4IKOA

Structure of peptidyl- trna hydrolase from acinetobacter baumannii at 1.90 a resolution
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
193
structure length
193
Chain Sequence
MSNISLIVGLGNPGSEYAQTRHNAGFWFVEQLADKYGITLKNDPKFHGISGRGNIEGHDVRLLLPMTYMNRSGQSVVPFSKFYQIAPEAILIAHDELDMNPGVIRLKTGGGHGGHNGLRDIVPHIGPNFHRLRIGIGHPGSKERVSGHVLGKAPSNEQSLMDGAIDHALSKVKLLVQGQVPQAMNQINAYKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Peptidyl-tRNA hydrolase
publication title The Mode of Inhibitor Binding to Peptidyl-tRNA Hydrolase: Binding Studies and Structure Determination of Unbound and Bound Peptidyl-tRNA Hydrolase from Acinetobacter baumannii
pubmed doi rcsb
source organism Acinetobacter baumannii
total genus 64
structure length 193
sequence length 193
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2012-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 4ikoA00
3OFVA 4FNOA 4HOYA 4Z86A 2Z2JA 2JRCA 4JWKA 4OLJA 3TD6A 1RYMA 5IKEA 4JC4A 4QBKA 2NAFA 5B6JA 3VJRA 4LWQA 4JX9A 4DJJA 3P2JA 2Z2IA 2PTHA 4FYJA 2LGJA 4FOTA 3TCKA 4FOPA 3KJZA 4ERXA 4QD3A 4JY7A 4P7BA 1RYNA 3NEAA 3TD2A 4QAJA 3TCNA 3V2IA 4DHWA 5IVPA 2MJLA 2Z2KA 4IKOA 1RYBA 3KK0A 4ZXPA 4QT4A 5EKTA 5IMBA 4YLYA
chains in the Genus database with same CATH superfamily
1NW8A 1DAPA 1SKQA 3NEPX 1C9JA 4IL5A 3SS8A 1CCWA 3O3CA 3GRAA 5FLYA 3JQBC 3O82A 1MN6A 3ST7A 3CF0A 2BUBA 4FOSA 4GPZA 1QRAA 1LF0A 4BWGA 3PPYA 4C4TA 4DIBA 1KHHA 3H1EA 3PFHA 4RDCA 3HGQA 1B0ZA 4LKOA 1W5TA 2FQQA 1AC5A 1XP8A 3SC6A 3B2NA 2WJGA 3AJ8A 4YC7A 3F8TA 2WU8A 4M1QA 4EJFA 3QTLA 2R8PA 1XVIA 4HAWA 1J9GA 1M54A 2VDJA 2I2DA 1LVHA 2WHPB 2ID9A 4IOJA 1Z83A 1CQJB 3G6WA 4OQXA 4YCNA 1NW7A 4BNVA 5E7JA 2HFKA 1Z0UA 4EUKA 2FWAA 5EVCA 3AEKB 3EJWA 4MI3A 4RZQA 4DIUA 1IG3A 2FUNB 3Q40A 3TDNA 1ILWA 1X9GA 4KQ1A 2H5JA 4JWKA 3MVEA 4LXXA 5AM4A 1ZUD1 1NIPA 2G67A 4RHFA 5FLKA 3PEYA 5IT4A 1H5UA 5EUCA 4B0OA 3QEMB 3V2HA 3L8CA 4FW8A 5TQ0B 1H3NA 4LF5B 3NTRA 3K9NA 5EVJA 3CWQA 1YR7A 3GUCA 1KMIY 1VPEA 1XKTA 3FGPA 3R3SA 5LP1A 1K8QA 3KQVA 3R3WA 3RUFA 3UF0A 4B3JA 2FUG6 1NW3A 5A5VA 5CEEA 1GRVA 3CUKA 2H4YA 5ES4B 1AKQA 4QUDA 4BQOA 3KSDO 9LDTA 3B12A 4QBTA 4DPLA 2RI6A 2G76A 2XF8A 3Q8KA 1G21B 1Y3CE 2N47A 2OHOA 3IPXA 3NJ4A 4ND2A 4R8KA 3FNRA 4LJ8A 2O8CB 1X15A 4F5YA 3HCEA 3NKFA 1OXXK 1PD0A 4MQ6A 4P34A 2GHQA 1P33A 3L7DA 2PPLA 4Y6GB 1WMBA 4YQZA 4KNWA 4I4TA 3WLKX 1E6UA 4RKRA 2BDTA 5C7IO 3CLVA 3I2HA 1WABA 1HE2A 3A9TA 5GOTA 2EP8A 2LKDA 4IIGA 3TM5A 1UPTA 4FOOA 3U16A 2W2XA 1CUGA 5ECGC 2DFLA 4GE0A 5EZYB 4K81B 3E9ZA 3I2GA 3GLTA 1MTOA 4V0MA 5JXJA 5BMVA 2LV8A 4GDMA 2X2PA 4H15A 4C3OB 4QIHA 1IK6A 4WLUA 4GFDA 3EQ9A 3RIMA 3SZMA 3VR4H 1NUHA 5A4FS 3HTXA 4OJMX 5EFOA 4ETMA 2Q28A 3E03A 4LG1A 4L28A 5T67A 1FS4A 4URUR 2JZOA 2FUG1 1N5IA 3CF6R 4FR0A 1P2VA 3W6NA 1VSBA 3OIUA 5LOVB 3CLTD 1DTWB 2I54A 2QD4A 4XM1A 4OMDA 4RF3A 3HKBA 3SZLA 3DL4A 3O0TA 4C30A 5AW1A 3IT0A 2WU3A 3WWDA 5E4JA 2Q3LA 4HG2A 4CF4A 4Z1OA 1YIAA 4FC7A 1WOMA 5F3DA 1L7MA 1WZEA 4C21A 3R3HA 1IN5A 1L7XA 2B37A 4ND7A 3UJCA 4LSGA 4WE3A 1GNTA 1KK3A 3DMTA 4KUHA 4UVDA 2BKVA 5B30A 4ZDIA 4F21A 1OGYA 2A6PA 2WLTA 4C14A 2VDLB 4CKWA 1BHJA 2RH9B 4IIUA 5K20A 2QGNA 1UP6A 2B36A 4ER5A 2Q50A 5KU1A 1EDOA 4QEDA 4XD2A 4NOMA 5ES3A 1V5WA 4JROA 4QU5A 3TLBA 1DU4A 3F5QA 4UQPA 1Q77A 2R62A 3PCRB 4ZQBA 1Z8NA 5C0OE 3QX3A 5C52B 1KFEB 1VL0A 1TK9A 2GAIA 4GX1A 2XKKA 1Z3CA 1HM5A 2Q4EA 1PWEA 4L51A 4F6CA 2IVZA 4E15A 5JMWA 2GT1A 1EFPB 1SBIA 1CQPA 3D7KA 1OYVA 4CLOB 2RHTA 4G8DA 1P9LA 4RK7A 1A4RA 4I36A 3PX3A 4MVJE 3UJ8A 2GJ8A 2JVJA 3LKZA 1ENYA 3HR8A 4I5FA 3EC2A 3NUQA 3HB1A 3JQAB 4U7PB 4WZAB 2CNDA 2DQYA 2YOHA 3AUAA 2Y1CA 3KFXA 4BJHB 3C0KA 4BRZA 5EJ5A 3GPLA 2BPOA 2UZ1A 3F6YA 3SYMA 1W7AA 3IQGX 2JI4A 1QOPB 2ECOA 4XCXA 4BNKA 2FN7A 3A9CA 2WVGA 3DVRX 3KVOA 5LZ9A 4R2HA 2F48A 2PJZA 3I04A 1K8ZB 5EYPA 5A9SA 1QV9A 1ZITA 3L8ZA 1V48A 2IPLA 1LB1B 4OLFA 4PWZA 1O0SA 2ZVDA 4WSOA 1PFGA 3LW7A 3I6BA 2CXTA 1QR6A 2OB1A 3B82A 2O7VA 5YASA 1YR1A 1AKEA 3BEDA 3OZRA 3ELWA 3NR2A 4NMMA 4NFHA 3IESA 1YZNA 4MS3B 1MOSA 2BFCB 1XDWA 3QMPA 1IUKA 1P4JA 1GPKA 1MDFA 1ML3A 2QYTA 3CX8A 3ZI7A 1QGYA 3AHIA 4HO1X 4AUKA 1FUKA 3E9EA 1V95A 2D1QA 2WSYB 1V41E 1KK1A 3GFVA 3QVGB 2LCIA 4KQCA 3U7EB 3PDUA 3WGIA 2O3UA 1E7RA 3DLAA 5ALTA 4YP6A 4RETA 2FEPA 4J3NA 4B47A 3OPQA 1JEQB 4TV9F 2RB5A 4M1TA 1PF7E 4JBYA 1R8QA 2FFJA 1S2GA 2VTEA 4Q0MA 3THWB 3O84A 1SELA 1PS9A 2ZPTX 1CNMA 6REQA 1LFAA 4X95A 1Q22A 1AQNA 1JQDA 5LYJF 5LMCA 1OR8A 2E82A 2AC7A 4C22A 2R1ZA 4WMLA 4KXVA 1XE3A 1I14A 3LSTA 5C31A 1NU6A 2GK6A 2JVKA 4YHBA 5HE8A 1SZJG 1UXGA 3I0NA 3FZYA 4B81A 1DLIA 1P72A 4M36A 4BGDA 1DP4A 4JENA 1ZJJA 1ZOOA 1UKEA 3ZBPA 1LLQA 2V6FA 1JSLA 3DZJA 3FPFA 5HDBB 2R8YA 4RKEA 3ROFA 2YVLA 2PKRA 2EFCB 2H0AA 4W1QA 5EHZA 1KKMA 1OV6A 1P2DA 2Z9BA 3LT5A 4XDHA 2DETA 3OZEA 4BBAA 5IJ0A 1ZD3A 3MWFA 4ZT6A 1WHSA 1B43A 3T34A 4U9HS 2ZM6B 1LBEA 1WTAA 5DI9A 4DNQA 3HJFA 1H22A 1IN1A 2AOWA 3GT4A 4RDIA 1SUBA 1UXOA 1W4RA 3IQHX 1H5NA 3PFFA 4LIPD 1GPDG 1WCYA 3CUWA 5BYJA 3X1XA 1T5HX 1Z8DA 5CAEA 1ZIOA 1FNMA 3OMXA 4L3VA 1OX4B 4MWTA 1ZZGA 3AM5A 3GJ4A 3NHKA 3O83A 1IPEA 2PBLA 3N28A 4REMA 3WGZA 1RZRD 5HUQA 1DXQA 1HDOA 1OHHA 3E2PA 