4IKOA

Structure of peptidyl- trna hydrolase from acinetobacter baumannii at 1.90 a resolution
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
193
structure length
193
Chain Sequence
MSNISLIVGLGNPGSEYAQTRHNAGFWFVEQLADKYGITLKNDPKFHGISGRGNIEGHDVRLLLPMTYMNRSGQSVVPFSKFYQIAPEAILIAHDELDMNPGVIRLKTGGGHGGHNGLRDIVPHIGPNFHRLRIGIGHPGSKERVSGHVLGKAPSNEQSLMDGAIDHALSKVKLLVQGQVPQAMNQINAYKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Mode of Inhibitor Binding to Peptidyl-tRNA Hydrolase: Binding Studies and Structure Determination of Unbound and Bound Peptidyl-tRNA Hydrolase from Acinetobacter baumannii
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase
molecule keywords Peptidyl-tRNA hydrolase
total genus 64
structure length 193
sequence length 193
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2012-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 4ikoA00
4DHWA 3TD2A 3P2JA 3OFVA 4FNOA 5B6JA 4Z86A 3TD6A 1RYBA 4HOYA 4QT4A 2PTHA 4OLJA 3VJRA 3TCKA 4JY7A 5IMBA 4JC4A 3KK0A 5EKTA 4ERXA 2Z2JA 2LGJA 4JX9A 4YLYA 4FOTA 4LWQA 4QAJA 3NEAA 3KJZA 4JWKA 5IKEA 2NAFA 4FOPA 3TCNA 4IKOA 1RYMA 4DJJA 5IVPA 4QBKA 2MJLA 2Z2IA 3V2IA 2JRCA 4P7BA 2Z2KA 4QD3A 4ZXPA 1RYNA 4FYJA
chains in the Genus database with same CATH superfamily
4XPIB 4YRJA 4L08A 2TMDA 3L4BA 4L51A 1WMEA 2QPAA 4Q4HA 3ZHVA 1OWPA 1T2FA 4RF3A 5EKUA 4EMSA 2PKQO 2H1SA 1S8FA 3VO1A 4C4TA 4CQMA 5HKAA 3C8HA 2CVQA 4RQAA 2DKFA 5EI5A 3Q7RA 3ZU4A 1PWEA 5H80A 4Z54A 5C1BA 1E4YA 2ZIFA 4HWKA 3I58A 3GFGA 4PBSA 4AY4A 3V1YA 5JD5A 2O0HA 1ZCAA 1NXQA 3E3LA 4F60A 3WLQA 5EXEA 1PFKA 1A2QA 2ZW9A 3AY6A 5ALQA 2ECQA 3NBYC 3GZ4A 2OL4A 3MOIA 3TLKA 4BFXA 4BEWA 5LMCA 4MTLA 1ECCA 3NOXA 1T2UA 4PAWA 1ARZA 2ZE8A 1P3Y1 3JYOA 3BJRA 2B4KA 2R6HA 3VNQA 4EGQA 1DAGA 4QATA 3JALB 2KX7A 3EQ2A 5HP4A 4XASA 4QLBA 3STHA 1XZDA 1YJXA 3QWFA 4PYLA 2OGSA 4QC2A 2X8AA 1RYHA 1YE8A 3AB3A 4L2IB 5A4DA 2GK7A 1K8QA 1NNSA 1JKJB 2OGTA 4JITA 2V96A 2X2PA 2AMJA 4K88A 1UPFA 3RSFA 4FCWA 2ZZMA 1QLHA 1GAEO 3LC0A 1WU7A 5KU7A 1NSFA 1CEEA 3C6XA 3QU9A 4C0BA 3OOJA 2OXCA 2HF9A 3M5WA 1XK7A 5HXAA 3CVVA 1GZHB 4TPKA 3JQ7A 4Y2SA 3D3JA 4LFAB 4Z0NA 2IPXA 2QX7A 3HR7A 3OIWA 3DDOA 2W42A 4XWYA 4Z9AA 2O2ZA 3SZ3A 2WWYA 3LMKA 2WF7A 3UT5A 4B6PA 2CF5A 4KN6A 3BL5A 4K6OA 1EA5A 3EVFA 4DXAA 1M6WA 5J2UB 1S2DA 3AG5A 4K3UA 3RLFA 2O2CA 4Q1VA 1AKTA 2D62A 2J85A 3EVTA 3QX8A 1HYEA 1EUZA 1T0HB 1QPZA 3PEYA 3W2FA 1U9IC 1O96A 1J90A 3PJDA 1KO5A 2QT0A 4FOPA 3AFMA 1IB6A 2BFBB 3BWVA 3Q5GA 4J0EA 4KQMA 4RD0A 5FULA 2XCRB 2IYRA 6AT1A 2IOFK 2AKAB 5C7OO 2YJZA 3HU5A 4LQCA 2FFRA 3TUZC 2ZP1A 1Z4NA 5CK4A 3Q1LA 5B4UA 2V3WA 2AQHA 2QVYX 1B8NA 5BNFA 5CYOA 3PPWA 5EESA 5BWOA 2P2NA 3FTQA 3A9RA 2REOA 4YBZA 4CTOA 2CV1A 1RWXA 1RWMA 2WU1A 1UUFA 1C81A 4S1WA 4O4JA 3KVOA 1O97C 2YXNA 3HCPA 3KZMA 5ULLA 1AXGA 2KHZA 4NU6A 3DVRX 3CNBA 4F6RB 2G4VA 2O5CA 4W5NA 5G4LA 1OBHA 1Y89A 3PUWA 3TSZA 4UJ3A 1AQIA 3VOTA 1E2QA 4QASA 5AW5A 3JXEA 1F38A 3PDWA 1ZS9A 3WWZA 1APBA 4FK8A 3ZS9A 3OTGA 7REQA 2ZR9A 3AR8A 1NBHA 4QGHA 2C2XA 4QL3A 1JFFA 3T94A 1L5WA 3ZIAA 3E81A 3M70A 4U4AA 1RXIA 3ZQJA 3KQNA 3K7EA 5HG0A 3GEEA 1E7MA 1PGQA 4NZNA 4R8RA 1QYDA 2HTEA 2REXB 3IIMA 2AOVA 4PLGA 3C3EA 5FNVA 5IFKA 1EQAA 2HK9A 1KDOA 1I30A 2GPYA 3ELYA 1ZLXA 3ANXA 3EISA 1RYZA 4RANA 4ERNA 3M82A 1UODA 4P98A 3BQ9A 3OIYA 2FP3A 2BEUB 2XUHA 4NZPA 4FWTA 4TKVB 2FWBA 2VJPA 2OV4A 2HA2A 4ZHSA 4DLXA 1IBMB 3KJZA 2DAPA 2P2LA 3HGMA 4Y0NA 3KYDA 2GN8A 3JD1A 2G71A 3I2GA 4F96A 4BV2A 5ADHA 2OD2A 2FPUA 3V4OA 3PC4A 1W1UA 1V11B 2F8LA 3C7TA 4O3FA 3CIOA 1PIWA 1T9HA 4EKGA 2OHFA 4ZXPA 4HNRA 4ZMBA 3NT4A 4HN4B 4BEJA 4NXMB 5EYPB 3FFBA 1C2TA 3C8DA 4EA8A 1QIDA 4OHMA 5IJ0B 1YTUA 3A1VA 1SXJA 4ND5A 3KSAC 1TDJA 1WQ1R 1EB8A 1KYIA 2AQKA 1WEHA 1YB6A 5DE3A 3H1GA 4WAUA 1XZGA 3UHJA 1DIRA 2C61A 1S02A 3DWFA 5DYYA 2EHJA 3I2FA 4KTTE 2Y0CA 1U2PA 2XOEA 4LYGA 1UOPA 3ZBQA 3H5VA 1W73A 1SZPA 2YXEA 4QYIB 5JSFA 1UJNA 4CEJB 5JCJD 2V7BA 1VLLA 3D0RA 4ZO4A 1XZAA 3TSWA 1IIBA 3UC9A 4MHSA 3A6EA 5E1OA 3ZQUA 5FDFA 2X5KO 4CEHA 4M54A 3DMNA 5EZQA 3ZWMA 1H1DA 4ZQIA 1KI6B 2MYNA 1UOOA 2OB1A 3GF4A 3HK2A 1I0ZA 2Q1UA 5EXDA 1TZCA 5KCZA 1BNCA 3KB2A 5AKKA 1G16A 5B2EA 3C6BA 3NIFB 2J33A 2RHOA 3HXQA 4MRPA 3C16C 2CSUA 1M6VA 2R1VB 1RKUA 1SA0A 3TW8B 3ADPA 3GIWA 3PZRA 2MHCA 1WMAA 1KMQA 1I8TA 1E7WA 3CG0A 3GJRA 3JQDA 4EI8A 3IPXA 3PHCA 3EG9B 3LKDA 2NV2B 3QK7A 4RX1A 4DLSA 3F78A 5EWJB 1ENPA 2NU9B 2IZ7A 2X1LA 2GK3A 3QVSA 3VAZA 4EPVA 4PN7A 3RS8A 3NLLA 4AF8A 2Z2XA 1ISGA 3T34A 5C34B 3B1FA 5F52A 4BZPA 3USES 3IPYA 1NNEA 3E70C 2YRFA 3X1XA 4C07A 5ISMA 1KI7A 4FUTA 2O9JA 4NNJA 3EPKA 3P71T 2OLJA 1L7EA 3L0BA 3Q41A 1P0QA 1QAMA 1PKXA 4LQ4A 3OCVA 1X7XB 4L50A 5F21A 3KJFA 4JUDX 4PRZA 2FR8A 1Y80A 3DAGA 2ZS9A 4CIBA 1H1TA 4J03A 1H3EA 1CULC 1N6RA 3EWNA 3UJ6A 1ZA1A 4FBGA 5CM8B 5K8LA 5FYDA 2F3PA 5JY1A 4DT1B 1YAJA 3LOUA 5F12A 2BBTA 3ETNA 1YQTA 1HG0A 2WHYA 3NHRA 1USGA 4RGQA 3WOHA 4QD3A 1Q0UA 2ILVA 1S4MA 4JZYA 3F7TA 4PYJA 1VKZA 3MAJA 1II8A 4OHYA 1P0IA 2L2QA 2I4IA 1CQJA 1I4TD 1GPKA 2AUNA 4V0QA 3AZOA 3E9CA 3OX4A 4UASA 4ZCSA 4JMPA 3A28A 1O57A 4DBLC 2HK6A 1MQ9A 3TIXB 5IXSA 4IXWA 4HTAA 3DW3X 2QJRA 5JHHB 3GJ5A 2CD9A 2O14A 