4IKOA

Structure of peptidyl- trna hydrolase from acinetobacter baumannii at 1.90 a resolution
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
193
structure length
193
Chain Sequence
b'MSNISLIVGLGNPGSEYAQTRHNAGFWFVEQLADKYGITLKNDPKFHGISGRGNIEGHDVRLLLPMTYMNRSGQSVVPFSKFYQIAPEAILIAHDELDMNPGVIRLKTGGGHGGHNGLRDIVPHIGPNFHRLRIGIGHPGSKERVSGHVLGKAPSNEQSLMDGAIDHALSKVKLLVQGQVPQAMNQINAYKPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-tRNA hydrolase
publication title The Mode of Inhibitor Binding to Peptidyl-tRNA Hydrolase: Binding Studies and Structure Determination of Unbound and Bound Peptidyl-tRNA Hydrolase from Acinetobacter baumannii
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase
total genus 64
structure length 193
sequence length 193
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2012-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 4ikoA00
5IKEA 3P2JA 4QAJA 2LGJA 4IKOA 3TD2A 5EKTA 5IVPA 1RYMA 3KJZA 4JX9A 4ZXPA 2NAFA 2Z2JA 4OLJA 4YLYA 2Z2KA 2PTHA 4FYJA 5B6JA 4JY7A 4LWQA 3OFVA 2MJLA 5IMBA 3KK0A 4QT4A 3V2IA 4JC4A 4FNOA 4Z86A 3NEAA 4FOTA 4P7BA 2Z2IA 3TD6A 4QD3A 3TCNA 4QBKA 4DJJA 3TCKA 4HOYA 4DHWA 4JWKA 1RYNA 3VJRA 2JRCA 1RYBA 4ERXA 4FOPA
chains in the Genus database with same CATH superfamily
1HYQA 1UC5B 1KAGA 3R7WA 4K1LA 4F38A 4KPFC 5ALNA 5F4ZA 1AV7A 1U7XA 3IUYA 2CB0A 1P2TA 4M38A 2XXBA 3X1JA 4Z5XA 3IVGA 5ITZA 3LT4A 3PA6A 5FLXA 3B7PA 1NWHA 3Q40A 4MUYA 2WVGA 1L5OA 1Q11A 2ZYGA 2IU4A 3PXDA 5IC4A 4P4SB 2CLDX 1AKTA 1UJ2A 3Q12A 3G13A 1EK5A 3KL2A 2YJNA 3H0EA 5CBPA 5T7BA 2QTFA 1NVFA 2K7ZA 2O7SA 3T5MA 3GJQA 4B43A 2IC5A 5JD4A 2QZPA 2RAFA 2A3NA 4Y6OA 3DP7A 2AFIE 2AMLA 3A0RB 4RHYA 1CW2B 4P08A 2SKEA 2D4AA 4RK1A 2PPVA 4AMGA 2RKBA 2NTVA 3WK9A 4DC9A 3LL4A 3JYOA 4JMPA 5LIRA 1JTFA 4I9NA 2C54A 1R88A 1U0HC 4LC1A 2NXJA 3UWPA 2X1VA 1HFJA 3WKCA 3M6WA 3OQMA 4JA0A 5FPHA 4P53A 1J8YF 1CZKA 4WNAA 1Z2CA 1L0BA 1POXA 2I2AA 3I1IA 3GLGA 1DKPA 3HVKA 4YJ2F 4BCDA 2NUPA 3CF6R 1JU3A 4HOYA 5CDFE 1P91A 4DDVA 5H0IA 1B8PA 4NEGA 1QFZA 1FQJA 1W88B 4ZT2A 5MN6A 2D5CA 2HJ9A 4QOGA 4CM4B 1XF9A 4WBXC 3MT8A 1AGYA 2XITA 4H27A 2P77A 2Q3HA 3G2LA 3RRXA 3BB3A 1B6RA 3KXPA 4K6MA 1C41A 3C1AA 4DCMA 5KQLA 1K27A 3IUQA 4P5PA 3WMXA 3ZHCA 4RSHA 2K6GA 4IDFA 4LCJA 4PZLA 4OAPA 4HVCA 1UZMA 3NGMA 1UWCA 2C5HA 3OOEA 2H1IA 4PSKA 2M1ZA 1PQWA 2Y1EA 5EJ7A 4DQVA 2IDMA 3TEMA 1V1RA 5DSTA 5LDHA 1CP2A 4JCCA 2NZ2A 4CI9A 5FAKA 3WGJA 3ORRA 4OJMX 2BJHA 3AERB 4UNSA 1PSZA 4HGZA 2P40A 1YU9A 5F1KA 5P8WA 3RYHA 4EMUA 4HXYA 2OWDA 3VR6D 4BAGA 4ZI3A 4LRUA 3K0KA 2BEWA 3WGLA 4FD2A 5A9RA 3ETHA 1TF5A 1V47A 3CKKA 2GCNA 2YUIA 3R44A 3I0ZA 3E70C 1T3GA 4OFZA 3BN3A 3H3JA 1LTQA 1U3UA 1GGKA 1V1MA 4L5CA 1Z5NA 4WXYB 1ZUNB 2EBUA 4CLXA 2ZEJA 5YASA 2K87A 4QXAA 3I6QA 4O59O 2VRCD 5JJBA 2BY4A 2FZGA 4HAOA 1HURA 1NZJA 4HQKA 4JP1A 5HUHA 1S1CA 1HNXB 1C2TA 2HF7A 3FFTA 3DEIA 1Y8RB 4RF5A 1AX9A 3TFQA 3D7SA 1VJDA 4UVDA 4FGZA 4A23A 1EX7A 3ROZA 1SUCA 3T34A 5IAGA 5ADVA 4TWBA 3SHFA 1XOIA 1DNPA 5BOVA 3O74A 5LJLA 4QM6A 1X74A 1Z29A 1CZHA 1IIRA 4AD8A 4IIUA 2GLTA 4AK9A 3GRYA 3WK5A 3WGIA 2JRLA 1R16A 1A72A 4F97A 2YWDA 1G3MA 3GFOA 3UV6A 4ZEVA 1PR3A 3P9ZA 5F78A 3VMFA 1BH6A 4LQ4A 1KH1A 4I50B 4PZDA 1UODA 1EWVA 4C06A 3GNTA 4Z1MD 1SBIA 1C1YA 1HRDA 4F6LA 4I4CA 1PK8A 2HW8A 3GFRA 2R6HA 4KQWA 3SGLA 4WMLA 3WVNA 1E18A 1N5MA 2FEKA 3I23A 1P0MA 3BIFA 3I32A 5AMXA 2GGSA 4EH1A 1T25A 4AN4A 5C3MA 3FFXA 3I6MA 4PSAA 4AQ7A 1TM2A 1IH8A 1X7YA 4ER3A 1FQWA 4JC0A 3O8BA 1DZIA 1DC8A 1U4NA 5F35A 4JI3B 1WXDA 4EHIA 3CRQA 4FFBB 2HM7A 3OOSA 3R0JA 5DDIP 2AMFA 3L7IA 3ZHXA 4M83A 5DLDA 1U7PA 3QX7A 3ZX4A 1ORTA 1I3NA 1T6YA 2UVPA 5EESA 1E1MA 3NI2A 3Q1LA 5KNDH 2C4TA 2MMCA 2NUBA 3BIJA 4Q18A 5KNDD 1UXGA 4OQQA 1B23P 1L5WA 2QBYA 2WT9A 2C7PA 1U1FA 1VB5A 2SCUB 1LDNA 2ZPUA 1VA4A 3U1BA 4J0KA 4MS3B 5F7XA 2P2SA 3A10A 3DLCA 2W71A 3E7XA 3ON5A 5BV7A 5HR5A 5C46F 1FRVA 2XYPA 3IL2A 1D0IA 3HCRA 4PG4A 2NXEA 4S35A 2HK6A 1EUCB 2FXIA 5DULA 4RIEA 2FA9A 3NHFA 2SNIE 5IDQA 1N92A 3NASA 4W8HA 3VSCA 1JSZA 4TRNA 4TYMA 4BDSA 4EUNA 1OZHA 1Y37A 2IXGA 4JL8A 4HXGA 3UK1A 4YAUA 3QE9Y 1TLLA 1UIRA 4LHYA 2L2QA 2OG2A 1E4EB 2IIPA 1VJTA 1Z25A 2M6SA 2QYOA 3QU9A 3T3GA 3E5MA 4TZ6A 4PRLA 3VOBA 1NQTA 4AWBA 2Z9BA 4ZRMA 2D2VA 3ZVMA 1NXXA 4U7FA 2NU8B 3DZJA 1UFVA 3FOCA 2CDAA 1YRQA 3C5WP 3LBNA 1DIAA 4GR5A 5LBTA 5AW1A 4ZI2A 1E7YA 1ND5A 2XF2A 1REQA 1VMKA 5CK4A 2OBLA 4CIAA 4WW0A 2I6GA 1VKHA 3P2IA 3GRPA 4EI8A 1X13A 2JLYA 1Y6ZA 2OFWA 4YDRA 3OKPA 1DG9A 1MNAA 1KKLA 5C32A 4NE2A 3FSJX 4IIHA 1ZBDA 3LSYA 5C8XA 1ZONA 2WSSA 3STHA 1G5IA 3H75A 1Z5ZA 2OG1A 3MWFA 4MUHA 2Y6UA 2F3QA 5CX1B 3VYSB 4W5OA 1DX4A 3LLCA 3K2IA 3EN0A 3EQ2A 1FSSA 5REQA 2OFOA 5IH3A 3EGDB 1TYBE 1RNLA 5JEDA 2YJ5A 3GJYA 4H7IA 5TJHA 4QWWA 1Q95A 4Q6WA 1DWPA 4EHDA 4KQ1A 3EMBA 3PJDA 4DJFC 3RS3A 2F9LA 3QLVA 6GPBA 2D1TA 1LRLA 3G9UA 1VA5A 5EPUA 3OLXA 1J42A 1EFDN 1VSUA 4BMVA 5KC9A 2C7RA 2B30A 4YROA 5EOVA 2FEOA 2XEDA 5FFNA 2VP9A 4WLEA 5IJWA 2V7BA 2B20A 3CVYA 3EPKA 4BUCA 5F21A 4PGAA 2Z4SA 4C2TA 4NFYA 1QGUB 1TUBA 2I4LA 1XTZA 3JZAA 4OHRA 4DJDC 3G9QA 1M34E 5IH7A 4JYMA 4RFSA 3GPBA 4I5EA 3U3ZA 3UOWA 4EMBA 1RRVA 5A06A 2VK4A 3PE3A 4QRHA 