1Y8AA 2BFFA 2CMGA 4Q9KA 4JT8A 2M98A 1RWXA 2C4KA 4ZVTA 5C32A 2VK4A 3UH0A 1HOXA 1JKJB 4D4HA 1T4CA 1JB9A 1K0UA 2Q62A 4RS3A 3IKLA 2HDWA 1PQWA 4G81A 4P0PB 2ZUSA 2GRAA 3T5AA 3LO5A 3QRWA 3UWSA 4MWBA 1U1DA 1THMA 3ZQJA 3GIWA 4R98A 4IIJA 1OKKD 1B41A 2GF9A 3EDRA 5H59A 3ND9A 3QSYA 1PKEA 2WZCA 1G3QA 3DFKA 1U0BB 1O96B 4G1BA 4FDUA 4U5XA 2PEZA 3WWYA 3OEYA 3MRVA 3BXHA 2OV4A 2DF8A 5GONB 4YUVA 4B6QA 4GQAA 1JMYA 1KHTA 1Y4SA 1R2QA 4MLPA 4DCGA 4RY2A 1RSZA 3EIQA 4IFEA 4EUKA 3UOAB 1N6NA 3NJRA 2VWGA 1KE2A 5JXIA 1EFKA 2CVHA 4DCCA 3NANA 4LYHA 5B7QA 1JG3A 4A2QA 1GPKA 2J3HA 5JSYA 2CEKA 4C6TB 4J4TA 3COJA 4I5FA 1JR3E 2IITA 2PEYA 4I4LA 3OEHD 5AIAA 5KYYA 3QVJA 4K26A 1NYTA 1YF3A 5H80A 3WP0A 4GYKA 1SJ9A 3ENQA 1M33A 4PYLA 2E0IA 3SR3A 1W581 5HRUA 2QN3A 2C61A 2ID8A 1PWXA 1E2FA 5FWAA 3V34A 4Z4CA 1ZJWA 3D2AA 2GEUA 2Q4RA 1ENZA 1L5FA 1J70A 1T8PA 1RM4A 1IY0A 2HN9A 4HVAA 2WFMA 2CWWA 4ROTA 2AUNA 3DBLB 4RM3A 5FOUA 3EZYA 5CLGA 3IS3A 3OY7A 4ETNA 1L3BA 3MOIA 1MX1A 1XDSA 4GLJA 3ZN2A 1RQ7A 4AZVA 4EG0A 4EG6A 1MB3A 3CZMA 3TTSA 4YAWA 1W34A 3LMKA 4HVCA 2I2AA 1BYUA 3MCTA 4R31A 3OT1A 4M1OA 1OXSC 3EWNA 4J3FA 4GOMD 3E9MA 4LY6A 2FZEA 1Q0QA 1XFAA 3KYCA 3LUFA 1Q83A 4NJEA 3IUSA 4O4HF 1K7CA 1OH6A 1ZW6A 3LKDA 4LCEA 4ZZ0A 1F8FA 1HSOA 5U9CA 3A7EA 3WGQA 1ZD3A 3DHVA 3FSEA 3GLRA 2M32A 4NYMQ 5IKOA 3U7JA 4UHHA 1OFGA 1EFTA 1BE6A 1KYTA 3I5MA 3L77A 4LC9A 4C30A 4EYSA 2X19A 3RK0A 3ZPXA 2O0MA 4RSRA 3T9FA 3KDAA 4B82A 2R68A 3Q9SA 4EFMA 5FUBA 5KX5F 2QUHA 4YJGA 4L4XA 3STYA 5CBPB 4CWAA 5F9HA 1I1NA 4HRAA 4GBGA 2G7ZA 5CG2A 3KDPA 5JSQA 5REQA 1IEVA 4GHWA 3QJYA 1F0KA 1VKJA 1EVYA 2GD2A 2L0XA 4Z2YA 3ZBTA 1PLJA 4XGKA 3QKTA 5GVRA 3CKMA 4EMUA 1WHSB 1YR8A 1TCVA 3G1WA 3LY7A 5AKEA 1F8GA 3X2EA 1E4YA 5AQ1A 2AR7A 3ZNNA 1O54A 5SY4A 1J4AA 1QKJA 1W88A 1N1DA 3BF7A 3DLPX 2JLQA 2W93A 1QZTA 2EKBA 5J1SB 2MU1A 1CDOA 1MV8A 2DFKB 1GEEA 1TE2A 3KVRA 3IE1A 3HB7A 1V95A 1AS2A 3P9IA 3ZLTA 4BVFA 1CIPA 1OAKA 1U8FO 2XQVA 3IX7A 2A5DA 1KI1A 5CK5A 5LOVB 5AK5A 4LWQA 2XLBA 4D7AA 2QVGA 1DUSA 1JAHA 2QV0A 1BGVA 3D0QA 1AB5A 2E2WA 3L1KA 3SOZA 1XMQB 4PVDA 2GZHA 4ZEMA 1ZNXA 1F2DA 1KETA 1OWPA 4OHZA 1G8SA 1G55A 5EZYA 5LQJA 1P45A 1UPTA 1XN1A 2OSVA 1UKYA 1KO1A 4LRTB 4LYGA 5JG7A 3ZLUA 2RHHA 1SCBA 1UADA 1E2DA 4PNZA 5LDDC 3GFTA 5EMKA 5ITZB 5BQOA 1FNDA 3WGOA 4D56A 1IHOA 1U99A 1FMCA 1O5TA 2BM8A 3QE2A 4H77A 3MG9A 3FRIA 4I1UA 1B74A 2ZAOA 3LKVA 4B48A 3E9QA 3BXFA 3UMFA 1R0RE 5E6UA 3IUEA 2F8MA 1ISRA 1E1RA 3RV4A 3TUJC 2XCIA 4IZ6A 1J00A 1ZW1A 4TKMA 4JS0A 2JJ2A 4OU4A 4RMHA 1JLHA 2YHIA 3UUGA 4CMIB 5ER9A 2OC9A 4Y6LA 2OP1A 4MPRA 1JHQA 4CT5A 2P9YA 5ALHA 2QN1A 3IVCA 4DT1A 1ZUHA 