1S4QA

Crystal structure of guanylate kinase from mycobacterium tuberculosis (rv1389)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
183
structure length
183
Chain Sequence
VGRVVVLSGPSAVGKSTVVRCLRERIPNLHFSVSATTRAPRPGEVDGVDYHFIDPTRFQQLIDQGELLEWAEIHGGLHRSGTLAQPVRAAAATGVPVLIEVDLAGARAIKKTMPEAVTVFLAPPSWQDLQARLIGRGTETADVIQRRLDTARIELAAQGDFDKVVVNRRLESACAELVSLLVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Guanylate kinase
publication title Crystal Structure of Guanylate Kinase from Mycobacterium tuberculosis
rcsb
source organism Mycobacterium tuberculosis
total genus 62
structure length 183
sequence length 183
ec nomenclature ec 2.7.4.8: Guanylate kinase.
pdb deposition date 2004-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.63.10 Alpha Beta 2-Layer Sandwich Guanylate Kinase phosphate binding domain Guanylate Kinase phosphate binding domain 1s4qA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1s4qA01
3LV8A 3ONWA 1LS1A 1LW7A 2BBSA 2IHYA 3KJHA 2ZPTX 4V0LA 2RHMA 1T0HB 2RHDA 3QQ5A 1NVVR 4Q4AB 2JLWA 4D82A 3C15C 3THXA 4MGYR 2YOGA 3X1ZA 3Q5DA 2IX3A 2X19A 2A5GA 3LFUA 4PO1A 4NYJQ 5JHGB 5JFGA 2HXSA 4JVSB 2ZRDA 4ZO4A 3QG5A 2C78A 5JI2E 2WJGA 1VG0B 2WMNB 1OKKA 1IONA 1KMHB 2G1KA 1XCGB 1GRRA 2LWIA 2GXQA 3IO5A 1Z0FA 3BOSA 4RZXA 4RFVA 5G53C 2ZYTX 3X2SA 3FFAA 4KFSA 2XAUA 3VKWA 2GBLC 4HLCA 1GWNA 2BKUA 5KSPA 1HA3A 4FI3C 2ZSEA 3EIHA 5FPTA 1LF5A 4IOLA 3ZVRA 4Q4HB 4V02A 5CIWA 1E0AA 1N0UA 5KNBA 2XTZA 4QGAA 3GQBA 4TN1A 2A7QA 3N2IA 2TMKA 1W0KA 4BASA 4BFSA 2JLRA 1KK2A 3FKSD 3LRPA 5J4HA 4HDCA 1RC8A 4PQRA 4QHTA 2W00A 5FI0B 3NBFA 4O3MA 2FV8A 3P26A 3W5JA 4TYPA 2J9RA 3P1JA 4ACBA 2R62A 2WIAA 3CO5A 4DVGA 1UKEA 3OIWA 2I3BA 1JNYA 1ZU4A 2NQ2C 3QXCA 1Z63A 3DEFA 1P60A 1NIJA 1Z29A 3I1FA 5FL7D 1KSJA 5EE0A 4CT4B 3I8SA 3ICQB 3CRMA 5F2EA 1IN4A 1NBMD 3NDPA 3REGA 4PHHA 2WV9A 4MDEA 5FOWA 3T5DA 4WXRA 1XEFA 4IVRA 2UVQA 3B1WA 1JAHA 1COWD 3BIFA 4QXAA 3WRYC 4AKIA 1P9NA 5JS8A 1D6JA 1N6IA 1NSFA 5D3MB 3DZ8A 3VR4A 4AYWA 4HB3A 4IXMA 4URVR 5J4YA 5A0FA 2VLIA 4EIWA 1AGRA 3VR3A 1QHHB 5EXPA 2DWQA 3QF4A 2ZSBA 3EARA 4URZR 4C0LA 3T35A 4K8OA 1QHGA 1KYIA 1U8YA 3GLHA 4TMKA 3FMIA 3TVTA 4A4DA 3UG6A 2A5FA 2JLUA 2MSEB 1KJZA 2ZE6A 3F8TA 2BBTA 2VP9A 2YOHA 3DMNA 4LWZA 2IBMA 1H8ED 2BIFA 2A2ZA 2GVDC 3EW9A 4YC7A 4LC1A 5KNCA 2W58A 2G1JA 3I61A 1TU3A 1Z0IA 3DZDA 3K0FB 4JLDA 2EQBA 4D6PA 4DEXA 2H16A 3SE0A 2ZVQX 4OYHA 2CVFA 2ZRIA 3LVRE 3GLFA 2VP2A 2OBMA 3IKJA 4UQOA 2OLJA 2VYFA 3OIUA 4JVNA 3WNBA 4GFDA 3NC1C 1QHYA 3T1VA 2V7QD 1XFAA 5FOXA 5B57C 2EWVA 3FVQA 1NY6A 3PEWA 3TK1A 4I1SA 2ZEJA 2UKDA 1KNXA 4FMDF 4WBSA 1NI3A 1KY2A 4FIDA 1UBEA 3EASA 3NEYA 1G3RA 1G9XA 5CM9C 4O2LA 4XIGS 1Z83A 3R20A 4PANA 1NVWQ 2PH1A 1G5RA 1S3GA 2G3YA 4RZ3A 3R9IA 1RW4A 5FR1A 4RD3A 2IYUA 3GJ7A 4DUGD 3LXRA 4OI1A 1DTSA 2WICA 4B33A 1PLJA 1D2NA 1QG2A 4JKYA 3UXMA 3U44B 3BD9A 2CBZA 5GJCA 4LYAA 4D2IA 1X3SA 3THYA 2IYLD 4B3GA 1VMAA 3CX6A 5FBRB 2YWHA 4PC1A 4CT5A 3SEAA 3ZVMA 2PZFA 2AKAB 1EWRA 2YINC 4ZV4A 2CHQA 1M1YE 2J5XA 1TAGA 2ZJ8A 4PHFA 1A82A 3QPVA 4W7SA 3LA6A 1PLLA 3CZQA 2Z6VA 1DAGA 3HR7A 3EA0A 4UXJA 4PQYA 1QHXA 2EYQA 2PEYA 4W5HA 4Q03A 1QG4A 4BLSA 221PA 2C03A 4HEJA 4NONA 3U3RA 3TGPA 1CF4A 1E2EA 4Q9KA 4LPKA 3Q7QA 1VYUA 2JDIA 4NH0A 3CIOA 4OKSA 2FN4A 3SYNA 1ELOA 2WTUA 2FSHA 3U4QA 2WWIA 2CJWB 1SKYB 2AHOA 2BJVA 4UNSA 4A8JA 3IO3A 1N6RA 3MWYW 1II9A 1S0UA 2GAOA 2A9KA 5H1YA 2OAQ1 3ZD7A 3GLIA 1Z0AA 1AS2A 3T12A 1GKUB 2UZIR 1W0JA 2PLRA 4GBMA 3NC0C 2ZJYA 4LPSA 4OQMA 1P61B 3AVPA 4QJ4A 4XTCS 4Q9JA 3VR6A 3BFVA 1W2HA 4HAUA 1S9DA 3LLMA 2FSGA 1R5BA 4MUBA 4OL0A 3U2QA 1A2BA 1GVNB 1HEIA 5K8LA 3WRXC 4URXR 5CJPA 1W36C 4LJYA 4IVQA 2RGCA 4HDOB 3U5ZB 2VP5A 2GXUA 3AKYA 3BWDD 1XJQA 1FFHA 2D74A 4QGGA 4HSEA 4GPTA 2QRNA 2BMJA 1P75A 4S2EA 2QSYA 3R7WA 1CTQA 1AQUA 1DE0A 4JL5A 3SJBA 3KXIA 2AK3A 2CDNA 2OXCA 4IEIA 3THWA 4QHSA 3Q3JB 2N42A 3OFNA 3SHFA 1VG8A 4OBEA 3GJ0A 4PXAA 3QNUA 2ZR7A 4Q47A 1W0JD 2GXSA 2ZJOA 1OXUA 2IS1A 3M6AA 1Z2AA 2VP4A 4EPYA 5J5CA 3NXSA 2K5UA 3HWSA 2Z83A 5DGXA 3NDBB 1E9AA 3EZ2A 2OG2A 1R5NA 3I32A 3LH5A 3SZRA 4D26A 1E2QA 1YZNA 3K0CC 1NIPA 2GRJA 1E1QD 1R4AA 4GRAA 1Q3TA 3KKPA 1JI0A 2ZYVX 3PITA 5H68A 2W2XA 1W48A 2NZ8A 3QKUA 1NKSA 5FBVB 4IKEA 1UPTA 4B3XA 2RGEA 4KCGA 2ZANA 5CIQA 4BWYA 4C30A 1O87A 2ECKA 1NNEA 2PLFA 5B30A 5BWMA 3GLFE 2FDCA 2QU8A 3E70C 1LY1A 3FMFA 4RD1A 1FW6A 2BDTA 2ORIA 4BGDA 2W6IA 4HAWA 2XNDA 1FZQA 1HUQA 1VHLA 1P2UA 5LPNA 4F4JA 4B35A 5KTYA 1NG9A 5DE3A 4M2LA 4OHXA 3RYTC 3I62A 1OF1A 2X8AA 4TMTA 4PC2A 1W36D 2GJSA 1VIAA 5FH9A 1KI2A 1S8FA 4A2QA 1JEEA 1Q1ZA 1YR7A 2ZQ5A 3NWJA 1A4RA 2FG5A 2OFOA 2V8OA 2WWWA 4DKXA 3ZQ6A 4CF7A 2IXGA 4DLRA 1IN6A 1GILA 2CK3A 4UNNA 1EESA 1Q1QA 5IRCD 1R5OA 4KU4A 4YMUA 2I4IA 4OI0A 4QBGB 5SZHB 3THXB 1E2MA 1CJTC 2B7BA 4HZIA 2JJ1D 3K1JA 5EJEA 3K0AA 5JWHA 2C96A 3B85A 4A0GA 5DN6A 3SBDA 2IYVA 2W2TA 3T61A 4LYJA 2CNWA 2IYZA 3KB1A 4G01B 4A92A 3KXLA 3RS0A 2DYKA 3BAFA 3K09A 1H8HA 3T1OA 5J4LA 1UBFA 3PEYA 1KI1A 2EWWA 3B60A 1NVXQ 2HXYA 3IHLA 4JBYA 3GFOA 1G8YA 5LB2A 1SGWA 1DG3A 4RZUA 2OT3B 4XVUA 3RVBA 1MABA 3GLGA 2DB3A 2ASEA 3B7GA 2XJ9A 4M53A 4XJXA 3GLIE 2CEAA 1PZNA 1XJ0A 1Y3AA 2OCPA 2VSOA 