2BEVB

Reactivity modulation of human branched-chain alpha-ketoacid dehydrogenase by an internal molecular switch
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
341
structure length
336
Chain Sequence
b'AHFTFQPEYGQTQKMNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRSPWGCVGHGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAAEEVPIEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAKEKLGVSCEVIDLRTIIPWDVDTICKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHIFEPFYIPDKWKCYDALRKMINY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
molecule tags Oxidoreductase
source organism Homo sapiens
publication title A Versatile Conformational Switch Regulates Reactivity in Human Branched-Chain Alpha-Ketoacid Dehydrogenase.
pubmed doi rcsb
total genus 122
structure length 336
sequence length 341
ec nomenclature ec 1.2.4.4: 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring).
pdb deposition date 2004-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02779 Transket_pyr Transketolase, pyrimidine binding domain
B PF02780 Transketolase_C Transketolase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2bevB02
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2bevB01
3UK1A 2JLCA 1OZGA 1YD7A 2C3YA 1X80A 2BFFB 2XTAA 3LQ1A 2IHTA 3FSJX 5I4IA 1BFDA 1RP7A 3DUFB 5HYVA 1PVDA 2FN3A 2JGDA 3EXEA 4FEEA 4JUDX 4K9KA 1OZFA 3D7KA 5EJ9A 3AI7A 3E9YA 2Q5QA 3EY9A 4K9NA 3AHHA 4KXYA 1T9AA 2JI9A 4MQ5A 2C3PA 1PI3A 5I5EA 1UPCA 2EZ8A 1R9JA 2G67A 1OLXB 1OLSB 2Q5OA 4K9MA 2WVAA 1YBHA 4RJJA 2E6KA 1B0PA 2PGNA 5K3SA 4KXWA 3MOSA 1MCZA 1YI1A 5K2OA 1PO7A 1X80B 2BEVA 5HGXA 2VBIA 5ERYA 1OZHA 1POXA 5K6TA 2R8PA 1NI4A 1V1RA 2J9FA 2X7JA 4KXUA 4KGDA 2Q5JA 5ERXA 1YHZA 3HWX1 1V5EA 4ZP1A 3FZNA 2Y0PA 2UZ1B 4KXXA 3EXFB 1L8AA 2BP7A 1TKAA 3AHCA 2Q29A 2Q27A 3DV0A 3EXHA 5DGDA 4GPEA 1X7ZA 2QTCA 4JUAA 2VBFA 4RJKA 3OE1A 2BEWB 5I5GA 3IAEA 4JU9A 2R8OA 1YHYA 2EZ4A 1UMDA 1V1MA 2VK8A 5EJ4A 2BEWA 2YICA 2QTAA 1AY0A 3DVAB 3HYLA 5HHTA 1QS0A 3JU3A 2AG0A 3IAFA 3ZHTA 1PYDA 2W93A 1X7WB 1TRKA 1NI4B 1V1RB 2J9FB 1T9DA 1OLUA 2BFCA 2EZ9A 4GM0A 5ESDA 3DV0B 3EXHB 1X7XB 1Y9DA 2WVHA 4QELA 1GPUA 3AHJA 2BFBA 2G28A 2O1SA 2PDAA 2BFEB 2OZLB 4JUCA 4KXVA 1Q6ZA 2FWNA 5EXDA 1W85B 2Q28A 5I51A 1U5BB 1OLSA 1OLXA 2NXWA 4MPRA 2C42A 1UMBB 3FLMA 2R5NA 1N0HA 3OOYA 3LPLA 4XEUA 1UMBA 4JU8A 3F6BX 1JSCA 4MPJA 3KOMA 3EA4A 3ZHQA 4D5EA 3EXG1 3AHDA 2WVGA 2BEUA 3M34A 2XT6A 2UZAA 4K9LA 5EJ7A 3ZHRA 1QGDA 3M7IA 1OVMA 2VJYA 4JUBA 3F6EX 2BEUB 2JGDB 2VBGA 2G25A 4MZXA 1TKBA 3EXG2 1OLUB 2OZLA 4RJIA 2O1XA 3LQ4A 5DGTA 2Q5LA 2BFFA 2BFBB 4FEGA 5HJEA 1X7XA 3EXEB 1UM9B 2BFDA 2V3WA 2YIDA 1V5GA 3DUFA 2BFEA 2BFCB 2PGOA 2EZTA 2JI7A 2JIBA 1TKCA 1X7YA 4C7XA 1T9CA 1U5BA 1UMCA 1W85A 4GG1A 5EJMA 3ZHSA 1DTWB 5AHKA 4COKA 2C3MA 4GM4A 3DVAA 1W88B 3AHGA 3AHEA 2IHVA 2JI8A 2PANA 3ZHVA 1NGSA 1IK6A 3EXIB 2IEAA 1WCIA 1QPBA 1V5FA 1Z8NA 2IHUA 1UMDB 1V1MB 3EYAA 3HWWA 4WBXC 2XT9A 1V11B 1X7WA 2AG1A 3M49A 5C4IA 1POWA 2BP7B 4K9PA 2C3UA 2EZUA 1QS0B 3ZHUA 1T9BA 1V11A 1V16B 2DJIA 1ZPDA 2UZ1A 1X7ZB 5EJAA 3RIMA 1V16A 4Q9DA 4D5GA 1UPBA 4JD5A 3EXFA 4K9QA 1ITZA 5EJ5A 5EJ6A 5EJ8A 3LQ2A 1YNOA 5DEIA 3AHIA 5FEMA 3M6LA 2BFDB 5EXEA 5IMSA 2BEVB 3AHFA 1UMCB 4C7VA 1W88A 2JLAA 4GP9A 2VK1A 1UPAA 5K6RA 1UM9A 1WCIB 1DTWA 3L84A 3EXIA 2JI6A 2VK4A 2C3OA 3EXHC 4K9OA 1KEKA 1X7YB 4GM1A 4MPPA 4QPZA 4JUFA 1YI0A 4QQ8A 2C31A 3UPTA
chains in the Genus database with same CATH superfamily
2I9PA 4NMWA 4M1MA 3BT7A 4YLYA 4PYRA 2NN3C 5CYPA 4HX9A 4C0JA 1VE1A 2VTBA 4G25A 3ZNPA 3D3QA 3F6PA 4QUAA 3EXAA 2B8TA 3ZCTA 3NIDB 1R0YA 2FMTA 4EFKA 1G59A 1F7UA 1CETA 1G5FA 1BC5A 1X74A 2E87A 2B3TA 2PX4A 3KUKA 4ZKEA 3ZW9A 3SKYA 2LE0A 1E9BA 1QHHB 3SN6A 3ZWQA 1H9AA 3IGFA 4L73A 4MINA 3O3CA 3I58A 5BVHB 1SRRA 1T4CA 1F8GA 4OI1A 1C1DA 5DEOA 3X1JA 4DBVO 3TIGA 2H11A 4AROA 3O7WA 1KI1A 1MOSA 1DC7A 1O5IA 1QX3A 3FIJA 3DDCA 1ABEA 3G2HA 3MOGA 3NRBA 3C7DB 4RK7A 5A71A 3TW0A 5LPNA 3LCMA 3VOAA 3P71T 1K8RA 3QMVA 1E5TA 3LY9A 1Z6TA 3LO8A 4NJEB 4YGYA 2AMVA 4QDOA 3K9LA 1N6PA 2REQA 2J4DA 3NFYA 2WWTA 2QQ5A 1O6BA 3LHSA 4R5HA 3UV7A 4BGIA 5B53A 3SYMA 4HGOA 2X5JO 1ORHA 3QE2A 4EFNA 4W1PA 5MHTA 4MS1A 2LCIA 2C9OA 4H77A 2VDVE 2UXBB 1D5WA 4P1ZA 4PXYA 1FYEA 2GJKA 3MTJA 3FB4A 2GPJA 5EC8A 1FDIA 1W0CA 1E1NA 3HGQA 4M0FA 3CKLA 1WETA 4M8IA 1FMFA 2LDXA 4JB8A 1GU1A 4O29A 3RVKA 4WOPA 5KYTA 3HYSA 1HV8A 1S6YA 1DJMA 1Y4AE 2C5SA 1ZL0A 5KYWB 4EG6A 4OI4A 5B57C 4YFVA 4ZU1X 3DH0A 4U0JA 3EMVA 3LFUA 1SK8A 3HBFA 5TGZA 3SZLA 3Q8XB 4D99A 4DLZA 4CL2A 2UZ4A 3B5IA 2PQ6A 2ZITA 3PUKA 2CNWA 3AOEA 3WA6A 1O9GA 3ZWMA 4CT5A 2Y66A 3DEIA 3S44A 2DC1A 2ZSKA 3T61A 4INZA 3IEIA 1R5NA 3FPKA 4X91A 3AY7A 3KVOA 2YJ4A 3HV0A 3BGIA 3O26A 2EWMA 2L17A 5D84A 4CG0A 3I64A 1Z4JA 2DBRA 2H54A 4V0NA 5JSFA 1E3MA 1CHDA 4CLDA 4E7OA 4EELA 2NU8B 1RC8A 3K2QA 4UVGA 2VT3A 2Z8YA 3LT5A 5E9WA 4Z6KA 3O8OB 4ETNA 4NV0A 4RV5A 3CNHA 1RXVA 2WHEA 4L75A 4I50B 2MSCB 4XKJA 1E2HA 4R8LA 1QO7A 1ZH2A 4Z9FA 5EE1A 3UAOA 1CQIA 4FHEA 1H42A 3HABA 3KTDA 1OKKD 3F8TA 4LK2A 1FRFS 2F8LA 2YFYA 4DGSA 3U4QA 1XNRB 4U2GA 3ZCSA 1SCBA 4LSMA 4UNPA 3AILA 3TSAA 2Z57A 3U9SA 1WA5A 3NMUF 3DMTC 3DVQX 5EWMB 2NADA 3A9TA 