1II0A 4LI3X 1Z0IA 1GRRA 1J23A 2OHVA 2QRKA 4GP6A 5E7QA 3GRZA 3DXZA 1RLTA 4DSUA 3FY4A 2JIBA 4KMSA 4V24A 5L3ZA 3W9YA 2HV9A 1A8SA 2N9UA 2X8BA 3ZUGA 3WGVA 1O0CA 2Y71A 2C5BA 2FQYA 3OC0A 4R68A 4W6QA 7REQB 3DXYA 3NONA 4I9HA 2XXAB 2B37A 1H93A 1K6JA 4CMAA 2HSDA 3HRIA 1DQYA 1UFOA 4ASUA 4XM1A 1M1NB 3OFSA 1ODLA 2PD4A 2WJGA 3IMCA 3LQ4A 1XCOA 1OIWA 4UU0A 1Q7CA 1IZYA 1JZSA 2ZEJA 4MWTA 5K03A 1NF2A 1V5GA 2BFFB 1GTSA 3ZBPA 1MZVA 1NLYA 3K1YA 5TPZA 2OBMA 3W2HA 2RBKA 2BGNA 2PUGA 3O4GA 1ORWA 3BULA 3FNHA 4MYRA 1P81A 1CP2A 3RWOA 1TLFA 4HXEB 4ARVA 2A2ZA 4M49A 3JQGA 3W5VA 3EDQA 4UTPA 3BWMA 4IIJB 5A4JA 5EAIA 2X15A 2RKWA 3NHSA 4GWKA 1XNQB 3LZDA 2FEMA 2GNOA 2Z5LA 3D5QA 4V03A 3UXHA 3KKQA 4CIAA 1HH4A 5F7XA 3ADPA 1SBHA 3AIOA 3R7WA 1A7JA 1FOEB 2H4HA 2KB0A 4JT2A 3RRNA 1NW3A 3R5SA 3SY8A 1KPHA 1N2SA 1N6LA 2W2KA 3M6WA 4HUTA 5JFOA 4AZWA 2IYZA 6ABPA 3AHHA 5DNDA 4TMYA 2XQFA 1FLAA 1X1SA 4ZHQF 2HK7A 3RHSA 3V4FA 1TU0A 1EE9A 4R1TA 2GJ8A 1MDBA 2R48A 3BE6A 5JCOA 4INAA 4PYRA 1FP7A 2P40A 5EZ6B 2WJWA 3VHLB 4D9HA 5KJFA 2YXNA 2NACA 4PG6A 5ARCA 1XSEA 2NTEA 5CLLA 5GOTA 4P98A 5KYYB 2AS0A 2B5OA 2IHBA 4U7GA 4UEJA 3WHIA 5LIPA 3E05A 3ABSB 2YOFA 3PE3A 4PXAA 1LK0A 1ZNQO 3HLKA 3I1JA 4UHFA 1YV9A 2DTEA 3OCWA 3FIJA 5HYVA 2ZDQA 3PGMA 1KOJA 4JMPA 1J8DA 3NAQA 2HA2A 4XFJA 3HXPA 4PRZA 4ZAFA 1N36B 1S7GA 3QIVA 1JAXA 2XECA 1N5LA 1EESA 2P1DA 1EJ2A 1E61A 2D00A 3M4YA 3TDNA 4B6GA 4BN0A 3NVKI 1R0BA 3NIFB 4KK3A 4QL3A 2QTGA 3S6JA 2EDCA 2XBLA 1B1AA 2BE9A 1EB8A 5CLFA 1RLMA 1ZMXA 5F76A 3NHBA 5I9IA 4G0YA 4NJEB 1XDBA 2H7VA 3NS7A 5EMNA 1NNEA 3RM3A 3WA6A 1TQ4A 3TJZA 2H6EA 2XDWA 3M34A 1YNOA 5BUSA 2ATEA 1H8HA 1RRFA 2ZB3A 1XTPA 3U9SA 2RHTA 2GCEA 3U3MA 3HO8A 3D8TA 3LUGA 3PT9A 1X9GA 3MCWA 2X9GA 1SCIA 2LNDA 3PEFA 4L28A 5KWIA 2VF5X 2NM0A 4IRMA 4LF4B 3O8QA 1PR6A 4YJGB 3T52A 2PX4A 3H6KA 1GP2A 4LGYA 4A3SA 3E18A 5KWSA 3WHPA 5AOBA 2I8CA 1TK9A 3F78A 1R0LA 3OECA 1N3BA 1V1JA 2JZNA 5REQB 3X3HA 4BN4A 3C6KA 4F9TA 5DMXA 5FNVA 2ZUVA 4OQMA 4MYTA 4IVNA 1E0JA 3TNYA 4MTCA 3RG2A 1I0LA 1NXTA 5BQ5A 3D54D 4ZVPA 1F06A 2VVTA 2ZVJA 3DD1A 4R71A 4FQ5A 4BPBA 1HK7A 2ZE6A 1E3JA 1KKLA 4B47A 3JD1A 4GWGA 1YB6A 3IODA 1W88B 5EJ5A 2EW1A 1RRPA 3IRVA 2VF8A 1RTTA 1I8TA 3OLZA 4X00A 4DXAA 4HVLA 1TD9A 3DVAA 2ZJYA 1UXIA 4UUQA 4FYJA 4G4SP 1M3SA 4HQ6A 3ZHYA 1P9LA 2JAWA 3CZPA 4HPJB 4BJ1A 1M2FA 2Z8ZA 4LZWA 4IWYA 3O9VA 5F35A 1Z6ZA 4AKEA 3ERCA 1Y7PA 3IO5A 3S4YA 5CT9A 1ZC4A 3RUDA 5AT1A 4OQEA 3GDFA 3X1WA 1E3QA 4WLNA 1Z16A 1QDEA 4LHXA 4XFDA 3SXPA 3HCWA 4FOOA 5AW6A 5EIFA 5KTOA 3JQCA 2AJDA 4JUDX 1WLSA 5EZYB 4OO3A 1YFJA 3HNPA 1Y5LA 3OTOB 1IEXA 4O2BF 1GYRA 4TPKA 4N6GA 2WJVA 4L16A 