1QIEA 4WJKB 2TYSB 4IUCS 5D5QA 2VUSA 3E15A 4MRNA 1Y5RA 4I08A 1LD3A 2GCGA 2RC5A 5HRUA 3C4QA 3G85A 1NJFA 1EG2A 1UJ4A 2WDPA 2HBQA 2V45A 3ANXA 4IHJB 2NO6A 2ZQZA 3FIUA 2QD2A 5EJIA 3TW6A 3NRJA 1K89A 3VR4A 3WZ2A 5CX4A 3STYA 1QH0A 2HNBA 2PO5A 3M6XA 3HUEA 4KLAA 2Q45A 5CB4A 1E3WA 4RTJA 2CFRA 2AYZA 1PKEA 2NYRA 1TC1A 2V7TA 1FX1A 2HPVA 3OZTA 3QBVA 1LU9A 1V8DA 5IUJC 2IHNA 1L5WA 4PQYA 1N7IA 1X0VA 2PUEA 3D2AA 1QUEA 2ODNA 3JW8A 2FW9A 3AQIA 3GDGA 5AKKA 3UFXA 1XD2A 2DKNA 5DF1A 3B7PA 1P31A 4RTNA 2J09A 3FFBA 4FJ1A 1G2PA 2DHDA 5K03A 1P61B 2Z30A 3EAFA 4WCFC 3I5MA 4BKUA 4YJ3A 4DQ0A 2WVJA 3IT1A 2X0NA 2VT2A 2ZRQA 3BDIA 5DHPA 3ESAA 3C5CA 3FFAA 5LP6A 3DLIA 2Q5FA 1Z75A 4YUWA 1AMNA 4I19A 3CFYA 5L3ZA 4A1FA 2XCRB 1LH0A 4FXPA 3TQHA 5JNRA 1SM4A 4NEGA 1QAOA 4RV5A 2DXIA 1P1RA 2ZE8A 3OWXA 3DGFC 3FPLA 1Y1TA 3N2KA 4RD0A 4W9NA 4XWKA 1Z37A 1YOVB 2O2ZA 4INOA 3H6GA 3L5OA 4A9AA 2VG8A 1M0TA 1UEXC 2B0CA 3C6KA 3ZW7A 2Q6TA 2VYVD 1NXSA 2HA7A 3L6UA 5DPMA 2LCQA 3EOAI 2YVQA 3U4IA 4NZMA 4RVCA 2NVUA 4BO2A 3KDPA 4CWAA 1SXJC 3Q3IA 1I94B 3NEAA 1FSGA 4NZPA 2PFSA 4K5QA 3JVVA 1VJTA 2WFLA 3NH6A 1M9NA 1NUUA 1PFWA 2W93A 3PNMA 4LN1A 4HDQB 1HL3A 1D2EA 2BSXA 1WP4A 2JGAA 2WT9A 4HQ6A 4PYOA 4QC2A 5K0LA 1AV7A 3NBAA 2ODWA 2FOIA 1W6UA 4ZT2A 2OQRA 1E2NA 4YJHA 2MYNA 3SIXA 1SOUA 3EFBA 2G63A 1RYYA 4J9VA 4B3HA 4LK2A 4NPAA 2EARA 2VJQA 4WDQA 3DAFA 4YRZA 2XQJA 3NEYA 3PBKA 1GAQA 2HO4A 1CNEA 3KQKA 1XXHB 2QTFA 1RTKA 1E20A 1FXSA 1NJ6A 1GNVA 3FNGA 3IQFA 1C9NA 5LPNA 3DBIA 1BD4A 3CH7A 1WAMA 3I23A 1PEAA 1TCUA 3IVRA 1Z9BA 4Q5IA 1R9JA 2HDHA 5KYWA 1XZKA 3TZEA 2ZVQX 2R6JA 4P32A 1MQSA 1B0UA 3VPHA 5K8LA 2E1PA 4CW7A 3BJZA 3T3MB 1CPYA 3UATA 2GSDA 1GGEA 1FDWA 3H2HA 3ZXSA 1JTVA 3Q9LA 3I9NA 4F46A 2REXB 4RK5A 3PYMA 2I1QA 1FFCA 3TW0A 4S12A 3AEQB 1UT6A 3A7EA 2DPHA 4LECA 5JXIA 5J23A 1IOLA 2CJYA 4RMGA 1GSHA 1HOXA 3QKSB 4BQIA 5J4HA 1EFCA 2WKWA 3IE1A 1SVWA 2CE7A 2PT9A 3ZZNA 4J0FA 1EBFA 1MJHA 5AKIA 1JRLA 3V34A 5HX7A 3SQMA 2JL1A 1LJUA 4ZHQA 1F9AA 1W88B 1UM9A 4NS1A 4BU1A 2VSFA 5JOQA 2OHGA 3ZK7A 1P4RA 1QIJA 3IJRA 1DIRA 4J1TA 4Q3AA 5ARDA 1BVYF 5H80A 1QQ6A 3DC7A 5C1PA 5HIAA 1NWCA 3DL2A 4DLKA 3T1HB 5EIAA 3B5JA 2XKBA 3V7NA 2YWGA 3G0IA 3KSRA 4Q1DA 4RF2A 3W4KA 4TV8A 2OEPA 4GP7A 3QU4A 4MWDA 1NYRA 1MG5A 1KC3A 2WYHA 4IRXA 4MUYA 1TM4E 1VG8A 2IT1A 3UHPA 3A6LA 2RHMA 5C4GB 4BP3A 4MJ3A 2Z58A 5F9HA 5B3LA 3O5AA 2BELA 3NH9A 1EGMB 5C8ZA 5JATA 4Q7JB 2B7BA 4ENWA 1QV6A 2ZI4A 1W36D 4QYWA 3ZY6A 3DEJA 1U8EA 2IHYA 4Q21A 2PU7A 4KJZA 4E09A 1JDSA 1CS0B 1YS1X 2DFPA 4X1IB 4D57A 3R0IA 2HO5A 1WLSA 3ZD8A 1C5KA 2VATA 9ABPA 2XMGA 5I4CA 4L8FA 5C5CA 4LFAB 3BRCA 5A7HA 5T4EA 3AF3A 3RNOA 5A4JA 5CXUA 3AVXA 4CN9A 4WOBA 3WGTA 2BZGA 3HNOA 1ZISA 2IEAA 3KG2A 1ISMA 1UBHS 4OTZA 3GLFE 2HM7A 2FJPA 1YR9A 3SY8A 1AMOA 3OWOA 1QE5A 3IV9A 1OXUA 1JHVA 1ZK4A 3EUFA 1MGOA 1TOAA 5KSOA 1E1CB 4C20A 2EQBA 3GU3A 3HCNA 2H2HA 2CF5A 1V6SA 2AJDA 1W49A 4RESA 4XKJA 5EMHA 7GPBA 1EXVA 2AFHB 4YWHA 3M5CA 3SQNA 3ID6C 2OBBA 2WWIA 3M7IA 4CKZA 5E4YA 5DX8A 5JWOA 1KPHA 1PJLA 7MHTA 1Y4AE 3HRIA 3WL5A 9LDBA 2JHGA 2ZWVA 1X74A 4ND3A 1QRTA 3KQYA 4EPVA 4HV4A 3IALA 1HNNA 3A4NA 1SD2A 2Q99A 1O94A 4UNQA 1Q74A 4E5KA 4DL9A 2AQ8A 4BNIA 4IXMA 2EYUA 2J3KA 3BMXA 4D0GA 2C59A 2FOXA 1CUBA 1ECLA 1G3IA 3W3AA 5C4MA 4L5BA 1WQ4A 4EF5A 2MSLA 3PEWA 1U7PA 5KTNA 2NO5A 1NV8A 1NTOA 5ER9A 3W2FA 1TCVA 1P8JA 1X94A 3U0BA 3KPWA 2C9OA 4AVYA 3BRWD 2IQIA 2XIJA 4O4HA 3GLHA 4WGGA 3ZHYA 1T9CA 3WZMA 2HRBA 3ZU3A 2DQSA 3KBOA 2VZLA 3IUQA 4D7AA 2XWPA 4X64B 1GDTA 1A2KC 5JSKA 4MX8A 3U5TA 3PTLA 3UANA 1SKYB 2E55A 2WIFA 4OKIA 2GN2A 2JF0A 2RMKA 121PA 3AJEA 4TUYB 2A78A 5DYNA 2VQSA 4TZTA 4CMBA 1RU3A 4G2TA 3WL6A 3IPLA 3WSTA 4CM9A 5EAIA 1G7SA 3ETGA 5CRIA 1Z68A 4DRXB 4ARCA 2DBQA 1QE3A 2NXCA 3BXHA 3IMKA 1QHIA 3PYXA 4MKXA 1DIBA 4YUXA 3RKRA 1GPYA 3AGPA 2BHTA 1LK7A 2O3QA 3CUUA 1NQXA 1DQNA 1FX0B 5TXGA 1VJ1A 2GETA 4KQKA 4JVNA 3AP2A 4F2HA 3VKFA 2QE7D 1QZ3A 2Y93A 5L4SA 2I4MA 3OP1A 3TXYA 1RPJA 1DTEA 2EHJA 1I1HA 4X6LA 1M67A 3NDJA 1XQ6A 1VI5A 1I2BA 2XE8A 4RVGA 3GT3A 2L18A 1H23A 1TMYA 5BVHA 3GLIA 1EFRD 4XSVA 3FYTA 3WYFA 3GAFA 3HY6A 1Q0RA 2PS1A 2BDEA 3EN0A 4G1EB 4YAGA 5IJWA 3AIIA 1X7ZB 4CL8A 1YB2A 3BB1A 4Z7NB 3K3PA 3O1JC 4RJLA 5CT5A 5KYUB 2AKYA 1P2TA 2PMBA 4DCVA 4UHJA 1RABA 1KDOA 3HQ4O 2VT6A 2Q6LA 1HT0A 1XFDA 2VPXA 2Q8PA 3HYSA 5JD3A 2VHQA 3MCUA 3NHMA 4ZGGA 1YZLA 4QQ8A 3SDSA 3L93A 13PKA 3B6ZA 3LWBA 4GPTA 3LWZA 5HMMA 3JAKA 2EFEB 2QN9A 1H2WA 4H4CA 1AOXA 1B8PA 1IXZA 1HBJA 1K97A 2BR5A 3D81A 4K2HA 2EKQA 4NBNA 4NMLA 3TL6A 3L6RA 2C3YA 3AR8A 4N5LA 1FDUA 4CLEA 2WIGA 1R88A 2VOJA 5A4MS 5JCOA 4C4XA 1TCCA 5KYXB 4MPTA 2ECPA 3JD0A 1CP2A 1O03A 3KTAB 4LZLA 1LXCA 4EW6A 4XR9A 3ZGZA 4K9NA 4Q39A 3N58A 3GT0A 4YVFA 4ZXFA 4RY2A 4ZOBA 1YJ5A 2UUCB 1HZZA 3CW9A 4HBZA 2WF8A 4Z6KA 1GZHB 2GJAA 2ZW9A 3SJBA 1Y5MA 3EXG1 4A8TA 4FFNA 1E4YA 1LY1A 1Z08A 2G6TA 3CJQA 3CZMA 2PSFA 2BGGA 4DMLA 5MFZA 3AIOA 2ODBA 2V3VA 4JQZA 4I4CA 1TJYA 1X7WA 2PYDA 3F74A 3S2UA 1EM6A 1ZD2P 4BP9A 4OXXA 5C35A 4Y1FA 2MDTA 2G7ZA 5FR2A 3JX9A 3CW8X 3B9QA 1JAZA 1I5OA 1I2DA 4MO2A 1TZBA 2IDZA 5DXAA 2DC1A 1D8AA 4G63A 4KYIB 4BCBA 1TFUA 1FUYB 1X19A 2WF9A 2GB4A 1Z07A 4L9SA 3REQB 4E1BA 4YPOA 4EWLA 2R00A 