4BZWA 5EMHA 1YDWA 2FMFA 1CQIB 1E3IA 4KLCA 4X5OA 3DNPA 1G20E 1N25A 1L5QA 2Q6IA 1LWNA 4G5GA 3TJRA 4BMZA 2O2JA 1U8ZA 2XOKD 1II9A 1KOFA 3I2HA 5DWVA 1H5QA 2R1TB 4HPWA 5MDHA 4KCGA 2HREA 1C3JA 3BIJA 5FUBA 3TXAA 3W2IA 2Q5HA 1QPBA 4RCVA 4YLEA 3O1IC 4R1TA 2FZCA 2O52A 4ZT6A 2G5GX 1A1SA 1XXHB 2NZ2A 3AKCA 1UK9A 3OZXA 1DLJA 1I4LD 2O3SA 1BS2A 2R97A 1O97D 3VNSA 2NG1A 2ZZKA 2GCOB 3NAMA 4R2JA 1PGOA 1Y5RA 5D1NA 4DCSA 2HCTA 2HF8A 2ONCA 3FVRA 1SUSA 3EGCA 3L7IA 4JNCA 4EKEA 4OB6A 5DOVA 4FCVA 3MINB 3C3MA 2J5KA 3E7DA 4PBRA 3PRKE 1FJHA 4HX9A 1UJ5A 1E18A 4JB3A 5I9MA 5A3SA 2PS3A 3ZOKA 1JI3A 4U5QA 1ADFA 1VI5A 3A1UA 4V0LA 5DGIA 2EWWA 5F73A 1S01A 4MMYB 3V8PA 3OCXA 1JKXA 3S2SA 4K9SA 2L19A 4RIFA 5IASA 5KNBH 2VUSA 4KXUA 3USZA 3IBCA 2D8AA 1XDGA 2I2DA 5E6RA 1BD4A 1JDPA 1QUEA 2ANCA 2YW9A 2QLTA 1RKXA 2BPOA 2OBBA 2V3VA 3EAQA 1N6PA 2FLVA 2W2LD 3GYBA 3O92A 5DWQA 4YP1A 2DPGA 1N6IA 1PT6A 3CY6A 3K72B 4C7MA 2O8DB 5K0LA 5E8JA 3F5MA 2G8LA 4NENA 1JKIA 3G0DA 1DG9A 1FSPA 2YN4A 4N3GA 3UKJA 3SIPA 1RWWA 1XRLA 2W2QA 4LYJA 4U0KA 4YJ2B 4ZU1X 3NVAA 4MS4A 3ER9A 4N5NA 5I3CA 1D9ZA 1CUEA 1L1EA 3E22B 1GITA 3KPYA 4TTVA 3GUUA 4UXIA 4AJJA 2BISA 4B3XA 1HYHA 3KUXA 4TM7A 2R11A 2FUKA 4HLQB 4URYR 5ITZA 2NZWA 2JAUA 5CDHA 3AILA 3UAGA 4N7MA 3SICE 3SJUA 1H94A 2I2CA 1T15A 9ABPA 3D0QA 4G8BA 2Q1WA 2JCGA 4KE9A 3D5TA 3MS7A 2J31A 2VCYA 3L8FA 4JHLA 4RK0A 4A36A 1RPJA 1UDAA 1EEHA 2NN3C 4WBNA 3QWIA 3L1VA 5A6VA 3D54D 1G17A 1CZKA 2H07A 1THTA 3A7DA 4UVDA 4TS3A 1LZLA 4DA6A 1RFLA 4CQNA 3IP3A 4KH1A 4J1SA 4OXIA 3KBOA 3PFBA 4JB2A 5BN5B 1CIVA 1P2VA 3KT6A 2GPNA 3N75A 2FF7A 9MHTA 4ZVPA 1AZWA 3V2HA 4RSHA 3RYFA 2YZGA 3LLVA 2OZPA 4I50B 2I78A 1RWOA 2ZYIA 5DHUA 5EEHA 1M83A 2CJXA 5KWJA 2ES4A 3R9IA 4JI8B 3WLKX 5GPBA 3UHAA 3HYCA 3LV8A 3L05A 5JCOC 2IS4A 4TWIA 3RVNA 4F86A 1QGOA 3L0ZA 1EXNA 1OOEA 4BLPA 4EY5A 5IK2D 1UPAA 1L4MA 1IDN1 3VKHA 4I6GA 3RC3A 1XNGA 5DHPA 1LVHA 4QICA 2QB5A 2JLWA 1J2EA 1OU0A 3HA2A 1LJLA 4OBEA 5DN6D 3D2AA 4WJZA 1K7XB 4BFLA 5M34A 3WG9A 4YN3A 5JAIA 1HEIA 5IKEA 4YP6A 1LDEA 2ZIZA 5KBYA 5DT9A 3WS7A 2XRZA 1P74A 2HLNA 1U2GC 1QB7A 4WW0A 3PR1A 5FLKA 1GA6A 1CUZA 3SS9X 3HCRA 1IZ8A 1EX9A 4WKNA 3PEWA 3I1FA 1PJCA 3BTOA 3O8LA 3EXHC 1ZU4A 4YRSA 1Y5NA 3NHMA 3QNUA 4URXR 2OV2A 2YBEA 4LX8A 2XE6A 3M4XA 3RU9A 3KLOA 4LSMA 4O4IA 1EGQA 4EW6A 1K86A 5HKLA 3CSSA 2FZLA 1I5OA 1IQUA 3BJEA 3V1LA 4QFCA 121PA 1PG0A 3L7OA 1OTXA 1A9PA 4GMDA 3RVMA 4F7DA 3F5SA 1MPTA 1US8B 4W99A 2ZBUA 4BLTA 1QRRA 3H65A 4M21A 3RS5A 3WISA 2LIPA 4UKDA 1M54A 5UKDA 4BGVA 5IJXA 2PSSA 2D5BA 4H7JA 4L6CA 4LNUB 4F2DA 5CFRA 1YFJA 1Y6FA 4MQLA 1ZVVA 821PA 1HNWB 2DWUA 1L5MA 1WXXA 4UEJA 2HMTA 4Y9RA 3OCWA 1RQLA 1J5PA 4OUDA 4CRWB 4EG5A 5B7QA 1J39A 4M37A 3VR5D 2O7RA 2P11A 1LFAA 1GTJ1 1WSDA 2QU7A 1O9HA 1SC1A 3K0CC 3ND9A 1INLA 3NNNA 2VDWA 4ITUA 4QGBA 4DMKA 1Y3AA 4ENRA 4EJSC 421PA 3ZW7A 5AW8A 1SVKA 4TMWA 5TIIA 1T8RA 4X1IA 1J2UA 2GXSA 3FZEA 3S2GA 1TJPB 3VPBA 1EAMA 3CPSA 4E4RA 1KTIA 1X1SA 3FB1A 1VHLA 4DKXA 2WJAA 2PX4A 5C4IA 4YWJA 1WKBA 3GYGA 2EFEB 4QUDA 3V2IA 3VRHA 1EB9A 2F1HA 4DSAA 5IZCA 5JZMA 5KSWB 3E53A 3IOMA 3PVZA 4KI7A 4BTEA 1NF9A 1T2DA 3UMGA 2VPPA 3IO5A 2ZRKA 1ODIA 3KJIA 3L6OO 2B6HA 4CLEA 4DRZA 1RWKA 1VTKA 1YJ5A 3QJGA 1US8A 3P9QA 3W2TA 2GXUA 4CZ2A 1KEKA 4OGFA 1NL3A 1ZD4A 3ROXA 1FTGA 1SHTX 2ZRQA 1WUYA 1XFAA 2C2MA 3OUUA 3K1ZA 2QBYA 3D3QA 4FM9A 3RUFA 3V6LA 4J4HA 2VJKA 3FGPA 3SYMA 4E12A 5LVAA 1KZ7B 3MGKA 4QLAA 4IV8A 1NVKA 3UXYA 1WW8A 2RBKA 1PJ3A 4C6HA 4IFIA 3RYIA 4XVUA 5JJIA 1GVNB 1ABEA 1GQQA 1VSBA 4RE5A 4EY7A 9ATCA 2FX3A 1VHQA 4JJAA 1ZK3A 4HTFA 5LLTA 2W6JA 2C2HA 4M7RA 5JLAA 3K9WA 2Y2VA 4JVOA 1SCQA 4JT4A 2Y99A 2VEDA 3KS9A 2XCUA 1LVGA 1VCMA 3FWNA 3I9OA 3K0FA 4DA0A 3H42B 2C7GA 3W5IA 1ZVQA 3FOFC 1FFHA 1JHVA 1K89A 3L77A 1CC1S 4MLZA 1OKKD 1A50B 1YONA 2JIDA 5AVRA 4BY9E 5COQA 4F9TA 1GAWA 2BR4A 2GZ1A 3WKDA 2DQYA 3B13B 1HL7A 1ORRA 1CNFA 4RZXA 1VL1A 3MBOA 3AERB 4X71A 4LE0A 2RGYA 3LIIA 3UVEA 1TYEB 1L4EA 4RHFA 5IUKC 1OWOA 1ZNZA 1T4CB 4NJEB 1P6UA 4P4SA 4DNOA 1T2CA 4S0ZA 1WETA 1CK4A 1H2AS 1LPBB 2FZGA 4QXQA 3L7NA 3MWYW 5AJVB 1TM7E 1MX9A 4XA8A 1ZCZA 1QZ3A 2OLKA 1L5OA 1N1MA 5SZIA 2ZUSA 1JL3A 4QBFA 2FWIA 1Y3FE 1CR1A 1ESMA 1PZEA 1KC1A 2AEFA 1I4DD 2QVXX 1QHEA 1VIYA 2ODQA 2E1PA 1UQRA 3FUXA 4TMVA 4V0KA 3EY4A 4FVTA 3EEBA 4HAVA 3OKAA 3RS0A 1CZOA 2EG9A 1VKRA 1PWYE 1GU0A 1K6EA 1PGNA 1BYIA 1Q7GA 1UXHA 2W8BB 2WDPA 3LC2O 5DBEX 5TQVA 1RYFA 3IEVA 2QD1A 2ZOSA 2D2VA 2OYSA 4A3SA 1O94A 3H5OA 3IE1A 1VB3A 5K8JB 3DXZA 1SKAA 3IE2A 4TLBA 2XCLA 3GFFA 3LCCA 1WV0A 2A58A 2BEKA 3B52X 4KIWA 2HK8A 3K70C 1Y82A 3NTLA 3AFNA 1TLLA 1VJTA 3OUZA 4OKSA 5ALRA 3F8SA 2YR0A 3H2GA 2XF2A 4DJDC 1OI3A 4FD2A 2PQ6A 4H7EA 4NULA 4R71A 3I37X 3K0KA 5DHSA 2O3QA 3GRYA 2ZYWX 1Y4SA 3R09A 2I65A 2HHJA 4EJSA 1SVMA 2XGMA 5J5VA 4E3ZA 3MSCA 1EJ6A 2BIFA 2HN9A 1LV8A 1QVAA 3AUSA 3VXKA 2GM5A 4OHWA 4KYVA 4Z4FA 1X15A 1UDBA 4PRYA 2Q99A 1U0OC 3DOUA 4RTNA 3ZVMA 4FYKA 1X9IA 2OC9A 3LTEA 2O5RA 3UPUA 1YSCA 3OMLA 4M7OA 1PFUA 2HA0A 2RIRA 4QA9A 1BHJA 3WAKA 3AJ9A 3DTVB 3TUJC 3VR2D 4HYQA 3CW9A 1NRXA 5J2TF 3KLPX 3OE5A 3BD6A 5E3IA 1NVEA 4Q16A 3T0FA 1E1CB 1U90A 1C1DA 2J7PA 1PCXA 3EFHA 1E9DA 3HN2A 4RY9A 4HV4A 4ML3A 1XHFA 2NTVA 