2P2DA

Crystal structure and allosteric regulation of the cytoplasmic escherichia coli l-asparaginase i
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
336
structure length
330
Chain Sequence
b'QKKSIYVAYTGGTIGMQRSEQGYIPVSGHLQRQLALMPEFHRPEMPDFTIHEYTPLMDSSDMTPEDWQHIAEDIKAHYDDYDGFVILHGTDTMAYTASALSFMLENLGKPVIVTGSQIPLAELRSDGQINLLNALYVAANYPINEVTLFFNNRLYRGNRTTKAHADGFDAFASPNLPPLLEAGIHIRRLNTPPAPHGEGELIVHPITPQPIGVVTIYPGISADVVRNFLRQPVKALILRSYGVGNAPQNKAFLQELQEASDRGIVVVNLTQCMSGKVNMNALAHAGVIGGADMTVEATLTKLHYLLSQELDTETIRKAMSQNLRGELTPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-ASPARAGINASE I
publication title Crystal Structure and Allosteric Regulation of the Cytoplasmic Escherichia colil-Asparaginase I
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 111
structure length 330
sequence length 336
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.1: Asparaginase.
pdb deposition date 2007-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00710 Asparaginase Asparaginase, N-terminal
A PF17763 Asparaginase_C Glutaminase/Asparaginase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.40 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2p2dA02
3.40.50.1170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold L-asparaginase, N-terminal domain 2p2dA01
1DJOA 4RA9A 4ECAA 1HG0A 3NTXA 3NXKA 1O7JA 4R8KA 5K4HA 5DNDA 1HFJA 1NNSA 1HFKA 4NJEA 1WLSA 5DNCA 4RA6A 3PGA1 4Q0MA 5DNEA 5I48A 2P2DA 2P2NA 5HW0A 1JJAA 4PGAA 5CBPA 1DJPA 5K3OA 1IHDA 2HLNA 1WNFA 1WSAA 4RA9B 1JSLA 2JK0A 5F52A 5I4BA 3ECAA 4R8LA 1HG1A 1HO3A 5I3ZA 1ZQ1A 5K45A 1HFWA 4NJEB 1JAZA 4RA6B 1JSRA 2HIMA 2WLTA 5K4GA 1ZCFA 2OCDA 2D6FA 2WT4A 2GVNA 5CBPB 1AGXA
chains in the Genus database with same CATH superfamily
3KXKA 1ST2A 4GRDA 2W70A 4ECAA 4C6TB 3HCOA 1BWPA 3JPYA 4B0OA 1GNTA 2O3TA 5CDGA 2OUKA 2QLMA 3AHCA 1OZFA 3GT3A 5AKJA 1CEEA 4O2AF 2WKQA 4Q4HB 2MMCA 3OG9A 1VXOA 5DZSA 2ZSDA 1OI4A 2ZYUX 2XIJA 4PLWA 3URMA 3BIOA 4U0KA 2GLUA 1KK2A 1NOKA 3Q7PA 1A5ZA 1TLFA 3SX4A 1YI1A 2ZBGA 2CNLA 4C07A 1AB5A 4X1IB 1YQ9A 2VBCA 3CLVA 5KOJA 2GBFA 3AF6A 3UMBA 2WM8A 4P7JA 3CEJA 4GSYA 2OSVA 3D1JA 3DR3A 4S35A 4EJMA 1V8OA 3CUSA 5I4CA 1T4CA 4KLRA 2ZIVB 1ND6A 2BT4A 2ZTUA 2I80A 1QUFA 5BW5A 1R4NA 4YRZA 5LZ4A 2QTLA 3EGDA 3RVMA 1Y1QA 1PR1A 1URPA 1W87A 2GLTA 5FNZA 3CCCA 3I6YA 1OC2A 3PNQA 3ZNNA 4F86A 3DHYA 4OMDA 3E9DA 2P9BA 4K9PA 4XWAA 1V26A 1R18A 2ATIA 3N7AA 2PE5A 3W2IA 1PQ4A 4GPIB 1C0EA 3L6OO 3K73O 3U26A 1DLIA 3S2ZA 4ZGGA 3HFRA 4C2AA 1GPDG 3VU9A 1P2FA 3QMMA 2WNSA 3AJAA 4EJSA 3N3AC 4G0UA 4FFOA 2JCVA 3FKSD 4IZIA 2CXQA 3C3XA 4UBIA 1WUJS 1VMEA 2VN8A 2X23A 4OUKX 3A4YA 4EHJA 4BNGA 5FTLA 1X7WA 4Q19A 5FA6A 3K2EA 4U7JA 2F67A 9LDTA 1A88A 1QG6A 1YDFA 2PKRA 2Y99A 4P7KA 5FEUA 2QRUA 1CRLA 1KOLA 4M0FA 2IZ6A 3CO0S 3CF0A 3OJ0A 1JDVA 1EVJA 4W5RA 2W43A 5AJZA 4B6SA 4C6RA 2A7XA 2BBSA 2JLAA 3K0CC 5GAJA 2ADOA 2A3NA 2I6SA 2YXEA 3SAJA 4OI0A 2D1RA 3QXJA 4RIFA 3SHWA 5AUOB 1U90A 1OLXB 1JN0A 1JU4A 1IJBA 2OQ2A 4R98A 5TQJA 2BFMA 2DHCA 3D4PA 2QG9A 4MR7A 4B80A 1E6EA 