1U6IA 2A9PA 4QE3A 4H4EA 4EYOA 4IDCA 4FW9A 4DV4B 2PWPA 4DLTA 1MIHA 1TC2A 5IJ0A 2JFGA 1EXWA 3B5JA 4DSZA 2EWMA 1MVNA 3K5WA 3TD9A 1XTQA 4WY5A 1SXIA 3GY0A 1YIDA 1FFBA 3SHFA 2CNDA 2HSWA 1Y34E 1PVVA 2PIDA 3G1UA 4Z9FA 4E6EA 1N2ZA 2G70A 3INYA 4RXTA 1G3MA 1UMCA 5FHQA 2YHIB 4EL5A 4K6MA 1DUVG 2UYQA 3P7MA 4C4AA 4EM6A 1DWOA 2H31A 1YCFA 1JHPA 1JJAA 1FW8A 1NASA 1VLQA 3K9WA 4I4TF 4RJ2A 4D45A 2VQFB 1M8GA 2FPRA 4KQXA 5E7JA 4DT1B 1D2NA 1KOGA 2HGZA 3Q9UA 4TL9A 2IWHA 2QW8A 2XHZA 3H2IA 3O84A 2IYEA 2Z2ZA 2A78A 2VJCA 3IEXA 3O95A 2PZFA 2D2IA 4IHJF 5TQVA 3NAZA 2PL9A 5TS3A 3V6LA 2AN5A 5IEBA 2H5JA 3RAFC 4IO0A 1U1IA 4ZD6A 2P2GA 4IIGA 3WJAA 3BD9A 2FQQA 1EVJA 4RVNA 5EERA 5AVOA 2YC4C 2AMFA 5TX7A 3O74A 1GTMA 4BIMA 3NI2A 2QMYA 3KPWA 4XRRA 1T8WA 1F48A 1XZGA 3O93A 4HXFB 1JVBA 4ISBA 2C3PA 3KR9A 4WK0B 2G25A 5E0OA 3WRYA 4BFLA 5KSZA 3ZHZA 2FR8A 4HB4A 2M2IA 1UC5B 4ZTUB 3L8FA 3I37X 4JGIA 4CKWB 1IM5A 2PRSA 2AFRA 5G1NA 3RVQA 1PL6A 2J7KA 1JBKA 4NRDA 1YK1A 4Q4DA 2KLHA 3F1LA 3JQGB 4X62B 1ZOIA 2J87A 2AMYA 3QPBA 3QW2A 4RPIA 5K8CA 1P2TA 1BWQA 3ELDA 3IOEA 1C30A 3GJTA 3OCZA 3QPVA 1POWA 4XFKA 1YIAA 2ZROA 4NL4H 4RH1A 2QX6A 4WD3A 4MKGA 1WMAA 3R7WB 4GICA 1GTJ1 5AW3A 3I2FA 4ZZ2A 1CY0A 1Y1LA 1YSCA 3K70B 1H85A 4BAGA 4DS3A 2IV2X 3ND6A 4C2AA 2W2KB 3U7RA 1HFKA 2FW0A 3QPWA 1MJGM 4DLVA 2GK4A 1EK1A 1N6OA 3MEQA 4JQZA 4UXJA 5LB4A 1ULZA 3LBYA 4AMGA 4C6HA 5JD4A 4BEBA 5AW2A 3PXBA 2BRUA 2FWJA 1KEVA 3O4HA 4N6OA 4ZAVA 3KALA 2BI7A 2D6FA 1ZPDA 1TDJA 4IKOA 4W7HA 1QBGA 3W6ZA 1DXQA 1MJGA 3QLUA 5C35A 3ZBUA 3G0HA 2OCBA 4YXWA 2PUHA 1O97C 2ZRQA 4G85A 3WRVA 2HRCA 3SP1A 1AT1A 1KC1A 3KKNA 4G5RA 4XQ9A 1P39A 3AM4A 5HQJA 4NZZA 1T6NA 4D0RA 1GPMA 4RHYA 1B26A 1YVDA 4L8GA 3CE6A 1Z4LA 3RJ5A 3VR6A 2D8MA 2RG7A 4QWWA 1RI2A 3BIXA 5CRIA 5AXCA 3IBCA 5ICGA 3NHYA 3FTDA 3JWHA 4DLYA 1SVSA 1PP4A 4QUDA 1YU9A 1Z7BA 4V0OA 4WX2B 4I6JA 3BWXA 2JCGA 1QNLA 2JDID 5U1PA 1RYYA 2GCPA 2H18A 2E89A 5DBHX 1L4BA 4XDZA 2YL2A 2REXB 3LLCA 2HNAA 2X1HA 3KEMA 3G89A 4BVGA 5JT1A 1IE3A 4X8HA 1ZESA 3PJFA 3I76A 3EEYA 3HJUA 3FZEA 1S89A 3RODA 1YS2X 3DWGA 3RGWS 2GZSA 3S40A 1IK4A 3SFZA 4YV7A 5ILOA 2Z1NA 4IIEA 2AG1A 5GVSA 1ZVVA 4N8SA 1O94C 1R1DA 3HZOA 1DB3A 1T9ZA 3F98A 1DAKA 2GD1O 4LKOA 1B6RA 5KTNA 5AJZA 4WUTA 1GITA 4DSTA 4M8KA 4MUXA 3VO1A 5BWLA 3KPVA 1YJ5A 4MKZA 1NQOA 4EMTA 1TYDE 3O8QB 4K88A 2H4JA 1M66A 1OXTA 3NEAA 1XZKA 4QEKA 4ZJYA 1ZUWA 2IP2A 4V0SA 4ZAYA 3WFJA 2B8TA 2HPAA 4FGLA 2SICE 5FNVB 5F77A 4C7BA 2GBGA 1R6UA 2AH5A 4WN3A 4CE6A 1YQTA 3U62A 1N7IA 2A86A 5J47A 1IN1A 2EC5A 3I9NA 4HH0A 5BRJA 1X13A 2YFHA 4G89A 4R54A 3NNNA 5IK2A 1RPTA 2PUVA 1A9XB 3Q3GE 3AQIA 4GX5A 