2P2DA

Crystal structure and allosteric regulation of the cytoplasmic escherichia coli l-asparaginase i
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
336
structure length
330
Chain Sequence
QKKSIYVAYTGGTIGMQRSEQGYIPVSGHLQRQLALMPEFHRPEMPDFTIHEYTPLMDSSDMTPEDWQHIAEDIKAHYDDYDGFVILHGTDTMAYTASALSFMLENLGKPVIVTGSQIPLAELRSDGQINLLNALYVAANYPINEVTLFFNNRLYRGNRTTKAHADGFDAFASPNLPPLLEAGIHIRRLNTPPAPHGEGELIVHPITPQPIGVVTIYPGISADVVRNFLRQPVKALILRSYGVGNAPQNKAFLQELQEASDRGIVVVNLTQCMSGKVNMNALAHAGVIGGADMTVEATLTKLHYLLSQELDTETIRKAMSQNLRGELTPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-ASPARAGINASE I
publication title Crystal Structure and Allosteric Regulation of the Cytoplasmic Escherichia colil-Asparaginase I
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 111
structure length 330
sequence length 336
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.1: Asparaginase.
pdb deposition date 2007-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00710 Asparaginase Asparaginase, N-terminal
A PF17763 Asparaginase_C Glutaminase/Asparaginase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.40 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2p2dA02
3.40.50.1170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold L-asparaginase, N-terminal domain 2p2dA01
1O7JA 5CBPA 2OCDA 1HFKA 1WLSA 1AGXA 2JK0A 5F52A 4RA6B 4NJEA 4RA9A 3NXKA 5DNCA 2D6FA 1WNFA 5I4BA 2GVNA 1HG0A 2HIMA 1HG1A 5K4HA 4RA6A 2WLTA 5DNDA 3PGA1 5DNEA 5I3ZA 2P2DA 3ECAA 2P2NA 2WT4A 4R8LA 4ECAA 1JSLA 1DJOA 4Q0MA 4PGAA 5CBPB 1DJPA 1JJAA 4R8KA 5K4GA 1HFWA 2HLNA 1NNSA 4NJEB 4RA9B 1HFJA 5K3OA 1WSAA 3NTXA 5K45A 1HO3A 1JSRA 5HW0A 5I48A 1ZCFA 1IHDA 1JAZA 1ZQ1A
chains in the Genus database with same CATH superfamily
4R9RA 1YB7A 3DE1X 1GL3A 4OGGA 4D1YA 1Y9DA 3IQFA 4MSUA 4YROA 1BDBA 1NBMA 3FVVA 4FNMA 3AQ4A 2ZWAA 1N32B 2GAIA 3G13A 4FZRA 1KJZA 1Z22A 5CGQB 5M5BA 1M0EA 1EDZA 1ISRA 5FFNA 2PWBA 3QWBA 3BTOA 4O2LA 5KWIA 1QLHA 4HAOA 1MR3F 1RQ7A 3BMNB 1T3GA 1F8YA 4YMUA 4BQIA 3WGLA 3D4BA 1V5WA 2O8EB 3AUSA 4RA9B 1UBEA 4Q1CA 1T1RA 4HDCA 4PZCA 2HRBA 2DBRA 3SIXA 3TR5A 2C5AA 1V48A 5K51A 1ENZA 2P11A 2ZPTX 2FEWB 3HLYA 4JI5B 4EEZA 1SXQA 2NSLA 3FRHA 4CQMB 4XJSA 3K0CA 3RQSA 1CCWA 2R5NA 4IDFA 1P9WA 4U5XA 1L4MA 3FA2A 3LL4A 3UOAB 1ZZEA 2HMVA 3OCJA 4B6GA 4QOSA 5B7NA 1BJKA 2LBPA 2RGBA 1ZCAA 3UB4A 1VL6A 1N5JA 4GUAA 4X61A 4HNVA 3UQZA 1GV0A 4OL0A 4J07A 2ZJZA 2H92A 3BN3A 2NUTB 3WHIA 3D6AA 1QRUA 1NY5A 3BWEA 1XAGA 2XMRA 1NBEA 3K5WA 3EQ7A 1UMKA 1VKOA 1Q0PA 3R0VA 3FNFA 1DV2A 3ND6A 4J49A 3UWMA 1UMDB 1P7CA 2FF7A 1J97A 1DXOA 1LQ2A 4RCVA 1FDTA 1X3LA 1P1RA 5JNUA 2ZZNA 1ZBQA 2JFNA 2ZITA 3DKRA 3H3FA 3K9LA 2JLCA 4TTIA 3DR5A 3IPAA 1RRCA 4ZYVA 4O33A 2MSKA 2Q50A 3GLIE 1TMOA 1RQNA 5ALEA 4FQ7A 4B5KA 4FYVA 1FDWA 2CKMA 4QUHA 3T0IA 3MK31 1VHDA 4ZVPA 1WY5A 3LUHA 3P20A 1LZKA 1E7WA 3HWSA 4OQLA 1Y63A 2FUG6 3PU6A 2VNAA 1SBQA 3BWMA 1LS6A 3GEHA 2NVUB 3C14C 3H1TA 4GGMX 4H7EA 3LHDA 3H9GA 3H9BA 2HSGA 5DVZA 2UXBB 1MEEA 2R8BA 4V02A 1D2NA 4V0KA 3PGXA 4GI5A 1AHNA 3OQIB 4P36A 1N7JA 4CUKA 1ULHA 4EFLA 2WTEA 4DV3B 2O54A 3E82A 5EE0A 2CLCX 3LGSA 4PHGA 3AY6A 1ISSA 5K09A 1WABA 4MPJA 4MMXB 2WF7A 4ND6A 5LU8A 1DMSA 2VNIA 3EVZA 4YRSA 2KYRA 2Q3CA 4OL9A 2F4NA 2P27A 3MTGA 2JZOA 3LV8A 2JGRA 4GFDA 1LSOA 4KQWA 4YRQA 4BN5A 4MIYA 3V5NA 5BN1A 3AUFA 4Q3CA 4Y1EA 1DPGA 2QHXA 2VSOA 3E9DA 1EGAA 2BFCB 3UMJA 2INGX 4M7OA 1G0NA 3AHJA 3QYFA 2OECA 4XJVA 2Q6OA 2IPMA 3BFJA 4HADA 3TZ6A 2Q3LA 4GPAA 3P8ZA 4R8RA 5NLLA 2I76A 1ZJYA 2E4ZA 1KJNA 1U5CA 2EDAA 1V3UA 2BDTA 4KDFA 5DBEX 2OFFA 2Q7OE 1UZMA 2Q1XA 3M33A 1A7UA 3NTVA 3KQPA 4YWJA 1SVMA 3QBEA 1FTWA 4N9WA 5DGHA 2P1DA 4GMFA 1BX0A 1FVFA 1RZUA 2MSLA 3RAJA 1AMNA 2XAAA 3HP4A 2AJCA 4KQ1A 4HDSB 2O59A 1JA9A 1U6KA 2PPLA 1SKBA 3NJ4A 4C7JA 1DBIA 3AOEA 5FNVA 4F7DA 2L42A 4F2DA 2WWTA 2EL9A 3FI0A 4P7GA 2V3CC 1ODLA 1OLUA 2QAGA 1CIVA 3P2IA 3I62A 1C3OA 3ZWMA 1U1GA 1PK9A 1BZYA 1NXTA 4CZ2A 5JH7A 1GDHA 5EJMA 4QU8A 3WXMA 1S6YA 3M0EA 3RHFA 5KJCA 2YMPA 2JZNA 1VE3A 2FLWA 3JQFA 1JDUA 3A0UA 2WYIA 1RVDA 4HRAA 1XTBA 4M22A 1Z0SA 1FA9A 4NAHA 5LUBA 1DDGA 2QTBA 3WLQA 1L4GA 2XSZD 3HUDA 3P9IA 1JKFA 4KRXA 4CDGA 4PLGA 4XCXA 5CJPA 4P54A 5HJ2A 4BJ1A 3CRZA 3W3AA 5H83A 3DFIA 3KQLA 2HBYA 2ODTX 1HNWB 3LW8A 4U2KA 3HA7A 1JQBA 4URZR 1V2HE 3DF9A 3EPRA 1CPYA 1V7ZA 4CIYA 4JXKA 2XQIA 2BT4A 1DUSA 1Z5NA 3NDBB 4D81A 3AM5A 1HPLA 3I4FA 3NGXA 1QPGA 3QY9A 4UD6A 3JRNA 1ATZA 3PQEA 4NC9A 4ZKDA 4CIDA 4RTKA 4I4NA 1CUCA 4NATA 3OZCA 4IHKA 4KXXA 4ECEA 5KB3A 2EJWA 4XWOA 1PFWA 4LMPA 5LD2C 1DHRA 3D02A 3ENZA 1IBCA 1IHDA 4KXUA 2HK7A 3PX2A 4MQEB 5K3FA 2EC5A 2OCIA 3GP8A 2R8PA 1KQNA 4EPRA 2AIRA 5JQGF 2PX8A 1TVKB 2WSSD 4RY2A 5JRJA 2PBLA 1WQ1R 4HNSA 1E2KA 3JQ8B 4HX9A 4DA4A 2J59A 2FV8A 1PZMA 4LAFA 3DO8A 4WGGA 4NIMA 4PPNA 2IDJA 5LP6A 3OQPA 2O8CB 2HMAA 4WGFA 4LK2A 4RS4A 4YHHB 2KBEA 4B6QA 4MUAA 4R3NA 5FOWA 4P84A 4MP3A 3VZSA 1TKAA 1OJ7A 4YRAA 2GN2A 3HDGA 1FSSA 4DV2B 2E5FA 3EVEA 1UODA 3SX2A 3TZHA 2D1QA 3F7MA 4LWZA 4E2ZA 4KC0A 1UINA 5JZ9A 3F78A 1Q95A 2VAWA 4OP2A 4FOTA 2UZIR 1JHMA 1WZ2A 3KAQA 5FFFA 2K5UA 2C5FA 5DASA 3AF5A 3U2QA 4IDPA 5HTKA 3LXRA 3CG0A 4LOIA 2SKDA 1C3EA 3BZUA 3PG5A 4G1UC 1SC6A 1CIPA 