4UZSA 4ML3A 4CR8A 2H92A 4RFVA 1FEZA 1IY8A 2BN4A 3E2MA 2XV1A 2DJ5A 2P5UA 4QQRA 2ZSAA 1CW2B 1ORWA 5KAPA 4C3VA 1QGED 4TWZA 1KY5A 3ROEA 4P0TA 5D5HA 1C1XA 1TW2A 3DJYA 5KX5F 1NATA 2UZ4A 3ZZTA 3SXUB 1WTCA 4IFBA 4LNUA 5CJ2A 2CL6X 4KWEA 1E61A 1YI8A 2JJ1A 3V8MA 5BY2A 1PUXA 1OFHA 3FWPA 3TOVA 4Q19A 1ES9A 1B6SA 2NZJA 2NYAA 1S3FA 2VHZA 3WADA 2BONA 3EXIB 1MBZA 2JBAA 4Z99A 5CCDA 1RWXA 3UKJA 4PBTA 4GC5A 4KIFA 3AWDA 3BQ9A 1GVHA 4MUFA 3FHCB 5AVYA 4XUEA 5CT9A 2JIZA 2ENUA 2R48A 4NV0A 4URFA 1XAHA 2JHPA 3DT8A 3KYDA 5DTRA 1QRRA 4E7PA 1NF3A 4LHVA 1T8UA 221PA 2GK4A 3NOQA 4QGSA 2V0CA 5CA0B 4R9NA 2RHWA 4FUQA 5JUWA 3HK2A 2NV6A 1RMTA 3PJGA 2KI5A 3RBZA 1VXOA 2QU8A 2VJKA 4Q1VA 4ZN6A 1DQRA 1X8KA 1AKMA 3CN9A 4FYYA 5F4BA 1N8TA 1PK8A 4B43A 4BUJA 2GUWA 3SQLA 3TSYA 3HKCB 2RSLA 3IPYA 3JWIA 5K0JA 1TXGA 2RHLA 1FB5A 4KODA 3E3NA 3QF4A 1GUAA 3Q0IA 4KXLA 1MGPA 1T24A 2D0OB 2X9QA 4B3SB 1ONOA 2YJ5A 3WMWA 2QBYB 3CZCA 3OCJA 2EGGA 3Q5DA 1XC7A 1FVHA 4U9UA 1U4NA 3E84A 3T1OA 3BMCB 4B6SA 2IOYA 3AHFA 1J0CA 4P3OA 3FYSA 1B76A 2ZCJA 1E5VA 3M6WA 4ZOLF 2AW5A 4HDSB 1FQWA 4L7VA 5AVOA 3LZDA 4RY9A 4C2UA 4AJKA 4HFMA 4TKVB 3P9ZA 2PUGA 2BFAA 3NI2A 3KWJA 4YRBA 4DLXA 2Q7OE 1ZO8A 4KAXA 4OSPA 4I9NA 5ITWA 3LK7A 3PC6A 2QOEA 1QDUA 3ZWBA 1SBHA 3O4GA 4E5SA 4EG0A 1KS2A 2D8MA 4PCVA 1G7RA 3QELB 4JKOA 3T5BA 2ZYUX 3VXKA 4F2PA 2ATCA 4X1YA 1CR2A 2BFOA 2DFVA 3H84A 5HILA 3W4JA 3SHTA 1GDHA 3A4TA 2DTDA 4AURA 4PE5B 1IN7A 2CYAA 3C74A 4IG9A 1L9XA 4OJTA 3SFTA 3THOA 4AZWA 2UVPB 1NURA 4BLTA 5GAJA 1FNSA 1XVAA 2VEOA 2C0CA 4M0CA 2HEGA 2HOQA 2PMFA 4OHUA 2DH6A 3N2GB 4N65A 1RXCA 4RK0A 1ND5A 1RHMA 4TXLA 3TD9A 4AF8A 3UMSA 5BOVA 1E9DA 2Q5JA 4INJA 4ZZ0A 1SC1A 1XYYA 3I53A 3WSVA 1TVKA 3A1CA 2WMYA 4DMUB 1EFHA 1SUFA 4HNQA 1I9GA 5HCIA 4AWAA 3L0BA 4KR2A 1EX9A 3WK9A 1MXFA 4JI7B 3OUZA 4Y1RB 3UJ9A 1IY2A 2ZIXB 1N5RA 1JLKA 3GVXA 1VIMA 2HNAA 3O4FA 1ZC4A 2GYUA 2Y1DA 1FFEA 4YUZA 3RIEA 1L3BA 5L6LB 2IQ5A 5CPFA 3B3AA 3FTNA 1ZH2A 3Q7SA 5GVSA 1PBNA 3OFND 1SULA 2W0SA 1Z82A 3KO8A 1IZ8A 3O2QB 4YCJA 4H31A 3E8XA 3HVRA 1ZSNA 4G65A 5HZHA 2QVZX 3V00A 5KNBH 2YIVX 3L3BA 1O96B 3QHPA 5I5GA 4OLAA 3R40A 1OB5A 1CJSA 5T3YA 3SYLA 4GSYA 3LBAA 4H27A 5GVRA 4JELA 1JHRA 1S89A 1RJ9B 3ACBA 5D3ZA 1C7ZA 1UFVA 3AOGA 3OZCA 2JJMA 4L57A 4Z5XA 3RGWS 3OLWA 4MUIA 4R51A 4JODA 2WB4A 3EDYA 2ZJ1A 4UJ5A 1Q0HA 1XCOA 1R4MA 3CRW1 5LR6A 3NXKA 4E32A 3V8QA 1IUPA 1WQ3A 3QVSA 2FZVA 4HF7A 1KZ6A 1Z0JA 2H5LA 1HEYA 2EC5A 1Q7RA 1ZZEA 4N5HX 5DYYA 4AJLA 4MR9A 4WECA 4FYMA 2XUFA 3LQFA 3H9GA 5K2MA 4IVQA 2NGRA 2ZJ0A 1V5EA 3TSWA 4F12A 3A9UA 1E1RA 2ASEA 1U0SY 3P0IA 4ZVOA 5LDGA 4UASA 3AI3A 3C8UA 1UMCA 4JLBA 4MRMB 3HPQA 4MW4A 1H6AA 4P3NA 2Y2VA 4L74A 1S4QA 3O8QB 3ZOKA 2C99A 3CSDA 2WWFA 5LYYA 4BKOA 2IYRA 5BNWA 2UDPA 2HCBA 5KS2A 2I4TA 4CLRA 3A1TA 5PGMA 2EKDA 2WP0A 4M88A 2NYVA 4QXPA 1KRXA 3DTVA 4X62B 5AP9A 2VF4X 3A1FA 5GINE 4DLAA 3MWKA 3PGMA 3A9VA 3ETDA 4EB0A 3RRJA 3U5ZB 2XEDA 5K3EA 4QXRA 3UJHA 1XP5A 4CMEA 3QZUA 2FK7A 4JJ7A 3TRHA 4MI6A 3E9CA 4I55B 1H3EA 2XZDA 4KIJA 2GA8A 4OK6A 4C7VA 1OLSB 5JBIA 1WW3A 3R6DA 2XOKD 3WMEA 2E1RA 2JJYA 2PCLA 3QGMA 4Z3DA 2QGZA 4YP9A 2BZ1A 2HWYA 1NPTO 4ER0A 2QXTA 2APJA 2WD8A 4MLCA 2R2GA 4B4WA 4GMGA 4LGCA 1SUPA 4DSNA 2IOFK 3LL4A 4S1PA 2ZXEA 1SR8A 4UUAA 5TGDA 4LWOA 2B8NA 1QZXA 2VJAA 3ZHCA 1AUPA 3A6GA 1NMSA 4RCVA 3G23A 4W5WA 1PK7A 4JR1A 2VNHA 3N2NA 3VH3A 4WXRA 3A4YA 4NMWA 4D0NA 5JD6A 1SQFA 1AKRA 2DT5A 1OMOA 3IRUA 4X97A 2EBWA 1CZNA 1NUTA 1UJNA 1UK8A 3KKOA 4K6FA 3RFTA 3H5IA 1UP7A 3FCUB 5AI5A 1MABB 3KCNA 3OT5A 3EZXA 1KXZA 1UZUA 4IIJA 5DYTA 3QPUA 1JU3A 2C2OA 2UUPA 2FHPA 3KJIA 3T3OA 3DBHB 4IXWA 3MLEA 1SVIA 1DAEA 4F6RB 2GHIA 3P45A 4P31A 5C5EA 4DG9A 3TX6A 1PR1A 1G8FA 4FOLA 2YCBA 4UU7A 4A10A 2QJOA 1XNHA 3K0CA 3II6X 2PEZA 2GCPA 2NTVA 4LHYA 4MHSA 2WYUA 3FIJA 3HU5A 1AT1A 2OCDA 1YJQA 1YOBA 4HAXA 4BNJA 1RPTA 3EEBA 1NN1A 3L7KA 2BL4A 2CCKA 1KMQA 2KHZA 3OO1A 3KAPA 4MWGA 1PZGA 1T8SA 3UICA 1TYZA 1P7VA 3PNLA 3T0IA 3C7CB 3PJRA 2V3CC 1V4VA 4WK2B 1L7DA 1BHQ1 3ULKA 4HMOA 2DR2A 1QYVA 3OF3A 2XHZA 3L8YA 4TV9A 3DMRA 3TFWA 4TYWA 2D1YA 1NQAO 1EHCA 1ZKMA 4FN4A 1D2MA 5HK9A 1T25A 3SX0A 1AUXA 4TX1A 4DMMA 5F12A 4PYRA 4I6EA 4LMBA 1XEWY 3BDAA 4QXMA 3VU9B 1CR6A 1Z17A 4I50F 4F0JA 5LYJA 1UAGA 3ENVA 4S24A 3NONA 3WDMA 3K6SA 2XXAB 3IUMA 1EJ6A 5F2KA 1A7AA 5CCXA 2AXNA 2JFXA 4G23A 1M2OA 5CNMA 3IUNA 3RJ9A 2DBZA 1LTKA 5DBIA 4FOPA 2X86A 4D0LB 4FSXA 3LHKA 4JYBA 4UTZA 4BS9A 2A0WA 4MVJF 4D0RA 1QX3A 2HLNA 3PWSA 4LEIA 2QLTA 4DDTA 3D5EA 3DB1A 1YZKA 3M5WA 2H7VA 5CGZA 4KR7A 1C7EA 3W5CA 2XTZA 3QBEA 4ZOEA 4B46A 1JR2A 3QEKA 4FT4A 3AL2A 2B20A 4S1OA 5KNDD 3O6VA 2O7NA 3GEGA 3JATA 3IODA 4NOLA 5D7NA 1S3IA 1RLMA 5JROA 1ZCFA 5KNBD 5L7YA 2RGNC 3KSMA 4P81A 3JQFC 4BN5A 3BIJA 2ZAIA 1T3SA 1PUJA 4TSRA 5AESA 3CLRC 1Q3HA 2ZZKA 3TRFA 1I3OA 4ZHSA 1NMXA 3W5HA 1NXPA 2GPJA 2D7DA 3LL7A 2PFKA 1JR4A 2H9IA 4HP8A 2W58A 2QORA 3HA7A 4ABYA 4MYUA 3R41A 3C8ZA 5DOVA 5IVPA 3KFLA 3PLAE 5DB4A 4AKEA 5FI1B 3RU3A 3CKKA 1XPUA 1QC5A 1M6EX 3ZHXA 2KLHA 5HUHA 5C7YA 4N41A 4XYGA 1JLMA 2D1TA 1J0XO 3TS1A 2Z8YM 5I7AA 4UBLA 1NVDA 4RXTA 5H59A 5CW2A 2H11A 5DHRA 2MWMA 5AXBA 4C1BA 2RKBA 5A62A 3CZPA 5KIAA 2FF7A 1RCFA 3I4FA 2YIMA 4MKGA 4AB1A 