1S4QA

Crystal structure of guanylate kinase from mycobacterium tuberculosis (rv1389)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
183
structure length
183
Chain Sequence
VGRVVVLSGPSAVGKSTVVRCLRERIPNLHFSVSATTRAPRPGEVDGVDYHFIDPTRFQQLIDQGELLEWAEIHGGLHRSGTLAQPVRAAAATGVPVLIEVDLAGARAIKKTMPEAVTVFLAPPSWQDLQARLIGRGTETADVIQRRLDTARIELAAQGDFDKVVVNRRLESACAELVSLLVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Guanylate Kinase from Mycobacterium tuberculosis
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords Guanylate kinase
total genus 62
structure length 183
sequence length 183
ec nomenclature ec 2.7.4.8: Guanylate kinase.
pdb deposition date 2004-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.63.10 Alpha Beta 2-Layer Sandwich Guanylate Kinase phosphate binding domain Guanylate Kinase phosphate binding domain 1s4qA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1s4qA01
3B85A 2KB0A 3ECCA 3QKSA 1R0XA 3VHXA 4C2TA 2WWGA 3WMGA 1NY5A 4MH0R 2RHMA 1G4UR 1AQUA 4PX9A 5KDDA 3CIOA 4R98A 5J5CA 1E9CA 1AZTA 3K9HA 2QORA 1CP2A 3U3JA 2X19A 1FNMA 4AG6A 1COWA 2CBZA 1DG3A 1XXHE 2JIZA 1EX6A 3NC1C 1W2GA 2JJ2A 3GFPA 3SFVA 2BKUA 2JJ2D 3V00A 2OUKA 3CX8A 5FOVA 1D9ZA 4XTRA 3Q5DA 4DCVA 2CJWA 2VIIA 3B9PA 3SYNA 1UBEA 2WKPA 4FMCB 4ZV4A 3ZVRA 4MRVA 1EX7A 1R5OA 8OHMA 4JSTA 2IX3A 1DEKA 2IHBA 2QAGC 4LJAA 1G41A 1UEIA 1LF0A 1E2IA 2FFQA 1E2LA 2PT5A 1KSGA 3VQTA 4EKDA 3CM0A 4IW3B 5FPTA 2IYTA 5KNBA 4D25A 3AP1A 5JSZB 1FNNA 2A5FA 1Q12A 4PC6A 4HSEA 4B74A 3L0SA 5JI3E 1M6NA 2W2XA 2J46A 2YOFA 3BIFA 2W6ID 4DLRA 4QBFA 3BFXA 4L16A 2AHOA 1EFHA 2WWFA 4J0QA 1ZC4A 4GFDA 1G5TA 2WICA 5IK2A 5JRJA 4NTZA 4S2EA 5IK2D 4BLSA 1T6NA 3A4NA 4B32A 5DHFA 1AKEA 4BFXA 3WHKA 1OT3A 1FOEB 1AK2A 1LV7A 4WXRA 1N0UA 2D06A 3OIYA 4FMBB 2OAQ1 2J7PA 2C8VA 4UNSA 5EQTA 1SVOA 4EPVA 3DOEA 5KNCA 2J7PD 3KKQA 4M9QA 4OJKA 1G7CA 2HCJB 3EASA 3GJ5A 1JR3D 2IUSA 4KVAA 4NCNA 4BZQA 2DB3A 3WMEA 2Y8EA 1IOZA 5EXPA 3BFVA 1BIFA 4UNPA 3K0SA 2L0XA 4YXWD 3ZH9B 3GP8A 2GWHA 1KTVA 3CONA 3QKUA 4MKFA 5C4GB 2W2TA 1RIFA 1XMJA 1GOTA 2GKSA 2ZRBA 3EZ2A 3BB3A 3QXJA 1ZNYA 1XMIA 2ZRNA 4EPXA 2J7KA 2ZRIA 1RE0A 1SHKA 1YHNA 3NBZC 1TF2A 3X1YA 2GK7A 2ZANA 3ZZ0A 5BXQC 1KSHA 4C0LA 1OFIA 3KTAA 2RGNC 3K0FA 2QMEA 4WZ6A 2C99A 1Z29A 2VLIA 1TNDA 3A37A 4BECA 4MRRA 1GP2A 4Q1FA 3CRQA 3ADDA 1JPNA 3ZLJA 1PVOA 2RGBA 3RS4A 4RD3A 4LOAA 5GVRA 1Z0IA 3AF0A 5F98A 3MWJA 5FBLB 2OFXA 4LYAA 5IRCD 1ZP6A 2QAJA 3LVRE 4HZIA 1N0VC 4EIWA 1LW7A 1U8YA 4AY2A 2J0UA 4JLMA 1UBCA 3GPLA 1D9XA 2BMJA 3ZVMA 2AK3A 2QBYA 4BEBA 3EIEA 1G6OA 4GT1A 1OPXA 2X2FA 1DOAA 1NBMD 1XJ0A 3AP3A 2ZYWX 1XTQA 3MWYW 3FMPB 5G3ZA 4HB4A 1VIYA 2DYKA 1Z28A 1QHGA 1TU3A 3F8TA 1IN7A 4Q1BA 2CL0X 3WRYC 5KYKA 3I73A 3JZMA 3QUSA 4MUBA 1WB9A 2GNOA 1F48A 3AF3A 3K0CC 2NO7A 2FFHA 4IEIA 3A1SA 3K09A 1ZM2A 3W5IA 1G64A 1W1WA 2OFWA 4RCZA 3MGCA 5H1YA 3WYFA 2QNRA 2QTVB 2XJ9A 2XSZD 1ETUA 3MD0A 1OXTA 5CM9C 4M0LA 4Q1CA 4TSFD 3BJIC 3KL4A 3KUCA 3AVWA 2NPIA 2GK6A 3LWNA 3SBEA 4A8JA 4IFBA 4G0NA 3WMFA 2O5VA 1XMSA 1T3SA 5FUVA 4C3ZA 1RFLA 2OILA 4YDHB 4ASUD 2KWIA 1N6KA 3MAAC 2GRJA 5TV2A 2OXRA 3A58B 1G7RA 2GVDC 4NH0A 2CK3D 3GJ3A 2VHJA 4EQ6A 1FMJA 4JMPA 2O8CB 3C7KA 1HEIA 2JASA 2ZRAA 4TTQA 2JLWA 5AK0A 2JGNA 4UXHA 4CGZA 2C9OA 1XZQA 2FG5A 2H16A 1KDOA 5EE3A 1KO1A 2CE7A 1TQDA 4EAQA 4IXNA 1G291 2FH5B 1R8SA 4A2PA 1IJFA 1Q0UA 4MA4A 5BN3A 3AF2A 2O0JA 4US1R 2EVWX 1KNQA 4MUAA 5CDFE 3CLVA 3ZYCA 4OL0A 1IN8A 4IEEA 2ZITA 4LHYA 2WWYA 1OXVA 1P9RA 5FBWB 4Q4AB 1ANKA 1E0SA 4PHGA 2ZSFA 1KHTA 4JIMA 4PHFA 3LLMA 4FINA 1DAFA 4M8NE 4YXWA 5FOXA 4IVPA 1N2CE 2NO6A 3C5CA 4NE2A 2WVJA 4ZCLA 1M7BA 4ZIRB 3I8XA 2FOLA 3BOSA 4A0FA 2ZROA 4EFLA 3SQWA 2PLFA 4P32A 1NI3A 4RCYA 5FBQB 4OK6A 3WY9A 1R2QA 3H0KA 4Q4HB 1KZGB 3SEAA 1GFIA 1DTSA 4C2UA 2GF9A 1DPFA 1UBGA 1XFAA 1D2EA 3A1VA 3QOFA 3R9IA 3UWKA 4OK5A 1NIJA 4I1UA 2VSXA 3DO6A 1JEDA 5DGXA 4AWXA 1S3SA 2XNSA 4B3GA 1E2PA 3WNDA 3KQLA 3T5DA 5LPNA 4F93B 4M9SA 1Z0DA 1YKSA 3AUYA 2NOAA 2Q6TA 1FMLA 2Q3MA 3IIJA 4RSGA 1MRNA 1HH4A 3UATA 3E1SA 1G8FA 1A2KC 5CJ2A 4MKGA 5K8TA 3L2OB 3RLFA 5L3VA 4M2LA 3K9GA 3ONWA 3AQ4A 2BBWA 1ZYUA 3Q9LA 2ZVPX 1Z6TA 4DHEA 1U2RA 5DSZA 4OQNA 2BCJQ 1B0UA 3BXZA 5L3QB 3VR1A 1W0KD 1DELA 2BBSA 1UDWA 2BHRA 5LD2C 2YZ2A 4QFMA 4HAXA 1RVDA 3FTQA 5HTKA 2XITA 4HAUA 4IVRA 2AFHE 4F7WA 1XMVA 1ZM3A 2G3YA 1DADA 2IHYA 4NP6A 3MCAA 1JXMA 1XTIA 2PCLA 2JLRA 2WWXA 2ZE7A 5AUPB 3QI2A 4OYHA 1XU4A 4A82A 2CCJA 3RVBA 2ERYA 1E99A 2QZ4A 2W83A 5AWFC 5J4KA 4PAQA 1NVVQ 1N6RA 2Q3FA 5HZHA 2XZOA 621PA 5FTNA 4BLRA 5JSZA 1NN0A 4F91B 4X8LA 4OHWA 4XIGS 2YINC 4DKXA 4ZKDA 4ESVA 2C5LA 1W4AA 1DO0A 2D4HA 4Q7JB 2NO0A 4OQMA 1KDPA 4P0TA 2EWVA 5DISB 4C0AC 4H1UA 1E2GA 3SU8A 1H8HA 4B3FX 2JJ8A 1UPTA 2JATA 3BERA 1KDRA 2R44A 1XXHB 1AIPA 2VHQA 1XWIA 3TIFA 1OIXA 2ZUCA 4DC9A 1NN5A 1UKVY 2C77A 2ODEA 1D2MA 1KSJA 4IFEA 5BYKA 5CIWA 1NG1A 2G1JA 2TMKA 3KKNA 2A5JA 3QXXA 2W6IA 4DLVA 2GDJA 4P4SB 1W0JD 4TTPA 4DXAA 1LS1A 4B33A 1MKYA 1XTSA 3VX4A 5EP1A 2O8FA 3TBKA 1G21E 1KAGA 1KMHB 3B8HA 3MJRA 2W6JD 3A4MA 2NZ8A 1VECA 1SVSA 1Y3AA 3PUVA 4A92A 1H8EA 2WSSD 2OBLA 3KKMA 5FTJA 1JAIA 4BLOA 3RRYA 4URYR 5BQ5A 4CEJB 1E9SA 1MABA 2ZRPA 