5ITVA 2GVDC 5KDDA 3BZUA 3JRXA 2GCOB 1U2GA 3BWEA 3NWBA 3OOHA 3JQDA 3WYEA 2C29D 4JI8B 4K1XA 3RK4A 1VECA 1R00A 4XUCA 5LKRA 4OAQA 3TSYA 4WVLA 5CVTA 1SG6A 1W6RA 1UMBA 2OHXA 3S0JA 2JAXA 3L7AA 4HDAA 1NAIA 2I76A 4EF6A 3BMXA 4AY3A 1PUIA 3UAGA 2AJ8A 4RMHA 4UCWA 4XDGA 1K8ZB 3L41A 4HYTA 5CH5A 3VHLB 3E3LA 4B3JA 1ODCA 3TNYA 5HDBB 4PYJA 1CF2O 3I83A 4PTYA 4RC9A 1EHYA 1B16A 3H9EO 1JFTA 2X58A 4EL5A 3LZDA 1O9GA 1R2QA 1TTPB 2QVGA 3MGKA 3MXOA 3N6XA 4FGKA 3NKFA 4XGQA 3TQFA 1W49A 2I4OA 3BDIA 3MTEA 4LQDA 5B1DA 3A05A 4C3ZA 5BORA 1H6CA 4C0WA 2RGUA 4DV3B 2TSYB 5DLQC 4EITA 2R9VA 2VP5A 4DAEA 2G6BA 5EGNA 3LX4A 5LLSA 5L3QA 4W7IA 3JQ7A 4OLHA 1SRRA 3RC1A 1PSWA 4LTNA 2BEJA 4NBKA 3WIUA 4D6YA 2K5UA 1NE2A 2ZTUA 5GIOE 1FC0A 4Q7QA 2XWBF 2XDYA 3UG7A 5B7QA 1S3GA 1T5HX 3MPOA 4EQ6A 4MVJI 1N5DA 1GL7A 2J3MA 2BPOA 4V3CA 2JBHA 1HX7A 5EP3A 3RC9A 2AYYA 1F0KA 3DBLB 4HTFA 2Q2WA 4ND7A 1N7GA 3BQ9A 3LUHA 4IR7A 4NBVA 4AJNA 2EERA 3ZI0A 3E3AA 4RTJA 1C8LA 3EDQA 2D1YA 3PFHA 4IFIA 3DH0A 4IYJA 3RRJA 2A5GA 3OIVA 4UEJA 5DP1A 4BC1A 1E9AA 2ZRDA 3W3AA 1XXHB 1TAQA 4Q93A 5CNIA 1IFXA 3WKAA 4DXHA 3ETDA 4CEJB 2FW1A 4C21A 3VV3A 1GZUA 5A4MS 2R00A 1WQ3A 3DZFA 3T1YB 1MVNA 1PR1A 5CXSA 3EIXA 5AM4A 1FW6A 1IBMB 4NX2A 3BXEA 3M4YA 3OHPA 4YMLA 4CMKA 2XA9A 3LM8A 4EEZA 4PIPA 3ADCA 4TV8B 4G0WA 1IEQA 4C6HA 2AXQA 3GYGA 2GQ0A 3BWMA 1DI0A 3ISTA 4P34A 2HL6A 3GDHA 1PV1A 1ZA2A 3UQYS 4BTVA 1XEFA 1YJ5A 1JHAA 2VFAA 3DO5A 4YJ3F 1R9JA 3NYWA 3P9NA 5I9BA 5A2QA 4PHTA 2OHOA 4ASUD 5A3JA 5TQJA 1QYXA 4PGHA 1FNCA 1LJLA 3OU2A 3ROPA 2ZP1A 5K3OA 3PTAA 3O26A 1GQSA 1GXSB 1NT4A 1Q7CA 5EKUA 2XNJA 2Y2VA 3F2VA 2ZKIA 4PYRA 1UBGA 1YVUA 5ANRB 3ZI4A 1E6WA 2A9VA 2GN0A 1TA9A 3DVAA 4D99A 3PWZA 1XTKA 3QBEA 4IF6A 1OWNA 1U5AA 4KUGA 1XLVA 2HY7A 3FZEA 5I7OA 5I47A 1NM5A 1TM5E 3K96A 3QLJA 5G1OA 3I61A 1FSPA 4QPNA 2Q4RA 3RCBA 4BECA 2VHWA 1MB9A 3LQ4A 2GAOA 2WTBA 1JBQA 2ZE8A 5HEKA 4OOFA 1U1GA 2PLNA 2YXLA 2CUKA 2ZRNA 5KYNA 4I3HA 3NRCA 1AKYA 1YMVA 4TXLA 3ITNA 4NAVA 4QKQA 1QOPB 3NBUA 4R2IA 3E0QA 3OE7D 1TC2A 4KQCA 2WSLA 3BERA 4N8EA 3R7LA 3UEOA 3OF5A 1ZIDA 3HRKA 1UADA 4MUBA 3VVBA 1CS0A 2ORIA 1X14A 3DD5A 1IOZA 2DR0A 2HHJA 3IX7A 4Q9LA 1NVUQ 5GJWC 5KMGB 5IT0A 1KETA 5DGHA 3H5RA 3GRUA 3HO6A 2PH1A 5DBFA 4ZOQI 2O2XA 3SBXA 2CLCX 1PD0A 1EYZA 3DOHA 3PEWA 2EFGA 4IDDA 4NYIQ 2NIPA 2OO5C 4UNIA 3NO4A 1K7EB 1E2MA 2Y66A 5LN1A 2EQBA 3R6DA 3WGHA 5GVRA 2YINC 3KZOA 3AFMA 2G9UA 1NR7A 1DKLA 4FNOA 5C5CA 1U7UA 2L18A 1VIYA 1YFZA 5H82A 2V3VA 4LI3X 4DCVA 2GAAA 2WM8A 3VPHA 1DC4A 2HF2A 2H4FA 2HA5A 3CEMA 4O8CA 3GH1A 5C8YB 2XB4A 3KE8A 2FKAA 3Q0EA 1W2WB 2BKLA 3SHTA 4CGYA 5TLSA 3RUHA 1B14A 2NU7B 3KOOA 4V39A 3TLKA 1Z7BA 2APJA 4FOLA 4YQEA 5GJBA 4MEBA 1CDZA 2R66A 4EFDA 3M6FA 2EDAA 1CJSA 2AV6A 2EC5A 4FYXA 3GB9A 4CM3A 2K7FA 4JEIA 1X8LA 2D74A 3EVZA 4DDHA 1GPMA 3OCYA 1NKVA 2E2WA 1RLJA 1CDEA 1SHKA 1DQPA 1O96B 3ONFA 3T3EA 4EABA 1L8OA 1CE8B 1O9BA 4C0XA 3AESB 4MO9A 3AT1A 4OU5A 3TLCA 2AK3A 2N46A 1VBFA 1WXQA 3N0TA 1BD3A 4MZDA 4V0ME 3T0FA 1RYDA 1W4ZA 1XEWY 3ID6C 3JPWA 5DN6D 2IPNA 5I4KA 4MWDA 1JYSA 5FF9A 2QD3A 3HJFA 2F43B 1Y3CE 3P4YA 4UVGA 3KR1A 4W7SA 5KTNA 1GNTA 3R6TA 3D0RA 1YVEI 3UTDA 3R5HA 1ZVVA 1NF9A 1RJFA 2KJQA 1V11A 3X1MA 3ORYA 4S24A 1UWVA 3SM9A 4QBTA 3KYJB 4EK9A 5IZ4A 3BWYA 4NV1A 4I5IA 2J33A 4JQYA 1JEYA 3WWZA 2JK0A 2ZJ2A 2RB5A 1MLDA 3DZ8A 4U9UA 3CCCA 4TKMA 1L5FA 3MAJA 1JFFA 1JG3A 4I55F 4XTCS 4XCVA 4XJXA 1V7QA 3FJ1A 5CM8B 5B53A 5LB4A 4D82A 2R1VA 1GTVA 1C30B 2G70A 4DMLA 4K9QA 3PPVA 3BL5A 3GUZA 5IJ9B 3IPLA 3VX4A 1TZKA 5BSTA 4NBNA 1OX6A 4JNKA 1JA9A 1CF4A 3FPHA 1CY1A 4JNCA 4LXGA 5G53C 3S8MA 3VYTB 3ZWQA 1N2XA 2XCTB 5IT5A 2OK7A 1C1XA 3EWNA 3E0XA 3MCWA 4WZBB 5AO9A 4BFVA 1A98A 1OLSB 1RM3A 2QRVA 4V0RA 4TQGA 1X80B 3T1QA 3K8OE 2PCJA 3C7CB 4RO0A 1T4BA 2O3JA 4OY3A 5EIWA 3SJ7A 4TYPA 2WIKA 3HJTA 1R4NB 3KLMX 1C81A 4O25A 4AURA 2P79A 1N78A 1QC5B 5IVDA 2XWQA 1C4WA 2WU0A 3OM9A 1MBZA 3L07A 1S01A 2WZCA 2REXB 1ORDA 2XCRB 3HK2A 3DDZX 1QYCA 1D09A 1JV2B 1AGPA 4XM2A 3O8LA 1PR6A 1BKSB 4QA9A 1YHZA 1MO6A 2QUKA 5FNVF 4D8XA 2O3RA 1M3SA 3SHQA 1XAJA 1ZK1A 5CT5A 3VC3A 4MOWA 1TU0A 1DWUA 3UCFA 3K0FB 4BMNA 2PRJA 1RZVA 2BTQB 2R5NA 3CX3A 4G4IA 4CCSA 4XFJA 3PQCA 4JSTA 2WF9A 2WD7B 2Q5HA 1DUVG 2ZIAA 2IPAB 1KZ7B 1FYFA 1VKJA 1SXJB 2F3UA 4JELA 2HCBA 1M7BA 5CVEA 1J2RA 1X87A 1HE8B 3PDCA 5DSZA 4A91A 3WMFA 4JP2A 2VRWA 4YRQA 3L84A 1YHNA 3F71A 1JS1X 2IIQA 3U1VA 2P3OA 6PFKA 2P9BA 2WPNA 4G8DA 4X91A 1A82A 1IEVA 3UK0A 1CR1A 2JAPA 4CT4B 4E4TA 2OCLA 3WQSB 1GZSA 10MHA 2QRGA 1PZFA 4CNBA 1KEEB 2P6UA 1UJ6A 4LZNA 4PLZA 4FEAA 2DY0A 1AG9A 1OIXA 4WCFC 3L5OA 2Z4RA 1FF9A 4YP0A 3WBBA 4DIUA 3B1KA 5D1NA 3UHJA 2W2XA 3BD6A 4RSMA 5KUTA 3DKIA 3KUCA 3KXKA 3QLUA 4RZIA 2JGDB 3GFBA 3NYRA 4D41A 3WBFA 3RIXA 3L0SA 4BFCA 5ENVA 3TR6A 3BMOA 2H6EA 1GYRA 2YWXA 2DKNA 2IYTA 2VZ9A 3V2UA 2UYQA 1UDXA 3E7PA 1BN6A 1XR3A 3FTCA 4BBAA 1QJCA 3C0KA 4GBGA 1WLYA 2IXBA 1Q0PA 1CQZA 1N36B 2OBYA 2ZRLA 3LUKA 3NGXA 1HFEL 1TT5A 2MJLA 1MIOB 2OPBA 3A9WA 2N1MA 4M54A 3U3KA 3ZWOA 1RQ7A 3LC0A 2GK4A 4YRGA 4BP3A 5HRAA 1X94A 2AS0A 2O7RA 2JHGA 5EZYB 1NVTA 1KIMA 1GU0A 2ZYSA 2JH9A 3VKFA 5HOEA 1QCYA 3MYYA 1XMJA 3INRA 1JDZA 1PWHA 4MQ6A 3WL5A 4OHMA 4BNLA 3IP3A 1C3OB 