1PS0A 3K53A 4AROA 1ORHA 2A57A 4B2LA 2QGZA 2IXAA 2WU3A 1ESNA 4IQ0A 4Q34A 4RFSB 1XU9A 4OK6A 4EB6B 2AHOA 2HPHA 3CCBA 5AXAA 3UAZA 5AUQA 3RU2A 5CVCA 5CB4F 1IBRA 4IXNA 4D9KA 5CFZA 5ALKA 4Q93A 4F93B 1JX6A 3H1PA 3NCTA 4C4XA 4XD7D 1D7AA 5JMOA 1NBHA 3NHKA 4ERXA 2QX4A 3BWBA 1R7RA 5EKUA 4JJKA 2DPMA 2OSVA 5PNTA 1SO8A 5F1KA 1U28C 1VHQA 2GHRA 2PH1A 4U39A 3K0BA 5BMVF 1V1RA 1GEGA 1X0XA 1S2IA 2J1LA 1XV5A 2AG1A 2RBGA 2W98A 3VDXA 2QTVB 1GARA 2BFFB 2VSXA 2W71A 3JYNA 4AUEA 5BURA 1W87A 4PU0A 3GLFB 5K0LA 4GMKA 3OA2A 1L7AA 5AK5A 2Z04A 4OAPA 5IK2A 1OE0A 2DPGA 3Q3GE 2JI7A 2HCFA 3KZCA 1KSGA 4CF7A 1CVLA 3BCUA 4NL4H 1C9DB 4IOKA 5LMZA 4AAYA 2OP1A 3GO4A 3VHXB 4BO4A 1A2BA 4DARA 4MLPA 1KAMA 2BAGA 4EDFA 2CMHA 2C1XA 4EAQA 5I51A 2VSFA 4LRXA 1N77A 4UHHA 1GNRA 2O20A 2IODA 2WM8A 3G2IA 4BY9E 3GT3A 2OEPA 1ZWLA 5I4IA 3W7VA 2CV2A 3Q0EA 2BKUA 4L3OA 1H23A 3E7DA 2X7XA 2FMUA 3Q0IA 4HATA 4XWYA 1BN6A 2C3UA 2GWRA 3PL1A 4MIKA 3GL9A 5GGYA 4DTCA 4H7DA 4BDSA 1CG6A 2XVAA 2KHZA 4J3JA 1D0SA 4LQ4A 3UK7A 2JIBA 4ZCRA 4ZYLA 3TM5A 1S3IA 2ZW9A 4NCAA 3BT7A 4MWZA 4ZT5A 1G38A 2E9SA 1Y1LA 3QJYA 4Z1MA 1C4OA 3QVMA 5CH5A 1KDPA 3W3AH 4CLOB 1I7SB 4ZTZB 2FZEA 1JKJA 3COZA 4YP6A 1A0OA 2BBOA 4HCJA 4KSCA 4JC4A 1KVUA 3RSCA 1E3DA 1YGYA 4RV9A 1YBVA 1OGYA 2P9BA 1CKEA 1YBHA 1RJFA 3E2IA 3G6WA 1J9EA 3HP7A 1MABB 4R5HA 4FFRA 2BFNA 1RABA 3EW9A 3DDUA 1G3RA 1MA0A 1GFSA 1Y6ZA 2RGYA 4I1VA 4L15A 4LVCA 3RAGA 5LOVF 1O5OA 2XRYA 1ORDA 3P9NA 4O4HF 4B5LA 2EV9A 4KTTE 5JS1A 2R65A 1MC8A 1GNTA 2CYCA 1HG1A 4Q1DA 1OV4A 3G2KA 4WXEA 1ZW6A 1VCNA 4O08A 5L3SA 1F20A 1KYTA 4GYJA 4K5QA 2BM9A 1P1CA 3I73A 1IXSB 1W52X 1U4NA 3ZDRA 1SVUA 3WG9A 1XYGA 2E55A 1GTJ1 3IO5A 1ID1A 3U7IA 3AHIA 3MWJA 3MUFA 4MGYR 2FP4B 3CEPB 1GL7A 3HKDA 4DIEA 4HB2A 1UJ2A 2QRKA 4YRTA 1G3IA 2VZ9A 4H59A 2QPOA 1QBGA 5KWEA 5DHFA 2C8JA 4WY2A 3S55A 3G9XA 4F1JA 1WBBA 1I1HA 1VGQA 4ZK2A 2FQ1A 4HQKA 4YJ2B 5L51A 1NU8A 5EE3A 3VZPA 1RCTE 1F14A 3QI2A 1PDVA 4M1OA 2VBCA 4DREA 2R8OA 3PQ6A 2C8KA 3TD9A 1Q84A 2FVXA 1PJQA 2J45A 2R66A 1QCYA 2EKDA 4RXTA 1B74A 1OT3A 1VYTA 3NBQA 4BVFA 2XUPA 4K9MA 1NMZA 2J3EA 2OLJA 3CY6A 3HCNA 1B41A 2P2YA 4KR6A 4GEKA 2LVBA 1YOVB 5LIPA 3EG5A 6ADHA 1UBFA 4JKIA 4D2IA 3MLAA 4RE6A 5ADUS 1GCIA 3K92A 4YRZA 2QMOA 2I7XA 3GPIA 2C98A 4EO7A 3BTSA 2GD6A 2PA0A 3FPCA 1R8JA 3ESYA 2ATVA 3N2GB 2HLDD 4G6ZA 4V0MA 4UPEA 5CIYA 4WOPA 1K6XA 4NY1A 1H0RA 1HKUA 3DEZA 1YS9A 2A84A 4KXYA 2VDKB 3ZVRA 1MN6A 4MYDA 1XZPA 1IM5A 3HUTA 3M4NA 2PV7A 3CBGA 3HEBA 4N01A 1ZH8A 2AX3A 2VPIA 4H7JA 1U2SA 4Q7EA 3QLUC 3OT1A 1NMXA 2DGDA 4FP9A 2SHKA 3AJ8A 5KQSA 3V1YA 1G9TA 2P6OA 1BO6A 3PFHA 4IG9A 3RS0A 4D4IA 4BFSA 1BRTA 1AMUA 1XOIA 2G9VA 1CZUA 1U90A 4L7VA 3KJGA 1Q44A 2H2AA 2HLHA 3A9SA 3DTVA 1Z2OX 1UKBA 5GJWC 3RRBA 3UHAA 2WE7A 3EGIA 4YJGA 1T36A 2FCAA 2JL1A 3SYRA 4ZQHA 1A50B 2I4IA 4QVGA 5D3MB 3T34A 3SC2A 3VOAA 5BWBA 1FQOA 2A9OA 4QEKA 1CDEA 1HDXA 3IILA 3PNKA 3QA9A 3CC8A 4XSHA 3BRQA 4GPZA 3QM1A 2F8MA 5AQEA 4WBSA 5GV7A 1QVZA 1U3TA 3RRFA 3ZDYB 3MSCA 3C98A 5KVCA 5FAKA 5BXQC 2NV2B 1VQ1A 3PNOA 4LHZA 2P6NA 1VECA 4NCKA 3AF0A 4NYJR 3QMVA 1T6BY 1L1EA 1SCIA 4RPIA 3DFUA 1LTQA 2GH1A 4PRZA 1OYVA 2MTBA 1L8XA 1NXWA 3KJEA 4RL4A 2FNAA 1L5RA 2VH1A 4GW3A 4KMMA 4V0RA 3Q12A 5T4EA 2C4MA 4KQIA 3MJCA 4B75A 5H4HA 2VWGA 1W73A 3ZV4A 2HQOA 5ILOA 2IYTA 1Z5WA 1G7SA 3U61B 2H31A 2JGJA 2A88A 2GCIA 2JI4A 2VL7A 4NH4A 1YE8A 3OD5A 5IM5A 3MZ0A 3O90A 2QXTA 3LPMA 4UNSA 4OM8A 1WBJB 1CQIA 1MF7A 4FJ1A 3I8SA 3RIHA 1TAUA 4KO1S 4LWOA 3IKTA 4PSUA 3N7TA 4DYVA 1A4RA 3O83A 3Q85A 4FYPA 3S1AA 3P0FA 4J0KA 4Z86A 1MEOA 1B6GA 3GA7A 1E9DA 1QGUA 3CZMA 3HFSA 2PDAA 3OCZA 3X2FA 1NP7A 3QZUA 3AJAA 1RU3A 3WL4A 3M3DA 3A6EA 2E49A 4QJIA 4ZAWA 1L7DA 3QA3E 3ZZTA 3EDCA 2QW0X 1HMPA 4GNRA 3DLAA 1ZIOA 5FI3A 4M60A 1UT6A 4BKUA 2GYVA 5A3QA 2NU8B 2B8WA 1P33A 4WOCA 2CJYA 2ZYWX 5DK4A 4AWBA 2G6BA 5ICFA 4MEBA 3MQ2A 3U3DA 2BV3A 5HIKA 4BCBA 4KOAA 4QXQA 4C89A 2ASVA 3DC7A 5HRAA 1OTXA 1TQ8A 3JALB 1L7RA 5L7YA 1MH9A 2YJ3A 2PYDA 4GS5A 3RS2A 4Q4AB 4BNFA 2OVBA 4Z4QA 1BHSA 3H4VA 4L22A 5DCYA 1XJ5A 2IEAA 3HU5A 2AQHA 5M04A 2G4CA 3QE2A 4Q1VA 3PDCA 4U1RA 2WWVD 1NBMD 1UANA 2HWUA 1QUFA 4LGCA 3X2SA 1IJBA 1A8IA 1WPXA 3MRTA 1GJRA 4EYOA 2CWDA 1L3BA 1PJ2A 1TAQA 3OLCX 1EVKA 4PBSA 4BWGA 4XPIA 1SCJA 4TRJA 3O8RA 4BRUA 4P93A 5KOJA 4OXNA 1W85A 2D5LA 2GVNA 4R83A 4OUDB 4LCBA 4N76A 4WXMA 2BJWA 2EW1A 1P60A 4YAWA 4ARCA 4N0MA 2W70A 2ZIVB 3UAVA 1RYEA 2OGZA 2OZLB 2ZI5A 1GKUB 1B3BA 1Y9EA 3D2AA 4WWHA 4DQUA 3JVVA 4A1OA 7YASA 4GYYA 2AZDA 1Q6ZA 2H7XA 2IYQA 4OGWA 3SHWA 3H9QA 5J2TB 1U28A 2FWBA 2YNMC 1KA9H 4BFTA 4Q21A 1FS4A 1ORWA 2YFQA 3TH5A 4E14A 3AG6A 5CFPA 1FP1D 2DUMA 2YRWA 2HA7A 2PANA 1U9CA 3KT6A 3F9RA 4TWRA 3EOAI 3EH1A 4FN4A 1QRRA 1GZHB 2NT4A 1KDVA 2FN3A 1S9HA 5LMNB 1JDZA 3HDYA 3NETA 3T94A 2QT1A 4RELA 2ETVA 3JQBC 3LQKA 1WL8A 2Q5IA 5E2AA 1GPBA 2JHGA 1JJFA 4UOQA 3GEPA 1I7LA 2WJAA 3H5IA 2RHLA 1E4VA 2ZAYA 3D0RA 4JKOA 4MYTA 4PZDA 4YCAA 3TRHA 3GZJA 3OKCA 3MYYA 3QJ5A 4WY8A 4NS4A 4ZO9A 1OA0A 2YWXA 3EJWA 4EW2A 5LKAA 1BU5A 5DYIA 4HBZA 4IKPA 1KTIA 1XPOA 3DGEC 2AKYA 4CETA 2PT7A 2XJ4A 3ESZA 3IAS1 3I76A 4WNIA 3DE4X 1F6DA 3OQNA 4WHMA 1LY1A 4TKMA 1ZM9A 1FRVA 5AO9A 1NUTA 3A1TA 1DBSA 2YWJA 4UAGA 1H0KA 1JKMA 3NNNA 1V37A 3DXFA 2QYSA 1XKLA 