2BEVB

Reactivity modulation of human branched-chain alpha-ketoacid dehydrogenase by an internal molecular switch
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
341
structure length
336
Chain Sequence
AHFTFQPEYGQTQKMNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRSPWGCVGHGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAAEEVPIEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAKEKLGVSCEVIDLRTIIPWDVDTICKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHIFEPFYIPDKWKCYDALRKMINY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
publication title A Versatile Conformational Switch Regulates Reactivity in Human Branched-Chain Alpha-Ketoacid Dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
total genus 122
structure length 336
sequence length 341
ec nomenclature ec 1.2.4.4: 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring).
pdb deposition date 2004-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02779 Transket_pyr Transketolase, pyrimidine binding domain
B PF02780 Transketolase_C Transketolase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2bevB02
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2bevB01
2PANA 1GPUA 5ERYA 1V5GA 5K6TA 3LPLA 3EXIB 1UMBA 2YICA 3DUFB 5IMSA 3EXEA 2XTAA 1Q6ZA 2JLAA 3AHCA 1PI3A 2OZLB 4KXUA 3AHFA 2EZUA 2JI6A 5ESDA 3HWWA 2Q29A 2QTCA 4GM4A 5ERXA 2IHVA 2R8PA 2VBFA 1RP7A 1UMBB 3KOMA 1UPCA 2C3PA 4JUAA 2EZTA 1PYDA 4GG1A 3OOYA 1OVMA 5HGXA 2Q5LA 1Z8NA 1YHYA 2E6KA 5EJ7A 4KXXA 4MZXA 5I51A 2JI8A 4XEUA 5EJ6A 1UMCB 5EJ4A 5EXDA 1W85A 4MPJA 2JI9A 1X7YA 2R5NA 4JUFA 3EXHC 3MOSA 1ITZA 1OLXA 1T9CA 4K9QA 2J9FA 3EXG2 2AG0A 2JLCA 3EXFB 1TKBA 4RJIA 1NGSA 3D7KA 1X7YB 1X7ZA 4GPEA 3FZNA 2G67A 1OLSA 3EXG1 5EJ8A 3AHHA 3OE1A 1V1MB 1QGDA 2J9FB 1L8AA 3DV0B 5I4IA 2BFDA 5AHKA 2QTAA 2W93A 4K9KA 1X7ZB 2UZ1B 2JGDB 4RJJA 2C3YA 3EXIA 4K9OA 3DUFA 4MPPA 2NXWA 2OZLA 1X7WB 4JUDX 1B0PA 3ZHTA 2IEAA 3M34A 4K9PA 1X7XB 3ZHUA 4JUBA 2O1XA 2WVGA 1PVDA 1OZFA 2Q5QA 3LQ4A 2Q5OA 1ZPDA 4MPRA 5I5GA 1UPBA 1YHZA 2VK8A 4D5GA 4JD5A 4WBXC 2XT6A 2Q28A 5EJ9A 1UMCA 3RIMA 2FN3A 2EZ8A 5HJEA 1W88B 4JU9A 1YBHA 2C42A 1X80B 2X7JA 1UMDA 1TKAA 3AHIA 2BEUB 4GM0A 3JU3A 3E9YA 3ZHVA 3EXFA 2IHTA 4D5EA 3AHJA 2C3UA 3M6LA 5HHTA 1UMDB 2BFBB 4QPZA 2YIDA 1V1MA 2V3WA 3HYLA 3DV0A 5DEIA 1JSCA 2UZ1A 3ZHRA 2G28A 5DGDA 5I5EA 2JGDA 3LQ1A 3UK1A 1V16B 1PO7A 3AHEA 1V11B 4K9NA 5K3SA 2VBIA 1X7WA 2C31A 2PDAA 3F6EX 1WCIA 5EXEA 1TRKA 3EYAA 5EJMA 4C7VA 1X7XA 1DTWA 4KXWA 5C4IA 2G25A 3DVAB 4QELA 1N0HA 1WCIB 2BFEB 2C3MA 2XT9A 5EJ5A 1Y9DA 1DTWB 4KGDA 2FWNA 3ZHSA 1W88A 2R8OA 2O1SA 1OZGA 4FEGA 4JUCA 1X80A 2BFCA 4KXVA 3ZHQA 3EY9A 1YNOA 4FEEA 1QS0A 2BEUA 3FSJX 4K9LA 3EXHB 4K9MA 1AY0A 2DJIA 5K2OA 2BFCB 2BP7A 1QPBA 3F6BX 2BFBA 1V1RA 4RJKA 1POXA 5K6RA 2Y0PA 2PGNA 4JU8A 1QS0B 2JIBA 1UM9A 2Q27A 3L84A 1TKCA 2EZ4A 3EXEB 1YD7A 1YI1A 1POWA 4KXYA 2BEVA 1R9JA 3FLMA 3IAFA 4ZP1A 1NI4A 3AI7A 2VBGA 2BP7B 2IHUA 1V1RB 2VK1A 3AHGA 1V5FA 3UPTA 4GP9A 1U5BA 1UM9B 1V16A 1T9DA 2BEVB 1T9AA 1V11A 3M49A 2PGOA 4Q9DA 5FEMA 1NI4B 3IAEA 4COKA 1U5BB 4GM1A 3EA4A 1IK6A 2JI7A 5DGTA 1W85B 3M7IA 2BEWA 3DVAA 4MQ5A 1OLUA 5EJAA 3AHDA 2Q5JA 1KEKA 1YI0A 2BFEA 2WVAA 2BFFA 2EZ9A 1OLXB 1MCZA 2VK4A 1UPAA 2BEWB 1OLUB 2VJYA 3HWX1 1T9BA 2C3OA 4QQ8A 1OLSB 2BFFB 2WVHA 3EXHA 1V5EA 5HYVA 1OZHA 2AG1A 1BFDA 2BFDB 2UZAA 4C7XA 3LQ2A
chains in the Genus database with same CATH superfamily
1RXYA 4IJMA 5CLGA 5F23A 4NJMB 5TIIA 2QPOA 3F3YA 3JAWB 2P9YA 4Z51A 4YAUA 2EG9A 2EGGA 3G0BA 4IQ4A 1ELOA 4E3WA 5KJ6A 3W78A 1S2IA 2BEJA 1KI1A 2WD9A 4RENA 3K70D 2W6JA 1V6CA 2CKMA 2V7QD 2LDBA 2YICA 5SZJA 2ALJA 4NBSA 3D8UA 1VKZA 3ZWKA 1V8BA 5DLDA 4AKIA 3C16C 3FCOA 2GDJA 3PDIA 4NHOA 3F6PA 3HEAA 2VQ3A 1C7JA 3TQHA 3FKQA 4RM3A 3NU1A 1GCIA 5M7EA 3Q8MA 4R1TA 3KKMA 4R0NA 2E4VA 3DLAA 3IBCA 1IY1A 5LQCA 4MA4A 2C98A 3CY6A 1B76A 1IMJA 3NRBA 4CMAA 1QCYA 1RYBA 2AKYA 3FVRA 2YJTD 3OHPA 1UK9A 3PGVA 3IDOA 2EKDA 4A16A 5K3FB 4RS4A 4RA9A 4WOBA 4TKUB 1Z18A 3I2HA 4I1UA 4BBPA 5JY1A 3GPDG 1T8SA 4TVBA 3I83A 4LZLA 3RYFA 1EQAA 13PKA 1NKTA 1UZUA 1TVEA 1ZCFA 2GK6A 2WSIA 1OFUX 2G4LA 1U2GC 3H7IA 4LDRA 1RWPA 3X0DA 1GQFA 2X1VA 2AIRA 1B42A 3KLMX 1RM4A 4MI1A 4BPBA 2EF0A 5ALLA 1P72A 2B69A 3OOYA 4F85A 2J3MA 5B7NA 5EIXA 4N18A 5HGXA 2CUTA 3C70A 4O0LA 1TQ6A 2XRMA 5AKHA 3SEFA 5F1KA 2XDAA 3AR9A 2XUGA 2Y05A 3NTUA 2VPZA 3TOCA 2QX7A 4BDTA 3CLTD 3RUEA 5F52A 3HJGA 3QF4B 5FO0A 2J3KA 3T3IA 3UOGA 4CEJA 3SQNA 3ED1A 1QTQA 2X41A 1F8GA 2I22A 4Z0PA 3CPHA 4WFIA 1H0HA 2CXRA 3AR7A 1G16A 3KOXA 4V39A 3ENZA 3HJUA 4DLTA 3IAM6 1CW2B 2VDKB 1S02A 1Z5VA 3MRTA 4PC3A 4UPVA 5JV5A 4FM9A 1G6KA 5K99A 4QUDA 1BXRA 2VA8A 3IILA 1GPWB 1M2KA 3IQDB 1HE4A 1IDN1 3MJRA 2H5JA 3OZRA 4WNAA 1NN3A 3UO8B 5EHXA 3PHCA 2D0OB 3ELWA 3ZNQA 4OFZA 4B34A 3GLTA 3ET5A 3SHFA 3TL2A 5FUWA 1VQ1A 3DS8A 5LB2A 2J4FA 3PEUA 2CVZA 1X6VA 3A6GA 3DEIA 3RYTC 4OB7A 1VXRA 1P7WA 1CXZA 5FADA 4JEMA 3DMTA 1ITZA 2WWHA 1CD5A 1IHDA 1PV1A 3JWIA 4L73A 4TSFD 3QNMA 2BE9A 4QEKA 4PXSA 4KI0A 3JVIA 3KB1A 3QFRA 4AB1A 3TAXA 1PNQA 1V8ZA 3ZW7A 1AZTA 4FE4A 5ICGA 4RQBA 1PKEA 4EZEA 2PMBA 1UADA 4Y2TA 4OHYA 2P6RA 3C8UA 3CLUD 3OIDA 1ETUA 2J0VA 1VLHA 