3RODA 3F9IA 1IWBB 3IGFA 4H7JA 1UOPA 4IINA 1WVMA 3D2AA 1N6HA 1Q3TA 3OTHA 1IONA 3FKSA 3T7EA 1S7GA 1U0LA 2HXSA 2OFPA 3QEKA 3ZDCA 2H48A 1IHXA 5JLAA 1AQJA 3WGQA 4A0SA 4RIHA 2CXHA 2V65A 3VYWA 4KN5A 1SU6A 4UHBA 4F11A 3VJRA 2IYLD 2VO1A 3ROMA 3N07A 4S2EA 3SEZA 1SB9A 2QMEA 3RSGA 4QXPA 3W9YA 3E5HA 1SG9A 5DHSA 1T0HB 3DV2A 1AXGA 1YQEA 3PRYA 2ECFA 3H2KA 1NBWB 4AF8A 1TAUA 3DZKA 4WASA 3KQHA 3FWHA 1CJMA 2B35A 1XJ5A 3H3XA 4C14A 1HFWA 2XH8A 1KS9A 2NP6A 2NGRA 3AJ8A 3A06A 3LHDA 3EGXB 2DHRA 5BO5A 4RPIA 3SYMA 4F2HA 4GICA 5AUNB 1UP7A 2OP0A 5DOZA 1ONNA 2F8SA 2C3UA 4I1YA 4UQOA 5EFZA 4DIMA 8ATCA 1XTJA 1F2UA 2D2FA 4QASA 4K9DA 4QUDA 5AM5A 2JFXA 3REQA 2EJUA 3GEBA 3AEYA 4TT3A 3BL6A 2B4AA 3IAXA 1GL6A 3V32A 3I1FA 3THRA 2XKKA 4RH0A 4PCUA 4XH9B 3NYQA 2ZETA 4EW6A 5IYZB 4ALLA 1J0XO 5JCOC 3TUJC 1AS3A 4WINA 3GCGA 2HOQA 3CLTC 1K4MA 4QJ5A 3ZCQA 2G04A 1SQFA 1RU3A 1B6TA 1SPXA 4Q4JA 2GEJA 4MIOA 2IHYA 3U4QA 5JSKA 2CCKA 3MTDA 3PIDA 4WL0A 2XE8A 2PWPA 1CR6A 2AE2A 3IVCA 4KR2A 3PNMA 2FSVC 5DKFA 1WUJS 4OVKA 5IUJC 4TXJA 4Z53A 4GKJB 1ABEA 3Q3IA 1V6SA 3ND7A 1DRVA 3AVQA 1Q0HA 3AP3A 4FCTA 1H5QA 5IDWA 1RXUA 3T1HB 4HJXA 3OZSA 5EWMA 4FKZA 3PL1A 4ZVVA 1ZNZA 1SBQA 1ETUA 1L4HA 5TQ0B 1WL8A 5M04A 1NAHA 3I2HA 2HNAA 3G2MA 1NA5A 3DTTA 4LDPA 4L8WB 4RJIA 1LVHA 3DBVO 1U0EA 4H0FA 3GI1A 3IERA 3KKEA 3O1JC 1PX0A 2OOSA 5I9TA 2OGTA 3GEDA 5HILA 1E2NA 3D6UA 4J03A 1DEKA 1WHTB 4R0VA 4O1HA 2ZREA 4PGGA 2WSBA 1ZW6A 1S2GA 2OCGA 1WXWA 1AK2A 1U3GA 1FX0B 2VNHA 1FPQA 2BMFA 1Q57A 2W2VA 2IKSA 3QPWA 3F6EX 5BQOA 4DLNA 4ZTZB 1ZMRA 5CM9C 3K5PA 5FRDA 4M1WA 2XWSA 5CG1A 1YCHA 2ZSHA 2FE4A 3RVKA 4ZKDA 4W6ZA 2B8WA 3G9XA 2P75A 1SIUA 1GSAA 1HC7A 3NW9A 4ZODA 4ZU1X 4C4RA 3Q8WA 1F20A 1LQTA 1RJ9A 3IP9A 1T8UA 3QY9A 3I6ZA 1K8YB 5AQEA 1PF7E 1GRQA 5I9MA 2QL7A 4AO7A 1WU8A 3FHJA 3I9OA 2VG8A 5TXGA 3RUEA 4BPBA 2J7PA 3OFND 3JTEA 4IIYA 4BP8A 1V71A 3NDPA 3KBOA 3F6CA 4Y1FA 2WU3A 2OLKA 4GUDA 3UTCA 3FLEA 5KNCD 4PU0A 1DO2A 1I36A 1XYVA 2G9VA 4N3BA 4QDUA 3S1LA 3THOA 5FEMA 4GS5A 2J87A 4BFLA 5CEJA 2YMPA 1QKKA 2B9VA 3P96A 1YRLA 1E3TA 4Q3NA 4JC5A 3PKZA 2FMIA 3TKAA 4QPPA 1YS1X 2F9FA 3BHJA 2VDNB 3NEJA 4N65A 3VM6A 2ETXA 3JQ9A 1QYDA 3BDVA 5DXJA 1Q0UA 1R3DA 3IPXA 3ZWDA 1FSGA 1NMXA 5DWVA 5F12A 1Z68A 1D1SA 3K9LA 3FYTA 3FBTA 4R69A 4IDBA 3G2OA 3P7MA 2ZI4A 2JB9A 1JAHA 2Y0DA 2PKEA 3DFIA 3PD0A 1YS6A 2J9GA 5FLKA 1JR6A 4JH0A 2R8EA 5CVCA 2P90A 2BL4A 1G3QA 3G8AA 4FGWA 4RKYA 3ZBQA 2A5JA 3P52A 3KS9A 2GJ9A 1ADJA 4H7EA 2HQOA 1YDHA 1I0LA 4X44A 3ZVLA 5KOJA 3B5IA 3UBMA 3E8XA 2WWHA 2B69A 1AQUA 1Y81A 2ODTX 3GMDA 3I04M 3BMQA 3M3PA 4FKBA 5DGCA 3VR1A 4F9FA 1MGPA 4CNQA 2H2IA 1FTWA 4H16A 1ZO8A 3OJEA 5AXCA 2A7QA 4LBVA 4JEHA 2GWRA 1LK7A 1VHDA 4O2AA 4RMNA 3AOGA 4NFLA 2CXQA 2OV4A 4QU5A 4URZR 3OX3A 3M1YA 3BSYA 1Y8CA 3QMVA 2CMHA 5LP6B 2AIRA 3FFBA 5INTA 3O8CA 2A88A 4P7FA 4A3SA 1DJMA 4DCSA 4CLRB 4MPDA 1FLVA 5FX2A 1WCWA 1TMYA 2AFHE 3U9TA 3ZDAA 1SUAA 1GZVA 1VL6A 1W47A 3HHEA 1W581 2JJ1D 3P4UA 3K0HA 1PDOA 3PDUA 4L22A 2ONJA 4B4WA 2O6HA 1XZHA 4JHLA 2QP9X 2VOJA 2XA2A 5D3MB 1WDMA 3A3OA 1EM8A 2GI4A 2ODWA 1JIUA 3W5UA 1DXOA 1T8YA 1VL2A 1NTOA 2ALJA 3HU3A 3QKRA 5AVVA 5F5NA 5JD5A 1MMFB 1EK2A 2I65A 4IL5A 1TCBA 5CUQA 5BT8A 4CKCB 1RAAA 5GOTA 3GLFB 3USZA 3KAQA 1TC1A 2A33A 3PUYA 3UJPA 1D4AA 4ABTA 1XEXA 1XCLA 1PZGA 2IY9A 2Y71A 4PXSA 5JARA 1NYRA 2W2LD 4Y2PA 3FLAA 5B7PA 2O8CA 2W8BA 1G18A 3TE7A 5JZSA 1DXHA 1SG0A 2Y92A 1WPGA 1M74A 1W5EA 4D79A 2PUFA 4BNIA 1MQAA 1QH0A 2ZSUA 3IVXA 4ENUA 3P9QA 1DG3A 3FGZA 3N8IA 3UFXB 2HA2A 1SVUA 4G0QA 2X3YA 3ZVNA 2ZIXA 1GAEO 2NO5A 3N7UA 4DY4A 2ABWA 4L1KA 2R3SA 2P2ZA 4AXXA 1IB0A 1Q14A 3ZHZA 2GN8A 4KWIA 2CVQA 2IJGX 4KUHA 5CAEB 2V03A 4HR7A 1QG6A 1VP9A 1SBZA 2Q2VA 3FJOA 3B6JA 1AUOA 3O9MA 2MSKA 3DV0A 4YACA 2BEUA 2F8LA 1IOWA 1QGAA 1U31A 4US2R 2VUTA 5TVKA 3B20A 4A03A 4HAIA 3NHWA 4AO8A 1Y6QA 3ORQA 3TVYA 1V7CA 4QNRA 4BFZA 1IDOA 2CXRA 3ABZA 4YRNA 2OESA 5BW6B 1MB0A 3SXPA 1U3VA 2PLWA 5F51A 3ZD8A 2DP4E 2PAFA 4NBRA 4JLJA 3BJZA 1A9RA 1D07A 1DHTA 3GFGA 3IP7A 4Z4EA 4V0MA 1VHQA 1K5PA 4L76A 4QEZA 2IUTA 5KSPA 4OEHA 3KZNA 3IQIX 2Y4OA 3H4IA 1GGVA 4R2XA 1F7UA 1LLCA 1P2VA 2OZKA 2VNIA 5CVUA 4EMTA 2QTWB 3K09A 1YZ3A 4BMPB 4GZ5A 5AW2A 4U5QA 5CFRA 1R4MB 1R8YA 1Z6YA 1EX6A 2FMHA 2I4MA 2Q1WA 2IRWA 1IJFA 1E6EA 3M6AA 3EXAA 3PT5A 4P3PA 4ETWA 1UEXC 3OE1A 5CYGA 3QV1A 1P80A 3N2NA 5A4AA 5KHLB 5TY0A 1EJ0A 1PDWA 1R8XA 3N53A 3A6LA 4RGYA 4QNNA 3UN1A 4FYHA 1J39A 1Y6FA 3E9NA 3CF4G 4RANA 1WTCA 3GUVA 4D97A 3IUNA 4ND3A 3MPUA 1PFYA 1SM4A 3EC2A 2B83A 4RCYA 4E6PA 5EA2A 3D8BA 5IG2A 3D5EA 3PQ2A 3W79A 2OV6A 4E5NA 1YQGA 1YL6A 3IDAA 3RQIA 4DBLC 5IM4A 1OF1A 2GPYA 3L8FA 4JX9A 2NZ8A 4C01A 1L9KA 3L7LA 3SS9X 2C88A 2H59A 4LDRA 3EHDA 3IV6A 3V4ZA 3ENNA 4P32A 5D3ZA 2Z1NA 4ND8B 4TT8A 1A9QA 3L7MA 4HB2A 3K4HA 5JVDA 1XAGA 4KXFB 2CDNA 3FDZA 1YR8A 3QYPA 1Q19A 2IYWA 1UKEA 3GP3A 3BJEA 1F51E 1EGQA 4D9NA 5AESA 1TEZA 1OILA 1W75A 4LC0A 4O2BB 5BSEA 1OX4B 1GGHA 3RYIB 3M5DA 3GJ5A 4HVAA 5JALA 3N2GA 3RS4A 3G79A 2KB0A 1X8JA 3RFXA 2HA7A 3AM1A 3LPDA 1SXJD 2OT3B 2VYQA 3EH2A 3JV7A 5DU2A 1KRHA 1H9AA 4ZGBA 1MX5A 2QJRA 2P69A 4TMFA 3UM9A 1H23A 5JJCA 2PQ6A 3AJEA 3H83A 3KEFA 4BLTA 2W37A 5AW3A 1GA4A 2PS1A 2QGFA 1EMDA 