5SY4A 4C7OB 4HQLA 4K26A 2I87A 3HY4A 3U31A 2ZSUA 4LNAA 3TRDA 3E5HA 4UHKA 1YO6A 4U6NA 3M4XA 3STUA 3IQXA 3AI3A 3L07A 3QE4A 2GZAA 1MPXA 2A6PA 1ZM4A 3EZ9A 4M6WB 4WKPA 4XOUA 2RBEA 2F00A 2OVFA 4EI2A 2H7YA 4GRDA 5AKHA 5B1DA 1O7JA 1Y4DE 4QPZA 2WZCA 4M55A 4F06A 1G5IA 5F23A 1ECFA 1OYYA 2WNIA 3ETLA 4XFKA 1XAJA 3Q2IA 4A8PA 3DJFA 2VQEB 3W77A 1KBOA 4FMDB 1BFDA 1JE0A 4WVLA 2APJA 2W37A 5DHUA 1FFDA 1I0ZA 3CZMA 4JWTA 1WPGA 3A11A 1HLDA 4K6OA 3LUFA 4Z1MA 4ZCPA 3T1OA 4L1KA 2CV2A 4L0QA 1Z06A 4G85A 4XWWA 2FF7A 4BDSA 2IOHA 5JU6A 1YVPA 1SQFA 1DOAA 4H59A 4S1TA 1H2YA 5IMSA 3IMGA 4Y2QA 4UM7A 1ODCA 1PSZA 2JATA 2N75A 4MUEA 1PO7A 5ILQA 2OENG 2B1IA 4GGOA 4IDCA 4MR8A 2EJCA 2PZ8A 4H4CA 4CFZA 1KQFA 3HFGA 5K6TA 3CVWA 2PUAA 3SCZA 1NBEA 1TFUA 2HFJA 3NONA 2Y68A 4V3BA 1TCVA 3QUBA 1T9GR 3LCRA 4EX7A 1P2UA 1USUA 1M6EX 3R6GA 1NXPA 2ORYA 3MMSA 3I6BA 1U7OA 1LVUA 3R0ZA 4BKUA 2YBEA 4YMTA 4NEHB 1BMFA 4MI6A 1RKBA 3EIUA 3MWFA 4BWVA 3QFSA 1OXTA 221PA 4PS1A 1EESA 4RMIA 2QA5A 2VKTA 2EWVA 1FJGB 3D43A 2W0MA 3Q3JB 4EHDA 2C5BA 2GM9A 5JZMA 2OQRA 2C88A 4LECA 2NO5A 1J07A 4DCMA 3OZ7A 4IINA 5LB4A 3V97A 2V55B 5KQLA 4O0LA 1WBJB 3F0TA 3L4BA 4PVDA 1U11A 4CEJA 3U56A 2GBCA 4II7A 5G4LA 3V8EA 3DNPA 1OT5A 3AOGA 1KOLA 3RVLA 1F3LA 3L6UA 4RTLA 4YJGB 3GHHA 1RQNA 1UFRA 5CDHA 5JISA 4OM7A 2VZEA 4REMA 4HNVA 1J70A 2QAGB 3S55A 4R8KA 5CLHA 3UUEA 2PWPA 2QVLA 5ABPA 3FD8A 1NQOA 4MKRA 5TMPA 3U49A 5C8YF 4JBGA 4R8VA 5REQB 2QVYX 2X1LA 3A1CA 4PHHA 3UFXB 4BKRA 3C1OA 4HVAA 5E2BA 3UK0A 3HXLA 4NCKA 1FJXA 3L7LA 4YPFA 2C59A 4JMPA 3IOYA 1UBNA 1SC3A 3V4ZA 2I65A 3CW9A 3K8QA 3PHGA 4QXRA 4RJIA 3RB8A 1SBZA 2BFBB 3F3YA 5H3HA 5EMJA 3AXSA 4AB1A 5JHGB 3FYSA 3VR0A 1BDIA 4GDMA 2PGOA 2YXDA 2BGTA 3PPIA 1RRPA 2HCRA 3LU1A 4PHCA 3RRNA 5AICA 1CDDA 4EA9A 5G1OA 1SMKA 2DB3A 4IIBA 3R9XA 2IHYA 4TKVA 5TQJA 1DCKA 3M2TA 2ZE5A 3T7EA 4C3UA 1QRTA 3ORQA 1ZN2A 3FCEA 3UA4A 4QZVA 2GLTA 1U63A 1PJAA 1FB5A 1YAJA 4Q3OA 4D6YA 1BRMA 3IB6A 1PGPA 2B4RO 4WZZA 4HN2A 1NN3A 4LDQA 4A5OA 4D25A 3GH1A 4LJAA 5K0SA 3HPRA 3JAKA 1I3LA 5T4BA 3PCXA 1OAOA 4JYPA 4MYTA 5DO9A 4UDNA 4CF5A 4XVRA 2N42A 4FGSA 4B3TB 1FFCA 2A58A 2R2AA 2H1CA 3W7AA 2CNDA 5TV2A 1EK0A 3LC2O 3JQQA 3ZWBA 4Q16A 4ESOA 3G2OA 4I7EA 1XMJA 4IHAA 2RHCA 1AKRA 1NDUA 3CKMA 3UPTA 1SUSA 5BR1A 4BECA 1X1SA 1VLMA 4DLWA 3AO0B 2YQ5A 4AY2A 5I9LA 1OA0A 3GW8A 1JDVA 4TOIA 1OIVA 3VV2A 3X0DA 1QHIA 4HQRA 3ZN2A 2OEPA 2Q4BA 4AWAA 4BVEA 3UXMA 3U26A 4HRVA 5CNMA 3KB6A 2R47A 1PUXA 1EI9A 4BIMA 1FTQA 4F4CA 1BXGB 3S5JA 2JFBA 3DZCA 1JH8A 1OXKB 1QZTA 3LBAA 3M3HA 2QEQA 1I7LA 3P7MA 1K89A 4NQRA 4YCLA 4KIGA 3TRJA 2RGCA 2Q1XA 2WMOB 3FVWA 2O7NA 4CCSA 3ZZNA 2BN4A 2COKA 1A7JA 3U3JA 4KWIA 5LLDA 4C06A 1EZZA 1ZNQO 1B76A 2AN3A 3L7YA 4B0OA 4KPUB 1LTQA 3B7WA 4AURA 5AIBA 4M99A 1CTQA 1SHZA 2NO9A 4OGFA 4A9AA 2IXFA 3BWYA 4GMHA 4MLZA 3ZE2B 4YBZA 1WMBA 3L0IB 5DCYA 1OTXA 5PGMA 3AR5A 2RIRA 5MDHA 2H9IA 3WRYA 2CYCA 2R8OA 4QPCA 3TEJA 3MMZA 4R81A 1ZJ6A 2ZANA 4UBJA 4BTVA 4Y1GA 4NENA 3OO1A 1JAZA 5H5JA 2F2TA 4V38A 1FVXA 2EX4A 4KRFA 2QG4A 4IUYA 2Q3DA 2PH1A 4PM4A 1IBLB 1R6XA 2D0IA 3TN7A 5LNK6 5AVXA 3L0OA 3TD6A 4LRYA 5DTJA 3F9CA 4MLCA 1BRTA 3HHPA 1XTTA 2EFHB 5J2TA 2FG6C 1EKXA 3O4HA 3E53A 1RACA 2QTTA 2D5AA 4EKGA 5KQGA 1BXRA 2EGGA 1YTLA 2QM0A 2XV1A 1KRXA 3R20A 2QLNA 1ELOA 2ZIFA 3GA5A 3PEFA 4HUQA 3U09A 3QFFA 1V3QE 1M8JA 3I9V6 3RRYA 3SAJA 1LBTA 3CSUA 5HILA 5I7RA 4DTIA 1NDHA 1HTBA 1AZLA 2HF2A 3KFXA 1YIDA 4K9SA 3F6EX 4ITRC 4Y2RA 4W5TA 2ZUBA 1G1AA 3OJFA 4B45A 1K7FB 2QN2A 1Y1RA 3VU9A 5JI3E 1AT1A 1NVMB 1JX6A 3D4PA 3IRUA 1DI0A 1ZW6A 3A06A 3WHLA 4NDAA 2WJ4A 5AFSA 4MJ3A 3DE1X 3P1JA 3QVXA 1NF3A 1W1WA 5BNTA 4GI5A 2QMZA 3O4RA 1HT2E 1U7PA 1Z68A 5DASA 1SFRA 3CLRD 1QHEA 4TYNA 2RH9B 5DCWA 1KEUA 3ZVMA 2FX5A 2FMFA 5K2OA 3NYWA 3PU6A 5AJHA 1ZLXA 1FFSA 1PZGA 4PSDA 1RM0A 1PJSA 1TCUA 2ZK7A 5ALZA 1PFKA 1TKRA 4ESVA 4FYVA 1ODTC 1P5RA 1ITZA 1ZIPA 1VXOA 3RT9A 4GU5A 3S29A 4E2WA 1VCIA 2DFDA 2P5YA 3JR3A 4MTCA 3L6DA 4XUCA 1J22A 3INYA 4OHOA 3L41A 1BDMA 2PD4A 3HNOA 4NPHA 2Q7DA 4FT4A 2VK4A 5FOUA 2XITA 3E9RA 3GPCA 1I2CA 4ZT3A 2GYYA 3D8NA 2J6BA 2JFWA 3IAUA 5IZCC 1YD7A 5F7XA 1H0RA 2AWNA 4MW7A 2HXYA 2ORED 2E37A 2M1ZA 3OZIA 4MVJP 3RVDA 1EBFA 1ISIA 1FP4A 2BDEA 2FETA 2HJ9A 1ODFA 3F5MA 3H99A 4FZVA 3NYRA 4A0FA 4YCNA 3HCPA 5JFGA 5A1JA 2V1XA 5DHFA 1WW2A 4DT1A 3H8SA 1E1YA 4CDNA 3RRZA 4D4GA 3IP7A 1H2FA 1KYWA 2XDWA 2NUBA 3BFKA 3PQ6A 2C9ZA 5IG2A 1T6YA 4IDQA 1GLNA 3ZEIA 1FDOA 4LJRA 5AW1A 4AS3A 5E8JA 4I19A 3UIEA 2YWDA 4BQOA 1SD2A 3DAFA 4HDQB 3KTAB 1TMYA 1SN7A 3IKTA 1V8PA 3WAGA 1MTZA 2C00A 5DGIA 5F1OA 1MX3A 2VATA 4EKIA 1CVLA 1CP2A 2KX7A 2IYZA 1Z16A 1DG1G 1NN1A 3BREA 3O83A 4DLKA 3LC0A 1Z56C 3IX7A 3KB8A 4ZYTA 2VDWA 3LUCA 4TZ0A 3R5SA 4QHSA 4XUDA 4OHZA 5KB3A 4A6XA 1UXJA 4KSYA 5I8WA 3JWGA 4AP6A 4CF4A 3QFCA 1RKUA 3FOAA 1ZH0A 5JAQA 3P4XA 1LBIA 4U2KA 4ZGGA 5LB2A 1TDJA 1KEEA 2P9QA 3LQFA 4L2IB 3PVZA 5EQJB 1OWNA 3FOEC 1YZLA 1OLUA 3BWBA 4XQCA 2PG3A 2YFHA 1BXGA 1N3LA 1QHYA 2Y1FA 4NCIA 3WLEA 2CK3D 2H5LA 2VZLA 3UMSA 3LFTA 1U2EA 4ILKA 4IJUA 5DHSA 3O9MA 1F17A 4MPRA 1UMBB 1C0KA 1GKLA 1P0QA 1DU4A 2FSHA 2NT3A 2XYQA 3E82A 1O58A 4P4SB 3N6RA 4RA9A 2ZIXA 1NU8A 1CDEA 2W9XA 4TS1A 3KE9A 3DG9A 2O5CA 3BJMA 1XO1A 5M2QA 3GIWA 1P45A 2X3FA 