5KREA 4GXNA 2OXFA 2TYSB 3IGFA 1DBRA 2IIVA 4GP9A 3DVAB 2BTQA 4OUDA 4IIBA 3LOPA 2JLRA 4AJPA 2HRQA 3EW9A 4YV2A 1E89A 3OI7A 5AIBA 5HUHA 2D3WA 4IDHA 5KMGB 2CXQA 3EFBA 3HP7A 2E4ZA 2N1BA 4MWOA 1E99A 1L6RA 2B5WA 3MJSA 3WYEA 4AXXA 4BO6A 1SHJA 5GY7A 5HF9A 2QNRA 1CIVA 3L4EA 1A2BA 4OY3A 4JAVC 3N3BC 5F2NA 1UIMA 3W2GA 1TLTA 3I6BA 4GMGA 1ZFNA 2WHRA 4N0MA 4O02B 2XGSA 4UMEA 3BDVA 5GV8A 2HGSA 3F2IA 4P92A 1KA9H 2P6PA 5EHQA 4DTIA 1MC8A 4L1KA 4ZCTA 1QVRA 421PA 3JWGA 2I2FA 4TXHA 4AS3A 3L8MA 3GH3A 3TLCA 3IP7A 4L74A 4D4IA 1ITZA 1Q0ZA 5DBFA 2IQIA 4YREA 1PEAA 5IJ0B 1K27A 1Z6AA 2EHJA 4AT1A 2J67A 1WP4A 2D1QA 1EGMB 4M1SA 3I6IA 1VHJA 1G3IA 3S2FA 3THSA 4B4KA 4MUMA 4KN9S 3Q3HA 1KZ4A 2X7XA 1A4IA 1D0VA 5A5VA 2AUTA 1CJMA 1TUBB 1GARA 4ZVSA 4BNMA 3E9CA 4E30A 5IF3A 2HZBA 4REMA 2A92A 3O73A 3PRHA 4MHOA 3OBBA 3UUFA 4FZ5A 1S2IA 1LNQA 2V0CA 4GBED 5EUBA 4KQHA 1FC0A 3ZXYA 3A37A 2O8CB 1WQ1R 3P2OA 3L8EA 3QXJA 1OC4A 4S1WA 1P61B 4BVEA 1FQKA 2HT1A 2O3UA 2TS1A 4I3HA 1IB6A 1X1AA 1Y9ZA 2Q1YA 3KVOA 3MT7A 5FUXA 4G01B 1TIKA 1TZMA 1UKEA 4J4BA 4MLZA 5DN6A 1BS1A 1YB4A 3HDVA 3MBOA 3I28A 4ZQIA 1DJOA 1CF2O 3V7UA 4IIVA 3QPDA 1RC0A 3CJRA 4UXIA 2IW1A 1G8JA 4FN5A 1JLRA 4OXQA 3G9QA 4Q16A 1IN7A 1SKUA 5KIAA 4FSHA 1NUHA 2LKCA 1Z4OA 1IY8A 3E27A 3TCKA 1F5NA 1QVVA 4DA9A 1LNZA 3TPCA 3VYSB 2OQ2A 4WKGA 1XXHA 4GX2A 4UZEA 4M0FA 5A3VA 5KCMA 1B00A 4IWNA 4Z1MA 4D4GA 1BIFA 3OFKA 2GXUA 2WJ6A 2HH9A 3D31A 4OK3A 3N2GA 1F3LA 4CIWA 1U2DC 4L15A 3UFBA 1JWBB 2IYXA 1ZLXA 4H9GA 4HGPA 3C87A 3EG9B 4RL6A 3TSAA 4C0KA 1HQYE 3QYAA 3ZQ4A 2VNIA 4DLLA 4MI3A 4KRYA 3Q0EA 2FFRA 2V03A 3RUFA 4CFYA 3JSXA 5IVHA 5KZMB 3EGWA 1E3LA 4K9NA 1C30B 3ETCA 2WKWA 4GPZA 4UCWA 3R09A 4CQJA 1X7ZB 3WVNA 3G8BA 3AVPA 3N0XA 3KZNA 4C7JA 3B8EA 1X3SA 13PKA 5L3RA 3DWIA 4RM2A 2WC1A 4YAOA 5JY6A 1EVKA 1E4EB 1J8YF 5DHPA 5JJ5A 1X0VA 4J1SA 5LZ8A 4MW1A 2NZWA 5FEUA 1KYZA 3UN1A 4BJHB 1D2HA 3C5WP 1P4SA 3ZI0A 1Q0TA 5EI5A 1LBTA 3RKSA 1DAFA 3TBKA 9ATCA 2JKVA 3Q88A 1PZXA 1XPOA 3CIFA 2ISQA 2OTCA 5FBRB 3LWBA 1T2DA 3WFIA 2IH2A 2PKQO 4NH4A 5CURA 4IOJA 1W46A 1AA9A 2EIXA 1H94A 3PXXA 5B2EA 3RJMA 3R44A 3JQEA 1RVDA 2RG1A 3T8YA 3DHNA 1COWD 3ETGA 3BQMB 2XCLA 1A9YA 4P1ZA 3TGWA 4RZUA 1IEWA 3K0EA 3MC1A 3WJ2A 2CE2X 4EK9A 2BTEA 3TTVA 2V6JA 3L8YA 2I3ZA 3NBAA 5F1PA 2ZRPA 4Q6BA 5ALIA 5E38A 3ZI4A 5CFNA 2CLLB 2VK2A 1O9BA 1PS0A 1FQWA 2G28A 2MMCA 3GFGA 4PTZA 3B7GA 4KXYA 4BIIA 5B3AA 2OD7A 4FS8A 2WI8A 3A6GA 4I1PA 2YYAA 3BHJA 3O7MA 3UH1A 3UICA 1B6SA 3WGLA 2V96A 2P0AA 4YCAA 1ND5A 3W34A 5T3UA 3SDZA 3CUTA 1BW9A 3S7TA 3MIIA 1XD8A 3F8WA 2QN7A 1E2UA 3OX3A 3RSCA 4B8YA 2O3TA 2ZPTX 3ZG6A 4E5VA 2AK2A 1Q1EA 2C8VA 