3U9SA 4V38A 5J4VA 4I0WB 1R3DA 5I7AA 4YECA 3DD1A 4QAJA 4B8WA 1X7ZA 3QW2A 4JLVA 5AI8A 3VR2A 5FWYB 1DFHA 3CF2A 3EZ6A 5G0UA 1GHTA 4O59O 4XB1A 2C2WA 2ZWIA 5CIQA 1RXUA 4HZIA 1FLNA 1RFGE 3ZI0A 2DFTA 1L3CA 2QRMA 4CMBA 3WY9A 2RI1A 2IZZA 3PG5A 4AY5A 1EFVA 5ECYA 5P8WA 1M76A 4DLZA 2Q5EA 1AQ6A 5JXIA 1F2UB 2CYBA 3DHYA 3R4CA 4CU5A 2WRZA 5T6MA 4F56A 4IBOA 3S2YA 4UTRA 5F7OA 2CMHA 1ETHA 1YMVA 1VL6A 3P5SA 2CNDA 4H4CA 5A7GA 2TRSB 4AG6A 1FDWA 4ETMA 3E05A 2I6TA 1XG5A 4HX2A 5EJ7A 2MOKA 4WMLA 4TSFD 1G6OA 3M3PA 1Y4DE 2X0IA 3W6ZA 3BS4A 4LHVA 1NT2A 1U2QA 3B82A 1HE5A 4NQZA 1JQAA 1FX0B 4PS1A 3WGTA 4ZGWA 1S8AA 2ZSIA 4QPPA 3KKNA 4PIPA 2QTVA 1Z5ZA 3LUBA 5FORA 3A1FA 3W5VA 3FN4A 3NC1C 1C80A 2VJYA 5HTOA 7YASA 1LDYA 4INJA 3X1WA 2BCEA 1GCIA 3AZPA 3JWJA 4LFBB 1HGXA 1F8UA 1GPAA 2VYFA 4XJXA 3OMWA 4WFKA 5L9AA 3QXGA 4CLHA 2XBMA 1LK0A 4Y6LA 2DY0A 2COEA 3OPVA 2V5AA 3R41A 3ICWA 1TYBE 2DC1A 1T6XA 2XH8A 4HDAA 4MV7A 1ODFA 4LRWA 5K8TA 3GLSA 4GX2A 2DM6A 3L01A 2W6QA 3EXEA 5HKOA 2FR1A 1Z4JA 3OU6A 5MHTA 1BTOA 1YL6A 3QLEA 5TE9A 2P9JA 3FPBA 4UUBA 2JAXA 5EHQA 2J0UA 3IAM1 3WYFA 3S8YA 4PZCA 4XWOA 4WNAB 5E3HA 5H81A 3NG1A 4ZOLF 5I7UA 2ZBGA 3KJHA 4B76A 4YCAA 3NT5A 5B64A 1L4HA 1XKXA 2P1DA 2O19A 1ZN9A 3RODA 3AHCA 2RCNA 3DZHA 3EDQA 2LVBA 1JQLB 5CG1A 1YCDA 1CUWA 2QYOA 4NV0A 3FSJX 2JVIA 3QNWA 2MINB 4UQPA 4EPYA 3CW8X 3ZNOA 3GLGA 3NMUF 3EAGA 1Z0JA 2FZKA 3LY9A 3M9WA 1GYPA 4YR9A 3K4QA 3HDGA 3I1JA 3KQOA 5CNKA 5H16A 1HX7A 4NBTA 1DKQA 4ND1A 4EP1A 3H1TA 1WY7A 2HO5A 4H1TA 3W79A 1QYXA 2P5TB 4MR7A 1J1IA 1R5BA 3MS4A 1GZ4A 4OHVA 1BKYA 3R6TA 4LRTB 4QDJA 2HPHA 2ZWMA 1VXRA 2VDWB 1Z9BA 3RU7A 4ZDKA 3LFTA 4HN2A 1CJBA 4FHGA 2YJ5A 1ZAYA 3T8YA 1KIMA 2CLMB 3NYRA 4RY2A 1WVMA 1FP7A 3ZPXA 2NX2A 1KQPA 4Z4GA 5FWXA 2ZM6B 2J0UB 1QFYA 2AOWA 4GI1A 3HBFA 5A4MS 3VOSA 2DYKA 2NT3A 3AO0B 5BMVF 4QPZA 2P5YA 5ALKA 5TQ2B 3RF6A 4FFRA 4QDZA 1EJ2A 1DMRA 1HH4A 3LPLA 1ML3A 3AVUA 2VVTA 2PZBA 2PH1A 1RRCA 1FFWA 1J1UA 1OPRA 3IKJA 2D0OB 1BX1A 5BN3A 3G9UA 2I62A 3R6DA 1JIIA 1UKVY 4JUBA 1WHTB 3WJ1A 1RS0A 3F5FA 1KZ6A 4JP1A 5DYTA 3EZNA 1KO8A 1KY5A 4B4OA 3OF2A 1A4XA 4JEHA 3CFYA 4NPHA 2CNKA 1ZD8A 3EK2A 4N3NA 1MB9A 3E9ZA 1YVPA 2WT4A 3RSGA 5IM5A 4Q6WA 4OP2A 3U49A 3VR3A 4BGEA 1REQA 1ZGJA 4U3JB 4CE6A 1WAMA 1GNSA 1CRLA 2FP4A 4X1KA 1CQZA 1NUUA 1YDGA 4PYKA 1EWVA 4N6OA 3WK7A 3S0JA 3DBOB 2NPOA 4EF5A 3GLIE 1NLUA 1MP0A 1EXWA 2FOIA 2QW1A 4H6WA 5B6IA 4ZAWA 2H31A 2ZJ1A 4RHXA 3DVAA 4JR2A 2EV9A 5FWNA 1U28A 2NUTA 3SYLA 3TRJA 5JZ9A 1CS0B 2ODNA 2WUFA 4NAHA 1BQEA 4LJ6A 2XVXA 4WUVA 3YASA 3ZK7A 1YMQA 4DCNA 1JHRA 2XQIA 3GVPA 3PEEA 4UE2A 4Z4CA 4R1LA 2R48A 4QXAA 5G3ZA 4TZ0A 3KEGA 1EDOA 1FJGB 1P81A 3QG5A 4XDGA 5JZSA 4I55B 4BFUA 1UOEA 2OZEA 2JGKA 2Z8XA 3I4LA 3SJCA 1YJBA 1HE8B 1XA3A 5K9ZA 1PJLA 2NO5A 1SXJC 4IS3A 2ZI9A 1EJ0A 4M9RA 1Y7IA 1IOVA 4UUNA 1QJCA 1PJ4A 3EASA 5AKLA 2IHJA 1MNQA 1Z25A 2EKPA 3IRVA 4GD3Q 4N5LA 5K3EA 5KIAA 2GLXA 4YB8A 1YR6A 5F7ZA 4EPXA 2F3SA 3V97A 4D97A 4P36A 3K20A 3TG2A 1FFBA 2KE5A 2AFRA 1Z2CA 3LYLA 2BHNA 1Z5VA 4FU0A 5IKOA 1L5VA 4FMPA 4A8TA 2WM2A 2H4FA 2F8MA 4G4JA 4MV9A 4TVKA 2G6BA 1X1RA 2OR3A 3CX4A 3DOIA 1F3OA 1KI9A 4NCXA 1LY1A 1F0YA 1GSIA 3EXIB 2DSTA 2ZS8A 5HOQA 13PKA 1IZ7A 4GRAA 1IHXA 2J6IA 4F6RA 3K6KA 2HA3A 5HZHA 3ETJA 5BYKA 5CLGA 4E7PA 3G2LA 1KKMA 1QHHB 5BW6B 5KEIA 5HCIA 2B3DA 4YAEA 3A10A 3F74A 5AM3A 2WJHA 1HSZA 3B3JA 3RS9A 4CG2A 3NETA 4YJ2A 2BELA 1OB2A 5LLDA 1L5NA 4ZVTA 1W4BA 3TE7A 4FOOA 1KXJA 2YJ6A 3UT5B 4AZ3A 1E1NA 4CV3A 3I76A 5EMLA 2IOHA 3NTVA 2XA9A 1PJRA 1P1IA 2G9UA 1XJ5A 2Z8ZA 1NNI1 4HRXA 1ISPA 1YJ8A 3WBKA 2VPZA 1IJFA 4RS4A 2OTCA 3PDUA 2C96A 4KAXA 4JYPA 4UUMA 1PGPA 4MA0A 4WCFA 1E1MA 2CFIA 1XEFA 1SKQA 2P9BA 3LO5A 2PUFA 4TYYA 1HK7A 2QE6A 1NASA 1PL7A 1NUAA 1RWVA 1FA9A 1GU7A 4HEHA 1BXRA 1LBEA 3PE4A 4RTSA 1I7LA 4XKJA 1E8DA 4QU9A 1CE8A 4B4KA 5LQSA 4BNYA 3IKVA 1A95A 2IZ6A 3S1AB 5HQTA 4ZALA 2V7QD 5I7SA 1G8YA 1UPXA 1GG2A 5DISB 4WSOA 1GZUA 3C1OA 3SVZA 5B4VA 4LDJA 2EKQA 4NCNA 4O08A 3IESA 1LSJA 2VBGA 1KDZA 4CTJA 4DIEA 2FFBA 4OQFA 3CZCA 5E6UB 2DSNA 4EUSA 5TLSA 1U8CB 4ZZIA 1QG2A 3ED1A 5M5BA 3GDOA 3KZOA 5BSRA 4JOQA 5A0VA 1PLKA 2FRDC 3TSAA 3ZDQA 5KOHA 3QEJA 1BOFA 1R9MA 3OZGA 2JCBA 1PQWA 3OA0A 1O94D 1M33A 1RYYA 3E82A 5E4YA 2P68A 3CRZA 4KGZA 1LGYA 2YUIA 4EY8A 2WSSA 2PSJA 3O3OB 1E79D 2NXJA 3AETB 1DBQA 4L75A 1NJ6A 1DT3A 5T7BA 2Z2ZA 1RQXA 1SOAA 1QNFA 1CUBA 2C9OA 2INGX 4O29A 2WTBA 3MIZA 4ZOBA 5DKFA 4GBJA 1XTIA 2H9YA 2NZXA 4UFOA 3KYCA 4JOSA 1YT5A 2Y68A 3M6XA 5P21A 1UXGA 2QTZA 5BY2A 3VBEA 3ZU6A 2VDLB 2ZI3A 3HZOA 3Q7IA 3ZJTA 3E15A 4LVOA 4QQNA 1Z6GA 3H18A 3RT9A 1JVNA 3WFIA 3PUVA 4F3TA 3VVLA 5KYWA 3T5PA 2XUFA 1GVHA 2K4MA 1O6CA 5KQGA 3F97A 4Q7JB 1BCRB 1OFGA 3QVLA 3DD5A 4KACA 3RUAA 3A2MA 3CTMA 1RC8A 2DQZA 4REQB 2NP6A 3LUDA 4G0PA 4PSUA 1HFWA 1T2EA 2BFMA 1EUCB 4Q3CA 3RTDA 2DG2A 2ARKA 2ZTLA 1E3WB 3WLPA 5GM1A 1J0CA 1OC4A 3O2NA 3RKRA 4N9QA 4EFMA 1SXJE 5DM70 1H69A 1L6RA 1QFSA 2NOAA 2OMKA 4HWRA 2XGOA 1YKGA 1V8PA 4WZBA 1QG4A 4NYMR 1QE0A 1CG6A 4LIPD 1TX4B 2D0PB 2Z8YM 3THOA 2BM0A 3A6PC 3IBSA 4DLVA 4MIEA 1G8KA 1M6VB 1YZHA 2NVUB 3SQOA 5IM4A 2AEMA 1QX3A 2FW0A 3AGQA 3DAOA 3QKTA 3SWWA 4IEIA 4DEVA 3DF7A 1C0EA 3DJFA 1RI4A 4IG4A 1S5PA 