4JIMA 2AGVA 5J2TB 1TVCA 1JGTA 5EXSA 4DE5A 2VZEA 4LJLA 3X1ZA 4AMGA 4F4DA 4N7BA 1UK6A 4HUTA 5REQA 1SRRA 3FGOA 3DZBA 3H42B 3GRUA 3OLXA 1RLUA 4XDGA 1GQSA 1Y8CA 3BILA 3W1WA 2W5UA 4CU2A 2J6BA 3KS9A 2WWHA 1UPUA 1Z34A 1LBSA 1YDMA 3FMVA 5LMUB 4NS1A 1I30A 4BGDA 4H08A 1GCIA 1KY3A 1TF7A 1U0EA 1G8AA 2ZPAA 3MT0A 1FTWA 2UZAA 3KHUA 1BE1A 2AMYA 1JQKA 2VSOA 1TKBA 1W2HA 2YZ7A 3N3BC 2B0CA 5EINA 1EVEA 1S6YA 3TMAA 3IBTA 1IPEA 4ZVOA 3ASZA 2CJWA 1GN9A 4P4UA 3CURA 4DDUA 2WTMA 2QHXA 2JIPA 1FNBA 1XEAA 2R3SA 2NN3C 2M32A 1P8JA 3AF4A 1RC8A 1AZSC 2EX0A 1A7KA 1RRGA 4FHGA 1X3SA 2ZRNA 2CBXA 1FTYA 3L93A 4C29A 1P5HA 3T52A 1FU7A 3LC2O 4DG9A 1MVLA 4M1TA 4YUYA 1CUZA 3FG9A 4MHSA 3OD5A 3FSRA 4XD2A 4XGQA 1U9JA 4WJLA 2W2KA 1KO8A 4MYRA 5ITSA 1RHKA 1OSNA 4FNOA 2J48A 3IIJA 3DVQX 4KO4S 1I6WA 1KI4A 2XVXA 5AK6A 3FZGA 1E6UA 1XKLA 4V39A 5I7AA 1ZMRA 3RU7A 1F9AA 5ENZA 2IYYA 1II9A 3WQHA 3FN4A 1XR3A 2C03A 3TF5A 1VFNA 5CG2A 3I4CA 3FDFA 4B7AA 4TM8A 3ILHA 4IFIA 4RHTA 2I7DA 1LDNA 5K0EA 3KOUA 1MOQA 1ZNZA 3IHLA 3DEIA 3TFOA 4LS3A 3ND5A 1I3OA 1TIBA 2PLFA 3C48A 1XMXA 4TYMA 4MYUA 1I01A 2VQ6A 3D0KA 3F6YA 3T12A 3GLIE 3F78A 1YZYA 5B55A 4NBTA 5CEFA 2FEAA 4KH0A 2YYAA 3W34A 4AI6A 4DG5A 3S5JA 3H9JA 1F5NA 4ZPXA 2N42A 3CG0A 4XIJA 4C5AA 2BE9A 3TX2A 3CEPB 3UWPA 4DCOA 1V1MA 4RK0A 2ZUSA 5IVPA 4KTVE 1XRRA 2GS9A 2XT0A 4JDUA 1C9KA 1FX0A 1IDOA 1NG1A 1HQKA 2GHIA 1H8EA 1HFWA 5GVSA 1P2TA 3W8NA 3INNA 4L4UA 4MCHA 1Y3HA 4YRLA 5KI6A 1ZU5A 1E1RA 1SMKA 1HYQA 2XKBA 4JI0B 1BX1A 1VRWA 4KUHA 2POQX 2IHUA 1MX5A 3ON5A 3V32A 4X8LA 3QHQA 1T2DA 1EM8A 4X95A 2LVBA 3M8KA 4HNUA 1QCZA 2AN3A 4MULA 4IG4A 3RHFA 4PG8A 2ZSAA 4JCOA 2LKDA 1WMAA 1REQA 3T3PB 3NVDA 1FW8A 3PLNA 4GMFA 4Q01A 2IUUA 3ZJ5A 1JFSA 1BDMA 4D46A 1NSYA 1VP3A 3VJMA 4D9BA 1GA4A 1U2DC 1Z16A 3LG2A 5KQSA 3C3KA 1QK4A 3O2QB 5JXWA 3L46A 2QJFA 3EMKA 1QGDA 1DU4A 1FUKA 1ESMA 1Q3HA 1PG0A 1OWMA 2FW9A 3PFNA 4KQ1A 4MTCA 2IZ1A 1G4AE 2WKPA 1ACLA 4LSMA 1L5GB 3IUSA 3LLUA 3R3VA 2FQYA 4WJZA 3ITDA 4X8OA 5KYUA 4CLOA 2OBMA 5ALMA 1KMIY 3E48A 1EFPA 1PR6A 1E2BA 3OTQA 3NIWA 3OFND 2RHOA 3ZXIA 1NXSA 3KM0A 1CUHA 2FZGA 2OB2A 4U9IS 1DQNA 3BMCB 5DX0A 3BE5A 1Q74A 4ZCSA 4E5VA 1SY7A 1EKXA 4IQGA 1I14A 2EGUA 4BZWA 5IEJA 1VE3A 4U9HS 4YT4A 2QLLA 1IMJA 2XBMA 1U9ZA 1Q11A 3OU6A 2XX3A 4BRSA 2NLOA 2VKTA 1GPWB 1PJTA 4U2FA 4PZUA 5FL7D 2OXIA 3JYNA 1UBHS 4BEWA 1W0KA 1IIRA 2DQKA 2ZJ1A 1X1SA 3M0EA 1OPRA 3LD9A 4MYSA 3TXYA 1TT7A 1IN5A 5CXSA 4TQAA 4E51A 2TSYB 4ZD6A 3TFQA 2IYOA 2XYHA 4KXXA 1JSZA 4KLZA 1G7TA 4TL6A 2PS1A 4MARA 2PS3A 4BX8A 3OMXA 3LDUA 4FYPA 1S96A 3GXOA 4LY3A 2FK7A 4NY1A 4NABA 2H4YA 5B37A 1VSTA 4JP1A 4CYMA 1BOOA 2ZROA 4JLUA 1Q77A 2F1JA 1KRHA 4PLCA 3OCYA 1U1IA 1F7UA 1UBKS 1C29B 1L8LA 4CMHA 1IEVA 1IWPB 2I2BA 2R8XA 2ZJ6A 1ZD2P 3V8RA 5JCOC 2H16A 2WSBA 2A2ZA 2IQ5A 4Y67A 2JIRA 4Q4CA 4B7XA 2YMMA 1J23A 1X1CA 3QPAA 3SJZA 2H7CA 3LYUA 4RD4A 4WZBA 5FWYA 5JTUA 4AK9A 3KVNA 1SWWA 2IXBA 2VP6A 5K8JB 5HIIA 1KC3A 2WM2A 3TR6A 1V4BA 1AMOA 3TQRA 1NPDA 1QIGA 2XUGA 1C4XA 1EINA 2A9JA 2IW3A 3JD3A 4Z8YA 2V1UA 1QP4A 1KBOA 4NCAA 4O63O 2QR2A 3AM5A 3Q3VA 3T4PA 1BVHA 3BFVA 