4HUQA 4Q1CA 5B2ZA 1E32A 2DFKB 4MKHA 3TE6A 3THOA 1LFDB 2KJQA 4JT4A 2Z43A 4OK6A 4DZZA 4BPBA 1JR3D 5BN3A 5H70A 3LNCA 4ZKEA 4JLKA 2FF7A 3AKCA 4ZDJA 2DWOA 3OAAD 4MRPA 4GZLA 3EG5A 5KDLA 4TLDA 1CR1A 4C9BA 1E0SA 1XEWX 3DL0A 4TZ0A 2W2VA 2D7DA 1VKJA 1AIPA 1YRAA 4BLRA 1TQ6A 2BKEA 3VR5A 4F91B 2OAP1 1C1YA 2VPPA 4ON9A 3K8YA 1KY3A 4PZZA 5L8VA 3I72A 1CBUA 2QN6A 1AZTA 1A2KC 2GJAA 3DVLA 2V9PA 1E9CA 3Q72A 1SVKA 1Z06A 2BMEA 2J87A 3DMDA 4LV6A 4MH0R 4GMXA 4KVAA 4C0KA 1XB2A 3CRW1 1NF3A 4WVFA 1ZC3A 1EFTA 1U8AA 1Z6YA 2PMDA 3CNLA 3LD9A 2WJYA 5FPYA 1NKTA 2QA5A 4NYIR 5KO2A 4A0FA 3ZD6A 1G16A 3C8UA 1XDBA 3VTKA 4QRHA 1LS6A 2Q6TA 4FMCB 2D62A 1MO4A 4R2HA 3TR5A 4IOMA 4PHTA 4Q18A 3AVVA 1YR8A 2ZVPX 3IILA 4A0HA 1YZTA 1DBSA 3PUYA 3CBQA 2Q21A 5C4MA 2R8RA 2W6JA 3Q7PA 3QF4B 3U3OA 4OHVA 5EE5B 4CW7A 2ZI7A 4X8OA 1T3HA 2G88A 2C5LA 2H1LA 4CVNA 1V5WA 3AVXA 4XOIA 4B73A 3EPLA 3GLHB 4P4TA 3V4FA 4UNPA 1K5DA 1ESMA 4XTRA 1Q21A 4QBHA 4PPFA 4DIDA 3KL4A 4PSVA 4Q66C 1MH1A 2ODBA 1IY0A 2QAJA 4UNRA 4DDUA 1AKYA 1GNRA 1QVAA 2R6GA 3FGNA 5JI3E 3U3MA 4B32A 3GJ3A 3ADKA 1OV4A 1RKBA 3E2IA 3SHWA 3IQWA 1DG1G 1A7JA 1G3UA 1R2QA 2GESA 2ZE8A 2EFDB 4AY2A 5DH9A 1N6LA 3D8BA 4XWKA 4UJ5A 4WXPA 4IVPA 4JYCA 4OI4A 2XOKA 1GNPA 4P0TA 3K0EA 3QKRA 4OK5A 4MRSA 3QXSA 1IY1A 1HE1C 2XSZA 2VH5R 4JMPA 1ZINA 5C1BA 1BMFD 1CJMA 3H4MA 4LZZA 4QBFA 4B2IA 3IBGA 4HB4A 1Q57A 1XD9A 3ZIAA 2IYQA 1NN5A 1T4GA 2DWPA 4JS0A 2JAQA 4D4LA 1I4DD 3OE7A 2ANCA 4Z54A 4ZCMA 4XVQA 3B13B 3BFXA 2P0EA 1R8QA 5JJKA 3MMPA 4TMZA 3VAAA 3PXGA 2E9SA 5CK4A 3THYB 1N6HA 2VIIA 5B64A 3AF0A 2PT5A 4E5UA 3A8TA 2O8BA 3BK7A 2GHIA 4JLBA 1U90A 4H1VA 3BE4A 5KSYA 3FDIA 1UKYA 1M34E 4RKEA 1W5TA 2XX3A 2H5EA 1OSNA 4MRRA 3I5XA 2ZS9A 3B6EA 1KI7A 4FMBB 1XRJA 3GLGE 5EE9A 1Q3HA 2AKYA 3EPKA 2Q9BA 2WSSA 1Z2CA 4KXFB 4NCKA 4Q9LA 4DLTA 3A36A 1RRCA 1VCIA 3BH6A 5SZJA 3RHFA 4M1YA 1IAQA 2JCSA 3ZVNA 2O8FA 3HU1A 1WXQA 2ZSDA 3D7MA 3U4QB 2PZEA 2OBNA 4M1OA 2WWFA 4HLUC 4A8JB 1TPZA 3EWSA 4PSAA 1N6OA 4CEHA 1VIYA 4DSOA 1U9IA 2H92A 3B9QA 3OF5A 1EFRD 5C2JB 4DLVA 5FR2A 2BC9A 3M0EA 4RJLA 1BO6A 5AK0A 2WIBA 1FP7A 1FOEB 2V6JA 1CJKC 1GIAA 4B2PA 4ZIRA 2GK6A 1KDOA 1OXSC 1J8YF 2V55B 2AL7A 4R7ZA 2IYWA 2OSBA 2QQ0A 2YHSA 3MSXA 4UNQA 4Q01A 4HZUA 3PQCA 2LKDA 1G8PA 1XP8A 3QKTA 2ZREA 4W5WA 4IDNA 1ESNA 2DFLA 3PUWA 3B1YA 4URUR 1US8B 2RB4A 4EDHA 5K8IA 2X1VA 1OFIA 1ZIOA 5TY0A 4B2LA 5AJXA 1XXHA 2Z5FA 2AFHE 1N25A 3BS4A 1IJFA 1XJCA 3OIYA 3NBYC 2AX4A 3CH5A 4L5BA 1CJUC 2FNAA 4N0EA 5JWRA 2F1IA 2DR3A 4TL7A 4KO8A 4TQUS 5G3ZA 3THWB 5ELXA 4XD7A 4DHEA 4BZPA 3L43A 2JIZA 4PPNA 4PX9A 4AWXA 2ZRHA 3ZGXA 3HU2A 2RGNC 1E79A 4LDJA 4BFTA 1UF9A 1Q20A 1XPOA 4JLJA 3GEEA 1EX6A 5G40A 5TVKA 1F48A 2F1RA 4WAUA 5EUQB 2REBA 1JBKA 3QXJA 4DDWA 4JLNA 4LSGA 3OEEA 2YZ2A 4W9MC 3SNHA 1KSHA 1Z6XA 2RAPA 4Q4JA 2IT1A 4Q1FA 3MAAC 1VDZA 4MUAA 1KO4A 1OH6A 4JYBA 2JEOA 2E87A 3I92A 5JHHB 2ZRPA 1HV8A 3PENA 4IFBA 4YDSA 1NVVQ 1ZM2A 3AUXA 3IPXA 2IF2A 4TLAA 1MKYA 1ANKA 1UDXA 3RSLA 3RS5A 4KITB 5HCIA 1ZBDA 1XD8A 2QY9A 2HV8A 2VP6A 3ND8A 4OJKA 4P33A 2NO7A 2ZJAA 2F9MA 1G3IA 2QM8A 1UAAA 2YC2C 4I81A 4IDQA 3KFXA 3PIRA 2BEJA 4IJMA 4B6EA 3CPHA 4CDGA 4KAXA 2GEVA 1CIPA 4A6PA 5HCNA 2ORVA 1DS6A 3HR8A 4PZYA 3OESA 1XMSA 4P31A 2CCKA 4YDHB 3IHWA 4QNRA 4B3BA 1T3LA 5FTNA 2OHFA 4ASUA 5FTMA 1XPRA 3PR1A 4LHZA 3TBKA 4LV5B 2PX0A 1CRQA 3QOFA 2PCLA 4E09A 4UXHA 5TDHA 1CXZA 4I1VA 4B3DA 4AG5A 1XZPA 3CNOA 2JATA 3SN6A 2D7CA 2QUZA 3GJXC 2P5TB 3LO5A 3QG1A 5AJWA 3K0AB 3G82C 2C9YA 3CRRA 4ZDWA 1H65A 2GF9A 1KI6A 2ZROA 4MA4A 3PJRA 1M7BA 1W46A 5BW8A 3CLVA 3A1SA 1IXRC 3VHXA 1QBKC 4JLPA 1DOAA 1VYVA 2FFBA 1SVOA 4NL4H 2ZRCA 4TLCA 3F3YA 4Z8XA 4A9AA 4BLOA 1X8LA 3AVWA 2RGBA 3T5GA 1G17A 1OKKD 3BB3A 4ZI2A 3CF6R 1SXJA 2O8EA 4IOKA 2C9CA 3M1IA 1E9FA 1P9WA 4FCVA 1MABB 4AYXA 3W9YA 1N6NA 1G18A 3BC1A 521PA 3UATA 2RGGA 3PUZA 1E6CA 4BFUA 4A0RA 1DEKA 4BLQA 4JLVA 2QMOA 2QRZA 2RMKA 2B92A 1J90A 5G41A 4M1WA 4E07A 1ZW6A 1G41A 1M74A 2GK7A 2PZGA 2XB2A 1SVMA 3CWZA 1P2VA 2VL7A 4LYHA 3A4NA 3JZMA 3A6PC 1E2JA 1ZNYA 3GFTA 4DLWA 3MD0A 1ZD8A 4I99A 4FN5A 4JKIA 2QPAA 5EZ6B 1W0KD 2OESA 2QAGA 4C0SA 4BRWA 2HCJB 3IDQA 1G7SA 1OXTA 4I1OA 1II8A 4PR0A 4KLZA 2VQSA 5DSZA 4ZDKA 3ZVLA 4BFWA 2ERXA 3WBKA 1Z0DA 3TUZC 2GBLA 1EXMA 1XXHE 2GEDA 3CH4B 1N5KA 4B34A 3W8RA 1SVSA 2QGZA 4PC3A 1W44A 3EPJA 2GETA 1W49A 1NN0A 4LK2A 2ZI3A 3MLEA 3O8DA 4KBGA 2ZIAA 4KSBA 2ZS8A 4V03A 3OEHA 3QPWA 1TF5A 1JXOA 1NRJB 1OIWA 1ZMXA 3U60B 4G5QA 3LWNA 3R8CA 2CL6X 4OQNA 3QSYA 3AKDA 5E95A 3BH7A 1DPFA 4B43A 3UWOA 5JSZB 4Y0AA 1KIMA 2IEYA 1PUJA 4HAZA 2NIPA 5IK2A 5J40A 3ZDQA 1R0ZA 1KO7A 1VHTA 2Q3FA 4GP7A 3G5UA 4TYQA 3SS8A 2HYIC 1S1MA 2WOOA 1Z08A 1NJFA 1KK1A 4U5XA 1F2UA 3FFBA 4KI0A 3P27A 5LD2B 3E5HA 4OJQA 2J41A 5BQ5A 2ODEA 4LJ7A 1E9RA 4CZ2A 3SOPA 1JQLB 5M04A 4IOJA 1DADA 2Z4RA 5BYJA 3U6BA 1WMSA 4QFMA 3AVTA 3H2YA 1C4OA 3I5YA 1KO5A 1J99A 2GNOA 3CF2A 3U7EB 2AR7A 1W5SA 3R9WA 5EXSA 3K9HA 3ZQJA 2V54A 5JS7A 1P5ZB 2BCJQ 2NO1A 3AUYA 4IW3B 4MGKR 5DLQC 3J81k 1HE8B 1HY3A 3CONA 3W6PA 4AIIA 2QQEA 4Q4LA 4NDZA 5G3YA 4DDTA 2WKPA 1RPZA 2IHBA 2Q3MA 4C0BA 1UADA 3EZ9A 4DWJA 2WM9B 1YQTA 2IEZA 5EE1A 2QE7A 1IQPA 1M8PA 3AVQA 4EFMA 3QKRB 1E2GA 3MJRA 1PUIA 4AKGA 621PA 