4RVHA 1E9SA 2F9FA 2XUIA 5HTKA 2WJYA 2ZUCA 3HDVA 4HH4A 1NX6A 4WZAE 1LK7A 4GP7A 3V55A 4DHEA 4JI6B 4TTSA 2GUWA 5JO0A 3ICPA 5BWLA 2C7QA 1XTVA 2EAUA 7MDHA 1XQYA 2BUCA 4HD8A 1IHUA 1CY0A 5HBRA 3CLKA 5BN4A 3MJEA 2I34A 4P3PA 1JDJA 5K3DA 3SC3A 4BAGA 1JQ3A 1RD4A 3NHJA 4B80A 4F1KA 1CP3A 1NPYA 3ACDA 2C4MA 3CRW1 1T10A 1KVUA 3P2KA 4B2LA 5A9RA 5LKRA 2BHRA 4TN5A 4GEGA 1AGYA 2FPGA 1A8PA 1FUUA 2PJZA 3Q87B 2RH8A 4G24A 2V0GA 1QKIA 3BWYA 1GGNA 4J7XA 4J2TA 4D3XA 4L07A 1FVXA 4CTMA 5J5CA 1ETUA 1QGUA 5NULA 2O8NA 3O4FA 4ENQA 5JD4A 4TYNA 2QRLA 1QYRA 3LDUA 1ZJWA 1JEJA 3AUUA 2P4HX 1KZGB 3AJDA 3QYFA 5EPOA 5I7RA 3GJ7A 1A1VA 3URKA 2Q3LA 2PQMA 3TBKA 3T7RA 3AESA 3FSGD 1NQAO 4OQPA 4DV2B 1ISSA 3RK1A 2JGLA 4IDCA 3TPCA 4EEKA 5HIJA 2IEIA 3PQ8A 1XU7A 3HU2A 2UVPA 4M7PA 4BX3A 3WGJA 4D5EA 1X9HA 4LBYA 1EVYA 1NBAA 4QDKA 4EX7A 4EMUA 5HS4A 5HSGA 4W9MC 1T5BA 2C99A 5KX5A 3FZNA 4F5DA 3PYMA 1FQJA 5ERXA 1GGHA 2YWRA 1B6SA 2JVJA 4IGFA 1E5QA 5CA0B 1RQ2A 1T9DA 4ME6A 1A96A 2IZ0A 3ZHBA 1P3DA 2Y1XA 3E3AA 3W3AA 3SX4A 2ZSJA 1J9ZA 1CD5A 3ENVA 3OETA 4XIIA 4XUGB 2JIQA 5CPFA 3WGYA 4DZZA 3TUIC 1WZNA 2YV1A 1LLQA 1U2GA 3I1IA 4RZUA 2BW0A 1MO2A 1SC9A 2CJWA 4LZOA 3GLFB 4TTJA 1ZAKA 3REGA 4HMPA 1WCV1 2EIXA 3V46A 4EWLA 5HZKA 5CJJA 3FVQA 3OM0A 4XJVA 4BQSA 1J7JA 2APJA 3REFA 3KV1A 2RH9B 3AK4A 3L0YA 3CLTC 5GJWC 3HY6A 5CDYA 4OREX 3PXGA 3GEPA 4QUHA 2EFHB 4HB2A 1JIJA 1HOTA 1SURA 1C0KA 1YHZA 2XLBA 4I1RA 1BGXT 4NFYA 4OA8A 4RZ2A 4BECA 3WQBA 4D8YA 2D1RA 3DKKA 4X8OA 1P3JA 2Y2UA 4HR7A 1X77A 4YGYA 2ZQYA 2Q3BA 3TD9A 2VDOB 1FFSA 4E1BA 2BDUA 4RTMA 3ZDCA 4CGZA 1X92A 1J8DA 4JOCA 4MROA 1ZH0A 4UU8A 3EODA 1I2BA 1XK6A 3DYBA 3E27A 4XSVA 1XCPA 4CETA 4KAJA 1L8QA 3ZE0B 3LPDA 1SBCA 2AVDA 2G9ZA 4AZ3B 2FSPA 3I5YA 1NT4A 1IVSA 1OU4A 4G0VA 2VYVD 3T7EA 4XI9A 3P7MA 3ZZ0A 2JIZD 1GKLA 3O8QB 5M29A 1L4YA 4MR9B 5IDYA 4BKRA 5FFFA 1NUHA 1YRQA 2GEVA 2ZANA 1SZCA 4MA5A 1E0KA 2FEMA 4F9GA 4ISBA 3NWEA 4F8YA 3ACBA 1ZD1A 2JC3A 3AHIA 3PBKA 3Q6IA 4YQYA 4EHAA 5IN4A 5K20A 1WZCA 2C5FA 3JCZA 4TXMA 3SQDA 3GFSA 4BL5A 5JCXA 2OCGA 1QKKA 2HJVA 3QQPA 2F7SA 3L1UA 2N47A 1FU8A 1K7EB 3EFOB 4JL8A 4ND6A 4FZ5A 1ATIA 4IO0A 2GGSA 1BX3A 2FSFA 1QMPA 2PGAA 4JMLA 3CX3A 4PPQA 2VTBB 3OZEA 1T8TA 3B53X 3EVAA 2ZRBA 4J91A 5C8VA 1PK7A 2XYRA 4K9RA 4BV3A 2PR7A 3GCDA 3IOCA 3U26A 1F1JA 3DE2X 1KMIY 1IM8A 2CHGA 3CNNA 4FGKA 4Y9TA 4CIWA 1NVMB 3BEOA 3GW8A 4HO1X 1H0KA 3UN1A 2QORA 1I5EA 2Z43A 4D43A 1WX1A 3BRWD 4W5WA 3RRBA 2FK8A 3IDSA 5FYQA 3WGMA 4BV9A 1HO3A 3TH5A 4DNXA 4Z5XA 3KUUA 3TVYA 2QTBA 2BF7A 4MULA 4ZVLA 5JHGB 1Z6YA 3W7AA 4EARA 3M6LA 2NPIA 1VYUA 3WQHA 2D13A 5U4QA 1QSGA 1OYWA 2JI7A 3ZVLA 1P7PA 3FJOA 5DULA 3MRVA 4EAAA 4JLKA 1W36D 2O8CA 1RHMA 4D44A 4KWHA 5DN6A 5FBRB 3VV3A 5G3YA 3HVUA 3KHSA 2RGAA 5CDGA 4FGJA 2V5UA 4OHXA 4PVCA 5EL0A 4ZOLB 3OPMA 2Q0QA 3NGMA 1U8FO 2XVMA 4KQGA 3OE7D 1QIKA 3TIIA 2FX5A 3VDNB 2AN4A 2FPRA 3EIHA 1CT9A 4LQDA 4X6LA 1G4UR 2HNBA 3D3WB 1N2EA 1WHSA 3PWKA 1SUPA 4MKGA 3VHQA 3N2EA 4NCAA 1VHWA 1GDHA 3E4CA 4XPIA 1DRUA 3BGVA 4PCAA 3SDZA 3VH1A 1PVOA 3I3OA 1KAQA 1NWCA 2QQ5A 1MJGA 2QWXA 4IIJA 4Q4CA 1BGVA 1QGUB 2F1IA 5IF3A 2A5JA 5AI5A 2GK6A 4A8JB 3M5PA 4DR6B 1EWQA 4IIUA 2NACA 5HFAA 2A0KA 5KVCA 1PJZA 4B3GA 2DVMA 4N0MA 1D2HA 2VK4A 2ATCA 2XRYA 2ZTVA 4J0FA 3SC2A 1XR3A 1PYGA 4CMJA 1QUFA 3V5NA 1PSWA 1AKYA 2W2PA 3EHDA 1BX0A 2Q0XA 3QPCA 4LZZA 2E4AA 4L7VA 3K70B 3P9CA 3PXCX 4J7AA 2I9KA 1TKCA 2PD6A 4IHJA 2RHWA 3IUQA 1V5EA 3GT3A 5TEVA 1MIOA 2NAFA 5ALHA 1V7ZA 4FGZA 1FQWA 4E6PA 1POWA 1LI5A 1QWSA 1ZG3A 1Z17A 1S9DA 3ZUPA 1E9EA 1GRNA 3Q3HA 1UZMA 4DEXA 3BGIA 1WCYA 3X1MA 1Q3KA 5AHKA 3PLAE 4CF3A 4QJ5A 1R88A 5HDBB 1JG6A 3LYAA 4LVUA 4I7EA 3I12A 2W0SA 5AK4A 2EW8A 4BJHB 2ZSBA 4LJKA 1CBUA 3RV4A 2BI7A 4JSYA 1IN4A 2O1XA 3HCOA 4TMFA 1ZRSA 1MGPA 3K1AB 1N33B 2PKWA 4F4UA 2VJAA 3DHWC 4TQUS 2ZJ8A 3HJNA 1NUPA 3ENKA 5FPPA 1G5IA 2JFVA 3C3WA 4TVOA 5CB8A 2R5NA 4IJUA 3HKDB 4NKRA 1BYUA 1RE1A 2V4UA 1EQUA 1OAKA 2O23A 5KINB 2ZVQX 3A9VA 5CA1A 2A1UA 5LA6A 3TM4A 2O50A 2IUSA 5ANRB 4NBRA 1PR5A 3F0TA 5F1PA 4L3OA 1SBYA 3OBBA 4WHMA 4TWRA 5IYZF 2EP8A 2V65A 1J5XA 4LC0A 4YA6A 1VPTA 3H1EA 1KZ4A 1LSOA 2ID9A 1TM3E 2XVAA 1GL9B 4QGGA 4ZOAA 4YPVA 1UBRS 1ZUD1 4NYJR 2PL3A 3L40A 3N39C 1QOZA 4PCUA 4V39A 3ZIUA 5FV4A 1L5ZA 2BR5A 2O2SA 4G6ZA 2Y6UA 4JXKA 2AYXA 2BFFA 2GEKA 1V1JA 3TLZA 3PPVA 1KMCA 5KNDD 3G0GA 3G0HA 4A8PA 2X41A 4B43A 4CJXA 3ZWAA 3EBOA 721PA 4L8LA 3W8FA 4ZYZA 1IHDA 3B9PA 2IEYA 4FEAA 1CR6A 3F73A 3FKJA 1FTYA 1W59A 4L5YA 2GRJA 3MMSA 5CCDA 2GZDA 1AKEA 2C2YA 3T5GA 3LW8A 3V4PB 3MWKA 4J0QA 3OQOA 3UJPA 3DOOA 3LCRA 3D4NA 3MJTA 1TQ2A 4AMGA 2NIPA 5EWMA 6YASA 2HGZA 4NI5A 1Y9EA 3VQTA 4CT4B 2VP4A 1MJGM 4OU5A 4TZ6A 3LSYA 3TW6A 2FN3A 3OPYA 1EVKA 3W06A 3H8WA 2D2EA 4YCLA 1SWVA 4PRLA 3DLCA 4UHCA 3R9WA 3L6BA 4NONA 3DOEA 2LCQA 3BERA 3D6JA 3R6LA 4W8GA 3S68A 2HPZA 1GUAA 1UBNA 1W6RA 3BD7A 3GG2A 4UZEA 3CF0A 4YHHB 2GHTA 2QUIA 4BIIA 5IXJA 1KK0A 1R6VA 3AR5A 3PNSA 2C57A 3BSSA 3PFFA 3IOYA 2HU7A 4E08A 1E1RD 4WVFA 1FRQA 1D2EA 3IXQA 4RLHA 2UVQA 3LUCA 2IW3A 4RENA 5CX1B 4C1BA 1X70A 3EZLA 4M36A 4C2UA 3AU8A 3S8EA 5A1TA 2LZ0A 1AQNA 1NJGA 1WVGA 5LDHA 1D0IA 1MVNA 5EXPA 1U3TA 4QGAA 5DFAA 2HMYB 1JFLA 2V6IA 1D09A 2XWPA 