2HT6A 2CCGA 4G01B 1T4GA 1QVRA 1NP6A 4PANA 4IHQA 2WIBA 4IDOA 4UQOA 3H84A 4ITRC 3ZGXA 4OI1A 5F9HA 3HWSA 3FGNA 1NVXQ 1A7JA 1E9RA 1CU1A 2ORIA 4PPFA 2EU8A 3EXAA 3ICQB 2QN6A 2HUPA 2ZTSA 2AD1A 5BN4A 4LJ4A 1J90A 4MYHA 4B2IA 4DEXA 2F3RA 1N6HA 4RD1A 1TQ6A 3KKPA 3KJEA 2J0UB 3OIWA 3U4QB 2W2VA 5SZIA 5JWOA 4B6EA 1E1QD 4D4JA 2QRNA 4Q7KA 1KK0A 4HUQA 2OEPA 1E9FA 1F2UA 2H8KA 3ND8A 4KFUA 5KSYA 1Q1EA 5FBRB 4PPGA 2V9PA 4M1KA 4LV8B 2O8DA 3M1IA 3C14C 1RKBA 4QBHA 1I4TD 5CIQA 1OH7A 1TL7C 1SVLA 4BLPA 3LX8A 2IEZA 2ZR0A 3K9LA 1XCGB 2HYDA 4LUCA 1E9EA 5G53C 4WAUA 4JVNA 3THYA 5CJPA 5DO9A 4RD2A 1T0JB 4E09A 2D2FA 1EESA 1TQ2A 5HKKA 4KO8A 3LNCA 4HB2A 1U81A 5AJWA 2E1RA 3K1JA 4NBSA 2KBEA 2OV2A 3T34A 5FPYA 3UANA 1JXOA 3O8BA 3UPUA 1IN5A 4Q19A 3AGPA 1ESMA 4FWIB 3IILA 5EE5B 4ZDWA 4TYNA 3L0PA 2ODNA 1Q1QA 2ZJ8A 3UK6A 5EZ5A 1CJUC 4JLDA 3NG1A 3P26A 4Q03A 1HURA 5FL7A 5HZKA 4Q66C 2K5UA 1W4CA 3CRVA 4RFSB 4B2PA 1XPRA 1H8ED 4OI4A 4XOIA 1QHNA 2JIZD 3UKDA 5GJCA 2VHUA 2XTNA 3RS2A 1DAKA 1T8UA 1X8LA 2Z0MA 3OIVA 3A1TA 5DN6A 1VTKA 4JBYA 2WJJA 5SZHB 4BFVA 1N25A 2WWWA 2GEDA 4ERNA 4D80A 3TUZC 3Q85A 5L8VA 2QY9A 3GLHA 2B8WA 3FWYA 3P32A 4EJSC 1P9WA 4UJ5A 4ZKEA 1C9KA 1KK3A 3PENA 4Q21A 4Q4JB 2IL1A 2IBMA 3T35A 5KOYA 5FOTA 4LHVA 2ECKA 2LKDA 2QSYA 1ZNZA 2F43A 4MKHA 3NXSA 4KV9A 4TMVA 5EXSA 3M4YA 5JS8A 5CB6A 3SS8A 1T3HA 4CIDA 1IY2A 2VP0A 2OLKA 3PUYA 2CMKA 1ZNXA 4P4SA 2QL6A 2WAYA 3EZ6A 1N6OA 3RWOA 1XDBA 3K70C 3TUJC 1SGWA 2QQ0A 1E94E 3W8NA 1CKEA 1HA3A 2VSOA 3U6BA 3GLHB 2OHFA 2A5YB 4QNMA 2WWHA 1OJLA 4A0GA 3QEOA 4ZI3A 2IWHA 2V6IA 5JHGB 3OEED 2HLDA 3AVPA 4HZUA 5ANRB 1YZLA 2AWOA 1X1SA 4JYBA 1BKDR 1I4LD 3LAWA 4GOKA 5E7JA 3ZZUA 4CT5A 4LPSA 1SVMA 2GAOA 2WHXA 3D8BA 1KZ7B 3OZXA 5KSZA 2WV9A 2EFGA 3QKRA 4OKSA 3CNLA 4OI2A 3CZPA 4LJ5A 5AUOB 3IPXA 1DS6A 1YZNA 4NYIR 2D3WA 3AF1A 4JKYA 3DM9B 3VR3A 2CLSA 4FCWA 2CDNA 3OAAA 2XB4A 1SQ5A 1KO4A 4TN1A 4AIIA 4E22A 4TQ9A 1Z0KA 1XNJA 1KI3A 2J5XA 2RGEA 3N70A 2VBCA 4IOJA 2ZSEA 4M9XA 4MGIR 3RANA 4C7OA 5KSPA 1KI6B 2BMDA 1VG8A 3EA0A 2GCPA 1YZUA 2V4ZA 3Q72A 4ESHA 3ADKA 1TEVA 1F2TA 3K0FB 4RY2A 1A82A 2FWRA 3NBYC 4LBZA 5HE8A 3ZIAD 3EPJA 4LGMA 2O8EA 1IN4A 4A8JC 3IPYA 3THWA 4XSHA 3GJ0A 1II8A 1S96A 4LYJA 2DR3A 3B60A 1Q22A 3NKVA 2IC5A 4DCTA 1BOFA 4QM7A 4PC3A 4MRPA 4WW0A 3ZD7A 1BS1A 3EX7C 4MYTA 2QMHA 4XD7D 4WVFA 1U0LA 2RGAA 4TWZA 2CXXA 1OE0A 2OLJA 2P6NA 3CR8A 3R7WA 5KSOA 1LY1A 2V7QA 3BGWA 1BH2A 5CDFA 2YC2C 2FMXA 3G0HA 3RYTC 1NLZA 5GADl 3FMOB 3NDPA 4V0OA 1XX6A 3VR5A 1CR0A 4BLTA 4IDPA 1NKSA 2GVZC 2BDTA 4D0LB 3IDQA 2BOVA 4Z8XA 2IA5A 5L3SB 4Z1MD 1N3BA 2PMDA 2W0MA 1S1CA 1U99A 1RRPA 2V8OA 2CNWA 3LO5A 1AS0A 121PA 1ZM4A 4N0DA 3OF5A 4AYTA 4HUTA 1ZIPA 1JPJA 2QT0A 1VDZA 5LB2A 1QHHB 4TLEA 4KBFA 3MMPA 4EPYA 3UWOA 1PLKA 3QBVA 3I5XA 2AN9A 1E0KA 2G1KA 4LX0A 3VNUA 1P2UA 5F9FA 1P60A 1AJEA 4ON9A 1GWNA 4V02A 4GZLA 1MO5A 4Q9LA 1CRPA 1F60A 2WPDA 4DLWA 1VYUA 2CHQA 4MGYR 4LK2A 4E07A 1RJ9B 4O2LA 4OQFA 2HV8A 3B9QA 4X8MA 2DY1A 3D7MA 3TW4A 4NONA 3A6PC 4B35A 1W0JA 1WBBA 4UKDA 5J4LA 4TZ0A 5AJZA 2LKCA 1CXZA 2RB4A 4YQFA 1Z83A 4HLUA 2YWGA 4KXFB 3PFIA 2C96A 2IYUA 2YVUA 4OBEA 4LSGA 2IUUA 4TT3A 5J47A 1G7TA 1F3OA 4LV5B 4FCVA 3CNOA 4GRAA 3GFOA 3VR6A 1DVRA 1YR8A 2IT1A 3P4YA 4LJ7A 2O8BB 3FMIA 3WYAA 1Q1BA 1GILA 2P5TB 2ZEJA 4DT1A 1ESNA 1KI2A 2ZYVX 5EUQB 3GLGB 2QPTA 1NSTA 1OFHA 2NIPA 1RYFA 3EZ9A 1IN6A 3GEHA 2QE7A 2PBRA 1N6IA 5FH9A 2XTMA 1R10A 2MSCB 2ZUDA 1VCNA 4PHHA 2G9NA 1NNEA 2VTKA 1LB1B 2ZQ5A 2IWRA 3EIHA 4OQLA 3CPEA 1Z22A 3QBTA 4EDHA 1P2TA 4JS0A 2AWNA 1KI9A 1SVWA 2C95A 2XEXA 4X8OA 3ZVNA 2CHVA 3AUXA 1KI1A 4RZ3A 4R2HA 1X8JA 1EWQA 2GETA 4GSYA 4JT2A 3RC3A 4QG7A 2GZHA 1QHXA 1XEXA 5DI3A 3GLGA 5DN6D 3THXA 3NIBA 3RS3A 2UZIR 4GOJA 1EFRA 3J81k 4TMWA 5GJBA 1WP9A 2G6BA 4A36A 5ELXA 2QUZA 4K8OA 4LWZA 3W6PA 3NH6A 1G19A 2QU8A 1J8YF 2WAXA 2FPMA 1F2TB 4EFMA 1GAJA 1R5NA 4OHZA 1W0KA 3LW7A 1O87A 2AK2A 3CX7A 2RAPA 5JFGA 3AH8A 4AURA 1A1VA 3SNHA 3A36A 2Z4RA 1P3JA 2H1LA 4JLKA 3MUFA 2QI9C 4Q7MB 4GP6A 1MO6A 2PZEA 4XVUA 2GZAA 4KVGA 3V4RA 1Y63A 5AJVB 5FTLA 3L0IB 4IJMA 3TW8B 4LY6A 3MSXA 4WOPA 5CLQA 5B2ZA 2GXSA 1QG4A 1NVWQ 2VH5R 2ZU0C 2P5SA 3IEUA 4PZLA 1EG7A 4AYWA 2RGNA 2AL7A 2FFAA 5A5GA 2NO9A 1JEEA 1FUUA 4JYCA 1YZKA 3LBNA 4US0R 1R0YA 1E2DA 1XXHA 1NY6A 3H1TA 5F3WB 2XTZA 4Q4JA 2H7VA 5TARA 4URZR 3K70D 2XZLA 3AEZA 2XSZA 2DWPA 2PH1A 3I92A 3RSLA 5KUTA 4W5WA 3RWMB 3M0EA 2QEQA 1XEWX 4NU0A 3GJ7A 3AKEA 1VMAA 4M21A 2QENA 3SJAA 1P72A 4ACBA 4D6PA 2BBOA 1SXJC 1EFTA 2G0TA 2OCPA 3VR2A 2O0KA 4RFVA 1S1MA 1S2MA 2XAUA 1AGPA 2GHIA 3KUDA 1PLJA 1IXSB 4B44A 4Q1AA 3TR5A 2IS1A 1P2VA 1LFDB 2PX3A 4GPTA 4II7A 4W5HA 4ZCIA 4CF7A 4G5RA 2F3TA 4D0GA 4RKEA 2XX3A 4F92B 2ZRLA 1MABB 3LRPA 1US8B 2O8EB 2FSIA 1KK2A 1SXJA 3IEVA 1R0ZA 1ZMXA 3MG9A 4GI7A 2A30A 1GITA 2R6FA 4BZXA 4BGDA 4Z54A 5JECA 4IOKA 5JJLA 2PMKA 4B48A 2R6DA 1IXZA 1UBFA 3QG5A 2AFIE 1Z6AA 3SOPA 5TXGA 4YMTA 2V1XA 1E2HA 3L0OA 2ATVA 5JMTA 4UNNA 3F0TA 3T12A 1F6BA 1XTKA 1M8PA 3PITA 2I1QA 4D4LA 4JLJA 2YV5A 2WJGA 3SC3A 4I81A 4XWAA 1YR9A 2ZRFA 4PHTA 1GDDA 2NZJA 3CF2A 3OFNA 3B1VA 4YDSA 3OE7A 4GNKA 3ZVLA 2ZAMA 4NYMR 3PEVA 2D2EA 5EXTA 3WBKA 4PPNA 1GZSA 4JL8A 4M1TA 3QPVA 3CH5A 3SJZA 3T06B 