2MT9A 4MS1A 4QT0A 4C7KA 1VHLA 4IKEA 4O5AA 3REQB 4L4SA 3DBIA 1OLSA 3ASYA 2CXUA 3HL0A 1ZNYA 3EXG1 4H60A 4JBYA 4PX3A 3J7AC 4RD6A 3U3KA 4EJSB 5LIRA 3NALA 3O91A 1QOZA 3DTNA 1EVKA 4UBMA 5A05A 4BJHB 1GTVA 2ZTUA 2GTIA 4CZ2A 5JFGA 4LF4B 1YZFA 3SIRA 4B6FA 1E2PA 4ZYVA 3R9IA 3K0EA 5K3BA 3A04A 4TS3A 4F1WA 1EGQA 1SWVA 1TEXA 4PYMA 3HYTA 4KMRA 1RW4A 1DU4A 2GNAA 2GRAA 4RK5A 1ZH0A 1V4NA 2CHUA 2QTAA 3KOYA 3MWJA 2F3PA 4YNBA 2HHHB 1UEXC 5KSOA 2IKQA 1L6RA 3DDHA 4XJXA 1JEDA 4D9BA 5I47A 5IKEA 5JO9A 5JAUA 1LSUA 4N82A 2QJWA 2W2QA 2VG8A 3NTRA 1GSAA 2X9QA 1E5LA 4ZHQA 2ZJ1A 5HFAA 5T67A 4TZKA 5KQSA 4U1RA 4K0KB 3OCYA 4MYRA 1UT5A 1ZQ9A 4OY3A 3UVEA 3UJ7A 1M74A 5TQVA 2PSHA 2Y1GA 4QM6A 1B1CA 3CSUA 4BMSA 4YLGA 4C6HA 3SX0A 3GLGE 1QORA 1XL0A 4JLNA 3WAJA 3KC2A 2ANBA 3W0LB 4JQYA 5KC9A 2V03A 3UXYA 4A6EA 3ZLBA 1PVVA 2AGVA 3EQ9A 4RBNA 4IZHA 4EY5A 2YH2A 5IEJA 3DV9A 2FW9A 4FC7A 5E7JA 2J9YB 3F9RA 2DB3A 4FFPA 2BONA 1Q12A 3H9BA 2X1LA 4JUBA 1PR1A 1J00A 1QIEA 3CGGA 1Z2NX 3A9RA 1SOMA 4NI5A 2WVGA 2E85A 4RLHA 3AOEA 2O7QA 5JAOA 4U2FA 4CMGA 2Q2VA 2BCGY 3RYCB 2XB2A 1NW7A 2WHQA 2WM3A 4QG3A 3NBYC 2NG1A 1RAGA 5LZ7A 5BQ3A 5LXTB 4X1YA 1NI3A 1KYIA 2F1IA 1RP1A 1Y81A 1WLSA 3OWOA 6GPBA 2NW6A 2PVPA 3QI2A 4D9CA 4WZBB 3OZXA 5JZVA 1QHYA 2RKWA 4H9GA 4C01A 4NCHA 4D4KA 2V6IA 3OX2A 5AOCA 3V1YA 4CV2A 2AJCA 4WKNA 2BAGA 4BNUA 3AM1A 5ADVA 1D2MA 1F38A 3OJFA 3ZU3A 5CDFE 4KBYA 4CIBA 2EHJA 2QGFA 3E9RA 1CU1A 1DT5A 2RI6A 1O9BA 5ECWA 1R6BX 4YJFA 3DCJA 4YEDA 1T6XA 3CH5A 3DLIA 2NZ8A 1OH6A 1JDNA 1U4NA 2ZPAA 3BJZA 3EDRA 3NRCA 3B1XA 3KKQA 4U2DA 5DX8A 5CCBA 2ZUDA 1Z5ZA 3KAKA 4BLVA 1C9KA 1MJNA 5IZCC 1A50B 5JSFA 5J23A 2BL4A 4KIJA 1PZMA 4LXXA 2J5KA 4S1WA 4B75A 4KL8S 3T34A 2F3QA 4LDAA 1SIWA 1E69A 2NUAB 2R84A 3D7RA 5FLYA 5BR4A 1P9WA 2EL7A 3TVDA 5K2MA 4HOYA 2ZU0C 3VOBA 3K30A 1DJLA 1CFZA 1SCAA 4PC7A 5CJPA 1JYEA 1ATZA 5C1PA 4KIWA 3MELA 3ESZA 4MV0A 2QMQA 4ZIRA 2AYXA 3KDAA 3EIEA 3NUQA 4Q7JB 4W8GA 5DP1A 5SICE 3I2FA 5DLQC 3IERA 1SOWA 1IQPA 1ISRA 1KS9A 1SC3A 3KUUA 3NKVA 4MSUA 5FFMA 2PUJA 2QVXX 4P3OA 4PRYA 1NR7A 3BK2A 3CVJA 3T1OA 1E5TA 3Q2IA 1MHPA 3GDGA 4LWPA 4CBVA 3LQRA 4MV1A 3QVWA 5EIBD 4FCCA 3EQ6A 3L93A 1UPTA 4UCWA 2NU8B 5JMTA 1NQ5A 2G04A 1WLYA 3CFYA 2QXTA 1LK0A 2BMJA 3F8SA 1VI5A 1J5XA 2E4UA 3L7AA 4X6XA 4BKPA 1VPEA 1RJFA 4P83A 1Z6TA 3D0QA 2HW8A 4LV5B 4ZCPA 4PZZA 1FUEA 2COUA 2DKOA 3CIOA 3JQAA 5A7FA 2NPFA 3CM0A 1VE7A 4MWTA 2OZPA 3UKOA 4EITA 3CVUA 1N75A 1C9YA 3P2EA 1Z28A 4N0PA 3ROZA 2G28A 2REQA 1CV2A 3RDPA 3U40A 2R6ZA 2JGDA 2FFRA 4MULA 3LQ1A 4D8YA 3H2SA 1QH8A 3E4DA 3B70A 1UWLA 1EDDA 1EUYA 1EFUA 1DIRA 3MTGA 1KZYC 3USES 5FUBA 1KEUA 3PPXA 2I9PA 2FYTA 3I9NA 4KZPA 4H1WA 4OB8A 1SCIA 1AQ6A 5B1EA 4UQOA 4DHWA 1GGMA 3ZD8A 1WY5A 2LUOA 2Z95A 3HUDA 3N2LA 4DA0A 4DDHA 5EA2A 1IPEA 2PKEA 3U48A 2Q9BA 3DZGA 4P7GA 3S5JA 4NOMA 3H9EO 4M83A 3NATA 4Y1EA 3L1HA 4AU1A 1LRJA 1N3IA 1K4KA 4ND2A 1E9CA 3B5JA 1SELA 3HGTA 2FDCA 2IP4A 1N4DA 3K9QO 4O3FA 1C7QA 1QU2A 4EA8A 1HDXA 3BFXA 1ZC4A 4WZAB 1WNTA 2CUKA 3ZTWA 4ZYLA 3FPGA 2WB2A 2XUZA 1Q0PA 1XZLA 5T6MA 3BXOA 3HKEA 4QRIA 3DEAA 4BS9A 4ZAFA 2P2ZA 1SJ9A 3KPUA 5ICCA 2GCPA 2Y6UA 1R0KA 1W36C 2YINC 2R96A 2O05A 4IDNA 2LCQA 3O21A 3OSUA 3D4PA 3ZCXA 5C8XA 3OJCA 3B6IA 3ILXA 4KU4A 1WCIB 3S28A 3TUJC 1AX9A 3G2MA 1T26A 3BMOA 3RRZA 5I4KA 1RLUA 2WZDA 2GO1A 3KL2A 4KPUB 5F7XA 1ECLA 2WSSD 4WCFB 1VPWA 1XVLA 5J58A 3CUKA 1DTWB 3HLTA 1CUVA 4IAOA 2JAUA 4YO7A 2JKZA 5CHYA 1ULTA 2FQXA 4BQNA 3K8OE 3PKIA 1DUSA 4FEGA 2QD5A 3M1YA 1IUNA 4IMRA 3UWOA 2YQZA 1S8NA 3DQPA 4ZDJA 4UEOA 2ZZKA 5CHEA 1SQFA 3G0HA 4OV6B 4P0PB 1U0RA 2PGDA 3CSDA 1HRDA 4M1ZA 2FETA 4NABA 4YROA 2VDLB 4ALLA 3RCBA 1TUGA 4AKTA 3P4UA 4QU8A 4RSRA 4TXJA 2OHHA 3D8SA 1USVA 3F0TA 2IUFA 5CVVA 1E2KA 1MX3A 2YBDA 3HWSA 1QR6A 1YZUA 1EX6A 3NEJA 1KU6A 2PRSA 3TTXA 4E5YA 2PNFA 4EKGA 3OQMA 4DABA 3KYIB 5C5CA 1BN6A 3OEHD 1NZFA 4HDSB 1NNSA 3EEQA 3FYCA 1Z4MA 4LXGA 2INGX 2ADMA 2BHRA 5TT1A 3LVRE 3OQJA 1YJ5A 4EW1A 1I4LD 2JGLA 3S8MA 5F1OA 3J80A 2J9GA 3LDHA 3EZLA 1YDFA 1YGYA 2IXGA 2R2AA 1HKUA 2J6BA 2AOUB 2XE8A 3C45A 4LC9A 4X8LA 4B6EA 4EYGA 4H1UA 1U90A 1DDIA 3Q11A 4UDYX 2WICA 5BMVA 4CLXA 3FTQA 3NW9A 4IX9A 4KO3S 3BSWA 3H2JA 3O6VA 621PA 3AIIA 2B2NA 1GV1A 1RBYA 2TMKA 4N49A 1B7GO 4BZQA 4O4HA 4QNMA 2IYQA 3ACBA 3WMFA 3ZY6A 5TPZD 4EPXA 5K8TA 4GR5A 3H4IA 1KO4A 4C9BA 1F3LA 5K0FA 1UP7A 3GUCA 1EXVA 1ZIOA 3KEMA 3N0XA 4HUTA 5KNLA 4QDUA 1TM2A 2UV8A 4MKRA 4RESA 5IBRA 3P4YA 1JU9A 3JALB 4B6PA 3ZPXA 2PZEA 1L7PA 2DYKA 3E3OA 4KAAA 4JJGA 4DWJA 4WI1A 1RC8A 1T9DA 3L7IA 1ZHFA 2IEIA 4P80A 5KVAA 2HQOA 1E0KA 1ZUIA 1V3QE 4AI6A 4H6PA 4N54A 1UT8A 2B4RO 3A1SA 2G9UA 2UAGA 1N32B 3JQGA 5E2IA 4BQEA 1I1QB 4KUEA 1Z2DA 4O1MA 3ICOA 2BZGA 1E1QD 3MZ0A 5CJJA 5EMHA 2QRKA 3HABA 4BBJA 3ZI0A 5DNAA 3G88A 4QREA 1QDEA 1B8VA 1LB1B 4YRJA 5MFZA 1CR6A 1J33A 2D00A 2GBCA 3E84A 4KLRA 2QZJA 4AIRA 5DKFA 1JXQA 1RYYA 2XDYA 1T0BA 3Q5DA 4N6GA 2JLYA 3BKWA 4NK5A 1SCNE 1XXHE 3B1FA 4I6JA 3H5IA 1CJKC 3IUBA 3IH5A 1H5UA 1NQXA 1QR2A 2JI7A 2O14A 3O8OA 5B4TA 3EFOB 1DAPA 3I2GA 5TT0A 2DTDA 1SRRA 3HJBA 1RKUA 2IPOA 2ZIWB 3AO0B 4KMOA 4CHGA 1PFYA 1YCFA 4N8SA 1T5TA 2OGWA 4X3PA 3ZU6A 2A9FA 2P6NA 3E4CA 4HAZA 1TQ8A 4MXDA 3HB4X 4XVUA 5DI3B 4HFJA 5KIAA 1B2RA 4OKIA 