1A3CA 2X23A 4NQRA 4ZPXA 4DDKA 1Y6ZA 4AKEA 2JFXA 2FH5B 3L6RA 1GTG1 4ZIRB 1XU9A 2RH4A 4PSCA 3PXUA 1VPVA 3WWEA 2G9QA 4JLWA 1GM5A 4JUIA 3RC9A 5C8ZA 3MA0A 4L76A 5DTQA 5FL7A 3EB9A 5KDOA 5CW1A 3EQZA 2CDCA 3I6BA 3W5JA 4DDVA 4DEYA 2EQ5A 4UNRA 4CMAA 1M0EA 3UCFA 5LNK1 3I9V6 5G53C 4D46A 5KQPA 1AS2A 3U1BA 3Q8XB 1YB5A 3P97A 4N9WA 1PK9A 2I91A 4NC9A 4BC0A 4JT8A 1K3TA 5AH0A 2G88A 1P4JA 3RVLA 1BRMA 4BNLA 3FNHA 3CZ9A 1WBJB 4ZT7A 5SZJA 2DWQA 2ZZNA 3HB0A 4COKA 4UHKA 3LFHA 3UZUA 2FDXA 2VF8A 4X7MA 5CT9A 5EJ4A 3LPCA 3ZBUA 1FBNA 2Q9BA 3N53A 1KSHA 3DO5A 2OQRA 2XLCA 2BJWA 3OF3A 5EN4A 1YOBA 3WV4A 1MOZA 2XTMA 3EUWA 3VOBA 5JI3E 4OQ4A 5EQJB 1WXWA 3EDOA 4NFHA 4MUAA 1I6WA 4D26A 3NPMA 2VH5R 1RJ9B 4HY3A 4EUHA 2K7FA 5AJZA 3FOEC 3GLFA 1Z0AA 3UGTA 3A9SA 1LKZA 3KZNA 4I4TA 4UUPA 5DHTA 1EGHA 3UWKA 3VPGA 3IBFA 3VR6D 4TV8B 1WOMA 2JGJA 1XO1A 5CT5A 1E89A 1P31A 4AQYB 3FPGA 3BICA 1NTOA 1CKEA 1G5TA 1SUWA 2KBFA 3A70A 5HJ5A 1O0SA 4YRPA 4YMIA 3E3OA 2EDCA 2PLWA 4PC6A 1NF8A 2CZCA 3AVXA 1XMIA 3UB3A 3EYAA 2J87A 4MUBA 5L4LA 2W4MA 3SPXA 1Q50A 4HEJA 2FGJA 4QTXA 4Y2XA 1PV4A 4DLAA 4PX5A 4ZQHA 3QI2A 2IEZA 4FCCA 3OLVA 3MJ4A 3VZBA 3N6XA 5EFZA 2A5LA 1II0A 4LYEA 2QV7A 2QXYA 1SD1A 1QC5B 2VDPB 3WMGA 1KTVA 3TG8A 5JYCA 4AC9A 5IZCC 1K2VN 4HS4A 1Q0PA 1DPGA 3JR7A 3T95A 3KR9A 3ZGOA 5LKAA 1U2RA 1OAAA 1QX4A 1E1LA 2I3ZA 5AVJA 3MTEA 3UBTA 3DBLB 1IXYA 4HSEA 4E30A 3VNBA 1MW8X 2NO7A 1E4EB 3BXXA 4B6OA 3WKBA 5CURA 3D43A 4MV3A 4CQMB 3WSVA 3L7DA 1GKIA 3PNVA 1QGED 4R69A 3C87A 3L6CA 2PPLA 1DX4A 3NGXA 2ANBA 4YRTA 3BTVA 4Y2HA 4R7GA 4PLFA 1ZRHA 3OQBA 3ZNPA 4LHEA 4N0QA 3H04A 1EVLA 2NZYA 2WF8A 2VFAA 3T52A 1R0LA 1RVDA 5A3VA 3NIWA 4A0GA 4E15A 4F8JA 2HIHA 2PLAA 1Z7BA 4EJMA 4RSRA 3ZEAA 1P1RA 1UIRA 1WDMA 4AZ0A 2M6LA 4RHUA 1Z06A 7GPBA 5J4LA 4L5IA 4L8YA 1E2MA 3RW9A 4TLAA 2Q5FA 4TLCA 1ITZA 2PUCA 2X6RA 3G89A 4NMWA 2D5CA 1Z2OX 4R3UC 3H0CA 3PWZA 2R751 2WG1A 3OLCX 4FI3F 5TS3A 5BNIA 1UT5A 4U7FA 3D8TA 3M33A 3KEQA 1SXJD 2OVFA 2PGXA 3V3TA 1NLYA 4KSYA 5E3JA 1TJ5A 4MJXA 1Z6XA 2C5AA 5JAHA 1AV6A 1KJYA 1TYCA 5ALMA 5K5EA 4OI1A 4EO4A 1MORA 1UP4A 4WZBB 4MLDA 4LYFA 4M55A 3C85A 4MH0R 3SQXA 3EEFA 1A9YA 3KPVA 5AXDA 3TQRA 3UQYS 2VSQA 5IAGA 1EDZA 2GUGA 4MICA 4P35A 5JJBA 4GZ5A 2ZR8A 4MIKA 2N9UA 3K6SB 4HDQB 1Z83A 2PD3A 1NATA 3NWBA 4F71A 3I62A 3ECCA 2AJBA 4X00A 5TMEA 3NONA 5I8PA 4DCMA 3P0FA 4MJ7A 1N7GA 4M1QA 1I2CA 4TROA 2C0PA 2Z1NA 3DMHA 4BLUA 4FGLA 3JATB 1J24A 5JNVA 5KYXA 1XAJA 4WEOA 2QOEA 3C3XA 2ZRNA 3G0CA 2Y1DA 1E2FA 4WGGA 4ZHQB 4DOMA 4EYQA 3QPWA 4C05A 3EUEA 3HBLA 4P7GA 4BVLA 3EARA 2GTIA 3RRNA 5HW0A 1IZ0A 2M6SA 1FNSA 5K3SA 3OT5A 4WA8A 4HZGA 3ED5A 3NHKA 5AHXA 1EP2B 4EL5A 4FSDA 1BN7A 4TQAA 4FKMA 3BE8A 4BKQA 3SYKA 5C7LO 1K0FA 3Q8LA 3B60A 4ZRMA 2AK3A 1T3ZA 2CLOB 2C78A 3GBVA 3D6VA 3MPOA 4PNPA 4D9CA 1R5JA 5GV7A 1GPWB 2C59A 4IXTA 4UW9A 1E7SA 2DBQA 2ZKIA 5J5AA 3TSOA 3UK7A 4NEHB 1PL8A 1W35A 3W4IA 3WSWA 3A04A 5H9WA 3PUZA 4K86A 3CQ9A 4W9NA 4HQOA 2RHBA 4L5AA 4ROSA 4D9GA 1I7NA 2BONA 5DSZA 1VFPA 1VFNA 2FRDA 3DBHA 1FTNA 3OAAA 5CFQA 3UWOA 1IHPA 4M7WA 2QHXA 2GZHA 4GMGA 3DLPX 1ABBA 3GNLA 3Q3IA 3H2JA 4KTVE 4KQJA 2JIMA 4LN1A 3PUIA 1QC5A 2BFCA 3LT2A 4Z8YA 4C7XA 4NECA 2E89A 4PW0A 4PLVA 3ECAA 3O8CA 3F47A 2R00C 1VPLA 3QPAA 5IC6A 4RVFA 2C9YA 3DPUA 3UHPA 4YQFA 3I34X 1U0SY 1T25A 2GTPA 3I8OA 3GPCA 4INOA 5A05A 3U4AA 4B74A 1TC2A 1IOZA 2QP3A 3CLRC 3DZIA 3K9GA 4L22A 4Z9BA 1K2WA 3IDZA 3TBFA 5JTUA 1EESA 1QKJA 1ZJ5A 4BNNA 3PICA 2BV3A 3AM5A 3PC3A 1DSSG 1YNSA 2ZRGA 1KJQA 4QTUB 1KK1A 5GJBA 1I80A 4E4TA 2LPMA 5B6PA 4HDNA 1L1RA 3I2YX 4RW0A 1JAXA 3U3DA 3GDHA 4I81A 5EP2A 1MNAA 3WK8A 4C30A 2P78A 4OHZA 1AKNA 1PZMA 4M1OA 4ZC8A 1V8OA 4EW1A 2H2IA 2CC2A 1CE8B 1QO7A 3R75A 3OSZA 4HQLA 4X8MA 3U31A 4BFZA 3NHAA 3KHTA 2BTQB 3OLZA 4ZVQA 2H2FA 3I9LA 2AZMA 3ZUGA 5IT4A 1FDIA 3K0FB 5D51S 2B35A 1WQ4A 2AJLI 3M2PA 4RK7A 2DJIA 4HLDA 4CN8A 3PU6A 3IAXA 3K4HA 4OBXA 1EGAA 1HTBA 1LDGA 3P2IA 4IX1A 5AYVA 4E4YA 3SZOA 1VBNA 2DECA 1RI1A 3PCTA 5FX2A 5I47A 3LQFA 3IL2A 3UJCA 3ZWPA 2YRWA 1DELA 4QU8A 3W6OA 3RV3A 2G09A 2J46A 1R4MB 3PRJA 4B6FA 2NXNA 2OHGA 1GJRA 2ODAA 2FWRA 2C2KA 5EQTA 3TK1A 2VKTA 2VQ6A 1E5VA 2R6JA 3KYIB 4RFSB 2A9FA 4B09A 3D6AA 4AQ7A 5JI2E 3VZDA 4K9PA 3ZE9A 5KKAA 2WABA 1Y42X 2WR8A 2XB9A 3WGUA 3FA2A 4EITA 1GPJA 2C3MA 4LWOA 3EGVA 3V1TC 3ZHZA 1L2TA 4IH9A 2IT1A 2WILA 1YI8A 2PDAA 5TS2A 1U1CA 4KL8S 3H7AA 3PFNA 4M53A 1GGMA 4MUGA 1FPQA 3CPEA 1JSCA 3DZJA 5K8IA 4P32A 2EGUA 2HJ9A 3L8DA 4FFMA 4CKEA 5J23A 1KFEB 4PYMA 4TWBA 2TSYB 4AIRA 3UMYA 4URVR 2P3QA 1DWPA 1YVRA 1KPGA 2Y76A 1L8XA 2O20A 2YC4C 3AI2A 4HQ0A 3V8MA 3SF8A 4KR3A 1MO3A 3LHIA 2UYOA 2OGUA 3D8SA 5F1KA 3B6IA 2EDAA 4R9RA 2ZTSA 3QLUA 3SOPA 1UAAA 4KYUA 3OHSX 1IBKB 4M1ZA 3SIWA 2P69A 3ELBA 3ROPA 1XP8A 1DXOA 3DWIA 4DJFC 3SZGA 5HIAA 3VVBA 2PUGA 3P9PA 5CHEA 1CTQA 1Y9JA 4MCHA 5DLQC 5JSYA 5FTMA 1TD9A 1W9MA 1M2JA 1UBJS 1LNZA 2VKQA 3N2ZB 5BVGA 4YLGA 1SFRA 1IEWA 1S1MA 2OK8A 2PZKA 3C1AA 4NDZA 5ALXA 4EB6B 4HXEB 4GAEA 4OGWA 3RABA 4BNTA 4O1MA 2W7TA 4MZXA 2YYSA 4HH3C 2FCRA 3ONEA 1EFRA 3FUWA 3D7SA 4Z9FA 2C3PA 3DAFA 3H8VA 5LXTF 4P4LA 1U3WA 1E94E 3F7OA 3GJTA 3IA7A 3LD9A 3A9WA 5EP3A 5FWXB 3QUQA 4YCBA 3KQUA 2QVZX 3D0OA 4LF4B 2QRHA 2J9RA 