3N70A 4Q5IA 4JLOA 2NO0A 4IRUB 4LJ9A 4V0MA 1WA5A 1EX7A 4JZKA 2N1BA 4LHWA 4TMWA 3W90A 3TLXA 2OCBA 1II0A 3SR0A 3BORA 4NZYA 5EP1A 5KU1A 2VHQA 5TMPA 4DIEA 1Z47A 2REOA 3WYFA 4M21A 1KI9A 4EQ6A 4TL9A 1K5GA 5K8TA 1CKEA 1JQJC 3KQKA 1BIFA 3K9NA 3NH9A 5JRJA 3IEVA 3NIBA 3T1TA 2G83A 4MKIA 3RDPA 3TAHA 1W7AA 3MRSA 2O8BB 3OHMA 2VSFA 2GILA 5CB8A 2CE7A 2REXB 2XTMA 1NL3A 3UANA 1SXJE 1P2TA 3JVUA 3KJEA 1G8GA 1E69A 1UBCA 1AM4D 1PJRA 2WWGA 4UXIA 1N0VC 1KNQA 1OH8A 1AN0A 4TZ6A 1FX0A 4AKHA 4DCVA 2HF8A 4M9SA 3S1AB 3FOZA 2A3RA 2QM7A 2EYUA 3MCAA 3EZ6A 1NY5A 1OT3A 1OH5A 3TUIC 2P5SA 5HKKA 2O0JA 4P4UA 4FMDB 3VFDA 2D2FA 1KI8A 4ACAA 2O8FB 2IYSA 2WKQA 3UMSA 1Q1BA 4EFNA 1CU1A 3TSZA 3WNCA 4KFUA 3NHAA 4TLBA 3KDSE 5E7IA 3LX8A 4CEHB 1WF3A 4F7WA 3MGCA 4W5JA 2JDID 3WP0A 1K8RA 2Z0MA 5CYOA 4G3XA 3DOEA 3AVOA 3FYHA 1YHNA 4B6FA 3I4LA 3TIFA 4ZIRB 1XMVA 4WIAA 3LQRA 2IC5A 1OJLA 1KJYA 3WY9A 1UFQA 2RGDA 4BEJA 3AP3A 4N1AA 5BXQC 4C0HA 4HZUB 5DO9A 5DI3A 3FKQA 2MMCA 5LBIA 1Q44A 2GCNA 3NEJA 1I4TD 5FOSA 5UKDA 1KHTA 1QDEA 1Z6AA 1G8FA 3IIJA 4WZAE 3PUVA 2KWIA 2CLSA 1D2EA 4A82A 2R65A 3QPUA 2GCOA 2CHVA 2YNMA 5JBQA 4AYTA 4QJ3A 1U8ZA 4D0GA 2J46A 2WHXA 1WRBA 4LUCA 3LDAA 1KOFA 3U6KA 1JEDA 2P6RA 4RSGA 1M2OB 1OXVA 2A30A 1OW3B 1VCNA 4ABYA 4AD8A 2OM2A 2QTFA 2XZOA 1J2JA 4M9ZA 1Z07A 3ZZ0A 1FQKA 3SJCA 3JZAA 3KKMA 3LVQE 2IYXA 5CITA 3OFND 3O8RA 5JZVA 1ZM7A 4DLYA 2ZJ2A 1SVIA 4F92B 2VEDA 4Q48A 2BM0A 3D31A 4GNKA 3CPEA 5FOVA 2ERYA 3O8CA 3P4XA 2FZ4A 3B82A 2WPDA 4D0LB 1SKQA 3K9GA 3W6NA 4QHYA 3K70B 4Q4JB 2O8CA 3TW4A 1W2GA 1MOZA 3KJGA 4C7OA 2EFHB 2YWFA 3K9LA 2JLVA 1TL7C 2ZAMA 5AUQA 1KGDA 3VNUA 2FPKA 2A78A 3IIKA 1NN1A 3TH5A 5GVRA 2XGJA 4FWIB 4G5SA 4D4JA 2OUKA 3NG1A 3AF3A 3P4YA 3MWLA 4ITRC 2ATXA 1GAJA 2JJ2A 1T5LA 2OO7A 4V0ME 1UM8A 2W6ID 2GJ9A 2XNDD 3KUDA 2WWXA 3K0CA 4YMSA 1VPLA 1KI4A 1X1RA 2QBYA 3L0PA 4R9UC 4ZCIA 1GL9B 3GMTA 3LBHA 5DISB 1GG2A 1NMXA 1F3OA 2ZRMA 1KMHA 4BLPA 1SVLA 5L3RA 1TF2A 4JLAA 3KKOA 1OYWA 2V1UA 2ZRJA 1ZRHA 5KDOA 1LNZA 4RFSA 1E2DA 4L9WA 3D6TB 2P65A 1G7RA 3O8BA 2QORA 1UDWA 2FE4A 1GTVA 4DCUA 3AVYA 4CEJA 4EPVA 3CR7A 1SZPA 2G0NA 2GKSA 2CK3D 5FBLB 5K8UA 4XWAA 4TQ9A 4Q7KA 4KV9A 1OH7A 4M1TA 3KQLA 1G64A 4UKDA 1TTTA 1J70A 4WZBE 4TT3A 5L3QA 1DELA 4FMCF 2B6HA 3FE2A 4MGZR 1S3SA 4TSFA 5E3HA 6Q21A 1E2NA 1KI6B 3L0OA 4IFEA 1F6BA 5J4VA 5JRZA 1E1RA 1GDDA 3LXXA 1DAKA 1IM2A 1DAHA 4B47A 1UJ2A 2V4ZA 3WBJA 2YYZA 3SC3A 2PBRA 1WCV1 5DN6D 5FOTA 5EQTA 1ZCAA 2O0KA 4C0QC 1HQCA 2CNWD 1SXJB 3V9PA 2O8EB 2NOAA 5FL3A 1ZM4A 3DM9B 1D5CA 2DCUA 3TMKA 3A4LA 1KK0A 1ZCBA 4TMXA 2F3TA 3C4JA 1H8HD 4YMTA 2OCYC 1FL9A 2NO9A 2J7KA 4EJSA 4QKQA 2ZJBA 2HCBA 3QKSA 4YXWA 1DAIA 1M7HA 4NYIQ 4II7A 1N3BA 4EPTA 4YLGA 1L2TA 1J7KA 4IDPA 1XWIA 3QE0A 2ONJA 1CULC 3ND9A 4NCJA 4QNMA 3U3JA 2AWNA 4MYUA 3RS2A 4NYMR 4ESHA 1TU4A 4LJ8A 3WXMA 5FTLA 1ZUHA 3QBVA 2QAGB 4CGZA 4S35A 2PMKA 2FFHA 3WMFA 2RH5A 5KSZA 2QG6A 2W0SA 1OPXA 1TQ2A 2D2EA 2PCJA 4XH9B 3BGWA 3EIEA 2XZLA 2G77B 2FWRA 1Q0UA 2N46A 4KBFA 4Z1MA 3B8HA 4LHYA 1QHHA 1TX4B 4LCBA 3VQTA 1TF7A 1YVDA 1RVDA 4X8LA 5L3SA 2QL6A 4TMVA 1F5NA 3HPRA 3V4RA 3FWYA 4M22A 3L0IB 2ZJ5A 4WOPA 5B58C 3N5CA 2IYTA 3EIQA 4DSTA 3Q5EA 4LJ4A 4Q9IA 3ASZA 4L4UA 2EFCB 3A1TA 1IHUA 1P72A 1ODFA 1XTKA 3SQWA 1E4VA 2VHTA 1G21E 2FOLA 4QGHA 1T91A 4PAMA 1Z6GA 2EU8A 1GSIA 4A6XA 2ODNA 2VO1A 3QBTA 3WHLA 4RCZA 5L3VA 2G6BA 2R6FA 1Z28A 4X8HA 4GOXA 3RC3A 5H8WA 2ZR9A 1B23P 1EFHA 4M4SA 1F2UB 4BFXA 1E2IA 1OE0A 1RFLA 3GLFB 2W6JD 5KYKA 121PA 2XTNA 2IK8A 1UBGA 4DCSA 2ZM5A 4Q1BA 4Q7MB 2XXAA 1FTNA 4QBIA 3LBIA 4HDQB 2WAXA 1P6XA 4TWZA 1HT2E 1NMYA 1E0JA 2PEZA 1N6KA 1ZYUA 1TUEA 2HJGA 2BHRA 1YZGA 4DBLC 1G3QA 4A36A 4M1SA 1VG9B 4MQBA 2QGNA 4NBSA 4AI6A 2VTKA 3RRYA 1JJVA 2J7PA 4GZMA 1GOTA 2BEKA 3HYRA 3I8XA 1GNQA 2X77A 1DO2A 4U7DA 4A15A 3RS7A 4DLSA 3VX4A 3HP1A 1XBTA 3TSWA 3PFIA 1I2MA 1FPMA 1NSTA 4MYHA 2ZE5A 1SVWA 3EC2A 1WP9A 2XOKD 1RE0A 2HJVA 3VKHA 1N6PA 4FINA 1AS0A 2B8WA 2AD1A 5AWFC 3ZYCA 2XSZD 3SJZA 3H84A 3TNFA 5EXTA 3F5FA 2OILA 4PHGA 4EQ6B 5A4JA 4BLTA 1ZAKA 2ZJZA 3ZIAD 4CYMA 5EZ5A 3NHBA 1R0WA 3UG7A 2O8DA 4IDHA 3PUXA 3OE7D 2PJZA 1S96A 1ZUIA 4BZXA 5JEEA 4GP6A 4GSYA 1YRBA 1XF9A 3W8NA 1T8TA 3LW7A 4MYTA 2ZRFA 3LAWA 5CK5A 2EFEB 2ZU0C 1HYQA 1I4LD 2BJWA 3ZLJA 4PO8A 5JEDA 4FWTA 4DDVA 5AJZA 2WWYA 3CNNA 4F38A 1W47A 1Z0KA 1U2RA 1PLKA 3GLIB 2QP3A 8OHMA 5D3QA 5FFMA 4OHZA 1FX0B 3L8ZA 3QJYA 5HE9A 1Z6TA 4PPQA 3BRWD 3SDZA 2ZI9A 3NBXX 1CR2A 4F93B 1T9HA 2WSSD 4NCHA 1ZM3A 5AJYA 3N2EA 4CRWB 2C98A 1XMIA 1JPJA 3A58B 2VF7A 4XSHA 2JLSA 4LRWA 1XPUA 4H1UA 3AGPA 3MWJA 5J4KA 1MRSA 4B76A 1XD2A 2HLDA 3U7HB 1YR9A 2SHKA 1PVOA 3IEUA 3R8FA 3RC8A 2FSFA 1RZ3A 3R7WB 2EVWX 1FP6A 1YR6A 2BOVA 2Q0HA 1EGAA 2PJRA 1EFUA 1FTSA 5AUNB 4L16A 2AXNA 4DCTA 3DDCA 3WMEA 3SFVA 4EPRA 3MJHA 4DB4A 3C41J 4NP6A 4HLQB 4KVGA 5KPDA 1OFHA 1KZ7B 1ZVQA 5DI3B 1UEJA 1YZKA 2C77A 4D4KA 2XITA 2P3SA 3DOFA 5DIFA 4B71A 3KQUA 2OEPA 4LC0A 5ANRB 4GOJA 3RANA 5CM8B 5BN5A 1ZIPA 1G19A 2C2HA 4NKRA 2ZETA 1GRQA 2F3RA 3LLUA 4MDFA 1U98A 2GCOB 4FCWA 3NVAA 3L0SA 1XMJA 2ZRBA 4HLUA 4L9SA 4DT1A 2L0XA 1PV4A 1TADA 3AF2A 4DXAA 1G4AE 3ZZUA 2CL7X 2PL3A 4NCNA 4AURA 5HZKA 3PEUA 2IYRA 4LV8B 5EP3A 1T5IA 4TYWA 2OBLA 2BBOA 