2JDID 2WSMA 4QJ3A 1NN1A 4E5UA 3CF0A 1E9AA 2R65A 4MKIA 2D74A 3CRRA 4FW9A 1ZW6A 1E2KA 4TTRA 1U98A 4YLGA 4E03A 2NMVA 4RFSA 4QHTA 1GTVA 4NYJR 3QE0A 3K0EA 1W36C 3AKCA 4JL6A 1FZQA 4EFNA 2YKGA 1II8B 2HXSA 2N42A 3RS0A 2GAAA 1UAAA 4KJZA 2GZDA 3FFBA 3OESA 3U7GA 1DAIA 5FOUA 1CBUA 4QGGA 4BRUA 2HDNB 4U00A 3SQXA 4WA7A 2ZRMA 2QMUA 1S4QA 4QGFA 2MSEB 2ZE6A 5KPDA 2ZM5A 2J41A 2EFDB 4WIAA 4Q00A 2JEOA 1KGDA 2V6JA 3A1UA 1ELOA 4L9WA 4AKGA 3ZIAA 2XXAA 4EPRA 2PJRA 2FPLA 4OK3A 4UXIA 3H86A 1H8HD 3O8RA 1OW3B 3X1XA 5C4MA 2GJ9A 1RZ3A 5HR5A 1KMQA 3TH5A 2IYVA 1P9NA 1WCV1 4V03A 2EFCB 5FPKA 821PA 3FYHA 2JCSA 2QP3A 2O8BA 4QBGB 3R9XA 1Z2AA 2ZRDA 2WKRA 1T0HB 1G1MA 4PQRA 4BFSA 5GJVC 1IAQA 1KDTA 2PZGA 4QKQA 2QAGA 1LTQA 1JNYA 3M6AA 3QNUA 5JEDA 2O0HA 3R20A 4D4MA 3OEEA 4ARZA 1VYTA 3GLIE 4URVR 1CIPA 1RJ9A 4B3BA 2CLDX 2OBMA 1TPZA 2W58A 2IYSA 1Z0FA 1EFUA 1R0WA 2QM8A 3FE2A 3KFVA 5P21A 1OB2A 5AUQA 4B34A 3LQRA 3PQCA 4PAOA 4PTLA 3KB1A 5AJYA 5HE9A 1IQPA 4DUGA 5EJEA 4AKHA 3W6NA 4F38A 1GNQA 1Q20A 2J45A 1GRNA 2J3EA 2GTPA 4LJYA 3LY5A 4C0KA 3U44B 1L4UA 3B2EA 3NBFA 3SYKA 3SFZA 3ADCA 4Q02A 3IO5A 3BORA 1Z3IX 3MFYA 1PJRA 3VKGA 2VEDA 1T8TA 2ZJ2A 3OAAD 2ONKA 5H8WA 3T1VA 3L82B 3NEJA 2ZPTX 4DSTA 3C15C 3AVXA 2B92A 3NVAA 4MGZR 5FPHA 1K5DA 1VG9B 3EW9A 1FQJA 3EPKA 2EYUA 4EPWA 4LHZA 1VHLA 4H9GA 5D3MB 5L3RA 4Q48A 1L4YA 1N5LA 3S1AB 2B8TA 4KLZA 1RRFA 3HYTA 1RRCA 2QBYB 1M1YE 3K0AA 4C0BA 1EK0A 1GL7A 1VPLA 3GQBA 1GRRA 2R6GA 3OE7D 4NPHA 1QZXA 1KSFX 4G5OA 4PSVA 3DKVA 1QG2A 5SZKB 3WP0A 2FPKA 1T91A 2ZUBA 3RC8A 1OSNA 4JSYA 3F3YA 5CM8B 2ASEA 2QP9X 1OYWA 3KFXA 1E69A 5DI3B 1Z0AA 5TB5A 3B1XA 3RS5A 5FI1B 1ZUHA 4CZ2A 1DBSA 4YMVA 3BAFA 4KFRA 2HEIA 3LDAA 2NPFA 2VPPA 5FTKA 2DWQA 2JLYA 2FZ4A 5CYOA 3AVUA 1JQJC 2LWIA 4FMDB 2WTUA 2HT1A 2ZJOA 3V4FA 4LCBA 3AM1A 3KX2A 3QF4A 1IXRC 1CS4C 1X8KA 1G8HA 3BS4A 1YU9A 3U3RA 1F5NA 3OEHA 1LVGA 2FX3A 3THYB 2D7CA 3TR0A 5E4FA 3T1OA 3TE6A 2Z83A 1BMFD 2P0EA 1OFTA 1GRQA 4UNRA 2PZFA 1NLFA 1V43A 4P31A 2Z6VA 4HDQB 3T1TA 2OAP1 3PV0A 2CNWD 3KKOA 1MRSA 2ZJYA 1CRQA 1L2TA 4G1UC 1YRBA 3GJXC 3RABA 4R7ZA 2DWOA 4BE7B 4ZDJA 5TDHA 3MWKA 4QRHA 1WRBA 1U94A 5A0FA 3IIMA 5LDDC 1UKZA 3SJBA 2JLXA 3D31A 3QEJA 4Q4LA 1G3UA 1MT0A 1TMKA 2P65A 2RKOA 3WHLA 1G9XA 4Z8YA 4NMMA 4LHXA 1J70A 4D2IA 1E1RD 3AVOA 2OCYC 3RRNA 1PLLA 4PAMA 3UMRA 3HYRA 3QENA 2RGCA 2N1BA 2GXAA 3GLHE 2D7DA 1FTSA 1TU4A 1U8ZA 3W9YA 3I32A 4A1FA 4N1AA 4TLBA 5FBVB 4C9BA 2FU5C 1P62B 4KSBA 3SHFA 3LA6A 1K8RA 1N0WA 3FDIA 2HJVA 4B3XA 3FKSD 2IF2A 3PJRA 1DAHA 4LHWA 5C46F 1D2NA 2X8AA 4WXPA 1VKJA 2VO1A 3LBHA 1ZVQA 4L5BA 5BWMA 3I4LA 3IKJA 2V55B 4GL2A 4ZDIA 4PSAA 5D3MA 2JAQA 4A9AA 1GKUB 2B6HA 1ZC3A 4HLQB 4NYMQ 1OB5A 1XPOA 2ORVA 2H17A 2OO7A 1Z5ZA 4DWJA 1AS2A 1G5PA 3VMFA 3TKLA 4QBIA 3DPUA 2FFBA 1IY1A 1Z0JA 3KJHA 2OCAA 5DH9A 4BLQA 3LXRA 3CRW1 5FUXA 5M04A 4DT1B 1E2JA 3CX6A 2X2EA 5C1BA 1FUKA 3IBYA 3L8ZA 1WA5A 3E70C 1UJ2A 1R7RA 4HAWA 1W48A 1X6VA 1P6XA 3CBQA 3G5UA 2O8CA 2FF7A 1X1RA 1XCPA 1XJQA 521PA 3TGPA 2F9LA 1E79A 4JJZA 2KBFA 1W36B 1CF4A 4OHVA 3UMFA 3ZJYA 3B13B 3L43A 2OESA 4D26A 2DFKB 2ZJAA 2ZAOA 1CEEA 4HB0A 1OHHA 1I2DA 3JVVA 1YE8A 2QROA 3BE4A 3HR8A 4DBLC 2ZS8A 2QG6A 4MDFA 4ZCMA 4U7DA 2ZI9A 3R7WB 2BJWA 1NLYA 1II9A 5K8IA 2ONJA 1RPZA 4DCNA 4JLVA 2IXFA 5JJIA 2BC9A 4K46A 1FP7A 2EYQA 4HAYA 4TLDA 4BPBA 3BH0A 4DIDA 1CULC 2QRZA 3CPHA 3LBIA 4JZKA 3SN6A 1KI8A 1GKIA 2NG1A 4HYYA 1DARA 1KYIA 3VTKA 2XNDA 2WM9B 1QVAA 4F4CA 1KI4A 2IYXA 5JRZA 1MOZA 4Z1MA 4KITB 1II0A 1TAGA 421PA 1YRAA 5B57C 4TYQA 3GJ4A 4JLBA 1M7HA 2EFEB 2ZJZA 4TQAA 4RKFA 4BFWA 4GMXA 1BYUA 1G8GA 1UKYA 3U6KA 3EC2A 1T5IA 3B6EA 1W5SA 2Q9BA 3NHAA 4OQXA 1OKKA 1YJ5A 2R6CA 2Q9CA 1IHUA 1XB2A 3W90A 1X86B 1NSFA 2JJ1A 1ZCBA 1EXMA 1W47A 2JA1A 4N3NA 4PZYA 4WZBE 5DI9A 1SULA 3U3MA 4YONB 1P75A 4EUNA 1XZPA 1EWRA 5LBIA 1XEWY 4P4UA 4P4TA 4PO8A 3Q7PA 5L3SA 2OZEA 5CK5A 3VKHA 2BV3A 3CB4A 1V5WA 4MRSA 4PR0A 2KJQA 1KKMA 3QXCA 2ODBA 3OIUA 3T5GA 3TQCA 4DZZA 4JT4A 4AKEA 1R5BA 2G83A 3KXKA 2IS4A 4Y0VA 1OXXK 2P67A 3U7FB 2DFLA 1NKTA 2YC4C 1JB1A 3DMNA 3JVUA 4FXPA 2H57A 2RCNA 4L4UA 1Q44A 2VYFA 2EFHB 3DHWC 3E5HA 1KI7A 3PG5A 4NCIA 4TT3D 4K81B 2RHDA 3BC1A 4LYFA 1UKEA 2UVQA 4NL4H 1CR2A 1ZU5A 3GLFE 1JR6A 3SBDA 5JI2E 4B76A 4TL7A 1L8QA 4M1YA 5FPSA 4LI0A 3UMSA 2QT1A 2WOJA 4A15A 5BW8A 3AVYA 3AVVA 2A5DA 3IUYA 4CT4B 5EE0A 2JDIA 2NQ2C 2OG2A 4Y0AA 4C0QC 3IIKA 2XB2A 2RH5A 2BCGY 3KQHA 3K09C 4LJ6A 4JLAA 1WBDA 2ZR7A 1KY2A 1GUAA 3FB4A 1W7AA 4O2RA 2DPXA 5FI0B 2ZRCA 3LFUA 4BWYA 4I99A 4S35A 2QQEA 2YYZA 2WPDD 1J2JA 3BH7A 3CNNA 4M1OA 4R9UC 4DRZA 2X1VA 3OEHD 1BYIA 5BN5A 4TYYA 2FV8A 1FP6A 2P2LA 1OXUA 1CLUA 1BMFA 1E2FA 1ONBA 3Q5EA 2FSHA 3JZAA 3GLFB 2AXNA 2QA5A 1E6CA 1JR3E 3R8FA 2R8RA 4DSUA 4MGKR 1IY0A 1HTWA 4MQBA 5FUYA 1NL3A 2CE2X 4EQ6B 2C03A 1Z8FA 4FIDA 4F4JA 1Z6YA 1KJZA 3W5JA 4DDTA 3KB2A 5D3QA 1DAGA 4O3MA 1HY3A 3QIAA 4DDUA 2F43B 5JWRA 4CEIB 1XPUA 1NBME 1XTRA 2EQBA 1W36D 2J9RA 2R6AA 3MWLA 4L15A 1DO2A 4A6XA 1NBMA 2ZRKA 1P4SA 2GEVA 2QTFA 3PEUA 1W49A 5J4VA 1GNPA 1KO5A 5G3YA 2QE7D 2IS6A 1KAOA 3SYLA 3ZQJA 1E32A 3B1ZA 1HQYE 1O3YA 3B1WA 3VU9B 3ND9A 1XD9A 3DKPA 4HLCA 4KAXA 1T5LA 2C9YA 5EXXA 3QXSA 3P1JA 2QP4A 3HR7A 4TZ6A 3KQKA 3DDCA 