5HW0A 4DKJA 3EH1A 2BZGA 5DHFA 1RJGA 4X7PA 1L1RA 4XM1A 5EG5A 1QO0A 3DAFA 3RK4A 3VAYA 5JZMA 2XUHA 3KXIA 5F1OA 3H04A 3ILYA 3IEKA 4OATA 2GILA 3BFPA 3IESA 4FILA 2W11A 3WBFA 1JXQA 2X77A 1QO7A 3IDOA 1ENOA 4HPWA 1AO0A 4P08A 4R84A 4C05A 3ABRB 3TB6A 1K06A 1DADA 3GBSA 2C31A 2AYXA 2FUEA 5TF0A 4TVKA 4KPUB 2FW0A 5JJBA 2P9EA 4XQGA 3OZEA 3FWNA 3LUCA 4RH3A 2NSJA 1EK0A 1HT3A 4ILKA 2PUHA 3LY9A 2WP8J 5JFOA 3H65A 1YVEI 4URXR 1Z7GA 4JVOA 3TZCA 5B3JC 2UDPA 5ECDA 1BX0A 1DCMA 3VNAA 1WMSA 4HNSA 1QE3A 3RU2A 4W5WA 4ZEVA 2JLYA 1BIFA 3UJAA 5FLYA 4P4LA 3L84A 1ZN2A 3F1KA 5CLIA 2AOWA 2HPVA 1EBUA 1HKHA 3EVTA 4K46A 4UE6A 2ACKA 1V7ZA 1NUQA 4H60A 4UM7A 3BD9A 3K15A 4TTPA 5KVQA 3UAVA 421PA 1G8SA 4BNFA 2E6KA 1YONA 5KVCA 2IYVA 2ODBA 3B1JA 1QYIA 1ID1A 1XAHA 3U62A 4G4JA 4Q9DA 4LKRA 3KVRA 3WRXC 3C6KA 3GLIB 5ES4B 4RE5A 3ZHUA 4FGKA 1N4DA 1E1LA 1ZI8A 2PBLA 4LJ9A 2YXBA 1IBRA 4D8YA 4B3RB 3TNDA 3AVUA 4ND8B 4QGGA 1PJ8A 3DLCA 1QGAA 3GJSA 3B52X 3D3EA 3HJRA 4XB6B 3BXGA 5F2NA 5FAXA 2FJPA 5KQRA 2RGRA 4OV6B 2F55A 1UMKA 1F8YA 2NUPA 4IHAA 5HWSA 1I7DA 4KZPA 1DRJA 1OX4A 3EYWA 3SEFA 4Z7JA 3KB1A 1P1FA 4F97A 3O9MA 2RD2A 2QIOA 1XL0A 4YJ2B 1H8HD 4DZZA 3ZHVA 4OQ4A 1GL6A 4Q7EA 3WGLA 1EVZA 2JJ8A 1QTQA 1C81A 3CB2A 4EA7A 1TC2A 4G25A 1Z18A 5ALFA 1ODKA 3DZJA 3IBGA 4AZ3B 3OJEA 8ABPA 1NKTA 1U7HA 2HJRA 3KSUA 3DS8A 2XWQA 1Z7EA 3I8OA 3L01A 1VHJA 2QOEA 2QRPA 1N6NA 3IQFA 2ZU0C 1EP2B 4DEVA 3A32A 3KQLA 3GYBA 3U9SA 4JLKA 1A4UA 3KQSA 4GU5A 3UPDA 1EMDA 1FUYB 1LPOA 4MJ7A 3UJHA 5HIKA 5EUBA 1DHRA 2OM6A 3RJMA 1R6TA 3KAQA 2YWXA 5IUJC 1WF3A 3MM4A 2RHBA 1SQGA 3HR8A 3N70A 1ZIDA 3PHHA 3WQSB 5KOIA 1J0EA 4NCKA 2N47A 1XQWA 3K30A 3ML1A 4KAFA 5KHAA 3T1VA 5KVAA 1X3LA 3B1FA 4RLQA 2WABA 5F78A 4KQWA 5IDWA 4Q4JB 4GVXA 1KK1A 4HNHA 3ZBTA 3ST7A 3LIPA 3SJBA 1HNWB 3RYHA 3DJFA 5AQ1A 1SQ5A 4TTAA 1DCFA 2AL7A 4H18A 3OTHA 4CUZA 2XXAB 5IKEA 4F4UA 2PJUA 3MC1A 4I14A 4QYSA 3T4XA 4AJ4A 4E94A 1Y3IA 5I9SA 2NZJA 4UFPA 5JH7B 3GX1A 3AWDA 2BGWA 2WY2D 3V00A 5K8VA 4RBNA 3WWCA 4DR3B 5F73A 4KR2A 4ZIRA 4PYMA 1JEDA 4G3XA 5BUSA 2B7BA 4DC1A 2J07A 4PCVA 4UCWA 4XYLA 3UICA 1TO2E 2OA0A 4C3OB 2DYKA 2HK6A 2Z43A 1NU8A 3ETEA 2HMYB 4R4JA 5L3QB 1HOXA 1XP5A 1RI2A 4NDAA 1QZZA 4UUMA 3RGWS 2HQOA 4QPNA 3I8XA 2NP7A 4JXJA 4WJKB 1OZAA 2BEVA 2FNAA 2H1CA 4QJBA 2WC1A 3PQDA 4BP1A 2K7ZA 4DXHA 1JIUA 3IB6A 3HZRA 4OHOA 1GCAA 4M7OA 2G36A 3DO8A 3EXEA 3W5AA 4FNMA 1SHTX 1O95A 2QJOA 3BS4A 3II6X 5U1PA 2V4MA 3TTUA 3TJZA 1QKKA 3MCWA 3I9V1 4FGSA 4S2UA 1RQNA 2P68A 5EXEA 6NULA 1CUGA 1IZ7A 1B73A 4BMDA 1MRNA 2IPOA 2HREA 2PUTA 4WN9A 3AP2A 4YAKA 1SNYA 1SB9A 4Z86A 1INLA 1D5WA 3L7LA 4B84A 1WR8A 2EFGA 1M8PA 4XDHA 1KMCA 3HB7A 1RRKA 4Q37A 2GKGA 2IYZA 1F8XA 1Z62A 3WJ7A 2JFFA 4QFBA 1A8IA 3E23A 3MLBA 3QV2A 2PR7A 3PHJA 5HQ3B 3EGVA 4EBBA 4PCUA 4IGAA 3UCFA 4EGJA 4IIBA 1Z3CA 4AIRA 4EJ2A 1TD1A 1R9NA 1JLLB 4ESVA 4X3PA 1M74A 2NZYA 3P9PA 4AMYA 1X1EA 2QAJA 3CFYA 3KX2A 1HTTA 2GEBA 2Q0SA 3H2SA 3LX5A 1MB9A 2FMKA 3ONEA 4HH3C 3MGCA 5JECA 4ZVQA 4CGYA 3ONDA 2UUCB 1BN6A 2OV2A 4PYLA 4U3JA 3RC7A 3ANLA 2BFCA 1ULBA 1JZTA 4PCLA 1PGOA 1OU4A 2FPPA 2X86A 4Y2GA 