3ABOB 4EF4A 2E87A 2I99A 2XWJI 1V95A 5DHPA 2J9ZB 5A4DA 2ZB3A 2QAGC 1O58A 1ND5A 3E8SA 1UUFA 4G5FA 3FETA 5FJIA 2JRLA 1PYGA 5CU7A 3UHPA 1ONNA 1QYXA 1OLXB 1M10A 3PC8C 5FPSA 4EG1A 2PUGA 1QX4A 2C5SA 4CF6A 2MSNA 4NU5A 3DVSX 3PDJA 4NY1A 4P36A 2IYYA 1Y48E 1X8LA 4U7WA 4BNKA 3IRUA 2IPMA 3QTTA 1GL6A 1KMMA 2H9IA 3ER6A 4PZLA 1VPTA 1XMIA 3DAPA 5KYKA 1GPYA 3SC2B 3ZVRA 3RUHA 5EIFA 1Z0FA 1E6UA 4ZOCA 3LP8A 1U1GA 1OBFO 3U7HB 2I4NA 3CLVA 1D8AA 1YB6A 3OTOB 1U8YA 3JASB 4IEEA 4AJOA 5EZYB 5E0OA 1C7IA 3G2OA 5CDYA 2Y76A 4BQPA 1RPTA 3IT2A 2P9GA 3ZWAA 5HQTA 1M1ZA 4ZAZA 2BFFB 4HV4A 1DZ3A 2QQ5A 3DMGA 1VYUA 5CCEA 1BMTA 1K97A 3KR0A 4YT5A 1TMGE 1Z88A 4ND3A 1VL0A 3M9XA 3FGPA 3NZEA 3I9V6 3CVYA 3FMIA 2QBYA 3C7CB 4PIPA 2QPLA 3QSYA 3OF3A 4N3CA 1P3DA 1QHFA 5LZ9A 4F5DA 2SCUB 4B0PA 5FWDA 2NUTB 1U2DC 2E37A 2VPQA 2OFPA 1SURA 3BG5A 5G1PA 2KMLA 1KP2A 1AQLA 1EK2A 3A1UA 3CNHA 4FBMA 3PFHA 5DIFA 2O52A 4AK9A 2XEDA 4B74A 3IXQA 1F5SA 1PSWA 1GKYA 4HB4A 4ZCSA 2ZVDA 3WLJA 1WL8A 4N8EA 3A11A 5K5EA 3UZUA 4US0R 1A3CA 4IHKA 5K6AC 1G8MA 2JAQA 2Q1UA 1KZ4A 1CJTC 5EWMB 1PDOA 2H2HA 2OKGA 4IQGA 3KQLA 4EGCB 4TS9A 3ND9A 2BZSA 2ZYHA 3JQ9A 4JSYA 4FW9A 4K9SA 1GUBA 1UEIA 1YQTA 5ESDA 3TR5A 1PLJA 3VFDA 1TEHA 2PD4A 2XXAB 1I3MA 2WKRA 2ES4A 3CNLA 1T9HA 1ZYUA 3F97A 1XZAA 2HBRA 2C4WA 1UK8A 2Z58A 3ROFA 2O8CB 3MWYW 1E64A 3EEYA 1CUFA 3QY0A 3O8QA 4RMGA 2OC9A 3T4PA 5KYYB 2CSUA 2BVNA 5G0VA 1XQ9A 4N8DA 1ZI9A 4XASA 5LA6A 4B45A 1MO6A 1Y3FE 4AN0A 1E3WB 3FNBA 3EC2A 1WKBA 2XB8A 2CVPA 3KUXA 3G82C 1IHXA 4KX3A 4QYIB 5BW8A 1LSOA 1Q44A 4UARA 4XARA 1I01A 3R0IA 3NQ41 5EPUA 1N8NA 3RFCA 4YRAA 2WAAA 5U9CA 1CIPA 4RMNA 1R66A 4D82A 4BO4A 2RH9B 5IN5A 2ZUEA 3OT1B 3KHUA 2XF8A 1XEWX 1VP3A 4JIMA 3WO1A 2FFHA 4XWKA 4CLRA 4KE7A 5I9TA 4X63A 3D2BA 4KBGA 4G07A 3TZBA 5IJ0B 1IOVA 1LF0A 4ZCLA 2I1LA 2PQ0A 3QELA 3IVXA 5CB8A 3S8YA 4N5LA 4URFA 3D3WB 1PNRA 1L8XA 4TLLB 7ADHA 1YULA 4UASA 1X2EA 5F33A 4IWNA 1E9AA 1HZZA 2WPNA 1SBQA 1R8YA 2JI9A 2ZDQA 3ET4A 4I4NA 5HKBA 2C2XA 1DKLA 5FNVB 3D3QA 2YRWA 3UF0A 5JEEA 1P2UA 3Q10A 4NCBA 1FRVA 3ZEAA 1B15A 1N2IA 1PZHA 3D1VA 3VYTB 3U61B 4RZHA 2BM0A 3E5MA 1QQ7A 1F7UA 3A6JA 2AYZA 4Q05A 3N76A 1P6QA 1UCFA 1AHNA 2PRKA 3IPRA 4K9QA 4OJYA 4J1TA 2GMWA 4I08A 3VDNB 2C00A 1TADA 3B1ZA 2IIPA 2VXBA 3AI1A 2K6GA 3KXKA 5HNKA 1YFZA 4E5SA 1EA7A 1RKVA 4EI8A 4XIYA 1N5JA 1A5SB 1BIFA 1X7YB 1P5FA 1JHUA 1I9CA 1HF3A 1UJ6A 2LCIA 2JJ8A 2P65A 3C3YA 2GX6A 2O3RA 3NVMB 4P4SA 1HGXA 3VOTA 2ZSUA 1GTRA 3J81A 3NXKA 3ZNNA 4IEIA 3WRVA 1Y6RA 4GYKA 4IMJB 2X0EA 4KRGA 2OHIA 3GPBA 1FTGA 3K9NA 2BMWA 4LN1A 4PYOA 4TROA 5CM9C 5EERA 2Y92A 5IJXA 6REQA 2WSBA 3LC0A 3OKCA 3ANTA 3CW8X 3WL5A 1OGIA 2YZGA 3HE3A 4G0ZA 3F73A 3VKWA 2B4AA 4UDXX 2PLWA 2CJYA 2MR5A 5FP0A 1BVYF 1T91A 1VIAA 4NFSA 3L8EA 3TB4A 4YY3B 1C2YA 3T9BA 2VVTA 3O0DA 4HH1A 3CZCA 1AS0A 3NV9A 2Z1MA 3G68A 1M6YA 5LKRA 5CB4B 3BFPA 1ENPA 1WY7A 1W2WB 3PCTA 2ZCJA 5F64A 5HQJA 2GKGA 1TAQA 2VJMB 3KUDA 3ORQA 1RAAA 3PFGA 3QPUA 4O4JB 3ZBTA 3HUEA 4RJJA 4MS4B 2DUMA 5BP7A 4K6GA 1P29A 2XNDD 3Q1KA 2ZT8A 4DQUA 3NS7A 4F3NA 5J4HA 2GEVA 4ERXA 1XQWA 1WR8A 1C14A 1Z0KA 3RJ9A 4U3JB 5FAKA 5KOYA 1QRRA 1HYEA 3G5AA 4B73A 1ZKDA 4EF5A 3KWMA 3M3DA 1SRQA 3HGMA 4QDKA 3SYMA 1XLTA 4EYSA 3NC1C 3HCEA 4G4IA 2WWWA 2O23A 4G97A 4JUDX 1EX1A 5IAJA 1BQEA 2A14A 2PFSA 5C1OA 5C8DA 1SA0B 1JIQA 2BFWA 2CYBA 2APJA 2QYOA 1W34A 2QT9A 3VPBA 1PT9A 3M4ZA 4EB6B 3I8SA 3D6HA 3ROEA 4HNUA 1E3IA 3NG1A 2IYFA 3PHBE 1VRVA 2XCQA 3E22A 3SYRA 1YQWA 4FBGA 4U0KA 1UKAA 3TSOA 2E4AA 1YXMA 1EDBA 3FJOA 2WUDA 1YE5A 4IV0A 4CM9D 2A8YA 2O8FA 2CVHA 1OU0A 1KEEB 2V6BA 2FUEA 1M8PA 2O0JA 2X42A 2C58A 3G9UA 3L0BA 3TKLA 4W4TA 3VKUA 3Q8LA 2CV1A 3A6PC 5EZYF 1G8GA 2QSYA 5TEWA 3UUFA 2AJBA 1MA3A 3ZHBA 3HJHA 5GZ1A 2ZXEA 1K2VN 1PK7A 3LF2A 5DM4A 1WKCA 2O3SA 2VCYA 4MPRA 2IYNA 3LCCA 4IOKA 3CNNA 1L5LA 3DL7A 4EJSC 4X84A 1KERA 2DPXA 3I76A 3COSA 2V0NA 4Z7NB 2RHBA 4Q7LA 4QOJA 3IEKA 2X4DA 3FAKA 3OY2A 4V0SA 4Z8YA 1P18A 3GNSA 4L8VA 2DX7A 4KR3A 2F4VB 5LOVB 5ALGA 5BRNA 1JEYA 1MDBA 5E6RB 5ESXA 4BXOA 5K05A 5CGQB 5IC5A 3OPNA 4C7OB 4DIKA 4L1KA 1AHIA 1OPRA 4MW9A 4FZJA 2E4WA 1M6NA 3KTDA 5K0EA 3I5YA 1QYRA 3PQFA 2Z8XA 3WV4A 4PC1A 3SKYA 3PT5A 2ECKA 3WIUA 5HRAA 1ISSA 1LZKA 2HFKA 2AW3A 1E6KA 5A6VA 3I5UA 4U2KA 1YONA 3HJFA 1BS9A 3HJCA 1L8QA 4CRWB 1I7LA 2BD0A 4ZYXA 5C4GB 3DOFA 4AUEA 4R3UC 1D1QA 2O3TA 1IBCA 4UHJA 2OD2A 6ADHA 4YCCA 1SOUA 1NVXQ 4XSHA 2MINA 2PKQO 4MKIA 2C9MA 3DT6A 1FSGA 4KRYA 3ZHVA 4FDLA 1EE2A 1DRVA 1II8B 2HQ1A 2SKCA 1DC7A 1C9MA 3GH1A 3MWDB 5IARA 1OFHA 3THWB 3QOYA 4DVJA 2AEFA 4R2XA 1T2EA 2WF5A 2K2WA 5AWFC 1GT6A 3Q12A 3VC2A 5FH9A 1HLGA 3EW7A 2D5BA 1U28A 4TRRA 3SKVA 2HIMA 1DKRA 2PCJA 3LCRA 3EW9A 3M5PA 2H7YA 3IOBA 1IY2A 2WD8A 3EJWA 4JASB 4QPZA 3V4ZA 2PLRA 3OZUA 4N9WA 3OM9A 5A5FA 1ZMRA 4A15A 4PG7A 2ABWA 1NQWA 3LXUX 4Q4JA 4FHDA 3EAFA 1CNFA 2XODA 1IEXA 1YQUA 2YXLA 1OILA 4YP7A 1P4RA 1KZ7B 2OC4A 2P4EA 1FMCA 2ZSKA 4O2AF 5KNCD 3LUDA 1YDEA 2ZUBA 5HCUA 1SD1A 3QZUA 4EW6A 2DFLA 6CHYA 2DBRA 4TQGA 1XDBA 1OGJA 3FHOA 2J6IA 1CB0A 1S3GA 1P91A 4FKBA 1ZL0A 2AD1A 1VPLA 1QHEA 1TTQB 1ZCZA 4P7KA 4YUXA 1XYVA 2CDCA 4B3JA 3CUWA 3FOWA 3AJDA 3C6BA 4ZVNA 1MX5A 1M1YB 2P90A 1WMAA 1PUXA 1WHTA 1OB5A 1KIMA 4GWKA 2ZDGA 1WS6A 1JQKA 1TCCA 