1N2ZA 5A7FA 1OVMA 3RUCA 1OAAA 4C5AA 4WNYA 3HR4A 4E4RA 1VM6A 4GZ6A 1Z7WA 1EX7A 1XZGA 1J33A 2XRMA 1XU9A 3AVUA 2BL4A 5KC9A 3AKCA 2OPBA 1KYQA 1M73E 1XZQA 3DCJA 5F78A 4B44A 1QP4A 5EWJB 3F1KA 2X0IA 4GSLA 3ZLTA 2BZGA 5DWVA 2PANA 3W78A 1KC3A 1Z4KA 3I6IA 3K9NA 3ZXIA 4RHCA 3O8BA 1E61A 3RU7A 3EG5A 4JI3B 3R5FA 2JLZA 1AB5A 2C8JA 3M49A 2XMCA 3H9CA 3HB4X 3MJVA 4MP8A 1T9KA 3PZBA 1YIAA 1VYHA 3WVNA 2ACEA 3ADOA 3NT4A 2AMLA 4MRMB 1L3BA 3F47A 1G19A 3QVUA 1BH6A 2C4KA 4JD5A 4IDPA 3RFCA 5EMNA 3FPBA 2OP1A 1YJXA 8GPBA 1VCHA 1EB8A 2WF6A 2YOFA 1YASA 1Y3DE 3HGTA 3IVMA 2D4HA 4RK1A 1KY2A 4ZU6X 3ZIUA 3DZFA 5DHRA 2AB0A 3HCFA 3JQRA 4HJRA 1FCJA 2QSJA 1WZUA 2VNSA 3UMGA 1PIWA 2AVDA 5DIZA 2JH8A 3H9GA 2NVBA 1F38A 1ULBA 1X80A 4HNUA 4EW2A 3UGQA 2PTGA 3VU9B 3MS2A 2PYIA 4HQ6A 3RU9A 5L53A 1A69A 5LBUA 2ONYA 5LQKA 2HW8A 5KCMA 4JUDX 4L72A 4NMHA 3WOHA 4DQ0A 1NZJA 2G8LA 3LGSA 5IJ9A 1V2GA 2V0GA 1DCFA 1K97A 4YONB 4FCCA 2WQ7A 3CZAA 1D2NA 2EP7A 4QECA 3AF4A 2I2WA 4AJKA 3GUYA 4Q9JA 1FUEA 2LCFA 3EDCA 4QUBA 1FDWA 4KLAA 1Z7BA 3M5DA 4K81B 4QE3A 5EZ5A 2R0QC 1CJMA 3AESB 1C4XA 3GGOA 3WZMA 3VVCA 1E3SA 2AX3A 2R6HA 2XUKA 1ZWKA 3JW8A 4DJJA 2C77A 3M6AA 3CLVA 2Q2VA 1UC9A 2WYOA 1AB6A 4I2NA 2BGKA 3EBOA 2UYYA 3G88A 1E7YA 2FQ1A 4OI2A 2O1WA 2PJZA 1WHTA 2FPPB 3LQYA 2G63A 1M2JA 1E3WB 1QGUB 4JJ8A 3K0CC 4G8JA 2VSXA 1RP1A 5I5GA 5T4HA 1KO1A 1XOIA 3WLSA 1L4YA 4DCJA 3F73A 1E3QA 4YX9A 2OXCA 1I7SB 1AY0A 2XQJA 2PD6A 2L69A 2IPLA 1UBFA 3V4VB 1P4HA 1UBUS 1W9MA 2B9VA 2JHAA 3SBOA 2AG0A 3NH9A 2WTMA 3DYIA 3Q0TA 2WW8A 4INJA 1EUZA 1EM8A 1ECJA 1UL1X 1YZYA 4J0HA 3GJ0A 1EGAA 2AF3C 2JBAA 2UVQA 4S05A 4F8YA 3GFRA 4RDIA 4UHHA 4KXVA 3WKEA 2I67A 2FRXA 5DSXA 1KWGA 4FDMA 4TKVB 3RGWS 3VFDA 3W2TA 3WE7A 2W2TA 3GUVA 2YYZA 3CU5A 3ORFA 4FYHA 3EJ6A 4H7FA 4CM3A 4PFSA 3I0ZA 1WMFA 1AA9A 1NXOA 1VHJA 1X1DA 2WHYA 1SOAA 1Y6GA 1YS2X 2C9BA 2V4MA 5C8YA 5C8XA 1CC1S 4GLOA 1APBA 2H29A 4UBNA 2BEUB 4GZ5A 4RFSA 3FMOB 5EYPB 3OPVA 3CEPB 4BY9E 4PYQA 2ZBDA 4CQLB 1WVGA 2CKMA 3VYRB 3QBJA 3BM5A 4H0NA 4CDRA 5HX7A 3W3ZB 3I39X 3IJRA 4FINA 2QVXX 3NHUA 5B64A 4IRMA 5ALDA 1M1XB 1W85A 4EVSA 4DIMA 3STYA 3W5SA 4GM4A 5DM70 1UC4B 4IXWA 3GPLA 4Z0TA 4JUIA 2IXTA 2R79A 4FNOA 3S2GA 2AFHE 1U9YA 4AK9A 5JAMA 2MT9A 4KAAA 3H1PA 4Q21A 2WSMA 4Q4AB 4TZKA 3SBEA 2CCGA 1K6XA 3DBLB 1HETA 5EKSA 5F9MA 3VVLA 1AC5A 3V8VA 1RRVA 1EE9A 1I8TA 2OBFA 1N32B 2X8LA 3DB2A 1AQLA 3F67A 3FX2A 3OZXA 1X6VA 3OEED 2YUIA 1NC3A 5DZSA 1KIAA 2B7LA 2DKFA 3L6BA 3UWPA 4YRZA 2PZMA 3PFIA 4IJMA 3RLIA 1MFZA 2QRMA 4JP2A 3CWZA 4MR8B 3WRWA 2FW6A 5FR2A 1GNQA 4G5GA 1QIGA 1J1ZA 2G0TA 7ADHA 1VHTA 3TDNA 5JH7F 3EOBI 3HNPA 1SULA 2NIPA 3MS4A 4YMGA 2SCUA 4JVNA 3ADPA 3PDCA 1S7GA 4R4JA 4GZLA 5KQMA 1JG2A 5K6AC 3NBXX 4RHXA 2WU3A 1GCGA 4JAVC 3U3ZA 3ZG6A 2GAIA 2OHFA 4RSHA 2X3UA 2ZGVA 2VXCA 4K6CA 5ILOA 3THYB 4RXUA 1KZYC 4U63A 1RC0A 2AT1A 1Y3CE 3GFPA 3B89A 1UJMA 3MS7A 3M1AA 1BCRB 4LFCB 3CE6A 4PYKA 4OMDA 2ID7A 2O0MA 5HK9A 3IXMA 3LI2A 4BWYA 1TT5B 1VB3A 1WR8A 4FR5A 4X1YA 3GC6A 1UBMS 3GJYA 2FTKE 1GKYA 1HPLA 1VL6A 2CMKA 2H5EA 4GLFA 5IFKA 4RFLA 2QGNA 1Q16A 1VYTA 1GO2A 3OIYA 2Z4RA 4MKXA 3HCCA 1TKAA 1ZMOA 3NTLA 4IXTA 4MV3A 3GROA 3RTBA 1RWPA 3DOIA 3SEFA 5B55A 2OGWA 3P4UA 1I7NA 2Q6KA 2PZEA 3F7TA 1QYDA 4TWZA 1Z82A 3SHQA 4JU9A 2DETA 5L3VA 2A14A 3E7XA 4Y3UA 3R9XB 1XTRA 3QLEA 4MR9B 4BGUA 3WLKX 1VCMA 1P33A 2QYTA 4LISA 4MUJA 1XGKA 3RJ5A 2KHZA 2EP5A 5TEVA 1QS0A 1B23P 1D9ZA 1R12A 3EIFA 2OC9A 1JILA 2I2DA 2QWXA 3OF2A 5AXCA 1M5RA 5KYYA 5ALUA 1WE2A 4TYYA 3IPAA 4FDTA 1JJVA 5AKEA 3ZCQA 3RYHB 4B48A 1LBHA 4XIFA 5A0VA 2ZI7A 1H3FA 3JWJA 4NOKA 2RMKA 1G4AE 2HFKA 1YCHA 4G2TA 1FS4A 2A9KA 4X3OA 4ECAA 5D6NA 1HNXB 4UU0A 2ATIA 3ZXYA 5H3LA 4WNAA 5CXQA 4MULA 3JX9A 2BDUA 1KGDA 2DFLA 2H1OA 4YP5A 1V3UA 4IJVA 5DF1A 1IBRA 4KGVA 1GFWA 1VBKA 1ZESA 3M6VA 4OYYA 1V5IA 1PR4A 5A9RA 1ZFNA 2D8AA 4Q3EA 4HFNA 4JLNA 1NNLA 1ZUNB 1N6RA 2H0QA 1T5DX 3A10A 3QKSB 4OM8A 5JD4A 4F9TA 2OZLA 2Q3FA 2PSJA 1Q7BA 1BROA 5KSWB 1PZEA 1L8XA 3WKAA 1N5DA 1A5SB 2JNWA 3H8JA 5CCBA 4MDFA 1HFJA 3CVJA 5AXBA 3TZHA 2ZUUA 4F8JA 4DR4B 3OUZA 5KNBD 2XGMA 4IS3A 1HNZB 4F92B 2YJNA 4YGXB 2AW3A 1JPNA 2V7BA 1LSUA 4WJZA 4RVOA 2IFTA 4OHXA 1Y1LA 5T67A 5HG0A 3ZHVA 1OMOA 1NGSA 4YJ3F 3AFIA 3TKAA 3JWEA 4BP3A 1EFRD 1EXVA 1P2SA 1QKKA 1TYDE 3OZWA 4JHLA 3SS8A 1A97A 3UCFA 2PZLA 3MUFA 4XLTA 4OUDB 1ZGJA 2VYQA 4PAMA 4RVNA 1ZNYA 3V9PA 1IE3A 3DULA 5FTWA 2C4NA 1Q19A 1LQUA 3CA8A 3EC1A 1R8SA 1FP7A 4LC1A 4WASA 3UW3A 3WL7A 1KAGA 4HGNA 4XWOA 1GLGA 4LDJA 5U4XA 4G0YA 1RE1A 1QHNA 3FMGA 1BG6A 4J43A 3AKYA 3UK2A 1Y5RA 2NV2B 1MZVA 3UHAA 1YUBA 2FQQA 3UAGA 3H84A 1G3UA 4M0DA 4R05A 4DADA 1F0NA 2MSKA 3D6JA 3GRCA 3O8CA 1DOHA 2PS9A 4UKDA 4D82A 2ZQYA 3PEEA 1MIHA 2DGDA 2YYAA 3WXMA 4B79A 3NRJA 4I9NA 4F6RA 3TW8B 2VJAA 3TPFA 4M21A 4EYKA 2JLBA 4QKQA 3L77A 1F2DA 4US1R 1FDRA 2PLFA 4A36A 2V5AA 1GGKA 1A4UA 2H1IA 1GAXA 4V0LA 3SX4A 1F9EA 5K3SA 1A8HA 4CIAA 1MCZA 6ABPA 3IVXA 2OXTA 2NTEA 2CNKA 2TYSB 3L7JA 4E5DA 3DGFC 3QVWA 3RVNA 1TUIA 4CF6A 1QVZA 1A7UA 2H3EA 1S8NA 2X8BA 4HEJA 5IP5A 4M9SA 4IXNA 1ODLA 4ZYYA 2UXCB 1UK7A 1VL5A 1OT3A 2V74B 1M34E 3H18A 5IYZF 4FB4A 2RJ3A 4QU0A 4GZ3A 1ZD8A 5JCOA 3ZZTA 1ZI6A 4LRXA 4D8YA 1CJUC 1QHFA 2ZXEA 3AG5A 1KE2A 1V8OA 3RPEA 4JITA 