2F1IA 4NCJA 1LS6A 4Q4AA 3EWAA 5E7MA 2YJTD 4DVGA 1TF7A 4HAZA 4MYCA 4KBGA 3EARA 4DLXA 2VQSA 2A2ZA 3CW2A 1W46A 3DZDA 1FFHA 1NRJB 2HF8A 1SHZA 1TADA 4BASA 5J4HA 1GSIA 3TVTA 1FL9A 2WOOA 2G88A 3DZ8A 1E4YA 1JJVA 3QKTA 3UG6A 2FA9A 4KU4A 1SVKA 5FOWA 3A8TA 1OKKD 1KIMA 1R4AA 2CVHA 4LC0A 1YZGA 1FX0B 2WJHA 4FCTA 2SHKA 3VKWA 4DUGD 2HYIC 2JJ1D 2WJVA 3AF4A 2ZR9A 2VF7A 2WKQA 3SR0A 1AQYA 5TVKA 1MO3A 3QXHA 1AN0A 1QRAA 2J1LA 5G40A 3WNBA 2QM7A 4C7OB 2OSBA 3I1FA 1TUEA 4DLTA 2CL7X 2JLQA 2DHRA 4BFTA 4BQSA 2Q0HA 3RRMA 3LH5A 3SZRA 1E1RA 2C98A 2RGXA 4WZAE 2CHGA 1D8TA 3O8CA 2ZRJA 2QSZA 3FVQA 4CEIA 1SXJD 4JL5A 1EGAA 4HEJA 5FFMA 2R9VA 1HE8B 4C0SA 3GD7A 4NCKA 1NJGA 1N5JA 3WBJA 2NGRA 3Q3JB 2VRWA 2E87A 3QPWA 2G77B 5K8LA 2A9KA 1QHIA 3IBGA 2ZJ5A 1OF1A 5JCPA 1ZIOA 2DCUA 4M4SA 4Q9KA 2ZS9A 1SXJE 2EWWA 2N46A 3BK7A 2WSSA 4HUQB 4NYJQ 3FKSA 5E95A 5IHPA 4KFSA 1U9IC 4RD4A 2Q3HA 4DLSA 1VG0B 2IYWA 3IQXA 1S9DA 5E3HA 1TEXA 4NKRA 3PUWA 5B58C 5EP3A 3VAAA 1P5ZB 4AC9A 2AD5A 1JJ7A 3EG5A 4NCHA 2PEYA 5BYJA 2ZU6A 3CWZA 4DB2A 5GVSA 5HCNA 3TUIC 2ORWA 3CKLA 4TMTA 2YWEA 4A8JB 4LZZA 3SE0A 2BMFA 3AV0B 1COWD 4PO1A 5SZJA 3W8RA 3C16C 4DCSA 3WXMA 4CEJA 4PQYA 1C4OA 1ZJ6A 3NH9A 2RGDA 4AK9A 4N0EA 1US8A 1XTJA 2EW1A 2GXUA 1HV8A 2XZPA 1VCOA 4R2IA 4XVQA 3PCRB 2J0VA 2REXB 3KJGA 2H92A 5CB8A 2ZIAA 1RC8A 5AR1A 4BEJA 2ZI4A 3DM5A 3EAQA 2IYQA 4PC1A 2Z5FA 2NO1A 4A2WA 2GCNA 4V0LA 1W4RA 1OHHD 2R2AA 4C4PA 4LYHA 4EPTA 2KI5A 4XTCS 3TSOA 2AKAB 1WF3A 1G16A 2B7CA 5DIFA 5FTMA 3VX3A 5JLJA 1KNXA 2ZS7A 3KDSE 1PZNA 4M53A 4P3YA 4QC2A 4ZDKA 2C04A 4DDVA 4U5XA 5FUWA 3I72A 2BWJA 4AG5A 3PR1A 4D0NA 4P33A 4TL8A 4BRWA 2W6JA 3QJYA 2IEYA 2ZRGA 2HJGA 3BRWD 2I1VB 3KJIA 2J0QA 721PA 2DBYA 3C8UA 2Q9AA 5CLLA 1P73A 1SKYB 3EC1A 1G4AE 3FFAA 3U7EB 2ANBA 5IDVA 5F2EA 1I2MA 4TYWA 5KDLA 5KTYA 3NBXX 3TSZA 1KJYA 2PLRA 4CW7A 4TSFA 4CEHA 1PUJA 1M2OB 4O0MA 5CK4A 4RD6A 3RHFA 4JLPA 2AKYA 1TF5A 4ZPXA 1AM4D 1N6LA 4Q9IA 4BFYA 3EPLA 1WMSA 4F4IA 5JCZA 5JJKA 2PX0A 4KHZA 1OH8A 1OFUX 3A4LA 1EFCA 1KI6A 2UKDA 4EJSB 2VL7A 3Q7QA 2YNMA 5AJXA 3H2YA 2ERXA 3VFDA 3THXB 1WE2A 2ZSBA 4Q1EA 2ZE8A 3KXLA 3NC0C 3GCGA 2OBNA 2V3CC 1G3RA 2I4IA 1DAMA 1U0HC 4TMXA 3BB4A 3K53A 3QPUA 3TNFA 2AXPA 4YMSA 1K6MA 221PA 4FWTA 4AKIA 3O8DA 2J87A 1FPMA 3REGA 3THWB 1NVUQ 4QJ4A 1ZNWA 4XWOA 1A5TA 1G3QA 3FMFA 2HF9A 2FZLA 3PXGA 3PEYA 1XF9A 3X2SA 1ZM9A 4DEYA 3U61B 2H5EA 4TQUS 1Z47A 1G18A 2FE4A 5KDOA 2PCJA 4AD8A 1Q57A 4KYUA 3TLXA 1A4RA 3CZQA 4Q9JA 1NG9A 2GJKA 2XJ4A 1QHHA 3C5HA 4QXAA 1GKYA 2GJ8A 3LD9A 5G41A 2JLVA 2XOKA 3X1ZA 4Z51A 1HT1E 2FEMA 4M1WA 2WMNB 1B23P 1G7SA 3P20A 3WYGA 1M7GA 1SVIA 3BFKA 3BBPA 4RZXA 3U60B 1E0AA 5TMPA 1YZQA 1YZTA 2BM1A 4A2QA 5C2JB 2MMGA 1VYVA 4XH9B 1YVDA 4FN5A 4V0KA 1CJTC 2A3RA 5FL7D 4B3DA 5EZ6B 2YOHA 3AKYA 1W4BA 2IYRA 3T15A 2WWIA 1P2SA 4I1SA 2GBLC 2UZ3A 3N5CA 3HU3A 5FR2A 2IS2A 3K0AB 1Z06A 1E4VA 2OFOA 1FTNA 4HAVA 1AA9A 4HDOB 1C1YA 4LDJA 4QGAA 3S1AA 5L3QA 3ASZA 3GLIB 1Q21A 4PPQA 2ZVQX 2JLUA 3TRFA 4HZUB 4A0RA 1G17A 4HI0E 1R8QA 1AS3A 2DFNA 2VP6A 2GCOB 2X77A 4C0JA 1ODFA 2IUTA 5DHAA 3GFTA 3QF7A 4D4KA 1GIAA 3QKRB 3QG1A 3TAUA 1EFRD 2CEAA 1E79D 2WBLC 2R62A 4US2R 3EPHA 1QHYA 3RRZA 1E9BA 3DMDA 4HDCA 4POAA 4YMWA 1H65A 3MLEA 4BUJA 4AYXA 4CEHB 3HP1A 3NTUA 4QHSA 4BFUA 1QDEA 1ZD9A 4LBVA 2BMEA 3E2IA 5H68A 3VNVA 1IBRA 5EP4A 1VCIA 4Q01A 1XD2B 1GL6A 3QQ5A 4A6PA 1IJEA 4LBYA 2F1HA 1CJVC 3ZS8A 3T61A 3BD9A 4HLDA 3QVVA 4JKIA 3K0CA 3RAPR 3SHWA 2BEJA 3HU1A 3VHLB 3GLFA 4QOSA 3EZ7A 4WBSA 1TQ4A 3AKDA 1ZAKA 2AX4A 2P6UA 3B7GA 5JHHB 2VSFA 2GXQA 4IOLA 3CF6R 3CRMA 1XCMA 5DNYB 2JLZA 5C18A 4X8HA 2QTHA 5UKDA 2XNDD 3I61A 1G8YA 1NMZA 2G0NA 3LX5A 2ZXUA 3B1YA 2C2HA 4KODA 1CTQA 2FGKA 3GJ8A 5CYPA 3ZQ6A 4TMKA 1CJMA 2IYLD 1WXQA 1YR7A 4PFSA 1SZPA 4QL3A 3GEIA 1N6NA 4QNRA 5HPYB 4DDWA 4JJKA 4V0MA 1TTTA 1XEXB 5J40A 3WRXC 3O47A 2W0SA 4M9ZA 3UXMA 1BO6A 3PEWA 3ADBA 1Q3TA 4RJLA 3P4XA 1HUQA 3KTAB 5B30A 4GMDA 1E2NA 1E0JA 2ODWA 4UNQA 4ZO4A 2BEKA 4ILEA 1E1QA 2W00A 2BVNA 4G5QA 2XXAB 1P61B 1G5RA 2GA8A 4OJQA 3W34A 4GOXA 5HCIA 1T3LA 2FNAA 3CR7A 1E9DA 1ZRHA 4I1VA 4YC7A 1UADA 4DB4A 4LRWA 3R9WA 1OIWA 4B75A 4V0NA 4OHYA 1U0JA 3LV8A 4Q4HA 3GLGE 1PV4A 1Z08A 4L9SA 1G6HA 1M74A 4DLUA 3QY0A 3TJZA 2PJZA 1Q1ZA 4GZMA 4Q5IA 3W3AA 1FX0A 2Q21A 1LF5A 3TSWA 3FOZA 3VR4A 5DE3A 2J59A 2A5GA 2XOKD 1MH1A 4BZPA 1HYQA 1G3IA 4Q9HA 2AR7A 3HU2A 4PZZA 1ZU4A 1TUIA 1VIAA 2ZSAA 3U3OA 1NN3A 1ZD1A 3AP2A 3C41J 2WJIA 2A78A 4TMZA 4XD7A 5K8UA 4IDHA 3CH4B 4DSOA 3UG7A 3FKQA 5LD2B 4AI6A 1Q3HA 4LJ8A 3U7HB 1K5GA 1WQ1R 2O8DB 4CVNA 5JZVA 5JWHA 1JQLB 1VG1A 4LBWA 1SKQA 1VHTA 2Z4SA 3OHMA 3REFA 3LQQA 1Z2CA 4PO9A 1RYHA 2DFTA 4JLNA 3IGFA 4B3CA 1OH5A 4FMDF 4B43A 1HT2E 2ZI7A 3X1DA 3P27A 2KE5A 3NEYA 5E7IA 4I4LA 1G3MA 2VP5A 3CWQA 2ZI3A 4YMUA 3U44A 4M1MA 5LB4A 2F9MA 1JBKA 2RMKA 3KZ1E 1OH6A 2QGZA 3ASYA 3BWDD 4G3XA 1ZBDA 2VP2A 4Q1DA 2XGJA 4CYMA 1NMYA 2VHCA 2BIFA 4H1VA 3KXIA 3L8YA 1ZD8A 2CL6X 1G20E 1E2QA 4IDQA 4IOMA 3KQNA 2BM0A 1RRGA 5FL3A 4GDFA 3FHCB 4W5JA 3AB3A 1S3GA 3EZFA 5AUNB 5EE1A 1OV4A 4MDEA 1ZINA 3EWSA 3PVSA 2VHTA 3U4QA 1D6JA 1GL9B 1XEFA 4MYUA 2O52A 3IHWA 4DLYA 1XJCA 2BKEA 5DLQC 3PUXA 2FDCA 4RZUA 4FD2A 2REOA 1ZUNB 2IW3A 3D6TB 1ZCAA 