3VDRA 5JSZA 4NYIQ 2V74B 4D02A 2A84A 1E0DA 2NYAA 2PD3A 2HCRA 2ZE5A 5FNVF 1H6AA 3UM9A 4IJQA 1SHLA 2PEYA 4Q6BA 1A98A 1RIFA 1C7EA 1AO3A 4A82A 5HA5A 4ND1A 1YS9A 2W00A 4Q37A 4TS1A 4GC9A 2W6JD 3DW3X 5FDFA 3D6VA 1OIWA 2E0IA 1CUBA 4URZR 5HCNA 3RJZA 3VV2A 2GLTA 5HPYB 5JCXA 4JI4B 5L6LB 3F5MA 3TW8A 1X8KA 2YNMA 3ZDQA 1ADFA 1BCRB 1ECGA 1LD3A 4DIOA 1TF2A 5LSAA 1U1IA 4AZ3B 4AUMA 3CLSD 4CQMA 5C4IA 1QHXA 2BGMA 2PX2A 2PL1A 4J3NA 3EGWA 4FKZA 2JFYA 1H22A 2OO7A 3A1CA 1P39A 4P5PA 1EFDN 2OAP1 1ODJA 4M1KA 4OXQA 4IZIA 2FZKA 1KOLA 4BAZA 5I7VA 1WBDA 2YL2A 1CRLA 3RYIB 2WDPA 3BTVA 3HYNA 3TIVA 1RKXA 5JI3E 3KKOA 5CFQA 2RJNA 3QWIA 1QYVA 1CZNA 1U6KA 3NJ8A 4G36A 2XB9A 1GLVA 4OQXA 2XT9A 1W7AA 3KT0A 4JA2A 3T7DA 3AESA 3O92A 1SBHA 3DGEC 2CK3A 4DKJA 3K2EA 2M32A 5C5IA 3BB4A 3QMWA 3H9UA 2VUHB 3RAGA 3WRXC 2QOEA 2NT4A 3KSUA 1QIKA 5CB4F 5ITVA 2JJ1A 1QONA 2H57A 4JLWA 4O4JF 2UYYA 3F4KA 1E3LA 4ZVOA 4PHTA 1CY0A 3C41J 1KH3A 1IEVA 1N7GA 2PTHA 3NJ4A 4L0DA 1Z8FA 4DY4A 1JEQA 1F2DA 2BTQA 2WUWE 2IX9A 2FA9A 3VX4A 4ER6A 1JQ3A 3ZLTA 1IHUA 1Z6XA 2KS6A 3K1YA 3MJVA 5HZKA 3MCWA 5AVWA 3HJNA 4G5SA 4TTVA 4UMDA 5IKOA 4RD4A 2OB2A 2WU1A 2YHSA 3MTQA 5JAMA 4NXMB 1VE3A 4J6FA 1Q95A 3OPYI 4Q48A 1K5DA 1UDRA 2H7VA 5FOVA 4D98A 4ENTA 3F5QA 3PX3A 2ID8A 4ND8B 2JIQA 4CKZA 1U0BB 3M2PA 4MR9A 5ARBA 1M7BA 4CKWA 2F8MA 1GZUA 1II9A 1E6WA 2IT1A 4J7UA 4HDCA 4YCSA 1UBEA 3WBBA 1CUDA 1CERA 1GCUA 3GLHA 4FMPA 4H7KA 4MYUA 2HMVA 3RODA 4KZKA 3O8DA 1U8ZA 3C14C 1YIAA 1F2TA 1XZQA 4TYMA 1W6UA 3KYDA 1OAAA 3JPWA 4Z0NA 1R4ZA 4Q03A 1ZM3A 1ZD8A 2FJUA 1DOZA 4ACAA 3OQNA 2Q5IA 3OZWA 1JA9A 2HNKA 4Z3DA 3WYGA 5KKNB 5LXTA 4E08A 4ZP1A 2XUOA 3T94A 2J6HA 3TIXB 3TW6A 4BQOA 1IL0A 1XLWA 2VBGA 2VYFA 1MEOA 1PW5A 2HJVA 4WCFC 3GZTB 4WADA 5K8IA 1AK2A 4N0MA 2GYVA 3L18A 4L6AA 4TTTS 1YS1X 5I8WA 1VL5A 3EWIA 1XU4A 2VNKA 5K0GA 2I71A 1TYDE 4DYDA 2VH2A 4FOTA 2H9AA 4ITVA 4D0GA 2HT1A 2ZS7A 3PUZA 2VJOA 2AMVA 3EPPA 4WECA 3CWZA 2BT4A 1J25A 2QTVA 2WT9A 1EZ4A 5EMKA 4TVSA 2H31A 2HRBA 1ZUHA 3EG5A 4MWZA 1DCTA 4YJ2B 1LK5A 5EUBA 3ZYCA 2PH5A 4LK3A 4B17A 2LRHA 1T10A 5KTNA 5ENDA 3G5UA 5DX0A 3NYQA 3CKKA 1TLLA 3PKJA 3VISA 1VG0B 4E12A 5HQ3B 2IUYA 3U7JA 4UFPA 1U5BB 3ADKA 3U31A 2HO4A 1PFVA 3BTUA 1DC4A 2GVZC 5DNUA 2F59A 3KP1A 1CS0A 1Y8QA 1XZIA 4CIVA 2JKVA 2NVUB 4Q4HA 3E81A 5KJFA 2UYOA 1G8JA 1EUDB 1XJQA 2BFMA 1Y1LA 2O8DB 2IV7A 2QIPA 2W5UA 3BXHA 3COZA 2I1WA 2JEOA 2Y93A 2P8JA 3HHPA 4G6ZA 4FNAA 2VPWA 3X1DA 3L6EA 1IXKA 1YI0A 2XV1A 3FNFA 3G7SA 3OETA 3PA8A 4HH4A 5AM3A 1P2VA 2QV7A 3OQPA 4RVSA 4ARCA 1WDWB 1G9TA 1X19A 4R4JA 1LBSA 4RVGA 2V9CA 2GNPA 5E6SB 4RZXA 2AUMA 3CC8A 4HGNA 3S2EA 3T5GA 3CCBA 1QQ5A 1ARZA 4LG1A 3CF2A 3AF0A 3QOWA 5AW8A 5AVSA 3WDSA 4E2FA 4JXKA 2QQ0A 1NR1A 3OVMA 5BWNA 2IDZA 1WMEA 4L0CA 1J0EA 2I1VB 3W6PA 4QPDA 1Q21A 5B37A 2WTNA 2FG5A 5BRAA 4K40A 5F98A 4TQAA 3WGYA 4XDGA 3I01A 1Q14A 5KYUB 3HVRA 2JFUA 2AX4A 5IDYA 4YMWA 4NATA 3SHTA 2OECA 3PUJA 1SVUA 4JWKA 1X0XA 4RD3A 4YDRA 5HBGA 2AC7A 3AEXA 3UCXA 5IFLA 1A9QA 3IKVA 1P45A 2R6FA 4KAJA 1TKRA 2ZYDA 3Q7RA 3ND5A 2F48A 4INAA 1IJBA 4RDXA 3U16A 1RFGE 3W6UA 1JIXA 1XTRA 1N6HA 2W2PA 4QYXA 2ZBUA 4F1KA 4DR4B 2ZYRA 2N3ZA 4QICA 1WEKA 4AJEA 1REQB 5THKA 1W73A 3OLVA 5FOQA 5ELXA 3IUPA 4EA6A 3F6YA 2XNHA 2HEIA 3KOUA 4ZOQI 4PLWA 4Y9UA 1K06A 1WTAA 3KL4A 1VHTA 1NNUA 2VDWA 4FGLA 4HAWA 2YBEA 3ZX4A 4JI8B 1XRMA 5FTMA 4P8RA 1JI0A 4ZVLA 4D9GA 2AC2A 3OOSA 4XGNA 1NDQA 9LDTA 1WDMA 2IS4A 1W52X 3A3OA 3ZV7A 4E13A 1V5GA 1ZM7A 4MWCA 5EJEA 1A77A 2W9XA 3X1XA 4IHJA 2IDMA 1UMBA 2QE6A 4G0YA 3O2QB 5HF5A 1GKIA 2J45A 2G80A 1K2WA 3Q5GA 5B1IA 1XPRA 1HT3A 1I2DA 3B53X 4PHCA 3K0FB 3N05A 4IX1A 4LJAA 4DIFA 5TMPA 2GLUA 1E7SA 3JQ7A 2R1ZA 3NASA 5KEIA 3VNQA 1LK7A 4GKBA 1N0VC 3QENA 5EIWA 3U4HA 4F06A 1SY7A 1Z2AA 2RK6A 4MVXA 4LSGA 3PGXA 1MW9X 1EDZA 1NP6A 3HWWA 4ER7A 5KTTA 4P3XA 1PG2A 4YGXB 3ZVLA 2BGGA 4EH1A 1UFKA 4L50A 4OL0A 1GUYA 1DLJA 2R8PA 2WU4A 3I37X 2WRZA 4MUKA 3JQAD 4DARA 2QSJA 1PT6A 1UPCA 3FR7A 1WUJS 2I66A 4M87A 5ELLA 2YVKA 2O2DA 1TT5A 5G0TA 4HS4A 2ZBFA 1PYDA 4TX1A 4M1OA 4I14A 3WQSB 3CIFA 4R1QA 3SLGA 2H85A 2GEBA 1WZUA 4OOEA 1E7RA 1QNLA 1GQOA 4QA9A 2I2DA 5G4KA 1WZCA 4R7TA 4WCDA 4W5WA 5TQ2A 2DBZA 2JAXA 3DL2A 2IU3A 3H2GA 4OFXA 5D01A 5AO9A 1XPUA 3NWJA 1YHYA 3IR6A 3FVQA 3Q2OA 5H16A 3RUCA 3KXDA 3WIEA 1EVQA 3UMRA 1S3FA 1XEWY 1G5FA 4FYKA 2HJ9A 4XGQA 5DN9A 3JQ8B 4X44A 4E7OA 4PQGA 1ISIA 1C4OA 3MIIA 4YMUA 3CH4B 3TLCA 1FMLA 1BROA 3EVGA 3OCWA 4FWBA 4R01A 3WKBA 3IL2A 1Y1KE 4MPJA 2CE2X 1PZNA 3CONA 5KOHB 1OR8A 3DYIA 1GNPA 3FBGA 3O4FA 3KSMA 4JUFA 1I0IA 4LY0A 4HYEA 5CT5A 3BM5A 2W0SA 1M2VA 3K0BA 3PE6A 5B57C 4PLGA 3FWNA 4QRDA 5F35A 1PZGA 4ESVA 1M2OA 3LY7A 1Y1PA 2P1ZA 3RK1A 4JOCA 5LMCA 2P2SA 5I48A 4IIVA 2QRUA 3A4TA 3M4YA 3NV7A 5FPPA 5D3KA 5EN4A 4BJ1A 4B3MB 1XAIA 2HF7A 4DSUA 5KWJA 4GNKA 1X3SA 3W06A 1W5EA 1Z82A 2H2AA 3IP5A 3KQQA 4RV9A 1TKBA 2KB0A 5FORA 1YC2A 1X9IA 1N2BA 2GD1O 2V0GA 1AUXA 3SZOA 2ISCA 3SQXA 4C5AA 2HKIA 2HTEA 5DJ5A 1L4LA 5FUYA 1TJPB 1ML4A 1ZJ6A 4ZTZB 1H1LA 4HEHA 3RBAA 5LUAA 2BUAA 1MENA 3GJXC 4IDGA 4TWJA 4UHHA 2EWWA 1Q91A 5KHLB 2VOJA 3LQQA 4GPZA 3E3NA 3ESXA 1E5XA 1QTNA 1KJ8A 4P0QB 4TMFA 3AHHA 4FGJA 4R1NA 5JSKA 4ER5A 2D1QA 2PUTA 3IHTA 3RLIA 4DCJA 2CLLB 2IKSA 5DT2A 