3C6KA 3QPVA 3R3VA 4XKJA 5EY5B 4DKXA 3R3HA 2WUWE 3DDOA 3BILA 2JEOA 1WSBA 4Q3OA 4W1QA 1NTRA 3MJFA 2WJAA 3LUFA 3PXBA 4QOIA 5JHGB 4HDSB 4MEJA 1ONOA 3C3JA 1OBHA 4PN7A 3KD3A 4AKEA 3TDMA 3RTBA 3HBFA 3OQIB 2ERXA 3TOVA 2UU9B 2GN2A 4MVJA 1IQPA 2H8KA 2I3GA 5K0BA 1TVCA 4JUFA 1QRSA 4G0VA 1O5TA 2QPTA 1ULZA 4PBTA 3W7VA 1A9XA 4N6OA 1K0FA 4C3VA 3UC9A 3JARA 3ZK8A 4CM8B 4P3KA 2QL6A 4GBMA 4ZHQB 3HFGA 4FLEA 3SDSA 1J9GA 4FB5A 5A71A 3PX2A 2RGRA 3D1JA 1N2EA 4XSVA 3LBFA 4UHKA 2DVMA 4O02B 4YQYA 3SP1A 3CFYA 2H4HA 2WKSA 2CUNA 2Y27A 1HNWB 1RYZA 2C78A 1ST3A 3LQ2A 4BO2A 2P9QA 3GQBA 4XDZA 2H5JA 4LWOA 1PEAA 3W4IA 2GZRA 1NQWA 1GEEA 1OI2A 2RC6A 1QS0A 2BGMA 1YRYE 3KD2A 4O4JB 2V7WA 3EVCA 2IGTA 4L0CA 5DTQA 5K6TA 4J0EA 2R11A 5AJZA 4IDNA 3TJMA 3PTZA 2GTHA 1PTJC 1XQ9A 3SJAA 3J80A 3KQKA 1DUIA 5HS6A 5B7GA 4O4IB 3LBYA 4AKIA 4D9IA 1QKJA 5K3BA 4MUJA 5THQA 4OBWA 4J7CA 1E9FA 1HPLA 1WD7A 4U0JA 2D2EA 2OQVA 2D0IA 4TL6A 1WQ1R 4HCJA 1ORWA 4MP8A 5LA6B 4OL9A 4PFKA 1HFKA 1WP4A 4ZAGA 1E2UA 1GWNA 2HGZA 3IODA 4BNYA 3JWIA 1QH1A 1FFDA 2PL3A 4I4TA 4MA0A 3VOTA 2FEWB 3DAYA 4AAYA 4D44A 4EL0A 2DG2A 3B6ZA 5AK6A 4JR1A 1PZEA 2VBCA 3HUEA 4G86A 2IS1A 3CLVA 3TDKA 4FYMA 1UXJA 4DV7B 1NBOA 1T9BA 2L19A 5D5QA 2FOXA 2QTRA 3OOWA 3TQQA 2GF0A 2X42A 3B3FA 5E3JA 2FPWA 1OXBB 2J48A 3DAHA 4NYJQ 1RJDA 3ACDA 1Y42X 3A1VA 1S7CA 1XC7A 4EARA 1UFRA 1KIAA 1G9XA 3BHNA 1O1YA 3R0QA 4RBNA 4ZJUA 1N33B 4WN9B 1MT3A 3KSUA 1EWTA 4C5CA 4NNOA 2BN4A 4KVFA 4L3WA 3KQQA 7YASA 2XVMA 3C6MA 4EB6B 1FDSA 1MX1A 1B93A 1NHWA 2R6GA 2XNCA 2AI2A 5L8VA 4W9MC 4DIBA 4QDJA 4BX3A 3BFXA 1TU3A 3EPJA 4XD7A 4DR1B 1V43A 2VJCA 3LTEA 4HUJA 4N41A 1CHDA 2FJUA 4UTOA 3K3PA 3S28A 4DMRA 4I8DA 4ZDWA 3DTNA 4FW8A 1F3OA 1YT5A 2Z08A 3CPHA 4KQHA 3M1AA 4X1YA 1T1IA 3T3OA 4L5JA 1BH2A 3EVFA 2JIOA 5JCZA 4RKRA 3Q7QA 1R4ZA 3IC5A 2CSUA 1BXRB 1D1PA 4CQNA 2D8AA 4BNDA 5MHTA 2ATIA 3X1WA 5K4HA 3OETA 3PK0A 3MILA 4UPDA 2VUIB 1U7ZA 3BRQA 3UXYA 2EKZA 5I48A 1MABA 3UMSA 2ZB4A 4KU4A 2NADA 3GW8A 1SC6A 4ZI5A 2W58A 1O6CA 4URYR 4RGQA 3HCPA 3R3JA 4LGMA 3VYRB 1DAFA 1PWEA 1BXZA 1PKXA 2JVKA 3M6VA 4LXXA 4QEKA 3VOAA 3GA0A 4Z0TA 3HMKA 3EEIA 2YCLA 3ZU2A 4AC9A 2N0SA 3ZHTA 3HXLA 4K2AA 2UUAB 4XVCA 3RRNA 2JLZA 1AQLA 1O6BA 1QZ3A 1GV1A 2BCEA 2VF8A 3LX6A 1TJNA 3QOFA 2EW8A 4GXQA 4U6NA 1PJSA 3UFBA 4AUMA 2EFYA 2VI5A 1SKMA 3PGJA 5E4JA 3RAEC 3C4VA 3PGVA 4Q03A 3EMVA 3OM0A 4CKYA 4BEWA 5A03A 2FG7C 2GCEA 4X24A 4ZV7A 1SPBS 4U3JA 3U40A 1SC3A 2B34A 2Z2KA 3IELA 4FFRA 4DTCA 4DB4A 4BYGA 2XBUA 1EK1A 1NVKA 3H2JA 4NAUA 2QRZA 2PXXA 3TZCA 4M86A 3LFTA 2BMVA 1ZH6A 4CF4A 4YEDA 4RADA 3QBDA 2O19A 1FQOA 4MI1A 4QFDA 1GQOA 1V39A 4HXFB 4M0CA 5DHQA 5EIBD 5CFLA 5LLTA 4OD0A 4OSPA 1TVEA 1D2NA 3TQHA 2SHKA 4ZC1A 3F6RA 3TZBA 1PK7A 4I1RA 1E61A 3MRVA 1C3JA 2E87A 4YV7A 1D9XA 4JLNA 4M98A 1SBTA 1SXQA 1IY8A 1UBNA 4ZOAA 5FP0A 2FWBA 3IKJA 1BYUA 3I05A 3N87A 4J3NA 4QOFA 5LQKA 4CKZA 4IUYA 4LW8A 3K9CA 4GMKA 4JIMA 3COVA 5E95A 4C03A 4DLSA 3OQPA 3PU6A 2QTVB 2IEAA 2ZQZA 3U4DA 2F3PA 1JR3A 2PUJA 4XPIB 5DX0A 3E9CA 5FUXA 3GWZA 3W05A 4TMZA 4UM8B 5B6PA 1JDSA 2VJMB 4H7PA 4HS9A 4RA6A 1RPAA 4MGHA 2G08A 2FZKA 5BNWA 1H2RS 4MARA 3NFYA 3SNHA 4WX2B 2XDWA 1QU3A 4R98A 1WUYA 1ZN7A 3G0IA 1IWPB 4H4CA 2CBZA 2X19A 1BE0A 2BZ0A 2XZLA 1TKAA 4U00A 1OSNA 2AQHA 3EG9A 3H2IA 1N2CA 4HGOA 1KR2A 2EJBA 3R3XA 2OENG 4LYYA 3C1OA 4GXNA 1Y3AA 4KLNA 4UHJA 4EEKA 3CNBA 4IUDS 1NN3A 1OKKA 4UNPA 1WXGA 5D5PA 3MWLA 5AVJA 2V7XA 3PPWA 3D6JA 3PVSA 1GFSA 1W85B 1ACMA 3KP1A 4HWTA 5DWDA 2X0EA 5K0TA 1FMFA 4HSGA 2V4UA 3HVUA 3KWJA 1G42A 2Q3CA 3SQMA 4XIYA 5FR1A 1F1BA 3EVNA 3GJXC 2XLCA 4HN9A 1R74A 1EE9A 2OC4A 3EC7A 3ZCPA 2Z8YM 4UCXA 1CB7A 4TV9A 5G1PA 3KX2A 3T4UA 2Q27A 4KLRA 3QW2A 4WZAE 3JQRA 4JB0A 2BGGA 4I9GA 5DTIA 4FFSA 1OXMA 4F1KA 3FBGA 4K87A 3U9LA 3U7QA 3T1TA 1G3RA 2JFPA 4ZAXA 2GDJA 4BNJA 4RVOA 1EP3B 1EU1A 1OYOA 3B1ZA 3A6EA 4U7HA 1U11A 2FPOA 2GXQA 1J23A 3FDJA 3O95A 3OZEA 5FBQB 2RHHA 2AW5A 5D00A 1BSVA 4J0QA 2HU2A 1SUEA 3JYHA 1K8QA 2PMEA 1ZGGA 4ZO9A 3TD6A 4D0GA 4IHKA 3LTNC 2PK3A 3WNDA 3V7YA 3OEED 3F8SA 2ZBUA 4TMVA 2QLMA 4NK4A 2BKEA 1OBCA 4FDLA 4TKVA 5L9AA 1TM4E 4OHYA 2AFHA 1NN0A 1N0HA 4L3OA 5H5JA 4NCHA 1TTHA 4DPKA 4JP5A 1ECGA 2J1LA 2WF8A 5DNAA 2DERA 2BUCA 1BMFD 2CLEB 2Z3WA 4C05A 1CQIA 2GRJA 2J4DA 3UZUA 3AY7A 5IDXA 1L5MA 1JB9A 1GCUA 2UZ1A 3NC4A 2SICE 4JSRA 2XRMA 2PKRA 1TAHA 3U31A 3VHRA 4M46A 1TYEB 1E3MA 1KE1A 4E3WA 4JSYA 3B6MA 4AUEA 2CC2A 3W9SA 4JYPA 2HLDD 4M0PA 5CRIA 1CUYA 3LHKA 4BU0A 2BFFB 3ZJVA 1WZNA 2DFKB 2H54A 2IPOA 2LNDA 2Q28A 1M6EX 2X7XA 4TWAA 1WUKS 2GNOA 5EKXA 5F9HA 1BQ3A 4LTMA 2Q3EA 5JD3A 1CJKC 3WJ7A 3VDMA 3QMMA 1F3LA 1H2FA 1K6JA 4FNMA 3MWYW 3OE5A 3STVA 3ESXA 1BCSB 1E60A 1OAOC 2YDYA 4Y6PA 5JXIA 4FZJA 1UP4A 2CFTA 3ZNNA 4M49A 3WWYA 4RGBA 1TK3A 2H2AA 4FMBB 1WE2A 2H16A 4MWOA 4EI2A 1XJ0A 2NM0A 3PHIA 4J43A 4KDRA 5DM70 1CBUA 3HDYA 3N0RA 1IQRA 3NWOA 1NFRA 2JCSA 3TSOA 4CV1A 4ER0A 1N6KA 4FDTA 2FPPA 1C14A 3OX4A 1W93A 3DMNA 1XZJA 4P2GA 1N1EA 1VI2A 5F77A 2MYPA 3HE3A 1W48A 5E9JA 1EVJA 3BEOA 4EYSA 4F3TA 3QU7A 2C58A 4OYYA 4MGKR 3T3NA 2Y0BA 4GPAA 1MOZA 1IK6A 1P7ZA 1W0JA 3O1IC 4KVAA 4ZOBA 4RQTA 1GKLA 4B46A 4YMVA 4E7PA 4KO2S 4YRIA 1ZUHA 3L93A 4AG5A 1YC5A 3OPVA 1RHQA 