1Z6XA 2BBTA 5J4YA 2ANCA 1OIVA 3FPAA 4GBMA 4TL9A 5EUMA 4ARZB 4D82A 4QM6A 5A4JA 3N2IA 1S0UA 1KY3A 3BB1A 1XRJA 2FJUA 2CCKA 1TX4B 1U90A 4G5GA 4C30A 3K70B 3DVLA 4LPKA 4QJ5A 1QHSA 4B6FA 2IK8A 1ZM7A 2PL3A 2YHSA 4HLUC 3PUZA 4TYPA 2WJYA 3ZDQA 3AVQA 1KO8A 3SJCA 2J0SA 3CUEF 4CRWB 5JBQA 3IHLA 1A2BA 1SKYE 2OM2A 2V54A 1XP8A 4JVSB 1UEJA 2H18A 2LCFA 1JECA 3QSYA 2QPOA 1UM8A 1JALA 2IYZA 3CPJB 3CO5A 4PXAA 1AZSC 1G8PA 3F5FA 2GF0A 4M1SA 2GJSA 1W2HA 2MSDB 4TLCA 5FOSA 1JAHA 4JBXA 1KJWA 4A4DA 4BFZA 4KCGA 3I3SR 4FI3C 2QMOA 1N6PA 3W6OA 3EA5A 4C0HA 1WDTA 3TVDA 1J99A 4DLZA 1MR3F 2GILA 2VA8A 4U02A 4TLAA 1IM2A 6Q21A 3HPRA 3RSOA 2CVFA 5CITA 1PUIA 4Q7LA 2V1UA 2ZI6A 2CLCX 2ZE5A 5EE9A 1S8FA 4M22A 1FW6A 2HCBA 2JLSA 2VF8A 1ZUIA 1M34E 4L8GA 5KO2A 1J8MF 2VP9A 3LXXA 4LV6A 3D3QA 1Z6GA 4Q18A 4V0ME 3SI7A 2FSFA 4UJ3A 3T1QA 4B47A 5FR1A 3I5YA 1T9HA 1I4DD 1UDXA 2FN4A 3BH6A 1KK1A 5JS7A 2GCOA 4IDNA 4KI0A 3GJ6A 3RNLA 4GP7A 2NTYC 2V7QD 1E2MA 3R8CA 2REBA 1MO4A 4I1OA 4ZIRA 5JEEA 3MRSA 2IYYA 4ACAA 2F7SA 1W5TA 4PSKA 1NF3A 4OI0A 2YOGA 3GEEA 4KYIB 4RD0A 4XVRA 4URXR 4LC1A 5IF9A 3HPQA 4IVQA 4Q47A 1U8AA 1X3SA 4DJTA 4ABYA 4KLNA 1Z07A 4NZYA 1OLOA 1NJFA 3RDPA 3TK1A 1JI0A 1UF9A 4URUR 3B5JA 4KSCA 1CJKC 3HDTA 3N2EA 1L7VC 4IXMA 2P3SA 4QHYA 4NYIQ 1DAEA 1R6BX 2D62A 3K8YA 1Z63A 4JVMA 1J7KA 1U9IA 1SXJB 2GBLA 3KQUA 2F6RA 3ZD6A 5KU1A 2ZI5A 3X1WA 3NWJA 1DG1G 5KPJA 4R71A 4IKEA 3LVQE 2PEZA 3LLUA 2CK3A 3WP1B 3ETLA 3NHBA 4OHXA 5HKKD 2MMCA 1GG2A 2VP4A 2ZETA 5IT5A 4HB3A 3LW8A 2I3BA 4HATA 1DE0A 4XWKA 2Z43A 3G82C 4MITA 4JVLA 1VCMA 2C78A 4G5SA 3GMTA 1HQCA 2P6RA 4FMCF 3HJNA 2PT7A 1QBKC 2ATXA 3ICEA 2F1JA 4ZI2A 3U3KA 4KFTA 4MRNA 5GJWC 3DEFA 1N5IA 2YWHA 3EIQA 2GEUA 3VU9A 4IRUB 2IXEA 3IO3A 3QVUA 4B71A 3ZZTA 1NVVR 2KSQA 1P7CA 1KKLA 4O25A 1N5KA 4DSNA 1CR4A 4W9MC 1HE1C 3QKSB 3U5ZB 2WZQA 5DYGA 2IXGA 3B82A 3I8SA 4B2LA 5H70A 5B64A 2ZRHA 1S9HA 5KHOC 5TY0A 2QPAA 3QF4B 3MJHA 1E96A 2FSGA 3THOA 1JR3A 3AVTA 3C4JA 4PC7A 4QGHA 3NDBB 5KNDA 1E98A 1GVNB 3B78A 3SDZA 1E2EA 1QF9A 2BJVA 1E3MA 3K9NA 4W7SA 1GM5A 1AKYA 2IF0A 3PIRA 4ASUA 4PC2A 2ZSDA 1YQTA 4LJ9A 4TL6A 2GESA 1XBTA 1F2UB 1OXSC 2F1RA 2RGGA 2OT3B 4XJXA 4JBWA 3WNCA 2GJAA 2ZREA 3ZS9A 2FEOA 1KMHA 2B7BA 1NMXA 4RVCA 4D81A 3TQFA 2ZYTX 2QAGB 2OE2A 1YR6A 4UXJA 4EJSA 3A1WA 3FHOA 5DYIA 1XD8A 1KOFA 4NHOA 1KO7A 4DCUA 1AGRA 3RS7A 4XSGA 1LNZA 4DIEA 3AGQA 3U2QA 3I62A 1CR1A 4CDGA 3FHTA 1OYYA 3DOFA 5EP2A 4A0HA 2FGJA 2QGNA 4NDZA 3IQWA 1UFQA 2OXCA 2O8FB 2HLDD 2E9SA 1W44A 1IONA 2ZJBA 1GNRA 4RZ2A 4URWR 4B73A 3H4MA 3OFND 2C9CA 3GLIA 2OCBA 3TAHA 2B21A 2YWFA 3UIEA 3TMKA 1XD2A 4JLOA 3DL0A 3W3ZB 2A7QA 2HXYA 2ZYUX 1MV5A 3V9PA 4PQFA 1FQKA 1D5CA 3Q8XB 2WMOB 2CJWB 2WIAA 2F55A 1NIPA 1RW4A
chains in the Genus database with same CATH superfamily
3ECCA 4D3XA 4MSUA 5ELLA 2WM3A 2J4CA 3VHXA 4CUJA 2G7ZA 4WNAA 2D1QA 1BS9A 3NP7A 4PX9A 3COZA 3M89A 1MH9A 4C4RA 1RU3A 5IDYA 3CHYA 3H8JA 3K9HA 3EFEA 3LYLA 1ATIA 3MCZA 3U3JA 1FNMA 2PS1A 3RK0A 3TR6A 2Z3WA 5MFPA 1DG3A 1UMKA 3ZH2A 5C32A 2O5CA 2HU2A 1W2GA 2BY4A 2CEKA 3H5LA 1GT6A 1Y8RA 4Y1FA 5FIUA 4CV2A 4PN7A 3O94A 1JG2A 5ITZB 4MIOA 3V00A 2OUKA 2E4XA 2Z04A 3CX8A 3ME5A 4XTRA 1XELA 5FADA 2HBZA 5JAMA 2PRIA 1WWKA 3KUUA 1BD3A 2WMYA 2BGLA 1HL3A 2CJWA 2VIIA 2VDOB 1U2QA 3N86A 4N5HX 4OLHA 4QECA 5SY9A 3SYNA 4ZV4A 1ZDMA 3EB9A 2GPNA 4JSTA 4IHJF 1CUCA 4RVUA 4YUWA 1J7JA 3D8TA 1PW7A 4CPDA 1BHO1 4XPZA 1DEKA 5IDXA 4UHBA 3VDRA 2J3HA 1N9GA 2CXQA 4Y9UA 3EPPA 3VQTA 4JXZA 1X7WA 1WTCA 4EKDA 2Z56A 4HD8A 5DMHA 1TW2A 3D3NA 3L7NA 3C7CB 5EWJB 1BMDA 1NQXA 1FNNA 4Z4GA 5KJEA 2IUYA 3ZBTA 1B3RA 5DLEA 1EB9A 2JIOA 3TQTA 5AW3A 3MMNA 2YOFA 2J46A 1MXFA 1WMAA 1GTG1 2IP2A 3G68A 3JQRA 4BJ6A 4IR7A 2PUBA 1YBVA 1BN6A 2AS0A 2IKQA 2WE7A 2W9XA 2YWBA 2A88A 2COUA 3E7WA 4ALIA 3FNQA 4GFDA 1G5TA 1S89A 5IK2A 2FW9A 4C14A 2PRYA 4S2EA 3E3AA 5JRJA 3JQGA 3L02A 2ZBDA 2JVKA 3QE9Y 4ZU1X 1T6NA 1S2IA 3A4NA 3DP7A 4GPIB 4FFBB 3G2LA 2VPIA 2XE6A 4TPKA 2IV2X 4BFXA 1J1IA 1OT3A 2IY9A 4DSAA 3QX3A 3K1YA 5H81A 1XMQB 1U9JA 1LV7A 1O8BA 2CC2A 3DAOA 3QWHA 1U2TA 2WT9A 2YNMC 3OZCA 4PX3A 3UJCA 2J7PA 1IOLA 3PLRA 4UNSA 4EPVA 4LECA 4UCQA 3BWXA 3A4YA 3MQ4A 5CG1A 4D9IA 1KETA 3OTOB 4WE3A 3GJ5A 4IIEA 3DONA 5C7IO 5EJ8A 4DV1B 4G9EA 4L3WA 2Y8EA 4E5SA 2OOKA 2VZLA 3BFVA 5JNRA 3K0SA 2IOFK 4ROSA 4YXWD 4P4NA 1U3FA 4B87A 3GP8A 1NUHA 2ZZMA 3PD7A 1O95C 2C4TA 2GWHA 2O7SA 5CX4A 1O5IA 3LXMA 4DAEA 2AG1A 1EVEA 1M1YB 4D3YA 1F5SA 1RIFA 1NASA 4ZO6A 2GKSA 3IT0A 4XB1A 3QTBA 5JAIA 4CQNA 3I5UA 3SE7A 2IE8A 1KZ6A 2J7KA 2X3UA 2Y6VA 3H8VA 3KQOA 4NBKA 1SHKA 1ULHA 2XUPA 2VAWA 4I8DA 1TF2A 5JDCC 3ZZ0A 2ZWVA 3BWBA 1JFLA 3DVAA 1YQQA 5BXQC 1GA4A 1T26A 1MOSA 2GHTA 4C0LA 5ED0A 5JSQA 4Q3LA 4AJLA 1VMEA 3ZCRA 2QMEA 4BECA 2O1WA 1U9ZA 1KJQA 4LOJA 3A6KA 4MB6A 3DXXA 4MRRA 4J90A 1MZVA 2WDZA 1JPNA 2XECA 3MYYA 4J0FA 3ZV4A 3GG2A 3VSCA 4PYKA 4DZTA 2F1OA 1V45E 1Z0IA 2FFRA 1RQRA 3EQZA 1H85A 4IMPA 2OFXA 3AUFA 3GL9A 3ZDZB 5CA0F 3TINA 3NUGA 4EIWA 1N0VC 3OLYA 3V1LA 3LGAA 1U8YA 4QPPA 4Y6RA 4Z99A 3LOQA 3V8PA 4FGWA 3L4EA 4H6VA 4ZHSA 1D9XA 2BMJA 1WULS 3R0ZA 4ZXPA 5G0TA 2O2JA 4DMCA 3GPLA 1AQ6A 2O8VA 2X2FA 3LYUA 3PE3A 3T3IA 1ICEA 1XTQA 1IDN1 1LWNA 2MSLA 1J9ZA 3PE6A 