4M7RA 3HDYA 5FXMA 3UW3A 4M8SA 3AM3A 2QTLA 1WHTA 1DFIA 1H8EA 2VDRB 3PS9A 2VSQA 5K8VA 3WIBA 4RO0A 4J2HA 3V4RA 1WL8A 2I9PA 4M46A 3H9EO 3TH5A 1Y7TA 5I3ZA 1RFLA 1SFRA 1G1AA 3L79A 3VYRB 3W7VA 3CKYA 1XQXA 1TTQB 2ZIGA 3I05A 1Z4OA 1BJKA 1KR2A 1KYYA 5INTA 2H29A 1B8VA 3WKBA 2WNSA 5IBPA 2FRDA 3NORA 1GQFA 2O1EA 3A0RB 4JI1B 1JIVA 5KU7A 1M1UA 4N0MA 1Z34A 4RQUA 1DFHA 3GJ5A 1WE2A 2QVXX 4Y0NA 4XRGA 4DA6A 1JR3E 3Q9NA 3U9TA 4ZJYA 5IWAB 4QEZA 3CR3C 3AR2A 2P2NA 4E31A 4A2PA 4PG8A 3KLBA 2KMLA 4ZI5A 3ZDFA 3GRKA 2FG6C 4MEBA 4WERA 3TWOA 3STVA 3VSCA 1W1IA 1WEHA 3SPXA 1KYTA 3SBDA 1AHPA 5HTOA 3U13A 4ZWNA 2JDIA 3UMBA 3IQWA 4PHTA 1IBLB 2OMKA 3M8KA 3F3YA 3PGJA 3DBLB 3MMZA 3VOAA 4RXUA 3WMRA 2KJQA 1NM5A 3UHJA 1II9A 2RCNA 1TYCA 4GI3A 2ZQYA 4N5IX 3W9YA 3ESXA 4XD7D 4EI7A 1XV5A 1E59A 2C04A 2A14A 3I01A 1IIRA 2XDQB 2IUSA 3R44A 4G9GA 1J7KA 1C3OB 4I5IA 3HKBB 4ITUA 4ZCMA 5D1NA 5E1BA 3WNVA 1PL6A 4P6VF 4KREA 2N9UA 3IEKA 2FSSA 1U7UA 4HX2A 2IXEA 3QLVC 4KV7A 5F5NA 5JXGA 4NXMB 3OU6A 4TL8A 2UYCA 2QRVA 1W0KA 1W5FA 4UBIA 4IVRA 4C0AC 5I01A 4EEKA 4QUKA 4LDRA 2QTGA 4OM7A 1BCSB 2QPLA 2EJCA 2VJPA 4K6GA 5DGCA 3GNTA 1HGXA 1D4AA 2JFUA 1C81A 1IWPB 1GZVA 2G25A 3OF2A 1GADO 1DV2A 2I99A 4JX8A 4KE7A 2GPSA 1POXA 3WZLA 2PD6A 2OECA 2X5XA 2YYAA 3V1MA 3VDQA 3GD7A 1E9BA 4WOKA 2L69A 1ZIPA 4V1CI 1JU4A 2CUTA 1GPLA 2HWKA 3A3OA 4IG4A 4MKHA 4GIBA 4WN9B 3N0XA 1P1FA 4NJOA 4B7ZA 5FUQA 4MINA 1U2SA 3C41J 4X3PA 1P3DA 1QNFA 2WBLC 3CG4A 1XELA 1Z8FA 4LUCA 2PM8A 3W9BA 1J24A 4D92A 5HKKA 3FR8A 2E6UX 1B3RA 3P4YA 3S44A 3NBYC 1MO3A 1Q0LA 3B1YA 4DVGA 3NUZA 2KM1A 1GPJA 3SIWA 3LO5A 4J0DA 2F3PA 3WIVA 3Q11A 5C8YB 3CHYA 1RXIA 4YAJA 1E2JA 4KTTE 4PZ9A 5JH7A 1R4ZA 2GN4A 3B5EA 1Z26A 1Z0SA 3AKYA 4JEUA 1Y7PA 2FPUA 4FBLA 1UWVA 4TLEA 2QRZA 1C7IA 2YWXA 1XVVA 3GJ8A 3RTDA 3AUJB 3V8BA 3KQNA 1JLHA 2LIPA 3LK6A 1X1DA 1CRPA 1N2CA 1T3LA 2DT8A 2V7BA 2NTJA 1PR4A 5JPIA 1L5OA 1GFSA 1Y4SA 3TPZA 4H1TA 1M6NA 1O54A 2C4UA 2ZGVA 3KXDA 4NJEA 1SUAA 4RTRA 1H2BA 4I1OA 2YN2A 2PX3A 4X71A 4Z9XA 1II8B 4IXDA 1LTHR 2GKGA 1WD7A 3HL0A 1K5DA 1KVUA 1UXKA 2X15A 2BTQA 2FRXA 4G1FA 4L4UA 2F7SA 2HQBA 3FWKA 3KJQA 4DKXA 1XNJA 1I51A 4AAYA 3DKVA 4OXQA 1XRQA 3RS2A 5JY6A 1FVFA 1VLZA 2EOAA 1HE8B 1K92A 1M66A 2R2AA 1QMPA 2O5VA 1PX0A 3PD7A 5B37A 4TWJA 1LDGA 4OLJA 4FNMA 5FTKA 4QXQA 4I0WB 3NASA 1R7RA 5EJ7A 3F8WA 1JSRA 4ESHA 4CEIB 3TTTA 3PQ5A 2JGNA 1G291 4CDRA 3V6LA 3SZRA 1FE8A 2Z9DA 1RBMA 2QLJA 5DGIA 4P22A 4WIAA 4D4KA 4MH0R 3HDJA 3LA6A 4XQEA 4B4DA 4EYSA 1HORA 4JI0B 2JFNA 2OD2A 1MC5A 2WJ6A 4HC4A 4N7RA 5HKOA 3NHZA 2PGOA 2HRZA 3MMPA 2YWFA 1G8JA 2IU3A 2Z4RA 1N6PA 4DLYA 2Z6UA 3BZUA 3BJIC 3EYAA 1KHTA 1IVYA 1KOFA 2C9MA 2QQ0A 2UYQA 2ZIAA 3MHPA 4ND5A 4D4GA 1WHSB 4D9GA 4BMOB 4HYQA 1Z6QA 1KO1A 1TL7C 3VDNB 3TE7A 3T8YA 4WJLA 2H1WA 3QH4A 1H2HA 1DXYA 1FRQA 1NJSA 4EJ0A 4UULA 5EQTA 3SZ3A 4RQTA 2ZYRA 4R69A 3UK6A 5AK4A 2YIDA 4MGYR 4TXJA 2PUHA 1R4AA 2OBYA 5HCNA 3L6BA 4UD2A 3TZHA 4ZZ1A 4ZCIA 4L7QA 4MS1A 4MROA 4ANFA 3A6DA 3G5UA 3IBFA 2OFXA 4YBRA 4E12A 5BN1A 3ETLA 5C51B 1Z73A 4P86A 4R5HA 4II7A 4GSLA 4ZXPA 4MQ4A 2GVZC 5DX1A 3TMAA 5C3MA 1WPQA 3IBSA 2VP0A 2R6AA 4JLWA 3RS8A 4WCFB 4QWWA 1GUZA 2PCJA 3U6BA 2FR0A 1FMJA 1KH2A 1OVGA 4Y9UA 4FEAA 2HIGA 3ZDRA 3UTDA 3KB8A 5CYPA 3ZJVA 2FEWB 4O59O 1DAKA 5KC8A 5DXJA 4BVEA 2GILA 2WWXA 3G0OA 3Q8XB 1E2GA 4WLNA 4QWMA 4B3CA 3VNVA 2XI4A 2ZRKA 4TMZA 3ZPXA 3DFIA 2AFRA 2Q9BA 1U7XA 2ERXA 2VP5A 4LHXA 3DHEA 1VECA 2L82A 1O5IA 1Q44A 2OBNA 3C7TA 3HJTA 3NV9A 2I7CA 2F8MA 4OQNA 5TQ2A 5BYKA 2BE9A 4NG4A 1W8DA 3I6MA 1R5JA 1K8YB 1SC9A 4ZYYA 3EH1A 3IPRA 1RLTA 2ZJBA 4Q93A 3TTYA 3JWHA 4DABA 2C2YA 2AMVA 3ORYA 1I2AA 3P9XA 4BZZA 4YRQA 5K3FA 2GZSA 1TIPA 4M6WA 4GUDA 4AXXA 4GL2A 3PFKA 5LP6B 4IX1A 1B16A 1A1SA 3HV0A 3KTFA 1EXMA 3D1LA 1LBHA 4OD0A 3COSA 1DLJA 2QHXA 3GH3A 1RM4A 3OFSA 4BJ6A 2PUBA 4RVSA 3ISJA 3QE3A 1Z18A 4KNVA 3N2KB 1P60A 4EPRA 3DTYA 2WKPA 3AF6A 1V25A 1G8GA 2F1RA 1Y3FE 4TWBA 2YV4A 4UW9A 1WNFA 1NQWA 2ZRCA 3RAPR 2O8FB 1PBTA 5B4UA 3CZ9A 4MW9A 1JA9A 1S02A 2NVUB 5AXCA 1CUFA 2Z57A 4W6ZA 4CM8A 4DDKA 4QULA 1EP9A 2E4UA 3U7RA 3PL1A 2FW6A 1GGMA 3OQMA 5E0KB 4AI6A 4JDUA 4OP2A 3ICOA 1N9GA 5BSUA 3AR9A 4ZTUB 1O9GA 1VHWA 4GMKA 2SKDA 4TZKA 5KQMA 3K15A 3K9BA 1PWHA 2VCEA 3L84A 5AJTA 4M89A 4UU8A 2Q3JA 5EFZA 1HYBA 3R8XA 1OIVA 3TSCA 3AEXA 1P4HA 2AG8A 1LBQA 2YWDA 2GJSA 1T6YA 2JEYA 1D2NA 2PSHA 1YQTA 4HNHA 3VR3A 3WDLA 4BWVA 2G9NA 4BE7B 3FYHA 3CRQA 1KE2A 4C7KA 3DVLA 1D1TA 4YV2A 1JXAA 4WNAA 5DP1A 4HEA1 3E05A 3KQTA 3C85A 3QYPA 1N8SA 3D8NA 1N3IA 3F4KA 1ID1A 3KL2A 4M0FA 5AHRA 1N2EA 1AQJA 4XGIA 1UJ2A 3SC2A 1V7PC 4DQUA 4PTYA 1CUXA 1HG0A 1O9BA 1A69A 1WWKA 4TTPA 3S99A 1V45E 1HI9A 2HL6A 2I2WA 2QM0A 3L7IA 1OIWA 3LPLA 1RT9A 1T8RA 2AMJA 3ENWA 5AYVA 2Y6VA 5THXA 5IMSA 5CA1F 1LZLA 2EU8A 2E4ZA 3CKMA 3KOZA 2PZBA 1KEEB 4RZUA 5TT0A 3B78A 5T6MA 3NOVA 2V5VA 1KL7A 3TRDA 3UMJA 1IN6A 1HY3A 2V6BA 1BMDA 2YVUA 4W9MC 2EBHX 2YX1A 3D6TB 4F3KA 4PAWA 4WZAE 4YH1A 1V2GA 3MSXA 4JASB 4PPFA 4D43A 4DR5B 4K3VA 1SRQA 5KX5A 5K4GA 4P53A 2YHIA 4H59A 2XDAA 4AW9A 1PVVA 1UKYA 4OHMA 2I6XA 4R8RA 4ROTA 4DDWA 3CUSA 4N0PA 5IT9A 2CXSA 3I8OA 2HRDA 1NZFA 2O8NA 3MEQA 3QFTA 5GQSA 2EL9A 4F72A 1HNXB 1IL0A 2XUKA 4JOBA 