5BR8B 5E6SA 1KBQA 4MWBA 2A5LA 5FNVF 1GG5A 4DMMA 3MT0A 1U65A 1ODCA 4EKYA 3ANXA 2IX9A 4OXIA 3IBSA 1GRCA 4KI7A 2BBTA 5HCUA 5BOSB 1XCLA 2GKGA 3S44A 3WKAA 2P75A 5L4NA 3NP7A 2QUIA 3GVCA 3Q7EA 3SXUA 5JH7F 5DNYB 3GLHB 3VU0A 4NULA 3CEJA 1J7KA 4ETIA 2VO1A 3OQHA 2OB1A 1M2VB 2IFTA 3L8MA 1Y9ZA 4LWPA 2AG5A 2XGJA 2QRVB 4CMCA 1I24A 4HDQB 3FNGA 3ER9A 1TD1A 2C3OA 1TGYA 1HE3A 3OE4A 2O2YA 1WQ3A 1TUIA 2R44A 5TPWB 1E6WA 4UAVA 2ZI7A 2QM8A 3K30A 5T8KA 1ZK3A 1VIDA 1IG0A 4FGZA 4B32A 4AULA 5FUWA 2ZYSA 1EP3B 1UKCA 3IOEA 1II8A 4I08A 1E2PA 4K9QA 5B12A 2HEGA 3P9YA 3TTWA 1L5LA 3PHCA 1RYZA 1MA3A 2XI4A 3L0OA 4IIYA 4HF7A 3UB3A 3KPJA 2XEXA 4YR7A 1A8HA 5AUOB 3A9RA 5BPHA 2CXSA 3HSSA 4W8HA 5E1BA 1UJBA 5YASA 5CDGA 3ISJA 4F3TA 5HGJA 3UICA 4TXHA 1EMDA 5J4KA 3OICA 4AMYA 3DO5A 1UKYA 1N4AA 1NT4A 4BTLA 1G8PA 4B09A 2V4MA 3BJZA 4IDAA 4YCNA 1W36D 4N5NA 2QAIA 1PJ4A 3HYNA 1VKNA 3HXTA 2QD5A 1JB9A 3ECCA 2WTBA 2XVMA 3G59A 3L01A 3W5SA 3WS7A 2K87A 4C5CA 1Y3BE 3CVWA 4Z53A 1DINA 3BK1A 4IIBA 3UCEA 1Y4AE 1B7GO 5K20A 4I7EA 3ABSB 3NVMB 2BMWA 4H2DA 4MWTA 3N53A 2NTEA 4MUFA 3WWEA 3TVYA 4IO1A 1FDRA 1OLXB 2EWVA 2HJ9A 4JT8A 4MS3B 4J4HA 1XVTA 1JR6A 5JCOC 3F5FA 3V1MA 1H4TA 1L4EA 3LCUA 2VAMA 4NLLA 5LQRA 3JATA 1U3DA 4FYKA 1A76A 1FFGA 2BM8A 4QG7A 4EG4A 3OM0A 3BSFA 4BLQA 3WGGA 3CYFA 4QL3A 5B1HA 4KLCA 2JI6A 3ZV5A 4D0GA 1ZVVA 2IHUA 3EXHA 4RWZA 2ZB2A 4KQMA 3ZOKA 1N6HA 2LW7A 4OY3A 3W3AD 3O1JC 4QO8A 4PG8A 1RHJA 4PHTA 2C4TA 4WZAE 4PG4A 1V41E 5B1YA 1MOPA 3ABQB 2HY7A 1TZBA 2AG8A 4OFBA 2F9LA 4CTOA 3CG4A 1QV6A 2AN9A 3ZDQA 4D8YA 3OMWA 3PE4A 3UJNA 4JYZA 3UF0A 3URMA 1AKVA 4AJ4A 1ISGA 1CTQA 3PNYA 1YMVA 3NV7A 4JUAA 1LC0A 4LZLA 4BN4A 1BDIA 3K96A 4F6RA 3HKBB 1U80A 3U6KA 4N03A 1FZTA 2JAWA 4IIJB 3SSOA 3K70C 2Q5CA 1AXEA 3CCCA 4LRUA 4N8SA 4B7UA 4MARA 2B9VA 1QR2A 2CUKA 1DKNA 1LC3A 4Y6OA 3LLUA 3OE5A 4MV3A 4Y9TA 1MOQA 2FSVC 1WUYA 5ESDA 3ENNA 4BO7A 1SCUB 1AHPA 3V7NA 4LQCA 1XFAA 4F72A 3ELYA 1EUZA 5JCPA 2X19A 2BMJA 3KKQA 5T4BA 3V4OA 3HJNA 2ZS8A 3OTQA 1P29A 3SDBA 1XYYA 2DY0A 4L72A 1XEFA 1BEZA 4MCAA 2O2JA 1P45A 1YZLA 3OPQA 5DHTA 5A5FA 1ZIYA 2HRRA 3E48A 2DPLA 3DNPA 1IFXA 1J56A 3H4TA 2OZVA 1MDFA 4KQGA 3SF0A 1YFJA 5C46F 4BUZA 1NNUA 1E3LA 3K9HA 3V8BA 1U1FA 3KQHA 1WA5A 4J16C 4YONB 3RRYA 2EARA 1QU2A 1GSOA 4AQ7A 2FG6C 3OPYB 3TCXB 5CIWA 2IEBA 1ILEA 3PKIA 3RFXA 1WUIS 3VZRA 2APJA 4S12A 3ZHXA 5JBQA 1H85A 1UDRA 3M6WA 1SH7A 2AJLI 1JQ3A 3AF2A 4LE0A 4YASA 4BZQA 4HVTA 3PS9A 4EMBA 2OT3B 1KY2A 1AUQA 1VE1A 1STOA 2VDQB 3IEXA 2ZR9A 4GOND 3KB6A 1AZTA 1NI4A 4YP9A 3U49A 8MHTA 3OFNA 4TVKA 1NW8A 2YS6A 1D3AA 1R2QA 4RA6A 5F78A 3A4NA 3NZEA 3WFZA 1GLNA 3GJRA 5CJ2A 2Z2IA 3WV5A 1WZEA 3SDZA 4BFCA 3WNVA 1E9BA 5D1HA 1R0RE 1HSOA 1F8UA 1XPJA 3K5PA 4M0EA 2LTAA 4HRYA 2M6RA 2P5UA 5L95A 4C0AC 2UYCA 1HV8A 2X5JO 4AJLA 5ALHA 3ZDZB 3E9MA 2FZKA 3FW1A 3BMNA 1Q3TA 4KWIA 5C1PA 1L2TA 1SR8A 1SVKA 4BXOA 5J4VA 1D1QA 2AFIB 4RA9A 1FNNA 1W9HA 3L8CA 3IHLA 5DWDA 5HHTA 5IK2D 3JQ9A 3HI6A 1CDOA 2X3UA 1CJSA 2GHQA 4ZXPA 2HNKA 4N3AA 1E98A 3B2QA 2JJYA 3HZOA 3N0WA 4LYGA 1USGA 1XDSA 3AHEA 4FKMA 3R8FA 2Y0EA 4CQMA 4DZTA 3VPGA 1Z68A 4JLOA 4KQEA 1GRQA 3CIFA 2YUTA 2FRVA 1EEXB 3L4BC 4B2PA 4ESEA 4NS1A 3GHYA 3GEGA 4RIEA 1RRMA 2PRYA 3BGOS 3ZE1B 1GTMA 3MCWA 4X6UA 1AKWA 3OZTA 1L8LA 1RCFA 4D99A 3I30X 3A3NA 1ML4A 3DNFA 1X7GA 3TQFA 3HDQA 1KNXA 2VPPA 1NVTA 1U2QA 1OXVA 2QRHA 3MTJA 3VKHA 3DQZA 1G5TA 2DTXA 1H2FA 5A9RA 3IRUA 1M1YE 3HO6A 1XCJA 3BFPA 3PFKA 3SR0A 4Z1MD 1ZIDA 2IU0A 2WVJA 3UA3A 3FD8A 4F2WA 3A37A 4K6FA 3ZEAA 1M6VB 2NSJA 5JXJA 2ZSDA 4P32A 1E1QA 3H0CA 2YQ4A 3OZRA 2DHRA 4OCZA 5EIBC 4EJSB 1O4WA 4AJ2A 1FW8A 3IBGA 5LYJA 2VYCA 4ZIRB 2ECKA 4ZU1X 1WU8A 2YHUA 3E1KA 4MVJE 2DXIA 3C7TA 3PXAA 3KSZO 1MB0A 2NVUA 4NECA 4RF5A 4AMUA 4XKJA 1LNQA 3C41J 4X00A 1FU8A 4BO5A 2PZMA 1F4PA 2P2GA 4LYFA 4WERA 2V6FA 3PQ2A 3OQIA 2WK1A 3IELA 5IDXA 5IUJC 1QIMA 1HOXA 2R8YA 2J0UB 2X1HA 5IC6A 4DDVA 3IQXA 4AO8A 3AP2A 3CINA 3EPJA 4DG8A 1TEZA 4IIHA 3KSMA 4GR9A 1I5RA 3O95A 4NHEA 4NNOA 3OQBA 3WB1A 3WL7A 4BMVA 4E88A 3SSAA 2REQB 1U8EA 4R05A 1GAWA 1X1TA 4OQDA 1ZM3A 4UM8B 4E08A 4HYQA 4RTNA 3KSAC 3KT0A 2ZTVA 2NG1A 5HCNA 3U7GA 1OFTA 4WESA 2VYQA 2BFCA 1JIQA 3E5MA 3KPUA 2MMCA 1WDMA 2ZSKA 4FFSA 4RHTA 4UBIA 2NYAA 4JVMA 3ABIA 5DN6A 1DMRA 4OOEA 1L6RA 3MFYA 1CNMA 3O8NA 3IDZA 4QUAA 4XX0B 2ZRGA 2G0NA 3UMSA 4CHGA 1FFXB 1I7DA 4NR0A 1N5KA 2WP0A 4MGKR 4NOMA 5A5VA 2R8RA 1RYDA 4RYLA 4PF1A 4YCSA 3RTAA 1MO5A 3NVKI 2EFJA 4JT4A 1G8FA 4AY6A 3GJ7A 5JAOA 3UO8B 3HJFA 1KK0A 1OAKA 1HEYA 3LIIA 2JGFA 4DV6B 3JQQA 3RJMA 1SBCA 4BZZA 2BOVA 3FWPA 1WZCA 3KELA 4DM7A 5CB0A 3OOJA 3JR3A 2B7BA 3KSBC 1L7MA 2BFOA 1O94A 3RV3A 3F9IA 4FD3A 3UJAA 1YVRA 3ZNNA 1OCEA 4UE2A 2GD2A 2C8LA 2XEDA 1DUVG 2JS7A 3DBHB 3K72B 3PFCA 4GLBA 1P4GA 5T3YA 3A6FA 3FBWA 1Z7WA 1SXJE 2ZATA 1TRHA 2ADMA 2BE7A 3DB2A 3DE7X 1EGHA 4C2AA 1GLVA 1Y7HA 4F92B 3M82A 2R68A 1SOAA 3U5TA 1HA3A 2F1OA 2DTDA 5GINE 1NUUA 2OG1A 1QFZA 4C7BA 3MS4A 1C80A 4KGDA 2O8NA 4UNRA 5H4GA 2HPZA 1XRQA 1IJEA 3D1JA 3HCRA 2XQGA 4KFUA 2PMCA 3CN9A 5CFNA 5J47A 1XP5A 5CDUA 1V11B 3SFZA 3DTVD 1GPYA 3UKOA 3LQFA 4QNMA 4GU5A 2Q6LA 4EFNA 1D9ZA 3JSAA 4HL6A 5KKNB 5G0WA 1K3UB 1PNOA 1U0BB 4LZOA 4QVKA 3F4LA 5IAGA 2FW9A 5EIHA 3C6KA 1OFGA 1W5AA 4C0QC 2FR8A 