4WECA 1EP3B 2HC9A 1QCCA 1A69A 2VRNA 5FNVA 1ZHFA 2QR5A 1TW3A 1Z28A 3HCFA 3ISTA 4J16A 5T4EA 5JNWA 3BF8A 4L0CA 3D2LA 2O5EA 2CL0X 4QLAA 5B7NA 1GTZA 1PG2A 3JZMA 4CMIA 5HIMA 5FRDA 4MUBA 5BN1A 2JNWA 1NR7A 3DOCA 1QANA 2GNOA 3AF3A 3K0CC 1WABA 1XTBA 2NO7A 3GVPA 1L3CA 1BE8A 1HDCA 3JCZA 3OZIA 3P9RA 3VH2A 2PU5A 3K09A 2JCBA 3PQEA 1PGQA 1ZM2A 4KVFA 2CVQA 2V3WA 5H1YA 3WYFA 1WCYA 1X7YB 2XSZD 4DA4A 4UU8A 1I7PA 1JDBB 5BNIA 4R41A 3MD0A 4XX0A 3GGCA 3FPBA 1UK7A 1KQOA 1HK7A 1CB0A 3DS8A 2J9XB 4JBIA 1FDSA 3HNOA 4TSFD 3KL4A 3WGYA 3AVWA 2GOYA 1K9SA 1Q91A 2GK6A 3H9CA 3SBEA 2ZBVA 1PS9A 1ZONA 2GPTA 2HQ1A 2LV8A 3OCXA 4FKBA 4G0NA 3THSA 4A8JA 1Q15A 3ZLUA 4IKOA 4AUKA 2OZLA 2ODTX 2OILA 1JLRA 1VJ5A 4BVKA 4C3ZA 2Q1WA 3IOBA 4D9KA 1V6SA 1N32B 3CMCO 1N2SA 4YRKA 4P80A 2MCFA 3PQ6A 2IH5A 2HA2A 5J58A 3JQEA 2FP4A 4KN9S 1GCUA 2P5YA 4D44A 2E82A 5E3IA 4XQEA 4RIGA 4BUZA 3GJ3A 2GM3A 4JMPA 3R3WA 1HFKA 2QDKA 1WMFA 1JZSA 4BO7A 5AHXA 3JYHA 1YVPA 3X43A 5AK0A 2H16A 3L7DA 4Q7EA 2B8EA 1RJEA 5EE3A 5IKPA 1KO1A 5KREA 5BVHB 1UZNA 3N6VA 1T15A 4QDOA 4EAQA 4AIRA 4U4AA 1Y9EA 2VDUE 3CUYA 4WX2B 3ECSA 3OURA 5A7FA 5ALKA 3DO8A 4IXNA 4MB0A 5IH7A 3DV0A 1UWCA 1Q0UA 2F3PA 4PSCA 1QGED 4BEVA 1EQAA 3R3ZA 2O0JA 3HEAA 5BN3A 3C8HA 1J00A 2OC4A 1KGSA 1I0ZA 3F3MA 4BKPA 3KEFA 1I4OA 1V7CA 4WZAB 3ZDRA 1XVUA 4R83A 1K66A 4YRNA 2DHQA 3N8KA 3OCCA 2SKDA 3Q3GE 5EWLB 1B6RA 1QRDA 3GPCA 2FCAA 1ANKA 1E0SA 1ENZA 4Q4AB 2ZSFA 1KHTA 4JIMA 4NBRA 3WLRA 4PHFA 4G2NA 2DPMA 4JYMA 4M8NE 4ER3A 3L01A 3ZHBA 1N2CE 3C5CA 4KWHA 2YJ4A 4NE2A 2A4MA 4S1VA 3R7SA 3I8XA 2FOLA 3A6FA 2QTRA 2GZ2A 3PGA1 3WB1A 5HRAA 1QV9A 2XB8A 1STOA 5IYZF 4FR0A 2CF6A 5AP9A 4RCYA 2JJMA 2YXBA 4DCJA 2PBLA 3DTTA 1C7ZA 2DPYA 4D3FA 1R5JA 1COZA 5K3EA 1R0LA 1CS0B 4M6WA 4R1NA 3SEAA 3AEQA 4C2UA 1E18A 2MTBA 4I9GA 4CM1A 2HRZA 1XFAA 1X9GA 2R8EA 3A1VA 3DT9A 3OJFA 3QOFA 4OK5A 1NIJA 5G4KA 1FQOA 3K0KA 3L9WA 4XUDA 2Z2ZA 5DGXA 1QFSA 1KC3A 3KHKA 3RK4A 2NUPB 1TJ4A 4DC1A 3KQLA 3SS9X 5IT0A 1MVNA 1UPBA 5DGHA 4X5OA 1V7PC 4FXOA 1SD5A 1YKSA 2C5HA 1FMLA 2FEKA 2V4MA 3ASVA 1A2KC 1YIOA 3UCXA 3CN7A 4J2OA 1HZJA 3RR2A 2P9FA 3ONWA 3F47A 4N40A 3DFZA 4S1OA 3AQ4A 2W37A 1ZYUA 1WY5A 7ABPA 1Z6TA 2ZVJA 2VJMB 3AEQB 5K3OA 1U2RA 4IX1A 2FXVA 1YC2A 4I1YA 2BCJQ 4RKYA 3G8AA 4OMUA 5ALYA 3VR1A 1EXNA 1TCVA 3RAGA 3USCS 3SVZA 4D92A 2BHRA 2FCRA 4YWJA 4ZOQI 4QFMA 1RVDA 2CW5A 2FQYA 1E6KA 3FTQA 3OMXA 4KJXA 5HG0A 1ISSA 2HAEA 3QYFA 1L5OA 1ECLA 2G3YA 5BMVF 1HDEA 2CMHA 2FZCA 1UFOA 5KTRA 3K20A 2F17A 2JLRA 5F1OA 1C30B 2PG3A 1GQQA 3VYRB 5JDCA 3EQ6A 4PYMA 2EFJA 3L04A 4K26A 3VSDA 1T2UA 3KCNA 4BBAA 2CCJA 1TYEB 2R96A 3EA4A 5K3BA 1SKAA 1E99A 3CKKA 4PAQA 3E7FA 1IYZA 1PJLA 1Y7LA 4OGLA 5I3CA 2XZOA 3ETJA 1AHPA 4HP8A 1IM5A 1G8SA 3DUFA 5IM4F 3OQ1A 4KR6A 3WGIA 2VSQA 1GZHB 4O02B 1AUQA 1YDWA 2DBRA 2YINC 4H18A 3ENNA 1JR4A 1VIVA 3JR7A 2KQUA 4RV5A 4ATNA 2J9GA 4RIEA 2HRCA 3W5UA 2D4HA 2XIQA 2WM2A 5BN5B 4OQMA 3TZHA 1N7IA 4DMRA 2ADFA 4P0TA 2QKYA 5AW2A 4JXXA 1UZUA 2FR0A 2NT3A 1H8HA 5PNTA 1PWHA 1UPTA 2JATA 3PC3A 4GX1A 4PV7A 2V0GA 1KE1A 4F7DA 1QRTA 1I4EB 1KDRA 3X44A 2EW2A 3KHTA 2AI3A 2VDKB 2VHQA 2G4CA 4CCSA 1BHSA 5EXEA 3QXGA 5F2KA 2IX9A 3IPAA 4ND6A 4EQZA 4ENWA 1JLSA 1WZCA 3QXXA 4DLVA 4K86A 1ND6A 2GDJA 2Z1MA 2HHHB 5FXMA 3Q10A 3JRWA 1XHLA 2IHJA 3QW4B 3NW9A 5ALXA 2CL5A 3RRBA 3UUWA 4G65A 1UKCA 1Y7TA 1XTSA 4NZ9A 3VX4A 5K0EA 2VVTA 2O8FA 3OC0A 2I6TA 3G9TA 1KDZA 1KMHB 1LD3A 3B8HA 3MJRA 4INOA 4O4IA 2YRWA 3D0QA 5BSKA 1VECA 2AYXA 4MW9A 4CXMA 1GGMA 5EQJB 5T67A 1Y3AA 2O57A 2I2BA 3GGDA 4I1IA 3JWJA 1ZWLA 1CUZA 2VAXA 1J33A 3BVPA 4LGVA 1E5LA 4ZGWA 1IBCA 1AUXA 5FTJA 4BLOA 2PKQP 4G0QA 4ZVMA 1K88A 2IZZA 3PC7A 4X1YA 5ALOA 5DP2A 4IHQA 2JFPA 4ITRC 2BRUC 4OI1A 1EM6A 3HWSA 3FGNA 5F9HA 5IXJA 3QHPA 1UH5A 2EU8A 3FSGA 2XCRB 1FFYA 4BO5A 1E5DA 1KS9A 3INRA 2OQIA 4NV3A 3GJYA 4N0QA 4P1ZA 3R7FA 2QN6A 2HUPA 4IIVA 4Y3UA 2ZTSA 2AD1A 4K88A 4G0MA 3VZDA 2R47A 3KYJB 6REQB 1XCLA 2RJ3A 1LH0A 4YFVA 1D1SA 4RD1A 1TQ6A 4H1HA 3KJEA 2G82A 2ZT5A 1Y8QB 3SFTA 5SZIA 4BNHA 1VL2A 3DBOB 3D7KA 3OZ7A 2ZYSA 5CVUA 4B6EA 3HCNA 2BCEA 4D4JA 1PX2A 3D4BA 4N5NA 4FLEA 3GG9A 2BEWB 2OEPA 1SBCA 1F2UA 4D8VA 2Y2UA 4C5CA 2XQGA 2I34A 2GNPA 2UUPA 2X5NA 4PPGA 3WGNA 4G8CA 1SURA 3PUKA 4LV8B 3CNQS 3G1UA 1XKQA 2Y1DA 1A4UA 2B36A 2EBWA 3JQFA 4GYKA 1I4TD 1UC4B 2CKDA 1TL7C 2V5VA 3AR3A 3C48A 3Q41A 2IEZA 2H9IA 3RC1A 3SQOA 5ITSA 4JVNA 4A23A 1BFUA 4YT5A 5DO9A 1T0JB 4RJIA 3ASUA 4ENSA 3AUAA 3ZZNA 1UM9A 1EESA 2MINB 4KAFA 3IAM6 4AZVA 4KO8A 3WK9A 1F0KA 3QE3A 3UB3A 1U81A 3PDWA 3AHGA 2NUTA 2FWPA 3HGTA 2KBEA 2OV2A 4KOAA 4AQ7A 3H11A 3O8BA 2JI7A 3UTCA 1WKVA 1C2YA 1DXHA 4NV1A 4P08A 1XA0A 4ZDWA 1FDTA 4IF4A 4X95A 1RTKA 1Q1QA 4UC0A 2R6JA 1EJBA 2JFUA 2QMYA 3I9FA 5DYNA 4EW3A 2Q3LA 5YASA 3TM4A 3NG1A 4Q03A 3L93A 3HCDA 4M9CA 3A3OA 3LKVA 5FL7A 1Y4SA 5HZKA 3DMRA 4EVQA 1W4CA 3ZDAA 2C2ZA 1N3LA 2IYEA 4NFSA 2PLWA 3K1AB 1Z4JA 4K1XA 3S6JA 5U4XA 4DG9A 1QHNA 2JIZD 3EGIA 3O3NB 4DWVA 2C9ZA 4TKLA 1LDNA 2EGGA 3UJ7A 2CKMA 1ZO8A 1FNBA 1PSWA 2PYDA 1DAKA 1T8UA 2W22A 4LDNA 1XC7A 3VDXA 3VHLB 2VXBA 3W2TA 4BX9A 2YXNA 4HXEB 4H77A 1C1XA 5DT9A 3UHAA 3GJRA 5JCJA 2BTEA 1CUIA 1NZFA 5GOZA 1Q7EA 4ZVNA 1VTKA 5J23A 4QTTB 3SWWA 2NV2B 3V8BA 