4Z7QB 4GZ6A 4YJFA 4E94A 1SIBE 2P6RA 2IFTA 4FHDA 2X5JO 1PWZA 3AY0A 1Y4AE 2YJTD 2FW9A 2QY9A 3FSRA 1G41A 2NSLA 4OXKA 3VR3D 1JTEA 1SZPA 3KAQA 5IAJA 1NOJA 2W83A 3I9FA 1ZJ5A 4OYRA 1ADFA 3HQ4O 4P7JA 1WDMA 1ZMRA 4JVSB 4PSUA 4KLNA 4E7OA 4O4HA 4QICA 5FD8A 2D0PB 2DMRA 3E2MA 2XYHA 3WDKA 3MHPA 2R60A 4U6QA 2DYKA 1CQPA 3USES 5JVDA 3R3SA 1Q6ZA 3OY2A 4S1PA 5DW0A 4EAQA 3QX3A 3LQ2A 4EFDA 3UK7A 4ZN6A 1WLYA 2JGMA 1J0XO 2EP8A 3IDAA 4B44A 2PSFA 3WYCA 1SKBA 1DRKA 1IH8A 3BJRA 3C39A 1WBDA 3GGJA 5I47A 1SUDA 1EE1A 1EFUA 4JB2A 3TD6A 1PT6A 1WUTA 1XVAA 3F6PA 2ZXUA 4OB6A 4F2DA 2D06A 2NSDA 3TH5A 4D9GA 2BTQB 1T3SA 3H8SA 3WLFA 3OQ1A 5DYIA 1D6JA 2PGXA 4RH3A 4XM0A 2VAVA 3M5WA 4M7OA 2VP0A 1V5WA 2WOJA 4NQRA 1BEUB 1QH1A 4GLLA 4OI0A 1T25A 3R5XA 2GBIA 3N39C 3SS9X 2E82A 4FR5A 5ED0A 3C8HA 3STWA 5JARA 3TRJA 4ZI2A 6CHYA 1OROA 4J0EA 3AESB 3HCEA 3L8HA 3IVAA 5LQDA 4J49A 2XWJI 1I4LD 4IEFB 3VUEA 2FEWB 3C6YA 1RCUA 3ER6A 4HATA 2BEWA 1XTRA 3KYDA 3U1TA 4M7PA 3C74A 2XVZA 3DMDA 1HXHA 3BK2A 1DHTA 2WAOA 1I7PA 3K6SA 3A4NA 4JMLA 1X14A 2OMEA 2FF7A 1I30A 4G1FA 1K63A 2Y1DA 3EH2A 4DJJA 1J8QA 1SD5A 3GG9A 1NM5A 2J48A 4UJ3A 5B6PA 1AC5A 3H04A 4DOMA 3FCAA 5FPHA 5ELXA 1NSYA 4RFSA 2XRYA 3C3WA 3RK4A 4RCYA 5HDBB 4JLOA 3WGKA 1WAMA 4NECA 1ZGCA 1QRSA 4JFAA 1SC9A 1D7OA 1FLDA 2YXEA 4KHPB 4JSYA 1P4HA 4QJ3A 1Z4JA 2IE0A 4OOEA 1RWOA 1TPZA 1X7GA 2WKPA 3FR8A 2Q5CA 2CXUA 2FPIA 1IUPA 4F11A 2J08A 3DT6A 1P1KA 3HGTA 3L1JA 2ZI5A 4Q3LA 4TTJA 4EKNB 3CZ5A 2MMGA 3SNHA 4RO0A 1L5ZA 3LCVB 1VJ0A 3L0OA 3G8YA 1WVIA 3T1YB 4U2BA 1DKUA 4WH0A 2IP4A 2X76A 2CNKA 4KE9A 4AIIA 5AM4A 4Y7DA 4DNXA 2YJ6A 3VDXA 3ZWMA 1GGVA 4RQAA 2Q2NA 1Y8ZA 2AOTA 4L3VA 4N7JA 3FGZA 3MT8A 3C5EA 4MUNA 4Q01A 5AM0A 5BRAA 1MAWA 1B2LA 3PX3A 3SE7A 4KR3A 2C94A 4QXMA 2XLCA 1GL6A 5AW7A 5INTA 4W8GA 2OB1A 3BL8A 5K2OA 2ZU6A 4KI7A 1AKWA 2AXPA 2XZOA 1XXHB 4ZJPA 1KAQA 1TJ4A 5K0LA 4CM1A 2OAP1 3HRKA 3K0BA 4QBTA 5AM3A 3P0RA 3UPTA 3STHA 1XDWA 5K20A 5A4MS 3EF3A 3H5IA 2P27A 4H6VA 2WJHA 5ERYA 4G0NA 1P6UA 2OCGA 2C2ZA 1ABFA 4E51A 1GHTA 1YUMA 3KJGA 4YRSA 2YBDA 4BYGA 4N65A 1FYWA 1HYHA 1X87A 3LECA 3G79A 5I4IA 1O94D 1RD4A 3VM6A 2FG7C 2ZBPA 3AWIA 3F49S 5K0NA 1Q1GA 3SLGA 2FPKA 2VDNB 3TZEA 3G2QA 2ID4A 1H22A 1X9IA 5BSKA 1OX4A 5BWCA 4C9BA 5F4BA 3L9WA 1ZKMA 4MDYA 1WY5A 1RIIA 2REBA 4MVJE 4RPKA 2UXBB 2TMKA 4KP7A 4RK6A 4C0XA 3Q5GA 1A69A 4GR9A 3TNDA 1GQQA 5TMBA 5BQXA 4NG5A 5JAIA 1ZQ1A 1ISFA 1PW7A 4DYDA 2HJWA 2ZS9A 1V3TA 4L5YA 4I0WB 2A1IA 2QUJA 3QY9A 1WUKS 3V8NA 1O03A 1XCBA 2YOGA 4LNHA 1UBKS 2F67A 3X44A 3TUZC 1T2NA 5JRJA 1F7UA 4J2HA 4BLSA 1NQAO 3NTRA 3U3RA 3EXEB 3ENNA 3LCJA 4ZHQA 2X4DA 2G8NA 5HR5A 