3QWIA 4EG6A 3DC7A 4MRAA 1U1DA 5JADA 2JFUA 4NCBA 5KOHA 3WTCA 3R41A 2PJDA 1H6AA 4UFOA 1ZK3A 4EUKA 2XYGA 3QJGA 3X2SA 3GRAA 4KG7A 1L5HB 3ZY2A 3ORSA 3LCVB 5A6VA 1FUIA 4NMXB 1Q77A 1JHPA 4RELA 2WU1A 5KVQA 2RGEA 2WG2A 4ODIA 1OC4A 1ZM4A 2QX9A 1NOIA 3E1GA 3ZU6A 1EM6A 3JD2A 2QK4A 3OD1A 4Q3LA 3HI4A 2Q0HA 1UXKA 1HYEA 4H7KA 2Z5VA 5GGXA 2MYNA 4EYKA 5H7XA 5DW0A 2X8JA 3FCOA 4OG2A 4DLZA 5ALPA 2BGNA 4FE7A 1J1UA 2VPPA 1YJ8A 3CNNA 4ZO8A 5DFAA 5AKIA 1H9CA 1YMUA 4YP9A 3H3FA 2LCQA 4M1SA 1M2OB 1W4CA 5HSGA 3PG5A 2RH9B 2WKQA 5AKJA 1FTSA 3SYKA 1I6KA 3Q6IA 3FSGA 5C4IA 3TH5A 1I0IA 1TQDA 2XUIA 1R6BX 5JRZA 4S05A 4G89A 5CGQB 5F7JA 2P6PA 2W90A 2F2TA 5H83A 4ZGGA 5LMNB 2NO0A 5IM5A 2X3UA 3L8YA 3TQIA 3KYBA 4E2XA 4Q1FA 3C8ZA 3TLXA 3WNVA 1WDTA 2C2KA 4DGSA 5IUNC 1CP3A 5EXDA 1JQJC 4HX9A 4JDUA 4LYEA 2O8EA 3OIFA 4LNUA 4XYLA 2YBDA 3PX3A 1FZQA 2OCAA 3FNIA 4GGMX 2AG1A 5E6SA 1NF3A 4NMMA 4MWSA 4JOCA 1YH3A 5AR1A 4QG7A 2KHZA 3W77A 3ESYA 3M6IA 1H5NA 4IRUB 3LZCA 4O0LA 4EFKA 3MEQA 3SEFA 2FU5C 2GZMA 3NIFB 1DKOA 1ZUD1 3QXHA 3FYSA 4O5AA 2P8JA 3T06B 3MSXA 2ZUCA 4DCUA 4U2DA 3PXEA 4UHHA 2HMYB 4MWCA 4N82A 1Q50A 4MHSA 3ESAA 4R16A 3GZJA 1BXGA 2FMFA 1DKRA 3DAGA 3H9QA 1RP1A 2I67A 3OTQA 1RWMA 3W6PA 3REGA 1NMEA 1HE4A 3WI7A 3VHXA 4IJQA 5BNTA 4P82A 1ORIA 3T5PA 4O8ZA 4ISBA 1LXCA 2C31A 4ER7A 3LUAA 1XFDA 1HBJA 2ZRGA 1P2BA 2FFBA 2IXEA 2XNHA 1BDBA 1CDDA 4PNHA 5JNSA 1IN7A 3G2QA 4L9SA 3CN7A 1YQWA 1X1EA 4BVBA 4RESA 5IKPA 2QENA 3O7MA 5KU1A 3TIIA 2Q5QA 4ZALA 5ALMA 5BSKA 4ATNA 4C22A 4MGIR 4NQZA 3WR5A 4RENA 1QLHA 2Y68A 4D4GA 1P3Y1 4R8RA 1FFWA 4U9IS 5J4YA 1A8SA 5HMMA 2UXDB 2I66A 2QJTA 3D3EA 1VE3A 4JKYA 2C95A 3NBFA 1W46A 3O8NA 4M8IA 4Y2RA 4ZQEA 4I2NA 3AGPA 3ILVA 4NULA 2OPHA 3FDFA 3RVOA 3AF0A 4ZK6A 4L85A 1UAAA 2FOIA 1NX9A 1U2DC 2KPOA 2QTTA 1CUAA 3TTVA 4YCNA 5DHTA 4AXBA 3C2QA 4J0CA 1CZUA 4DCCA 1ZSVA 3X1YA 5KDOA 5KYUB 3CMMA 5GIPE 1U3FA 2YN4A 3N8HA 4FUTA 1OY1A 5AKKA 3O8RA 1SCUA 3DMHA 1K63A 3O4JA 3WQHA 4CDGA 2PCLA 1P5HA 4HUTA 2RGXA 1XTPA 3M1LA 2CL0X 2QRJA 2H7XA 3NHKA 4EYOA 3IT3A 1O0SA 2AJCA 3H5VA 4J16C 3FSRA 1WNTA 2Q1XA 4GSKA 3TFWA 3QTLA 1NMYA 1VHWA 3CNEA 5IAOA 3CB2A 3TAUA 1XWIA 3U09A 3LPCA 3PDIB 1XIVA 1ZIPA 2VHQA 2E21A 2ENWA 5FIUA 4CUZA 1ZG3A 3ET5A 4TTQA 1OFIA 1KU0A 5HFNA 1I1HA 1ONBA 3E2IA 1ISSA 4G2NA 1KYIA 4RCVA 1R3UA 3ZKWB 3NHRA 4QXQA 1N34B 3TXYA 2JIZA 2BVNA 3PR3A 2J3LA 1FDVA 5C1IA 4WK0B 4GLBA 2VCYA 2YOHA 2VA9A 2FMXA 2MSEB 3M1IA 1B73A 1TJ4A 5E1OA 1NI4A 2AN5A 2Q3JA 3BMNA 3MS2A 3QU2A 1U3TA 3E8MA 1SWVA 3DF7A 4JQSA 4RKWA 5B37A 2ECQA 4IQFA 2W6QA 1K6IA 1RTTA 2ZW9A 3AKCA 3L8HA 2RG7A 2H63A 4QC2A 4QPDA 4X84A 5DRYA 2J7KA 2VNKA 1P9LA 2R87A 3ENZA 1Y1PA 2HK7A 4GPZA 4J1NA 3X1XA 4GHWA 2NVUA 3NTOA 1TJPB 1ZJJA 4KQGA 4KPEC 5A4FS 3FNBA 2AKEA 3U7GA 5B4TA 5FPYA 3D3NA 3T7TA 3THYA 1SC1A 4ZRDA 3ADKA 4K6KA 5TE9A 2R6ZA 4B5LA 3ADPA 5AUPB 2R4QA 4YTEA 2WF7A 3H84A 3VAZA 3ZDQA 4RZ2A 4M0DA 1FU4A 1PAUA 1ZI6A 2QPLA 3B13B 4W4TA 4JKIA 1TF2A 3C8UA 3G1UA 2FR0A 3WRXC 4EAQA 1SOUA 2IKQA 5TGZA 3BH6A 6Q21A 2QT9A 2EX0A 1W4AA 4ARCA 3EC1A 1Z6ZA 3LDGA 5JATA 3VPBA 1A4RA 3G23A 3S4YA 3THXA 3CPSA 1UM8A 4RABA 4HEA1 1EE1A 1PG5A 2I9PA 4ZWNA 2X77A 3DNFA 4OI2A 1ADGA 3OAAA 3WQQA 1RPZA 1Y98A 3EMDA 2A5DA 5GQSA 1VHJA 4QFCA 3HWSA 2CNKA 5CTAA 2BBTA 2YHIA 3NIWA 2ZRMA 3JQBA 1NW3A 3A6DA 3P9YA 1C7EA 1Z4QA 2BGUA 4LZZA 3W5SA 1UH5A 1ZYUA 2VJOA 4Q4HB 2IEDA 2YH2A 2L0XA 4YCMA 2NU6A 4TSKA 4U7PB 3QPCA 4N54A 2QVYX 2EBFX 4JUDX 4PZUA 3JQFC 4LY6A 3L04A 3QFCA 3EULA 5CK5A 3DCNA 5FUMA 1PLLA 3N5CA 3W2IA 3D2LA 3SHWA 1KQFA 4ESVA 3OLZA 1OFTA 4F4CA 4J0DA 1AHHA 3BZBA 3QU4A 4P7KA 2PGDA 4LXIA 1ZGZA 3VR3D 2OZVA 4RPGA 4CLEA 5FWYA 2ZZNA 1Y8QA 2VJNA 4QTXA 4PQFA 2XUKA 1W44A 2DJIA 4HEA6 2FX3A 2WD9A 3MCVA 4MR7A 4MW7A 2P3SA 3OPXA 3PJFA 3BWBA 5DP2A 3MSCA 3FKJA 1G8MA 3P19A 5L3RA 2CLKB 3IMGA 3MT0A 1W2HA 4B17A 4GI5A 4YCLA 2FZCA 5B57C 4FZ5A 1NY5A 4MCJA 1CXZA 3FCXA 3UIEA 4CBVA 1E4YA 3AB7A 1PP4A 4JB3A 5CIWA 3VR2D 1LSSA 2MMGA 2WWWA 3NBKA 4QBKA 4RTKA 2WQ7A 4GKKB 4KRGA 1F60A 3I9LA 3NBZC 3OLCX 4YMSA 4KHPB 2O2YA 1P9OA 4OUDA 1PLKA 4QQNA 4FCVA 4AMUA 1T5BA 1MAWA 2BIFA 2BOVA 1JAZA 5EIOA 1G5HA 2LP4Y 2WM9B 2WVHA 2ZBRA 4JGIA 4KFSA 5JZBA 2WJ4A 4JBLA 2REOA 5J63A 4NZYA 1N2BA 3DEHA 1FDTA 1TEXA 1YZKA 1K97A 2EGUA 2XQIA 3M2PA 1JDPA 5DF1A 4M1ZA 4P0PB 4XVQA 1NMQA 3WDLA 5IJXA 1V0JA 2B4QA 2JI6A 3WDSA 4KIGA 2HFJA 1T9GS 2GFIA 4EGJA 5F23A 4NH4A 2A0XA 3UMGA 3BQMB 2FPIA 2QW8A 3NJ4A 1IY9A 1UZLA 5AI6A 1F8FA 4M1YA 4AZVA 1SJ9A 2JZNA 5KJ1A 4ER6A 1XXHE 2EGGA 3VSBA 5BYKA 3VO2A 2FPGA 2FQQA 2YWJA 1E2FA 1JSLA 4KQMA 3O38A 4ZQFA 4AG3A 5KSYA 2DCUA 1EB9A 4EDHA 5H70A 5H3LA 3UC5A 4WZAA 4L5IA 1P4RA 4B6FA 1FNBA 2XF8A 4TRMA 5TF0A 2J5QA 2JS7A 4LN1A 4BNUA 4UM7A 1LPAB 3RV4A 9ABPA 3LF1A 3HA2A 3U3XA 1IVSA 2H5IA 1ZNXA 4L5YA 5KTSA 2ZB3A 2P30A 2XGSA 5EE9A 5LYJF 1RXCA 4BB0A 2OMEA 3WGYA 2G1UA 4JZKA 2Q3MA 5T6BA 1V7ZA 1JJ7A 3ZXYA 2R86A 7AT1A 4MUNA 2W2MA 2XRZA 1KYQA 2IH5A 1O0BA 2RK4A 1QIMA 4K26A 3HDTA 3ILHA 2GZHA 5FYDA 1Y1QA 4B74A 4OI0A 1D8TA 1W8IA 2V4MA 4UXIA 3CHYA 5FWXA 4RK0A 1K7XB 3ZWXA 3QEBZ 2PKXA 5IAAA 3ZJYA 2XT0A 2HTEA 3HYTA 4Y98A 5A62A 1GFWA 4N0MA 3ULKA 1X9GA 3HKDA 4MYUA 1XZCA 2QG4A 1Q17A 1XA4A 5ED4A 1S2DA 