4IXTA 3AHHA 4WNYA 1K9VF 3SJUA 5IF3A 4XIJA 3RRYA 5KOIA 1APBA 4F3NA 2LUOA 2DE0X 3HV2A 4RD3A 3UUGA 2NUAA 1HE1C 4TV8B 3CMMA 4EX7A 1VLJA 4Y6SA 1NBMA 4XTCS 1KQFA 1OFUX 1WNTA 4EFDA 3HCAA 3K2BA 3U3ZA 4QUIA 1S9DA 5D51S 5FNVF 1I3CA 2OAP1 5FTNA 1C30B 3N1UA 3SEAA 1T15A 2XYGA 2PBZA 3C1OA 5J59A 1JNYA 2ORED 3FVVA 4S1NA 5TS2A 3RQIA 4AS1A 2HZ7A 1YR6A 3U3OA 1COWD 4KO4S 2VDWA 3KS9A 1YTLA 4GM0A 1OILA 3U3RA 1G5RA 1WDWB 2OPBA 2QU7A 1S2NA 3DHNA 3TOXA 3Q88A 4UNRA 6NULA 1T9HA 1EZ1A 2E4WA 1YAHA 2ZU6A 4ZD6A 3ZHTA 4EAAA 2IH2A 2W6JD 1P4SA 1YAJA 3CVJA 4JNCA 3DL7A 5FNZA 2Q3EA 1C4WA 4EZBA 3H65A 3MCTA 3WGVA 4GDFA 2WJZB 2PNJA 4HKTA 5FQNA 3W6UA 2E4AA 5ICMA 2FEAA 5IVDA 4GPD1 4MICA 4FMCF 5SYMA 4XSHA 1E4EB 2R6CA 1ZA2A 2ZSKA 2OGZA 4L78A 4X54A 1AQUA 1KMHA 2H0QA 4NQZA 3ZH2A 4PZAA 2H85A 2FWJA 3HBLA 5CJJA 1ZPDA 3VU1A 3K9WA 4D3XA 2Y6UA 3P0RA 3BWXA 3WG9A 1N75A 4NQRA 3WK7A 5ELMA 1FJXA 2JFVA 2YN4A 2HXSA 5K0CA 2Z8XA 3VR2D 2GEVA 1MJFA 2BJHA 1KYZA 4GZ5A 2Y1LA 3BXXA 4JNKA 3GHHA 4LWZA 4O4IB 1RI4A 2B5WA 1PHRA 2XCTB 1TEZA 2ISCA 4AKIA 1FP1D 1QP7A 4D8TA 1N1DA 2HTFA 3O7WA 2BRUC 4J76A 4DJJA 2WHEA 2XWSA 2IZ6A 4TMFA 1P7CA 2UUAB 2ZB4A 1N6HA 2IHTA 4ZIRA 1ZOIA 1TIBA 2YBDA 1KDVA 3G8AA 1PYDA 1ZNQO 1YIDA 4BEJA 1YC2A 3CF4A 2QJFA 1ECFA 2GERA 4DHWA 1PV1A 4X8OA 4J0HA 2XUQA 3AY0A 2LBPA 1PSWA 2AE2A 4Y2VA 2ZS8A 4O2AA 2CL5A 5SY4A 2PN1A 1YUBA 1UKZA 1Y8QB 1REQB 2GARA 1BXGB 4RENA 3T6KA 5B55A 1LQTA 2I1WA 1XZMA 4C4PA 3MC1A 4RANA 2I03A 4QRIA 2GPBA 2FR1A 2O5EA 2IUFA 5AVXA 1XTKA 5E7QA 1FUEA 1Z5UA 4BVHA 2AMFA 4D9CA 3EHDA 4NARA 2WTUA 3BCUA 1LDMA 3HBAA 4MVJH 3OIDA 3FWHA 3B6KA 3PNBA 4TLAA 3ZLBA 2FPRA 1U3FA 1M5TA 2HQRA 2Z6VA 4OK3A 4AK9A 4P4UA 2C2BA 3FUTA 2B34A 1X7DA 2J30A 1VMAA 4RJJA 1PS0A 3EG9B 2P8SA 3AJ9A 3M6MD 4JXZA 4MCHA 4D8XA 3W5DA 5ICSA 3AOEC 4MYCA 1F0NA 1JIKA 2V54A 4O5AA 2C00A 4DVJA 3GLIB 2EWVA 5EZQA 2C2HA 2ZIFA 1Q1AA 2BCJQ 3GD5A 3GZ4A 4WOCA 3RVMA 1RTTA 5KDLA 1OXKB 1U2RA 2BEUA 2LPMA 1MIOA 1G3UA 2C94A 2GN9A 4DZRA 4RVFA 4A8HA 3TW4A 3IGFA 3EGOA 3LTNC 1BE6A 2O23A 2X4IA 4KTVE 2HHAA 2R4TA 2ZI7A 3D3JA 1U8FO 1O8BA 1SU7A 1WCWA 3TG2A 2ZUVA 1Q5PA 1IONA 2P6OA 2GF2A 3ECSA 2IIQA 4LW8A 2GZHA 1RWKA 1J06A 3MWLA 4COOA 2BI4A 3JAKB 3TFQA 3CNLA 4WW0A 3U81A 1L5SA 2CFOA 2IEDA 2ZM5A 2AQHA 2OK7A 1TYDE 1CZUA 4FK8A 4LJ5A 1YCFA 4U1RA 1AMUA 3U4MA 1F1BA 3M6AA 3VNUA 6GPBA 2WJPA 3B36A 4F5EA 1FP6A 4C43A 1JECA 2Q4DA 2VP6A 5ALRA 2A1UB 2HV8A 4PZCA 4ZQEA 5ITZA 3EVGA 4K1LA 2OT3B 1GTVA 4H0CA 1GYQA 3L4BA 4TMKA 4YI3A 4DEXA 2NAFA 4LXQA 3UWMA 3U09A 3X1YA 4LNHA 1XXHE 5K4HA 1TEHA 2H7CA 2O8BB 2HA6A 5BXQC 5C8XA 3DCJA 1IJFA 1WCIA 2V6GA 2QPOA 2VWPA 1VIYA 4XSGA 5DFAA 5JVDF 4A0FA 1JYEA 1MB0A 1U6IA 3DPIA 3AF4A 4IF6A 3GW8A 2ACKA 1JBKA 3N86A 5AXAA 4Z1MA 2JCSA 4RPKA 3Q8LA 1PQYA 5DU2A 3VZQA 1Z6PA 5H81A 4UUQA 4WINA 1TPZA 2AXPA 4XGRA 3NIFB 4GX2A 1Z2EA 3P19A 5JEEA 1Z39A 3CRNA 4AKTA 1RJWA 1EE2A 2E7ZA 1P17A 2JEZA 1HDYA 2ZVJA 3D2CA 4G5RA 2QSUA 4GI5A 2WIJA 4K40A 4URHA 5FUYA 3ROMA 5K0GA 4W1SA 3NETA 4EHDA 1RWOA 1W581 2P79A 3KVVA 4F9TA 2OZPA 1D4FA 4KK4A 3P2MA 1MX9A 4JP2A 4AJNA 4F4FA 3RFCA 1RAEA 1RCUA 2Z4TA 1YFJA 5JO9A 2HK8A 4LNAA 3E9YA 3DTTA 4M0LA 3UT0A 2W2VA 3HLYA 2FWBA 3I04M 3WLJA 1WPGA 3EF1A 5MN5A 1WIWA 4G1UC 3OIFA 3ZDQA 5FTLA 3PUHA 4QICA 2VSNA 2J3EA 4DMFA 4RH3A 4EA7A 2NXEA 2AK3A 1Q2XA 1WULS 2CMFA 4O0LA 3RIXA 2ODAA 4RBNA 1YR3A 3LUKA 3FRHA 3QX9A 4A5SA 1CSEE 2CL7X 2Z08A 3OC0A 4AROA 2XOEA 5IANA 1V6AA 1JT2A 1DJLA 1ZHFA 4YJ2B 2PBRA 5HQJA 3JWPA 2FFBA 4KH0A 4UEKA 1D2HA 1IHOA 2TS1A 1FUUA 6Q21A 4NV1A 4QBHA 1ORTA 4LI0A 3BILA 3D43A 4D96A 1U3DA 2WKSA 1E7SA 4FS3A 3WNZA 3KYDB 4NICA 2MINA 3WLOA 2HHLA 2VJDA 3FTQA 4MNTA 1LUAA 4TLBA 5HDQA 2X0EA 3V8NA 3KHUA 4YCSA 4MUMA 2F1OA 2H2WA 3E9MA 1I7PA 4X7PA 3PUWA 4JJ4A 4HTFB 1V2HE 3WAJA 4PAOA 1GNSA 3ZCXA 3DKKA 1Q17A 4V02A 1WZCA 4ENTA 5EG5A 3KTDA 2IPOA 4PZLA 5L3QA 3DDSA 1FMCA 1RC0A 1ACLA 3BZBA 1N2XA 2F3UA 3I92A 3A3PA 3ICQB 2LKCA 4WK0B 2O0LA 4R9SA 1Z4MA 3W5BA 1CUAA 1GTG1 5DASA 1A88A 1PZHA 3AEZA 2BCGY 4I50A 2CV1A 3PHGA 1EAMA 1NJ2A 3QQPA 4JGGA 1IH8A 2YWBA 1TVCA 1V16B 4X00A 2AFHE 3LRTA 4UAVA 4HGNA 3RV3A 3FLEA 1ZM4A 3GEIA 3KYCA 4YR9A 1W85A 3KD3A 3KTOA 1V96A 1TUBB 3AR3A 2C5LA 3Q0EA 5EZ5A 4B6JA 1XL1A 3A0UA 3LLSA 4UEQA 3PJFA 4OHZA 2IHUA 3RDPA 1J1ZA 3ZLUA 4E70A 3K92A 5K0BA 3A3YA 4HGRA 3T9EA 5JSZA 4HXGA 3ADCA 2EJWA 4D4HA 3K9QO 2DTXA 1NJ1A 3WYAA 4BLRA 4KO8A 2OSVA 3ONDA 4PICA 3TLCA 1MD9A 4PTZA 5D6NA 5ALWA 2NV2B 4D98A 3G8YA 4KQ6A 3OCWA 3PNVA 4GL4A 5EJ8A 1BHSA 1GKIA 4LQDA 5FBKA 1SQ5A 2B78A 5DTQA 2FZLA 5CBPA 4DIEA 5M7EA 3YASA 3C6MA 3FD8A 5BSVA 2XJ4A 1Y9AA 1DRWA 2X1MA 1T6NA 2R8XA 3TNJA 1UFRA 4HGOA 4OBXA 5IYZF 1GA6A 2BGNA 2ASVA 3A14A 4UM9B 5K6TA 3OLVA 3C3CA 1G4AE 3INNA 1YK0A 4XEHA 3UPDA 4OQDA 2AC4A 2AGVA 2TMYA 3OBIA 2XUZA 4UE3S 2RBEA 3PI6A 3TW8B 2ZB8A 2HMAA 3PFWO 4EATA 5LIPA 1U28A 2IZ1A 2JCBA 5E8RA 4IZ6A 5AW2A 4MWOA 1X92A 5EXXA 2FDXA 5ICFA 1OT5A 1ZMTA 5K8JB 1CFJA 4BFTA 1QPBA 1OYOA 2GPTA 2LXNA 1KR5A 1QIIA 2P3QA 2ZBDA 3DNFA 3AUKA 3SGLA 5C46F 2J46A 1GXSA 3EWSA 3R6WA 1B23P 3ABZA 1RP7A 1TYBE 2JIBA 1GSOA 4JFAA 6ABPA 2PQ2A 3FDFA 5F21A 1ECJA 2QMZA 3HXKA 4PW0A 4ZREA 4WNIA 1B0AA 2ZSFA 4Y2SA 2O07A 3PC3A 4JR0A 2IP4A 