1XQXA 3FCXA 3E22A 3MB8A 1A2QA 4HX2A 4D6YA 3I12A 4I6EA 1QMPA 4ERNA 4BMOB 5L7YA 3DNPA 2P4HX 4D80A 3TUZC 1TKRA 4UHCA 2QY9A 1QH1A 4MEBA 3FWYA 3KKLA 3QOXA 1BXRB 2RHHA 4QYIA 2PMCA 4U9UA 1LVUA 2YNMD 4ZKEA 1KK3A 3PENA 1PNOA 1WV1A 3N7AA 4Q4JB 3NNDA 1ZL2A 3G7SA 1WZNA 1N77A 1MV8A 2LKDA 2QSYA 1GKKA 2KM1A 1CR6A 1UMBA 1R3DA 2BKAA 2IXTA 4M8IA 1G20A 3M4YA 4X41A 4UAVA 3RFVA 5BWNA 4FGKA 2AX3A 4CIDA 5HUJA 4NFLA 4YRTA 1PT5A 2OHIA 3PUYA 2CMKA 4P4SA 4WT7A 2QL6A 2WU0A 4NAUA 2O7VA 3K70C 1R8XA 2JKZA 5ED4A 1SGWA 4UTPA 1PK8A 1SIBE 2P75A 2VSOA 1V11A 3RFXA 4F6RB 1QH1B 1K97A 2OHFA 4QNMA 3P2KA 1N5RA 2WWHA 5JBIA 4A0GA 3AT1A 1PQWA 3OEED 3A4IA 4Q3CA 2J30A 3DMPA 3RIMA 1YZLA 4MVJI 1UBNA 3KPUA 1VP9A 3TTSA 4EO9A 2IZ5A 2P35A 3MQFA 4GOKA 5E7JA 5JO9A 4CT5A 2X23A 5C8YF 4ISBA 1GQSA 1SVMA 3M5CA 4BKMA 2OAGA 1JSXA 1QM5A 1YSCA 3JYQA 5T4FA 2Y0CA 1BDMA 1KZ7B 1CHDA 1SCDA 3D8BA 3D54D 3SZOA 5KSZA 3AIKA 3WLAA 2PKXA 3G17A 1TAUA 3F2VA 4PN3A 3H4TA 3PXDA 4DUPA 5DIZA 3CA8A 2BKVA 3LHKA 5K0NA 5DLYA 2O7RA 1T36B 3F5DA 3OO1A 3R4CA 4IQ4A 5HILA 1K6IA 4MVJM 2CDNA 2F62A 2IELA 2XIJA 2ZRQA 1KC1A 1PE0A 3EHEA 3KT6A 4L0MA 4TN1A 1OZ0A 4AIIA 3N28A 2VT3A 4RBNA 1KI3A 3C3JA 1JR2A 5ILQA 1Y42X 1RWQA 2XW6A 3IA7A 4O5AA 5F3RA 3ACBA 3CT6A 4MOWA 1KI6B 3VR5H 1VG8A 3BXEA 2BZSA 1GPLA 2D1YA 2EJVA 1YZUA 2RHCA 3DOOA 2QX8A 2RGRA 3N8HA 3C6XA 6ADHA 3NBYC 4LBZA 2PDAA 4RZSA 3D8RA 4UEQA 5AKKA 5TIIA 3UK0A 4A8JC 4G8BA 2DJIA 2X7XA 3G9UA 1M2HA 3GJ0A 3HXPA 1Q22A 2W4QA 5F7ZA 3MTGA 4DCTA 5AJUA 1CY2A 1PWXA 1BOFA 3RU9A 1CZOA 1PS0A 2AZDA 4GSKA 5L51A 3IERA 2IV3A 4MRPA 2XAAA 4XPIA 1H9CA 1QQ7A 2Y99A 3GO4A 4KW7A 5JJBA 4J0EA 1L4FA 4GOLD 4HDKA 1Q0PA 2QMHA 4AO8A 4FONA 5EJ7A 3NNSA 2OLJA 2ZUTA 2ZIWB 1V16A 1WUJS 3RGGA 3BGWA 4KR2A 13PKA 1WAMA 5CDFA 1Y8CA 2FMXA 1QE5A 3NHYA 3BXFA 5GADl 1ODTC 2K87A 2WHYA 3NDPA 2WSYB 2JGRA 4P3KA 4V0OA 1W94A 1E7RA 1Z5OA 4BVGA 2XUZA 3GPDG 4R69A 5KEIA 4W5QA 3FJ1A 4IDPA 3GP3A 4RTPA 2ZWIA 1ST3A 4Z3OA 5LWQA 4WASA 5T7BA 1T9GR 3SEFA 3P4UA 3ZIDA 5CLJA 3OPYA 3KR2A 5L3SB 4OX9B 4Z1MD 5EJGA 2PMDA 4L74A 1JBQA 1ZJJA 5JQGB 4JJ4A 2V8OA 2ZJ0A 3U16A 3VVMA 1BH6A 4G1VA 4HDNA 1V9SA 5DRTA 1U2PA 1ZM4A 4JIGA 5JISA 1UDBA 4V38A 4MIEA 3W0LB 1P8JA 2HQOA 1HYEA 5F7JA 2QT0A 1VDZA 4QUKA 4KGDA 1HFEL 1EZ4A 3STYA 1SBTA 3MMPA 2GD6A 4DDHA 3WGKA 4M6WB 4B81A 1E0KA 1JXAA 2C5FA 1AJEA 2C4WA 3W8EA 1GN9A 5IUKC 4OXKA 4V02A 1A1SA 1MO5A 1LNQA 4Q9LA 4PZ0A 2WPDA 3CGGA 1ZJWA 4DLWA 2CF5A 2CY0A 2XWPA 4LAFA 3EC7A 1EGVB 1QVZA 4F85A 4LK2A 4E07A 3CJTA 1RJ9B 4S05A 1VJTA 1V48A 3CWCA 1ZWKA 3LT5A 4X8MA 4IILA 4CQJA 3C7DB 5LC1A 4I50F 2I7VA 5J4LA 2IU4A 4TZ0A 2LKCA 2WJ6A 3BMQB 3WB9A 2JFGA 2NADA 1XGKA 2PJUA 4TV8A 1PTJC 3TLZA 2ES4A 2YQ4A 3MTAA 3C85A 2YWGA 3PWTA 2EIHA 3MBIA 5LLTA 3I23A 4ARIA 3COSA 3B8EA 1HBJA 3O9MA 7MHTA 3NYQA 4EG1A 1GFSA 2OG1A 1J0EA 2FRVA 4GRAA 4FR5A 3GFOA 3O74A 4OY3A 1DVRA 1YR8A 2ADOA 1YS6A 2IT1A 3IC5A 3KQPA 1V1MA 4KE8A 4IXDA 4TXHA 4BGUA 1M54A 4F3YA 2C4NA 4FBLA 2ZEJA 2VJQA 4HX9A 3OZDA 3WVNA 3GLGB 5EUQB 1WVGA 2PSJA 3ID6C 1XN1A 3AXTA 1I3CA 1YHYA 1I7LA 4HXGA 1GV0A 4MV1A 3R2JA 3GUZA 3LIPA 3GT4A 4E3WA 2MT9A 1RZVA 5FH9A 4ES6A 2M98A 5DP1A 4D3ZA 4EB3A 2FLVA 1U4SA 1AGNA 3IP5A 3R6LA 4PHHA 2PNJA 2VJYA 4YACA 2ZQ5A 4NBNA 1PDWA 2A0UA 4FBMA 4OQLA 3ZNPA 1FE8A 5AK4A 2X42A 2FEXA 3L41A 5A6SB 1LI5A 4JS0A 3EZNA 4L6CA 1ACLA 1KI9A 3I9LA 3CF4G 4X8OA 3AR8A 1JQEA 1DEOA 2CHVA 3AUXA 3DH0A 1SB8A 2QR3A 1KI1A 3LC2O 4JWKA 4WJZA 1X8JA 2ZBGA 1P4GA 1TB4A 1RP7A 5EMMA 4QFCA 1AK9A 4W5NA 4UHJA 2W6NA 2ZIEA 2A94A 2RFLA 5EG5A 3TTYA 5EJ2A 4FFNA 1EM8A 4GR9A 1C9DB 3QFTA 5IMBA 4R1LA 1YVRA 2FKNA 5LQKA 3J81k 1YI0A 2G6BA 3GLQA 1QO7A 5ELXA 3HBLA 3NYWA 4K8OA 4LWZA 4AMUA 3MTBA 3W6PA 3X3HA 1J8YF 1ZN8A 3VBEA 4NFYA 3CV3A 4EFMA 2W6ZA 2RAPA 5H82A 3ESQA 5DM1A 4LC9A 4AURA 3UN1A 2OPHA 3BGOS 3RVLA 2Z4RA 1P3JA 2PZJA 3BD7A 3MUFA 5EPUA 1U2GA 1W8IA 1MO6A 4GP6A 4KNWA 1OYOA 5B58T 2AI1A 3QVLA 1GEGA 3KOZA 4YT2A 3V4RA 1Y63A 2HNKA 4JQSA 4MEAA 4GWKA 5HRCA 2DFVA 4AZWA 2V6GA 3MSXA 1E3WA 4WOPA 5CLQA 5LQJA 1WKBA 2GXSA 2YV1A 4M1ZA 5ADUS 1QG4A 2DQSA 3LQFA 1E8NA 3IEUA 4AN0A 2EW8A 1P81A 3SG0A 4PNPA 2ECQA 1T2CA 2YQZA 3PWSA 4GLFA 4AYWA 1FPQA 1FUUA 4A5SA 4A26A 2IEAA 4IJVA 1E2DA 4KACA 2WE8A 2COKA 5KYVA 3HFSA 1ZN9A 1IZ9A 3TSCA 2XZLA 2V7PA 4URZR 5LZ8A 1VRCA 1AUPA 4NY1A 4PZPA 3RSLA 3M0EA 3HC7A 1X7HA 1U6IA 3OZVA 5IU6A 1YVUA 1LWOA 3R77A 4FOOA 3GGPA 3SS7X 4DIOA 1FRVA 3P96A 3GD5A 4F9FA 3PXAA 2JRLA 4LISA 1LLDA 2ZTHA 1CSEE 1EFTA 2G0TA 2OCPA 3QMPA 3Q5GA 1LLQA 1KBZA 1VFPA 2O0KA 3GJSA 4RFVA 5EZSA 1ORIA 1E63A 1FTYA 1RYZA 2C82A 5FUMA 3NU1A 3X1JA 1YRWA 4B44A 4HQRA 2IS1A 5JYEA 1LFDB 3HB9A 1SCNE 4ZQEA 4BJ1A 1XWWA 1BHJA 2FF5A 2R00A 3VAZA 2VK4A 2E7ZA 3FUUA 4M38A 2J48A 1OTYA 1GARA 2XX3A 4X91A 4RS4A 4MLCA 4UW9A 4PU0A 3TXXA 3CSUA 3BQNB 1US8B 3I64A 3ZWMA 2Q6LA 2WAMA 1KK2A 1AA6A 3VGJA 4P58A 5FA5A 3VPBA 3IEVA 2BKLA 4O4JB 5HA5A 4CUKA 4PO3X 3LS2A 1GITA 2R6FA 4BZXA 4F4DA 1WDWB 4Z54A 4BGDA 5JJLA 1O6FA 2PMKA 2C57A 1UBFA 1E7QA 2AFIE 4RPIA 3BRCA 1XLUA 3SOPA 1EXWA 3IODA 3IUSA 5I7HA 1E2HA 3OCZA 4K9RA 5B1YA 4J8PA 1E4EB 3RVQA 5K7SA 1SOUA 3KT8A 4JLJA 5B55A 5BUZA 3VGPA 1DP4A 1SNYA 1VLJA 2IY8A 2P2CA 2Q45A 4JU8A 1UKBA 3TKAA 