2WKPA 3O3NB 3SR3A 1U0TA 3SS8A 1RP7A 1JSXA 2IYOA 4LDNA 4P1ZA 5AUNB 2D1QA 3K70D 1H05A 1G5FA 2DFNA 2ZJ7A 1CJUC 2I80A 3N2YA 3IQGX 3DMRA 4MR7B 4BN5A 2WVJA 4IOJA 2IV3A 3GBSA 4PLHA 1FTSA 1M1YA 2QRVB 3AMVA 1GR1A 1OLSA 1QH8B 2CBGA 3CXUA 4A2QA 5ALDA 4Y2UA 3RTGA 2N1BA 4OJNA 3WGOA 2O7VA 3HUDA 3SFTA 1F2UA 3MUEA 1RRVA 1IL0A 2REBA 4HWPA 1U3VA 2PSHA 4UM5A 2AOUA 2HHAA 3WFZA 1ZH4A 5ALJA 1A82A 4BVKA 3FWYA 3E18A 3ER8A 3F9CA 4FZJA 4HB3A 4IUCS 1L8AA 2WJIA 2B37A 5T4EA 3RJ5A 1LFDB 3TDKA 2W2NA 3BE6A 3F2VA 3TZLA 3RC7A 3TMYA 4YP5A 3D2CA 4CMHA 2W70A 1VA4A 3HDYA 1ZCJA 3E5MA 4P53A 5AOVA 1JHXA 4MMZB 4DARA 3EGOA 4K5QA 4KRFA 1HZZC 4EKIA 4CXMA 2V7PA 2H1IA 5CD9A 1G2IA 1N6HA 1ZKMA 2VDQB 3GEGA 4GVXA 4KLRA 4MVJI 2PKEA 4CMEC 1TUEA 1SPBS 3OZFA 3ZDBA 5EUCA 2VJCA 1KQOA 1YQDA 4PO1A 4R9UC 4OUDB 4JROA 4R2XA 3WLNA 3X1YA 2XXBA 5JMWA 1D2MA 1B14A 2Q29A 4MKFA 3T41A 3VNVA 4J76A 5H83A 3BMOA 2XMPA 3H9BA 1NZFA 1XMOB 1YOVB 2GVNA 3N2KA 2CFSA 1NLMA 1P2SA 1QPGA 3IUNA 4G8CA 4DABA 5TDHA 1P4AA 2FUEA 1TCCA 3FYDA 2WZCA 2ZREA 3TX6A 1EWTA 2WE7A 1EK2A 1W4AA 3TIGA 1S2NA 2I1WA 3B70A 3M49A 3Q3CA 3GRZA 4I9FA 4RELA 3TEMA 2PT9A 3WL3A 2IYNA 2FLWA 3WGHA 4DQUA 3GLIA 1NYRA 2GFQA 4CODB 1P1BA 2BY4A 2P77A 2ZRCA 2JBAA 4O0LA 4Z7QB 5KU1A 3K5IA 4JK3A 2G1JA 1PEDA 4N03A 3VTZA 4C0HA 2RKWA 2PKXA 3OFNA 3QMMA 1AGPA 2F9LA 1WV1A 1O87A 4LMRA 4Y2GA 4ZQCB 4WN9A 3A26A 3HU3A 4N82A 4EVRA 3LK6A 4KFCA 2W2KA 3OKPA 4PNEA 3D4IA 2RAFA 2XUDA 3F46A 2GAIA 3HDJA 1YQ9A 3O8QA 4HUQA 4PZPA 3RWBA 4OCZA 3LL4A 3TE6A 3OFND 3TI7A 4BC1A 1X87A 1FYEA 1L5FA 3QQ5A 5G0WA 5JE8A 5C5CA 2Q5IA 1UMDA 5NLLA 2AJTA 5JPDA 1VIAA 1QRDA 4TKVA 1W85A 4Q6BA 3SE0A 1ENOA 2PUEA 3O4JA 3MB8A 1Q44A 1I01A 1QHFA 3MTIA 1JEYA 4RAQA 3HVIA 2IV7A 1PN3A 4JVSB 1IMJA 2DR0A 1U2DC 5K0NA 4D9KA 4QZVA 2O8EB 1PX2A 3D31A 1FOEB 4G0OA 3IDOA 3VC1A 4MJ3A 5HCUA 2XT9A 3KWFA 4LYHA 5JWHA 3GO4A 3L93A 2HA4A 3EA4A 2JJYA 3ZYCA 3PSAA 1ORTA 5L3SB 5DTJA 1QYVA 4O4HF 3L46A 4QTTB 4V2UA 5CB4A 3B85A 1H5UA 4CLRA 1LD3A 4Z6KA 2IKQA 4KRXA 3MJHA 1RYNA 3GRPA 4P0TA 2J6BA 4QX6A 3ETCA 4Y2JA 3UYKA 2A0WA 2BMEA 1KYXA 1Q7BA 1TVKB 1Y6RA 2DHDA 2HIGA 2WM8A 5IW8A 2JH9A 2O0LA 3LKZA 4E2ZA 2BKLA 1V2GA 5GZ1A 1KAMA 1XRPA 1FVFA 2ZUBA 4B85A 1O95C 3PWTA 3CE6A 2VYVA 3Q9LA 4QTZA 4TTIA 1NI4A 4Q24A 1IFXA 1GCAA 4QOHA 3TDNA 1BMFD 4R5HA 4MW9A 8ADHA 3DFUA 1Z6TA 3AFHA 3CLSC 2VAXA 2J3IA 4X84A 4GPIB 2Q2VA 4PCLA 1D7OA 4WD3A 1QGDA 1C7ZA 3BCHA 3UXEA 3NDRA 3T9BA 2FJPA 3GFQA 3OEHD 4OSOA 2V0CA 4B46A 4E2YA 4TX1A 5E1MA 3GL9A 3IE0A 1G20A 3RUHA 3O2JA 1IEVA 4YUWA 2QN7A 1R4NA 2CYCA 3HN6A 3TZ6A 5A3JA 4YCSA 1M2VB 3DDUA 2H1VA 5J9FA 3B3AA 5E6RB 4Y2QA 1N92A 3Q88A 5EJ2A 1M0TA 5AOBA 2NWQA 2XX3A 1UK6A 2P7IA 1T3SA 2QA5A 4ACAA 5TSDA 3LOPA 1DUIA 1T2AA 3RFVA 2G4LA 4DCUA 4O8ZA 3SVTA 3ABOB 1IPEA 1RAEA 5EMMA 2DGDA 3FDZB 4YQZA 1UEIA 2GO7A 3PJGA 3I9FA 4IMRA 1ZUNA 2GNOA 3P26A 3ZW8A 1PJSA 2J32A 2X7HA 1B7GO 1V6AA 2JFYA 1W52X 3EAFA 4JFRA 2PWAA 4R05A 4RE6A 4Y67A 1D6SA 3ORHA 1MAUA 4OAOA 3E1SA 3FPFA 2GCPA 2FWPA 4BB5A 4BQEA 4DLWA 2E21A 3PITA 3AEXA 2BEWA 4RYDA 2J67A 1VKHA 1ZJ4A 3B3QA 3R76A 4L3WA 4LTDA 1FNDA 1KIFA 3LS2A 1L4KA 5B7NA 3ERCA 1BDBA 2JD1A 3EPRA 4LDPA 3WLAA 4ZDJA 1ZZGA 5BPHA 3OTOB 4E51A 5LQMA 1SUBA 3TNJA 2EZ4A 3UTCA 1JZSA 4UUQA 4W5JA 3ESBA 2H4ZA 1A9QA 1QQTA 2CJWB 2WSLA 2XV1A 4GOND 4BB6A 1QF6A 2D00A 4GBED 2O2DA 1M5TA 1QK3A 2IUYA 1FQOA 1WZUA 3F90A 3GA0A 1YVEI 5F76A 2V5VA 1O0CA 1UMBA 3RVSA 1ZXLA 3TMKA 2I8LA 4S35A 1BJKA 1OXMA 4LNHA 5KYNA 2JLSA 4E5KA 1PQ4A 1YJCA 3PUJA 1EFAA 1GNRA 4O63O 3VU9A 5THQA 3TZKA 4B87A 1CYDA 3BGDA 1FC0A 3FOAA 4F2HA 1JYFA 4BKPA 3MHPA 3LWZA 4C0WA 2X7XA 2ZJYA 5AJTA 1L7QA 3QXXA 3NUQA 2RG1A 3I0NA 1IHOA 5FP0A 2OAEA 3S29A 4BDTA 4BNGA 3SXPA 5B7GA 1I2ZA 1XF9A 4HUQB 4UCQA 4DMGA 4YRLA 5EKTA 4IJ5A 3BA1A 2Y1LA 1QH8A 1E1QD 4YMSA 5B58C 4POAA 3T1OA 3RT1A 2AW3A 5BVGB 1XWFA 4ICIA 1QO0A 1RPTA 4OYRA 4PY2A 2IPMA 2H1OA 2RGRA 2WM3A 1G55A 3M1LA 5FQNA 4CDRA 5E0KB 1JHOA 5AQEA 1IUNA 5G4KB 3R7AA 1LQTA 3LBYA 1JZTA 4KBFA 3WNVA 5C37A 1PG5A 2NM0A 2NXWA 3CVYA 3DHEA 3OEWA 5HM8A 1JRLA 4IWXA 1J0EA 2O6HA 2J5RA 4RDIA 4B3RB 1A2OA 2YV3A 4ENTA 3JYNA 2I71A 5GY7A 5ES4B 4ZTZB 2DKOA 1WP9A 1OQAA 1QIGA 2WK1A 1ZSVA 1B1CA 1T1IA 4KXWA 4PZ0A 3MD0A 1OGJA 1E5TA 3IAAA 2XOXA 2GXQA 1BA2A 4YRGA 2GPTA 4ENWA 2G83A 3I01M 1KDPA 4C03A 2H8GA 3AXSA 3PDHA 2G3YA 2EERA 4G0XA 4MVJD 3ASYA 2AQ8A 5DEIA 2YNMC 2XVYA 3OBIA 3WQQA 2B8JA 1SIUA 2V7EA 5DMHA 1S4QA 2C9MA 1R8XA 3IEKA 3QM1A 4YAKA 2E5FA 1NC1A 2N3ZA 3G79A 4MGKR 3NB0A 3JZFA 3SM9A 1Y48E 1CHNA 1XTTA 4M9SA 3M1YA 3UAXA 5L7TA 1DJMA 3PD0A 1J0XO 2MMCA 1GAJA 2EFDB 2GZAA 5KREA 4KXMA 5EMJA 3R8FA 1KEWA 3Q3VA 1QAQA 3TQTA 4DNQA 4EHJA 1THGA 3HACA 4IDOA 3SFZA 2VATA 3X2SA 5AW7A 1FP4B 2P6PA 2O2XA 3K2BA 4WOJA 3T99A 1EINA 5KKCA 1VRVA 4KDFA 4QYIA 1Z4IA 1NJ1A 5EJ6A 3FCCA 1P0PA 2Z5GA 5KX5F 3PGLA 2JKVA 4HUTA 4BWGA 5DM60 4BQPA 3GT4A 3CRMA 4DT1A 3ACCA 5C1OA 3HUEA 4IIJF 1R5NA 1UBMS 2OESA 4W7SA 3QVUA 5GGYA 2JGMA 4D4IA 1CUVA 2I3DA 4REQA 4WL0A 2OM2A 1HYGA 3FDZA 3SHWA 4KUEA 1YU9A 2ZB3A 3QKUA 4FEYA 4PR3A 3B1KA 4OUKX 3VYTB 1L5KA 3ZLUA 3IMKA 5I7VA 4A9AA 1A27A 4TWZA 5TQ0A 3UJHA 1HE4A 3BWBA 1E4OA 3QIVA 3JQBA 4KFTA 4P9NA 1R2QA 2IDJA 2PX2A 1P2UA 