4Q9HA 2CXXA 4XVRA 2WJJA 4XD7D 3EXAA 2F55A 2JIZD 4TL6A 2RGXA 2ZRKA 1R10A 1E79D 1S9HA 1IXSB 3L2OB 1Q1EA 3SJAA 4Q02A 2IWHA 5JECA 3QENA 2HEIA 3R9XA 2QT0A 3EZ7A 4DSNA 4DB2A 5FUVA 3TRFA 5JWOA 1XEXA 4QGFA 1CJVC 1KO8A 5FI1B 4N3NA 3OEED 1KDRA 2R44A 2WVJA 4F4IA 2EW1A 3K70D 3KX2A 1QHNA 4L15A 1JALA 4G5GA 4IDOA 4D81A 5KSOA 2QMEA 1F2TA 3F0TA 2ZRNA 2MSCB 3WHKA 4JSTA 2RGNA 5CDFA 1TEXA 3KKNA 4Q7JB 1NN3A 2IS2A 3TAUA 1L4YA 2C99A 1E98A 4CEIA 2FJUA 5F9FA 4G0NA 2QMUA 1IOZA 3FPAA 4G5RA 4GOKA 4XSGA 3QEOA 1RRPA 2QBYB 3WYGA 3EPHA 2MMGA 1FMLA 3ZJYA 2LCFA 1LVGA 3FKSA 4KSCA 5FPKA 2F9LA 2RKOA 2GDJA 1MV5A 3DM5A 3REFA 4LI0A 2ZU6A 2IWRA 3B2EA 2GWHA 4LY6A 2R6DA 2NMVA 2QAGC 1OXXK 4RFSB 5TV2A 4NYJR 5FBWB 4ZI3A 2FZLA 1R0XA 1SULA 4DCNA 3MG9A 4A2PA 4I1UA 4RY2A 1LTQA 4ASUD 4EFLA 5AUOB 5KNDA 4CEJB 1YZUA 4LJ6A 3L82B 4C4PA 1T8UA 4FD2A 1XCPA 1SKYE 2IXFA 3SYKA 4KHZA 1ZJ6A 1TEVA 3GLGB 1TQ4A 5FL7A 5L3QB 3CW2A 3ADBA 2YV5A 3UIEA 3VHLB 2CHGA 3PVSA 3T15A 3IIMA 5AR1A 2IF0A 2CL0X 1NBMA 1NLYA 3AP1A 1BYUA 1AS3A 4HUQB 4X8MA 3AQ4A 2IW3A 1G6HA 2KBEA 1NMZA 3VX3A 1COWA 1XU4A 1E3MA 1FQJA 1SQ5A 2QMHA 2YVUA 1ZNXA 1JAIA 2J0VA 2ANBA 1R8SA 3QEJA 2RGAA 4PAQA 2AFIE 1E2FA 4JBWA 3H0KA 1P7CA 3A37A 3VKGA 2D4HA 1L7VC 1Y63A 3ADCA 1JXMA 4QG7A 2OE2A 4K81B 4Z8YA 1SXJD 4EJSB 1VYTA 4D80A 4E22A 1GL6A 1G3MA 2QZ4A 2YC4C 3CKLA 3QKSB 1N5IA 4PTLA 3W3ZB 3TSOA 3UKDA 5F3WB 1N5LA 2J45A 2DFTA 1U81A 5TXGA 3SFZA 2JGNA 5DNYB 2GF0A 3T1QA 1E94E 1W4BA 5GVSA 4NE2A 1DAFA 3KJIA 1OIXA 1L4UA 4HLDA 4TYNA 5E7MA 2ZSFA 1CR0A 4M1KA 1H8EA 1ETUA 2ATVA 1GKIA 4H9GA 3OZXA 3X1XA 4RD2A 4E03A 2CMKA 2GCPA 1R7RA 1B0UA 2F6RA 4KJZA 3TJZA 2Q9CA 1KMQA 1P4SA 4ILEA 3OIVA 2GA8A 1U94A 1KDTA 2J0QA 2ZTSA 1HURA 1OLOA 3QVUA 3BXZA 2AWOA 2QROA 1KZGB 4GDFA 2NZJA 2FPLA 3D3QA 2V7QA 3HDTA 2KB0A 3P32A 5L3SB 2I1VB 4TL8A 3BBPA 1JR6A 3ZS8A 3W34A 4DLUA 4KYUA 1CR4A 3KTAA 3VR2A 3SBEA 5FUWA 4P4SA 4BFYA 1CS4C 2F1HA 4IHQA 2YWGA 3ZH9B 1A1VA 3UMFA 2PX3A 3GP8A 2DY1A 3CPJB 4G1UC 4GI7A 1N5JA 1C9KA 3OEHD 1WB9A 2BMFA 2GTPA 4DUGA 3U3KA 2ZI5A 4LHVA 4US2R 2X2FA 3L8YA 1UKZA 2J0SA 1NLFA 5IK2D 4C3ZA 2J3EA 1GITA 3DKVA 4GL2A 2BCGY 5AUPB 4A8JC 1AA9A 2QTHA 3GJ6A 3HPQA 4KYIB 1F60A 3GPLA 4URWR 5CDFE 1G1MA 3M4YA 4NU0A 4LHXA 2XXAB 4MRVA 3WYAA 2FPMA 3EX7C 2W0MA 5P21A 4PO9A 4C0JA 5BN4A 1VCOA 1CEEA 2BVNA 1BOFA 1T3SA 4JIMA 1Z8FA 3QVVA 2DPXA 1E9DA 3LBNA 1IN7A 2GXAA 3RABA 4HI0E 1MO6A 1HQYE 1QHIA 4BQSA 1E2LA 2ZI4A 2FA9A 5LDDC 2VP0A 2VBCA 1OB2A 4MRNA 1G20E 1OFUX 1VCMA 3KB2A 2QE7D 3DKPA 4TLEA 5C46F 1JPNA 3ZS9A 4OQFA 1XTQA 1AGPA 2QTVB 4LX0A 2GZHA 4QC2A 1DVRA 1DAEA 1IN5A 2QI9C 5J47A 4MITA 4ARZA 2V3CC 2OZEA 3B1ZA 5F98A 2Z4SA 2O8DB 4B3CA 1E96A 1S1CA 1NBME 2GJ8A 4FXPA 5JJIA 1BS1A 2CCJA 1QZXA 4RD4A 3CZPA 3O47A 4ZCLA 2J0UA 3FTQA 1IXZA 4DC9A 1EFCA 2G9NA 3CM0A 4GT1A 4PSKA 5BYKA 1CRPA 1XX6A 3DHWC 5HE8A 4G5OA 2YWEA 1KO1A 2D06A 2ORWA 1LF0A 3X1WA 4RD0A 4U00A 1KSGA 3TQFA 3CUEF 3W5IA 4M8NE 5DHFA 4V0NA 3EAQA 1BH2A 2WZQA 2ZAOA 2YOFA 4US1R 3SQXA 5HZHA 3PG5A 1XNJA 1XTRA 1I2DA 3AM1A 5EP4A 1LV7A 2JA1A 1D9ZA 1E1QA 1DAMA 2WMOB 5KPJA 1RYHA 1US8A 5HKKD 4JLMA 1AK2A 2XB4A 1XD2B 2FSIA 5E7JA 4B3FX 5C18A 1XXHB 1RIFA 3KKQA 3GEHA 3A4MA 4QJ5A 3CR8A 4RCYA 4LJAA 1Q22A 4M9XA 1ZP6A 2FFAA 3GFPA 1GKYA 1V43A 5IHPA 5FUYA 4M1MA 3IUYA 1U0LA 1XTIA 2HDNB 2QENA 4US0R 5SZIA 4DLXA 4O25A 5CB6A 3K53A 4HAVA 4PC6A 1U0JA 3ECCA 1YZQA 1RJ9A 1G291 2H18A 3DO6A 4BEBA 4TTRA 1E0KA 3TW8B 2F43A 2ZUDA 3GLHE 3PV0A 3QXXA 2FGJA 3U7GA 5JCPA 3P20A 2QPOA 2E1RA 4YQFA 1XTJA 4TQAA 5DYIA 2AK2A 3GJ8A 4DRZA 2WBLC 2HYDA 3KXKA 1VTKA 2FEMA 3TVDA 2GJKA 4DT1B 1GZSA 3FMPB 1BKDR 5CLQA 4QM6A 2XEXA 1E4YA 1W1WA 4LBYA 3AB3A 4I4LA 2QSZA 1KK3A 2O52A 3AH8A 3C5HA 3A1WA 2UZ3A 4R71A 5EXXA 3GCGA 3K0SA 2QEQA 5GJBA 421PA 2C95A 5GADl 2C04A 3SYLA 2QP9X 4M9QA 5GJVC 4B44A 2IUTA 4JL6A 3VU9A 1HH4A 5JCZA 5SZKB 3K09C 4OI2A 1ZU5A 1VECA 1N2CE 2WJIA 1XCMA 1ZD1A 2WWHA 4KODA 1D2MA 2ODWA 1G7TA 3QXHA 3TQCA 2GZAA 3UK6A 2JJ1A 3FHTA 2YKGA 3SU8A 3GJ5A 1MT0A 4D0NA 1S4QA 2H17A 4Q4AA 1U0HC 3UPUA 1JECA 3EC1A 1WQ1R 3H86A 3UMRA 1GM5A 2NPFA 4B74A 1XEXB 1FMJA 2O0HA 1ZC4A 1D8TA 1TQDA 4WW0A 4IEEA 2ZYUX 1SHKA 3W3AA 2WPDD 3HU3A 2CLCX 1IBRA 2Q9AA 3I73A 4MYCA 5JLJA 1FNMA 1P2SA 4POAA 1D9XA 5TB5A 5HPYB 3CRVA 1W4RA 2V6IA 1NLZA 1F2TB 2VHCA 1QF9A 3QIAA 1X86B 4RZ2A 1UEIA 2H57A 4OHYA 2WAYA 1ZM9A 4O0MA 4CEIB 4WA7A 4EJSC 1HT1E 2B8TA 3Q9LA 3H1TA 3X1DA 1NG1A 2YJTD 2C8VA 2QNRA 4ZPXA 5EP2A 4J0QA 2F1JA 2ZI6A 3C16C 1WE2A 1FUKA 2QPTA 1E99A 2JJ2D 2W83A 4Q4HA 4FW9A 1JR3A 3QY0A 4JL8A 1T6NA 1OIVA 1ZNWA 4FCTA 5FTJA 2NO6A 3Q85A 4KFRA 3OAAA 2ZYWX 4N0DA 2A5JA 2Y8EA 1YU9A 4DJTA 4BFZA 2LKCA 3W6OA 2O8CB 3PEVA 4BFVA 1TUIA 3B1VA 1E2HA 1FUUA 4ESVA 4EPWA 3A1VA 4B48A 4D25A 1L8QA 4JSYA 2H7VA 4AC9A 3BH0A 2DHRA 2WOJA 4NYMQ 4Q21A 3VMFA 3KQNA 1G4UR 1CLUA 2GZDA 3U61B 1X8KA 2B21A 5DI9A 4Q1DA 1WBDA 5LD2C 4JVMA 1SHZA 4TT3D 3RSOA 1VG1A 4LBZA 4EAQA 4TSFD 4NHOA 5FTKA 1MRNA 3BB1A 721PA 4PPGA 2JJ8A 1E1RD 1YJ5A 1R6BX 2AXPA 2XZPA 3AF1A 1ZD9A 5AJVB 2IXEA 1J8MF 4LGMA 4WZ6A 3ZZTA 2NPIA 4UJ3A 4RKFA 4RVCA 1II8B 2ZUBA 3RS4A 3ICEA 1FNNA 5D3MA 2OV2A 3G0HA 1GL7A 3RRMA 4V0KA 2VF8A 3B78A 3IQXA 4YMWA 3RAPR 5JMTA 4OK3A 4TYYA 4C2UA 