1CR2A 1KKMA 3P32A 4W99A 4Z7NB 4I4CA 4BDTA 2WINI 2GYVA 3AVOA 3ESYA 2QUKA 4MDHA 4MNTA 3IT1A 2XTJA 4LC1A 2GETA 4PHHA 3G0CA 1UPAA 2XNDA 1US8A 4DWJA 1QYWA 2J3MA 1BCSA 2E4WA 2PSJA 3LH5A 4AY3A 5CDGA 3WAJA 1JDBC 1PJQA 1P7YA 1TOAA 2RHGB 3N0WA 2F64A 4BE7B 2RAVA 1NPYA 5BNFA 4HQKA 2ONKA 5BQ3A 3PHCA 5IH7A 3L9XA 1YJBA 2IYTA 2AN4A 2FFHA 3MD0A 1H6BA 1KZ1A 4KN5A 1ODJA 3IHWA 4WLUA 5IBPA 1BW9B 4EI2A 2YQ4A 4OP3A 3WNQA 4PYOA 1NTRA 2OCPA 4ZO4A 1N9KA 5JWHA 4BNFA 1R6XA 2O4CA 2VF2A 1L7OA 4D57A 4DIFA 4YJFB 3NTUA 3D6AA 2B98A 1JNXX 4CIXA 1X8LA 4CGZA 1XYVA 3GLUA 5HRCA 1KORA 2H9YA 3PVZA 2ZM5A 4Z3KA 4GKJB 3DE3X 4O4HB 1GG2A 4DAOA 4HWSA 5LDHA 4KPUA 5JVDB 3P4UA 3FROA 2PX8A 3NHAA 1QUFA 3V97A 3DMGA 4R1QA 5IP5A 1OJLA 3Q1KA 5ECWA 4R1UA 1SCKA 4GOND 2YJZA 1K3TA 3E2PA 5KX5B 3RIXA 2NSYA 3ONEA 2WM8A 2AJBA 2X0IA 4D1YA 1PYGA 1B3BA 1IRIA 3BZBA 2IF0A 2PZ8A 3KE9A 1RHRA 4CN9A 3ZNQA 3AOGA 2BHLA 4M98A 2NPIA 5C52B 4W5OA 2AFHA 1KO4A 3GLGE 1Z7YA 4JASB 4Q9IA 1G8YA 4IWXA 3NHUA 1Z6YA 3PHBE 4JI5B 1SOVA 4CR6A 3K09A 3BGVA 1CUFA 1QIIA 1NA5A 1E9SA 3K0FA 4UPEA 1QFZA 1W4LA 3GO4A 1NF8A 3F96A 4M9ZA 2FZKA 1NVMB 2WYHA 4LXXA 1VL0A 1L5HB 3R3HA 1SU6A 2IVZA 1A27A 5BR4A 4ETMA 1NJ2A 3N6XA 1YUBA 1DS6A 4DA6A 2BEWB 1TFRA 4DUYB 3KYDB 3FBTA 3DV9A 3U1VA 4TLAA 1SH7A 3IESA 2BM1A 4R7GA 4H1TA 1XO1A 2ZYWX 3K6SB 4GNRA 4QX6A 1YOVA 4M9XA 1EJ0A 1P31A 3L1HA 4TKVA 3QOYA 2DU8A 3AO0B 1Y89A 4LY9A 3R8FA 3H9EO 1E8MA 1MRZA 2H1VA 4O2BA 4RFSB 3HDHA 4D02A 2CV1A 4D4MA 4QBHA 2AFIA 4TTQA 1OLSA 1MKYA 1VE9A 2EOAA 4B85A 3O21A 1HT2E 2CXTA 1FDWA 1JV2B 2WE8A 1O6ZA 3LHFA 3LC0A 4LVCA 4RMJA 4XVQA 2G72A 5KC8A 3COWA 3RD5A 3AEZA 2PANA 3JQPA 2FPIB 3NHRA 1GCAA 1L4UA 1ZWKA 3I64A 3ZK9A 5K8TA 2BYTA 3E3AA 1G5IA 4KGZA 4QOJA 1JJVA 1GV1A 2IZ7A 4FHCA 3IDZA 4NULA 4RHUA 2PO7A 3E3NA 1QP7A 2XX3A 4P3OA 2BGMA 5HIMA 5T5QA 2W43A 3G23A 5MFZA 1YDFA 1HNXB 3TDKA 5AVYA 2B1RA 4TZTA 3TQSA 3FHTA 3KJXA 1P1JA 1QRAA 3O8DA 1P0PA 2ISSD 5CT4A 2AOTB 1WD5A 3FJOA 1BMFD 1ZMBA 3V1KA 4BNLA 3MGCA 2HDNB 3KQMA 4F21A 1QHSA 1GN9A 3MYRA 4GOJA 3PT5A 4IHJA 1TJ3A 3W5HA 4DQUA 3OZVA 2Z43A 4M8SA 5BR8B 4BO4A 2FQ1A 1CJBA 3CLHA 3EZLA 4K9QA 3AT1A 4KQEA 3FVWA 2ADOA 3MUOA 1EXDA 2Z6AA 2ZZNA 3WV5A 1Q2UA 2A59A 2A3RA 1V35A 3DDNA 4LNAA 3WMRA 5KVCA 1QDUA 4CFSA 1T8YA 4QG7A 1C81A 1ZBQA 3UAOA 1HX7A 3A9SA 2EQ5A 4NF2A 2EW8A 1Y98A 1YFKA 1KAOA 1WG8A 1JLLA 1FBNA 4LSGA 5EPUA 2NX2A 5K8VA 5MN6A 5DISB 3L43A 2I6TA 2NG1A 4CM9D 1EVLA 3N2EA 3OJEA 3WLQA 1OX4B 4PLVA 2FDCA 3IQEA 1MQAA 4KPYA 4NCIA 5G40A 3NFYA 1UPXA 3OE7A 3RDPA 3MJFA 4XX1A 4JBYA 5B58T 1IM2A 1NPDA 1ZM2A 2J6CA 3SZGA 5A06A 1T5DX 3KFVA 3TKYA 4CJXA 3F46A 4WSOA 4DIDA 