2JAOA 3E9QA 5FD8A 2WLSA 2GFHA 5JZVA 2P1ZA 4ZAXA 1Y48E 4G2NA 4O1MA 1ZIYA 1H4SA 2JW5A 1Z2CA 3HJRA 3E4CA 2FMTA 4GYWA 3VA7A 3NTVA 4E6EA 3R5JA 4YRRA 2PT6A 2ZXFA 4PSUA 4PXYA 2HF7A 4ND6A 1ZHHA 3AP1A 3B1XA 4BO8A 4CQMD 4D9EA 2C7RA 1FC0A 1MX5A 2P4SA 2PT5A 2WAXA 3I9JA 3N2YA 2PZEA 1V7CA 1HYHA 1EWVA 1CC1S 2VDPB 3DT6A 3F7OA 3OHPA 1DDGA 1YKGA 2IK8A 3R6LA 4RVDA 5DBEX 2XT9A 3PXCX 5HM8A 3ZCSA 1R4MB 3WBKA 4B87A 2I6GA 2QLBA 3ADPA 1Y1PA 1YRLA 4PFQA 1RNLA 5BN5B 4AZ3A 2CXNA 1G64A 1PLJA 3IIKA 2PDAA 3RQSA 2AXEA 4DC9A 4HNTA 4UMFA 1NVWQ 1N7GA 3LQQA 3OP4A 4M9UA 4MR9B 4DQKA 5HIKA 5KTKA 1PDVA 4TMWA 2NUTA 5A6VA 1UAAA 5J9FA 2PUAA 3Q7PA 3QEBZ 4MUKA 2GNAA 4B4OA 3ZD7A 3OX4A 1UMCB 2RK6A 5B58T 1LQUA 2X0JA 2BMEA 1DIHA 3LKBA 2JLAA 2CLEB 3TUIC 1VTKA 2R25B 4IFEA 4FKMA 5ENVA 3ZWYA 2GH1A 4MW5A 5DCYA 1YQGA 3HSYA 3A7DA 1VOTA 2OM6A 3ROTA 3P32A 4CLRB 2IOFA 4BMDA 2W2OA 3KYIB 3C48A 2BBTA 3DTVB 1V4BA 4UZFA 2Q5IA 3JAWA 4KR3A 1MPTA 1O97C 2KPOA 5CHEA 5AO9A 4EHJA 5A3VA 3KKNA 1C14A 1VDMA 4JVLA 1Q91A 3CX7A 3J80A 3Q2KA 1NC3A 5IT5A 4O02B 4HLNA 2EKPA 4S2EA 4LRUA 2C5FA 4XWGA 4Y2GA 4BV8A 3RGGA 1A9PA 2CFCA 2E0IA 5AQ1A 5HRCA 2HGZA 4BKQA 2ARKA 3H1TA 3O2JA 3P7MA 1J5PA 1HWYA 1YHZA 2VNIA 4ZVUA 3MJRA 1O4VA 3IVGA 1D9ZA 1KEKA 2KQUA 1E9SA 3D9QX 2YMMA 1CJCA 2X8BA 2ZREA 3FB4A 3ITKA 2YY5A 3KOUA 2ZSBA 4L8GA 4TS3A 1I1OA 4UCXA 5DMHA 3VHXA 1XALA 4AICA 5J58A 2IUUA 1ZRMA 1L7RA 1XPJA 2O2DA 5B7NA 2ZQ5A 3EVAA 4IOKA 5U4QA 3TIGA 3FLMA 3CO0S 2XAAA 4A2WA 2DB3A 4OXKA 2AKAB 2O19A 2CN1A 4EEXA 2W6OA 4EHIA 1L4KA 4D6YA 2JGLA 5KPDA 2BFDB 4G56A 4JGIA 2FWIA 5F2OA 4BRUA 3QUBA 4IIJB 4IBOA 2PMCA 2D1SA 4EHHA 1N6IA 2HTEA 4KFTA 3W5IA 3U19A 3R3VA 5IJXA 5ALDA 1J8YF 2CNOA 3T5MA 1PT6A 2G36A 3O4HA 4HADA 4G5XA 1SIOA 1Y9JA 1XA3A 3AF2A 1ISFA 1H1LB 2X8JA 1XZGA 4WKOA 5AOAA 4QM7A 1YSCA 1GRQA 2JFWA 3EVFA 3U44B 2JKYA 2C9ZA 5UKDA 2AJBA 3T1NA 4P38A 4CYMA 2I8AA 2YV1A 1MG0A 1G3MA 3A2MA 1VJ0A 1Z2NX 2H4JA 1GZSA 1JP7A 2PWYA 3Q2IA 4TTRA 3KIPA 4C6SA 3ROGA 1IATA 3WL3A 1JL3A 2BEVA 3EIOA 3ZWVA 2IXTA 3SK0A 1ZK2A 3C7DB 1JYFA 1CP3A 1KJQA 1BOOA 3H8JA 4ID9A 4ZMSA 1X7YA 3ZJ4A 1XTZA 4CIXA 1VFPA 5CITA 3AJDA 3WBFA 2H65A 2W71A 1YACA 3KP1A 3K6SB 4LHWA 4LVNA 4YN3A 4UVHA 4CQLA 3PYLA 4PNPA 2PUJA 3FLAA 1Z3IX 4PBRA 5J47A 3QI2A 1BXRB 3HNPA 2QYSA 2YFYA 3K35A 3O1LA 3V4OA 1IBSA 4QUGA 3GEPA 4HGQA 5I7HA 1VMIA 3NPMA 3OLQA 16PKA 3OIWA 4G25A 2IZ7A 2JASA 3D4LA 2OG2A 1FP4A 1DKLA 5K8TA 4MEJA 4NIMA 3EDQA 3HHPA 1CDDA 1ZP6A 2ZBUA 4NCJA 3HR4A 4ATNA 2O2GA 2VJMA 3K8YA 3V8VA 1WSWA 2BFFA 2GTIA 3EQ6A 4F84A 3EPLA 3G7SA 5IM4F 2FKNA 3JATB 4R3UC 4BNDA 2HF9A 2Y3IA 2LE0A 1GR0A 4MO9A 1SZCA 1K6EA 2JGMA 3DUFA 3QLEA 4KQMA 3DV0B 2I91A 2RG7A 3BRWA 4UVGA 5I7WA 3T1VA 2VP3A 5C8YA 4M0MA 4ZRNA 2ZBQA 4EDHA 2R6FA 2HCRA 3L7AA 3SHOA 3HKDB 1XWWA 1AGNA 1XTTA 3HA3A 1H1TA 4AYXA 4RMNA 2Z3WA 1VLMA 2VYFA 3KV1A 4RVUA 2P4HX 1D1QA 1NSFA 4ZZ2A 1G2IA 4UTPA 1YA6A 1TJ5A 1DPGA 3PXBA 5ERGB 3RUAA 5HIMA 3U3XA 1JLLB 2E9SA 3MWEB 3DAYA 5DO9A 3UXYA 4KB5A 2ORYA 4CG3A 4XVUA 1YHYA 2A5LA 1O87A 2HSZA 4CDNA 1QGZA 3GYBA 4E14A 4TT3D 1N25A 2B5OA 1W0JD 1RYDA 3OIGA 3R77A 4FFLA 4UNPA 2YKGA 3TRKA 2CXOA 4GPIB 3UB2A 4G4SP 4AS2A 1T26A 3BTUA 2VK1A 3QTTA 4HNAB 1NUQA 1MLDA 4KN8A 4KDFA 4ZCSA 3JQ6A 4FYJA 3ZWPA 3PRHA 2OD7A 2F6RA 1KJ8A 2Z3VA 4PLYA 4FXOA 1TTPB 2IV3A 2DRIA 1SU4A 2QE7A 2VTDA 4OQYA 4R1NA 1YQWA 2XTJA 3EMBA 4QUHA 2O8BA 2HA2A 4U8HA 1VSVA 3GVHA 5B6PA 1AUVA 5CVDA 3W1WA 1A5BB 1MA0A 2PK3A 2REQA 3PLRA 5A6SA 1HFKA 4EBFA 1M7BA 5FH9A 4R81A 2VNJA 4TYNA 3OE5A 1KORA 1T0UA 1UDCA 2OOSA 3FGZA 1L1EA 3GDOA 3LVRE 2QM7A 5DW0A 3TGPA 2A86A 4EPYA 3IT2A 4FGKA 4RDXA 4JB8A 1OBHA 4OOFA 3DG9A 2VF7A 3OQPA 1PV2A 4FI3F 4MTLA 2G9VA 1FDOA 2XXJA 1QVWA 3EE6A 2FWPA 2OGSA 1V1RA 3W78A 3MOGA 1JPUA 1OC4A 2AI3A 4UDYX 4ZRMA 2CFTA 5I45A 1E3QA 4M9QA 4AU1A 2ID4A 3G8DA 4B31A 2FW7A 3OTHA 1Z88A 3QV1A 5COBA 1RAFA 4WBSA 1U31A 3NG1A 2VF5X 1FJGB 1JG6A 1SKAA 1HE3A 4JYZA 3BWBA 4G0XA 2QTCA 5DNCA 1PGNA 2H31A 1XJ5A 2TSYB 2ZSHA 3O4JA 5E9AA 2W70A 3TEMA 1Z0KA 3DE3X 2JI9A 3TRIA 3SVLA 4S1TA 2HSEA 4WCVA 4R0NA 3RS9A 5JAUA 1A04A 1R0CA 4NATA 2G9ZA 4OA8A 3F3KA 4PNHA 4TTJA 4X6YA 3KOOA 4MMYB 1AGPA 3SSOA 1NN3A 1OH6A 1K4MA 3I9V1 1J8QA 4RPIA 3MUOA 4GI1A 2HJWA 1ZMBA 4A0QA 1W73A 1YS7A 4AUEA 5BORA 2PRZA 5KWVA 2J9XB 3WBBA 1C1DB 5F33A 1C3XA 3H2ZA 1A8HA 5EQFA 2QUHA 3DR5A 1T43A 3DE4X 4B45A 2YZ7A 2HJHA 2QVLA 3OZUA 4OHCA 5DSTA 3FFWA 3WGJA 3WRYC 4AJOA 1KJNA 2JRLA 3KDSE 5EKXA 3EEFA 4ZAVA 4DCOA 4DYVA 3FNBA 2CDAA 3AUUA 4JLSA 4TYQA 1YTUA 3R5XA 4IJQA 2QSJA 3KPJA 1GCIA 1CJBA 2RGBA 5BQXA 1FLAA 5EZ6B 4X66B 2X4GA 3JU3A 4DQDA 4O0MA 1MQ9A 2QVCA 1GTMA 2NMVA 2O2XA 4EF4A 3C43A 4GOLD 3ZE9A 1N2HA 3ZGOA 2QTRA 2QRHA 4LE0A 5HFJA 1E2UA 3K0AA 1F8UA 4KUEA 4P2GA 5P21A 4Q9JA 5EZYF 3K8ZA 4JMPA 4UREA 3VQTA 2CK3D 1Y6ZA 1ZEMA 4IOLA 2M6KA 5LQKA 3REFA 1F0PA 1TUGA 1RCTE 3N76A 5JH7B 4PVCA 5DBFA 3ET4A 3PENA 1EK1A 5LOVF 1T9BA 4LZJA 3TINA 3KSBC 3WB2A 1HNWB 4N6NA 3KEFA 2IFTA 3IE0A 3D7LA 3PQDA 4WFQA 3PD1A 5GMOA 1HDXA 1I1NA 3I6YA 3DF9A 1J2TA 1Y1SA 1Z2AA 1L7AA 3PKJA 2R1TA 1N32B 3Q98A 4B0PA 3CPJB 4NJEB 3H4VA 5CEFA 3H5WA 1W35A 2FPLA 3RVPA 2ZJ2A 1LPNA 4IQFA 3CX6A 3OE7D 3GELA 3D8RA 3IXQA 3RHFA 5DK6A 1I32A 