2IBTA 1C4XA 1QZTA 4E30A 4ZHSA 1X7GA 4BB5A 1C9MA 1UOOA 1SU4A 4G5YA 3NWJA 3KWMA 2YJ4A 3EUWA 3H9GA 2HX1A 4FPXA 4GGPA 3RHZA 1P7CA 4AIIA 2A4KA 4QVKA 1J25A 2BT4A 3HFRA 1U2EA 3FPCA 5JCXA 4ZGWA 4IDQA 3DHNA 5CT6A 3U26A 2E3JA 4ES6A 5A4KA 2AC2A 3HV0A 1W7AA 3IIIA 5CT9A 4HT3B 2O9JA 4HSEA 4D42A 1J20A 2R8XA 3Q7TA 4Z1OA 4XX0B 4B32A 2EOAA 3LP8A 5FNZA 1G7CA 1U3CA 4BVEA 3OSZA 1UF9A 1DEXA 4GZ6A 1PR4A 2CWDA 5C37A 1P61B 3O0DA 1L4BA 2ZUDA 5GJCA 4NBSA 2IS4A 1F8GA 2BZ1A 3FVWA 4EFLA 3VJMA 3LI2A 5BN3B 4MRVA 1K68A 2BFDB 3EQ7A 5L6MB 2YYZA 4OU4A 3ETNA 1AE1A 3FYUB 4YP6A 3FD8A 3IRVA 3ZDYB 1PZMA 4OIMA 2DPLA 3BJMA 3DWEX 3UUWA 3BMCB 1CFJA 2MCFA 1G2OA 1CY0A 3DQPA 5MN5A 2IUFA 4YR9A 4BX0A 3TEFA 2HLNA 4A8JC 2CK3D 5EE0A 5HQJA 2PUBA 3SMQA 2XOKA 1TYZA 2AR9A 2H4JA 3AOEC 3X3HA 5J2UF 2YV5A 2OHHA 1ZRMA 3ABRB 3IOEA 2OCPA 5HK9A 2I3ZA 3O73A 2L69A 3ANLA 1D6NA 1LC3A 4JT2A 4AJOA 1BZYA 2P7IA 4ZYVA 4ZT3A 3R7WB 3AB3A 4MB2A 2AQIA 1RQRA 3IJRA 4JLKA 2RGBA 4OXYA 2JJQA 1FUYB 3VTFA 5ITZB 2YIMA 5AHRA 2GSDA 1F5SA 3CEHA 4PRZA 4D8WA 1GCIA 2ZE6A 2QMUA 5FBVB 2JF0A 5FHQA 3EUFA 1EXVA 1NJSA 2J3HA 1TQ2A 3IQZA 1EFRA 4V03A 5I7EA 2ZT5A 1W36B 1LX7A 5CBPB 2AYZA 3I1JA 5EUQB 1A2KC 1JYEA 2WYHA 1I3CA 2BP7A 3E53A 3W6OA 3NHPA 2C4KA 4WXRA 5DCLA 4BJ5A 2VYVA 1P1KA 2R5FA 3BGIA 3ZOZA 2JEZA 2QV7A 3KQOA 3QG5A 3KAKA 3KFVA 2GO1A 1E1RD 1SVSA 4N12A 4RE5A 1THTA 2QF7A 4ILKA 4M9SA 1G16A 4WE3A 3UWOA 2JGLA 5F7OA 3PE6A 1VMIA 3BWXA 4Z8XA 3ZBTA 5BUQA 1BHO1 5FPSA 3V1KA 5HE9A 5CA0A 4YAJA 1N9GA 4NCNA 2YFKA 1VE7A 3N05A 3V4OA 3FVTA 3GRKA 3V9AA 4EX6A 3V6LA 2G40A 2X4IA 4IILA 4WNAB 1MJGA 2ORWA 1SUIA 2F1IA 4FNAA 4BP1A 1FXWF 2QUJA 3GLGB 2HN9A 1L6IA 1RWNA 2AHOA 2NUPB 1KGSA 2BE7A 1G21A 1N25A 2BM1A 2E4XA 4RS4A 4UBMA 4YMIA 4R5HA 3ZXSA 4GE0A 3RHSA 4XI9A 3B9PA 1U9CA 4QWMA 2O2JA 2P65A 1RYBA 1UP6A 3D4PA 3ELBA 3NGLA 4J1TC 4GXRA 2IHZA 1ML4A 4HWKA 4M8SA 2FGKA 5CFMA 4WZBE 2NAFA 1V26A 4FXPA 2C5EA 4JU8A 5JTUA 2ZM6B 1Z62A 3U3RA 3PHGA 3P5BA 1DG1G 2YRXA 4ZZ2A 3LGXA 2G4VA 3AR2A 3TQSA 3MAAC 1MOPA 2OO3A 1W1UA 3KT0A 4RF3A 3K8QA 4CI0B 1QSGA 1JE1A 1V1RB 2Z95A 3K9BA 4YQFA 4DMUB 3CXRA 1L5NA 1OXKB 3P27A 4LC9A 4PHHA 5DB4A 3W8DA 3WFIA 2N47A 3STTA 3LBAA 5CXQA 3P5SA 4DADA 3RYHB 2HB6A 4JJ8A 5JJ5A 1EXMA 3U61B 1R64A 1M2VA 2ERYA 2QZSA 1QV7A 2BFNA 3GFQA 4L28A 2QX4A 4NMLA 1TFUA 1XZDA 2BEWB 3OLQA 3NOXA 3CX7A 2VQEB 1U0NA 2A9JA 2XTZA 4M1EA 4K81B 1SXPA 2HZBA 3TK1A 1DQNA 4WCDA 2OD7A 3R9KA 3HU5A 4IMPA 3RABA 3KL4A 2VSFA 4J0JA 2G9NA 2BMWA 1V1MB 1W2GA 3HDVA 2QA5A 4KXWA 3UMFA 4YO7A 1LVUA 1NVDA 1NIJA 1SXJE 2ZAIA 1LF0A 4FWBA 5D7BA 4AVYA 4AZWA 1J0AA 1AS2A 1Y7IA 1XDZA 1U7DA 3UAXA 4W7HA 2VAMA 1Z39A 2WE7A 1YRWA 2DWOA 4IJ6A 3RTEA 4TLDA 5JNWA 2B2CA 2JLVA 1UBOS 1HM5A 3E23A 5ETJA 2HBQA 1YB4A 4M7OA 1L5QA 5FWDA 3WQBA 2RI6A 1JG1A 3IJPA 5IU6A 2IX3A 3P2KA 3OIWA 4AJHA 1AIPA 1T1SA 3B5JA 3MGCA 5C1PA 4PG7A 4QSHA 5EYPA 5EXPA 5IEBA 4HZUA 1NPYA 3KTAB 3VKWA 3R76A 1FE8A 4XPZA 1QO9A 4P36A 5D7NA 1EPUA 1ZLYA 4I4TB 1UKVY 4FR0A 3VVMA 3FPGA 4D7AA 3RVJA 2HHLA 1NMZA 1RRFA 4Q7LA 1KOFA 3KR2A 4RZ3A 5DYWA 3K6SA 1OIWA 1Y9JA 1QVRA 3VQTA 4B7XA 1L8XA 1YE3A 2J9FA 3EXG1 3GVCA 3L05A 3I2JA 5GY7A 1Z5PA 5DYYA 3UGTA 3ZWCA 1L5RA 1WNFA 4MH0R 4D9BA 4PN3A 4WBNA 4B09A 1A97A 2P6MA 1K6XA 1YQTA 1X7YB 2WMYA 3FF1A 1E1DA 1MAHA 3BIOA 4HFNA 3STUA 2NP7A 4I5FA 2VZLA 4L73A 2C7BA 4Y9DA 3OQ6A 3PIRA 5HGJA 4X6YA 2GH1A 3EDCA 5ALLA 3LD9A 3I76A 3UJDA 2GEDA 1QP4A 2XBMA 4YLGA 5F5XA 1TB4A 4QREA 3LFHA 3DHVA 1LCIA 2UVPB 2NYVA 3L1VA 3OWOA 4QTZA 5DBOA 5HXAA 3NH9A 3IAUA 1E5TA 1TI7A 1G7TA 3NLLA 5BWNA 4BWGA 4E14A 1JBKA 1GCOA 4MW6A 4OHPA 1Q1GA 5G0UA 2WBLC 3E8SA 2GUGA 3HJBA 3H1GA 2QBYB 3G0HA 2FW9A 5FBWB 3H86A 5IW8A 3TIXB 3ZGNA 3L9WA 2ACWA 1RVDA 4EGCB 1L9XA 1S02A 4JBGA 1MRSA 3HXPA 1KBQA 3WGMA 4EY6A 1AMUA 1TKRA 2VAXA 1A27A 2WAXA 3I73A 3CNQS 3ETCA 5ARDA 4DF3A 4JJ4A 4QGGA 2MR5A 4MRPA 1U0BB 2NUAA 1YU6A 2DR3A 2SECE 4L15A 3C24A 5AVRA 1BVHA 2ERCA 2PXHA 2I4NA 1VL8A 3NWPA 1UDWA 2DYKA 2OILA 4J90A 4MV4A 1VPLA 2D1QA 2DH5A 3B6KA 4MV3A 1CQJA 1LSOA 2ZIEA 5IABA 4BVGA 1MEJA 4PS0A 2E4AA 4F56A 4RIIA 1RS0A 5BN4A 5BNZA 1M8KA 2AK2A 1Q44A 1VL1A 1KNXA 3DDCA 5BW5A 5FUQA 3SQXA 5CA1A 2JI4A 4MVCA 1E3EA 4U6QA 4LTDA 5BUCA 3TF5A 1REQB 1ZMOA 1WO8A 1HT1E 3O3MB 1RXVA 2EVWX 5AK4A 4M2LA 3DGEC 2WHQA 3T3MB 1BU5A 1J5EB 4L4UA 5JV5A 3GFFA 4HBGA 2RK6A 3HNRA 5CNJA 4X45A 3W5JA 3WQRA 3BJIC 2BFAA 3QTBA 4ZAZA 1QRTA 4URWR 6ADHA 4GI7A 1UQRA 2VEDA 3EWIA 1VC2A 1JDBB 4H9GA 2ZVQX 5EP1A 2HSZA 4C2BA 4HNTA 3AVXA 1JDTA 3KUUA 4G1EB 3OPYI 1LB1B 1EB8A 1U4OA 3L7KA 4MV9A 3AWIA 4ZANA 4A0QA 1X77A 3ENQA 2NSHA 1PJAA 2ZI6A 5REQB 3V4VB 2IHTA 2R2GA 4QBGB 3IAS1 4UE3S 1GZ7A 2GN9A 2MIIA 3OQVA 4NG5A 1WSWA 1NC1A 4TV9F 3TMYA 4YONB 4RKEA 1MX3A 2UYGA 2AFVA 2PT5A 4KE9A 2IEBA 4ENQA 3BXZA 3ZE7A 2JJ2D 2PLAA 3PP8A 1XLUA 1YR9A 1YS4A 2HIMA 2V97A 5K6AA 2RHCA 1PGJA 3I01M 1DT3A 3HCOA 1CEEA 1ZI9A 1C3LA 2NZJA 3EZFA 4HYQA 3IPAA 4JBNA 3HY4A 1TUBB 3H11A 1WSAA 1O89A 3HI6A 4JJGA 1UZNA 1E1YA 2PR2A 2XVYA 3DV9A 1TQ4A 1JEQA 2ZJBA 2MHCA 3MWEA 4RFSB 4DV2B 2F1KA 1RI2A 4B6GA 3RS8A 2W2OA 3MGBA 2ZJZA 4NPHA 5DNVA 4DUGD 2R1TA 3BWVA 4I0WB 3WB0A 4AKTA 4DQ0A 3N8DA 5A4JA 1SXIA 5AUQA 3ZG6A 2LWIA 1C8VB 1IQUA 1LPMA 