1E3WB 4QDJA 2JGMA 4AYTA 1VJDA 2EFYA 5KOHB 3DS8A 2XF8A 2Z8YM 1TJ5A 4JZKA 4DY6A 3LT0A 5ED0A 4DJEC 5L7WA 2Q3EA 1WNFA 2IKQA 2XDWA 3PXCX 3BGIA 3ZYCA 4EDHA 3AU8A 5AW0A 4KQ2A 4MQEA 1SUBA 3H5VA 5BV8A 3Q88A 1IUOA 2A8YA 3U4CA 2I6UA 4G26A 1T2NA 2I1WA 3HBAA 3EPLA 4UFPA 4G0OA 4RAOA 4AMBA 1HNZB 4U2BA 4J0EA 4CODB 1DIRA 3HPQA 1V0JA 3WK8A 2EQ5A 3PCXA 4RH0A 2VAXA 4NX2A 4UTXA 3JQ8A 2YWCA 5A7HA 1Q7RA 4AO7A 4UTRA 3K9QO 2O8CA 4Z7NB 3QFRA 4TS1A 4ENQA 1E0AA 2HXGA 3W8EA 5K99A 2B6NA 3HRIA 1J5XA 1Q1ZA 1Y5LA 3CLKA 1U8YA 2Q49A 1Q11A 4M2LA 4PINA 5BSEA 2QVZX 2WWIA 3CJTA 1QSGA 1SKYE 2XX3A 3IVCA 4IDQA 4BO3A 2A5YB 2J8ZA 2PJZA 1BHO1 4PHFA 1VBMA 3FUTA 1TZ2A 4GDMA 3JWHA 2HHCA 4EHNA 3NEAA 4LV6A 1QG4A 2OOSA 1RM0A 3F7OA 1UCFA 2OOKA 3PKJA 3AP3A 1L9KA 2CY0A 3KZMA 4HNUA 4DLTA 8AT1A 3IR7A 4HB0A 3A1SA 3FSJX 1CWUA 4XVHA 2HRZA 2ZYIA 3VSDA 4YWHA 5BUQA 4KN9S 5JO9A 1K27A 2G04A 4JEUA 4ESHA 3AVQA 5CG1A 1ZNQO 2G82A 3Q11A 4H1UA 2WJYA 3CR3C 2CDRA 3S5JA 4P2BA 1CUYA 1IB0A 4QTUB 2F9FA 3ZGNA 5K4GA 3FTEA 4Q1FA 4F3CA 4MRSA 3VO9A 2IE8A 2B98A 1BE0A 1FNSA 1DAHA 1QXSA 3LYAA 1U5AA 1MVNA 2JJMA 3UKJA 4F3NA 3J7AC 3D6HA 2AHRA 4COKA 1X7YB 3LLVA 1IXYA 3IH5A 1QHXA 2C3MA 2H8GA 1YZKA 2AN3A 3C7CB 1C9MA 3QI7A 5FTLA 2QTLA 4F45A 1D4FA 1T0IA 1ZJWA 3LVFO 1M2FA 4KVFA 1CULC 1EAMA 1TVEA 1PLLA 1TF2A 2X8JB 5J2UB 2JASA 4GGPA 5J5CA 3RHZA 1Q5PA 2QTVA 4ENVA 4NYMR 1U31A 3A26A 2I3BA 3GLFA 1JG3A 3WLJA 3ZDDA 4TKUB 221PA 4MWCA 4U6NA 2ZRFA 1E7YA 2W6OA 4IJMA 1CJBA 3FHOA 2WI8A 1JQAA 2CHUA 3JD1A 3FLAA 3Q8WA 1G19A 3R76A 2J0EA 4ZGWA 1A9OA 3O2JA 5GM2A 1FUIA 2WKQA 2QD1A 4CG1A 2Q62A 3DT9A 3FUVA 3HBNA 3HUUA 3VHXA 1LFAA 2CKDA 2XECA 1CF2O 4V0SA 3ELDA 5IVPA 2YKGA 1C1XB 3HVIA 1F2TB 1XXLA 1SVLA 3E9QA 1UC5B 1X7XB 3G2OA 3ORSA 3WMWA 5KEIA 2FW6A 4MV6A 5DI9A 4NCHA 3ED1A 4O2BA 3B89A 2D06A 4KPEC 1EJ6A 4BAZA 3GA5A 1ZMTA 3ZY2A 3KOZA 2IH4A 4NESA 1MAVA 1RLIA 1WHTA 3N8DA 4XTRA 5DU2A 4AX4A 2I87A 5ABPA 3ZXYA 4UDOA 1SEPA 2WIGA 4QAJA 1PJTA 3UXHA 3I3SR 3GRCA 1SCBA 1WDKA 1H22A 4X41A 2IPLA 3E3OA 4YAFA 5HKLA 3UJ6A 4S1OA 4ZV4A 1AHIA 3EK2A 2N1MA 4EB0A 4MWSA 2R6ZA 1B8UA 1NWCA 4EUKA 4G1VA 1NXXA 3COYA 3OHMA 3P9QA 4LJSA 3G0HA 4XVCA 2AYYA 4Z9YA 3LBNA 3TNDA 1H9BA 3CF4G 5LD2B 3AR9A 2GXAA 1JU4A 3LXUX 3I05A 1IJFA 2W6NA 5KQMA 1MABA 1NTRA 2NUAA 1YV9A 3GGGA 3IKLA 2DRIA 1YASA 3ESRA 4KJXA 3DA8A 3KZKA 4QSHA 3HXQA 1MJ5A 3BH6A 1M74A 4MW0A 4OV6B 1TM7E 1USUA 1A9ZA 2I2WA 4QPDA 3D8TA 1PI3A 2YN4A 3TNLA 3I61A 3U1BA 3FE2A 3IESA 5IC5A 2JC3A 1YRWA 3FMOB 3T95A 2BP7A 4B48A 4CMBA 1SBHA 3ESDA 4QNNA 2WIAA 3NFRA 1QYWA 1UEIA 3DWIA 2W2TA 3AO0B 1OFUA 4YN3A 2EQAA 1EGQA 5GZ3A 5D6NA 2EJTA 3ZPXA 2GARA 2FP4A 4D4LA 4GOLD 2NM0A 1ZN7A 3OBBA 1TTTA 2J09A 3H8JA 4UW9A 1DBQA 4B7ZA 2GRJA 2ZI4A 4EFMA 5BP7A 5K8TA 5KNCA 3GYGA 3MLBA 4IEFB 3VSAA 4YQZA 1KU0A 5L45A 5FXMA 2G7ZA 5AJYA 3VJLA 5JYBA 4YJ2A 1QHFA 1JAXA 1KQOA 1UJMA 3MGCA 5B1IA 2C57A 4KU4A 3U3RA 3E35A 3A4LA 4ZVMA 2FEXA 2BTOA 3FMIA 3HZRA 1KFEB 4EMTA 4DAEA 2PR2A 1DC5A 2R1UA 3CKMA 4KJZA 4TTSA 2FSUA 4E5YA 4EWLA 4BBAA 3W77A 2Y1KA 1O7JA 4OSOA 3EHEA 5DSTA 3AR5A 4QLAA 4OHZA 2OFWA 2PBZA 3EVBA 1Z0FA 4GWGA 1W5SA 2ORWA 3B36A 4Y2HA 5A1TA 2B4RO 3AONB 3R2JA 4I55B 4UAJA 3K1TA 1P1JA 3RUHA 3F5MA 2F90A 4UFOA 4Q4JB 1KKMA 2H06A 1R8XA 1V4NA 1X0VA 2WUFA 2IY7A 4XIYA 3PEVA 2BFPA 4FDTA 5IJZA 1TI7A 4FT2A 4PV7A 5JCXA 4BAGA 4RZ3A 2E18A 4GZ3A 3FSEA 5DHUA 1AH2A 2NYUA 1E2EA 3CLHA 1JEJA 2HFJA 3KZ1E 4TN5A 3I5YA 5HX7A 1BWQA 1KBZA 3ZWKA 3LRPA 1BFKA 1GA4A 1I3LA 3CZAA 1ONBA 5BT9A 3EIXA 2XLCA 3LVBA 2V55B 2CXOA 4NF2A 1X80B 5GOZA 2Q8NA 4X90A 4AJ1A 2B34A 3P7MA 4CKCA 1CK4A 5T4FA 5IT0A 2RJOA 2NU9A 3A9CA 2V3VA 1YOBA 5DIZA 4DZZA 1RPTA 2J9FA 1Z38A 2VHEA 4WZZA 1DC8A 3TGWA 4JZYA 1JFLA 4AKIA 4MIEA 4PYJA 4A8HA 2WHXA 2R85A 3E3NA 2A58A 3AEUB 4FHCA 5HIJA 3KJHA 3BMOB 4IGFA 2CJPA 3L77A 4MVJG 3JZMA 1GXSB 1Q0LA 1EAYA 4HEA6 2H1SA 1Z2DA 4M37A 1M75A 1GYRA 1KI3A 1YQQA 1ZSVA 1E5XA 2O4UX 1WG8A 3EWAA 4LXQA 5CHYA 5IYZF 3OZAA 4PZEA 1AKMA 5AVUA 5HR5A 4D42A 2PXHA 4BEJA 1KOGA 1N6NA 2QY6A 5HS6A 1JILA 4JR2A 3YASA 1KYIA 2IHYA 2VT7A 5I7AA 3N5KA 1GGMA 1UADA 5JSZA 1GKYA 4BFVA 3AG5A 2XTZA 4A0GA 2QR3A 3VYTB 3QU4A 1JPJA 3REQB 1KGDA 2HDWA 1E4EA 2Q07A 3JYOA 3P0HA 1SXJC 2V7BA 3S2GA 3WWZA 2QM3A 1NQVA 2WQZA 3HYLA 1P5RA 1PQYA 3S27A 4JI6B 1UAAA 4B3RB 3C3WA 1JHVA 2I4NA 3GQBB 3Q3CA 3V8PA 5PGMA 1KFKB 2EL7A 4JXZA 2LDXA 1WRBA 3D6TB 5BSTA 1LRLA 2GVDC 2ZIFA 3PXXA 3NHLA 4GKBA 5IP5A 5B36A 3HCBA 1USWA 1XCBA 4UEJA 3ZDEA 1YBAA 3G2LA 1RYNA 2XBUA 4O8ZA 2ZI9A 4JUDX 3HADA 1Z2NX 4ZCTA 1K08A 5K9ZA 4R0NA 2RCNA 2ABWA 4F8EA 3KB1A 3GJ0A 3ZCQA 4BGUA 4IL5A 4O3MA 1E5TA 1UBNA 3FNHA 3PFWO 2DFLA 4J0HA 3CVUA 3PDIA 4UNIA 4RGQA 1EGVB 1TYAE 2PUTA 3GR6A 3IQEA 4NEHB 2OXFA 1G5IA 1N3IA 1P2BA 2ACKA 1XRJA 3DTYA 3IXLA 5KNCH 3WA7A 4IV5A 5ECYA 3JALA 4QGSA 1PNRA 1DTEA 3NHPA 3IDSA 4LVNA 3E23A 3QWFA 1Q57A 2O4CA 3OFND 3PEFA 3U37A 3ZGVA 3NBAA 5D86A 1AQYA 4ZAGA 2BH2A 1N7HA 3RTDA 4D5GA 1JIKA 2FDCA 5A0FA 1LLQA 2CEKA 2GNOA 3TLAA 3PUYA 2QU7A 3HRKA 2RFLA 4ZALA 4JYAB 1QFSA 4RD2A 4NNPA 5JE8A 3IE2A 4LDRA 1J0CA 5LYJF 2P9HA 2RHCA 2VBIA 3HA2A 2JFXA 3SY8A 3IMGA 3WWPA 1D4ZA 4DR2B 3ADDA 4GO1A 1QYRA 3NHSA 2PLRA 1AUXA 4RGVA 4UZEA 3V4RA 3B48A 4EFKA 1M9NA 4NDZA 3EAGA 4H27A 4AC9A 1NT2A 