3R7LA 2CLDX 1V7QA 3EXHC 3MK31 4Q9HA 1TYAE 3PGLA 2PCLA 1TGVA 3RSFA 1U0RA 4MWCA 2VTBA 3HO8A 3R41A 2D0DA 4Z1MA 2XD4A 3HSKA 5FPQA 2VTDA 3LKZA 3LVQE 1FP6A 2C4TA 1JT9A 4YQZA 2BUBA 3HCAA 3HKCB 1EK5A 3LXUX 3MUFA 4EO4A 1GDHA 1WTAA 2QDXA 1TM2A 4I08A 4Y6LA 3T3GA 4BQIA 1NW7A 4P7GA 5KWSA 4MVYA 1JYEA 1NF2A 5AVJA 1XEXB 5BOSB 4IICA 2FQXA 4P5DA 2OHFA 1RMYA 2A92A 2E5FA 3F3KA 3GB9A 1MUUA 1JDZA 3TRHA 3TL3A 5AFSA 1ZRHA 4WI1A 3F6BX 1O4WA 1W1UA 3BMQA 1M1YA 5DGTA 4K7JA 4Z0TA 4TRRA 4R8KA 3PFBA 4LFBB 1N1DA 2B0JA 1GU7A 2FOIA 2BGGA 2CE7A 3MHPA 4I3GA 1H94A 1NMQA 1UXIA 1KAMA 2XTNA 2PT5A 4O4LA 2OBNA 4BVFA 3L1HA 3U16A 5C9ZA 3MGKA 5BY2A 3PT5A 4CF7A 2HO4A 2J30A 5E2IA 2VF2A 1MOPA 1WEKA 1ZI6A 4IINA 2LE0A 5GVRA 1RKVA 1HQCA 4U9UA 5B1IA 3VH4A 3SC2A 3ZE9A 5KC8A 2OGZA 3NIFB 1ZRMA 1FSZA 3OX4A 4UMFA 1EWYA 3RQIA 4ARZA 3F9CA 3T0GA 2GM4A 1EUCB 1SZPA 2IWHA 4RVGA 3STVA 1ZA1A 3HYRA 1B7GO 2Y1DA 2B8JA 1FDTA 4KE7A 4F1WA 4HHEA 4IP0A 3EWSA 3KB6A 2V0CA 4PNEA 8AT1A 1M54A 2ZJBA 1SHLA 2PH7A 2QENA 3HY3A 5D5HA 3ZV7A 2DY1A 2J9XB 4MITA 5ER6A 1JR3A 1QGUB 4FNAA 4BE7B 3V8PA 3AXSA 4JLSA 3UUGA 1U99A 3OKPA 3NTVA 3L18A 5CM8B 4UEJA 2A9OA 3L07A 1ZLYA 1JEEA 4I99A 1NJGA 4O2BB 4OA8A 3HKDA 3X1YA 5LQAA 3GF4A 4HEA1 5CDTA 4MW0A 2V6JA 4P7BA 4KQHA 1LDMA 4NZOA 3ZCQA 2QYHA 1T5IA 5ESRA 2IYPA 2WPNA 1KJYA 1Y9EA 2WF5A 3JQQA 1WE2A 2FH5B 4ALKA 1ODIA 1JF8A 4ZQEA 4REQB 1VG8A 2JGIA 2Z9DA 3HWSA 3T99A 5LZ8A 4C88A 4J2TA 3DBLB 4C6SA 1N2HA 4NECA 2ZAMA 3W7AA 3ESQA 1JU3A 1QGZA 2MSWA 1PYOA 4RIHA 5EGNA 5TPZA 3ZE7A 1YMQA 3CIFA 1KSHA 1PS0A 2RHGB 1MLDA 2YTZA 4DQ0A 2PUFA 2CVPA 3DLPX 1ZJ4A 3OIUA 3OPVA 5FNVA 2I3AA 3JTEA 3NHYA 1Z2EA 2JFGA 3MUEA 3G9ZA 1SOVA 2R7MA 2ZT8A 3FUTA 3MAJA 1Q20A 4JI2B 4HGPA 3RAFC 3ANTA 4PNPA 5JSKA 4MW4A 5D6NA 4ZHSA 2B35A 5EE1A 3OCVA 5DYNA 3EXG2 4F1JA 2ZI4A 2VHWA 3UC5A 3MLEA 3K0BA 1JTVA 3NKVA 2XZDA 1CY7A 4DCUA 4L4XA 5KNDD 3QW2A 4Q7LA 2JDID 2MSEB 3ER8A 2JFNA 4EY3A 1E9AA 3DKKA 3EJWA 5KSYA 3AVYA 3VXKA 3ICVA 2PZ8A 4EYKA 2Z3ZA 3TDMA 4KAAA 5TT0A 4BJHB 3E05A 3O92A 3P0IA 1ESCA 2G08A 3AG5A 4Y1FA 4AUNA 3CUUA 5KTPA 5F2OA 4F0JA 4LMBA 4MWBA 2XUKA 4P3OA 3IMGA 3EFOA 4FMCB 5IN5A 4E31A 2ZT7A 1XVIA 3CJRA 1GPKA 3NJRA 3Q7QA 4O4LF 4RTOA 1Q7RA 4MH0R 1ORIA 4CM4B 1B8OA 4POOA 4UULA 2WSIA 1UM9B 1E6CA 1XVVA 4JLOA 1CJKC 1V2GA 3HFSA 3BG5A 2QU7A 4MIKA 3IUJA 4YCDA 3A9SA 1CIVA 4KXQA 2F1HA 1D2EA 3RRMA 3VDNB 3RADC 4XWGA 1Y0BA 2P67A 3RRYA 1A2BA 1M2VA 1DJLA 6Q21A 3R40A 2Z04A 1RAEA 3LVFO 1VJ5A 2ECPA 2UVPB 3BRQA 2Q50A 2AZMA 3SQLA 2A1TR 2V5VA 3UB2A 3VZCA 4BUZA 4BFCA 3BHNA 3P4UA 5AVZA 2QS9A 1RWBA 3CVOA 2YFHA 4DSUA 2FSPA 4HSEA 8ATCA 5JC1A 2QSZA 5IEBA 5E7IA 4CN8A 3SXUB 4OJMX 1AVTA 4O2LA 4WCFC 1KEPA 3EUAA 5DEOA 3UGKA 2RGEA 2BFNA 5IXJA 3RR2A 5IC6A 3GZ4A 3WLEA 4U6NA 2ZWIA 3DTTA 3LQFA 3H2IA 1NM5A 2R8PA 2CZQA 5F3WB 4WZAA 4ZZ0A 1JEQA 2EXXA 2FUCA 3KPYA 4M76B 4KE6A 1JA0A 5L4LA 1SA0A 1Z74A 2KLBA 4S1VA 5EHZA 5AXCA 1S0UA 1DAPA 3WRYA 3NDJA 2PGOA 5EVCA 2AEMA 3HJTA 3NCHA 4TKVB 4ZI5A 4B47A 4CNBA 4OD0A 2F8TA 2PVPA 2REQA 2YVAA 3DCIA 1DOAA 2YHUA 2ZQYA 3ZDDA 1VIDA 2RGNC 5IN4A 5AKHA 3H1PA 3AEUB 3SYNA 