821PA 1GFIA 1G7CA 2QT1A 4IXNA 2B7CA 5E4FA 3Q8XB 3QUSA 1YKSA 2IUUA 4YXWD 2NGRA 2OCAA 3SI7A 4PZLA 5FUXA 1OHHA 3VR1A 1Z22A 3LY5A 4YMVA 1KKMA 4QM7A 1QHSA 4HUTA 2R9VA 2CLDX 3UWKA 1KKLA 3KZ1E 2RCNA 3LX5A 4ZKDA 5JSZA 1IN8A 3EWAA 4LBWA 1G6OA 1M7GA 3LQQA 2IUSA 4F4CA 2WKRA 4PAOA 3K0FA 4BZQA 4CIDA 1G8HA 4C2TA 2ZE7A 3T06B 3KUCA 3IBYA 3AEZA 1MO3A 4Z1MD 2WJVA 4Y0VA 5CLLA 3NKVA 1K6MA 2HT1A 1Z5ZA 3ASYA 3QF7A 4BRUA 3FHCB 3KTAB 1RRGA 1BMFA 4Q7LA 1XZQA 4LYFA 2P6NA 2ZITA 1EWQA 4P4SB 3C7KA 3X1YA 5HTKA 4U02A 2FX3A 2JLYA 2H8KA 1JB1A 2OLKA 4HYYA 3RNLA 1P73A 2A5YB 3AF4A 2R6AA 4AK9A 1OHHD 2JLQA 1P3JA 2AN9A 1A5TA 2BWJA 4KFTA 3RS3A 1X8JA 2ZRAA 4EPXA 1S2MA 2C9OA 5KHOC 5JJLA 3C14C 1T0JB 2GAAA 5CYPA 2FMXA 1KAGA 1N0WA 2NG1A 1YZLA 2P6UA 5A5GA 4P3YA 2P2LA 3U44A 1TNDA 3AV0B 1OFTA 1P9RA 4LBVA 2F7SA 4QL3A 1CP2A 3CX7A 4DEYA 2WJHA 2JLZA 4A2WA 1U9IC 2KI5A 3VNVA 2R2AA 3B1XA 4HB0A 5EUMA 1GRNA 4NTZA 4Q1EA 1XEWY 1ZUNB 3CRQA 4HATA 1DO0A 3DPUA 1XTSA 5KOYA 3MWKA 4OQXA 4R2IA 2GVZC 4EUNA 4D4MA 2VHUA 3RRNA 1GP2A 3TR0A 2ZRGA 2IA5A 5FPSA 1JR3E 2BBWA 2IL1A 2R6CA 2ZS7A 3NH6A 2BV3A 5C4GB 5CJ2A 2IYYA 1W4AA 4JJKA 1EG7A 2P67A 3JVVA 4P32A 3CWQA 3HYTA 4XWOA 2X2EA 4JJZA 1YE8A 3GEIA 2J7PD 1U99A 4O2RA 1EFRA 1IY2A 1X1SA 2CJWA 2QP4A 3WMGA 4ZDIA 1E2KA 1GUAA 1TMKA 4JT2A 3TKLA 2CE2X 4EKDA 1NP6A 2FH5B 4PFSA 1AKEA 1KSFX 1Z3IX 4QOSA 4ARZB 1KTVA 3U7FB 3BB4A 2PT7A 3S1AA 2NTYC 1LB1B 3WP1B 5IF9A 1KI3A 2GEUA 2HUPA 3IPYA 5LB4A 4A1FA 3ETLA 1RYFA 4B75A 3E1SA 4C0AC 1E9EA 2BMDA 4K46A 3RRZA 2J1LA 1AQYA 2J0UB 4BECA 1OB5A 4HB2A 2XNSA 3MFYA 4RD6A 4TTPA 4V0OA 5FBQB 4AKEA 2BM1A 3PCRB 2KSQA 2V1XA 4URYR 3K70C 2XJ4A 4PQFA 4JBXA 2FU5C 1RRFA 5KUTA 2FFQA 2ZXUA 2D3WA 1JJ7A 2J59A 1KJWA 4DLZA 2O5VA 1HTWA 1X6VA 3RLFA 3KFVA 2A5DA 2IS6A 2CCGA 2FGKA 1OYYA 1EK0A 3LW8A 3EZFA 3NBZC 1Q12A 2VSXA 3FMOB 3ADDA 4Z51A 1QRAA 1WBBA 1MR3F 3FHOA 4BUJA 3BJIC 2HF9A 1E9SA 4TTQA 2I1QA 3IGFA 5EE3A 5TARA 5IT5A 1ZNZA 1W4CA 3BFKA 3AP2A 4BE7B 3CX8A 1E9BA 3GJ4A 5F9HA 2VHJA 2VRWA 1WDTA 1UKVY 2KBFA 3B5JA 2FEOA 2ZRLA 4JVLA 1R0YA 4MKFA 2AD5A 4OQLA 4ERNA 4HAXA 4DSUA 1P62B 2JASA 2DBYA 2ZUCA 1G5PA 3BERA 1KDPA 2CVHA 1M6NA 2Q3HA 1ONBA 2HLDD 3T34A 5KDDA 4PC7A 1DARA 3AVUA 4NMMA 1IJEA 1G5TA 3CB4A 3QI2A 3EA5A 5DHAA 3KQHA 4Q1AA 2ONKA 3RWOA 1RJ9B 4Q00A 2G0TA 1AZSC 4KLNA 4MGIR 3RWMB 3V00A 2F43B 3NTUA 3WNDA 1E2PA 1AJEA 3GD7A 4OHWA 4YONB 1NJGA 3B9PA 2OFWA 3AGQA 1W36B 1KAOA 4NCIA 5GJWC 5IDVA 3CF0A 2ZSAA 1Z0JA 2WSMA 4Q19A 1MO5A 2ZR0A 1NVUQ 4AG6A 3I3SR 3HJNA 1O3YA 3AKEA 4NPHA 3TUJC 3A1UA 4GMDA 2JLXA 1QVRA 4C7OB 4L8GA 2OFXA 2OXRA 2VA8A 5HR5A 4HAYA 5FOUA 2EFGA 3VU9B 2DFNA 2HT6A 3C5CA 4LJ5A 4MKGA 5DYGA 5FPHA 2MSDB 1SXJC 3FB4A 1BYIA 4LOAA 4M0LA 4R98A 3MUFA 2KE5A 2IS4A
chains in the Genus database with same CATH superfamily
5JYBA 1U3VA 2ZYDA 3AONB 3ONWA 2IHYA 5C1IA 2ZPTX 4UZEA 1OASA 3BGDA 1CY6A 3OFJA 4K7JA 1WU8A 4YROA 4D82A 4FGKA 1K0UA 3ZHOA 4MGYR 4FGSA 3ZOKA 1ST3A 2NXWA 3UUGA 3UXEA 5JDCA 1RU3A 1FBTA 2FWAA 3KSAC 4LHEA 1CY8A 3IT2A 1HKUA 4NJOA 2HXSA 4JVSB 3WGZA 5C32A 1DCFA 2CLFB 1G8KA 3QG5A 1BQEA 2WJGA 3JPWA 4XUDA 2JHFA 3S1SA 2EW2A 3PNPA 1KMHB 2P9CA 1FXWF 2LWIA 3RJTA 4DCOA 3FLAA 3QUCA 1S2IA 2ID4A 3KEMA 4YRFA 3ZLTA 4BIMA 3KJNA 1FUYB 3WK6A 1Y7PA 4ZGWA 3BOSA 4CN9A 3BIXA 4FQ7A 1E7MA 4X5OA 3H2KA 1RAHA 1E6MA 1TTHA 2AR9A 2XAUA 2OVBA 3L1IA 3NOQA 2Y0BA 3GVXA 5KSPA 1M1YA 1C0PA 3VNBA 1HA3A 1PYGA 5AHKA 3KHSA 3KEQA 3I64A 4FDLA 4FI3C 1OJ7A 1L5NA 3UGJA 1K8XB 3MB8A 4LRQA 1MX9A 4IOLA 1RYDA 5CIWA 1DL5A 5HG0A 3T5CA 4AJKA 4UAVA 1BFUA 3GB9A 1SXQA 3WBFA 2TMKA 3Q8WA 2JLRA 3SSOA 2NP6A 2K4MA 2YV1A 3SYRA 2Z1NA 3KWLA 1AE1A 5AM5A 3BJRA 5ELMA 2W00A 1EFPA 1DUVG 4O3MA 2HO4A 3G2LA 2WSBA 2OQVA 2J48A 3P26A 4TYPA 4MHTA 2YCBA 4ZMSA 4EJ2A 3PNBA 2J9RA 4Q3AA 2N9UA 5CFMA 5JYEA 5KNDD 2WIAA 1UKEA 4S1VA 3GDHA 1OZ0A 1ZU4A 2EWMA 4JBGA 1J6UA 4DTIA 3V4ZA 1QH1A 4AB1A 4MQLA 2ZGVA 5HIIA 5FJJA 1VIDA 1YDHA 2OSVA 4UBLA 1GYRA 2JLAA 3ICQB 1S3IA 1J09A 5F2EA 1ZJ5A 2HU2A 3WBBA 1RC0A 3H05A 5KJ6A 4RHUA 1UZLA 4PHHA 4Y0NA 1D4FA 3G79A 5EWMA 4U8GA 5KWEA 1YHYA 4S04A 4M8KA 1VL8A 1XEFA 3CE9A 3B1WA 1F17A 3MD9A 3BIFA 3PQ5A 4FHEA 3UK1A 4RADA 1SKBA 1CUJA 1TZMA 2FQXA 2ECPA 1ZK1A 3L7OA 2PH7A 4U2GA 3MT0A 3NEPX 1F2DA 1SEVA 3W4IA 3KZNA 4C01A 1B6RA 4GD3Q 4AYWA 4P3KA 4IXMA 4Z6KA 4URVR 5FEMA 3DLTA 3OY2A 1W88A 2FYTA 2AUTA 2XVMA 4LN1A 5FPQA 5EFZA 5BPFA 5JO0A 4MJXA 5L95A 4YRLA 3V1MA 1TK2A 1C30B 1XJWA 2B82A 2DWQA 2NTEA 4LY9A 2FG6C 1Z82A 3G68A 4OU5A 4NCBA 3RAGA 2ZSBA 2Y05A 4KRXA 4EY7A 3JQ8A 3PF8A 4GR5A 3KOMA 2VJYA 4R5MA 2P2ZA 5GZ3A 1QHGA 4G1BA 1YE3A 2P9JA 3TVTA 4ZVUA 2WUGA 1EDEA 4A4DA 4LF5B 1ISGA 4F85A 4Y6PA 3U37A 4LWZA 2RD2A 4YAJA 3MGGA 3CEAA 3W2FA 3AK4A 4FX2A 3PE4A 4LC1A 1TGVA 2G1JA 2CY0A 3U0BA 3DZDA 4WL0A 3DLHA 4YECA 3IQGX 5U9CA 1IJKA 3TIVA 1EQUA 2PVSA 1V9CA 2XDWA 3PE3A 3DQPA 3ZWBA 3A7DA 2ZVQX 4QQNA 2YWRA 4H6VA 2CVFA 3OD5A 3M5CA 3BHMA 4E5PA 1WIWA 5IN4A 2VP2A 3M4ZA 4UQOA 3C43A 3LUHA 3OIUA 3WNBA 4LNUA 3RSFA 4CQNA 3EGDA 3T1VA 4CGYA 3S3TA 4DR3B 1ZICA 1J5PA 3PL5A 5SY4A 2WR8A 1E3WB 1NY6A 3FVQA 1PX2A 2B99A 2O3UA 3DTTA 3I9JA 4P4LA 4JJGA 4PNHA 5H80A 2UKDA 1DJPA 1UXHA 3QV1A 5I47A 1EX1A 1KY2A 4F6CA 1G3RA 1SURA 2DUUA 