4OM8A 1G7RA 5G0WA 3T95A 3K09C 4C2TA 4L74A 1YDHA 3Q3HA 4WA7A 4YJ2F 3F8WA 5FYDA 1KS2A 3ZEIA 1JR3D 2EBHX 3D9QX 3IT3A 3PXXA 4TKZA 2DTXA 1JHRA 2JBAB 2UZ1B 1HY3A 1KRWA 5KNBD 2WJZB 2GCOB 3H75A 1WSDA 2O4CA 4K3UA 1IC6A 1ZZEA 2ISSD 2HZ7A 1V1JA 5EWLA 5GM2A 2QMEA 2X3YA 2ICAA 3ZWBA 3GGOA 3PRKE 3GN2A 3BIXA 4KDFA 4EHFA 1JJAA 1P8AA 1Q2XA 1JN0A 3FGZA 3B89A 3EXIA 4M21A 4DCVA 5LU8A 5KO2A 4YXWA 1HLDA 4IZOA 2NZVG 2VSOA 1XEAA 1G3RA 3DUFA 3OE5A 1IBKB 1ZESA 4TUYB 2VSFA 2VK2A 1SXHA 2VEOA 3L8ZA 3P5BA 4HQNA 3Q9LA 2H1FA 2W6QA 3AR4A 3KJGA 3TLKA 1Q0TA 3UWDA 3G3EA 4WZ6A 1PCXA 2Z4TA 3RS3A 2OZLA 5B55A 4OK5A 3N2IA 3AZQA 3WL3A 5CH3A 3JVDA 1B0PA 3M82A 5DSTA 1GJRA 4OJTA 5JYEA 3I28A 1YK0A 3NHJA 4ZCQA 1FYEA 5ALWA 3AUXA 2IYRA 1ESCA 1GRNA 2WG0A 3AW9A 4YV2A 1E2EA 4OQMA 3U17A 1R16A 1UXIA 3B38A 1GDHA 3I6IA 1FXWF 2ZJZA 1ZCAA 4IIHA 3CN9A 1MRNA 1Y1QA 4Y0AA 1T1GA 5SY6A 3LFTA 4Q15A 5EP4A 1JEEA 2L42A 3QKWA 2DPHA 3MPOA 4IIGA 3VSCA 1PVDA 1CZOA 2ROQA 3WMXA 2AMLA 3BMCB 1UJNA 2YXPX 4JP8A 1PR0A 2WTEA 2ZPTX 2Q5QA 1N9GB 2XNKA 3CB4A 3MCVA 3NBKA 4J4HA 5DBFA 1JBEA 1ZPDA 2XYQA 1AJEA 3RSFA 3UTDA 3IVAA 2FFQA 3HKCB 5BN5A 3W34A 1I24A 4L08A 2PWYA 1WU7A 5JJKA 5LUBA 2P5SA 3RTBA 1L7NA 3F67A 3MCZA 4ZZ0A 2JIRA 5J5CA 1NKVA 1SUEA 2PMCA 2I03A 2ZUCA 1X77A 3MQFA 3NOQA 4YP5A 2Z56A 3OHSX 4KMSA 2ECOA 4PCVA 5E1DA 3WLFA 2GCGA 1LX7A 3TSZA 1CVRA 3UFXB 1ZIXA 4NKRA 3HBJA 3NUZA 4KBFA 1ZUNA 4WXYB 1F4PA 4J4BA 4ZT5A 5FPQA 3SD7A 3UUWA 5HK8A 4D25A 3FSGA 2ISQA 1PQUA 5BXYA 2FP3A 4O3MA 2CMKA 1JDZA 4GP7A 3EDOA 3QVGA 1AD2A 2XWBF 1J2EA 4YRFA 2O0KA 4ZDKA 1NMSA 3GEIA 4BHTA 4G0VA 2HMAA 2FFAA 3L0PA 4BX8A 4UHBA 1J23A 1AG9A 1CEQA 2IY7A 2JFZA 3MWGA 5SYMA 1Q3HA 4GR9A 4YBZA 5KTPA 3E9YA 5L3QB 1K7YA 2P27A 2YQ5A 3NBQA 2YXEA 3EXFA 2V9ZA 3JQRA 5REQA 2QNBA 3RS8A 2FPGA 3WJAA 5AUNB 5JUWA 3ZNPA 2G4CA 3FTPA 3GNTA 3RRFA 3U0BA 4KQ1A 2H5LA 3O1IC 3L8MA 2JAOA 4BBZA 2J7KA 5KWSA 1JFTA 4W7HA 4K1LA 3RRNA 4DB2A 1NLFA 2ILTA 4DXDA 1O6FA 1K75A 3GLGB 5EHIA 4J9VA 4M88A 5HIJA 2RG1A 2YIDA 5JCJA 1LBTA 1ZI8A 2C9BA 2IBTA 2V3WA 1UFOA 1C8KA 4MRMA 4NEGA 3HEMA 5K4AA 2JIOA 2D2FA 4O63O 4N0DA 3CPSA 4HAXA 4KOAA 2BOVA 4D43A 5C8YB 3WGQA 2OFOA 3LK6A 4FN4A 4K6CA 1BD3A 4FCVA 4YUAA 1PUJA 4RVDA 2YXNA 3NTQA 3VH2A 1TJ5A 1ZWKA 1TM5E 3C8MA 3ZD7A 2PSJA 3BHIA 2NSLA 4FQ8A 1HT0A 1R4NB 1A2QA 2DWUA 4ESEA 3L7MA 2YC4C 1TU4A 3NORA 4HNQA 5LNK6 3A0RB 1G55A 3ZWOA 4D46A 3FM9A 3W79A 2ZM5A 3PEVA 2VF2A 2UUBB 4HPXB 4KX5A 1CY8A 1QK5A 1EXDA 2BJWA 2Q4RA 3LSYA 1YASA 3WFIA 1YL7A 1NOIA 1KMHA 3O82A 3QVKA 3S7TA 2BSQA 4IDCA 1QGED 4Y9RA 1GPBA 1XVIA 1YR7A 2R1VB 2Y1OA 1E4EA 2ZYSA 4JMLA 2GSWA 2YUTA 5COAA 1BDJA 5JC1A 1KZ1A 4RMIA 4J7XA 4YALA 1H0RA 2ACEA 4GLBA 3F6EX 1TK9A 1RQXA 4BVLA 1KIAA 2WYHA 1Z17A 2XOEA 3ELYA 4S2UA 4YUVA 1ZOPA 1NF9A 1IY0A 1DUVG 3ESRA 5LVAA 1ID8A 1H2WA 4PX5A 3TBHA 2BY4A 4C4PA 2ZE8A 5J2TB 2WIBA 3A2NA 3DL4A 4DTCA 1ODSA 3OPXA 1LX6A 1ZN7A 4F9FA 2W2XA 4MV8A 2QTWB 3UXHA 3HVIA 3N6VA 1C3OB 3OCUA 1TFRA 4KRXA 4GYJA 3HFSA 1IHYA 5TQJA 2DF8A 3VA7A 3FCYA 1O95C 4HEA1 5AW9A 3W4KA 2OG2A 4V1CB 4DG9A 5F78A 2JCGA 3ABQB 5LQMA 1Z5OA 3UCEA 1XYYA 2PQ2A 3WWOA 1Y9DA 1G5QA 4M6WA 4EHDA 3W05A 1O5IA 4LQDA 4DSZA 5K9ZA 3T38A 2BR5A 3ZHSA 1W88A 1KI6A 5EESA 1YB1A 3GVIA 1T3ZA 5IBQA 4LDPA 5CAEA 3E35A 2J3EA 3C0KA 3T12A 4MUGA 3EG9A 3OZAA 1KYXA 5JXWA 3N7AA 4LVUA 3UW3A 1IBMB 2CDAA 3PF8A 3KWFA 4G5OA 4XPIA 3GDHA 3QYAA 5CYOA 3CE9A 3LLMA 4TUYF 3BICA 4TYWA 3MCTA 1P4HA 3HRKA 2JGEA 3JATB 2QX9A 3N2GA 1GO2A 2IOHA 2OCPA 4C3ZA 3PQ5A 4IDDA 3V1LA 4B6RA 5AKGA 4LRYA 3VU3A 4M0PA 3C85A 4D8WA 4Z53A 1AY0A 4IKOA 5D6NA 4HTFB 3OKAA 2JK0A 1EGAA 3LXXA 5DFAA 5ER6A 2MIIA 3OIVA 3W6OA 1LBQA 3DNMA 3JYNA 1P5RA 4TXHA 5DMXA 5AJHA 4MGYR 3O9VA 4Y2XA 4A8TA 4L3WA 1IAQA 1C80A 4NV1A 4DLKA 2O54A 2J6CA 2G5TA 4RELA 4JH0A 4ZK6A 1QS0B 3O4GA 4IYRA 3ETHA 5KVSA 3DE6X 3MTEA 2WJVA 4ADSG 1ECBA 2WKPA 1XCBA 4INPA 4ZEOA 3OQ6A 4OXXA 1R9JA 3I12A 4Q4AB 5CG1A 1SKYE 3DR5A 1ZK2A 3ICWA 1W59A 3LHSA 3OWXA 4N40A 5GJCA 3MBIA 4DM3A 1N1DA 1E9RA 4EPTA 2IW3A 1PJ2A 3QPDA 3ZVMA 5HK9A 1PJ3A 2FX2A 2J0EA 2IHUA 3DLPX 5DTJA 3DBLB 3AUKA 1GGEA 2I5PO 3IO3A 4JBLA 9GPBA 3VHRA 1XFDA 5DM1A 3KSAC 4RYDA 2DUNA 4BRWA 1YZNA 3CKLA 3HZRA 3WYDA 2VAXA 2RHGB 4GP9A 1RXEA 1RIIA 2H3EA 1GNLA 2O2GA 3C3EA 3MPUA 3Q88A 1MF7A 3VSBA 4DRYA 5MN5A 4Z4QA 2PRYA 3DO5A 1YE3A 2M9MA 1J56A 1T9AA 2XTJA 1LZLA 1BAPA 3I6YA 2WK1A 4O2BA 2VJBA 4OK6A 4C0HA 5I7EA 2FMHA 2IV3A 3LX8A 3W9YA 1JP7A 5HE8A 5JWHA 2AUTA 5AKJA 4EELA 3VR4H 3RC8A 1JQDA 4WGGA 4AY2A 4XOUA 3AVUA 2PZKA 4J16A 2W2OA 1XQXA 4YMHA 2D4HA 3AJRA 4LE1A 1SUAA 2HU7A 2OSVA 1X7GA 1A4IA 3C3BA 5AP9A 4TKMA 3T5CA 4ZTUB 2QRMA 3U44A 1WB6A 1E5DA 4RIGA 3JV7A 4M86A 4I2VA 1MB9A 2HA3A 5ICFA 4G5GA 1XX6A 3EMKA 2BHSA 2P5TB 3KKKA 1MIOB 1VMIA 3KT6A 3IBYA 1PE0A 3QNWA 1ZI6A 4JJAA 5D3MB 3QIAA 3STXA 1C0EA 3HBMA 1XJ5A 2RHLA 3U80A 1DJOA 3LBFA 3LUPA 1CZLA 1ONBA 5FL3A 2BFEA 1FTQA 2ZI4A 4RYLA 1FSFA 4GSLA 3L06A 2OUIA 2CNBA 4YONB 1DWPA 4EPRA 1LU9A 1Q20A 3QX8A 5C8YF 2ZBGA 3ZOZA 3PEEA 4FR5A 2YZMA 4NPAA 4Q4CA 2G7ZA 2XQGA 3CEHA 3CCCA 3HC7A 4YMTA 1LI7A 1YZ3A 4XLTA 4N5HX 3TGLA 3PXUA 4PSCA 5LLDA 3AVXA 2XJ4A 1BFUA 4UM8B 5KYGA 3UPDA 4HQ6A 4R0VA 1LDNA 2X8LA 4LOAA 4Z1MA 4IDBA 1RYEA 2QV0A 3HFGA 3IMFA 3MLBA 