3SZMA 3P26A 3AV0B 5A4KA 1L5HB 1ZXXA 2IU6A 5JCZA 1CRLA 3MCZA 1C7EA 1EP1B 1FEZA 1M8KA 4Y0VA 1KDRA 2JD0A 3CH4B 4CQMD 3T3PB 2PKYX 3IBYA 4WFIA 1M2GA 4DKJA 3DO6A 2UZ1B 3Q3EA 2GMWA 4HFJA 1IWPB 2NSDA 1A5ZA 4RIGA 3QELA 5CD1A 2DBVO 2H2HA 5FIUA 3CF4A 1NBAA 4D3XA 1IOZA 1LBEA 5MN4A 4U7PB 2ID4A 3IIEA 3ZU4A 4EPVA 2P6UA 2YXDA 2P9EA 3OE7A 4RJLA 3W06A 4B6JA 1TM2A 2B0CA 3GT7A 1A9XA 1WDWB 3RM3A 4QOEA 1A5TA 4ZU3A 2IELA 3P0JA 3ITEA 3NRCA 3HFJA 1YHZA 3NCHA 4EO4A 1TJNA 3NJ8A 1C41A 1A71A 2HA2A 2JHAA 4WRRA 4PIPA 3UAGA 3FCUB 3SLKA 4HLUC 1E1QD 4KUEA 4RVNA 4Y8VA 3UFXA 4ZZIA 1F8GA 4MB0A 4LBVA 3TGPA 3MJHA 2YASA 4LG1A 1FSFA 4UOEA 2EKZA 3HI4A 3BAFA 4DABA 2M98A 5EJ8A 3FMVA 3KZVA 4DIDA 1T8UA 1N2GA 1O6FA 1O5TA 3E03A 5H02A 3TOXA 1U2PA 4M8NE 4ENPA 1PEKE 4DRXA 2SECE 3FN4A 4GBGA 1Y4DE 3SD7A 3SEQA 3VNVA 3VVMA 1G2QA 4FX5A 2CFTA 5BOSA 4DQLA 1X19A 4ZCPA 5JI2E 3QEAZ 3IR5A 4UVEA 3JWEA 2OGUA 1AE1A 4Q1BA 5I8ZA 4DT1B 2CT8A 1XNHA 4J0JA 4QTTB 1ZVMA 3VMFA 1X2EA 4BEBA 1NIPA 2HJSA 3L7BA 4I5DA 4OHPA 1X8KA 4P98A 5EG5A 3VTFA 2BSAA 4DMUB 4I1SA 1N2EA 1KMNA 2YCBA 2QRVA 3IJ5A 3WTCA 3GDFA 1DEAA 2W90A 4R31A 3ZV7A 4E1BA 4A8TA 1XKQA 3O8BA 4AIIA 3GZ4A 4OK3A 4WKCA 4YMHA 2AUTA 4PBRA 2HX1A 1Z6XA 1YJCA 1KC1A 3IUEA 5TPWA 5BYBA 2CYAA 3H7IA 5I9SA 5IAOA 1B00A 3Q15C 4HOYA 5IKEA 4F1WA 1P2DA 5REQB 4RW0A 4O5OA 1N1GA 3AVPA 5DN6D 2ZDHA 2FX2A 3WYGA 4ZYWA 2X7HA 3S3TA 1CLUA 3UGTA 1R16A 1B1AA 1DB3A 1Z47A 3FYUB 4TRMA 3KSRA 2F8TA 1E9RA 4OXYA 5TS2A 3EC1A 3H65A 2JLZA 2YOGA 4UUPA 2VNKA 3QTTA 2XYQA 4MAFA 4QWMA 4BPRA 1AGPA 3O8CA 4R68A 2PSDA 3UG7A 1J0EA 3B52X 3E9ZA 1ZR4A 2B5VA 3A0RB 5F21A 4JI2B 4KPFC 1I2DA 4UKDA 1G5PA 5AJZA 4GL2A 2H3EA 3K0KA 4XVUA 3SE7A 2V98A 4B45A 1O94D 2WTXA 1Z18A 1M0WA 4X95A 4LX8A 3IS3A 1FY2A 4QQ8A 1PTJC 3QEOA 1AKYA 1TO1E 3B5IA 4MS3A 1PFUA 1ZGGA 1TOAA 2NP6A 2AOVA 1YCDA 3UCFA 3ZWWA 4QC2A 5J1TB 4PQFA 4BZWA 2W00A 3FH0A 1KQFA 3N9IA 3TG2A 1Y6QA 2FOXA 1OI3A 4EZBA 1V1JA 3CZQA 1DQYA 1M1NB 3K32A 1MJGA 4HXFB 3L1VA 4PYQA 4R1PA 5K8IA 1XZDA 2Q5EA 3WZ2A 3MBIA 4MS4B 1C7RA 4BE7B 3BIFA 1XPUA 3T1OA 2QS9A 4JL5A 1OZHA 2DY1A 5E38A 3ONWA 4RZQA 3RC9A 2H18A 3OECA 1C3JA 3HABA 4A8JA 2O14A 4V0OA 4DM3A 1SXGA 1HE1C 1T6YA 5B6PA 1KO1A 1EDDA 3DZHA 3BMQB 4DLUA 3I39X 3AWDA 2O48X 4HWRA 3SYTA 3W34A 5DXAA 3HKBA 1U7ZA 2J6BA 5G2OA 2B7CA 3ONFA 3QLVA 5ES4B 3O9ZA 2P78A 4MYCA 1HQKA 3D8SA 1KY5A 3OFJA 2GZ3A 4IPTA 3FUWA 3IAFA 1MD9A 3B60A 1K3FA 1WCWA 2OBYA 4CKBB 5I3CA 3TAUA 4G81A 4R1OA 2PL5A 3L82B 4FZVA 2ODWA 3KWMA 4PAOA 1W2HA 1QWOA 3RK1A 1XMIA 4ALJA 4Q02A 4CM5A 3KE8A 1PQWA 4RZSA 3UWDA 4G65A 3W5UA 3KZNA 1YS1X 5LDDC 3WQQA 4QM7A 4K9DA 2W6ZA 3JPYA 3PFGA 2NNLD 4CLDA 3K3PA 4HG2A 5DV9A 1NR5A 1GPH1 1OTYA 1FDSA 3EQ8A 3JQPA 4BHTA 3MJ4A 3OIFA 4ZDWA 2E4VA 3TEJA 4QUJA 1XTJA 1ZCJA 2E82A 2Q5QA 3TFQA 3IV9A 1BKYA 2DKNA 4OBWA 4DIKA 5U9CA 3I6BA 1WZNA 4ZCIA 1AY0A 4IQ8A 1KNQA 1DL5A 1S0UA 4RMHA 4F91B 2O1WA 4IOJA 3EASA 2C58A 3SFVA 3OPYA 3BA1A 1G21E 2AS0A 4FBGA 3QITA 2YRXA 2GPNA 1VA5A 3HR8A 1WUTA 4AB1A 1S7CA 1SC1A 2EKLA 1UBHS 1YBMA 4O2BF 5AI6A 2Z4SA 5JC8A 4KRFA 4HKTA 5CH8A 1JRLA 4NWIA 1OLSB 2KQUA 4FUQA 1EPUA 4L8GA 2HA4A 4G0ZA 5CM8B 2B2XA 1YR7A 2O05A 5DBFA 4BB9A 1VPLA 3KOUA 2BUBA 2PX4A 4F6LA 1VJRA 4C7OB 2H2FA 1R0CA 4E12A 4PNEA 5FBRB 1DPFA 2H17A 4BKOA 1FOEB 4NBWA 3QPUA 4OIMA 3R9IA 5JDCA 3KLOA 3BXPA 4Q82A 1YB4A 3PVZA 5EUBA 4Z7QB 2LDBA 1CR2A 2IOHA 1H8EA 3KWFA 1Q0RA 1M8FA 4YJDA 2J31A 2O2SA 4MUHA 2LWIA 1NQ5A 3CMMA 4OATA 4QGBA 2DE0X 4IGEA 3DYBA 4H4DA 1M34E 3FYSA 4Z4HA 2PE5A 3ZWVA 4D0NA 5HDBB 4P4SA 4DV1B 2XCTB 2AOWA 2N9UA 4BWFB 1CUEA 1GNQA 3KLNA 3NPMA 3N8IA 1HTTA 2AQIA 2ATCA 4WEQA 1ADGA 3R3HA 5IDYA 5KYKA 1LI7A 4CKZA 3T3GA 1SKAA 4INAA 4LQLA 3AB7A 2WUVA 3RI3A 3K1AB 1KJWA 4LE2A 2H0QA 2XKAA 3OIWA 5ICGA 3OVMA 4KITB 2PZLA 3TOVA 1Z13A 1L7BA 2WYUA 3ZTTA 1YMUA 1T26A 1P39A 4A15A 3MD9A 5F35A 3HFGA 3HY6A 1QF9A 2CD7A 4PZ9A 4XLLA 3WZLA 3EXEB 4UARA 1IQUA 1TCUA 4YJ2F 1XQ6A 3IDOA 2Z2ZA 4JLPA 4UMDA 4EHKA 5F4ZA 1KZYC 5H82A 3LDFA 2PH7A 2C04A 1PWXA 3R09A 3FWKA 1RXEA 2V9CA 2C42A 2D5CA 1M6VA 1MENA 3F6YA 1X1DA 1ULUA 1BWPA 2QQ0A 1GWNA 3LA6A 1ST3A 1YVUA 1C1DB 4W5HA 1UBOS 3A2KA 4WDRA 3GAZA 4EJSA 5HEKA 4EOGA 2CV0A 3ICOA 4IDEA 1ZOIA 3RC8A 2HA0A 2QIOA 4BUJA 3M49A 4ZIRA 4W5OA 4B71A 2I34A 3S1LA 4EW3A 3M6AA 1SHJA 5FOXA 2C9CA 2G5PA 3ZKWB 2Y0CA 2XT6A 2ZK7A 3IEPA 2FGJA 1EHCA 1U0HC 4K86A 1NP6A 1HOTA 4Q4HB 3LW7A 3NX4A 3ZN2A 5DNUA 2VCHA 1U7PA 1DT3A 3D3QA 3IEKA 1XNGA 3L8YA 4QATA 1TQHA 2R1VA 2C2ZA 1ZUD1 1S7GA 2JCSA 3U4DA 3LXXA 3A06A 2JIPA 5EHXA 1KS2A 4OTZA 3UV6A 2ODEA 3FUXA 2AB0A 3L04A 5JT1A 3I0MA 1GFWA 2J0UA 3SOZA 4I50B 3ZCUA 3LTNC 3MWFA 4JOSA 3O4VA 3F0TA 1T5OA 1JHDA 1L5VA 2RHOA 4ZVOA 4GM4A 2JIZA 1CS0A 3VPSA 3FLEA 3EWIA 1OROA 2REQA 4KSBA 2RBKA 3A3PA 3D6UA 3KUDA 2HGZA 3NYWA 2MSNA 5KNCD 5ULLA 1D9XA 1I3OA 3QVGB 5FUMA 1IZZA 2IEDA 5F52A 1P3Y1 3IO3A 3A2NA 3K9WA 1CJTC 2HIAA 1YHNA 4G0MA 4PCAA 3QVXA 4B47A 2FFAA 1CX9B 4IDGA 3LY8A 1DBPA 1EFUA 1TMKA 3II6X 4KIJA 1JQKA 1MAAA 1XEAA 2ANBA 2JFHA 4XX0A 2I9PA 4IUCS 3CX4A 4XQCA 4B4OA 1EX7A 2XCUA 3BWDD 3GRYA 1IZYA 4I19A 4LKOA 3U80A 1Z7GA 4BP9A 5BO5A 2Q2QA 3IC5A 521PA 4B80A 1ICEA 4LUCA 1BYUA 1DWQA 4FR5A 2G4LA 4RMNA 5MFZA 5FWAA 1ATIA 4M55A 3OUZA 5HS4A 1R12A 3SQXA 4RHYA 