4Z53A 1OYVA 1QAQA 2F43A 3G8AA 3P2MA 4HTFA 4DDVA 1OV6A 3D3WB 4JZKA 4A0SA 1J1IA 3BGVA 4OA5A 1KS2A 1SEPA 4BO6A 1P74A 4ZU3A 3TUIC 1VL0A 4TX1A 2PL1A 5A2GA 5ADVA 3NHAA 3R8CA 1YRQA 2CVHA 5I7WA 1ZP6A 4QGBA 2JFGA 1KY5A 1P72A 4LHZA 1X38A 4P5EA 5HF8A 4A5SA 2MSDB 1JSCA 4LXTA 3WGIA 3GLHB 3E2MA 1EA7A 1BX3A 1NBMD 2NTVA 4B6FA 3AJEA 4ZK2A 3IBFA 3H4IA 4MWBA 5ALIA 4FFBA 3SMQA 3FAZA 3JTEA 3A3OA 4O5OA 3IVCA 2I3ZA 1E4EB 1UKYA 3MGGA 3W4KA 4TTQA 5KU1A 3UKOA 4RZHA 1L5FA 3DKRA 2RI6A 4MPJA 2ZKIA 2PY6A 4GVLA 2YYSA 4LG1A 3ZHSA 1JEYB 4H0FA 3H8VA 1GFSA 2YXLA 2ID8A 4Y6OA 2W70A 1KGSA 5GIOE 1QRDA 5GZ6A 3VKWA 2ECFA 3OLYA 3E8MA 3L0ZA 4ZT2A 3JPWA 2ONJA 1MBZA 2UUPA 1IRIA 3PR2B 2E49A 1Z2OX 1E5VA 3O90A 3R44A 4NFSA 3WGUA 2WSBA 4IHJA 3QVLA 4DC0A 1ENPA 2QLMA 4AULA 1G66A 4JQCA 4RUKA 1U7XA 3W8FA 2RGAA 4FHGA 1GA4A 3OT5A 1CUBA 4KMRA 5IK2A 2C9DA 4KPFC 2RBGA 2P6OA 2ZAGA 4DJEC 4YCSA 2GT1A 3ETDA 5GPBA 1QGZA 4OY3A 1CQXA 2QYOA 3KQVA 3PUWA 4DVGA 2X0DA 2HQ1A 2CXNA 2ZB4A 4JLVA 1JHAA 5ICGA 2CXSA 3KU1A 4HPWA 1B0UA 1BX1A 4XJTA 4OUKX 2OGZA 1YBVA 3ROXA 3M1IA 1GHTA 2R1TB 3ZLJA 1BVRA 1KVUA 1UIRA 1YB2A 2SBTA 3A6HA 2QMUA 3EOZA 4IJ6A 4MQEB 4TTVA 1T8UA 1HE5A 3UK6A 4YP9A 4GWGA 2B2CA 3DL4A 4GL2A 1U04A 2E4VA 3UB4A 4HO1X 1JLSA 5EERA 2GEFA 4RJTA 4XSHA 3GYBA 4BDTA 1FVOA 4Y6LA 5FULA 2RH8A 2WIBA 3I3SR 4Q1EA 3PQ4A 5CDTA 1USVA 2FZLA 2XUGA 3W8RA 1Y7LA 2CLHB 3AJAA 4ZI2A 2B7BA 5DN6D 2PSSA 2IS4A 1LWNA 3F4LA 3H6HA 3GLFA 3WBFA 4E12A 3WNQA 1RXCA 2KPOA 4IIDA 1ZAKA 4TRJA 1CP3A 3OQMA 3MM4A 1X2BA 2O2XA 3BULA 3CLTD 3NYIA 3GJ4A 5K0TA 3FKSD 2AOUA 2WIJA 4BYMA 4KO4S 1FSPA 3SJBA 2QD2A 5AKJA 4ARZA 1EVYA 3DV0A 4RF5A 1KRHA 3WK4A 4BO3A 3O2QB 5IWCA 1DC3A 3QRWA 4KFUA 5BYJA 2IYUA 4XDGA 3I37X 4D0SA 2DU8A 2V5UA 4NJMB 3I9KA 4BO4A 3V4PB 3R5XA 3DDHA 2WWYA 3DL0A 3RHSA 1FPMA 2DQZA 3U37A 3P2EA 5DSTA 1FTNA 5CM2Z 2VYCA 1G9TA 2G6TA 2O9JA 1ZJ4A 3THSA 1SOUA 4OXNA 3WNVA 4G86A 1LNZA 3GRPA 3N2YA 1NJ8A 2BFCA 3P9RA 1CDZA 2K6GA 4HT3B 5L8VA 1E7QA 2BMJA 1KI8A 5BPHA 4S1NA 2OD9A 3NANA 5KYXA 1XEXA 2COEA 3B1JA 4B32A 1T10A 3R41A 4I1PA 4HWPA 5DCUA 2B36A 4Q3LA 5HBRA 4LHYA 1ZCBA 3J81A 3UFXA 5B2ZA 3ROPA 3W5JA 2XE4A 1LK7A 1RLTA 2FPSA 3OE4A 4PG7A 3LKVA 2PZGA 4M7OA 4YUVA 1E7SA 4IMIB 1KI6A 4KI7A 2QVGA 3K5IA 5CFNA 2GXUA 3R0VA 4QUJA 5HZKA 3QPVA 5KNCD 3ASVA 2CHUA 4MW9A 1Z4NA 2QQ0A 3TK1A 3E22A 4ZJYA 5BSFA 5C5EA 2JJ1A 1YOVB 2X1VA 4PLZA 2PCJA 3NTUA 1P5JA 2Z5GA 3IUJA 2J7PD 1DKQA 4IGKA 2VJMA 4KI0A 3WNZA 2PBFA 5E95A 1ECGA 3DDWA 3FYDA 3QGMA 4PIMA 2W98A 4W7SA 2PEYA 3ZR4B 2BONA 5AJXA 3K5WA 5BQPA 4HVTA 3ZHUA 3UAWA 4CUZA 5FRDA 2ZR0A 3QFTA 3D6MA 3STVA 3BDIA 4LI0A 3VPFA 1X8KA 3LS2A 5CJJA 1Z74A 2W2OA 4B6SA 1BFUA 3RT7A 2BUBA 3TLYA 3TUJC 2SKEA 1ZUWA 3A36A 2RARA 2X0FA 3S1LA 1JYFA 4UE6A 1SZPA 3LBNA 3ZC3A 1G4UR 2CMFA 3PUZA 4AL4A 4EP1A 3A4LA 4LYHA 3RH0A 1P2BA 4DXAA 4EB6B 1MP0A 5CIQA 3K6KA 3ZDBA 5L51A 1P4RA 5ICCA 3SPXA 1PG0A 2VJNA 5JNLA 2AZTA 2B8EA 1VIDA 1FRVA 1R9GA 1WLSA 1BE0A 2BGJA 1Z4OA 1DO2A 2QRZA 2VTDA 1RTTA 4JH0A 5JMTA 5JWOA 3N0WA 1UK9A 3MB5A 2C1XA 5D1NA 3QKUA 2ZBPA 3W5AA 4ZAYA 4OH1A 3KAJA 3ZIAD 4K9KA 1Y7IA 3QUSA 3GLVA 1CJBA 3R74A 4COOA 5K8CA 1ZMXA 3V6MA 4N9WA 1I6LA 2E1PA 2VP5A 3MD0A 2AKEA 2Z0MA 1GAJA 1F1JA 3NORA 4WK4B 4G0WA 1YBHA 1GGVA 3U81A 4PQRA 3L7MA 3FUTA 2ZRBA 2QTNA 1U7HA 1TJ4A 1QC5A 2RC5A 3DTVA 1XEWY 3PD1A 3P9QA 3R6LA 2JK1A 4FKBA 4I5EA 4WH0A 3USES 4BNIA 4F8EA 2WYIA 4LRUA 4N6OA 2HF7A 3LYLA 4KXUA 2YRFA 4MRAA 2B78A 3ZBTA 1ZUD1 4BUJA 1J42A 1HSOA 1D04A 1IEWA 2PLAA 4E4YA 4BKMA 5EIFA 2YHSA 2CLCX 5I7EA 4TSFD 2R87A 3MJ4A 3QJGA 3UCXA 1QP0A 2GHQA 2PUEA 1K75A 2NYRA 3WQHA 3L0PA 4NCHA 2CHVA 1PNOA 3S5UA 3AJ9A 1TYZA 2E4XA 3NXKA 4AC9A 4DNOA 1VP3A 3ROMA 3Q41A 3ZGYA 4HP8A 2QQEA 3JQ7A 3VNUA 1RXYA 2Q3HA 4WZBE 1V7CA 4WPGA 4TTPA 1ZJJA 4Y1RA 1E94E 1ZGBA 3EVFA 5B7PA 1XU7A 2NXJA 3OSUA 3TRFA 1O95A 4CM1A 1PJ3A 5TPWA 4W99A 3D4LA 2WSSD 3O1JC 1D2HA 3SVZA 4PR3A 1FFBA 2CXRA 4YV0A 2AN4A 4LXHA 1E6WA 3AVXA 4E09A 1VJ0A 1X9IA 1G0NA 3OA0A 4OHPA 4RENA 2E89A 4JT9A 4U9UA 1KJ9A 2FPUA 3B78A 1XTKA 4Y1FA 2FCAA 5AVKA 4RTKA 4BTLA 3FCOA 3EZ2A 4ID9A 1E9VA 1YJ5A 3R3JA 4M37A 4X7BA 1UZUA 1TO6A 4U00A 2OGSA 4GUAA 3R7WB 1LDMA 4NATA 1ZRSA 4J29A 4V02A 4H31A 3MVEA 2DG2A 3FH0A 3K35A 4WW0A 3E27A 1BQ4A 3WLTA 3JVEA 4BBZA 2D2IA 1W30A 1YUNA 1NR1A 1X19A 2D4AA 3T3HA 5TGDA 3ANMA 1Z2DA 4CTKA 1Z5ZA 1JE1A 4N03A 5E6UB 2VCHA 1E79D 1GT6A 1JHRA 2FN9A 2WD9A 4FGKA 2DJ5A 3QITA 4QT0A 5EP2A 3B52X 5TMEA 3F46A 1T8PA 2VPIA 3S28A 3KYDA 1IM5A 3UT6A 4H3KB 5IWAB 1QK4A 5AW2A 4XIIA 3SSNA 1A9ZA 2GZSA 1EX9A 4NAVA 2FK8A 4ODIA 4AN0A 2UVPA 1CJKC 1TU3A 1PJQA 2G7ZA 3K4PA 2BHLA 3V80A 4PRZA 3LGAA 5EHQA 4JP5A 1Q3KA 1GGHA 4ARZB 3VNSA 4UFOA 5CX1A 5F77A 4AJEA 4YCAA 1R3UA 2JK0A 4LV5B 2ZCJA 4NI5A 5H02A 1Y42X 3AOEC 3NVKI 1CEQA 4LQDA 4K3VA 1Z8FA 2QJWA 2VK1A 5AXDA 3F8SA 3IRVA 4A03A 1NSYA 1P5ZB 1CD5A 1Y3IA 4ZI7F 3H05A 1GFZA 1X8LA 3GRRA 3W3AH 4B80A 3PLAE 3ZJ5A 2W4QA 1K8ZB 2HYIC 4EBFA 3FCUB 4CQLA 1F2TA 2IYOA 4I66A 1GZDA 2OT3B 3K6SA 5JBQA 5ES3A 4G4SP 4MS4B 2AG5A 4ZC8A 1QZUA 2VP0A 4F2HA 3IJEB 3FOBA 3BGDA 1IB0A 4QU5A 1R88A 1ZIXA 4CQNA 5HS6A 4DT1B 1JL3A 3TSCA 3LQRA 1Z8HA 2RGYA 1XCGB 1HDZA 4UCQA 4EYGA 2XWSA 3NM6B 1H5QA 4GWLA 1SBYA 2IRWA 4Y30A 1T5HX 4K28A 5I3CA 