1ZGZA 1RKQA 4FC6A 1K75A 1QGYA 1REQA 3CN9A 4JOSA 1NJSA 3MMSA 3W8EA 1ZOLA 4PYNA 3T3MB 4PPYA 4QEDA 4RTRA 3GWGA 2QM0A 4LX0A 3S8MA 3WMEA 4ZHQB 3FSGD 3UYLA 4C01A 3R7LA 3GI1A 3VMMA 4LF5B 3JQRA 5ERXA 1PUIA 4R1PA 2IE8A 2CYCA 1UBMS 1US8B 3DEIA 5HJ2A 3GNQA 1IG3A 4LXIA 4JD5A 3B36A 3LUDA 1GU1A 4BWVA 4XIJA 1RXSA 1W8DA 3VA7A 2Z83A 1E9RA 2A35A 2H92A 1RWKA 3MLAA 2OG1A 3DPIA 3KAPA 1NBOA 1QOZA 3B3FA 3EEBA 3LPDA 2TSYB 4PN7A 5CA1A 3LK6A 2IKSA 5L6LB 4HC4A 1LTHR 3CLTC 1JSCA 2IEGA 2XSZD 3SQOA 3OQOA 3MAJA 2XHEA 2G9ZA 4FYWA 3DVRX 3AEKB 2WT4A 2RGBA 1NN5A 1SUFA 1Y6RA 2ZXEA 1OFHA 1W9HA 1KWKA 4MQBA 1VBFA 3RVRA 3O92A 3WGGA 2FEXA 5GM1A 4LDJA 2D54A 2YFKA 1AIPA 3S5UA 4DBVO 1TFUA 1N33B 3O47A 4PFJA 5EL0A 1B0PA 1T4BA 1FUIA 2C3MA 3I9V1 1WW8A 3H0KA 4GP7A 2WABA 3N58A 4KPUB 4TN1A 5C1IA 3HDJA 4BFVA 2QQ0A 4RU1A 1WVMA 2I7TA 4LN1A 2V3VA 5EZQA 4QJIA 5JR3A 5M34A 2WICA 3DO5A 2P2LA 2UXCB 3T94A 1C7FA 2BFBA 4BX2A 1IUNA 1BKYA 2OG2A 3COSA 4ZEOA 2O8DA 5KWEA 3LWNA 2Q1TA 3AUFA 4HEA1 2B6HA 1GTVA 5GWXA 521PA 5EJ2A 1GG8A 3QVTA 3SJZA 5BOSA 3A25A 2AFHB 1V2HE 2GK3A 2FV8A 4FEAA 4H2DA 5AJYA 1DKQA 3JQAD 5AVRA 3KQKA 1OI4A 4JJ8A 2YXLA 3OVMA 1P7WA 3ILHA 2IXEA 4FJ0A 4LHZA 3C16C 5G0SA 2V6MA 4UU1A 4ICIA 1CEQA 5J2UF 1Z37A 4I1OA 3R4CA 4MB6A 3TD2A 1FF9A 1H2YA 1Z2PX 2Z4RA 3ZWXA 4AMUA 3K0FB 2OLEA 5E3HA 1AM4D 1G2QA 3MUNA 3R0IA 5I51A 1KTIA 3H5NA 4S0XA 4U2EA 5JPCA 1DBQA 3ZWWA 2HEIA 4X41A 5DBGA 3W2IA 3A2LA 4ML3A 1BC5A 5CT6A 4O0MA 4MAAA 1MGPA 2AOVA 4FJ1A 5F7ZA 2QD2A 5CAEB 3SF8A 1B4DA 1N3YA 3ZDYB 1OCEA 1Q0PA 1YOVB 2P30A 4S1VA 5B6IA 1DTWA 2HJRA 2QJOA 2YXDA 4TKVB 4EEKA 1YCDA 4RGQA 4Y0AA 4E1BA 2B2NA 4PO8A 1GAWA 1E3WA 3DPSA 3QGMA 4O2BB 5HGJA 3TOZA 5JROA 1NVXQ 4KO2S 3RWBA 2AFIB 1O5IA 4RX1A 3WBJA 3KDSE 3ASVA 2W2TA 4RVSA 3ZZNA 2ENWA 3BFPA 3HXOA 2ZRDA 1X1DA 5IVIA 4KQGA 5EHXA 3B89A 4F5DA 1X1CA 3RVDA 2YMMA 4KIWA 4N49A 1D8TA 3OF3A 2I78A 1HTBA 1Z6QA 3B3QA 5EPOA 3SX2A 4B17A 2RB4A 3O90A 1MW9X 5FRDA 2AMLA 4R40A 3K73O 5BVGB 1ZWLA 2VP4A 1ECJA 4NAHA 2DEUA 2G1KA 5EXTA 1C2YA 1XROA 2O7NA 3JVVA 5SY9A 4CMEC 1WXQA 1JL3A 1H1DA 4MWZA 1A98A 4MS1A 5CFMA 4FINA 1PFVA 3D3WA 1IDN1 1JT2A 2VP5A 3GLIA 1L0BA 3AILA 3FHCB 4Z53A 1OZAA 2WHYA 4V0QA 4IHJB 1C2TA 4CT0A 3V7YA 5KVQA 1XAJA 5I3ZA 5JMOA 2X23A 3FDXA 4PPQA 1GAJA 5CIYA 4WT7A 4HGRA 5K3OA 2ON6A 5HJEA 1Z17A 1H2ZA 2DR0A 1NY5A 3JQ9A 3R1IA 4MGHA 2FSSA 3Q6NA 5CPBA 2VF7A 1VPDA 2NSJA 4G25A 3G2JA 1HG1A 3RFCA 3U81A 5AW0A 3EASA 2Q50A 2Y1XA 3RYFA 2I6QA 4EHBA 1QZUA 1IQUA 2XMZA 5HHTA 4P38A 1LU9A 1DIOB 2R1UA 2AG6A 1IQ0A 2PVCA 3AF1A 1K5DA 1UEJA 4HPXB 4P35A 1T1JA 4QPCA 4JI6B 3RTBA 4M9SA 3SZRA 1JLLB 5FFMA 3ZIAD 