1Z38A 4Z9BA 4U7DA 4XYMA 1MPXA 2Z3ZA 3QX8A 3H0KA 2HDOA 1HMYA 1XWIA 2DUUA 1L5LA 3LF1A 5FWYA 2GK3A 2X23A 2FZEA 1W0CA 3AERB 2NZWA 4FHFA 2Q1TA 2A5FA 2V0NA 3NBZC 4OB7A 4DLRA 4FFBB 2SKEA 3QNUA 4N3BA 1M2KA 2JI7A 3P97A 3X1KA 4E07A 4HGPA 3MA0A 4M83A 2EF0A 5I7EA 1AZWA 1NBHA 2K7ZA 4JJKA 2NO4A 4K88A 3BKXA 3D1VA 4RPGA 1ZD4A 1DCKA 4Y98A 2B1IA 3H17A 4UCFA 2ID7A 1P75A 3OLXA 3W8DA 4Q1AA 1O3YA 1S9HA 1Z4QA 1ZLYA 2X1LA 4WEQA 3SLRA 3T5PA 1B73A 1EK5A 2Y27A 4ACBA 2J45A 1VYUA 3HYRA 3WL8A 3A9WA 3SOZA 1E77A 2I4NA 1EA7A 3NAMA 3AI2A 3GLRA 5JSQA 1WB9A 3NMUF 2Y77A 2IW3A 2WWRA 1J0EA 2XA9A 4CMHA 3RODA 5JZSA 2P27A 3IHTA 3NDIA 4HQLA 2GNPA 1AXRA 1FYDA 1ICEA 3KEOA 5CLHA 2AEJA 1H4QA 4G01B 1YC5A 2PGLA 1SVKA 3F6BX 1E8NA 3QHQA 4C76A 4NLLA 3R2JA 4EI2A 5IH7A 4LQ4A 5JAZA 1BJTA 2KW5A 3FVQA 1I3KA 2ZRMA 4MJLA 4BCCA 1GITA 3OPXA 3TUJC 4WWHA 2ENWA 1RKQA 1YDEA 1G6OA 4LDJA 4Q4LA 2X9NA 1WMSA 4WUVA 4CR6A 4YAWA 5THKA 1ENOA 1Z0ZA 4DCJA 3KVRA 5G4LA 5AK6A 1GCGA 3WWZA 1TTHA 3WQHA 1U0TA 1ZMXA 5H82A 2O2EA 1ZBQA 2XR1A 1QTQA 3C8DA 4D4IA 4NXNB 4F4DA 4BUZA 3EZFA 1QHEA 5ALYA 2LNDA 1XLTA 5DI3A 3TQFA 1T9DA 3OO0A 3B1WA 2N0SA 2CZCA 1V5GA 3MQ4A 4XQGA 3KUCA 1FRVA 5CAEB 4OHKA 4BFUA 4JI8B 5EE5B 3OTQA 2B0JA 1YMVA 2CY0A 3VR0A 4F56A 3KPUA 4CIDA 4LXUA 3NX4A 3V4VB 4RZIA 2C9YA 5HNKA 1ZFNA 1BYIA 3ICVA 5KOJA 4AXBA 4S05A 3N0TA 1PX2A 1QV7A 1MNAA 2YINC 1YCDA 2Z5GA 4IHQA 3MB5A 3AB3A 4BNHA 4P5PA 2RB4A 5K3FB 1BFDA 4UDXX 3OFVA 1HTBA 4M6WB 2ZI5A 4Q3OA 1I3NA 3F6SA 2WJJA 4HSEA 5CP8A 3TQRA 3SJCA 2XTMA 1HXHA 3P26A 5DJ5A 1LV7A 2F8SA 5ALPA 1NYLA 5BR8B 1ZCJA 3BL8A 5CGQB 4L0DA 2DU8A 3AGQA 3P2EA 2C7VA 3D6MA 4IZIA 1OAOA 2HV9A 4KFUA 1JLSA 2QD1A 4XASA 1AHHA 5JANA 3UXHA 1EUCA 3NBKA 1QIDA 2BGRA 1FYXA 2D74A 1JQBA 2JGDA 1F5NA 2PGJA 4MVJG 4PQGA 1N5LA 1Y33E 2W6MA 1B1CA 4V0ME 4OHFA 4KQHA 1QK5A 1Z15A 2HFJA 4UD6A 5CM9C 2WUWE 4TQ9A 4WTOA 2GAJA 4CMJA 2HJRA 3ZXIA 3T94A 1WXQA 4CDGA 4IHJF 3C3XA 4TTAA 5AI4A 3ZE2B 4B4KA 4F38A 2POQX 3I9OA 5LUAA 2VJLA 2BEWA 4Y7CA 4MRSA 2PRSA 4N3AA 5LCXA 4R84A 1P0PA 4Q47A 4Z4FA 4QDTA 1A82A 1MT3A 3H5NA 4C04A 2Z04A 2A9KA 3IUPA 2BEJA 1BZYA 4ENVA 5EXPA 4NCIA 1F9EA 1AA9A 4RCYA 1R4NA 4CCWA 5TGZA 5JVDA 1ORHA 2A5YB 1SUWA 1N33B 1F8XA 2BP7A 2XVZA 3TCXB 2I7TA 4KPUA 3O26A 4NFSA 3C5HA 3PUYA 3IP8A 4HGYA 1BROA 3SC2B 2B4AA 3R74A 5LD2C 3W5UA 4FMPA 4C08A 1QNLA 4RTLA 1NVAA 1W4AA 3GLVA 1V9LA 5HBGA 3X44A 3KQUA 3L9WA 4IO1A 3QQ5A 1AURA 1B93A 3FAKA 7YASA 5IULC 5IVKA 2NUPB 5AOBA 1J4AA 1DUIA 2UZAA 1TRHA 1UJCA 2ONCA 3HSSA 4PQEA 4MVCA 4Y3UA 3K53A 4LX0A 1SVLA 2PRKA 4OLHA 1ISSA 3RC7A 4LRTB 2F9MA 4I1VA 2OILA 3AL3A 3E9DA 2FDRA 3MWDA 3KKLA 3ZEAA 3S2FA 3EMVA 5A02A 3GOQA 1JH9A 4KI7A 2OO5C 3DD1A 2AG6A 2ESRA 1SBQA 3MTDA 4PX2A 4Y2PA 2QZPA 3GJ3A 2QTAA 1H8HD 1P74A 1RRCA 3FRJA 3RS7A 3AIMA 3LH5A 5EJFA 1Y1LA 3HUFA 3IBGA 3NHPA 4JLMA 3DFMA 4QSHA 1I2ZA 4NU6A 5TF4A 4L15A 1Y42X 9ATCA 3C5WP 2QK4A 3A1UA 3MS4A 5EWLA 3U7JA 3BH6A 5A3RA 4OX9Y 4HAIA 2NUAB 1XMXA 3IVCA 3OZVA 4KO3S 3H4TA 2JIRA 2V7GA 1QGUA 2XUPA 5ICGA 2EXXA 3GQBA 2R68A 3Q72A 3ZG6A 3IHKA 3C15C 5FULA 3OG9A 3NCHA 1F8FA 3I6ZA 2TRSB 1QDEA 3MTGA 4HDRB 1OD6A 4XB6B 3L82B 1P62B 4YS6A 3R9KA 3GY0A 3FDZA 1I0IA 1NDHA 2ERCA 4JMLA 4UAGA 4X20B 5HZKA 1P2UA 3PR3A 1FDRA 4UHCA 3RSOA 2QZZA 2ZRIA 4TTQA 3VPXA 3SEFA 1IHUA 2PA0A 4J75A 3CZ4A 3W1VA 3DNPA 4BE9A 3R3JA 2D5CA 3WWPA 2OV3A 2OTCA 1EUDA 1E96A 3FPCA 5DULA 1WVGA 2J9FA 4L6IA 1E58A 1RYMA 1QH9A 4EQ6A 4NKRA 2G88A 2Y1GA 5GWXA 3U39A 4JDPA 5LQJA 4MS4A 4TLCA 2C7QA 1NVGA 5JS1A 1JPJA 5FV7A 3IKTA 1PNRA 2FQWA 4JAVC 1E9CA 3NLLA 3ZWCA 4DHEA 4JD5A 3GA5A 4CKEA 1QGDA 4CFZA 6LDHA 1IZ0A 5M5BA 2I65A 2JHAA 3ZV4A 3ABRB 1IVSA 1RKVA 4D3FA 3FFXA 4GLOA 4AF6A 1LS6A 3VMFA 1V8OA 1R66A 1ULTA 3OKPA 3O8OB 2J5QA 3EIHA 3IDAA 3U40A 4DDHA 1N5OX 4PYLA 2HJVA 4Y2QA 4YAUA 5KNDA 4KYUA 2XGOA 2RK4A 4PZZA 1WUTA 3M1LA 1YQQA 3M1IA 2K87A 2HMWA 3VR6D 1HT2E 1I24A 1MQ8B 1S8OA 1CT9A 2E49A 3UYLA 2UXCB 3B51X 4X8HA 1OTHA 3DBOB 5GJBA 3N3BC 3EMDA 2HF8A 5IUNC 4L8YA 4L73A 2NSHA 4YDSA 3DDNA 4DXDA 5ELXA 5IYZA 3KPYA 1YIOA 1BVRA 4ZIRB 5MDHA 3DGEC 3N75A 4HQ0A 3OOHA 2C92A 2Q2OA 4I46A 4PX3A 1A7UA 1U2DA 2GBPA 2XNDD 3IO3A 2JG3A 3E1SA 1XQWA 1BO6A 1MC4A 5EP1A 1ODCA 1U2PA 2HKIA 1YHNA 3D6VA 3OJLA 2I1LA 4ZT4A 2V4UA 2IGTA 4O2AB 5FLEX 2PSJA 1SD5A 3ZJ5A 3ZJUA 3EXHA 3V4PB 2OYRA 2P77A 1OLUA 1XJQA 1C2YA 1A9YA 1GVNB 2DWOA 1YONA 3AX6A 3HXTA 3GPBA 1LV8A 2BFEA 4HR7A 4J9UE 4RKQA 5AM3A 1T8WA 2PH5A 2V7PA 3BSSA 4YAKA 4C4YA 1OC2A 2P6NA 2W6NA 4D42A 1V9SA 2IBMA 4LWQA 2JH3A 4OYLA 3UK2A 4B83A 1XLUA 1KEPA 4JOCA 5A4IS 2F9LA 4YJFA 2I3GA 3QJGA 1F17A 4HATA 1JLRA 4NZZA 1H9AA 2FV8A 2EWWA 2I66A 3P1JA 2GF9A 4EGSA 4WFKA 3PEVA 3UIEA 5EKUA 4OJKA 3MELA 1VBMA 3GUHA 1AGXA 3SBXA 5IH3A 1ULSA 3ZHRA 2YZ2A 1Q1NA 1EM8A 4A7PA 1WV0A 1W6RA 2D5IA 4MRPA 2G07A 3NFRA 3SJAA 1F7UA 3V7FA 2X58A 4Z7JA 4RCZA 2ETVA 1SCBA 4G9BA 1TC2A 4KR9A 4CLHA 5MF6A 2R5FA 3OUUA 4HUQA 1OY1A 4RD4A 2WWWA 4CXMA 3ABQB 1UZLA 2BEUB 3D6HA 1MIOB 1I2CA 2I4LA 2OWDA 2R7AA 1LSUA 4FWBA 4F4JA 2B8EA 3CW2A 4MQFA 2GRUA 1AHNA 4E13A 4ZK6A 3DB2A 3DQZA 1SQSA 1EFDN 1FYVA 2G0TA 2JAHA 2XZTA 4LBVA 2GAOA 2WNHA 2CSXA 5JJBA 2FZGA 3GVCA 2H1HA 5ENDA 4MXDA 2X3YA 1WU7A 1P8AA 4QECA 2RGUA 