4LRYA 4NZZA 4YCBA 4CLDA 1UMBB 3WYAA 2GF2A 2W6ID 3SFTA 4BIIA 3U39A 2CN1A 1VLQA 2IFTA 3WBKA 3Q8LA 3CCBA 1FW8A 4RFVA 5H02A 2XNDA 3G49A 3HJUA 4X8MA 5KCMA 4CU2A 1G2IA 1D0VA 1E63A 1RYFA 2D2XA 4UDXX 2EG9A 2IIBA 3LF2A 1CRLA 3QVSA 4F4HA 5KVSA 4E5UA 4U7GA 1XDUA 3GFTA 1IVYA 5JMPA 1PTJA 3D9QX 3W7BA 2C2ZA 4G5FA 3FOZA 1E5VA 1FS5A 4RSGA 1AC5A 2E6KA 3VR4H 2M2IA 5I7SA 4R5MA 3WGTA 4BLWA 3KB8A 3P2MA 1DAHA 1R10A 4AYWA 2R25B 3NIBA 2F3TA 3U3MA 5ALKA 2OHIA 5BYBA 3I45A 1UEIA 5JAOA 3IAM1 4A2WA 4NU0A 3KSBC 1USUA 5AVSA 5K2MA 2IXTA 1M8FA 4OHBA 3WISA 5HJEA 5L3QB 1U28C 2Q3FA 2V6FA 4IH9A 1VPVA 2GKSA 5BYAA 3JQ7B 5BWOA 5F73A 1PNVA 3WAKA 3UH1A 3SQWA 1G7SA 1RRPA 2RCYA 5GV8A 2PZMA 1UPTA 1X8KA 1S4QA 1EVKA 2Q07A 3QF7A 3LX8A 1N7HA 3ROQA 2HUNA 4EQ6B 3BXOA 4EUHA 3UPUA 2FXVA 2XR1A 5MDHA 3OQHA 3NV7A 4BVFA 3IQFA 5IASA 3CF4A 3LPAA 3QK7A 1KVTA 2YMMA 5T8KA 2XQFA 3HFSA 4HTFB 3SQDA 1PG0A 3KYIB 4CDRA 2IPMA 1OCEA 1RRMA 2DBRA 1QQ5A 4AJLA 4I4IA 2EZTA 3RRFA 4INJA 1H94A 4MS4A 1XNJA 3L0DA 1JVNA 4OBBA 4DIOA 1PV4A 1IXKA 2DC1A 2E4UA 3GGJA 3LT0A 2Z0MA 2XIQA 5KHAA 5IX8A 4IRMA 2RG1A 1XHFA 3JR3A 5A05A 1ZU4A 1CQPA 2DTDA 3NAGA 2VIIA 5EJIA 4MCIA 1HDEA 2OA0A 3GBVA 1YE5A 3PXUA 2IOHA 1SH7A 1T9ZA 4XX1A 1JJVA 2NOAA 4INZA 4CL8A 4EG5A 2J5KA 821PA 2XTMA 1XK7A 4PTLA 1ZC3A 3AGQA 1QX4A 4ZT5A 1PKEA 4OFBA 1NDHA 4PCAA 3AF3A 1SA0A 1O6GA 1CYDA 5I51A 4OF4A 4WXPA 1OWLA 3MCAA 1HDXA 1EWKA 1OW3B 2JFZA 3DE2X 3LQ1A 4WOPA 3VOSA 4L4SA 3P9XA 1T8SA 3GOQA 4CM9A 2I1LA 4F3YA 2PN1A 3KCQA 2R6CA 1GA6A 1PJ4A 2LIVA 2X2PA 3D5TA 4FU0A 4BVHA 3K0CA 3ZV4A 1YRAA 6YASA 2NV0A 4UD2A 3DT9A 3FB4A 1QDEA 4GKAA 3S2SA 3RUPA 1BQ4A 2PSHA 1XZPA 4DY6A 3B7WA 3H42B 4YRCA 1BROA 2O1WA 3W2FA 1YIOA 2DUJA 3H8SA 5ED0A 2FK8A 4LXTA 3CISA 3WWEA 3WIVA 4C0JA 3ZY3A 4LVNA 4B31A 2QRHA 4JAVC 4EHNA 3GLFE 5I6DA 1U81A 1RM0A 3OJFA 4WXMA 2H3EA 2OXCA 3DOUA 2B6HA 2WD8A 1JG7A 3TZLA 1CHNA 2XSZA 2XMDA 5E9AA 2Q9UA 1GPDG 5B5SA 1CY2A 1MD9A 5SZIA 2GZSA 2H2WA 5EEGA 3T1OA 3HN6A 5ADHA 1CX9B 1UOQA 2FTKE 3M5WA 4PPYA 4XRGA 2BKUA 1CS0B 2R84A 4L7QA 1W36D 3PNBA 4JUIA 4KKXB 1J2EA 3D7NA 3D8RA 3LK7A 5CDTA 1YS2X 2QR3A 5JMWA 4PG8A 3PDJA 3QVXA 5EIAA 2IZ1A 5B1SA 3V1LA 4EELA 2BWJA 2QIOA 4YAFA 1Y3DE 4DWJA 4H08A 4DANA 1N2GA 4PPNA 5AH0A 1HQKA 2F59A 2HTFA 4RKFA 3ANTA 4S1OA 5F2EA 5BMVA 2Y9PB 5IWCA 2O8DA 4OGWA 1KYXA 3GP5A 3OJLA 4NOKA 2ODPA 2WIGA 1I4WA 2REBA 4JYCA 2QL5A 2R1UA 4F5ZA 3EEOA 4FBGA 5H80A 3JZFA 3K9FC 4W5WA 4D0NA 3PCRB 3T5AA 4LF8B 2NV2B 1GPNA 1R5JA 5HKBA 2ZUWA 3NR2A 3SY8A 3TTUA 2GHQA 4WY2A 4XZ3A 3B9RA 3W1WA 2IL1A 3AUAA 2FZ5A 3ZK9A 2NVWA 4EG8A 1M8JA 1W25A 2JLXA 1PGQA 3DA8A 3MLBA 3LBIA 4ZQIA 3VPGA 2QTAA 4NBUA 4PLCA 4WT7A 3HYCA 2SKCA 1YK1A 2QPOA 3TJZA 1E3DA 3PWSA 3T9BA 2YFQA 4Z7QB 3NUZA 4KPGA 1VFPA 2QKYA 4ZC8A 1DBIA 1UXOA 1AURA 1C0PA 4HAWA 2VHYA 3C41J 5LXTA 4WA8A 3NQ41 4ZAFA 3WSWA 3HO1A 1Z8HA 4MLDA 2O3TA 3S40A 3DO6A 3AH8A 5FFFA 3MTBA 3OIYA 1TA4A 3BBLA 2CMGA 4XJTA 3O0TA 5JLJA 5JG7A 4EG4A 3U7HB 1UBUS 3VPDA 2CLSA 3KZKA 1U8UA 2ZM5A 4OJYA 1R6AA 1DTEA 4MV7A 1RAIA 2H7CA 1A8IA 1CNEA 1V11B 5HBRA 4Q3CA 4R01A 5CD1A 3KQUA 3ICOA 3NM6B 1XPOA 1KYVA 3FMOB 1SMKA 3QGMA 1F6DA 1YBMA 1NXOA 2NTNA 2J59A 4RQBA 5D86A 1JEYB 5EJGA 4YRTA 3SJCA 1A5BB 3QPBA 2QGZA 4YNBA 5ALYA 3RU3A 4FEEA 1S2IA 1JFFB 1Z7WA 4V1CI 2CHVA 4YPOA 2E18A 5DYTA 2R1VB 1UBHS 4QGBA 3SSMA 1HZZC 2VSNA 1L5LA 3WGVA 1QUEA 1I10A 5J4KA 2EQAA 3X1DA 1D8AA 2FH5B 4Z4GA 3HCAA 2OLEA 3ZK7A 3ORHA 4L78A 5ER6A 1RHRA 2QUBA 1IVNA 1J1ZA 1U0JA 1YL7A 1BJTA 4WY8A 4RXMA 1C1XB 3CKLA 4DABA 2G77B 4LJ8A 1CPYA 1GUYA 2CXNA 1DADA 2IEZA 3FAZA 2P4SA 3FNQA 3L6BA 3ZGYA 2QRVB 3VJKA 2YJ6A 4V2IA 5FLYA 3I5XA 3D3KA 1QGED 4DIKA 4DXDA 1F8UA 1P18A 1TD9A 3DMRA 4OQXA 4DNOA 1E98A 1XTVA 2HDHA 2YYSA 1YVDA 4HB0A 5G0TA 4Q16A 3UF0A 1BIFA 1WDLA 2VPTA 3G6KA 5CP8A 4QLAA 5FJIA 4C30A 3IKTA 1Q3HA 1T8TA 1XGKA 2ORYA 3QH4A 1DCKA 3QEMA 2A35A 2NVBA 1KK0A 4IDCA 3A3PA 2H92A 4L8VA 1V5GA 3TLYA 4LIPD 3U3JA 2ZUVA 2WFAA 1M5UA 4CEIA 1I3KA 4X65B 4W9RA 5KI6A 1WRBA 2N1BA 5I9LA 3MJEA 1FVHA 2HXYA 1OFHA 1W5BA 3VTZA 2P1RA 2YXEA 3R6WA 3A1CA 5JAHA 5KVAA 4LF7B 3K70B 3HPRA 1XX6A 2RIRA 3R0VA 2IX9A 2O4UX 1KYWA 4NARA 3ZE2B 3VO8A 4J9VA 5P21A 1QH8A 2I80A 2X0IA 3SKVA 1SUFA 4CIYA 3MRSA 2JGDA 1X1RA 3DKKA 1NNLA 4OHCA 5ILQA 3W1VA 4DWOA 2YL2A 3ED1A 1Z83A 3EZXA 4GUAA 4B0OA 1E6UA 4DSTA 2JZCA 4NEQA 4YAGA 4WLFA 5C7OO 2H85A 2KYRA 4CMHA 2YV4A 1NATA 5ILOA 4UAVA 1OI7A 3V4RA 1XRQA 4ZARA 5BQ3A 5EP4A 4X1KA 2WUEA 4NECA 1EI9A 3D0OA 2EP7A 3KZMA 4EKEA 3AEKA 3D6TB 3OMLA 4MVYA 2CB9A 2RC5A 2IHBA 4KPUA 2JKZA 3V7WA 1RJEA 3G88A 2ZIUB 3GD7A 3SJBA 2I29A 3PEUA 1D5CA 2I7TA 2VJLA 4JK3A 4QOHA 4E5YA 1OAAA 2ZWOA 4HJRA 3HZHA 4BVAA 4R2HA 4HATA 3TTWA 1T2UA 1EFUA 5JCPA 2Y1DA 1CUFA 3C1TA 4FEGA 2VAPA 4XIIA 1C3OA 3UAVA 3W5VA 4BQNA 1WW2A 3D7MA 4ENRA 1LLUA 3ZCTA 3BMOB 3W8NA 3GHHA 4EWLA 1QYVA 3KVNA 4BIMA 1KYTA 5HIMA 1OHHA 4PYMA 3BXPA 2WJZB 3AHHA 4I5GA 2GM4A 3LWZA 1N2OA 3P2EA 3DE0X 5HF9A 1FTQA 2AOTA 3TOSA 1TT5B 4M60A 3ZWBA 4F6CA 1FVXA 4RHXA 4RZHA 3PS9A 4BNZA 4BKPA 1VM6A 1XQ6A 4BO1A 1I24A 1ZFNA 5CU7A 1AGNA 2ZSDA 4ZYLA 2VJYA 1OPXA 1MB2A 4G9EA 4ZCTA 4Y8VA 4B2YA 2X1LA 1O03A 4DSAA 2LR0A 4MEAA 1POWA 3TRHA 1WF3A 3FTPA 4J0IA 1AU9A 