3K9BA 1ZC4A 4MGIR 1U81A 4M1EA 3WIDA 1ICEA 4AVYA 3KETA 1JEOA 1XZJA 3RT1A 1WPRA 3MTIA 1EUCA 2ZQ5A 5TT1A 1R37A 3CMCO 4DA7A 2HV8A 2GNPA 1IHYA 1J97A 5EWLA 4JLUA 2X5XA 3WIBA 5HW0A 4H6WA 5IC4A 5IYZA 3AW9A 3FNGA 1AQJA 4LZWA 1QR6A 4JLAA 2PXHA 4YRRA 2YYYA 4G0MA 2R65A 2CNNA 1HT1E 5KDOA 3U19A 4RXTA 2I1VB 4WACA 2J7PA 1GNTA 3E4CA 4BVFA 5JCJD 5B2EA 1SOWA 5CDFA 5A3VA 4DLAA 3ZJTA 5BUZA 4QBGB 4EVRA 3GLSA 2XBLA 3BWMA 1TTPB 3U16A 5IM5A 2D5BA 2QL6A 2FV8A 1Z22A 1PKXA 1QM5A 4KW7A 3RHFA 4NWIA 3OTQA 3GI1A 2CMHA 5L4LA 2AFHB 4IDGA 3USZA 1XL1A 1DV2A 2FH5B 5D7BA 4ZOAA 3VTZA 2HADA 3NHPA 5KWVA 1SWWA 1NBHA 4KQ2A 3ZKWB 4QDTA 2B98A 5B1EA 4U7HA 4ZICA 3IT1A 2ZB2A 4RYLA 3LKDA 5K05A 3V1NA 2HJHA 4ZDWA 4X0EA 2X5OA 1Q14A 4S2EA 4GVXA 4Y6PA 4I2VA 3EXG2 1YL5A 2WT4A 1GZSA 3F71A 2EJUA 2GD2A 3LDGA 1AKEA 3SNHA 5D85A 5CX1B 2RONA 2OTCA 1TD9A 2CD9A 2JAWA 3I76A 3ROKA 3B36A 4D2IA 3E61A 1QRSA 3OZVA 2FK7A 1VIAA 1Q17A 1XTSA 2QNBA 3V34A 4RPJA 3VKVA 4ASUA 1Z07A 2ZJ2A 1P2GA 4IDNA 3EEOA 1DBPA 1OVGA 2FEMA 1QPBA 2DYKA 2JCXA 3I5UA 3KFVA 3IXQA 3LDHA 1ZYUA 3PC7A 3UOWA 3WDLA 4D4JA 3FNQA 1J39A 3EQ7A 2Z3ZA 4DDWA 4MRMA 1DAHA 4BEJA 2BV3A 4LMAA 1K68A 2EP8A 3SS9X 2JIMA 3G6WA 3G9TA 4IHJF 4PU0A 3FUVA 1EE2A 1FNCA 5KNBA 4A91A 2EFJA 2DWOA 3DEKA 2QR3A 3HI4A 1FXWA 4NS4A 4WNCA 1FSSA 3EGOA 1CUAA 5B3JA 4FKZA 2P9YA 5E6RA 1HDOA 5EMLA 4O2AB 3UVEA 2HT6A 2Z5LA 1TMKA 4N6GA 4QODA 1NX9A 4HX2A 4I9FA 1KQPA 2OCDA 2PJUA 2HQBA 1JPVA 5J4YA 5BMVB 3IBCA 5GTDA 4A16A 3IPLA 2J5QA 2LDBA 1VIYA 3N07A 3QLUA 3U7EB 4AS2A 5C8YB 5LP1A 3GFVA 2G9UA 4Q1FA 1WCWA 3AEKB 1AK9A 1ZIOA 2Q3CA 3WLNA 4PSKA 2GCGA 1IAQA 4RE5A 3QV2A 3LPMA 2HMVA 1A0OA 1YDGA 2ZIXB 3ONEA 3LP5A 4FX5A 4IDEA 1PHPA 1JDPA 3NNSA 2PGNA 1TVMA 5F98A 3C41J 4JJEA 2WNSA 1NVVQ 5H4HA 5C7OO 1PQYA 3NWEA 4J0DA 4LHXA 5FL7A 5TQ2A 1FQOA 1R18A 5KTPA 2WQ6A 4NP6A 2MIIA 2CWDA 2QTLA 3II6X 2J9FA 4FS3A 4W9NA 4X8HA 4YUWA 3BC1A 3QVJA 1PLLA 2HIMA 3HS3A 4J8PA 2I7DA 5AW8A 1VZ2A 5K2MA 4U8HA 5AM4A 4P81A 4D8WA 2P2DA 3HADA 3Q3VA 4P7JA 5CT5A 2K87A 2P2YA 1LDGA 1ABFA 2VP6A 4NH0A 2XDAA 3D8UA 4EHBA 2CNBA 2IH5A 2O8EB 1G291 2HPZA 4HGZA 1DHTA 3WL6A 5CIWA 3LZCA 5LYYA 4S0XA 1CUEA 2GN0A 2QIPA 5AVOA 2FPPA 4J0CA 4RBNA 1ZOSA 3AIOA 5IHXA 3V55A 2Z6AA 5ALOA 1RSZA 1JPUA 1AMUA 1ZCAA 3CC8A 2BH9A 1MOPA 3B7PA 3ND9A 3OX4A 1XZNA 2F90A 3IAFA 1WV0A 2DSNA 3CJQA 3LH5A 3FJYA 1FDTA 2CVPA 3Q87B 4OQYA 1DAPA 3TIFA 1T1RA 4D41A 4XFJA 2RHTA 3IAHA 1OH8A 1XT6A 3PFHA 1QU3A 2WVHA 1DAFA 1PHRA 3C5HA 3KSAC 5G0TA 2O1SA 3CEJA 3TIXB 1E6MA 1TI7A 4HATA 3TZEA 4D3FA 1M8PA 1W96A 3RD5A 4A3SA 3TQTA 4Z4FA 1P2VA 2NXWA 1QH9A 3TR0A 1E7RA 4RELA 1GYRA 4RA6A 3DWIA 3EGVA 3U62A 1EVEA 1Y3BE 4RIEA 3UCEA 1XQVA 3UJ7A 1XCBA 5JXWA 4G84A 1KETA 1RR6A 2O50A 2R68A 4KWTA 5KAPA 3K6SB 3V8PA 4ZEWA 1ZJWA 3QLVA 1GCAA 4RESA 1PR1A 2BFFA 4XYBA 3LBFA 4ZAGA 2FPWA 3FA2A 4LK3A 4L0CA 1XA3A 3N1UA 3AY3A 5CT4A 4Q12A 5EJ8A 1TU4A 3MINB 1P9WA 1R50A 3OVMA 5J47A 1NQUA 2XNDD 1B0AA 4O0MA 3VTKA 1DTWB 4PYNA 3DE0X 1SXJC 3ACBA 3S8MA 3B2EA 1AE1A 1WTAA 1YFZA 2IPNA 2GVNA 1CY0A 4IV5A 3FVRA 3NOXA 1QRAA 3KT8A 2OCBA 2OESA 2CE2X 3ZDQA 1CRZA 1H2HA 2VWPA 3L02A 3JQ9A 4C3OB 4K8OA 4MV9A 1IJKA 1XMPA 1G18A 5ED0A 4YR7A 2NVOA 2J09A 2VP3A 1TVKB 4RD1A 3KQLA 4Q48A 1BWRA 2Q6LA 1LY1A 3S1SA 3GLGB 1F4PA 2R1ZA 4MKFA 4X5OA 5GZ1A 1YQTA 1NUPA 2IVZA 4QFDA 5EXEA 2GAFA 1BHQ1 5EA2A 5EWLB 3SC6A 2P62A 5F1PA 1CF9A 4BB5A 3E22B 4J0GA 1DLIA 4XD7A 4MW6A 4X9XA 2JI6A 1NAIA 3P26A 4RVHA 5D3ZA 3F6YA 5ITZA 2CDBA 2J6HA 3CR8A 3Q6MA 4TSFA 3OCVA 2QX9A 3KXKA 2HCTA 3HACA 2ZTLA 4TMFA 2C3YA 3IERA 4B82A 5TQ2B 3DCNA 4WFIA 5A4JA 4MUKA 3A6KA 1AA6A 2XVZA 4GKJB 4AKTA 4NOLA 3BTOA 1M6YA 3EA0A 1MOZA 1XHFA 1XXLA 3FTCA 2J3EA 3ZHCA 2XYHA 1J5EB 4HLDA 5BUSA 3IMFA 2QROA 1G8FA 3KDPA 3QU7A 4Z86A 5HBGA 1Y82A 4LQCA 1NVGA 5HDQA 4ZXPA 3DTVD 4URWR 5D3KA 3T4PA 1J0DA 3TL3A 2QRLA 5DHTA 4IWNA 1ISJA 2C2BA 3UMFA 4YCBA 3EHEA 3VQTA 3WP1B 3VSCA 4CM5A 4DMMA 4J3JA 1FRQA 4PY2A 3KP1A 1NW5A 2R7AA 5DX1A 2OSBA 2BR5A 3QA3E 4RCYA 2Z9CA 1JJFA 1R6AA 3RSGA 3L8DA 1F2TB 2X58A 2HWWA 5ALRA 1J25A 1LPOA 4JI7B 2GZ3A 2BMVA 1W1IA 4FN4A 2XX3A 2CVOA 4GIBA 5G1PA 2XD4A 2W2LD 3GEDA 5TJ9A 5SYMA 4BQNA 3SHOA 3TLMA 3KBBA 1KI2A 3AHCA 4RL6A 5GZ3A 4K05A 4GPEA 2O2EA 3I05A 1OREA 4TQAA 4AIRA 3LLMA 3EISA 3PXCX 4DRXA 2H63A 1C81A 4OIMA 3X1YA 3U5ZB 3CF0A 2M2IA 3AUUA 4GBED 3LQKA 1XR3A 2YNMC 5BN5B 1JQEA 1T1GA 4HWOA 1MDBA 2OGUA 3GT4A 1XZCA 3JU3A 4QGGA 1ADGA 3BH6A 5HSGA 3WLLA 1QG2A 1GEEA 1NY5A 4N8DA 4TYWA 3C87A 2QAJA 1SBTA 1KI4A 3DMRA 4IDOA 4D8UA 4EGJA 2G28A 5CFQA 2POQX 3IELA 3I23A 3M5WA 1XZFA 4EKNB 3AEKA 2QGFA 2HZ7A 3AINA 4BBAA 2QTRA 3OESA 1RYNA 1RWWA 3R8FA 2QZZA 2YXNA 5IEJA 3MJHA 5KZMB 5HUJA 1SCIA 2QTMA 5FL7D 3RRJA 1BEUB 1AZWA 1JIUA 1FZQA 4MCAA 2D2XA 2RFLA 1OC2A 3NBUA 4HH4A 3ET4A 4UBKA 3G17A 1K5GA 4FBLA 3SVTA 3BWDD 2DVMA 4E1AA 3K9FC 3SR3A 3HM9A 3LUAA 4HBZA 4F5YA 2B37A 1O08A 3NNDA 3FR7A 8MHTA 4Y1RB 4MDYA 3EFEA 4X8MA 4IPTA 1SUPA 3B2NA 4OGLA 4DTCA 2V7QA 5FOWA 4BN5A 2ETVA 2FSSA 4DGQA 2R00C 4ILEA 1DDOA 3T8YA 3LWZA 2C57A 5KTKA 2SNIE 4Y2VA 3U3DA 1WAMA 3DO5A 1KEEB 2IHUA 1JR6A 4OJYA 3BGOS 2A1UB 5K0EA 3HJBA 1EGHA 3EGDB 1CF4A 4Q3DA 4JVLA 3K73O 3ZQ6A 4QDZA 4A15A 4QYSA 2LKCA 2EFGA 2VPPA 1DX9A 4CLRA 1EXMA 2YXBA 2R6CA 