1OZ0A 2I55A 3H0CA 1BQ3A 4FIZA 3SDZA 3DXYA 1DTEA 4WNCA 3A6HA 2H17A 3AF2A 4UULA 2AZXA 1PS9A 4C7BA 1LSSA 1Q92A 1Z73A 3UIEA 3FPCA 1DJQA 3EXHA 3R5TA 1MZVA 4PWYA 1ZA2A 5AIBA 4WQMA 5PNTA 2EBUA 3AB3A 3THYB 3TUIC 2A67A 2Z1NA 2BFDB 2EVWX 1OI4A 1SC9A 2WABA 4ZCMA 1FFYA 1TVKB 1FL9A 2P1DA 1VCNA 3V80A 1QGYA 5J5AA 2JI4A 2J4CA 1RHQA 2IOYA 3F1LA 5AM4A 2OQ2A 3K0CC 2EFDB 4GIBA 1GPUA 5EIOA 4G5RA 5HBRA 4P4NA 5J2TF 5E6UA 7REQA 2RH4A 4W8OA 1L8OA 3NIGB 4JK3A 3Q6MA 5AI9A 2J67A 1GGHA 3ROKA 5K6TA 3K9FC 4GVXA 4MAAA 4YC7A 5DK4A 2Q1YA 1YBAA 2GTHA 4PO8A 4QE3A 1Q50A 1XV5A 5JRDS 4NESA 1O3YA 4D0NA 3UPUA 1XXHB 1G5IA 2Q9UA 4XIGS 4CDRA 4EQ6A 1DKQA 1IUOA 3IUEA 1M0EA 3TM4A 2XBUA 1AXEA 4NH0A 5LP6A 5B1SA 3GZ4A 4WH0A 5ALYA 3AFGA 1U8CB 4P5EA 4XFDA 2J3JA 1UZLA 5F21A 5A1TA 2XZOA 1HKHA 1AF4A 1MX9A 2FN4A 2WMYA 3ORHA 3VUFA 2ONYA 2HA0A 3X1WA 2OXEA 2FWBA 3TL6A 4A73A 3Q98A 3EGDA 3LBNA 2QT0A 3I0NA 3V4OA 4CTMA 1ADCA 3C3JA 3JARA 4F2HA 2WR8A 5JD4A 4LVOA 2GLXA 3PS9A 3GVHA 4JUAA 3KJHA 2J59A 3ZH9B 5JMWA 1CX9B 3GLQA 1SHTX 2FLWA 1BMFD 1XAGA 3KRTA 3R3XA 5JLJA 5DHSA 2X8WA 4M8SA 3V4VB 5HE9A 2IYAA 1E1KA 1RJGA 2A92A 2AFIE 4G86A 3SC3A 3R9XA 1OI2A 3ADPA 2PVCA 4BJ5A 1VFNA 5FV7A 3HM2A 4C4YA 4BEJA 1R5NA 1H2AS 1B6TA 1FP1D 2FQQA 1HO3A 4ZQBA 4OBWA 3TX6A 4KYUA 3AUUA 2EFJA 5E3IA 2VLIA 5GONA 1W1WA 3A70A 2WWFA 2X8AA 3BTSA 3FMVA 2O2ZA 4MW4A 2PUHA 3QXXA 3ZV6A 4EBBA 1T29A 2YNMD 5BYBA 1ST2A 2FKNA 2FUNB 2YTZA 2BHLA 4FTWA 3MGCA 4MRSA 4JGBA 1DX4A 5EXXA 4DYHA 1KO1A 2FZ5A 1JA1A 3EUEA 1WCV1 3QTLA 5H02A 1HMYA 2CZGA 3VPGA 2DETA 4AKHA 5A1JA 3GFSA 5EUMA 4RU1A 1ISGA 3SYNA 4CQMD 3NHWA 2D2VA 3MEQA 4UVEA 2VS1A 3ZZ0A 3MOSA 1F2VA 4H7JA 3HB5X 2GRUA 3H2KA 4ALIA 1HETA 5FUQA 3NHYA 2IVZA 4UE3S 5JATA 3TDNA 3FTDA 1GXSA 3B52X 2GM3A 2GYWA 1WZEA 2WE7A 3EDCA 1V48A 2Q3HA 3D4NA 3H0EA 1C0LA 1UFQA 3R3VA 1KMCA 4PS1A 2CBZA 3VPAA 1Z63A 4RZQA 2YYAA 2XDWA 4RW0A 3LUFA 1ID1A 1Y34E 5AXBA 3GFFA 3MGAA 3D8HA 3HVKA 4DQKA 4V0RA 3DTVB 1U2GA 1KMQA 1KVQA 4DV3B 3A4YA 4IIXA 3EF0A 3G7UA 1Z4OA 2AOXA 2CK3D 3H6HA 4TWZA 5F5NA 4NDZA 1GL9B 1LVUA 2GPWA 4CM6A 4CETA 4XW2A 1NQUA 2F43B 1CY6A 1SVKA 1BX0A 2EGHA 1NRIA 2IXAA 3B1WA 1RRFA 4IH1A 3K1AB 4LDZA 1CDEA 1V1MB 2B3TA 2FPPA 2RBEA 1FFEA 1E8NA 1G8AA 2C4MA 1NVAA 2WJIA 5A5DA 2O7RA 2RGDA 4B82A 1S2GA 2QTGA 1DIOB 3GDOA 4BV3A 5I4IA 3ADBA 1H6DA 2GEDA 2Y4NA 1AS3A 4GSKA 5C7LO 2HV8A 2VLBA 4MW2A 3WL4A 3G23A 1KEVA 3O5AA 2OWEA 3AC0A 2PS9A 3WNZA 1X7ZB 3ZKAA 4ZKEA 4JP3A 3G13A 4Z4CA 2AYYA 1WU8A 3QWAA 1PR5A 3KD2A 4GHWA 5HOQA 2HREA 5E9AA 3IAXA 1AK9A 4QU0A 2Q7OE 4A0HA 1N8SA 5AI6A 3GB9A 3G0OA 3TOSA 1XMOB 4K6HA 4ALJA 5SY9A 3GRVA 4QFCA 3LS2A 4CI0B 3ZKWA 2OPBA 3ANLA 4M1QA 3V42A 5MN4A 3VR4A 1YDMA 3E9ZA 4FPXA 2FW7A 4E21A 4V1CI 5FI0B 2VWPA 2YHAA 5BVGA 2H2DA 3C6QA 1BSVA 4UUPA 2C5GA 6NULA 1IUPA 4X5OA 3CX4A 3O2NA 2OXTA 4D9HA 5GMOA 1EKXA 3B1YA 3OZDA 1VIYA 2EJBA 1DFIA 5KU1A 3AVPA 3M34A 3NNNA 4IKPA 4EA9A 2HNBA 4GMGA 5BSUA 3SI7A 2Z09A 3BFKA 5M04A 3UCFA 3VGJA 2HUNA 5LR6A 2C9ZA 1YRWA 2H0QA 1Y9ZA 2UVPB 1FP2A 2VT7A 2I6GA 4OQPA 3SQOA 2J33A 4UAUA 1O2DA 3QSGA 1W0JA 3PVCA 4DM7A 1MT0A 1DJMA 4H0NA 4AP5A 4A91A 3IPCA 4KVFA 4JBWA 4KKVA 4ALMA 2AL7A 2Q2WA 4GI1A 5CT4A 1O94A 1KU0A 4CKEA 5IPFA 4FHCA 1QGOA 4RHXA 2AXEA 1CY7A 4QPCA 4Y1FA 2XTMA 1WCYA 3MMZA 4CEHA 4MWDA 1R6TA 4AS2A 2WF9A 3B3AA 3MT9A 1TW2A 3AT1A 1BE6A 3REOA 1XBTA 2PSFA 1DINA 1BE1A 2N47A 4MRPA 3UT5B 3DSRA 3I6QA 1UBMS 3OZVA 1ZLYA 1ZDMA 4S3MA 5EIEA 2G77B 1FRZA 4MV7A 4RZ2A 1ZNQO 3UBMA 1L1RA 4CPDA 4WBNA 5EJ9A 5FRDA 2D6FA 1CQJA 3ZQKA 4BO3A 4X7PA 4EK9A 2JGMA 3EPLA 2XZTA 1Q5PA 2HQRA 3T9CA 4RHUA 5KYXA 3LO5A 1I6WA 2C42A 1CY1A 3TIGA 1JMKC 3F3KA 5HZHA 4WN9A 4I8IA 5AK6A 1E7MA 3CQ9A 4B32A 5CIQA 3KPVA 2ZRKA 1MB3A 2GO7A 3D2AA 2FSVC 4XTRA 1YOBA 4N5MA 4J9UE 4CT0A 3ETNA 4BO6A 2O20A 1GYPA 3OQVA 4LOJA 1DAMA 4LJYA 2I8CA 2E4YA 3DZCA 1RVV1 3JQFC 4EHIA 2DR2A 1JWLA 1X15A 1A8QA 3EODA 1JJ7A 1TCUA 5H68A 2IC5A 1D7OA 3IDZA 4C05A 4KLCA 5EUQB 1EVZA 3I92A 2F00A 1QX3A 2FPMA 4UTZA 5A4IS 3GEBA 2WHRA 1UBNA 4E4TA 3HI6A 2W6ZA 1JKXA 1GAQA 3IQWA 4CMJA 3ULKA 4Q0MA 4P3NA 4UZSA 4BP1A 2C96A 3PYLA 4RVCA 5D1NA 3WQQA 4ENWA 3Q41A 2TMYA 5A9SA 2UXDB 2H1VA 3HKDA 4NPHA 3X1MA 1DMRA 4BTVA 1XRLA 3LDGA 4HI0E 3IJRA 2DWOA 4LDNA 4M36A 5DOZA 8LDHA 4B7UA 4Q3BA 4JBXA 1KHTA 5E95A 5K3AA 4NH4A 1I5EA 3P1JA 1EG7A 1Z9BA 2IIQA 2ZJ3A 4YWJA 3VH4A 4ES6A 3K70B 1D4ZA 3OOHA 1SC1A 2CNOA 2QDKA 4HK4A 3ZWXA 4UTRA 5H8WA 2HUPA 1ZH6A 5FWXA 5A4JA 1EUCB 3RG2A 3BE6A 3HTXA 1EXMA 1XCOA 1E20A 1U0TA 1P4AA 1ZS9A 1JMVA 1TA0A 2B21A 1G5HA 3C3AA 4ALKA 4PVDA 1LDBA 2UYHA 2EERA 2UVQA 1WXQA 1IATA 2YOGA 3D43A 5IZCA 2PX4A 2VXCA 4GKAA 2IIBA 3GR6A 1DKOA 5KOJA 5C53B 2V65A 2CBGA 3QHAA 5KYWB 1Z4KA 2EQ5A 2VPPA 4V2IA 4DSOA 2NAPA 1P1BA 3BCHA 4MRNA 1XTBA 5I9SA 2NGRA 3TAHA 1Q0ZA 4J29A 1V11B 4BFWA 1TTHA 2LV8A 1JR3E 1XRPA 1LRKA 3C3XA 1NX6A 3PFCA 1KZHA 1EQUA 2VPIA 4WTOA 5E9JA 3RJMA 2AEMA 4YRKA 3AL0C 3NHLA 3QG1A 3SIPA 3JX9A 4HWRA 1N0WA 1GG2A 1RAIA 1ZD5A 2ADOA 4TSKA 4ETMA 4KDCA 3WXMA 4GR4A 1L3CA 1Z5GA 2R8BA 3HCOA 5AJZA 2CNWA 3VO8A 2GB4A 1E58A 4CT5A 4DGQA 1P7YA 4QXRA 1MA0A 1CQIA 1LDYA 3EYAA 1S7GA 2ECFA 4MV4A 2JAWA 1PG0A 1CDOA 2VNJA 1KYTA 4YP9A 3R7AA 3OIGA 4B3GA 3EGIA 3E8MA 1IN4A 3GNQA 4HFMA 1H8HD 2IH5A 