1DKLA 5JQGA 1GZ6A 4Y0NA 2ZWAA 3INYA 3K0AA 4I1YA 3BB3A 5EMJA 4NTZA 4DY6A 1ANKA 3OKFA 4PVDA 2DSNA 3TLXA 2EDCA 4CIBA 4A15A 4JQOA 3OOJA 3EASA 4AW9A 2IX3A 3MELA 5BW8A 3FCAA 4G63A 1VE1A 4QYTA 4CEHA 3GGDA 4ZPJA 1DRKA 1NBOA 3DAPA 5G4LA 3RABA 3GA5A 3LLMA 1PWXA 1JE1A 1PD0A 2JGDA 3IHWA 3MWYW 1IOWA 5FNVF 1QG2A 2SNIE 3ZKWA 2FN9A 1T0UA 1YZKA 5E0OA 4AJNA 2DR2A 4DA0A 3QVJA 3V1MA 3HJAA 4JMPA 4PZCA 2V7QA 4YP9A 4OGFA 3SSNA 2A88A 3O31A 1BJKA 4NE9A 4R69A 4ZZ2A 1KDPA 3UG7A 2NUTB 3EXHB 2CXRA 1CY0A 1QSGA 3K4PA 5CYOA 5F52A 2GO1A 5FBWB 4A16A 1FNDA 3QWIA 4RTJA 5D7BA 5T4FA 1U8FO 5CCEA 1PI3A 3ENQA 2XLCA 4HDMB 4B3SB 2O5CA 3PUJA 2ZR9A 3PUKA 1WVGA 2JCGA 3RBAA 1VBFA 5EKXA 3OT1B 4BP3A 3GFOA 1TQDA 1QYVA 4DDMA 2XQVA 1SVMA 1Z2AA 3AC0A 3FGNA 5FAKA 4KI0A 4ISBA 4DJDC 4UC0A 4HX5A 5TF4A 3D6MA 1D8TA 1F17A 4WFJA 3AP1A 1KY2A 2E7ZA 2SBTA 3ZXXA 3VX3A 4F4FA 4W5QA 1N6RA 2IY9A 1YBVA 3FXAA 3O8LA 2Y9MB 1DCKA 3B3GA 3DW1X 3EJ6A 5L3SA 1RRPA 3PT9A 3GROA 1Q83A 4L72A 1O57A 2C5SA 1Y1PA 3DE4X 4QPCA 5BQXA 1XZGA 4M9CA 3WADA 1XEWX 2ZFUA 4FHZA 2Y8EA 2H52A 4R8SA 3FWYA 3RTGA 2P2YA 4X6LA 1JMYA 1QHIA 3HB0A 1M34A 2Z3WA 1A8HA 4GAEA 1M73E 3W6ZA 3EQZA 3ZY4A 3GXBA 1ETUA 3COSA 1E2PA 4BMXA 1E9VA 2QMHA 5EJ4A 1BEZA 4ZV4A 2RHTA 4F1KA 4G8JA 2BE7A 1DSSG 1GKIA 1TZBA 3GYGA 4MRPA 4AYWA 3H1EA 3LHIA 3WY9A 5LYJB 3TMYA 2AW5A 2VXOA 1DBWA 2ZUDA 4PN7A 4LF7B 2WFLB 1NVFA 1QRDA 5AW4A 3K9WA 3CZMA 5K0ZA 1SHUX 1QK5A 4OB6A 1L5LA 1JQAA 4IUYA 1EESA 1G59A 1IM2A 5JXIA 1XN4A 3W0LB 3L77A 3GFTA 4OI1A 5FTMA 2YMLA 2BGLA 2JHFA 2OYSA 4DWWA 2B34A 3JYPA 3Q8KA 1QRUA 3PEVA 4B2YA 4WRRA 2QRVB 2WD7A 1M7GA 4MGIR 5H16A 1W4ZA 2FR0A 5T4BA 3STWA 3TLZA 1YK1A 4V1CA 1AS3A 5B6JA 2PFGA 3CRZA 4FLFA 5G4KB 2G6BA 5KCMA 3UUWA 3ZVMA 2QSUA 4QQNA 3G79A 4EG3A 1Z29A 4E4RA 4BMSA 1ZN7A 4RORA 2H8GA 1ZIYA 2PD6A 2FR8A 4YMTA 2WDPA 3ASVA 1DWQA 1HC7A 3U13A 5EZYB 2FPRA 3L1JA 3JD2A 1YDWA 1QANA 2FJUA 5SYMA 3UY4A 4RXTA 4EK9A 2NPIA 1DC5A 1Y6ZA 4Y98A 2QE7A 3HV2A 2XDAA 3D6FA 3DBIA 2OMEA 1V16B 2YWDA 3D81A 2VP5A 2ZI5A 5DOZA 1NRIA 1QR2A 4N0DA 3G89A 4JLDA 4RLFA 2P0EA 3DPIA 2CJPA 5GY7A 3NO4A 1JDTA 5A9TA 1M2HA 4FBLA 2QSYA 3IILA 1G18A 3B2NA 2HSEA 4BE9A 2XCSB 2GEUA 3BXHA 1DG3A 3A26A 3F49S 3G2KA 1Q21A 3L6DA 1O2DA 3OF2A 2WLTA 3EA4A 3QY0A 1GG9A 4DLUA 1NJFA 3G0GA 4GX0A 4PAGA 4AB1A 2IDMA 1YMUA 3IA7A 4HDRB 1AZWA 1JVBA 1D6MA 2VOJA 1D4ZA 2YOGA 2ZR0A 3GO4A 3L7AA 5CK5A 3V1YA 2O54A 1YNOA 4QGHA 1RJEA 2H7YA 2QTMA 2P62A 3F67A 2W7TA 3REQA 1ZW6A 5C8YA 1KJNA 5DM2A 3WV4A 2OCGA 1RXUA 2DERA 1BXRB 2B7CA 5EJIA 5AKKA 1QM5A 1KL7A 1DG1G 2AFIA 4G26A 3HXOA 4QTUB 4Q03A 4GC9A 3PDIB 3C24A 2J46A 2OGSA 2OZKA 4QWMA 1R9JA 4JX8A 3B9PA 1X8LA 2W98A 1MV8A 1Y6RA 3M34A 5JZBA 3RS7A 5JYEA 2OE2A 4U8HA 5M3BA 3OSZA 3TW0A 1R4ZA 3A05A 4IIEA 3HJFA 1ILEA 4CFSA 4Q15A 5AJVB 3WLRA 1BRMA 4AYXA 1UBNA 1W34A 3L40A 1KI6B 3LRTA 1GNRA 3A4NA 4Y0AA 3WI7A 1RHMA 4MA4A 1Y4SA 2NSYA 1XROA 2HHJA 4Q0MA 2BTOA 5CD1A 4KFRA 3C39A 1GHTA 1TVKB 3TPFA 2Q1YA 5FPPA 2OG1A 1CSEE 1VKHA 5DIFA 5LB4A 3U3DA 1R5OA 1RCFA 2AN5A 4ARVA 2PX6A 4GR5A 2DPLA 3ETJA 3ROFA 5LYYA 3EGOA 3IVAA 1P0IA 3S68A 4BV3A 