3GT0A 2DLCX 4BNTA 1E5LA 4UTVA 1YAJA 4RZXA 3HGMA 2VATA 5KSZA 2ZUTA 4IKEA 1UKZA 2KE5A 1WV1A 5JNLA 1S1MA 2NSYA 1EP1B 4BL5A 4BKOA 2W8ZA 2WSSD 1IATA 4M36A 1B2RA 1F2VA 2CF5A 2WOJA 3ZN2A 1BE1A 4XIFA 1AUVA 3D0KA 2YC4C 3WADA 2XODA 3M9LA 4B6PA 1CUSA 4U02A 1FJHA 1J4AA 2H51A 2I2XB 3EXHB 2IOFK 3CZPA 1NVVQ 3II6X 2P6NA 4RV5A 5K8VA 3DULA 1BQEA 3QX9A 4NG4A 2P9GA 4Y2TA 1EKXA 2V0CA 4IIVA 2P9ZA 1PNOA 2WW8A 2QG9A 3NM4A 3SD7A 4AO6A 4BE9A 5K09A 4YMUA 3PC3A 2BGKA 3VDNB 2FUG1 2WJVA 1XBTA 3B8EA 1PRYA 2A5LA 3I53A 5E3HA 2WQZA 3IBTA 3GJTA 5AVWA 2PGXA 3VC7A 4ERNA 2OGSA 3RLIA 3B89A 3PQ5A 1R50A 2G5PA 1F2UB 1KAEA 1N5JA 2IY7A 2IYUA 3SDZA 4FSXA 3REQB 1E8DA 1QVWA 3UJ6A 1PQYA 1CLUA 2ZB8A 1XTRA 3FNRA 3E4DA 2AG6A 3EPHA 3B1FA 4HWOA 5IBQA 2XUZA 1F38A 3WLAA 2PA3A 3ZIAA 1E9EA 121PA 5ALOA 3P4XA 1P17A 2DQYA 4JOBA 4E1AA 2GPTA 1SHUX 3PHBE 5BQ5A 4DR5B 2JPDA 3WGNA 4QUGA 1QWSA 2FCRA 3IEKA 3AKDA 5TDHA 4BZZA 4GYKA 4CQMA 3R8FA 3GVXA 4PBRA 3GCDA 4PR0A 4Q4JB 4PE5B 4DNPA 2C61A 4B40A 4ZEWA 2ASVA 1KZGB 3FPSA 1IMOA 2OBNA 2WINI 4PLGA 4E5MA 5KKNB 2HH9A 1QZZA 2B7CA 2D5AA 1Z47A 4OB6A 4UARA 3DVLA 4C9BA 1GNQA 3EIUA 4OP2A 1KMNA 4R6XA 2PZAA 2I6FA 2FWNA 2FW6A 4PS1A 3COYA 1Y6GA 1QCZA 4FC7A 5EAIA 1GPKA 5HX7A 3CRRA 2Y1KA 3PHLA 5EWMB 4MUMA 1O9HA 2AWNA 3DWFA 3FMIA 1ECJA 1H2YA 2Z3VA 4HH3C 1ES9A 4LRQA 5ALUA 1CEXA 1XZKA 1NQXA 2FQXA 2ZXEA 4LG1A 1MU0A 5B7NA 2MR6A 1Q0TA 4FILA 4NV3A 2R6DA 1JIVA 4IS2A 4EO9A 2HR1A 1GPLA 4Z0HO 1ODIA 3UJBA 2A0FA 4FR2A 3P0HA 2XNSA 3QVTA 5IF9A 1ZKMA 2QN6A 2QRLA 5K8CA 3QI7A 3NIDB 1MCZA 1QGZA 3KQPA 4RX1A 3LVBA 5KAMA 4LECA 2Z6QA 4GZLA 3GLQA 1PVOA 3WGOA 3MB8A 1RHKA 5DTJA 4IV5A 3CE9A 3SZUA 3DGFC 4KR7A 2PV0A 1QG0A 3BS4A 1M8PA 5B1EA 4Y6QA 3W3AH 1RZRA 2P0EA 4IM7A 1E58A 1JIQA 3QE0A 4M37A 1JXQA 1MORA 3B3JA 4HDKA 1RJ9B 3U48A 3W3AD 5J4VA 5LP1A 3KHTA 1TU4A 1GVNB 3QUSA 1NW9B 1KJ9A 1Z28A 4J2HA 1IXYA 3QP9A 2B0CA 2PDAA 3L8CA 3I09A 3M6UA 4MAMA 4C0HA 4U9HS 4RJKA 2E4VA 2O2SA 4TXMA 1T6ZA 2HA4A 3MFYA 4N3NA 4GEGA 1QPGA 4TTVA 3RC8A 1Z4MA 3CH6A 1X1QA 4FHCA 3PC4A 2X6TA 2ZGVA 3A2NA 4MAAA 1ZA1A 2O0JA 3AXTA 3DE4X 3FSEA 4O29A 4D9GA 1I9GA 1DRJA 1IN6A 5IT4A 1I6LA 1KK2A 4MMXB 3BL8A 1LDMA 3GC6A 3D7KA 3Q1KA 4M9ZA 5AKHA 1V8FA 4P0QB 1K5HA 1WB5A 2QVBA 1SOMA 3LO8A 1ENYA 4LI0A 2I6SA 1AQ6A 1X7DA 2X9LA 3LAWA 3P9CA 3QBTA 4QE3A 3SE7A 2Q50A 4UTZA 2DECA 1CFZA 1VMEA 3PYXA 3OE4A 4NS4A 4JS0A 5K45A 2I91A 1W29A 1Z2AA 4MTCA 5BSHA 2QTHA 5LL6P 1X86B 2WF6A 4FFOA 1NULA 2O8NA 1WB4A 3WGUA 2I62A 3ROFA 3ZE0B 3EIQA 4BMOB 5KOJB 3MMNA 3N74A 4KLZA 2C9CA 1RLMA 2GD0A 3N75A 3BMQB 4X1IA 4F9TA 2GTPA 3ZHOA 1JAYA 1U0RA 3CJTA 2GPSA 5EWLA 1ORHA 2BAGA 3OLYA 3SOPA 3WLRA 4MQ5A 1KHHA 2A9KA 3KE9A 3NETA 5D3MA 4PRKA 1KYZA 3ROEA 3LHIA 3KOXA 1Q16A 5HCIA 2X13A 4O2AB 1L6RA 4Q66C 3VZRA 3KJNA 1IY2A 3ZCSA 2A7XA 2VVTA 1OAKA 1GGEA 2CVZA 2VUHB 4INPA 3S2ZA 4B75A 3GLFA 3NDJA 5AT1A 3OVMA 4LDAA 4BZWA 1L7PA 3OHSX 2QMOA 2A78A 3BIWA 3M5CA 3OZTA 1F8YA 4JJAA 4BATA 4HI0E 3A26A 4ZYWA 3QKIA 4CT0A 3QW4B 1V8DA 3LHSA 1C0EA 2I6TA 2JW5A 2QRUA 1KAQA 2CFSA 3GN1A 2J0QA 4BQSA 3IB6A 5LPNA 5JS6A 2YICA 4Z3OA 1RRCA 3FOBA 1P9RA 1HDOA 2DJ5A 2QDXA 3MJ4A 1SVIA 3N2YA 4YRRA 4RMJA 1PS9A 1EM8B 2Z6VA 1O77A 2P0YA 3JQFA 3H0CA 4ZVQA 2VPQA 3QKRB 1XCOA 2HLDA 4AZ3A 1SHLA 2DUNA 1HA3A 1Y82A 4M76B 4UHFA 5DHUA 4BBZA 2ONCA 1N6OA 4YPFA 4C4PA 3DE1X 1KZ1A 1RSZA 2D3WA 3FRHA 3IT0A 4XASA 2PLRA 2ZKLA 2O8CB 1NLZA 3ML1A 2W8BB 4N03A 2E89A 2UZIR 1DKQA 4OXXA 2QYHA 2PS0A 1J70A 3PA8A 2VDJA 2GBFA 4GLFA 4B3HA 1A2OA 5BSGA 4I14A 1RC8A 3F46A 2PX4A 3Q2IA 3GCXA 3QEJA 3CMCO 4P92A 4JFRA 2NNLD 3LDFA 3TW0A 2WJWA 4H3VA 4Z54A 1ZOIA 2A1UA 2ZIXB 4M3NA 2OXEA 4DYHA 5A3RA 4K6CA 4CLHA 3ZE8A 5IRCD 2YY7A 2ZK7A 4D0LB 3MJTA 1EXDA 2V5UA 3DE6X 4Z7NB 1LZLA 1PGNA 2XIJA 1PT8A 4HLCA 1SQSA 3GVHA 4GLOA 2VAVA 2PUWA 3FPAA 3DV0B 4G6ZA 2BEUB 2R7AA 3BD7A 5E38A 5FOVA 5T3YA 1SOAA 1I2CA 1YO6A 3BBPA 3DPSA 4IDPA 2H4YA 5KTOA 3ONWA 3HUFA 1MH1A 1ESZA 5DYNA 3D6FA 3TRJA 3FIUA 4YMHA 4NZPA 2WSYB 2E82A 5AVZA 4M89A 3CA8A 4MQBA 2E5WA 2HYIC 3IP1A 5BW8A 4YK7A 1FRQA 4DJAA 2UYYA 3JTMA 4REMA 4ZVNA 3DTYA 5HTOA 1F4PA 3N59A 3GAFA 3QE2A 1D1QA 1AZLA 4NMWA 1WCV1 4CG2A 5AVXA 4OFXA 4DMCA 4AF6A 4Z4HA 4KO8A 3TIFA 3O3OB 1X1DA 4EBFA 4TS3A 1N5LA 2ZB7A 3FH0A 3UJ7A 2FNAA 4M21A 3UXHA 1E7QA 2EHJA 3KPJA 4JB2A 2OCXA 3EFOA 4G5GA 1J5PA 4JQZA 2ILVA 1PL0A 1O4WA 2ZBEA 4MDYA 3HCWA 4HPXB 3SKXA 2CMDA 1QCCA 4ZQGA 4P3NA 4XYEA 3W78A 3ZWPA 3ESCA 2RD2A 1ZINA 2C2MA 2CL6X 4KYTA 3RE1A 1L7AA 2PS3A 3D4NA 3DR3A 1ZI8A 4I46A 2LV8A 2XMQA 5J1TB 3T7CA 1BJKA 3UBTA 4JXXA 3TB6A 5K0LA 5J5VA 3IQXA 5LQCA 4JUCA 3Q5GA 2Q4EA 2MU1A 3ZVKA 4REOA 4DM4A 4L9RA 2DBVO 4HF7A 2YXNA 1LH0A 2DHEA 1P5ZB 1PFQA 1WZUA 2E48A 2I6XA 3H2SA 3F5SA 3HBNA 4JKOA 1AHPA 4IHJA 5JVDB 3UV3A 3FDZB 3RIHA 1PIWA 3VPCA 4DMKA 3HJRA 1T4DA 2PO5A 4MVXA 1CJTC 1IPFA 2VHVA 3A4NA 3FGNA 1OUMA 3CZCA 1J6UA 1BDHA 3SIRA 4M0MA 1TZCA 3K70D 2ON6A 2XVXA 3NBMA 3F3KA 5H1YA 2G83A 4HLUC 4EGSA 4QZVA 4PLYA 5DIZA 2HT1A 1X15A 3WHKA 3NBQA 1K5GA 1XQ1A 3HWWA 1MC5A 1B8UA 1XZLA 1SQ0A 3KFXA 4GM1A 2R8PA 1QIFA 4UMVA 1MFZA 1Z4KA 3EGEA 3OZWA 3TVTA 3V42A 1X7HA 3GGGA 1FEZA 1HWYA 2QRQA 2VTVA 5IXJA 3INTA 1VRVA 2Q99A 2ZJ7A 1IEWA 3UKJA 4EBBA 2H8GA