3DOCA 3SR3A 3TQSA 2WUGA 4PSAA 1P9RA 3VHLB 4X8MA 4RSGA 3VKUA 1T2DA 1QCYA 3WGQA 1ADCA 4IX9A 1Y9ZA 2XRYA 1ZCAA 1X1TA 3I42A 1G1MA 3I39X 4TUYF 2GN6A 4PN3A 1AF4A 3NT2A 1EFAA 4YMSA 3AFGA 3D2BA 5KCMA 4BXOB 3LYUA 1ZVQA 4X1KA 1VL6A 4BO1A 1CVIA 1X0XA 4WY5A 5H9WA 3PC8A 1MENA 1BS1A 1YZFA 2XWJI 1M7HA 4D8VA 3EZ9A 3PRKE 5H5JA 4YRKA 2QPAA 4BJ3A 4GBGA 4LDAA 3P9RA 2OFFA 3FFTA 1QCCA 1UK9A 4MJ7A 1WCIB 4NBKA 5CLQA 2B4RO 5CNKA 5EHIA 1UAYA 1E7YA 4UXIA 4XUGB 1I0LA 3EH2A 1G20B 1TGYA 2SKCA 4RA6B 1Q1BA 4IICA 1U0BB 4LYAA 3EB9A 2XBMA 4MGIR 3IB6A 4FLEA 2O0JA 1Z56C 4XVRA 3CCBA 4HX5A 4ECEA 3HYCA 5AVUA 1T36B 5E2IA 1HNZB 1QQAA 1RLOA 1SXJD 3N2LA 4JQOA 4LXGA 1QZZA 2G9QA 1AX9A 3I1IA 3P9SA 3GH1A 4ZDWA 3RARA 4R9VA 4A23A 3ZCTA 3NVAA 1N78A 4GKAA 2V65A 2QTZA 1PJCA 3ET5A 3BQNB 3ON5A 2D06A 2GSWA 1MV5A 1JB9A 1RS0A 2FX2A 2X8WA 1Q92A 3LE8A 1KPIA 1XEWX 1AO3A 4GR5A 4II3A 3D02A 4MQLA 2VZ0A 4PR0A 2D0IA 1QAMA 4MWEA 4R01A 2W6ID 3CB4A 3TSOA 3V9PA 4DUGD 3TRJA 5A3QA 5JI3E 5K3AA 3U26A 5FPTA 4TTTS 3QG1A 1X87A 3LXRA 3C6YA 1C8KA 1JR3A 4N5MA 2ZZMA 2AUTA 3S28A 1RHJA 4GP6A 2QUBA 4BHTA 2OAQ1 3DVAB 5F3WB 3HUDA 4I8XA 3UQZA 2P67A 5H4HA 4EHFA 3QVVA 2V8OA 4O5OA 2RGEA 1GIAA 2CXRA 3RVDA 3DSRA 5B1SA 3GFGA 2AZXA 3H1BA 2FSVC 2FPMA 1JU9A 1P29A 2AJLI 3HNRA 4HDKA 4G86A 4DKJA 2WA1A 2GFQA 2D4AA 1GUYA 2YDYA 1GP2A 1JHXA 3ECCA 2EAUA 3L06A 3LQKA 5TDHA 5K4AA 1US8A 3CC8A 4JX9A 1UJBA 1DWOA 4Z9FA 1GEEA 5KTPA 2IYWA 3QKWA 4Y8VA 3PC7A 4AJ9A 4HFJA 3KXKA 3TZCA 2P2GA 3DXYA 4BECA 1MOQA 1SVSA 1E2EA 3JS5A 3MS7A 5AKJA 3IAM1 1DQYA 3DR3A 5AHXA 3EGIA 3NFYA 2XLBA 5ELLA 2E18A 5F78A 2RI1A 1E9VA 2ZSDA 4EHLA 1A27A 1J22A 2YRFA 1STOA 3KLMX 1E9EA 3LLMA 4U7JA 5FWAA 4OQZA 1MKYA 3NBMA 3EQ7A 4WOJA 3VNBA 5DH9A 4O4JA 4URZR 1E5QA 3UA3A 2I2XB 3KR0A 1HV8A 4I50B 1Y6QA 4KYTA 2A0FA 2QRQA 2A9OA 2HDNB 4EO9A 1EMDA 4EKYA 4DSOA 3S1LA 3KYCB 2VNSA 4FFVA 1BD3A 1T1IA 4DC1A 4XIYA 4OY3A 3PA6A 3T7AA 3U3MA 1FTNA 4Q6BA 4HSGA 2O5CA 4ZAYA 2G8LA 4KKVA 2EBUA 1HFEL 2X42A 1N9KA 2BDUA 4J7CA 3RJZA 1NP7A 3V3KA 4OU5A 5JSZB 1M0EA 1K5GA 4PLTA 3IEIA 3HB7A 1KQNA 3DFFA 4UXHA 3ZXYA 4KN9S 3UAWA 3ZNNA 5ED4A 3WGHA 3MPUA 4BYMA 2VS1A 5HIIA 3GX1A 4FE3A 1NNI1 1I36A 2WPDA 3H1GA 3OH8A 4CUZA 5IM4A 2JRCA 1ULHA 2DCMA 2I6QA 3V1YA 1BAPA 2J9RA 4F1KA 1M1ZA 1VLLA 2ATVA 3GLHE 2VRCD 2FUKA 4K0RA 1PGOA 3L0CA 5CA0F 2OHJA 3EF0A 4NYIQ 3ZYCA 3LHSA 2D62A 2GA9A 1Z4NA 2WYOA 1DUSA 3EJ6A 2VLBA 5FA5A 3J81A 2WQ7A 3ZW8A 2I6FA 3RWOA 5TEVA 2G5CA 3L0PA 4O2RA 4PSCA 1M7GA 2YUIA 4MP6A 1GTJ1 4YQEA 4LF4B 2FMKA 1MOZA 4OQMA 4XE5A 1RQPA 1MZPA 2ZUDA 3SAJA 1L3CA 2B9EA 3LF2A 1ATIA 1J2EA 3FF4A 3RYCB 4JI3B 3GZJA 3QPAA 3ZIAD 3DW3X 4M86A 2XSZD 1L4HA 1USGA 3ONEA 4DE5A 2R8EA 2DPMA 3P52A 5EIBD 3RT7A 1GQOA 2VXYA 3KJGA 3HYTA 3KLNA 2IZ0A 3I1FA 1XTQA 4PIPA 3W3ZB 2PX2A 4YCCA 1UMDB 3GEDA 4FEYA 2D0PB 1SJ9A 3E9RA 1DV1A 1Y82A 4JT2A 4KI0A 4UTRA 1XK7A 4LYYA 2G4VA 2D4HA 1A5AB 1ZM7A 4ZP1A 2FQYA 5CFQA 1ZN9A 1Q83A 1E6EA 1L4FA 1V3UA 3GLIE 3DLPX 3EW9A 5AVVA 1M1NB 1RQ7A 1Y3AA 1E2KA 3AY7A 1CF2O 2NZUG 4BQPA 2MMCA 3KETA 2AE1A 1OJ7A 1OZAA 4GQAA 4H2DA 4ZRDA 1S1CA 3SDZA 4F2DA 1ZM2A 2OB2A 2Q1YA 1IZ7A 3OZIA 3VAZA 5LBUA 1E1LA 5HQ3B 1JAIA 2GBIA 3B70A 1Q11A 1TMOA 3GAAA 3C8MA 3MT7A 4EJSA 2H51A 4GR4A 1XZIA 3RK0A 4NHEA 3LBIA 4CMCA 4KWIA 4UNIA 3LP5A 4HZUA 3ER9A 4DNFA 2WHPA 2IPNA 4OIFA 3IP9A 3TBHA 3DKRA 1NUPA 1VZ2A 1YVUA 3ZDBA 1JT9A 1NG9A 1V1MA 1OLOA 2RHBA 4FS8A 3BD8A 3WIEA 4EGQA 1PR9A 5LJLA 1RQLA 1WKCA 3A2NA 2O3SA 2PHZA 3WO0A 4ZI7F 1IXYA 2VJBA 1EGQA 3WS7A 3DXFA 2G9UA 3U9LA 4ZO8A 5BV2P 4AMBA 3FNQA 1E62A 2F43A 1ZEJA 1RXUA 3P0FA 4OXNA 2W42A 5E2BA 2FLKA 2YNMA 4YDQA 3NCTA 2C4HA 3A1EA 2BHLA 5IC6A 4LJ7A 4QYIB 2VT7A 5B58C 2NYUA 4EW1A 2W2TA 3QEMA 1SY7A 3L77A 4KUGA 4RGQA 3JQ8A 3DOUA 1NYTA 3JAWB 4ZO6A 4Z8XA 2PZJA 4QKQA 1E92A 1KI8A 1X1EA 1Z6XA 3ND5A 4IP0A 1UPFA 4IMPA 3RPEA 3UJNA 4N6OA 4D9NA 1A9TA 1ONBA 2Q5CA 2QRPA 4NOKA 5AOVA 2J3MA 3IDZA 4BVAA 4C4RA 1YBVA 4N76A 3JQ9C 3CIFA 3KYJB 4NS4A 4P3KA 1JPNA 2Y99A 1BS2A 1QHGA 2GJ4A 4F97A 2ZAMA 1QVAA 1G21A 4RJIA 2VYNA 3SR0A 2R9VA 4F86A 2O8CA 2IITA 3JASA 2Q3HA 3O7MA 1ODKA 3ANSA 4EEZA 3N7UA 3CZAA 1DPFA 4RJ2A 1PG2A 3IBTA 3NALA 4AULA 4DREA 1N2GA 3X1MA 5DVZA 4EFNA 1XLVA 3I2KA 2CF6A 1EGAA 3AVPA 2GOYA 2UV8A 4TQUS 1O6CA 1Z33A 4ZMRA 1T13A 1HETA 3VPCA 2JBWA 3HDHA 2RH8A 1ZESA 3M5DA 1LF5A 1M34A 2XNCA 5TEWA 5I7FA 3Q9UA 4LPKA 4N5DA 3TCKA 4L08A 4DNPA 4PY2A 5EZYA 1C3JA 1U7ZA 3G7NA 5ILGA 4M98A 4C2TA 5EUMA 5F5LA 4QTYA 2YQZA 3WKEA 3LFHA 1KJIA 1M1YB 3G5AA 1DEAA 2PH7A 1K6XA 1B26A 4HAOA 3ZHQA 3VFDA 5HR5A 1UBUS 3ND8A 5HFNA 2G1AA 5IZCA 3AVQA 5EC8A 5IAKA 3FKSD 2X0DA 2E6KA 5K0TA 3SKXA 1U8UA 5LOVA 1P0FA 2P4QA 4NVRA 1BWQA 5IN5A 2GM5A 5EGNA 4RM3A 1DWQA 1XCBA 3EISA 1JWAB 2MSWA 1EHIA 3FSGD 1X39A 1SO8A 1W36B 1GFZA 2B30A 5I9LA 2D54A 2GKSA 3NTOA 1FDIA 1Z5VA 4XW2A 1DKPA 1ZN8A 4PZYA 4UHBA 2WM3A 5K9ZA 3RVRA 4I55F 4Q1EA 5CBKA 4BX0A 3RC3A 5FTMA 2NO1A 4AKSA 2W6JA 3K0BA 4X61A 5ALLA 1XF9A 3DJFA 3ESDA 3JYOA 4YQYA 4IGAA 2QZ4A 4AO8A 3SMVA 1N2OA 1KTIA 1X7YB 5JFOA 4M60A 3MT9A 4K28A 1I4TD 1J8VA 1JFTA 2O1SA 2W4MA 5ICEA 3LT0A 1XMSA 3DZKA 3PT5A 5JYEA 4ND4A 3MB8A 2NSJA 1EFPA 4CQLB 3UWDA 3CTPA 3IVAA 2NADA 3GN1A 4RM2A 4I14A 3TLKA