4KR3A 3NYWA 1ZRNA 3TCKA 1GTVA 3ORHA 3RRZA 5EPOA 3QRWA 3TUIC 1C7RA 2YHSA 3A4LA 3P9CA 4RMIA 3WXBA 1T35A 1J9ZA 2FXIA 2JGRA 2A3RA 2EV9A 3DL2A 3OPMA 1MW9X 1TCVA 2WTUA 2EU8A 2OOKA 1D7OA 4LYEA 1C7ZA 1A8PA 1E66A 1EX9A 3DFFA 1W6UA 4ARIA 1G4UR 2XIQA 4G36A 5DNCA 1CX9B 4GKAA 4MYCA 1GRVA 3R0IA 3PF9A 3QEMA 5L95A 1WTCA 3D7LA 3W9SA 2PZFA 4TTQA 2Q2VA 1KNQA 1TAQA 1K5HA 2DQZA 5F7OA 3T9BA 1GPNA 2X8BA 3AK4A 4HNAB 3MGAA 2Q6OA 1E3IA 1JH9A 3T4EA 3PR3A 1G38A 4H0NA 3KQWA 4JX9A 3X2SA 4BO9A 4EENA 4Y6RA 1L0BA 1UM8A 2D5CA 4RA6B 5KYYB 3J7AC 3OZRA 3ZZNA 3TLKA 1ZDMA 3W2TA 3WK7A 3LW8A 3HMQA 3HHPA 3TZKA 4CBVA 2MTBA 4Z53A 1DDIA 4AM8A 2ZITA 2VQFB 3NUGA 3BGWA 2G4VA 4CQLA 3FR8A 1SC9A 2JLVA 3DMHA 1T1EA 3TK1A 2HF2A 1WG8A 2JJ2A 4R8VA 1U9IC 1ES9A 1XMPA 2J4CA 3SCZA 1KDRA 2AMFA 3QVVA 2QZJA 2C4HA 3U7GA 3ZHOA 1E6MA 3DB1A 4DVGA 3KV3O 1EDZA 1X9GA 1AN0A 5JATA 1BMTA 2W4MA 2A7QA 2V55B 3LU1A 2PMCA 2ZYAA 1V8DA 3UJCA 1KMQA 4QYWA 4WD3A 3VPFA 2Q0HA 1MMFB 4WBNA 4Z4CA 1G6KA 3GK3A 2G70A 4FUTA 5CVVA 3KKMA 3HGMA 4B3MB 1G8YA 1NQUA 1UXHA 2JAWA 2OL4A 4BUJA 5D85A 5EJ5A 3AR5A 1IJFA 3IXQA 4LVCA 3G2IA 1XV5A 2X9VA 2CZCA 2GBCA 1VB5A 1WY7A 1WSDA 3KT3A 1HYHA 1YAJA 5DNVA 2JH3A 1K7SN 2DE0X 2GAFA 3AUUA 4FINA 5B6IA 2ZIZA 4CKEB 2OBYA 1IU9A 2O2YA 1GPJA 3F9RA 3GJQA 3D0OA 1CE8B 4NMMA 5EVJA 2Z58A 4NQZA 1YKSA 3RIHA 4BFTA 4D8UA 4A92A 4HNVA 3C5HA 4JI8B 1YZGA 3CISA 2X1VA 2OP1A 3E6AA 2OAGA 4UTXA 1AUPA 2AX4A 4ZAFA 3F4BA 4L76A 1DDOA 3I73A 3NG1A 4LECA 4ALJA 3ZV6A 5DWDA 4LIPD 4RD1A 1GDTA 1RBQA 1U65A 2X2OA 4DBLC 1LJLA 2IYRA 1TT5A 4D99A 5C5DA 2OHVA 1IK6A 2IHYA 1DX9A 3ENNA 5TVKA 2W42A 2AOUA 1F0YA 1AUQA 1Q84A 4B31A 2HWYA 3QJYA 3WHKA 5DTJA 2ZETA 5A5GA 2Z2JA 5I9LA 5JO0A 3PXUA 3UK0A 3V33A 3TI9A 5E9WA 4LWPA 3RTAA 1CFJA 3KPWA 4QPJC 5C53B 2EP8A 5IUKC 1JIVA 2P7HA 3OU7A 3NWEA 4LRWA 5DGCA 4BDTA 1GV0A 2UZ4A 3RWOA 1OHHD 1CT9A 3DEAA 3PFHA 3LTNC 4FN4A 3U5TA 1IRIA 2Y4OA 1KYVA 3QQPA 4UE3S 4XIYA 4LG1A 4DLVA 1WY5A 2IS1A 2L19A 4MCAA 5T41A 1YS6A 1TUBA 1GL7A 1XD9A 3MT8A 3OHPA 4I5EA 3UB3A 2O3QA 4GPTA 3W2GA 4E5YA 5IU6A 5JV5A 2WZQA 4L73A 2NTNA 4JSRA 3UJ6A 3V1KA 3B78A 3LDGA 4MQFA 3ZU4A 5ADHA 1SXHA 1CNEA 4NYMQ 3PEYA 3EDQA 5BRAA 2Q0QA 5TIIA 4KXVA 4GZ3A 2PS9A 1BXGB 1DDGA 3PHGA 1KRWA 1GCUA 1QR6A 1S3SA 2TMDA 5LNK1 3H0KA 4DBLE 4TKZA 2H48A 3E03A 1N2BA 2ZE5A 5F98A 1E8MA 2PZMA 1ZYUA 1QIJA 2FX2A 5UKDA 2ZAYA 3VZPA 3KHKA 1MFZA 3IKVA 4M2LA 2WTAA 2YUTA 3E3MA 4MKFA 2B1IA 3CW2A 3RUIA 1ILWA 4LDZA 2ZB4A 3PIIA 3E4DA 3WKCA 4EY4A 5HF9A 3U19A 1U80A 1M0WA 2Q6IA 3NWPA 4W5JA 1E9FA 1EAMA 1K1EA 2YW2A 2HM7A 1QH9A 1KZ1A 2O5RA 3IP9A 5JCPA 2P6UA 4EPTA 2A1UA 1H3FA 3VJKA 3SBEA 3CLTC 1XXHE 2L2QA 4KIJA 4EGAA 1NBMA 1WXEA 1ZK3A 2PM8A 4PWZA 1PT9A 1P44A 5DSZA 3L92A 4D3ZA 4DXAA 5IHXA 2ZXUA 1TM7E 5BN4A 1P2SA 4B7CA 3GLGE 4TTJA 3UGTA 4WBNF 1TTTA 4CLHA 3DOFA 3PNBA 3LCRA 4A3SA 4K87A 2MDTA 4EYGA 3GA0A 3LY8A 3U4IA 1A7JA 1YR9A 4P4GA 4EB6A 1GTG1 3D1VA 2C0CA 4WHMA 4ZGWA 1M6NA 1NATA 3DZHA 3EUFA 3MT9A 4GXRA 1TD9A 4YA6A 4LDNA 5CXUA 5KNCH 3ZDBA 1F5SA 1V1RB 2DPMA 4I4IA 4MZXA 1MABA 1TECE 1WDKA 2QTNA 2W2LA 3KU1A 4OLHA 5I7FA 2VHVA 