5IAJA 5ALOA 5IEBA 2F8TA 3SYRA 3OZIA 1V11A 1AMUA 2JEYA 4DIUA 4CTNA 1QR6A 4OX9B 1V0JA 1H65A 1ONNA 2QTTA 2A5FA 2QSUA 1HY3A 4RIIA 2QAGA 5FXMA 5EYPA 4N5MA 3ENNA 1JG2A 3LHFA 1X74A 3RIYA 1G7CA 3CWZA 4GQAA 4KQHA 4MAAA 4W1SA 5CUQA 3TOSA 2BEUA 1GT91 4OP3A 2E6KA 1V71A 2WU4A 1SQ6A 2Y8EA 4UEQA 1CETA 4R1MA 3OTIA 4ZQGA 4IJQA 4DRYA 4HQNA 1BHO1 3HB1A 3JRNA 5I9NA 4W5QA 4WK4B 3J7AC 1G8JA 3T9DA 3U5ZB 2FSVA 2RHMA 2BGRA 5EAIA 4OGLA 4BJ3A 3W77A 4CM8B 2BFCB 3IP5A 5GOZA 4L57A 5E9JA 1D6NA 1R9NA 4TRNA 2WJPA 1KI8A 4YCDA 3WZLA 1XVAA 3HXKA 2IBMA 1P80A 1UKYA 3AR3A 2CLDX 1YS4A 1EZZA 1M66A 2GHRA 4GUDA 5KJ1A 2PM8A 1QIHA 3A6LA 4RVGA 3S1LA 1U3GA 4HDRB 2QRUA 3V8NA 3VNRA 3WIVA 3ZY6A 3CVXA 3PXEA 1SEVA 3WLLA 3HB5X 4GPTA 5CBKA 1NA5A 1T36A 5GOTA 4O6VA 4AWBA 2AV6A 2HJRA 2PG3A 2PJDA 1HDYA 2HQRA 3MTBA 1OT3A 1W30A 4WA7A 4MWDA 2VTBA 1B8PA 1VYHA 1G19A 3C3KA 2NTNA 1JQDA 1UMDB 4DIDA 1WB4A 3RYTC 3LTNC 3LUJA 2CVHA 5B1YA 3MAGA 1AB6A 1OYVA 1R8SA 3HRIA 1X1TA 2B36A 1W44A 1NG1A 1CU1A 2HQ1A 4KV9A 4YRCA 5AUOB 2GD2A 3X44A 3EW7A 3R0IA 3W2GA 1Q2UA 2IXFA 3AX6A 1C7RA 3HUFA 1JSZA 3LY5A 4H7KA 2HSGA 3WLJA 3A6DA 5IULC 5ESDA 2VPTA 3AWIA 3GPLA 2B9EA 1ANKA 1G3UA 1IEXA 4U7WA 1SPXA 5F2NA 3E8SA 2FSSA 2Q4BA 3ILYA 2FB9A 2VJDA 1C4XA 3SD7A 5KZMB 2JJ2D 2H11A 3G2PA 3Q1KA 5E9WA 2Q6VA 3BX1A 4HXFB 4JY7A 3RSOA 1YQEA 3KSMA 3MINA 5EKSA 5KOJB 2YMMA 4RVSA 1DZ3A 4Q05A 3ZE6A 2JHGA 4OM7A 5EIOA 2E37A 4HAYA 4PLTA 4XCXA 2CLSA 1L7RA 2R85A 4Y18A 3G5AA 3RUEA 5K4AA 3SEFA 2JJ2A 1MC4A 2HU5A 1D07A 3VPFA 5FAXA 1YJAA 4L2IA 1K75A 3C3YA 1KERA 1I6MA 3RUPA 4OB7A 4L02A 3UOWA 1EK1A 2Y1OA 3AFOA 3PLRA 2L17A 3OZAA 4CNQA 4Y6QA 4Z99A 2X9NA 4K9DA 2VP0A 3PV0A 5KSYA 1I7QB 2O8BB 1E32A 4MCAA 4MPDA 4AULA 4M99A 5HS6A 2WI8A 1G8SA 5J4YA 4WCFC 1H9AA 2OXTA 1NN5A 1G8FA 4DL9A 5CAEA 4MWSA 1EE2A 2YWCA 2O0KA 2LKDA 3BXHA 4G0QA 1EAYA 3DDCA 2OK7A 2QN3A 5F1YA 1OXXK 2OQVA 1E9RA 3X1DA 3D9QX 3JALA 4AB1A 3H9EO 2FG6C 2ADOA 1KRXA 1E1KA 3ABQB 4PXYA 1E1YA 3L41A 3NNSA 2IEBA 4J4TA 3DMGA 1OH7A 2TECE 3IPAA 1K6XA 4M60A 3R0VA 3WBBA 1JZQA 2X8JB 2Z2YA 3OMXA 4WINA 3B5JA 4RPGA 1TAGA 1VG1A 4XWGA 2EQBA 1KPIA 3MWEB 2X86A 3FWPA 3K09C 1KZYC 1LBQA 2YASA 2YIVX 4R6XA 5DVZA 1EK5A 2ONYA 3SX0A 4IHQA 4FKBA 3ITDA 3HM2A 2JEZA 1UZUA 2BFNA 1DGQA 3VHLB 1O5OA 3B9QA 3CGGA 2BGUA 4JD5A 3EH2A 5CDTA 2M2IA 2OCBA 3P2OA 5BXYA 4GRDA 1BH2A 1MH9A 5KTNA 3NVKI 4DWOA 3U44B 4FDMA 1EKXA 2R8YA 4MLCA 1IQ0A 1KDYA 5B3LA 3VTKA 1IPFA 1E79A 3O93A 4JLSA 5L3VA 4OQDA 4ZEWA 3D7LA 1FBTA 4G25A 1NBMA 2IW1A 3COPA 2HWKA 2PIAA 4G5OA 4GX1A 1DI0A 1W0CA 2QG9A 4HNGA 4U7PB 3KQQA 4DDWA 5CEEA 1Z3IX 2PVPA 5AVTA 5BOSB 3KD3A 3PSHA 5AT1A 1T13A 1OSNA 4KW7A 1ISJA 1ST3A 4X24A 4ZVMA 5SZHB 3TCKA 4OO3A 3ZGZA 3O91A 1ULAA 1N0VC 2MCFA 4IL5A 1C4WA 3MTDA 2ON6A 2ZUDA 3Q0IA 3WX0A 5L40A 1F4LA 1WULS 2IS2A 4X64B 5H59A 4F0JA 5CVTA 2H5EA 4YK7A 3LYUA 3HA5A 3EVBA 4TV9A 3CZ5A 4HVAA 2QPOA 2OCAA 4G26A 4PHGA 3IHKA 4CMKA 5J43A 2QSZA 3V80A 1TLTA 2I5PO 4EL0A 1BMTA 2ZBFA 5HHTA 2YFQA 1ADGA 3CLUD 1RWNA 4ZK6A 4XX1A 2R8EA 4LVCA 3EVGA 2EJTA 1UFKA 5LUAA 3MUFA 2JFWA 4R54A 4NATA 5G1PA 1R37A 1NBME 3EXHA 4EIWA 4P34A 3ETLA 4NZMA 3UUEA 4C3VA 4IFTA 2YJ3A 4AUMA 3Q0TA 4LNUA 3GCZA 2P9TA 1ZCFA 1DC3A 1T9ZA 5LYJF 1C3LA 2UUPA 2EW2A 2QQ0A 2ZK7A 3R40A 4TLDA 4JQSA 2W6CX 3FR8A 5KYKA 4X85A 1ISFA 1KI1A 1DDGA 2ADFA 2P0AA 3L8EA 2DUNA 3CO5A 2X0DA 1FYWA 1K06A 4DA8A 3HKCA 3KTAA 3C6YA 3T7SA 5LCXA 3C3JA 1QR2A 3AHDA 3EQ9A 2QEQA 1U8AA 2XPCA 4C9BA 1SZDA 3AVPA 2WEKA 3IVCA 3UB4A 4C5AA 3GG9A 3IT0A 3KKEA 4XYMA 1H9CA 3ZWXA 4HRYA 2ZJ6A 1QIEA 2HIMA 4GPAA 4D0NA 2VDKB 5JJLA 2ZPUA 3CINA 2NNLD 4I8IA 4F4DA 3GLGE 3LHSA 4C04A 4FZVA 2WJJA 4B3SB 1SC3A 1DIOB 2WTMA 2PUWA 5JIBA 1G60A 1X6VA 4I5DA 3QSGA 3K0CA 2IPOA 4XD7A 5LOVA 5CA0F 2PWPA 5D85A 2H1FA 1GPYA 4GC9A 1Q5PA 1FCJA 1Z0KA 3DBRB 1AY0A 2D0IA 2DCUA 2VRWA 5IBPA 1GSAA 5JV5A 1ZH2A 4LBVA 3K8YA 1QQBA 3KTDA 4FBMA 1OYYA 3WR5A 4U6SA 5ICEA 5SV2A 2UU9B 4I6JA 2H1WA 2PKQP 4ZO8A 1A5TA 4EB0A 1MOPA 1Z6QA 3OIGA 3BHJA 5LQUA 1DKLA 4H6XA 4OHKA 2FDRA 2AL7A 2C4WA 1QTNA 5LMZA 1GXSA 3DC7A 3P52A 3C98A 1IONA 3WZMA 4DYDA 3O6VA 2PXAA 4G0ZA 4YRAA 5D00A 4YDQA 2VJNA 5PGMA 2IIQA 4Y9DA 1IG3A 2IX3A 4LXYA 1VLJA 1MPXA 4P81A 4W1QA 1NUSA 3MMPA 4MYSA 1Z08A 1B42A 1CDDA 1M7HA 2JAQA 4KUGA 1FUYB 1TU0A 2QGFA 1YVDA 3SBEA 4C4OA 2PGLA 5FBKA 2PLNA 4KXYA 2UXCB 1W0JA 5KNDH 1IN1A 2QYSA 1VG0B 1XAGA 1PTKA 1QDLB 4Q4LA 5DNVA 4GL4A 1PJTA 4XLLA 4EGAA 1HMYA 2AZ4A 1RJ9A 2V6GA 1XV5A 4F45A 4G5SA 2B2CA 4KZPA 4UHJA 3ST7A 3DBRA 4PV7A 2C07A 4F8EA 1IBRA 2DR2A 3FTPA 4HN9A 4QFBA 5FUQA 4AF7A 3RVOA 1Q0RA 4F93B 1W0JD 2DBVO 2JLAA 3C6KA 4HJRA 3CISA 4KBYA 3Q11A 1WXGA 3FH0A 3K8ZA 3N8DA 4B35A 2VBCA 1V16A 3P9SA 3KKOA 4RD6A 1BU8A 4F38A 4DGQA 1YI0A 1WIWA 3L82B 4R84A 3GLFE 3R23A 3F49S 4UHDA 3ME5A 1B6TA 4E5DA 4DLPA 1U31A 2BCGY 2WWVD 3WMXA 2J07A 1A9TA 1Z0ZA 2WJ4A 3L7YA 3U48A 1BD3A 2AFVA 4BIMA 2I2AA 2FZWA 4A5OA 1SU6A 2AIRA 3HRKA 4C08A 4B3IA 2HL6A 4HVCA 1NSTA 2G67A 3S1SA 2ZEJA 1G41A 2XNDA 3ECSA 5FOTA 3UBMA 2WTNA 2EBUA 3DKIA 3ZLBA 4QGSA 1JDVA 5EIEA 2ZCVA 2XQKA 3GJ4A 5IARA 4QQFA 4C4PA 2OP0A 1TOAA 2H4WA 2E82A 3CKMA 3L92A 1CHDA 4JQCA 3AQ4A 4KQWA 4N6GA 4EBBA 1UJMA 3LGXA 2XNKA 1WW2A 3KU4A 1XEAA 