3UWOA 4A2WA 4C05A 4E2ZA 3QV1A 9LDBA 1CFZA 4BFYA 5AI5A 3ODGA 2G3YA 3LUJA 3TM4A 4BNWA 1T13A 1H0SA 3G8BA 3PC2A 4HYTA 4B40A 2REBA 5EJIA 4IO0A 4R1NA 1HKUA 3HSSA 3NTXA 3WNDA 5A1TA 4UVDA 1RW4A 3L84A 3PTLA 3KJXA 3IO5A 5KOIA 1A8IA 4ASUD 3EG9B 2ZZKA 4QQ8A 1WLYA 2IHNA 1IPHA 3C3DA 2Y67A 4YAWA 4Z1MD 5LMUB 1E2JA 1XLWA 2BFFB 4DR7B 1CEXA 3LQ1A 2JLQA 2ZBVA 4JC0A 1NVBA 1ANKA 4PYLA 4Z5XA 1OTYA 1XEFA 3W1EA 1PUIA 4A26A 4QNNA 3H2HA 4F97A 3QKIA 3VH2A 1QP8A 4RD0A 3WHKA 1UPCA 4BV8A 3H3JA 2B21A 4ND2A 1QNLA 4KQ9A 5DTMA 4DR3B 3NDBB 1SCUA 3DAGA 2RAPA 5EINA 4GHWA 4FOSA 4H27A 2X8JB 5IU6A 1RLMA 1UJNA 5CVDA 4UD2A 1JUDA 3HA7A 1ACLA 2Q50A 1JH9A 1NP3A 3AUKA 3MYYA 4R84A 3GLGA 3FJ1A 1SKBA 9MHTA 4I4CA 1DAEA 5E1MA 1EYZA 2F8MA 2HH9A 3NPMA 4Q4CA 1KFCB 1P1FA 4L5AA 1SELA 3QF4A 1WP9A 3M9LA 3FGPA 5KNDD 1BCSA 3FGZA 5G3ZA 3K2IA 3UYLA 3RYFB 2WHXA 2FZCA 3SQXA 2HNAA 3OIGA 3QTTA 2OLKA 4BYGA 2Q9BA 5P8WA 5EJ4A 5BW8A 3CRVA 1JVSA 4YXFA 1NIJA 2H1FA 2KB0A 3D4IA 5JYEA 3GFQA 2W6CX 4QEKA 3RASA 2QAGC 3I9LA 4WINA 4ENWA 3JZDA 4OBBA 3H8WA 1ULTA 3H04A 3GD7A 3LIIA 1TEVA 2EL9A 3I1JA 3LPNA 1WCXA 5ITSA 4LXYA 1RJDA 1RU3A 2AUTA 1YB6A 4GFDA 1LB1B 2W4MA 1W29A 3ZCRA 2A5JA 2RCNA 3FNIA 3PNLA 3U7IA 3AK4A 3FDZB 3GG9A 4YFYA 5TQVA 2GKGA 4M0MA 2DRIA 3D7SA 3GWZA 1FTWA 2JC3A 4DCNA 3BDAA 3FVQA 3V1TC 3BFVA 2AD5A 4RZ3A 5GM2A 1F14A 1ORVA 1SUWA 1QFSA 1U98A 4L78A 2WWVD 2O8FA 5A05A 1XKXA 4IMPA 1YR9A 2OO5C 4FK8A 3LFHA 4TXMA 2AF4C 2M1XA 5K4HA 3D8BA 5KOHA 3FLAA 5HMMA 5GINE 2FF5A 1TK9A 5AKGA 2XRYA 3I73A 2QUBA 4QXMA 1DEAA 3L18A 3I1YA 5FPPA 3UUGA 1SVIA 3I9JA 3DEYX 1DBVO 2ZSJA 3CRRA 1UAYA 3RI3A 5GAJA 1JKMA 3T3IA 2FW0A 2WYHA 1DBIA 1N7HA 4DCCA 5I01A 2NZ2A 1AGPA 1FL9A 3DXFA 2A30A 5T64A 3B6KA 3QI7A 3OIDA 1Z08A 3COYA 3BAZA 1WULS 4G1BA 2HHHB 3D5EA 1N8NA 2QN1A 4FYKA 3BZUA 4KAFA 621PA 1ZPDA 4M7PA 1HE3A 4MW5A 5BV1A 1HFEL 4E1VA 1EUCB 3LW7A 3NU1A 2I4MA 4P35A 1P5FA 3HVHA 4Q03A 4FJ2A 1IHPA 3KAPA 4PYMA 3AESA 3S2ZA 2I4TA 1QB7A 2EGHA 3SE7A 2BLNA 4Z49A 3QXSA 4RTSA 4AJPA 3PRKE 1CZUA 2R11A 1GVHA 3U9LA 1ZIDA 1J24A 2A5GA 4JFRA 6YASA 2K4MA 2XTAA 1K4MA 4I4TA 2QQGA 4QLOA 3T7JA 1I7PA 2HA2A 3B1XA 3OHSX 1PCXA 1AV7A 1E77A 4OG2A 1IN8A 3BXFA 3KZMA 1J06A 3JARA 3ZWPA 3EUAA 2EW8A 4LYJA 1KXJA 4REOA 3T7IA 3TYXA 1EEHA 1J9EA 3N0RA 4KX5A 2FRVA 2O7QA 4UZFA 2A8YA 3ZV4A 3EVTA 4ZMBA 1E0SA 1XDSA 2XH8A 1VHDA 2O3UA 3ANSA 1RYFA 4J16A 2PRKA 3ZLUA 1KZHA 1KMNA 5I7FA 2AC2A 5ALGA 5H9VA 4IF6A 1K9SA 4DSUA 3A1NA 5K01A 3DOJA 1HE1C 3ESYA 4LRWA 4MO2A 4RPCA 4C3VA 5LZ4A 1A71A 4CGYA 4P3XA 5LD2B 5ALTA 1ZGAA 1XMIA 2ZZMA 2O19A 1MJNA 3ZTWA 1U8XX 1RIIA 1STOA 4WL0A 1KVSA 1CUVA 5GVRA 4Z2YA 1P9NA 8LDHA 2RCYA 3C3AA 5A6SA 1NA5A 5K8JB 1IVNA 2MCFA 2VH2A 3ISJA 4TS4A 4KITB 1RT9A 2GHRA 1ECCA 3R24A 4IHJB 2X1MA 3KR0A 5CT8A 1YVRA 4CG1A 3GUHA 4CHTA 1GZUA 4Z8YA 3JQCA 1ODKA 4AKSA 3K30A 3I2FA 3BIXA 3NHSA 1R5JA 4C88A 2RD2A 1M9NA 4TMTA 2B2XA 3BTUA 3KV3O 1O2DA 2VF5X 1JHOA 2NVWA 2VKQA 3DHNA 3QVTA 2AA3A 4PAWA 3ORRA 4C4XA 1EG7A 1Q21A 1RQ7A 1VL2A 3O47A 3T52A 2XNDA 1BHJA 3I45A 2HJVA 3TSYA 3VDMA 2P5TB 3G0IA 1I2MA 2HK6A 3DLAA 4ZGBA 1Q0TA 2CYBA 4HPJB 3H5OA 3TMAA 1H6CA 3VHQA 2GO7A 2QI9F 3G2NA 4P83A 4LOJA 2G70A 4H4DA 1FLVA 5DLQC 1U6IA 1WUHS 2J3QA 2PKWA 3IPXA 4JEHA 1AVTA 3RANA 2ZSIA 3THXA 1VPWA 1Q0HA 4X7PA 5NLLA 3RS8A 1NF2A 1MPTA 3T3GA 2OLEA 3GFSA 3N3BC 1LC3A 4OQFA 1XQ9A 4NAHA 1YIOA 4ZIRA 4DKJA 1CEYA 1KVTA 1QAOA 3TECE 2VRCD 1NHWA 3QWHA 2OQVA 1QGAA 3DE4X 3VVBA 2BR3A 1E89A 4RVFA 1VC2A 3DZGA 4FZRA 4FE3A 5CCXA 4OAPA 3VSEA 4DG9A 1SA0A 1IU9A 4U2FA 3V4FA 3ZXSA 2WWFA 3MUEA 4V3CA 2KYRA 4ZQIA 2D6FA 5FKJA 4ZOQI 4M38A 1I36A 3I62A 1H8HD 2GA8A 2N46A 4BB0A 1XTUA 3QXGA 5G53C 3QELA 2P9FA 1UADA 4PNPA 2O3RA 3LDAA 2E82A 1GNLA 1TMOA 1G8MA 2WI8A 1FMLA 3JAWB 3L5KA 4IUDS 1RZVA 3OHMA 4IRUB 4MQLA 1V41E 1B1CA 3D4NA 4MWEA 4ZVMA 2OGTA 5CXUA 2WWHA 1DE0A 2XLCA 3MG9A 5K99A 3EWSA 5FIUA 1KAQA 3MQ4A 4DJFC 5TY0A 3LYUA 4G07A 3RTAA 4TYQA 2F1OA 1T5IA 4PLPA 2YR0A 4N0QA 2VQ3A 1XWFA 4BQQA 4AMBA 5CTAA 1HSZA 3OPMA 1E7WA 2BGRA 5AK3A 5EKUA 1LPNA 4C43A 5EIXA 4KR2A 4PBRA 1JHYA 1W0JD 4GOND 4I1OA 5JXIA 1PT5A 4MRSA 4LYFA 1WSAA 5KYWA 1OXUA 3EGEA 3DC7A 3O94A 1SIBE 4UOEA 1IVYA 1DKMA 3F7OA 2BJWA 4PCVA 3WLMA 3UA3A 2D00A 4ENPA 3OLVA 3FHJA 5LQAA 1AKVA 1DX6A 2HPAA 2QDKA 2QY6A 3Q7RA 4LMRA 4M86A 3TQFA 2BGIA 1I2BA 4F4DA 2WVJA 3SC2A 2JJ2D 4RKQA 4H1TA 3T9AA 1ZZEA 2FR0A 3WGGA 2X7JA 4YMUA 5HKOA 4Q7MB 3HJFA 2WTUA 1D3AA 3NHKA 4EITA 2GD6A 1NIPA 4BFTA 2UZ1B 3VKHA 3E8SA 1L8AA 3IIKA 4DM7A 4UPEA 4HXYA 3MT0A 1LLCA 4UDXX 3MSCA 1R6DA 3R6WA 4IG9A 1RPAA 1WKVA 4X7MA 2D5IA 3WB9A 1W35A 3MRSA 4Y2HA 4UHEA 2J0SA 3GJQA 2VFAA 1OW3B 5LP6F 2GJ8A 2PX6A 3BHNA 3SDZA 4PN7A 1FDUA 4JVMA 5ELMA 2R97A 1GNVA 4H6XA 3FFWA 1CQIB 4IKOA 5C81A 1C3VA 1YA4A 1II0A 4Q1BA 5KJFA 1NPTO 3ONFA 5BYKA 3OUTA 2DXIA 2AZDA 4RS3A 3RAEC 4PYOA 4NZYA 4KVFA 3WKDA 3IPYA 4Y9DA 4AT1A 1W5SA 2IDJA 2W6PA 3W1WA 4RTJA 2JKVA 5ALKA 1CNFA 1H9CA 4OREX 5E4TA 3LUKA 4YMVA 1C7RA 4ZVPA 1OBHA 5KMGA 5SYAA 3DF9A 1DXOA 2WAMA 4HEQA 4N0MA 4R0VA 1HH4A 1LS1A 3V2IA 4FNGA 4J91A 4ZI5A 4F7DA 2P2GA 3SYRA 1H6DA 4R6WA 2EJTA 1E7MA 1WVMA 1UXIA 5IM4A 3OZEA 4EJSA 3N8GA 1R3DA 3H5WA 4LTDA 3OG9A 3I5XA 1KP3A 2K7FA 3BB4A 1ISPA 3SK0A 1SB9A 1P7CA 2BEJA 2J41A 