3UJNA 4IIUA 4DV0B 4DNQA 2FWMX 2VLIA 2BKVA 4FOTA 3QLVC 2BUAA 1EB9A 3LO8A 3HA2A 3B1KA 3N8HA 5SZIA 2O1SA 1NQAO 4KAJA 2C3MA 4DLNA 4B3GA 1XZMA 4QDOA 4ARSA 2GF2A 4BLSA 1ULZA 5GZ6A 4KGXA 3PB3A 4DR2B 1SUFA 1AHIA 1LZLA 1FRNA 2Z3VA 2FMUA 3E7XA 2RONA 4RAQA 2BGIA 2ISQA 2P69A 1N25A 3PU6A 1J25A 4QT0A 4RX1A 2X8AA 5AM3A 3ZQJA 1LDYA 4N3BA 5T8KC 1U7OA 2NX2A 3JWJA 2ILTA 3NIDB 4OQZA 4EECA 3PQ5A 2GNPA 3TR5A 1B8UA 3NCTA 4RZSA 1NR7A 3E0QA 1UKYA 2E85A 3OM0A 1UPAA 3IUNA 2V3CC 2OXFA 4WCVA 5JR3A 2GCPA 3K2BA 5LXTB 2ES4A 1RQGA 2H4JA 2B61A 4MVJP 3RYCB 3CRRA 3CNQS 4FFSA 4N8DA 3TLBA 4X00A 3KEGA 1K66A 1E9EA 4RLHA 2HHCA 4XGRA 3DL7A 3D2AA 3FUWA 5HQJA 5JROA 1P3DA 1ML4A 1V5FA 2SCUA 2V8OA 5IWCA 1WZNA 2EC5A 3QM1A 1AO3A 3SDBA 2QJRA 3IQIX 3CRVA 1GR0A 3V6LA 1PSZA 4A27A 3FKSA 4NK5A 2VZ8A 5TQ0B 2ZUTA 1X7YA 3C2QA 4OTZA 4P4SB 3VR4D 4YCMA 1DGQA 3U4DA 3OZGA 3GY0A 3Q3HA 5AI9A 2EL9A 4YLEA 4MRMA 4O6VA 2L0XA 3PITA 2ZRIA 4BNZA 2MU1A 3MBIA 3KZXA 3FMGA 4V0QA 3TTXA 1PW5A 4N6NA 4LYFA 1L1EA 1EZ1A 4MQBA 3C7KA 2XUDA 4F21A 3RS9A 1N5RA 2C7VA 2OV8A 3TW6A 2O8VA 2QZSA 3KFLA 3RB8A 3KQPA 1S8NA 2GR9A 1L7DA 1T9HA 2X3UA 5K8IA 1TQ2A 1POWA 2J9FB 2NPOA 4BFWA 1ZD3A 3TLEA 1Q2XA 4IG9A 3MNFA 5BWBA 2VHEA 1MD9A 3R7NA 1Y6QA 1BD3A 4NEGA 1QG4A 2QEQA 3WIEA 2VRCD 1Y5MA 4KN9S 4PONA 3ADDA 1UJNA 4C04A 3PQ6A 2DBRA 4JU8A 4LTMA 4EHBA 4CR7A 1A2OA 1TQHA 1CR1A 1WCIA 2AG0A 4EGSA 2GD1O 1ZBQA 1E1CA 4YRFA 4PFKA 5K1ZA 3ZW9A 4HH4A 2JJ1D 2WJVA 4WGGA 3K5WA 5JC8A 4MV5A 3LT1A 1RYYA 1LI5A 1B00A 2RHWA 3E58A 3NP7A 4BE4A 5L3VA 4P86A 4YJFA 2ZQ5A 3WLPA 2DZDA 4W9RA 1A2QA 3A1VA 1RMQA 4CDNA 1MPTA 3JQ7B 1AT1A 4GP9A 1J5EB 3WL4A 1WXFA 1X1QA 1EI9A 1ZA2A 2OGTA 1OOEA 4NWIA 5HCNA 3VHRA 1GUYA 1T15A 2ROQA 3UHPA 1RQLA 5JASA 1PYDA 1X1AA 1Y9JA 4EB0A 4EKGA 5LLSA 5KYKA 5MHTA 3AT1A 3N8GA 2C88A 4UTOA 1M2NA 5JNTA 4BKOA 5T57A 4A9AA 3I58A 2XVYA 2AKEA 1KVTA 2P9ZA 3MTEA 4MPDA 4PXAA 2ZRDA 2ZT5A 4ZOEA 3B7PA 3VFDA 3R8CA 1OPXA 5HJEA 2QRQA 4XX0A 1GO2A 8OHMA 4EHFA 3S70A 3ZI4A 4RCVA 4BCBA 1OGIA 2AIRA 5HF8A 1ODTC 2W6OA 2Y1FA 3G2JA 4CDGA 1WXWA 3F3MA 4E30A 2OCXA 2X40A 3GGJA 2FPIB 4RY9A 1KO5A 1S4MA 4JBHA 3WLSA 4FDVA 2XGGA 4EY7A 2WOJA 4YJ3A 3MAGA 4EZEA 4RC9A 3ZHTA 3MCTA 2CVOA 1L4FA 2OAQ1 3EZ9A 3GHYA 3OZAA 4F3TA 4XVQA 5ALYA 3SXPA 2XE7A 3IQGX 1FJ2A 4RMJA 2FP3A 2F62A 3PLRA 1FLAA 4K3UA 2ERCA 5IM4F 1BVUA 2YR0A 4O2RA 4XLZA 4P81A 4I4TB 2R1TA 4H3VA 4OQEA 4A5SA 4BBPA 4KWCA 3MD9A 4UHHA 4HMQA 2JFWA 5AIBA 3SQWA 1SXPA 5CDFA 1P1HA 3V8MA 2QVXX 4R2HA 1XXHB 2AI3A 1H2XA 3CYFA 3T1TA 4EUHA 1UBTS 4TYYA 1RWOA 2C1XA 4FYMA 1N6OA 3C41J 3WJ2A 1OIWA 5FF9A 3GLGB 2YNMC 1M7HA 4LMRA 5EE9A 2CZGA 3IUBA 2PCJA 2AZXA 2D2IA 1AQUA 3L1KA 3RM3A 4ZVKA 2NO6A 5T4EA 1YDGA 1BFUA 1ZESA 4YS6A 3T3HA 3ZWXA 5IDXA 2XRYA 5JE8A 4BP9A 3EHDA 3QKWA 4AAYA 1FXSA 1FVOA 3ICCA 4G0WA 1RJDA 2FETA 2GYVA 4WLUA 4PTLA 4RV9A 5CEJA 2QLNA 3KDSE 4QEZA 1BWQA 1MC5A 1A5AB 2IV3A 1X74A 4L0MA 3H97A 4GVPA 4RO0A 1B43A 1E2QA 2PMWB 3KJQA 1JQ3A 1USUA 1G0OA 1W8DA 2ZCVA 4URHA 4DS3A 2ZULA 4NE7A 5D86A 2ZRGA 4BU1A 1AC5A 1BJTA 3NC4A 4MAFA 2IBTA 3EEOA 1U0BB 5A3RA 5BNIA 1SBNE 4V0SA 1KS2A 