2VAPA 2DPYA 4O2LA 5CM9C 3RD5A 3FG9A 1M8KA 1QKKA 1U3UA 1XZKA 5IW8A 4LWPA 4XIGS 5JSHA 2F3UA 1G5RA 2P90A 3U26A 4RZ3A 4DQXA 1RW4A 4MWZA 1JHDA 3INGA 1KH2A 4DUGD 1WSAA 1DTSA 3RU9A 3IMFA 2WICA 1ZN7A 1ULZA 4F2HA 1HDOA 1PZFA 3MBKA 5KX5B 2A9OA 1JSXA 2H63A 1GQYA 1B43A 2N75A 4JOSA 3JQQA 1XYGA 2CBZA 3QVGA 3R5TA 4F84A 3THYA 1QF7A 1IOVA 5K2MA 3U5TA 3ZV3A 4MB2A 2QMZA 4O4IB 2NV6A 4OMUA 1I1NA 4XDHA 4OQYA 5HCUA 3SEAA 3ZVMA 1UQTA 3FDFA 3LVFO 1E62A 1EWRA 3MF4A 3H4TA 4QICA 4AX4A 5E1OA 5CDTA 1XL0A 3N2GB 3JCZA 4ZV4A 3PBKA 4NPAA 4V38A 3FOEC 4GKJB 1M1YE 1VL2A 2HRBA 2J5XA 1XAHA 1X7DA 2H1RA 1PSZA 3FYUC 3IPLA 1P91A 2WSIA 4IBOA 4ALNA 1QO7A 3QPVA 3LHDA 3GAMA 1W1IA 3O5AA 2I2FA 4H2DA 3LA6A 4J3NA 3VTFA 4BMNA 1Z26A 3EA0A 1RLIA 4R0NA 4KR0A 2PEYA 4XX0B 1QG4A 3K6RA 5H3CA 221PA 4NHEA 3U3RA 3KT8A 3HB0A 4BP8A 1UK6A 3OIGA 3U80A 1U3DA 1L4HA 4DQUA 2JDIA 2WTUA 2EAUA 3LPMA 5M29A 1JRLA 4L51A 1KQNA 2CJWB 3UAOA 1XLTA 2AHOA 1X2BA 3DBHB 3JYNA 3FDXA 3IO3A 2OY0A 4JA2A 4LXIA 3MWYW 1ZD4A 5DRTA 1QNFA 1T3ZA 5H1YA 3A11A 1AO0A 1LV8A 2VDJA 4FHDA 5F2NA 2GASA 3LL7A 1W85A 1Z0AA 3O38A 4O2AA 4GBMA 4QJ4A 4W99A 4OQMA 4DV3B 5ECWA 3KVNA 1VZ2A 3BFVA 4XE5A 2JFOA 3DMGA 1XZEA 1Y7LA 4WINA 1A2BA 2O57A 2OQ2A 3H8WA 1HEIA 3TLGB 3ZDZB 1I6LA 5DCWA 5JY1A 4URXR 4BV3A 1DKPA 3GPDG 1W36C 1FLAA 4IVQA 4YX9A 1KS2A 5AKJA 3AKYA 1G8JA 3BWDD 2EV9A 4YJ3A 2GR9A 4HSEA 4UEKA 5ALLA 2CJYA 5TQ0A 2ZRQA 1FP1D 3HB7A 4HQLA 1JEYA 1PS0A 3P9KA 2HHCA 1TLFA 2P62A 4OLHA 4ZQCB 4B4VA 1JQBA 3LCVB 2BMJA 1EM6A 5LYJA 2VPXA 3M5WA 4FBMA 4LFCB 2O3TA 3R7WA 3ASUA 1C3OA 2OXCA 4IEIA 2AG0A 5E2IA 3S68A 1G66A 3JWJA 3WK5A 4QHSA 4TUYB 3OFNA 1VG8A 4Y1RB 2JAXA 3LBYA 4GSLA 1JDBC 1QOZA 4Q47A 4PNPA 2IDMA 4U2FA 4X65B 3FPHA 1NT4A 2GXSA 1I2CA 2R8YA 5K4GA 2Q8QA 3NHLA 3OPYB 4QJIA 3C4QA 3HJBA 2QZSA 3I2FA 2IS1A 2R0QC 5DASA 1GJRA 3SPXA 1F7VA 4OJMX 3OLYA 5J5CA 2K5UA 3HWSA 3A3KA 2ZDHA 3IR5A 1VLZA 2I9PA 5DGXA 4ENPA 3NDBB 2OG2A 3I32A 3S40A 5LQRA 4IIYA 5DK6A 3W7BA 2QD1A 2PQ6A 4ZO7A 1H42A 5AESA 4CR7A 3D4BA 1YNOA 3JX9A 1PGPA 1Q3TA 2AF3C 4KXXA 3Q88A 2W2XA 5H68A 3HUFA 2LW7A 4DA6A 1NKSA 3PI6A 5FBVB 1Q7GA 1V7ZA 2FKAA 3HDJA 1WWKA 3PPYA 1S7CA 1NVAA 2VR1A 1L4LA 4RETA 1PQYA 4C43A 3UFXA 1CJBA 4P8RA 5LP6B 1GU7A 1NNEA 3LG2A 4JDUA 4FKZA 5I7SA 5BWMA 2O5CA 2BFEA 4KRGA 4D9NA 1RJFA 3S5UA 2PMCA 3IV6A 3S28A 3OQVA 2RHOA 3WQQA 1HT0A 2OBYA 3RJZA 1QFZA 4B35A 4E12A 3ICCA 5DE3A 1E3IA 1UJCA 1V3VA 4D8VA 1V4BA 2X8AA 1BWRA 4GC9A 4AJOA 3B1JA 5HUJA 1VIAA 1I51A 1IB0A 4DLBA 3EG9B 1I0IA 3FGOA 5IYZB 1YIAA 2EX0A 4RACA 3EGXB 3LPLA 1U5CA 1QIGA 1YR7A 3DTVB 1FPQA 3FJOA 3GXOA 3NWJA 4TTJA 1A4RA 2OGUA 1A27A 2GBGA 2DSNA 4DKXA 5CGQB 1O95D 3ZQ6A 2PHZA 4U7TB 4RGYA 4L6CA 1EESA 1Z33A 2HMTA 4QBKA 1FFWA 1NRWA 3E0XA 2NU6A 5DP2A 1D4ZA 5IRCD 10MHA 1R5OA 4KU4A 2OB2A 1EP3B 3VOSA 2I4IA 1W5EA 2PQ2A 1RPAA 3G5LA 1KAMA 2BMVA 4H1WA 2L18A 3FM9A 4TWAA 4U1RA 4QG3A 5ICGA 5K4HA 4OA5A 3EC7A 4G8JA 3ZEAA 3PGXA 1B93A 2PJUA 2EG9A 1PR3A 2C96A 3B85A 2QTLA 3NATA 5DN6A 4PO3X 4A0GA 5CG2A 3EVGA 2H0AA 5IHXA 2DPMA 3TAXA 1RQNA 2GAFA 1XVVA 1Z9BA 2HIGA 2IYZA 1NQ5A 5DBIA 3W3AD 5D1NA 4AW9A 5EG5A 4L2IA 4I5FA 1HDCA 1IK4A 1V5GA 3FJYA 3BAFA 3ZHRA 1H8HA 3M83A 1Q92A 2XYVA 4XDYA 4C78A 4XARA 4YV2A 1NVXQ 2J3MA 1YBFA 5JPIA 1HZZA 2ATEA 3IHLA 3QPDA 3D3WA 3QUBA 4HDNB 1M1YB 3Q3VA 1SGWA 2PSHA 4I9GA 2OT3B 4RZUA 2IJGX 5CT4A 3RVBA 2DB3A 4YT4A 2KYRA 4GOND 1IMOA 1X70A 1KZ4A 1Y8CA 3B7GA 1H22A 3B9BA 3LUDA 5EMNA 4D4GA 4O5AA 3WGGA 1PZNA 2VSOA 1K8QA 5KYVA 1JWBB 2FPOA 2DFKB 4FUTA 1LFDB 2KJQA 1AN9A 3MJFA 4RIGA 1YKGA 4YAOA 5GAJA 2O8VA 5FA6A 4DZZA 3B89A 2VHYA 3LNCA 2LV8A 4JLKA 2C2XA 4ZAXA 1EFPB 4H4CA 2XT9A 3ET4A 2JL1A 3OAAD 4MRPA 1CY7A 4XI9A 4TLDA 1CR1A 5KDLA 4BNGA 5SICE 3DL0A 4TZ0A 3IP8A 3AKZA 2M6SA 3KSRA 1P2GA 2HA0A 3H83A 5KBYA 5C3MA 2D7DA 5JFOA 2J5KA 2Q4TA 3RT7A 4C3UA 5FORA 2ONZA 4HXGA 3RT1A 1S2GA 4EI8A 1YL5A 1RAIA 4IUBS 4EUEA 4PZZA 1X39A 1QYXA 2FDXA 3R7FA 1QH1B 3OCVA 4ZGBA 4YPVA 1N2XA 3FDZA 3PJDA 2FWIA 3BFPA 4LV6A 2QLBA 1MJ5A 3DMDA 1QZTA 3EIXA 4TRMA 4Z7OB 1WVIA 2AN4A 3OQBA 2OPBA 3BTUA 4ZOEA 4IINA 1NF3A 3L7MA 1ZC3A 4HPJB 1RJEA 1AKTA 3E35A 3GFSA 1U8AA 3NHRA 1Z6YA 5EKSA 3I1YA 1TJYA 2WUWE 2WJYA 2EZ9A 1NKTA 2ERCA 2QA5A 2O4UX 2Q62A 5JJBA 5KO2A 3ZD6A 1G16A 2HD4A 3C8UA 1XDBA 3PD1A 2ONCA 4FMCB 1NQTA 3L05A 4WY2A 4KXQA 1MO4A 4R2HA 4MI3A 3TR5A 1QTIA 4PHTA 2NVWA 4Q18A 1YR8A 5ALWA 2A8YA 4OFXA 4A0HA 1AHNA 3DMPA 1A71A 3IV9A 2V7EA 1W88B 3LUPA 3Q11A 3CBQA 4HMPA 4HDMA 5K0LA 1R3DA 4FFBA 3DAHA 3DKRA 3H2GA 4ZRNA 3SYMA 2Q1XA 2I91A 4OHVA 1I3MA 1E3JA 3AU8A 3T3GA 1T3HA 4DBVO 3ZI4A 2QTZA 4KGXA 2DUNA 3JQ8B 4CVNA 1PF7E 4B4WA 1U80A 2P5UA 3AVXA 3F4KA 3HABA 3HA5A 4P4TA 3G8YA 1G2OA 2RI0A 1IY9A 4URHA 1K5DA 1G5FA 4ZAVA 3ITDA 5ALUA 3WOVA 4OUDA 5G2OA 2ENWA 3NNNA 2UZ1A 4QBHA 4PPFA 4GPBA 1SUWA 4X71A 3KL4A 3ECSA 1EWVA 2ODBA 3NPMA 4Y3UA 5ALVA 3WQHA 2QAJA 4HSGA 3F5MA 1RADA 3GNTA 3OWOA 3UV6A 4DDUA 1B2LA 1QVAA 5JI3E 3K5IA 1M2JA 3U3MA 4B32A 3GJ3A 3JQEA 3V80A 5A4IS 1RKBA 3E2IA 4P34A 1DG1G 1G3UA 5DM2A 1RTTA 2GESA 3WLSA 1E5LA 2ZE8A 2A0WA 2OPHA 2EFDB 4ZCTA 3FTPA 1GTMA 4IRMA 4AG3A 4XWKA 3T0GA 4LNUB 3HMQA 4Z2YA 3EGDB 3KT0A 4J90A 2UYHA 1GNPA 4IICA 4OK5A 1LUAA 3SK0A 1HE1C 4HGOA 