4ZRMA 1UBNA 4LJSA 3SHOA 1P3DA 3SQNA 1XALA 2H1CA 3VTFA 3KBBA 2A9JA 2ZCVA 2EF1A 4R0VA 2ZT8A 3MA0A 2RGYA 3P2MA 4F5WA 4AW9A 2FXVA 3N2NA 1VHTA 3G2KA 3PGLA 3D59A 1M6EX 4DY4A 1Y82A 3DBOB 3SSNA 2VCHA 2EJWA 2YWJA 1DEAA 1H8EA 4E2ZA 1E2JA 1CZLA 4YHBA 4RADA 3L0SA 3CUUA 3IFSA 3RFUA 1EQAA 3HJNA 3TLYA 1KEZA 2C5EA 2VTBA 1WB6A 4DKJA 1REQB 3ROQA 4AS1A 3NDBB 1P7VA 3DW1X 1SKAA 2NSHA 4R9UC 5DYTA 1KAMA 4UTVA 3ANNA 2FWRA 4Z5XA 1HDZA 3RUEA 3SHQA 5AW4A 4Q12A 4PAMA 1N92A 2UZ0A 1XR3A 3DTTA 1I6WA 5DXAA 3BIFA 4CKCA 3HJRA 1PNQA 2BGGA 1WEHA 2QTNA 1DDOA 3ZLJA 2JAQA 2IT1A 1U0FA 2B7LA 2WBLC 1MPXA 3GGSA 3DDSA 3HHPA 1RBYA 4JL5A 2QLTA 3EVZA 5ALYA 2WZDA 4R5MA 2CLEB 4L8YA 1SUWA 3KT3A 1U11A 2BDEA 1FJGB 2V58A 2BFEA 1BVRA 4V2IA 4OXXA 3OBIA 3DULA 1PTJA 3ITEA 1A9PA 4K9DA 4MVJF 4DZTA 3RVPA 2C4WA 4N4AA 1EUDA 4NS4A 4XI9A 3T1TA 4U7PB 4JXZA 1HORA 2IHTA 2P78A 1T3GA 1E7MA 4MA5A 3R0QA 2YMQA 2ZTSA 4UQPA 1STOA 1DKPA 2QL9A 3ZIUA 1YJ8A 4NBRA 1FP1D 2FMHA 2DQSA 3CUEF 5C5DA 4QC2A 1KZGB 4EVIA 5EJFA 1PE0A 2D2VA 3C98A 3UZUA 3ACDA 3E5RA 4HGQA 4RFLA 4LF7B 4M1MA 3WGMA 2DWQA 4HXGA 2AHOA 3CEPB 3IERA 2NGRA 1I3LA 1FUKA 4FS3A 4XJXA 4OQNA 1PZFA 4GLOA 4TMZA 4R2KA 1QHEA 3PCTA 1M2NA 1ZI9A 2XTNA 3C3BA 3NDIA 4LYDA 1OHHA 1KK0A 4DJDC 2HBZA 4IM7A 3HU2A 3BM5A 4YLEA 1JI3A 3TAHA 1BJKA 1KYIA 4M88A 3LW8A 1T8RA 4OHKA 4RPCA 4UPDA 1Z22A 3DTVD 2PPLA 4O25A 4WKCA 4YAFA 4KX5A 3LF1A 1SGWA 2BFBB 1EK0A 2B2XA 5C80A 2O8DB 5HZGA 1DZ3A 4QA9A 4URZR 1ANKA 3IBFA 5K3SA 4MYUA 4OIFA 1VI6A 4KG7A 1JILA 1LCIA 2BKUA 2OYSA 1G98A 2OBXA 4LJ7A 4WXHA 5BOSB 3A05A 5DX0A 1O87A 3O1LA 2BEVA 1GZ3A 3LX6A 1JFLA 4NV3A 3GJ7A 5A5FA 1OGYA 4LRUA 1CEXA 4CL2A 2CBZA 4RBNA 2C7QA 1SZJG 1YB5A 2DKNA 2YWBA 4IBOA 3RTDA 3W8RA 7AT1A 3KQHA 3LY8A 5IDQA 2R8OA 2D13A 3N2IA 3FB1A 3I39X 3P5BA 4P3NA 5L7YA 4XWOA 2B20A 2FG6C 3AHEA 5EIXA 2DBZA 1I3NA 1ND6A 2ZRBA 1JFSA 3WGNA 1ADYA 1YMVA 3TIXB 2OESA 1WMSA 1SCAA 4E11A 5F23A 4BVLA 4KMOA 4B2YA 2ZBQA 3AC0A 4KQMA 3CXUA 5FLKA 1WSWA 2C1XA 3IAM6 5IHPA 1KEEA 5F3DA 1KQFA 1CQWA 3SF8B 1SVLA 4P80A 5JZBA 4XYBA 3EZ6A 2GCGA 2D1TA 3CW2A 1DTWB 3H9BA 3IQXA 2Y92A 1G64A 1SK9A 2H2AA 2JS7A 1X8JA 2Z6QA 3BHIA 4XLLA 2PRKA 1E3WB 3UJCA 2BM0A 3NAMA 3QFRA 1WXWA 4NX2A 2YWFA 2VDQB 3K70C 2NZXA 3GUUA 5IM4F 3KXPA 2A7XA 1CY2A 2RH4A 2Y1EA 3EEFA 4LK3A 4ZWNA 1DBVO 1QGDA 3GW8A 3EULA 2QGNA 1E58A 2FPMA 2WKSA 1L9KA 3OLWA 4J29A 3LZCA 1YZQA 3THRA 5GZ3A 1APBA 1AZLA 2OMKA 3GLFE 3E0QA 4BB0A 4Q37A 4OJTA 3L7KA 4NFYA 4EKEA 4HDOB 4U7FA 2W2LA 2Q9AA 3F5MA 4LV8B 5CB4A 3RCBA 2GBFA 1SURA 3CNHA 3RANA 5IABA 3LOUA 2P2DA 1JH8A 5C8YF 1MCZA 1OBVA 3ETDA 2NZVG 2GYUA 2P7IA 4HX2A 1XP5A 4YQYA 1ISGA