2XADA 1UXJA 4AN1A 1MQ8B 2P0AA 2ZAMA 4NYMR 2HO5A 3PEVA 2D2VA 4UBIA 1GADO 4B7CA 1JFVA 2AG5A 4MB2A 3ELWA 3N0TA 3EODA 3Q6IA 4J6FA 1BW9A 1T6BY 1H1LB 1PT6A 2YW9A 4JL8A 5T4HA 3ETNA 1NU8A 3F9RA 1UPUA 3E5RA 1MBZA 2PAFA 2VJBA 3CTMA 3VU0A 4E5UA 4F9GA 2R65A 4KPGA 1T10A 1B1AA 4HX5A 5FF9A 4FW9A 5IC5A 1E2KA 2VRCA 1SN7A 4CIXA 3P0JA 4ZODA 5BORA 3K9FC 1GTVA 4NYJR 3JW8A 2B4YA 4FHZA 1YQGA 2AOTA 1U5BA 4MJ7A 4BV9A 4MNTA 5A9SB 2HL6A 3QFHA 5HWSA 3FYTA 4X6UA 1MNAA 3RS0A 5CCBA 4D1YA 1L5SA 1UAAA 3O4FA 4FDLA 4KJZA 3P9QA 3L77A 1JQ3A 4O2AF 5EJ6A 4BRUA 1TVKA 4LRUA 1VLHA 8AT1A 5C34B 1T2EA 1PJ8A 2AC7A 1PR4A 2B7LA 2PVPA 2ZRMA 3D4PA 4KLCA 5GMOA 5GQSA 2QMUA 3VNSA 4PXYA 2F3QA 4EX6A 2ZE6A 4CGYA 5KPDA 2FW0A 2QN7A 1FS5A 1BAPA 3IE2A 4K6HA 4JB8A 4V0RA 2PH5A 4AKGA 1UBSB 2Q4TA 1X13A 3ZIAA 3DWIA 2ADMA 4P83A 2ARKA 3ANTA 3O8RA 4AW9A 2P9JA 2QUJA 4G9BA 1IZ8A 4EG7A 3ER8A 1RZ3A 4ZVPA 4PLFA 1M8FA 5E1BA 2IYVA 3E3MA 5BUSA 3WK7A 4UAJA 5DXFA 1K8YB 2JGMA 1S8AA 4H15A 5EMKA 4EJFA 4U2KA 3VOTA 3PPWA 3I6YA 2EFCB 4HEQA 2NUTB 5B2FA 1RLOA 2O8BA 5DXJA 1IZZA 3SLGA 3BPSA 1CETA 1SHUX 1VJRA 2Y6UA 4CDRA 1DMRA 1V47A 2WFMA 3F9CA 4C76A 3U19A 1G1MA 1SBHA 2HDHA 2NN3C 3P2IA 3KYCA 4H0FA 2XGOA 5BSTA 1UXIA 2V8BA 1QO9A 3GN2A 5K0ZA 1LTKA 2PZGA 4DV6B 1YTLA 3IDOA 2CLOB 2BEVA 4RVHA 1LTQA 4F04A 4RLSA 2OQRA 2QLJA 3QWIA 2W6OA 1H1LA 5FLEX 2JBAB 4MUEA 2JD0A 3EMVA 3R0JA 4WRRA 4ALLA 1CC1S 1IH8A 2Z1DA 3C87A 5KNDD 3RC7A 4OSOA 3AYZB 3EY9A 2ECOA 3OTHA 5IVPA 4JT8A 1SK8A 3FDZA 3TLGB 4BNFA 5AUQA 5HGXA 3LQRA 6REQA 3GRRA 4AKHA 1U2EA 3W6NA 4F38A 1Y6RA 4EECA 3OM9A 5JZOA 1GRNA 1IDOA 3AX6A 1C0PA 1L4EA 4XJVA 3LY5A 2BFFA 5CURA 4MQFA 4C0KA 1I5RA 1UZAA 1L4UA 1J6UA 2Y68A 4RK1A 5F78A 2ZAIA 5LNK1 3O73A 5G1OA 3QPDA 3AZPA 1T8TA 1ZLXA 3T1VA 4Z4CA 5LM3A 5CDSA 1M2FA 4H08A 2ZPTX 5H83A 2AFHB 3C15C 3NUZA 3VZRA 4AZ0A 4D9NA 1QP4A 3AVXA 1NWHA 1UBLS 2B92A 3OX3A 4IMIB 4MGZR 5JVDB 3FOEC 4JDUA 1UFKA 4JENA 1B8UA 1Z7BA 1TZ2A 4MUFA 4PRLA 3BRSA 1KAEA 2BE7A 5C3UA 3KLMX 2EDCA 3I05A 1G2IA 1TDJA 1UBJS 2EYUA 2B78A 1Z4KA 4HNRA 1N1MA 1BQ4A 2QF7A 3ZEAA 3MJFA 3KCQA 2JFZA 1N5LA 1QKIA 4KLZA 5DBOA 2GQ0A 2QBYB 1VZ2A 3GWZA 4OXNA 2WAOA 4G0XA 1EK0A 1GL7A 1NQTA 3F4KA 2VXCA 3OWHA 4BS9A 5IYZB 3RW9A 1KSFX 4G5OA 2NVUA 4AX4A 1POWA 2H00A 4U2BA 2IH2A 5LUBA 4YN3A 3F3YA 1M10A 4B17A 5BSWA 5KVVA 1OYWA 3B52X 3KFXA 2C84A 1Z0AA 1IMOA 2OZPA 4HLNA 4QAJA 2QLNA 5DI3B 5FI1B 3AL3A 1J8DA 4MR7B 5LOVF 2OB2A 3WQSB 4LNHA 2JLYA 3TXYA 3FPLA 5FORA 4K2AA 1UT8A 2ZJOA 3V4FA 3I2IA 1HM5A 2G1PA 3GA0A 3AM1A 4KDFA 3KX2A 4WXEA 4NENB 4DTIA 1GGVA 1G8HA 3GAFA 3OEHA 5U9CA 1LRLA 1V3UA 3SF0A 2QRJA 2Z83A 1VSQA 2P0EA 4HRXA 5JS2A 3VVCA 2QX4A 1MP0A 4M76B 2EBHX 1KKUA 3FGZA 4J03A 4AJEA 2IYPA 1NLFA 4DJJA 3EQ8A 3RC9A 3UAOA 3T1TA 4GO1A 1Y3CE 3PV0A 1M2VA 4CDNA 3EBLA 5ELMA 5LSAA 2JIBA 5IJ9B 1MRSA 1CRQA 3DW1X 4ZMSA 3L7BA 5FI5A 3CW9A 1TYAE 2YFQA 1BU5A 3IR5A 5JH7A 2QXTA 5HTOA 2QTGA 3GJXC 2SKCA 2IFTA 1E92A 3BMCA 3C43A 3CH6A 1QE0A 4BE7B 4ZDJA 5TDHA 4B9AA 4CKYA 1GSHA 3DDZX 3ZW8A 1WW3A 5HK9A 1JIKA 1UKZA 2HLHA 3K5IA 2F67A 4OB7A 4PNZA 1ZJYA 1G3UA 5LMUB 3MA0A 1L7NA 2P65A 4JC8A 3FZQA 4X6YA 1G9XA 1UXHA 1J70A 3WL5A 3ED5A 3O2SB 4XLLA 3KQQA 3WA7A 1TA4A 5AKGA 3HUUA 4MWSA 3UJAA 3EZYA 3AM5A 1KIAA 2DBZA 3HYRA 4XUEA 3UMRA 3TEFA 2JFYA 1BCSB 1CUJA 1Q2XA 1TU4A 2O14A 3WRXA 4P84A 5A71A 3CO0S 3EHDA 1WXDA 3RSSA 5HF5A 5FNVB 5BQPA 1J20A 2H2DA 2DXIA 4KSBA 4BMYA 3OETA 1C3VA 3WAKA 5DWDA 3WWPA 4L2IB 3KEQA 5IUJC 3WI7A 5I9IA 4DBLE 3TBHA 1X7WB 4YRAA 1A98A 2CFSA 1A5ZA 2IF2A 3R4VA 2I4OA 4LHWA 2G5PA 5T41A 2EXXA 4RF5A 2X8AA 1VKJA 1UMBB 5KTPA 3VV2A 3AU9A 3LKBA 4CN8A 4PSAA 1SKMA 1DAPA 1E1YA 1FFWA 1T5TA 5REQA 3V1NA 1GKUB 1MXHA 2W93A 4RQTA 4A9AA 4MYDA 4TWIA 4NYMQ 3EVTA 4BWFB 1WEHA 5I9MA 3O83A 4JI3B 2H17A 4IXWA 1Z5ZA 4AY5A 1G5PA 1JN0A 4MULA 3VMFA 2VH2A 3TKLA 2ATCA 4QBIA 4Z5XA 1PJZA 4YQYA 2FFBA 3T3EA 2C7RA 2WJPA 3G59A 4ZEMA 4NV0A 5JSUA 4MQEA 4HDSA 3CRW1 3G0DA 1SBIA 5FUXA 3OPYI 3NRJA 3CX6A 4XUCA 4C2BA 5C1BA 1FUKA 4DEXA 5DX0A 1WA5A 1C0IA 3EVBA 4HAWA 1PQPA 1R7RA 2XQVA 3AV3A 4KTVE 4BBJA 4G0YA 1VE6A 2FMKA 4B3TB 1JS1X 2A0FA 1JEJA 5HBGA 5L7WA 4BTVA 2IPNA 4YNBA 3O75A 2W2LA 4XUGB 3HEMA 2FSVA 3WNQA 1PJBA 3JQAA 1BJTA 4WFQA 2KBFA 3PIIA 3UJHA 2QRKA 2I67A 2FDXA 3SK0A 3B13B 3L43A 1CJSA 4C1BA 2DFKB 3T41A 4HB0A 1CEEA 1SC9A 4ZVSA 4CE6A 2Z2JA 5BVHA 1O5TA 3JVVA 4DEVA 3OT1A 4CLOB 3QJGA 1H5UA 5KZMB 5SY4A 1ETHA 4RY0A 3R7WB 3UGJA 5LZ9A 1UWVA 1DRVA 2XCUA 1II9A 1T2FA 3CZ4A 5K8IA 4R3UC 3GW8A 4JLVA 3RFTA 3V4SA 3SVTA 1V6AA 3FPKA 2GN9A 3QEBZ 2DETA 2EYQA 4BU0A 4TLDA 2A3NA 5EIBC 4ZANA 2YASA 1QDUA 1CULC 1HE4A 3I6MA 3PQ5A 4V2UA 3T6KA 3ZNNA 4EJ0A 4G0ZA 5ADHA 4GH5A 5KQPA 1X2EA 3SN6A 1KI8A 2KX7A 1XA4A 2H65A 2NG1A 2JGAA 1DARA 3ANSA 5CUQA 5A7GA 3SD7A 2ON6A 4JK3A 3VR3D 4BTLA 4C7JA 3RRJA 2WM9B 1QVAA 1KI4A 3MRXA 4YI3A 5JQGA 3OF2A 4EL0A 4K9OA 5JRZA 3STXA 2IXDA 2BGGA 1EE2A 2A0YA 2C7OA 3T3MB 1WNFA 1V7ZA 2BDEA 1M7HA 4RKFA 1FSFA 1JW9B 1WF6A 1SXGA 1BYUA 1Z34A 2PGOA 2XMZA 4GMXA 4R9SA 5EWMB 4KWIA 4AMVA 4DPMA 5JQGF 3FM9A 5BO5A 3CTPA 4BYMA 3CG0A 3NHAA 4FD3A 2X0JA 2Q9BA 3LPCA 4RAOA 4BGIA 4EG6A 5GONB 4PGHA 1Z2NX 2Q9CA 2R6CA 1QTRA 1IHUA 2J85A 4W63A 3FCAA 1VSUA 4GX0A 4B6PA