5L8VA 4L9SA 3E9EA 3K6RA 3CR3C 2RGAA 1WCWA 4H7FA 3QUTA 3GP3A 4DV0B 3GH3A 1BX1A 3D0KA 3MRSA 1U3DA 1AGYA 2RJOA 2X1HA 1AKEA 2IF0A 3F9IA 2UZIR 1FDWA 1PZFA 4MS3B 4U6NA 2Q6OA 5IW8A 5F9MA 2BEKA 5E0KB 4CLEA 5MN6A 3RS7A 3HBLA 4DREA 3INTA 4QC2A 2R4UA 4LWOA 3Q9UA 5IMBA 3S6JA 3HRHA 1MGPA 5CDSA 5I4CA 1QANA 1SB9A 2ZUUA 3RD5A 5B2ZA 4E5UA 1YJCA 1ENZA 1M2GA 1E98A 3JYOA 4YDSA 5E1MA 2Q0HA 1YRQA 5CNMA 1CZHA 2EF1A 1SK9A 1HNWB 1R3DA 1GKKA 1FDVA 5LYYA 8MHTA 5GPBA 2PRZA 2YFYA 3N6XA 1N2XA 1SZDA 2I34A 1C9EA 4UE2A 5KOIA 1PR4A 2RARA 1XZBA 3F2VA 4LSMA 3ZGNA 1TC2A 4DWVA 2VRNA 1ZW6A 2QTFA 5L7YA 3HUTA 1H2BA 4EBFA 2Y9PB 1CUSA 2IOQA 1B74A 1NRJB 1UBLS 2F3RA 3I5AA 5AXAA 3TI9A 4JLKA 3CA8A 4C0SA 4CFZA 3EY9A 3LYUA 4OLHA 5CW1A 1YAJA 1F48A 1YNOA 3CR7A 3HA5A 4JQOA 4Y2JA 3GFPA 4GVPA 1XZDA 3MC1A 2RIRA 4QYMA 3RKUA 3TLMA 2ZBEA 3C8ZA 1VBFA 5LQSA 1DDOA 3MTDA 1LUAA 2X15A 3UICA 1RJEA 2DWCA 3HP4A 3KPYA 4FVTA 1PQWA 2A9RA 5T64A 4AQ7A 2D7DA 2Q6LA 5JARA 5CB0A 2NO5A 4CR8A 2GYYA 2JAHA 1V96A 1Q7TA 1E1MA 3H3XA 3IS3A 1RKQA 5FFNA 4LBWA 5FTWA 2OA0A 4KHZA 3RAEC 1EDEA 1O0BA 1P7CA 1VB3A 1E4YA 2VNSA 4MJLA 1HDEA 4L16A 3VR2A 4CMCA 5K6RA 2YMPA 2V5VA 3EIOA 3Q3JB 3RHSA 3DMDA 2YRXA 3A3YA 4JLBA 4Q3AA 1N92A 1C41A 1RC0A 1U5AA 4KXYA 7MDHA 1M8FA 4E2YA 3ONVA 4B8ZA 2V6GA 3FLMA 5SZKB 1IYZA 1NQTA 4XB2A 1Y89A 1BW9B 4N01A 4Z7QB 1XVUA 1QIGA 1MORA 3AF1A 3AI7A 4KH0A 2Q9AA 4ER0A 4JV5B 4ARBA 4KHPB 2Z57A 3CRMA 2C5BA 4QZVA 5EZQA 4PEVA 4YQFA 4W1RA 1QZXA 2P69A 4DNPA 2XUDA 5D85A 2W37A 3AHGA 2DCMA 2VDNB 5IWAB 5T4BA 2ZSBA 2FMUA 1R64A 4EB3A 4ZJUA 1M6WA 3M4JA 4KSCA 3ANNA 4LF7B 3AIMA 4E1BA 4W9NA 1T1RA 1XE3A 4CEIA 1NJ6A 2BEVB 1FDIA 4DLVA 3TVTA 4WXRA 3QVLA 3VAAA 1CUCA 4ZANA 3DL0A 3RF6A 1MIHA 3FB1A 1OU4A 2D62A 1U1DA 4NZ9A 2O5CA 5JMPA 3AI3A 4WWHA 1NZDA 2I76A 4J07A 1MUUA 4MW5A 3CO5A 1A1SA 1YDGA 1E5VA 3GBVA 3JSXA 4E1VA 1TCBA 2PGXA 2CW5A 4WKOA 4YXWD 1XMVA 2FKAA 5CBKA 1U2EA 4JOSA 2AE1A 4C2AA 1A5BB 4R83A 4WIAA 1SK8A 3HDTA 3K6KA 2E1PA 5BN3B 4MO9A 1B3BA 1IJKA 1R5OA 1JHPA 4U0JA 2ZYIA 2DAPA 4OGGA 3OE4A 2ZSIA 3LY5A 4RDIA 3ZWPA 1UP4A 1KR2A 4MWOA 2J30A 3R20A 4IV8A 4RC9A 4DIDA 1PVOA 2RCYA 4XE5A 1ADGA 4DZZA 1HRKA 1K3FA 4JN6B 3LM8A 1KFBB 1Y1RA 3E7PA 3LIPA 3OURA 4Z3OA 3FCSB 5IRCD 2H2IA 2NACA 2V8BA 5DCWA 4EIWA 4QJBA 3I9MA 1TO2E 3ICPA 3TQIA 4MH0R 3NHBA 2OHOA 2OXCA 3G6WA 3KTAA 4GC5A 4PFQA 5DGHA 5FA5A 4LRXA 1MMFB 4P3PA 2OZKA 3TLGA 3V2GA 2P6OA 1OSNA 1DS6A 1ZD2P 2OQIA 4HDNA 4A23A 1FQKA 1DEKA 1QVWA 1O4VA 3VPCA 1CZRA 4Y1GA 3SOPA 4PO9A 3WLAA 3FWZA 4ZGGA 5HF9A 2CL5A 3C4JA 2B98A 4GZ6A 1TYEB 3RS0A 2P7IA 2AX3A 3G0CA 1N4AA 4PZPA 2JH3A 4R40A 4MR8A 1ULAA 1BU5A 1UBHS 4ZVUA 2XI4A 5TNXA 3HA2A 4FJ1A 4GYYA 1XCGB 3GF4A 4QAQA 5LDDC 2WUEA 5IANA 5CFOA 1Z25A 2DT8A 1KJ9A 1Z36A 1BG6A 1DIBA 2Y1EA 2I4OA 3I8XA 2X0NA 5CDUA 2B5WA 4J0DA 1RT9A 3EZXA 4JQSA 1MO3A 5DGIA 1RLTA 2OCGA 3P2OA 3AUTA 2G9VA 2OBNA 3FSGD 2BKLA 3HI4A 2JA1A 4I99A 4C3OB 2ZEJA 1IRXA 2WTXA 4LXYA 1H6BA 1DWQA 1HM5A 1U81A 3D0OA 2C2MA 3HEBA 4P35A 4PXYA 4RD1A 1YCGA 3I2YX 3MQ2A 4I9HA 4NF2A 3VYVA 4BUZA 3LC2O 4RZIA 3AH8A 3Q3CA 4OQQA 4JP5A 5HJ5A 4KNVA 3GAAA 2BKAA 1YHNA 1FS4A 1I4DD 1IWBB 1KHHA 1NQVA 1T35A 2I0FA 2WIGA 4IDHA 4MMYB 4AYXA 3T52A 4DMMA 5BO5A 3ACCA 2ZJFA 1U3TA 1A8PA 5K01A 5CCXA 4IMPA 2CNKA 1PL6A 3UV7A 3L79A 3UGKA 3WC4A 2WKSA 2XUAA 3HVHA 5C7YA 5A3SA 2P3LA 4M37A 4BNIA 4XM1A 2JFPA 3VU1A 2HK7A 2QN2A 4EUEA 3CSSA 3OU2A 3QVOA 2CMFA 2OTCA 5KS2A 4D9NA 4H3HB 4JLOA 4UQPA 3R44A 4KR7A 2FTKE 1GZVA 1U0NA 5AVVA 1C1XA 2OV3A 2XE4A 4FYVA 3QKRA 1BRTA 4GMDA 2PPVA 1NJ8A 5A5VA 1FDTA 2NZWA 1V25A 3RTCA 1XCMA 2H1RA 4X1KB 3VRHA 3DONA 1K8XB 3KJXA 1LNQA 3VMMA 2A1UB 2QLJA 2C3PA 1ISMA 3V33A 4C4TA 1RLIA 4DM4A 3HGQA 2DY1A 1N36B 3V8MA 5AVYA 1J07A 2FFBA 4EFNA 1Y9JA 2DQYA 2Z9DA 4IBOA 1LLCA 4RLFA 3RV4A 4J43A 1Z8NA 4JVSB 1JQEA 3V7NA 1AQNA 4GOLD 3SBXA 1VHJA 1YVUA 1GPDG 3PXAA 4K5QA 3DC2A 2OT3B 3LIIA 5AOBA 2Z98A 3RTEA 4A2PA 3HFJA 2CJXA 2L17A 2ZAMA 1FTYA 2XGMA 3GFOA 3L8FA 2BGIA 2R2GA 2FEWB 4O29A 2W90A 3KCQA 4L5YA 4R1PA 2FB9A 3BJEA 4O1IA 2B7CA 1KEPA 2XEXA 1LTQA 1SXJA 1XN1A 4TLAA 2FGJA 5AHXA 1UQUA 1EUQA 1N0IA 3A06A 2RHHA 2YN2A 5I6DA 1J06A 1ZNWA 1QJ4A 2KX7A 4DCNA 3V48A 4ZKDA 1JJFA 3CLRD 3CS3A 4TTAA 2WJYA 4FX2A 4YS6A 3RFVA 1KFCB 4MDEA 2EX4A 3LXRA 3UMYA 1JHXA 4G89A 4Z4GA 3EYWA 1WE2A 3DP7A 1AURA 4IJVA 3WLEA 4C4AA 4ZO4A 3KZ1E 1NBEA 3AFMA 5FUVA 4HAYA 3S1AB 4HMPA 3E9DA 4RKYA 5EGSA 1EXNA 1CUJA 2PL5A 2C7BA 3KQSA 3PWSA 2HBYA 2G67A 4NNPA 2QTZA 5F1YA 5KYVA 3EOZA 4I1IA 5E8RA 5DBGA 5FWNA 2QE7D 2YWCA 4O4IA 3RVDA 2AKAB 3WV5A 3GLIA 2IFTA 1G20E 2ODWA 3BL6A 2I1QA 3U4AA 2FEOA 2RDMA 2WLSA 3NYIA 3V3TA 4WKCA 5JR3A 3LJKA 4EZIA 4HEQA 4F9TA 1GGJA 5U4QA 3BZWA 2JGFA 4D4IA 3IHWA 1SXGA 2YS7A 3WNVA 3CPEA 4M98A 1RMQA 1WPRA 2OCYC 1E1RD 3ZIAA 3HRIA 1JUDA 3PFNA 1NKSA 4L07A 1YL5A 4DC0A 5C5DA 2C78A 1K5HA 3T8YA 4FGZA 3IR7A 4EZBA 2AWNA 3TLYA 2V7BA 1VP9A 2W8BB 5IDQA 2ONCA 4NJMA 3JAWA 1EP1B 4MQ6A 4HN9A 2ZB8A 1TCVA 3H6KA 4Q9IA 2DQKA 1SMKA 4WNIA 4TLCA 1O0SA 4LFBB 1ZVMA 1Q1EA 4ZQEA 1D6MA 1V5WA 4DN6A 5JDIC 5JRZA 3OQHA 1A9PA 1AUQA 2H6EA 4YAJA 1W87A 3UK6A 1XCPA 1J1UA 2AHOA 4PHGA 3IODA 3RREA 3TINA 4S35A 4B6SA 4G09A 4Q1DA 1X1QA 2H4HA 4O4LF 4PLZA 5DSZA 5B4VA 3H11A 1NY6A 4KQMA 