1M2NA 1ADYA 1Z2DA 5IYZA 2VO1A 2Q6KA 2H2HA 3C48A 4L8WB 1P7CA 4CR6A 2WB2A 1R27A 3L8CA 4BO7A 2Q3JA 4FZRA 2X9GA 1XZNA 5EJ5A 2Q5JA 1DOHA 2FJUA 1DAOA 4G0MA 1V41E 4D45A 4EHBA 4Q4JA 2FW9A 4QOSA 4RF5A 3JTMA 4R8LA 4ITVA 4KOAA 3AV0B 1O94C 1O6GA 1BC5A 1YDMA 2B8NA 3T1QA 5C8XA 1RRGA 4Q9JA 4BE7B 3H3JA 4LJ8A 2GBFA 3ILVA 4U2EA 1OR8A 2FPXA 5IUNC 3V2UA 3ZS8A 2C2OA 4KSCA 4KU4A 3GCGA 3SXJA 5CYFA 2ALJA 2J4CA 3GPDG 3J7TA 3CZAA 4GS5A 3RO7A 1D9XA 3WLMA 1DXQA 2P6NA 1XBTA 3NBQA 2NUAA 3KQWA 3OX2A 4IH1A 3TDMA 1PP4A 3KQKA 3M89A 4GIBA 1MEJA 3BFVA 3BRWA 1K68A 4OIFA 4F3YA 1JQEA 5IXYA 2IVZA 4I55A 3RVKA 1TEXA 4ER5A 2O2GA 4H3HB 4XGQA 3T4PA 3P9XA 4W5RA 2V54A 4GHWA 5CT6A 2Z1DA 1V4VA 2VJOA 2WAMA 2ZIAA 1U9CA 4GGOA 4L73A 3KCNA 4NRDA 1JPVA 1TLFA 1WS6A 3LAWA 4GYJA 4KO8A 5FOUA 4EZIA 4ZARA 4ZMSA 1KY2A 1XTSA 3AF0A 3S2UA 2CMFA 1TT7A 4MWGA 1H2ZA 1X86B 1ZINA 3PXDA 2QIPA 2VYCA 4J07A 3WMFA 4CCAA 3SHOA 5LUBA 3PC8A 1QP4A 3T35A 1V7PC 1FU4A 3HJCA 2Q9AA 2PJRA 1R5OA 5EZYA 4DCOA 4BLSA 5IK2A 4CT0A 2COUA 4LRQA 5HQ3A 4XGRA 1REQB 3E03A 3HG7A 1VE5A 3VU9B 4DAEA 4GI7A 1ZR4A 3J81k 1RWBA 1IY0A 3FVTA 1UXKA 2GEBA 2MU1A 1YZVA 1ZVKA 4Q1DA 2ICAA 4ZJZA 1IK4A 4JC8A 1NW5A 4IIJB 2G0NA 3L18A 5EIBD 4BP3A 4MHTA 2GYWA 2ZYGA 5IAAA 1XD2B 2LUOA 3JW8A 1NVGA 1TK2A 3DZFA 4RTOA 3W7VA 4JLPA 1PFQA 5T4BA 1CIJA 3PVSA 3N3AC 2PVCA 2WUVA 3G3EA 4LXXA 4J1QA 5EJGA 3TN7A 4HPJB 4MS1A 3ZU3A 3MRXA 4OK5A 3ZDRA 2UVDA 2CHUA 1EFVB 1XVLA 3O82A 1KE1A 2IKSA 4O3MA 4G0YA 3UA3A 2NSYA 1QB8A 2FSIA 3D2LA 3PHJA 4I3HA 3LBIA 5TC4A 4NFSA 2EX1A 1N5DA 4LPSA 2CN1A 3ZVNA 2JAOA 2RAUA 2D1FA 1DBVO 1NUTA 2DY1A 2G5PA 2Z6AA 4JSRA 3I28A 4J3JA 2X1VA 3PQ4A 4V0RA 1N4AA 1SD2A 2IEGA 2VCEA 3UFXA 1MAAA 2P2CA 1Q7CA 1BQ3A 3LT5A 3VKWA 3EEIA 4UTXA 1YK0A 2P9GA 4C1NA 4KIGA 4TTTS 1HTTA 4FZ3A 1X1AA 4S1PA 2JFNA 5JSUA 2B7CA 2QRGA 5AWFC 2HXSA 5I9SA 5U9CA 5JW6A 1RAAA 1O08A 1TIKA 4O2BB 5I7EA 1IBSA 3B1JA 3E9DA 3NI2A 1HQKA 2QJFA 5EGNA 4G1UC 4ALIA 5JTTA 4LMPA 1S2IA 1ZPDA 3M6MD 1A7KA 3B1XA 1ZN7A 3WIEA 2ORED 4F85A 2FEWB 1IN6A 2WBLC 3S8MA 2IK8A 4JA0A 1N1GA 3E22A 1GAQA 3O7WA 1ULSA 2FPLA 4ZAXA 1ZUNB 1A69A 2A9PA 2OECA 1I14A 1TA4A 2CNBA 3EC2A 3EH1A 3FSGA 1AK2A 3L0DA 4BLVA 1HR0B 4U9IS 3B6JA 3PYLA 4FE4A 1NI3A 1W75A 1A2BA 2OB2A 5IVHA 4MDFA 2ZIUB 4DGSA 3S40A 4HQRA 5JARA 2NQTA 2B99A 4DLNA 3THYA 3M4NA 2L0XA 3QPUA 4MV6A 1DUVG 1M0SA 1JECA 1PJQA 3A1NA 1Q1BA 4F7WA 4FIDA 5KNBA 3C8UA 2VXBA 4BEVA 4EG6A 3FM9A 4YHBA 3ESRA 2QM3A 2REQA 4C7JA 1D0VA 4FLFA 4EENA 2CNOA 1U7OA 3GVIA 2AOTB 2W8BA 3OOSA 3K2QA 3KT8A 3NIDB 4JLAA 1FDUA 4CDNA 3MTQA 8OHMA 1UP6A 1EFLA 5EKDA 5G0TA 1E2GA 3ZX4A 1NDHA 4BO5A 4TTPA 1C50A 5LP6A 3D2BA 1GQOA 4AUKA 1NXPA 3NHUA 4ZAGA 2RE8A 3UH1A 1C0LA 3HUTA 1XQ1A 2MSLA 3VSDA 1LZKA 2OT3B 3R5XA 3REOA 2HU8A 1NWHA 4XGNA 1JG3A 3N6RA 4I1YA 5IVPA 1EFUA 2VTKA 5EIFA 5ES3A 1JT2A 1S2MA 1ACLA 5ESXA 3VOAA 5LIRA 4Q9NA 2WKWA 3UGKA 4FX2A 4WXHA 3RROA 1Z8NA 1KL7A 1HLFA 5A5GA 6CHYA 1E5LA 1K7SN 1HLPA 1KJZA 2P27A 4HGZA 1CVIA 4X66B 3DTYA 1R0BA 2AH5A 2QKYA 1KK2A 2FE4A 4DV3B 2QD4A 1U7UA 2C5SA 5IS2A 1WCWA 4YDSA 5BSHA 4CV2A 4DUPA 1FP1D 2JBAB 2XDQA 2BP7A 3K05A 2O8EA 4FR2A 3ADDA 4FOTA 4ZCLA 3ZD8A 4BO8A 4EKDA 1B2LA 4Q3EA 1GZ3A 4E46A 2H0QA 2P9EA 2JS7A 2X2OA 3AEQB 3VVCA 3LGAA 4JELA 5K3BA 4MGZR 5C3UA 2J3EA 4A82A 5L3QA 5MN4A 1BE0A 4QYMA 4DVJA 3NO4A 4EK9A 2PU7A 4M3NA 2CBZA 2HRDA 1Y9AA 3FBGA 3G0BA 1R0YA 2ZTMA 5A71A 3UWPA 5EZSA 2BBOA 5LMUB 2QTHA 5F3WB 4EI2A 2CYAA 2PXCA 4TS1A 5BSEA 2P6UA 3W90A 5B58T 3U3OA 1W7AA 5HK8A 2Z3WA 2C58A 2ZXUA 1Q22A 1GGJA 1OTHA 3AY0A 3MQ4A 1JDBB 1JG1A 2OO5A 3HDHA 2QM0A 4N12A 4Y1RA 1XCOA 1CUHA 1RM0A 4D3YA 4JWTA 3BOSA 5FO0A 5J3JA 1DQZA 5E7QA 3DV0B 3IPRA 3BKXA 2ET6A 1VP3A 3Q98A 5CB4F 4W4TA 3OKCA 3PDIA 4XJTA 2OUKA 5ALGA 1L7NA 3EPHA 5IBQA 3ZCVA 3F4LA 2R8BA 2AD5A 3FYHA 4Y9SA 3DUFA 1U99A 1P9OA 2YYAA 4QXPA 1Y8QA 3E8XA 2W22A 3C14C 4MUHA 4GKVA 3T4EA 3HNOA 1O03A 3WE7A 4UCXA 5JAMA 2XTAA 3QX3A 3BIFA 2X8LA 3KOOA 4RMNA 1UF9A 3UATA 1H2YA 1JIQA 2Z6UA 5ICCA 1XXHA 1T8PA 1NRJB 5IBRA 1UXJA 2A2ZA 1FW8A 1Z39A 2B69A 1V5WA 3CS3A 4LXTA 3C3CA 3S6JA 4IH4A 4HEA6 4I46A 1A97A 5T3UA 2XA1A 1TCAA 4G8JA 4GGPA 3NHFA 5AO9A 4C4AA 4NOKA 5AK0A 1M6EX 3DO6A 3T5BA 1ZITA 4IIFA 2C4UA 1ZZEA 2NZVG 3CLVA 3FFAA 3VNAA 4PTLA 1DMSA 3SLGA 4N54A 4DKJA 3EXEB 1IU9A 1G21A 2D2FA 2JFUA 5FOSA 1B6GA 2WJ6A 4CCWA 2DPXA 3K31A 3FGOA 4WZBE 1JR2A 1VKJA 2YINC 3F5DA 5I01A 1JDZA 1E2BA 3KFVA 3LY7A 4FKZA 3O21A 5HR5A 4GQIA 1X1BA 2EKBA 2JH8A 4DQXA 4GYKA 4XD2A 4DLYA 3JVVA 5LU8A 4H18A 4HI0E 2XAAA 3GC6A 3PYXA 4NAUA 2BMDA 1XZCA 3CPHA 1W5SA 1IVNA 1LC0A 1KYVA 3AP3A 3IEXA 4NS4A 4WZAA 5J2TB 2DWPA 1CF4A 1F8XA 4J29A 1D8AA 2K6GA 3S28A 1KRWA 1JWAB 3TQHA 4LBZA 2IXGA 3BORA 2R96A 4J9VA 4FT4A 4HKTA 1TZBA 3DZCA 1BVUA 1KOJA 1E4EA 1F9EA 2O1EA 3FD8A 2BJVA 5LWHA 1WVIA 1DTWA 1KVTA 5ITVA 1M2HA 2R6R1 4K6CA 4AX8A 2A86A 2JCSA 3M6UA 4LY9A 2ZI6A 3ZG6A 5JNUA 2J0QA 2QI9F 3O8RA 1YQUA 1G21E 3AYZB 5EPUA 5FADA 1NMZA 1DV1A 2RHJA 3DEIA 3M1AA 4E5UA 3C2QA 4DM3A 5LD2C 1QF7A 1YJQA 3ZH2A 1YI1A 3ZTTA 2YNMD 2WP8J 3ZXXA 4XZ3A 4KWIA 3NC4A 4XQGA 2BDTA 2X40A 1TM5E 3KKQA 3OWOA 4JLOA 4JYMA 3T1HB 4HHEA 4FS3A 1Z45A 3UOAB 2C9CA 2C31A 3FYUC 3IRUA 1SRRA 5T8KA 4CM4A 3S5UA