2XSZA 1QFJA 2BI8A 3K9QO 2QXTA 3H4MA 4W63A 4QBFA 3V1LA 3WLTA 3IBGA 3A9SA 5CEEA 1EVKA 2JFPA 4YTEA 4KX5A 4TXLA 4Y2QA 5ALNA 3PJGA 2Z6AA 1T4GA 4FZ3A 4I50A 2P9EA 3RUEA 5K3AA 1WD7A 3GMIA 4JUCA 1YMUA 4OCZA 4ZK6A 2FB9A 5ALIA 4BMCA 5C1PA 4J6FA 1CUEA 2NVBA 3VPGA 2P0EA 1KVSA 1MJNA 3A1EA 3AIOA 1RM3A 1JR2A 2GM5A 3QVGB 4FOOA 1CZKA 5CK4A 1GT91 1P0MA 3DZGA 3VVBA 4BBPA 3THYB 3AF0A 3I0ZA 2QZZA 4G26A 4N49A 4G85A 3A8TA 4E5UA 2ZAYA 4F6RA 5M2QA 4KRFA 3DCIA 2O8BA 4IIHA 1Y33E 5DGIA 1U90A 3LLSA 4MW1A 1S5PA 1V45E 2LE0A 5LQJA 4N3GA 2QLMA 3VAYA 1BXGB 2GZ3A 3FDIA 3LRTA 1SOUA 2H5EA 1V8OA 3I5XA 5HOEA 3IKTA 2P1DA 2ZS9A 2FEKA 1Y0BA 3GH1A 4J0FA 1D2AA 4PU0A 4D46A 3BRWA 4PG5A 2HWYA 3LVBA 1OWPA 4GLFA 5KZMB 2BF7A 2Q6IA 2Q9BA 4BNKA 4IJVA 4IO1A 3VMMA 1C80A 4DLTA 3KKKA 3A36A 5A6SA 1HO3A 5K0FA 1VCIA 3E58A 2PKYX 1WXGA 4B46A 3OPXA 1UP7A 3UMVA 1W73A 3ZVNA 1RRMA 4JYPA 3HYSA 2ZSDA 2UZ4A 2OGSA 4J1TC 4PFJA 5HQTA 2IOYA 3UY4A 1SC4A 1XDZA 2HADA 4HLUC 5KNDH 1JJAA 1T3GA 5ABPA 4CEHA 1TM4E 5AOAA 4DSOA 3IIEA 1T35A 4IDGA 4E4TA 1EFRD 3W5UA 2WA1A 1TC2A 1L7QA 4WKPA 2BC9A 1RQ7A 2BGKA 4K6FA 4O2AB 1JHMA 4RJLA 5FR2A 5KAPA 2L42A 1FP7A 3NHYA 2GK6A 1OXSC 2CXTA 3PZRA 2HIMA 2P35A 2CUNA 2OGTA 2YASA 5FA8A 1JPUA 2Y1WA 1L8AA 3MSCA 3LY8A 4HZUA 4AROA 3C6BA 5K0SA 5AKGA 1C9YA 2ZREA 2BUBA 5EA2A 1ESNA 2GZMA 1QANA 1RSZA 2OD7A 4URUR 5IKXA 3FAKA 4YJ3B 3TDKA 2X1VA 1RWWA 5TQ0B 2DHCA 1UBMS 4FONA 4GF5A 2ENUA 2B61A 5LYJB 2I34A 4LDPA 3TPZA 1IJFA 2B78A 2J3DA 3NBYC 4N0EA 3CH5A 3K8OE 1C3OB 1T5OA 2F1IA 5EHZA 5DULA 5G3ZA 5AP9A 4XD7A 4R2WA 3L43A 4KQMA 1QVWA 1K3UB 4BWFB 4RHCA 3HU2A 2RGNC 4YRZA 4BFTA 1K27A 3HA2A 1UOPA 4DLAA 2DG2A 2V5UA 1UF9A 3B6MA 4RW0A 1T43A 5JALA 2FR8A 3I6IA 4JLJA 3GEEA 5FXMA 3OIFA 1QTNA 3LCMA 1PCXA 5G40A 2F1RA 3PX2A 1ULSA 1Q0PA 1ZESA 1DT3A 3B38A 4Z9FA 3T4PA 4BTEA 4C4TA 3H1BA 3VO8A 5EJ8A 3QXJA 2VTEA 4QSHA 3T3DA 3N6VA 3EGWA 5BSEA 5L4NA 3KNZA 2AGVA 4HEQA 4MWDA 2YZ2A 4FYXA 3WOHA 5E3IA 4BAGA 2WW8A 2JH9A 3TTWA 3ZTYA 4F72A 4WACA 1KSHA 3C6QA 3OTWA 3PIDA 4Q4JA 1U31A 2JIMA 4I1IA 3GVHA 4TWIA 4UHHA 2JEOA 3KSBC 4ZI7A 2GF2A 4RZIA 4CN8A 5JHHB 3ON5A 3PENA 4ISCA 4KO4S 1NVVQ 4IIGA 3IPXA 4QDZA 2IF2A 3R7BA 3UFXB 3SHQA 4TLAA 5BV8A 2DBQA 4MS4A 2O2IA 4H7PA 1IHDA 4F9FA 2P4SA 3CVXA 3RS5A 4B3IA 2BFEB 1I36A 1ZBDA 4J7UA 4E5KA 5HF8A 5HW0A 1LFAA 3R40A 5T5QA 1R6DA 3OQ6A 1K97A 5HS4A 4N6GA 1HDXA 2EZTA 3DOCA 3ML1A 4S2UA 1NUHA 2I2DA 2X7JA 2VK4A 2XDYA 4IDQA 4QPCA 3PX7A 5C9ZA 4J49A 1H2XA 4B6EA 1FS4A 1NRXA 2LUOA 2MCFA 3EE6A 1SN7A 3GDOA 3MHPA 2GS9A 1XR3A 4KAXA 1PKXA 4D45A 1LVUA 3PPVA 5FDFA 5AW8A 3CVVA 2FX2A 2ORVA 1UKBA 1M66A 2FTKE 1YJ8A 2GSWA 2ZKLA 1V1RA 2F2TA 2I7DA 4O08A 4P58A 3PNMA 3CR3C 3MWFA 3N76A 4I9HA 4NE9A 4UBJA 4YDHB 3JSAA 5HF5A 1NOJA 3IHWA 4QNRA 3UYLA 4B3BA 2DEUA 2QUJA 2GT1A 2QWXA 3C8ZA 3PR1A 3NUQA 1P8AA 4ND5A 1DC5A 5HQJA 2VCYA 5EHQA 1CRQA 2NU6B 2NZVG 4FQ5A 5CVTA 1VFNA 2R4QA 3QOFA 3HUTA 1IRIA 4FFSA 2BLNA 2XODA 1EYZA 2CXRA 1CUBA 1YWGO 3EMDA 4I6GA 1R18A 1NVGA 3AHFA 5EC8A 3IMGA 2ZYSA 3LQ2A 3NHJA 2P8JA 3QH4A 1A3CA 2EJWA 3SN6A 4E5VA 1P9OA 1YC2A 2QUZA 1NR5A 1VJDA 2H1CA 3MVEA 3RIMA 3VH2A 3HVUA 4CNBA 3GC6A 1XMQB 1CR6A 1OAAA 3CRRA 2QRHA 1KI6A 2GSDA 2ZROA 3SXJA 1NXQA 1J00A 1M7BA 3EFOA 4RK7A 4UZSA 3D1LA 5ERXA 4K0KB 3ZEIA 1T5SA 1QMGA 1OX5A 4JLPA 3L7NA 1Q0RA 1VYVA 3DB2A 4I9FA 4BLOA 3VSAA 3F3YA 2PU5A 4L2IB 3CVOA 5J2TA 1PT5A 3QTTA 5DRYA 4WASA 5AW5A 1PFUA 4GYYA 4J0HA 4HX2A 1OKKD 1MQSA 1Y4ZA 5K51A 2O8EA 2YFHA 4RHXA 2BRUA 2C9CA 4L3OA 4XYMA 3EUFA 3D3WB 1P9LA 1JS1X 1NZDA 1Q7RA 1ZG3A 3FSGA 5DWQA 3UAWA 2N3ZA 4MR7A 4ALMA 5C7YA 3MPUA 5KVAA 1Z15A 1VPDA 3OF2A 3JZFA 4IIUA 3II6X 1R6VA 3CKMA 1H3EA 1SB8A 1AXGA 5DM4A 1E6CA 4KTTE 5IJXA 4BFUA 1KWKA 1KBQA 5G41A 4M1WA 4NCXA 4LGCA 1B6GA 4H3KB 2QX8A 2JFYA 3D54D 3OPVA 2QRVA 5TIIA 1P2VA 1KEPA 1Z0ZA 2VL7A 4LYHA 3V9AA 4EUKA 3G5TA 1NDHA 3KKZA 2WMDA 3WVNA 2OESA 4JJ8A 1LQUA 4C0SA 4ZZ0A 1MXHA 5CBPA 2HCJB 3IDQA 2WUVA 4J4HA 1AZWA 4MYDA 4YYZA 4RWEA 2O5RA 3NAQA 4JFRA 1N4AA 1B3BA 1PS9A 1U8XX 2P1RA 2ERXA 2R751 4QOJA 3R24A 3HJUA 3HBMA 4ARVA 2J3QA 3AHEA 3RYIA 2Z9CA 2ZFUA 1N5KA 1X80A 4Y7CA 2FE1A 4B34A 5JSUA 3W8RA 1SVSA 1W44A 3FDZB 1W49A 2BUCA 2POCA 3E3LA 4HWPA 4U0JA 1UT5A 3PFWO 8ADHA 1QKIA 2OHVA 2OYRA 4C07A 4LK2A 2ZI3A 3MLEA 1X1CA 4LS3A 1KFEB 3IJ5A 4PCAA 1X7HA 3OEHA 5E0OA 3BWCA 5D7BA 2QD5A 2NT3A 3HE3A 4WZAA 3RCBA 5ALKA 5KX5F 1L4NA 1U7WA 4MGHA 3R8CA 4KFCA 2CL6X 1XAIA 4PF1A 1H05A 2XVYA 3W5CA 2AJ8A 2G5GX 2IZZA 3TFOA 2C2GA 2PO5A 2F1KA 4L8FA 4PFQA 5E95A 3VKUA 4B43A 4D9MA 4DZRA 3RT9A 5I9TA 3VDRA 5JSZB 1KIMA 1RABA 2B2CA 3PHIA 1PUJA 2Z98A 4JC5A 2Q9UA 3DG9A 1Y89A 4HDMB 1R0ZA 4FFBB 1KO7A 4X6UA 1EE9A 2Q3FA 4P5DA 3G5UA 4BTLA 3TE7A 1E6UA 1CERA 3NM5A 1O03A 3D7SA 4PYKA 1KERA 2G04A 3FFBA 3VR3D 4A5SA 3ROQA 4KI0A 4PGAA 2WZCA 1B00A 1JLSA 3L1KA 4ZZ2A 4LXTA 2J41A 1EG2A 1I1HA 4LYYA 4CMAA 4LJ7A 2OZLA 5M04A 1YTUA 3SOPA 4IOJA 3U6BA 1D7AA 2IKQA 4OUDB 5AW3A 3COZA 1NYTA 1N3LA 2UZ1B 1WABA 3H2YA 3TXXA 1J99A 1GLGA 3CF2A 2PIAA 2GN6A 1L4KA 5EXSA 4F1JA 4UM7A 3FVWA 4KUHA 2Y6UA 3WNZA 2V54A 2QVBA 4JIGA 4F5ZA 5JS7A 5BSHA 3K92A 3PXEA 4IW3B 4MGKR 4TX1A 3O8QA 5K01A 2R68A 2QQEA 4NDZA 1A8SA 3OX2A 5G3YA 3ROPA 2O2YA 1PK9A 2Z56A 