3TUJC 2Y77A 1NM5C 1NYLA 2WD7B 1YR2A 3F7NA 1CUBA 1NJ1A 2A9RA 2A9VA 3LYUA 4TWBA 3IL2A 4M9ZA 4I14A 3U09A 4IZIA 5F5LA 3SYNA 4JLSA 2NPIA 2XDAA 1D04A 2BGRA 1APBA 1H4VB 1O87A 2PWZA 3CH5A 4V2IA 3HKCA 3R3UA 4D25A 1KIFA 1C9KA 5FOQA 1UZAA 3EVNA 2HD4A 3DBHA 3EG9A 2X86A 2JZCA 1WKBA 3JS5A 2A5DA 3BIOA 3IA2A 1UDBA 4OFZA 4XB1A 2OUKA 3IB6A 5IEBA 3VDMA 1E0KA 1T91A 5AFSA 4XI9A 5INTA 1XMOB 3ET4A 3NTUA 4HQ0A 4LRTB 3HJUA 4G37A 3TL6A 1KYWA 4QQNA 3U4QB 1GL9B 5JYDA 2IIBA 4OU5A 2LNDA 2ZDQA 4Q7QA 1WHSB 1HE4A 1PSDA 4K6MA 3U40A 1GZ3A 4QYTA 3MAJA 5CXQA 4S04A 5FUQA 3HS3A 4XQ0A 3EODA 3R7AA 1W2WB 5FPYA 1QJCA 3LFUA 3ZEIA 1TTHA 4QDUA 1V11A 2BY4A 1Q91A 3OTGA 1PR3A 4MQ4A 3V8EA 2H1CA 4BX3A 3PGKA 4X7MA 3EPHA 4L51A 2XT0A 1RD4A 1QE3A 2R6AA 2VEDA 4FGLA 4IJ6A 3N3BC 4BO2A 4E5PA 5FWXB 5KC8A 3ZNQA 1E3WA 1QK5A 2XH8A 4MRAA 4PGFA 1JP7A 3ND5A 3OJWA 3PZRA 1QIJA 1XZMA 1Z56C 4ZVSA 4BMPB 4B7CA 4UC0A 1RAHA 1RAAA 5DCUA 1TFUA 2VJCA 5BOVA 3ZUPA 4BBJA 3LZ6A 4DJDC 3A1VA 1HEUA 5CLIA 4S1PA 4IV0A 5HQJA 3X1JA 4JXXA 5DYWA 1DJPA 3PICA 2FEPA 2C0PA 1TYDE 2ET6A 5A2QA 3MPOA 2YUIA 2QP9X 1BJTA 2ZWPA 4LS3A 5CVTA 1K5GA 3PX7A 3EISA 3CN7A 3MWDB 2WV7A 2XB9A 1GGFA 1T8RA 4KI0A 4TQUS 1XQ1A 5I5GA 3D8NA 1ZMBA 3BBPA 4A7PA 1JXAA 3L6OO 4RNCA 5IF9A 4DWVA 3DKVA 3R20A 4J1TC 1QDLB 1AQNA 2GZDA 2ZSBA 3I5MA 1RC8A 2YIDA 1A69A 5H9VA 3CLUD 4A6DA 3UBTA 1E3EA 1GSAA 1SN7A 3K09C 2EBHX 3RAPR 1UJ4A 3TLYA 2HPVA 2OGSA 3UJBA 1UXGA 2X5OA 5F7ZA 2ORIA 5IM4A 3CTPA 4B3IA 3E0QA 1DKPA 2X0DA 1WBDA 3BA6A 1EP9A 1H5QA 4HLQB 1E3MA 1RYBA 3V6LA 1BXZA 1GTVA 2IY8A 3FNRA 5KBYA 3ZCPA 1RYYA 2ERYA 3ACBA 5J5AA 2MSWA 2NQ2C 2X22A 3MJSA 4NAUA 1NYQA 5U1PA 4DLVA 4D3FA 2LR0A 1ZMRA 4BKRA 4IBOA 1SRQA 1EB8A 3IUSA 3TK1A 3V97A 1Q19A 1YZHA 3AW9A 3VZQA 3QXSA 3G88A 1KHTA 4R8MA 4RHCA 2P9YA 5TGDA 1XK7A 3EDQA 4JLWA 2QBYB 1A72A 3CEHA 4XR4A 1CSEE 1R4AA 3OCYA 2J7KA 3JZFA 5EZSA 5EMLA 3M4XA 4Q19A 4KO2S 4TGLA 4XDHA 2HEIA 3WRWA 4X3OA 3TLGB 5HP4A 3R6WA 5LQDA 4GH5A 4BQNA 2X6RA 3OCCA 4FWTA 4L3WA 2YYZA 1P17A 4BLTA 5JXWA 2J6HA 4TLBA 2J48A 3O7WA 3JZIA 1VE9A 4ZJZA 5IEJA 2FA9A 2J33A 2VTVA 2YC4C 4QSMA 3D1VA 2X8JA 5J2UA 3OLZA 5KKCA 3BXZA 4YJFB 4PFJA 1MB2A 4ZGBA 2GQ0A 4B73A 1S4QA 1Z75A 1U2TA 2FEOA 2QXUA 3P9PA 3WGNA 1HYHA 3UW3A 1XJCA 5ALZA 2D0DA 5DT2A 4ENSA 2WJ3A 2VEOA 3DOJA 3JW8A 1SB9A 5HKBA 2IHNA 1NG1A 1OVGA 3WDLA 1J8VA 1X7XA 2ANCA 3BTUA 4Y1FA 5D51S 4AQYB 3BGDA 2ISCA 5TGTA 2ZQZA 1VIYA 2PZ8A 3CKKA 3GFTA 3OA0A 3PR3A 3RO7A 2CLSA 4DM4A 2UUAB 1HL3A 5H7XA 1RRPA 2R7LA 3LUBA 4F3KA 4XD2A 1KK1A 3LTEA 4KQKA 4YRBA 1SUCA 3OWOA 1TQ4A 1QAMA 3T3DA 2J9ZB 1UKAA 3CM0A 1EVZA 1ESMA 4YV0A 1FLVA 3PEYA 3OE7D 3PDHA 1SG9A 3RUCA 5LZ9A 2QX9A 1VG9B 4NAVA 2BISA 5FB3A 3R7WB 2HL6A 4MIOA 3TXYA 2HNBA 1ESZA 5B2ZA 4RD3A 4TT3A 5ALPA 5FLXA 1H5NA 3UUGA 1KEEB 1A8QA 1RYFA 4PC3A 4D4KA 2VP2A 2Z9BA 3ROTA 1A8UA 2RGXA 1Q15A 1ZD4A 3J80A 3RVBA 4BRSA 3KHTA 3N8GA 3VO8A 3WDSA 4I1YA 2IIVA 3WLMA 3B3GA 5JS2A 5JS8A 2IS4A 3ADPA 4DSZA 4H3HB 1PYDA 2Y99A 3QXCA 4O25A 4R2WA 4TTPA 5FTJA 2HFKA 3DXYA 2RK6A 4M9QA 1FNMA 3QUAA 4O4JF 4BZXA 5IT9A 5JSUA 4BE4A 2RB4A 4F85A 1CHDA 6Q21A 1E1MA 2XMPA 5B4VA 3TLEA 1VG1A 3LLCA 3DMNA 3QPVA 1HKHA 2CVPA 4UNNA 3DFFA 2JIDA 3BEDA 3WRVA 4ZMSA 4PTYA 3IAS6 3U7HB 3NONA 3K15A 1QMPA 1OQAA 2OQVA 4C5BA 2BGGA 1KJ8A 5CVEA 4Q9JA 2Z57A 3C43A 2VHTA 5JXIA 5HMMA 2AVDA 2YY5A 3O31A 1RNLA 2R4QA 3NUZA 1T9KA 1VYVA 1BA3A 3T0GA 2P6MA 3D43A 4IX9A 2VP6A 1KC3A 2CDCA 1JG7A 1ZRHA 2Q21A 4CXMA 1TCAA 2VK2A 5TT1A 2JFVA 1YIAA 3MJEA 4OJKA 1ZK0A 1EFAA 5FADA 3K0FB 4IXWA 2WVGA 1CRZA 4GI7A 4F7WA 4TQAA 2A7XA 4JUCA 3GLGA 4HGZA 4PFQA 4CNBA 4RLQA 1IN7A 4WCFB 1SUAA 3C0KA 2H57A 4I55A 3IKMB 1U5BA 3MWKA 4E13A 1NVMB 1YQEA 2X4DA 1B4DA 2PYIA 3EARA 2IA5A 4Q3BA 2XTNA 1ZJ6A 4EMUA 3ZHOA 1VL8A 2XKJE 1RQLA 3BQMB 3HVHA 1KF0A 3GLVA 3IPLA 3OFKA 3PC7A 3R5FA 2P6RA 4KLAA 1KZ7B 1QZXA 3PR2B 4TROA 5DLPA 3ZZ0A 5EYPA 1RRVA 1CR4A 3C48A 3DV0B 3KKNA 3L7JA 5AHOA 5TDHA 5CNMA 3O84A 5AESA 1DFIA 5F7OA 2AR0A 2C4KA 2DEUA 5E1DA 1CC1S 2EERA 2JIOA 3RBVA 1IYZA 2B4KA 2C07A 4I46A 1C4KA 1RLUA 1JEQB 2I78A 2Y8EA 3HCPA 5ALNA 3T7IA 2Z6QA 1S01A 4QUBA 2PUWA 1TIKA 4G5HA 4R9NA 5EXSA 4RD6A 1B8OA 3LPAA 1FFCA 4GE0A 1LCIA 1LPAB 3ZG6A 4CTKA 5F33A 1C8KA 2D7CA 3BXXA 4DC1A 4CFYA 3B2EA 3OQ6A 2YZNA 3E9EA 5T4HA 2Q5HA 3L8DA 5J23A 1J0DA 1P74A 3IP9A 2QQGA 2BF7A 3AEUA 3EEOA 4EF6A 4PC7A 4FOSA 1MPXA 3OESA 4PLHA 3ICCA 3HV0A 4BE9A 3RT9A 1AKNA 2JLRA 3C3DA 5BQ5A 1FNDA 2Q6VA 3RF6A 2IS2A 4EH1A 1Y4ZA 4W5NA 4DRZA 2RIRA 4N0QA 3R74A 2AI1A 3T1QA 1ZQ9A 2XMBA 1MIHA 4UD2A 2FPRA 1NV8A 3I34X 3Q3HA 3B78A 2C99A 1Q0ZA 2PZBA 3O4RA 2FZCA 4OG2A 4HAUA 2P5TB 2F62A 1LKZA 2WMYA 4NCXA 1IUNA 2NNWB 1CYDA 4G4GA 1MDBA 2QE7A 3D54D 3EZFA 3ETLA 5JDIA 1I6LA 4IMIB 5MDHA 1VSVA 4BU1A 3VNBA 3GQBA 3V2IA 2QY9A 3GG9A 3IHTA 1KYYA 1XJWA 3MUNA 4ZTBA 5BWLA 5ADHA 2B20A 1V9SA 3D6VA 2VP3A 4G9BA 4AT1A 4ZI7B 4X91A 2ONKA 3SYMA 1O3YA 7AT1A 4S2UA 3IQWA 4EFDA 4ZAZA 3UVEA 1QGAA 1SHLA 5JBIA 5IKMA 2Q5OA 2JCXA 2O23A 3EMKA 2AOXA 2BEWB 3VDNB 5K6AC 2W22A 1JSLA 2O06A 2Q4DA 2ZJFA 2FPWA 4HQRA 3SM3A 3KTFA 3OJCA 3ZHVA 5JYCA 3DCNA 1U3UA 4RESA 5FOUA 3EA0A 1P7PA 3U1VA 3DPUA 2DPXA 4ZQEA 3M6XA 4JBIA 4RQAA 4NG4A 1R4MB 1RHRA 3UC5A 4HHEA 3UWKA 3GJ3A 4MA5A 3CNQS 1RE1A 3NGLA 2OKCA 