4YB8A 3WOHA 4X66B 3K53A 1MAWA 3TNLA 3FVVA 3BXFA 1P0PA 3U4MA 3OE7D 2WJ6A 2CLHB 5K0LA 5GOZA 3VYRB 1GQRA 1GWNA 3K9BA 1TM1E 4BGUA 2WTBA 3HO1A 4L02A 1MJGM 5K3FA 1YOVB 2QL6A 5AVOA 2H3HA 1ICIA 1O8BA 2PX0A 3SX2A 4YAIA 1QPZA 4O1HA 4JBGA 3UJBA 2BGUA 1KVSA 3W3AD 2WV7A 1L5HB 3IAM1 4HVAA 4N3GA 4HVLA 3L8HA 1Z39A 3BORA 2CCKA 2HMUA 1PFWA 2DHDA 4UBJA 2EBFX 3F3MA 1OZFA 3DUWA 1J49A 3LMKA 4NAHA 5IUKC 2TS1A 4BMDA 3BJMA 2CNDA 3ZE8A 1VDZA 5JXHA 3I8OA 4BFVA 4L4RA 2H5IA 1W30A 4AJHA 1BOFA 3FOBA 1O1YA 2OOSA 2ORIA 4I9FA 4I4IA 5D7NA 3WNBA 4QOIA 4GDFA 3LC1O 4GGPA 1EMDA 4RZUA 5CG2A 2HM7A 3QF4A 4N5IX 3QNUA 2HF8A 4WBXC 3NGLA 4YMIA 3S1LA 3PJEA 5AMXA 4AO7A 3E5NA 4G26A 3E7WA 3Q7QA 1E4OA 2B8EA 4DYVA 4UVGA 4ED9A 1VA4A 1RXVA 3HCFA 2GBGA 4DXAA 1UM8A 2ADFA 1WMDA 2Q0SA 4H1TA 5DW3A 1AT1A 1XTVA 1IY8A 2CLKB 2NLOA 1OZAA 2K7ZA 2VDPB 2XVZA 1I94B 1UMDA 2F8SA 3HN6A 1QCDA 1JQAA 3STVA 3CCFA 4P08A 5T57A 1AB5A 4F46A 2GK3A 3FCEA 5JNUA 1ECFA 3GAZA 3MK31 1L7OA 3UC5A 1KJJA 1ZN2A 1LTHR 2CCGA 2OV2A 5FPHA 3BX1A 2DH6A 1T8WA 3T1NA 3OZSA 1H3EA 3R24A 3SGLA 4UHCA 3P96A 1TUBA 4W1QA 3IT1A 2NXJA 3VHLB 3N8NA 3WAGA 3B6KA 4BMNA 1LV8A 1RYMA 2V7VA 2ZTVA 5F1PA 5FIUA 4O25A 3BCUA 4ZN6A 2DM6A 2IU6A 1ZOLA 1RXUA 4YCJA 4YWHA 4IUCS 4LMBA 2YC2C 4WN3A 1LPOA 3VKVA 3W5AA 5GJBA 4DV1B 4R51A 1JDJA 3REQA 2JLZA 5ENVA 3BVPA 2RC6A 1L3BA 2YY7A 3EN0A 3KELA 3B36A 4YMLA 1ZK1A 5L4SA 2PFKA 4D57A 3C5CA 3SLKA 4F2DA 4Z1MD 3P9RA 4A0RA 3DKRA 3K5IA 4XTCS 5FLXA 5LD2B 5F73A 4RTJA 1F51E 1W0KA 1W75A 2QVBA 3KFXA 1FFGA 2XUHA 4RGYA 5CLHA 1RZ3A 3MA0A 2R8EA 1FTSA 1QGAA 1A8UA 1VKRA 3GPCA 2HI0A 1LF5A 4CXMA 4AKGA 4D4JA 4BU0A 4Q9HA 9ATCA 3CF4A 5JVDF 4C14A 2HA4A 3H4TA 5EE0A 3HVUA 3KUKA 1ZGGA 4H4CA 5F5XA 3RC3A 1CE8A 4MVJH 1UWCA 3ICVA 2CDRA 1S89A 1I2BA 4GU5A 4YAEA 1KJNA 2REBA 3DEZA 3SY8A 1H6CA 3QV2A 1D0IA 3OUZA 3N2EA 2W2NA 2M6KA 3DKIA 4ZEWA 5J2UB 5K8VA 1KYYA 1A9ZA 1KDOA 4EFKA 3HXOA 1JG1A 1KZ9A 3H4VA 2PAAA 4A6XA 2VTBB 2QTLA 1JLRA 4PLTA 2WFLB 4UMFA 1EWQA 1M7GA 4B40A 4XRRA 2MJLA 3R41A 3AEQA 2QLBA 1I2AA 2EJTA 4GT1A 4JIGA 1OROA 3PNMA 3L4BC 4OVKA 2Z83A 1TRKA 2VJNA 3OIYA 3R3JA 4XYBA 4FYPA 1NIJA 1P17A 2FN9A 5DYTA 3DMRA 1S5PA 1W9HA 5JYDA 2P91A 1PJQA 1KJIA 3ZE9A 3K71B 1V4BA 3GLHE 2QVGA 3NT2A 2DC1A 3A3KA 3N2KB 4MJ7A 4PNPA 4JLDA 4F3CA 1D2NA 2H00A 4ID9A 3RYCA 5B4UA 2AMJA 4KQHA 3MINA 3Q4GA 2Q2QA 3K35A 1Z0UA 5DDIP 3A3NA 1DRKA 3RTDA 2PBRA 5JISA 1X42A 1LA2A 3COJA 5MGNA 1NVVQ 2KI5A 4QWWA 4WZBA 2A57A 4MB2A 2IZ1A 3T1YB 1X7DA 2HSWA 1QRDA 4KC0A 1KC1A 3V9PA 5D7BA 4ECEA 2Y2UA 4FFMA 2J1LA 1U7UA 2WIJA 3IESA 5KDOA 3QKUA 5DU2A 2DULA 3FFWA 3M6VA 1JKJB 1NY5A 3PIDA 2BUBA 3DDUA 2VSNA 3EA5A 3GCWA 3KYCB 3T4EA 2Z5FA 4S04A 1JE0A 2ERCA 3NT4A 1T4CB 3GP5A 4BCDA 2A35A 3R3SA 4QSMA 2W58A 1DKNA 5EOVA 4W5NA 2HA2A 3H9JA 5JIBA 5EKXA 4AO6A 1QG2A 3S2YA 2QY9A 5L4LA 2PKWA 3KSBC 2VZLA 1K88A 1ORRA 2Q6KA 1U2TA 3RBXA 1JAYA 1I3KA 3N1UA 5I8ZA 3L8DA 1I4OA 3LTEA 4UUMA 2QN1A 1GPJA 1IEQA 3JYQA 3PLNA 3K9WA 1KY3A 2WWYA 4DCGA 1UMKA 2ZCVA 2GAOA 3ND6A 4HYTA 3GBSA 1FFSA 3G2PA 4R31A 3ADDA 2CHEA 4J0FA 1TAHA 1W46A 3VTFA 4N7JA 1HDRA 1GCGA 2WF7A 2O48X 4JC8A 5TR9A 1UH5A 3M6MD 3B60A 1DT3A 3BE8A 4G1FA 3OFKA 2BP7A 4N47A 4BB0A 1NL3A 1RLOA 4BVFA 1WB4A 2VXYA 4QFBA 1SZJG 3ESBA 5F7JA 3W8DA 2ZIVB 4OU4A 4JGGA 3ILVA 1HDCA 4HPWA 2R87A 3X3HA 2WJHA 3CLTC 3KPWA 1E8DA 3W5JA 2JIBA 4RTLA 1JW9B 2R47A 4HAUA 4M9RA 1HTBA 3GL9A 1PZEA 1YD7A 3PNVA 2IS2A 2VJKA 3ITNA 2HRDA 2PMDA 4GE3A 5C3MA 2XMBA 4YTEA 5JD6A 3OLQA 2PNJA 4D9FA 1FDRA 3NX4A 3IALA 1J2UA 1NIPA 4DA7A 1QIMA 1GEGA 2NU7A 4Z3KA 1GDTA 3IJEB 1GA6A 4BRZA 1U1FA 3SQLA 3V2IA 4DBVO 4GUDA 3G89A 2WHPB 4DHEA 4ZEXA 1QG4A 2IPAB 1I1NA 2P2DA 5KYTA 4M1YA 2Y6VA 1TJ4A 3UB4A 4MHSA 4OYYA 4JHXA 2FMKA 5FUXA 5JPDA 3C3DA 1SOVA 4H1HA 2HDHA 2WA2A 4GO1A 4H1VA 1QU3A 3JYHA 2HXSA 3BK7A 4LJ7A 4PAGA 4XWYA 1A69A 1U0HC 3C3WA 5GIPE 5LQAA 2NADA 3QFSA 1RWKA 4U8GA 4E2WA 2G63A 4Z6KA 3KQUA 1AIPA 3IMKA 4J2OA 1EGHA 4U9HS 4LXUA 1R8JA 1XKXA 1VGRA 5GV7A 3WNCA 1DLIA 3HYCA 3CLUC 3GLUA 3AL2A 2A2ZA 1RR6A 2D2EA 1NW6A 2AC4A 4PYJA 1DPGA 4P54A 2O50A 3D5QA 4F72A 2D5LA 5BSEA 4GZLA 3GP8A 3VR4D 1KOGA 3ZDYB 1V9LA 1CDDA 3LHDA 3SICE 2QX6A 3B3FA 4WZAA 3IB6A 3T7SA 1AA6A 4BAGA 5AJYA 2PJUA 2EJUA 4DUPA 2YFKA 3OESA 2HU2A 2PA0A 3GJ6A 2WTAA 5J9FA 1JYSA 1MAUA 2CMDA 2FOIA 4RKWA 5I9BA 5IDXA 4LJSA 5FL7A 1DBWA 3H18A 3QMMA 4Q1AA 2WZBA 4BO0A 2FLKA 1BMDA 2JCYA 3E03A 4MTLA 4QQKA 4NL4H 4Q7MB 4QODA 5LZ4A 3B5EA 4OFBA 2C7PA 2ETXA 3RVJA 4D4LA 1P1JA 2O7SA 4YRIA 1DEAA 2QK4A 4KPUA 4WCFA 1NMZA 1V41E 4X45A 2FDXA 5C1IA 1E1CB 1C30A 1O94D 1U3FA 2ZB2A 3B3JA 1KBZA 1LEHA 3CF6R 2QZ9A 1P62B 421PA 4AJJA 3U7GA 3ETEA 3L3BA 2PJRA 3I72A 4IOLA 5BUSA 5A4MS 1SQGA 2MMCA 5GINE 4A8JC 3D6JA 4R9VA 1TK2A 1XNQB 4G84A 5IEBA 2G5CA 4MS4A 3U7FB 5DSXA 1D9ZA 1SBZA 4UD6A 1P2BA 2MSKA 1COWA 2QUAA 1QV6A 2PCLA 4J2HA 4LBZA 3RIYA 4QQ8A 5IAOA 4D4MA 1TIBA 1YKGA 1QWOA 4WACA 5EHGA 4ARZA 1NU6A 3HCPA 3L2OB 5CVCA 4AY3A 2WV9A 5J2UF 3PK0A 4YBRA 3JQBC 5JQGB 3P94A 1RPZA 3DCNA 4V2UA 4R54A 2ZSEA 5KINB 4LISA 3DLCA 1IZ7A 4R6XA 3P0EA 1OZHA 3PQ7A 3CUVA 2C1XA 1NF2A 2E4ZA 2P0EA 3K4PA 3QUSA 4JKYA 4LGVA 4LYYA 4HDSA 4BKUA 2FI1A 2LIPA 4OMCA 3LQ2A 4MVJA 2PXAA 2IZOA 4YMSA 4C7OA 4G65A 4DJAA 5BNTA 1RAHA </