2ZUVA 3ZH2A 4C0BA 4RABA 2BHLA 1MB0A 1YQTA 3DYBA 3LYUA 3D6MA 5EE1A 1N0HA 2QE7A 3QFTA 3ZHCA 4DAEA 4B8ZA 3LDFA 2Y3IA 4YGXB 1E2GA 2JHCA 1PU2A 1ZIYA 3N70A 1OLSA 4U9UA 1SUCA 3O4GA 5HQ3B 2AW3A 3LT5A 2NO0A 4V0MA 4AECA 4QU5A 1TEHA 4NXMB 1Y3FE 2D2VA 3AW9A 2AH5A 4R1NA 3W90A 5JSQA 2OCBA 3TL6A 3BZBA 3FLEA 2V5AA 1V48A 4HG2A 4NZYA 5EP1A 1NRIA 1ZVVA 5H9WA 5LZ4A 1USIA 1RAEA 4DIEA 3WLOA 4L75A 2GEBA 4M21A 4UTXA 3RFVA 4LXXA 3W3AH 2GKGA 5K8TA 4JT9A 1RPJA 1W4LA 4BNJA 5LWQA 1RFGE 3WB9A 4TUYF 3WLKX 5I4IA 3NIBA 1NVMB 4DJFC 3EXHC 3UJCA 1Q7TA 4MKIA 3ZV5A 3MRSA 2O8BB 2Q3DA 1Z2NX 2VSFA 4F6RB 5A9TA 3RO7A 5D8DA 1G5HA 2GILA 2EKQA 2Q5QA 3DVSX 3ENNA 4OQ4A 5IUKC 2NUTA 1O4VA 4CM3A 3JVUA 4KXYA 3KJEA 1UBSB 3IV7A 3TM5A 5KQMA 1E69A 2WWGA 1PJRA 2X13A 2WJWA 5JTTA 5ESWA 3GJRA 1BXRA 1F8FA 1JQ3A 2DY0A 3BCUA 4IV0A 3RHZA 4EF4A 1OH8A 2ZUUA 4LCEA 3LQ4A 3GA7A 1DT5A 1CUCA 3CWCA 4DCVA 3S1AB 5E6UA 4Q93A 4CMBA 4YCBA 3ZDXB 1QGUA 2H4ZA 3EZ6A 1X94A 3KEFA 3KOZA 2CHUA 2QW0X 4N39A 2GD1O 1RIIA 4PG6A 4RNCA 4IUYA 4KOAA 5ARBA 2DP4E 3RW9A 2HLPA 4M8IA 4C4SA 5DWDA 3INNA 2XQGA 4AMZA 1T6BY 1N2HA 1VBFA 3MWGA 4JT8A 4Q9AA 5KYYA 3PU6A 1UFKA 1XNRB 2P3OA 3NHAA 3KDSE 3DMHA 5HRAA 1IB6A 4CEHB 2PKQP 3GA0A 2PGIA 5H83A 4NSNA 3ILYA 3MGCA 1LTHR 3WP0A 1O95C 4FDVA 1NASA 1XKLA 3OMWA 4XIJA 5DM60 2OCDA 1P45A 5CYOA 2ODTX 4PZUA 4J3JA 1OZAA 2EKLA 3FYHA 3M4XA 4XLZA 4AX8A 1CDZA 4B6FA 2CNOA 1DBIA 2NT4A 3WWOA 1ZHOA 5AI9A 4TV9A 3TQQA 3WY9A 1E4OA 3HB4X 3QMVA 2KW5A 2X1LA 5TF4A 4YHHB 1XDSA 4EMUA 4HZUB 1S2DA 2QTRA 1HC7A 4HYQA 5F33A 1Y6GA 1Q44A 1HG1A 2GCNA 4F21A 5CA1A 3A4IA 5DCLA 1FP4A 1DBWA 1G8FA 3DV0A 3FUVA 3UT0A 1E3SA 1ATZA 3QBEA 3FTEA 2HMSA 4WZAE 3T3HA 2CLSA 2WYOA 2Y68A 4KACA 2I7VA 2R65A 1ZLXA 1E2UA 4FPXA 4QJ3A 4D0GA 3WGIA 3ENWA 4LUCA 2HU5A 1UWLA 1PJZA 1P2BA 1KOFA 3V7FA 4LOKA 4E6PA 2A30A 2NV2B 3PVCA 1VCNA 4X64B 5LZ8A 1A4XA 3AI2A 4MQMA 1Z7GA 4NH4A 1EUZA 4MQEA 3SVZA 1J2JA 3IUJA 4ZGGA 1LJUA 5J5AA 3THSA 3N75A 4D3SA 4S05A 2IYXA 5CITA 3PYLA 4YUWA 4MDYA 1MCZA 4P3NA 4EGAA 1ZM7A 3AM4A 3IHTA 5TMEA 5ED0A 4Q48A 1JZSA 1AQ6A 1G21A 2RONA 1E3TA 2ADMA 2GX6A 3VA7A 4HYTA 3LS2A 1RBQA 4ZVKA 3GFBA 3H1EA 4Y30A 5JD3A 4C4ZA 2X0FA 4M9CA 5DNUA 4D0LB 1SKQA 4WY8A 4P36A 2I4OA 1KFJB 3TNYA 3ZUPA 1SCNE 4Q4JB 7AT1A 3HTXA 2QLNA 2XZDA 3CCBA 1NUSA 3KEGA 3L7KA 2YN0A 3HDGA 4J0CA 3QA3E 1QQ6A 2Y1KA 4ZEMA 4WBXC 4QUBA 2BHSA 2VF5X 3IDFA 2I66A 3LP8A 1KGDA 5LZ2A 1KH3A 3OQPA 4MS4B 2B8EA 3IIKA 1HETA 3TH5A 1YO6A 3B51X 2HTEA 2Y76A 4FWIB 4L08A 3THRA 4MEJA 1KEUA 2CMHA 2X6RA 1Y5MA 2VI5A 4UZFA 5DCUA 4UDYX 1PI3A 2GMWA 3HGTA 3L8DA 1J24A 2QN3A 2VVTA 3VPCA 1XP5A 3L4KA 2ATXA 2UYQA 3GIDA 3L93A 3I6ZA 1NV8A 3C5WP 2NP7A 3QP9A 5GP1A 4V0ME 4P9NA 4NECA 1EXNA 1FVXA 1VPLA 1KI4A 4YMSA 3K16A 1V1RB 1OD6A 2KS6A 4JJAA 3NWBA 5CCBA 1W30A 3BD6A 3DW3X 1G38A 3D0KA 1PGNA 2Z3WA 1GG2A 2QYHA 1R64A 2ZRMA 4HY3A 1SVLA 1K6JA 3QBDA 3JWIA 5KU7A 1SOWA 4RVDA 3KKOA 5CLIA 3E4CA 1E2DA 2F8LA 2JJMA 4J03A 4IWNA 4AMUA 2HF2A 4D0RA 3RBAA 4CKEA 3U19A 3A6LA 1GAQA 1YVRA 3BDIA 2QORA 3KU1A 3GUZA 3SR3A 3TVYA 4ZCQA 5F76A 1C2YA 2I33A 5DOVA 5ITWA 3CF4A 5FBLB 4Q7KA 3CCCA 4KV9A 4P2GA 4Q16A 1OH7A 3KQLA 1FTGA 3MBIA 4NJEA 1G0OA 2FI1A 4UKDA 3ZY5A 1IBMB 2EQAA 3WLMA 5AK5A 1R0LA 3IX7A 4FMCF 4YEDA 1BHSA 2XH8A 1S3SA 4MGZR 2QN9A 1PGQA 4TMFA 5ILOA 1KI6B 3VDXA 3L4BA 5JRZA 3EFOB 3K5WA 3LXXA 1J2UA 3PP8A 1RXWA 2HJ9A 1SBTA 4B47A 3RAFC 3H1PA 1DG9A 4UVDA 2YYZA 3A06A 3E9NA 3GIWA 3Q41A 4PLPA 5J2TB 1ZCAA 1ZCJA 2IH5A 4C0QC 1HQCA 4G1CA 3RIEA 2GNPA 3KPYA 3NI2A 3H2HA 3V42A 2NOAA 2OTCA 4A8TA 4D4HA 2O8EB 4X45A 4FT2A 1UJBA 3DM9B 4YFVA 5I9BA 1U1DA 1UZAA 4G37A 5AXDA 3UYKA 1ZCBA 1IYZA 4CM4A 3KZOA 4PZDA 4MR7B 4O2BF 2I78A 5CXXA 1V4VA 3DCYA 4EUHA 2NO9A 3DZFA 4RF2A 4C21A 5FPPA 1BGWA 3QVXA 4IILA 4IYRA 3Q9SA 2VSNA 3L5OA 2AXEA 4FFOA 4R31A 1MOQA 1UWVA 3DA8A 2AOTA 5AM1A 5K3FA 4RJTA 2PGDA 3C45A 1IDN1 3W04A 1ML4A 3NQ41 1P4JA 1QZUA 1L2TA 4XFJA 4FQ8A 1RR6A 2D5BA 4B81A 1CULC 2QRVB 4NCJA 2WUEA 3D43A 2ZIUB 1LNQA 1HWYA 1UANA 1XMOB 4HEA1 4NYMR 3N0WA 1VKNA 2IEDA 2G36A 3GARA 4LJ8A 1FSGA 2VCHA 1MH9A 3LT4A 1L5KA 3WXMA 5EN4A 1DP4A 1P29A 3QIVA 4OLJA 5MN6A 2QV0A 2FFHA 3N58A 1UKCA 2AFHA 2R1TA 8ATCA 3LUKA 1ZEMA 3UQYS 4BCDA 1YBHA 1R0SA 5JXHA 4Z4CA 3EIEA 2XZLA 1HOTA 3F1LA 3RYIB 2CJPA 2P0YA 4Z1MA 3ZE2B 1O8CA 1X80B 3B8HA 3KJXA 5ER6A 4JY7A 1PJQA 4LHYA 1TX4B 4MCAA 3V97A 3VQTA 2GZRA 3F7MA 4RV4A 4YRCA 3HM2A 2ODPA 3OQIA 3VR5D 3VV2A 2PXAA 5LVAA 1RVDA 2I5PO 4X8LA 1BA3A 5L3SA 2QL6A 2RHWA 1F5NA 3V4RA 3FWYA 3L0IB 1ZO8A 3NV7A 1YS6A 2AG5A 3E9ZA 3FSEA 5B58C 2IYTA 4P80A 1KJ8A 1HE4A 4CHGA 4Q9IA 4LJ4A 4WZAB 3C87A 3H6GA 1WOYA 1NBEA 2D5CA 3A1TA 5EPEA 5H16A 3QM1A 5FFFA 3AZOA 3KQTA 4GMFA 1ILWA 1G21E 4YN3A 2AG1A 2C07A 4QGHA 5I7HA 3E2MA 5I8ZA 5LQNA 3NT4A 1RD4A 3OCYA 2VO1A 4YRAA 5L3VA 2G6BA 4FNAA 1Z28A 4BVFA 4YBRA 2IY7A 2JZOA 2FPIA 4FGUA 1EFHA 4Y2TA 4M4SA 3V6LA 5L4LA 3R3HA 2ZT5A 1M1ZA 2RJOA 4RENA 1E2IA 1YDWA 2H51A 2ZTUA 3HHEA 3GLFB 2PSFA 2GNAA 4L3VA 1YCFA 2A88A 1PAUA 2AJTA 2OZLB 2W6JD 3IE2A 2OQRA 3KZMA 1QGAA 4NESA 4RGVA 5ALOA 3ZX4A 5LIPA 2VPIA 2D1YA 2XUJA 1UBGA 3BUSA 3I6YA 4YRBA 1EWKA 3OM1A 3MHTA 4QOFA 1K7EB 2HSGA 3T4EA 1Q77A 2QVYX 4G9BA 2EZ8A 2Q5JA 1FTNA 1KQPA