4KXWA 1M1YB 1HZJA 1HQYE 3BJIC 1JUDA 3VI3B 4DNFA 1IY0A 3NIWA 3D1LA 4RORA 2WKPA 2GA8A 2HOQA 2DM6A 3REGA 3F6EX 1H8ED 1ND5A 2B30A 4HWSA 3TLBA 1IWBB 4RQUA 1BHJA 5DI3B 3ZW9A 1JR3E 4FE7A 2PS0A 4HD8A 3I3OA 3RVRA 1G20B 3H18A 3HV2A 3FIUA 4C2BA 3FWHA 1KAQA 1WEKA 2QVCA 4GOKA 4H6XA 1P2TA 4QPNA 1KI6B 3M5DA 2KS6A 4M1KA 1ILWA 3SMQA 4B4WA 3V33A 1NMSA 5GJVC 3C85A 3UMGA 4BDTA 5K3OA 5E3HA 1RMYA 2DYKA 2FG7C 4R0MA 1CZLA 2R2AA 3I9V6 3LS2A 2NYRA 2X13A 2RH8A 4AN0A 2Y1DA 3VNAA 4TMFA 1FTSA 1W0KA 4NQRA 2DH5A 3CNNA 1GT91 2WJZB 3BD8A 4YLYA 1AUOA 5I4BA 1GYQA 5E3IA 1MJFA 2DQSA 2YFKA 4GM1A 3PR1A 5AW2A 1N2ZA 1HR0B 4KAXA 1LK7A 3UYKA 3WXBA 2OV2A 4D4GA 4P0QB 4RK5A 3X43A 1JAHA 3L18A 4DWWA 4EY8A 4W9MC 5GIOE 3AFGA 1UC4B 1X8JA 2VI5A 2ZRQA 1EFCA 4LSZA 4OBXA 1G1MA 5IX8A 1CUJA 3T4XA 1SCAA 2C54A 1XRLA 5CK4A 3T7TA 3WLKX 1PUJA 1RLJA 2J3MA 2O2EA 2XVXA 3CRNA 2R9VA 3HZZA 4NV1A 4G5QA 3CF6R 5ER9A 1HYEA 3NQ41 2I1LA 4RM2A 5BSVA 2C8VA 4CT5A 4LF9B 1IZ9A 4Z4EA 1EVYA 2GSWA 3BICA 3KZOA 3P9XA 2C31A 1NATA 1T2VA 1SCDA 3N0RA 3VKUA 1O8BA 1YIDA 1Q1AA 2QPAA 1ABFA 3MILA 3TO5A 2FX3A 5FBQB 1EUCB 5JAHA 5AJTA 2YWGA 1DRKA 5CLFA 1GCAA 2WLTA 1OXSC 3O9VA 4UJ5A 3G0IA 1GN8A 3NBMA 4LTNA 1XCPA 4P6VF 3W8DA 4CIXA 1RBYA 4DWJA 4JU9A 2ZREA 1B73A 4L7QA 2H00A 4Y2GA 4B34A 3NANA 1H6AA 2YOFA 3HL0A 5BPFA 1CQWA 4BV9A 1P5JA 2FAXA 1V95A 4FHFA 2HWXA 2OCXA 1PR6A 1QS0B 4JFAA 2B36A 4F86A 1KS9A 1XZQA 4BNKA 1KU6A 1C30B 5CDYA 4YGXB 3F3MA 3RAEC 1P3DA 5C8DA 3AKYA 3C3KA 4LXGA 3SBOA 3I9OA 3O94A 3R3ZA 2VT6A 1YRYE 1YJBA 1EM8B 4K3UA 1JEDA 1E4OA 3AV3A 2IP1A 1O95C 4C7VA 1LUAA 3DYVA 1J2TA 2JK1A 2JIZD 3N70A 2G1UA 3PXDA 4LFCB 1J8FA 1ZH0A 3I01A 4B0OA 2WSIA 2CBZA 1LI5A 2PRKA 2QUJA 1OH7A 5KHAA 1GCGA 3OZSA 3IEUA 4LXXA 4C30A 5K7SA 5IANA 2NZ8A 1R9MA 3MCVA 5C35A 3LY7A 1YACA 3O8DA 5AHWA 3WDKA 1XL1A 1C3VA 1SQSA 2W2MA 1JDVA 1RKUA 2X4GA 2YXEA 3BXEA 3JTMA 4A9AA 3DD1A 1JHXA 5F5XA 2DBZA 3ZOZA 4CL3A 1DAEA 1S3SA 2DR2A 1Z7BA 2ZLBA 5BUCA 3FYUA 2D2VA 2X3FA 3E9RA 2JFZA 4ZVKA 1ZA2A 2D1RA 3ONNA 2FOLA 1X1QA 5I7EA 3I45A 3VH2A 5MN6A 1KORA 1RI1A 1VSTA 2BZ0A 4XGNA 1MV5A 3ND8A 4LHEA 3VC1A 4Z6KA 4LYYA 1KRHA 1OF1A 2AXNA 1V3TA 2PAAA 5EJ7A 3H1BA 4GLJA 4P38A 3SE0A 1ESDA 1EVLA 3I4LA 1XLTA 2QZ4A 4E94A 4XGKA 2H2IA 4Y2RA 4V1CB 1I4TD 3LKDA 2FRDC 1DEOA 1WXWA 3WO1A 2CLIB 4WNCA 3EVAA 1QMGA 5EMJA 3V4VB 1LVUA 4N8DA 2GAFA 5FQOA 3E1GA 1ZD1A 1SG0A 1HUQA 1UXHA 4LKRA 5K45A 3TSWA 4ZPJA 2CL0X 3HCDA 1SKYB 3IAM1 2YZ2A 2C95A 1XTRA 3FOEC 3H3JA 1PGNA 1VL0A 1NL3A 2XTAA 5MGBA 4YS6A 2ZRMA 1PV2A 2VUHB 4Q9DA 1M1NA 1W49A 3DLIA 4IZHA 1KXZA 3R7BA 5IM4F 2OQRA 1T6XA 1VL5A 2DTEA 4NBRA 5EEHA 3FFTA 2HF9A 2OE2A 2QTHA 4MS4A 2Y1GA 2DG2A 1PFKA 4G8JA 4MVYA 3ST7A 2P90A 3UAYA 3QE3A 2UVPB 4PSVA 1KAOA 3I72A 4GE3A 3F5SA 4GWLA 5TX7A 4ATNA 5JADA 2HYIC 5HE8A 5K03A 2P77A 2JFFA 3NDJA 2V6JA 4LMRA 4QQRA 1JSRA 4NZPA 4ZVRA 1PJ8A 4MW1A 3BMQA 4C43A 5E7MA 5F4BA 2HM7A 4FONA 4FM9A 3HJGA 2BI4A 4M0FA 2F3SA 1J0XO 5CA0A 2Q9BA 3ZBTA 4FGUA 2M6LA 2I1QA 4LDZA 1E1YA 5DMXA 5HF5A 4EEKA 3LOUA 4EARA 4QFDA 4X6XA 1DTWB 3RK4A 4CKBA 5WRFA 2IEZA 3DV9A 3HXLA 4WFJA 1QTNA 5HZGA 1GPUA 1EE9A 4WCDA 4Y6RA 2EBFX 1P9RA 2Y71A 1L5GB 4U2FA 4EG8A 2G1AA 4NENB 3Q8XB 5TVKA 3GY0A 3TIXB 5K8CA 3VKFA 4CF5A 5JEEA 5GM1A 3TQCA 2BTEA 1W44A 2PRSA 3F3YA 1V25A 4R8SA 2WHQA 4YEDA 2YV1A 4DMGA 5B7GA 3W4JA 4Y2VA 1MHPA 4G1EB 1QRAA 2IBSA 4ZCQA 2ZUDA 3RRJA 3SQDA 4EG0A 3VR0A 3B7WA 4ABTA 2JCBA 5EUCA 2PO7A 4PX2A 4RPCA 4B2IA 4OX9B 1D6MA 2J67A 5CURA 1O97C 1TLLA 4EYKA 1ZFNA 2QDKA 2X15A 4JQOA 1F38A 1L7PA 5CNJA 3AX6A 1QC5B 1ZN9A 3C6XA 3FCSB 3MD0A 2I8LA 3QFTA 4Y0AA 4RD1A 2EEPA 1LD3A 1E96A 3J81A 1OLSA 3FPFA 1SK8A 1WDTA 4QGAA 3MOGA 1CY6A 4JXJA 1H3EA 1W88A 4G23A 1ICIA 4IMPA 3LAWA 4KRGA 1WV0A 7ADHA 3W6ZA 2H1IA 4C7OA 4RPGA 4P92A 5AM1A 3W5IA 4NFHA 2M2IA 1MVLA 2LPMA 2QRLA 3FPJA 3F6BX 1SB8A 2W2OA 2YWDA 4M8SA 2XQJA 1CUUA 4W5TA 2F8SA 1UFVA 3KJIA 3ITDA 4I4LA 3KB8A 5K6AA 3Q9NA 1JHOA 3RUPA 2F2TA 2FK8A 3EMBA 5KTRA 1X9HA 3BWCA 3WK4A 4NOKA 10MHA 1I5EA 1O03A 1JVBA 5H3HA 2W4IA 4W1QA 4YQYA 4LGVA 4I1RA 1QOQB 4E5DA 1K92A 4LZPA 1Z5UA 4M1QA 4DPMA 1VP9A 3HFRA 4UUMA 3TW4A 4DSNA 3E7WA 3K1AA 1QP8A 2C5GA 2HMUA 3BE5A 3GEDA 1VLVA 4JB0A 2OORC 4OD0A 3TZKA 4C3VA 1C9YA 2AOUB 5BMOA 4BMSA 3FFWA 4YUWA 4RV5A 4B4DA 5IH7A 3L49A 2IS6A 1OC2A 4DXDA 5L3RA 2IZZA 3RSQA 1XAIA 2Z6UA 4AKHA 3GZNB 2ODAA 5EP4A 2QMUA 3C5VA 1WUJS 5EMHA 1IRIA 3FR8A 1X1CA 4TUYB 3IE1A 4UBNA 4Z9FA 1ZUNA 2XHZA 1B8PA 3WLAA 4UNPA 4CDNA 3ZY3A 2Y68A 3LWBA 3WGZA 6PFKA 1PSWA 1R88A 2KM1A 4L75A 1D2HA 2ZIAA 1E9AA 1BAPA 2JIRA 3HNRA 2QR5A 3FGPA 1P7YA 1FP4A 4H35A 4NJMB 1T9DA 2R7KA 4JEMA 2J0SA 2VDVE 3DE6X 3E8MA 4YAIA 1KFBB 1N36B 3NWOA 3JAWA 4PC6A 1X8LA 4TT3D 4KR2A 3ORQA 5AW8A 3K6KA 5K8JB 4RS3A 3W7AA 1O77A 3HR7A 2H4XA 1N75A 2NN3C 2OCBA 1OBOA 2GERA 4UMEA 5FA6A 3T7JA 2VHZA 1JS1X 3A3OA 1VYHA 4I55F 2AF4C 4O29A 2BCJQ 2P8JA 1GZSA 4EUHA 3GELA 2A78A 5JRZA 3ZLVA 4X0EA 5FI0B 2H1FA 2YXBA 1C14A 3ZKWA 2WG1A 4Q4HA 2LIPA 2W37A 1KPHA 3CLSD 4LF4B 3TQIA 3LRXA 4XOUA 4RULA 1YA6A 2WOOA 4PZUA 5H0IA 3UG6A 4CM7A 4M7RA 2W0MA 1DIBA 2OV4A 4Y1RB 3L0SA 2HREA 1YA4A 2PBRA 3FPSA 3OIYA 4JAVC 4YRIA 1NJ8A 1IY1A 3N6XA 4I50A 4MV8A 2KBFA 4MQBA 1I13A 1JIIA 1FTNA 2IBMA 1S8AA 1JTVA 2O1SA 3KKLA 1SC3A 3OOHA 