1BJKA 1M2WA 2O20A 5TPWB 1EUDB 1Z0IA 2GUWA 2NTJA 3ZV5A 2BKAA 3HZOA 3UB3A 4MMYB 5IC5A 3UMBA 2QXYA 3IODA 3WIUA 4ENUA 1TA9A 1TKCA 4TRNA 4KMOA 4JP8A 4RY8A 4IH9A 1XZLA 5T4FA 2IXBA 4CN9A 4R3WA 2C4TA 3ELBA 4C14A 2FDXA 1WB5A 4EHAA 4LMPA 3ZU2A 2ATEA 2PLWA 4BIIA 2OZVA 3NHBA 3PFWO 4LXQA 1V1MB 5CNJA 1TJ3A 2C5EA 1UXHA 3ECSA 3BAFA 4OUDA 1V71A 1M8KA 1ZVKA 3GJ6A 2P6RA 3OQIB 4NULA 4D9MA 3ADCA 4INOA 2JH3A 3OQOA 2AFIA 1S9DA 2BBTA 3DBVO 4RABA 4JJZA 5HP4A 2O8CB 3TZKA 1Z6AA 4OQXA 1CYEA 1QGOA 4I9UA 2HU2A 5CLIA 4YMSA 3PX3A 5EP3A 4QJ3A 1C9DB 1KOFA 4I1VA 4CMCA 3IIEA 1GAEO 4NTZA 1E62A 3E48A 3N0XA 3KK0A 4XJSA 2VDOB 3IUEA 5HIJA 4F72A 1AIPA 3LRTA 4H08A 5TEWA 4GICA 4LE0A 2F67A 1WDLA 3PT9A 4BE7B 3IIJA 3SHWA 4DV5B 4WZBB 3DFMA 5EE9A 1V96A 2OKCA 4DBLE 3A0RB 1T6NA 3UHPA 1MMFB 1RYMA 2NXEA 1N92A 1NQWA 4UHJA 3PJDA 1GG9A 3JD1A 4OKIA 3IKLA 5CLQA 4NG4A 1EEXB 1AKUA 5M5BA 1JA1A 1FSFA 5FUYA 3T9BA 2EERA 2HI0A 3A1VA 1JNYA 1PDOA 5FUWA 3PEYA 2BEVA 1ULAA 1IIBA 1BKYA 5E6SA 1SAYA 2LV8A 4MIKA 4XD2A 5FA8A 1T5LA 2P0EA 2COUA 3LP6A 5IDXA 3N6XA 5HTOA 1C3XA 3LUDA 3ZGLA 4ZP1A 4WJLA 1UKZA 2FX3A 1MX9A 3X1MA 4BV3A 1U0SY 4WCFA 4F3TA 2OWDA 1PGOA 1AXGA 3GYGA 2VHXA 1SIWA 1AZTA 2V59A 2HAEA 2WICA 3PR3A 3LWBA 2EIXA 3BL8A 1UP6A 1Z6ZA 2ILTA 2AJBA 2B4KA 3ONWA 5JSKA 3T5TA 1KARA 1YOBA 4EGSA 1O4VA 2VCEA 3CUUA 5AK4A 4DIDA 3ZV3A 1Q6YA 2HQRA 4EEXA 1ECPA 1M1YE 4HWKA 4X63A 3QHQA 4HNRA 4HUJA 5EP1A 2O2CA 5E3JA 2BD0A 1GZ4A 1KU6A 2G9RA 3UOGA 1HUQA 3W6PA 4DRYA 4OHKA 5JW6A 4W5NA 2FMKA 2WKQA 4KMMA 1ZJYA 4XGRA 3IDAA 4G1MB 1A8SA 1XZ8A 2A0UA 5EP4A 1I1HA 3C48A 1XZDA 4J0IA 4AP9A 5KYGA 3QSGA 2MU1A 3M9WA 1MABB 2W58A 3WI7A 1BD4A 5FWYB 5IT4A 4YYEA 2CWWA 4LYDA 2C0PA 4GOJA 2V97A 2RHHA 4EH1A 1G3RA 4JI6B 1I4TD 1IMJA 2Q8NA 3BSSA 4J7UA 4CKWB 1GGJA 4QM7A 4YRKA 6AT1A 1LX6A 2IQIA 4HSEA 1C2YA 4YQEA 2CMDA 2SCUB 1KXZA 1ZXBA 4ZVKA 4GF5A 1XCJA 4FD3A 3SP1A 1I2AA 3NDRA 1Q77A 1DTSA 2JVIA 4NY1A 1HA3A 1M34B 1SZDA 4O8CA 2XA9A 1IAVA 4U7FA 1U2RA 2XCRB 4TTSA 5ECDA 5TIIA 2ZT8A 3T94A 3B5JA 3PNMA 1KZ6A 4L8LA 5ECYA 1B8PA 3HFSA 4C03A 2VAPA 3BEOA 4PC6A 2XDQA 3D6UA 4YJ3A 1A95A 4BU1A 3CINA 5CPFA 3PKIA 3DBHB 4G8CA 4LJ6A 5J2UA 3B7GA 2WJGA 2ZYTX 3L4EA 5DI9A 2GEDA 3HR8A 4NENB 5IJAA 5LBIA 4GE0A 3EE6A 1QLHA 1X94A 2GQ0A 3DFFA 3MK31 3KVNA 5EQFA 2CUKA 1WWKA 1E92A 3BRQA 1H1DA 1T5TA 3FYTA 4GRIA 1U0RA 5HFJA 4XPIA 1L5GB 3A3PA 3BJEA 4CM8A 4HVCA 2CL0X 1EXWA 1S2MA 2Q2WA 2P6PA 3A6GA 1Q0PA 4N18A 2OAEA 4L57A 3TTWA 3BILA 1NF8A 2QVCA 5JLAA 1WNFA 1X77A 5KYKA 2NU8A 2O0HA 3OJEA 5FI5A 3H1AA 3PF8A 2FPXA 2VAMA 3FF1A 5L4NA 4KEAA 1SZJG 3ICCA 5DYTA 1YU9A 1ONBA 3F6SA 3PGXA 3VA7A 2MR5A 1V3TA 4QQFA 3KJGA 1U2DC 3NTOA 4XM1A 5ER6A 5FA6A 4ZVSA 2XAUA 2A5FA 1G8GA 2VUUA 2J46A 1Q95A 1C30A 1NXWA 4ZO8A 4RJJA 2W8BB 4EI9A 4E14A 1A9QA 2B5OA 1HYQA 1VRCA 3DZBA 3QI2A 1YE8A 5AOCA 4FJ0A 1QYXA 4BHTA 3RF6A 4XYGA 1OB2A 5B12A 4TMYA 3CZRA 3ICPA 4PF1A 4MUYA 1G17A 4EIWA 3FFTA 1D4AA 3MT7A 1C14A 4OO3A 1NQTA 5JQGA 3UKJA 4TYPA 3K2BA 3KQKA 4EHNA 4JUAA 4L5IA 3RHTA 4E30A 2WKRA 2J0VA 2YV1A 1GGEA 5EZYB 4CMKA 1I0LA 4E3ZA 1VPEA 2ZTVA 3I6ZA 1RWXA 1FDVA 1F8XA 4F46A 3FZEA 5J3JA 4JKIA 2ADOA 4ND3A 2G1JA 2P1DA 2QORA 3DE3X 3PXDA 4JI4B 4GM0A 3EGIA 2P0YA 5C46F 1ILEA 2XKKA 1AN0A 3G0BA 2FYTA 3BGSA 5HKAA 4FZ5A 2D2FA 1M8FA 2V96A 2Z2YA 3CUKA 4KBYA 3S2FA 5JYDA 3P32A 3LA8A 4BRSA 4C6TB 3QENA 1RYBA 1Z39A 4ZI7B 2YTZA 1N2CA 2YMQA 4PHFA 2JHFA 4QO8A 2QMEA 4KQ1A 4CM4A 2HY7A 4I3FA 1U2PA 1XKQA 2A88A 3A04A 4L4RA 1QRUA 2Q1UA 3IEVA 1O4WA 3LAWA 2QY9A 4TWBA 1ZA2A 4C29A 3RVSA 3U13A 3OZRA 1RPTA 2O0KA 2A7XA 1JFRA 3MC1A 3X1XA 4DIUA 3N58A 3D8HA 4AXBA 3H65A 7REQB 4WLVA 5JS2A 2C03A 4CVNA 1XKLA 4I6JA 2WAAA 3P4YA 1JFLA 1D1PA 5GP1A 3SLGA 2VDLB 3PUVA 3O6VA 3HCEA 4S1WA 2OFXA 2JAHA 3HFRA 1CR0A 5JC8A 4DV4B 1IJEA 2KMLA 2OHOA 2GBFA 5KYNA 1FVFA 3GVIA 3OLXA 5KNDA 1XJCA 5GMOA 3UH1A 4BNLA 3RSFA 1LBQA 5BQXA 5CB4A 5HOEA 1ZOPA 5C31A 3QG1A 4D9HA 2XSZD 3FOWA 1KQGA 2UAGA 1EMDA 1AXEA 4S1PA 3WDMA 4NXNB 1JEEA 4ROSA 1RKQA 1U65A 1FNMA 2L82A 4IZHA 1W94A 5EGSA 4C6RA 2GPYA 3TXXA 1Y5MA 3QNWA 2DQYA 3OQPA 3OPQA 2QJRA 3HJTA 2W2XA 4IDHA 1PZNA 5K6RA 4RGYA 3WZ2A 1V37A 2WLSA 1P39A 4V0QA 3T4EA 2W8BA 3EPHA 2ZRLA 3ZDYB 4GM1A 1JIKA 4AKHA 2NP7A 3ABOB 1JHMA 4JLWA 4L16A 1NRJB 1XCOA 3SYTA 1NVUQ 1VSTA 1EAYA 4A8JC 2JGMA 2I4OA 1GQOA 4UUQA 5CFRA 3L8GA 2EGUA 4RKRA 3WYEA 2BKUA 3WLAA 2OCYC 4B87A 3EK2A 4D43A 3TZLA 1INLA 3FOFC 3ICEA 1SXJA 3AI7A 1SOVA 1E4OA 2G77B 3C4QA 4F85A 2UYGA 1AKTA 4HAYA 3Q8KA 1PQUA 3QJYA 2JFQA 3RBVA 4HF7A 1GQQA 4AG3A 4KR6A 4OGKA 2FUG6 2AYXA 3AB8A 4BCCA 4ATNA 4YVFA 3FLEA 1HX7A 2X4DA 2VWHA 3N75A 4X3PA 4MVJI 2FDCA 3G23A 2PH5A 1GAWA 2EG5A 1UC5B 1GWNA 1Y4UA 3G7UA 2A57A 2EBFX 2ZEJA 3BMNA 2JEOA 2QLTA 2BF7A 2XB4A 3P94A 4XPIB 2N9UA 2AQKA 4DCSA 4DLYA 1D09A 1RRFA 1OFHA 1QQ6A 3ZDFA 1J8QA 4C0XA 1KP9A 2Z08A 1J5PA 5AKIA 3GX1A 3L8EA 2JG3A 1A9RA 1EDZA 3T3PB 3B1ZA 5BSVA 16PKA 5DKFA 2W2NA 3DD1A 3TDMA 2PBLA 1TC1A 2A0YA 1FNSA 3GJ8A 1NP7A 1LZKA 1OXMA 2VEOA 2Z8XA 3EPRA 1SCQA 1KMCA 3WK8A 4AYWA 3AT1A 4O2BF 4ZO7A 5KI6A 3M0EA 2F1RA 3UPUA 3Q6NA 1QV6A 1HG0A 2I22A 3D1LA 4MWSA 4K0RA 1KYZA 5DRTA 3EAGA 1SXQA 5JC1A 3JXEA 2WTBA 1VSVA 2BHRA 1YB1A 2QE6A 2P7IA 3DVLA 4HG2A 1XJWA 1S1CA 3EW9A 1L1EA 4L6AA 