4MEAA 4TTTS 1VHLA 2P2ZA 4JYBA 4Q9LA 3RFCA 3V1TC 4BVBA 3AQIA 3H2IA 5THKA 1RLOA 1G41A 3WMGA 1D0VA 3KPVA 4JJ4A 4DLLA 3PI6A 3N58A 3QVGA 4FLMA 3BHJA 1UK7A 4WXHA 4EI2A 3KVVA 5JEDA 1M7GA 3NMUF 3MJRA 4I3FA 4EKEA 5I7VA 4KDRA 4LDAA 2WFLB 5DWQA 5FUYA 4OQEA 3RNOA 2HKIA 3C3PA 1P1HA 4I6EA 5COQA 2QN1A 5DP2A 1T5LA 5T64A 4LHYA 4EYQA 2GCOA 3EPPA 1M72A 1C2YA 1PE0A 1LLDA 1XQYA 1CERA 1VMIA 3VM6A 4IDNA 4DLNA 1IVNA 5FBKA 5DHQA 4KFSA 3CX7A 5J9FA 2AD5A 4GPEA 4J75A 5J5VA 4DA0A 2WD7A 2GK3A 3LUKA 4NMLA 4TLMB 2R00C 2Z5GA 3HXPA 3HXKA 4TPKA 1GL6A 2V4UA 1Q7TA 3T3EA 4C3ZA 2WFAA 1CUFA 1EA5A 4DWOA 1XDZA 1R50A 4F4FA 2HWYA 2ZRCA 3I2HA 2IHBA 3X2EA 4F60A 4D4JA 5BUZA 1QRTA 2FQYA 3UGKA 4L08A 3GFOA 4CEIB 4FJ0A 1G2PA 2QQFA 2VVTA 4BWYA 1WAMA 1OFUX 4RKEA 4B8YA 2Z9DA 3GFRA 3GAMA 4DQKA 4YJ3B 3CV3A 3L7AA 3ZJ4A 3ZCTA 4GI1A 2NUPA 2MYTA 3LH5A 3QKTA 1L5ZA 1VE6A 3L79A 5CU7A 3SJAA 3TMYA 4TWZA 3TXXA 4P0PB 1Z29A 4E21A 1DAOA 3QX8A 4WXYB 5DNAA 4OHBA 4J7CA 5A5DA 1DAFA 2HF8A 2AWNA 5C34B 3ICEA 3A1WA 5K3DA 1KWKA 1QNLA 3HGQA 1LA2A 4MW9A 3SBEA 4MRNA 4N0PA 3E1SA 4JBHA 5SYAA 1M33A 2A9JA 1NUSA 2ZB8A 4F71A 4KO4S 4H16A 1CZOA 4LZWA 3LO8A 3BD9A 4TWAA 1X86B 3TLXA 5FWXA 2P65A 1JDBC 4JDUA 3SC3A 5ICMA 4WBNB 2NSHA 1CUSA 4QO7A 4JV5B 3U7QA 3S7TA 4W8GA 5A02A 3UWPA 1Q14A 2D2EA 1L4KA 1EBBA 1DJQA 2FU5C 2ZRPA 4JJ7A 2IU3A 4IYJA 4WKNA 3M83A 4KSYA 1XRSB 2H08A 1QE0A 3HRHA 4QG3A 1QQAA 1GOTA 2A1TS 2G5GX 5F51A 3P0RA 3DZCA 1WPRA 4EYEA 1FW6A 1T0UA 2BC9A 2WP8J 3MOIA 1X8XA 3W9UA 2PGXA 1U7HA 3MWDA 2WY2D 3WKBA 1B23P 4ZD6A 2BRUA 2JA1A 3R6TA 1FFHA 1SBYA 2ZUVA 4NKRA 4NZ9A 3PHHA 3PB3A 4X3CA 2P2DA 3UPDA 5DRYA 1F2UB 2C2MA 3HUFA 2QE7D 4PX5A 1F7UA 3NC0C 4LOJA 4E7PA 1DC6A 4PLYA 2YQ5A 1Q0UA 1R37A 1LGYA 2EF0A 4PQEA 2Q4RA 1XMVA 1DOZA 1E6UA 3D2LA 3LPNA 3OLVA 1AK2A 2Y92A 1PTKA 2CFSA 3VAAA 2P0EA 2XWSA 4M4SA 4HWPA 2OCYC 2XMZA 2Q41A 2GFIA 5TXGA 4WW0A 3UHJA 3CONA 4PPGA 2AJ8A 4KEAA 1ENOA 5GAJA 4FI3F 4CN9A 1H42A 3L6EA 2L0XA 2B2CA 3FX2A 1UM9B 3AH8A 1PHRA 4WQMA 3FLMA 4HV4A 2RH5A 4J76A 4ASUD 1ZJ4A 4EW6A 5KVVA 4ZTUB 2DWOA 4E5VA 2ZP1A 1DJNA 1XP8A 2DERA 5K2MA 4N40A 1QH9A 1JDNA 2QBYA 1FUEA 3D4IA 3PEEA 4X54A 1C7IA 1J20A 4OJYA 1VLMA 2H7CA 5H59A 1KAEA 3T5PA 3TLGA 1KMMA 3QIVA 1Z25A 4FGJA 4HEQA 1WCXA 1XRMA 2CFOA 3CNOA 4KFTA 1V26A 4RY9A 4NOJA 3QQ5A 2QNIA 3CO0S 3ZJYA 5HWSA 2Q2WA 2UVDA 4ZI3A 3FZYA 3MGAA 5EUMA 4KREA 4CMGA 5BNFA 1GZ5A 2QDXA 4MICA 1Z82A 4REQA 4H15A 4DMRA 3PGLA 5ERYA 1ORTA 3OTWA 4OHOA 2G1PA 4N12A 2VYVA 1GSHA 3EGDB 2PM8A 1M76A 2WTMA 3IV7A 2Q1SA 5JAZA 3DEJA 2QSYA 2O0JA 3P9CA 5JSQA 4U5QA 1PL8A 1NVVQ 1W0KD 2ZJOA 3F6PA 3QUTA 4PPYA 2W4MA 3H04A 4RSRA 1PZEA 4EY5A 2HIGA 3QEMB 5GY7A 3CSSA 4FZ3A 3TUZC 2PIAA 4DSTA 1KZ9A 3Q8LA 3TCNA 1CY1A 2PH3A 2F48A 2JHCA 3AETB 5K0NA 4NBLA 2H1LA 4K81B 1OHHA 3OHPA 1MMFB 3TRFA 3ADOA 3ZNPA 1R5OA 4JMPA 4HX5A 2WHYA 4FDMA 1A7KA 3PFFA 4QASA 5DLDA 3U5ZB 1FLNA 2HQBA 4FTWA 2E89A 1MGOA 1RBMA 1V4BA 1PZFA 4L4UA 1ISJA 4YCJA 1QX4A 2ZIGA 4ECAA 4O1HA 4X20B 1CUIA 1MB3A 1E2LA 2QZPA 3C87A 3D7NA 3GFPA 4KR0A 4MV1A 3R7WA 3UUWA 2HR1A 2XCLA 3ZD8A 4N3GA 3PRYA 5ALGA 1P44A 3CJQA 4NE7A 2IHJA 5AJXA 3FB4A 1QPBA 1ZICA 4YYEA 2AJBA 1P8JA 1YRLA 4HO1X 3BDIA 4NU6A 2WMDA 3O4FA 4QGFA 5CRIA 1ONSA 2OCDA 5HG0A 1YFZA 1TQ2A 2IY9A 4TL7A 4HAYA 5AVTA 4GVPA 4OEHA 2ZSFA 1IIRA 2XRMA 2RGNC 4PZZA 4K9RA 5ALVA 3UWSA 3TX2A 5HQ3B 3ZYZA 2ASEA 1LTHR 2FMHA 1B1CA 2I3AA 3IDAA 3O9MA 5A9SB 4MMZB 1LFDB 1SQ6A 1ZZGA 2XWJI 1K98A 5EJ2A 2ZU0C 1ODKA 4ARBA 4F1KA 3CHYA 1YU9A 1CD5A 2H52A 1P77A 1L4LA 3VU3A 1R0SA 1V7PC 1VA4A 1Y3DE 3IMKA 2X4LA 4K2HA 4K88A 5CW2A 4GKVA 2XMCA 4N6OA 2PLNA 2QTTA 4HEHA 3GFGA 1XTKA 3CUVA 2WKRA 1RHQA 1S3GA 5KWSA 5G53C 1M6YA 2JVJA 4EMSA 4IG4A 3STUA 4RVSA 3KXKA 4DPLA 2XUOA 3V8MA 3I8XA 3SQWA 1E8NA 3ACDA 4YCBA 3D4NA 2ILVA 3ITNA 2ZYVX 2AWOA 4IWNA 4DQXA 2PEZA 3HG7A 1YKGA 1O89A 5AJHA 1MNQA 2BKEA 2ZJ3A 3ELUA 5DOVA 3DP7A 3VGPA 3WGVA 3WL5A 5GV8A 3D7KA 3RC3A 3WK7A 1GU7A 3BYZA 4PQRA 3EY9A 3HL4A 1KWGA 3KUKA 3ZWBA 1Z7YA 4KLNA 4ZOBA 2X77A 4TXMA 3KQKA 3NYIA 4XSVA 1IH8A 3I0ZA 4NYIQ 4PZPA 2WYVA 3MAGA 4KN5A 4JDPA 5LZ4A 4ZO6A 2UYGA 2VJMA 3LKZA 1OYYA 4GX1A 5CA0F 1LX6A 1ZRSA 3FFBA 1OB2A 2X1VA 4WCFA 1RXYA 1J6UA 5FR2A 3P9RA 4G84A 1THZA 2P4UA 1FMFA 1L3CA 3QFSA 2PGJA 4YO8A 1JFSA 4GLOA 5L3VA 1AQIA 3QX9A 4F96A 4PO1A 3FGZA 4BYMA 2O50A 2BGWA 1UBLS 5I9BA 5JSYA 1MP0A 3FDZA 2GBCA 5AKYA 2IV2X 1HEIA 3GLQA 4B3JA 4NBSA 1JJIA 4WZ6A 2ZUBA 2G0AA 5K0GA 5A62A 3DV0A 3MA0A 1UDCA 3G89A 4BIIA 2QYOA 2EP7A 3MB5A 3DBLA 3ZHBA 1RI5A 1HZZA 3PHIA 1H2ZA 4JCOA 5EWLA 1JEQA 4JR1A 5H68A 5DO9A 2D7JA 3NTRA 1G21B 4J4TA 4Z0NA 3R7FA 2P91A 4L6IA 5EKDA 1X13A 4AIRA 1NF2A 4DXHA 3VUFA 5J4HA 1PAUA 3IALA 4HPJB 5JNSA 1VG0B 3LP5A 5AK6A 4EHAA 3UMMA 5HJEA 1QZZA 1RACA 1EXWA 3EAFA 2RDMA 2AI3A 1LPNA 2OBLA 3AL3A 1ZGHA 3O4HA 4QICA 1N0IA 2VTEA 3KVRA 3OZ7A 4KYIB 4GIBA 4WL0A 2PGAA 1NN1A 3GBSA 5JPCA 1QYCA 5HF6A 1AGYA 1Y5MA 5EXDA 2RAVA 3SKVA 3MCTA 2ADOA 3FCCA 4L0QA 4O1IA 1TZMA 1E5VA 2OHFA 3NFYA 4UCQA 2HQ1A 3TTSA 2G6TA 3NWEA 1NUAA 1NMQA 2CBXA 5CNKA 1CE8A 3BSWA 5C80A 4P4NA 3LOPA 3UKDA 1BVUA 1VFPA 1BXGA 2O9JA 4RACA 1RHMA 5DGDA 4FS3A 4CLXA 3C6QA 2FP3A 3QG5A 3PNSA 2BUCA 4DJ5X 1M34B 3GGSA 5GP1A 2I65A 4ZAYA 2FMTA 3Q41A 4TLCA 3OJ0A 4KZPA 1Z34A