2HHCA 4KH0A 4P53A 2WIDA 5IN5A 3ETEA 4RLFA 2CT8A 4B3BA 2CLOB 3IT0A 2Q45A 4N5MA 1C30B 3OQBA 3HNRA 3ZWKA 4TT8A 2NZUG 4NCBA 1AUQA 3MBOA 5AI8A 5HA5A 4NC9A 1ZNXA 2BIFA 3QEMA 3I1IA 1AUOA 3DWGA 2VHQA 5L95A 4HLCA 1SQ6A 3EVAA 5FCDA 2O2IA 4BJ1A 4NYJQ 3C7AA 3MWKA 1R1DA 4PZPA 1E4YA 3HL4A 1GVNB 1ZJZA 3O73A 1KWKA 4YPVA 1EWYA 3V46A 3KKNA 1LTKA 2XGSA 1XZPA 4CI0B 2UYHA 1AO0A 4G5SA 2IYYA 1LLUA 1O3YA 1Y63A 1CDOA 2LPMA 1M33A 1D7AA 1JQLB 1E1CA 1MOQA 1NT2A 2IZ6A 3DOEA 3IKJA 4HAVA 5LOVA 1FZTA 4DUGD 3FCXA 3SWWA 1S2OA 2WNHA 3R3YA 1U7DA 4WADA 1THGA 4ZTUB 4OLBA 5J5CA 2DPYA 4PZ0A 3GDOA 2I7VA 3HYNA 3JV7A 5HEKA 3C3JA 4L0DA 4ND7A 5CTJA 2EHJA 5GQSA 1HDIA 2QE7A 3RU3A 3VDQA 1A50B 1U1EA 2AI3A 1M6NA 5AP9A 4NV1A 3WKBA 1ATIA 1X7ZB 3FMIA 3IP3A 3OKFA 5JPCA 3G5TA 4OX9Y 5IJZA 1JR3A 2ACWA 2J07A 3NQ41 2Z3VA 5K0FA 3K70B 1Y9EA 5EN4A 1B8NA 5JAIA 2E4ZA 2B61A 3G5AA 4KX3A 5K0CA 3G8CA 3L93A 2QTZA 2OCKA 1JDTA 2NVUB 2GN1A 4DCOA 1GQRA 2UUCB 4EUNA 5EI5A 3KD2A 1N3BA 1YA8A 3AY0A 4CMIB 3FPAA 3THWB 3JVVA 4FYJA 1GA6A 3STWA 4KUGA 3PXXA 1B74A 2PR7A 1PJBA 5TS2A 2HD4A 3L9XA 4Y0AA 5F4BA 3DF7A 3I12A 3OOJA 3N7UA 4TVOA 1XMXA 3B3GA 2B0JA 4C2TA 2XJ9A 2W83A 3BD6A 2H18A 3EFBA 3K2EA 2IHKA 2QUKA 4C6TA 3E7WA 1K7EB 2WFZA 3TEMA 1X7DA 2VA9A 3D02A 4AZSA 4DWOA 3TRHA 3RIGA 3PXUA 2C5GA 4D44A 2VC2B 4U02A 4B4DA 4OKNA 2H08A 2GZ1A 4G4IA 5BR7A 1QHSA 2IE8A 3OIUA 4HS9A 4UM5A 2XCQA 3L8HA 10MHA 3DL2A 2ZJAA 3P0EA 4CI9A 5FAKA 2HSGA 3JAKB 4R31A 1GG5A 1VKZA 3MTGA 3IQIX 3A9CA 4WOKA 3B12A 3QX3A 2BRUC 3UAYA 2ZTMA 4JBHA 4R51A 2VVTA 2GBIA 1LU9A 3GAFA 3I2GA 1JXOA 1N3IA 2YHIA 2H7XA 2O8VA 2OB1A 3HV2A 3IESA 4KXMA 1WIWA 4PYIA 1XMQB 2G1PA 5DNCA 4B6PA 2VK8A 3RK0A 5ALXA 1GKKA 4CMEA 1R7RA 2OUKA 3R5HA 3RFXA 1YT5A 1ZW1A 3JQ8A 4AMUA 2KLHA 2VO1A 1QO9A 3AFMA 1NMQA 4FI3F 3ORYA 3LVRE 4B2PA 3GFBA 3SHVA 2PE5A 2RK6A 2J0UA 1TAUA 2CXOA 4LF9B 2OYSA 4KDEA 4KH1A 5TVKA 4M9ZA 4MGHA 4WJKB 4RNDB 1MRSA 1QU2A 2O3SA 4RDCA 5AK0A 1MH9A 1N7IA 4H35A 4QJIA 3ZDZB 2WUWE 1KYIA 4IZOA 1JA0A 4OFBA 4DPKA 5C2JB 3R0QA 1MH1A 3BCRA 3SQLA 4HWRA 1JIXA 2VYND 5KJEA 5E7MA 1W4BA 4TUYB 1GN8A 1JDJA 4M53A 2ZIEA 4LRQA 3SZUA 4FEAA 2H1RA 1HYHA 3Q7QA 2IUSA 3DEJA 4N0PA 2WF9A 2B4QA 4WLNA 5HKLA 4YDSA 1FQJA 2H4JA 5CB8A 1KEZA 2F3QA 1Y1PA 4CYMA 1P3DA 5A4FS 4LZAA 4QREA 1Y80A 1IZ0A 2FEPA 2BAGA 1ZNWA 3KR1A 5E9QA 1V9LA 5EVJA 3DAPA 5T6MA 5UKDA 4X1IA 4D98A 4UTVA 5LYJA 1X7XA 4EG3A 4WE3A 4WEOA 4CMHA 1V6SA 3FY4A 3Q72A 2VPTA 4PPYA 3IR7A 5I9MA 2Q0HA 3AUJB 1Y1SA 5I8ZA 5JBIA 5KTNA 1P0PA 3L9WA 2OMEA 1Q83A 5DMXA 5F7OA 1QBGA 5IAAA 1TW3A 3WA7A 5JNRA 2V7WA 1CUZA 2OYRA 3T34A 3V42A 4ZCMA 4RVSA 3TE6A 1DJNA 1NVTA 3KC2A 3R5KA 3H2YA 3RS3A 2LTAA 4J1SA 1L7OA 3DOCA 3KTFA 1SKMA 2I4NA 5ALMA 3D7RA 4B3MB 1BN7A 4C7OA 1NN0A 5B6PA 4P4NA 5JCPA 1G0OA 3CM0A 1CQPA 1Y98A 4IKEA 4O3FA 2BSAA 3H2BA 4M0UA 4LBVA 1CE8A 5AI9A 4ZODA 2E5LB 3MIIA 2ALJA 1J2EA 1YS9A 3OWOA 1PWHA 3TL2A 3UV6A 3RS9A 5MN4A 2OOKA 2WLTA 1FE8A 4OAQA 1VLZA 1R4NA 2VJQA 2XVMA 3AJ8A 4GP6A 1VDZA 3O4VA 4GP9A 4OP3A 1OQAA 1GQSA 1DTWA 1SG0A 5CITA 5C1DA 4UAVA 4CODB 4YT4A 1SIUA 3OCCA 5AKLA 1JLKA 1Z26A 4HYEA 4BE4A 2P78A 2YRWA 4J07A 4U2DA 1F60A 5LDDC 2HBQA 2I3BA 3FB1A 4XW2A 2A78A 1C8LA 1RCTE 2GF9A 3BMOB 1TTQB 4FFMA 4UUPA 4RDXA 1HI9A 1X2EA 2DHDA 5KX5A 3AHHA 5KNLA 3AR6A 1YVDA 3QVGB 3OQNA 3IFSA 1QX4A 3ASUA 1U7WA 4HY3A 1COZA 3DLIA 3W7BA 4N5HX 2GMWA 4R2MA 3AQ4A 2OLJA 3LRPA 1CJSA 2ZSFA 4R69A 4HDOB 5LA6B 5JASA 5CLFA 1NW4A 2JIZD 1GTSA 4Q24A 1YGPA 3Q8LA 5GONB 5CVVA 2IU6A 3VDNB 3H2ZA 1CJTC 4BO0A 1H3EA 4IEEA 2ZJ0A 1GYQA 2A9JA 3EXFB 4M9RA 3DFZA 3O93A 3C3EA 3A9UA 4JSRA 1JDNA 2CL5A 4DV3B 1LW7A 3OF5A 5A3JA 3UMYA 1VGRA 1ZM9A 4QGHA 3VTFA 4AQ7A 3B70A 1MR3F 3ZI4A 3DM9B 2JJMA 3MIZA 2R9VA 1I3NA 4BP9A 1O95C 4MB0A 4OMFG 3QZUA 4XX0A 4YUZA 1DAMA 5FTJA 3PHCA 2CV0A 4RTOA 4GT1A 5B58C 1Z4QA 3T1HB 2Q2NA 1GL3A 3GZ4A 3ZWXA 1XA4A 4A23A 4EUHA 1KVQA 2XVYA 1JWBB 4UMDA 5DLYA 5AR1A 2EJVA 4F5WA 3ZY4A 1D1QA 2H4YA 1AKNA 3GEEA 5KHLB 1GD1O 1Q1EA 2RAVA 4IGEA 4QXQA 4URYR 1OASA 1OX6A 2CXUA 4WK2B 3MLEA 2BY4A 3G5UA 4RWZA 3ROFA 4C4SA 5E6SB 2X5NA 1UMBA 1KR5A 4V2IA 5GIPE 2FNAA 2EEZA 2P3QA 1P81A 1T3HA 3QTLA 4FUQA 2MINA 4HWGA 4DMHA 3THXB 4AO7A 1GADO 5EGNA 1H2RS 1X86B 2H1SA 3H1TA 3N5CA 1C5KA 5IS2A 1CZOA 2WTNA 1G8AA 1I6KA 1RWOA 1YZQA 3LCVB 1RI1A 5DT9A 5DVZA 1KZ7B 4TXHA 3UF0A 1B6GA 1NASA 4UUAA 2DM6A 2Y6VA 4HNQA 2PGLA 4FE4A 1B8OA 3PPWA 4MAAA 4X45A 5IN4A 1O6ZA 3GLFE 1SKYB 4HTFB 4KTVE 2HCFA 4L6IA 4W1RA 2PFGA 1BWSA 2FHSA 1QJ4A 3EIWA 5E9AA 5JS7A 3A31A 3WMXA 4E08A 3N8DA 4GKKB 2DBYA 4BMSA 3ST7A 1WCIA 4LZNA 2ZIAA 5B7QA 3CLRC 1TAQA 1YK1A 3L8CA 1RJ9B 1D0IA 1U2GA 3CW8X 1ISRA 2FZGA 3GAAA 2WJIA 1VLJA 5SICE 5K0ZA 3TRKA 2F55A 2V7XA 3JATB 3JVUA 1H6BA 3RIMA 2WC1A 5B7GA 2HQSA 1G6OA 1KKLA 2QSYA 3MWEB 2D3WA 3DLPX 4K9QA 5FFFA 2OV3A 2YBDA 4EA8A 2VRWA 4D3ZA 2ZROA 5DE3A 1L8OA 4C76A 1H8HA 2CE7A 5KIAA 4KLRA 1ISGA 1H65A 2Z8YM 4FQ7A 2YFKA 2FPIA 4J9VA 5TARA 1Q74A 1GR1A 1OI3A 5DHPA 4KLZA 2AXQA 1A9PA 3KBOA 1W48A 4K1LA 1UP4A 4PZZA 2D62A 1CUDA 2CXQA 3PPXA 1YRYE 1VKJA 1HDXA 5FADA 2F1HA 3CF4A 4F93B 1TF7A 1XP5A 2JGDA 1FC0A 4H16A 3OCXA 3GZNB 3RKRA 3H5VA 4KQIA 4O3MA 5AVVA 1F5NA 4OF4A 1OBVA 2I71A 3AYZB 3I01A 3O74A 1VCNA 1DJLA 1A2OA 4GKVA 2F48A 4OHBA