3U37A 1VXRA 1RAGA 1PEKE 2HU8A 2JGJA 2PWPA 3ITNA 3ND8A 3GEBA 1F4VA 1PG5A 1DQYA 2V54A 3PSHA 2BMVA 3R7SA 1SCUB 5DRYA 4BC0A 2G4CA 3TQOA 4NFLA 3RVNA 2ENUA 2GZHA 1FA9A 4Q5IA 2VPIA 3Q5DA 2O0KA 1RYZA 3AY6A 1NE2A 2ZWPA 3RFVA 3HU2A 3AL0C 3LVBA 3ICEA 2GPSA 1PT5A 1X38A 2WHPA 2J3MA 1YJAA 1E2GA 1U5BB 1ZITA 4JNCA 4FONA 3AETA 5C1IA 3PTAA 1JAIA 1I5OA 1VL2A 1HDYA 1YQGA 1TM5E 1GAEO 1RM3A 2C0PA 2G80A 3I8SA 4LQLA 2WQ6A 2O8BA 2I4TA 4JOBA 1O0SA 1IONA 1N3IA 1XMSA 3WA6A 5A0FA 5CA1A 4K9RA 3G0OA 2HFKA 4IDEA 4PNHA 2PRKA 1DP4A 3V9PA 2JD0A 1GGVA 2VHQA 4C5BA 2IPLA 3C8HA 4EX6A 5LM3A 3AW8A 3IE2A 4M1MA 4CZ2A 4MKGA 4RELA 2Z8ZA 5G53C 4HAYA 4HXGA 5AKLA 3HWWA 3BB4A 4H3SA 1NDHA 4BAZA 4L8WB 2XKKA 1CUBA 3DVSX 4EO9A 4QGSA 1DIAA 1DVRA 4Y6PA 1T2FA 3WR5A 3VO1A 1PHRA 1RWQA 4RFSB 4CL3A 5FI1B 1PSWA 4A0QA 1B0UA 3KHTA 4CLRB 4FGJA 2RCNA 1LU9A 4A1FA 4D0RA 2VQ3A 3WGQA 1N5KA 4IV8A 4LSZA 1J70A 3P0RA 4C4AA 3SBXA 4D8WA 1Z4KA 1WL8A 2NXJA 2W2QA 2OZEA 3DWIA 3O8OA 1YCHA 2AYZA 1VI5A 3WL5A 3UT5B 5IF9A 1E3WB 2F59A 1RLMA 5F4ZA 4Z54A 1FZQA 4FJ1A 3AFGA 3RIYA 3UXMA 4AJLA 1MB3A 4P0QB 4BQFA 3KETA 3ZU3A 3F4LA 4MQ4A 3WK9A 1BYIA 1PL0A 3C1TA 4B44A 4XXHA 3N07A 4GM4A 2QXYA 1UJ5A 3ASUA 3T94A 1T36A 3T3DA 3LH5A 1XZFA 1CNFA 2VPXA 4YJDA 5DI3A 1KFJB 1J00A 4MS3A 2BLNA 4ZCQA 4A7PA 2XR1A 5BMOA 5EHXA 5A7FA 5BQFA 5IASA 3KJIA 4R68A 2RHHA 5AKXA 2TS1A 1OZGA 1VBKA 1NULA 4OBBA 5JPCA 5JSQA 2DQYA 4II3A 4M9QA 3CH4B 1JIIA 4P38A 5U4XA 3ICQB 1DEXA 1YZNA 5FR1A 5KMGB 5KO2A 4NU8X 4Y9TA 2F48A 2PLAA 1T3SA 2WSMA 4R0NA 1RAIA 4YMSA 5JG7A 3R7FA 3UH1A 1PFYA 3LBFA 4EAQA 1VC2A 2Q99A 4KQKA 4XEUA 3E5HA 5DW0A 5HRCA 1AGNA 3RYIB 1PR5A 2C2XA 2C5EA 3GZTB 3PPWA 4RM2A 3LHSA 4LRXA 2AFHA 5E7MA 4D8VA 4MS4B 4LE0A 4HVCA 1EJ0A 4B74A 4D26A 2XV1A 2LZ0A 3QXXA 1PVOA 1EVLA 1MO4A 1NZFA 2EBUA 4GP7A 3FNGA 3DE6X 1U4SA 1L5OA 3RLIA 9GPBA 3GLVA 2NU8B 1UFOA 3OTGA 3DEFA 5J1TB 1M9NA 2D1SA 4V03A 3OVMA 3AYZB 4BASA 1I10A 4C21A 2PRJA 4W6ZA 3BRSA 4QECA 1VLQA 1WHSA 2W9XA 3G5TA 4I55B 3LDHA 3RSCA 4UM8B 4ZO6A 1A1SA 2ZXEA 2H4WA 4AO6A 5TB5A 2R65A 3L6UA 4EKEA 1N5DA 2B4RO 1U31A 3W5JA 3HL0A 5FWAA 2VWPA 2Q9BA 4R2WA 4K6GA 2Z2IA 3A1EA 1XEFA 4JDPA 2Y0DA 3C4JA 4TRMA 5ALNA 3NBAA 5IH3A 2Q7XA 3T5CA 1RWXA 1F7VA 3FSEA 3RVPA 3ZGXA 2GO7A 3C3DA 4L7QA 1E1MA 1EH5A 2HKIA 2HUNA 5CA1F 2BYTA 1H8HA 1K0FA 1PWYE 3L43A 2Z5FA 3HYLA 1HORA 3PHCA 4E32A 3NETA 4N18A 1UBFA 2DWCA 2ONZA 1CQIA 1YL6A 2Y1LA 3FPSA 3MUOA 4WBXC 5D1NA 1AK9A 3VGJA 3CVUA 5J5CA 1ISFA 2PMBA 3QU5A 4TT3D 5H80A 5CA0A 4TRJA 3OOHA 5H1YA 1SUAA 3TLGB 4ARBA 2J4FA 2HWXA 3PQ7A 4DDVA 3FZYA 2O1EA 3NEPX 5FL3A 2YVUA 4WNIA 5A3SA 4EEXA 1HG0A 3KAJA 1GT91 1L5FA 5CTJA 2EAUA 4RW0A 4R51A 4PO1A 4NESA 5F2KA 3DD1A 5CT6A 2XW6A 3TD9A 3KTFA 3COJA 1KARA 1S2MA 1R4MA 2C7BA 3IV6A 3ZVRA 4DABA 1VDZA 1X39A 3LQRA 5E9AA 1N5LA 4IDGA 2DUUA 3CLSC 2JJQA 1VIAA 3NHRA 4C3UA 2PQ2A 3HDVA 5BWCA 1ISIA 1T8SA 1SURA 1VM6A 1O6BA 1XKQA 5DCWA 2FQQA 2A14A 2BDEA 1UEXC 3HJBA 3NBMA 1Q12A 3R6TA 4RVCA 3RUCA 1WPRA 4I46A 1ZOOA 3TW8B 3LBYA 1RRFA 3BRCA 1SXGA 1EE9A 2EFCB 3GEMA 3V4ZA 4U7PB 1W48A 3WP0A 4B43A 1T6NA 2CUZA 1NVGA 4YMVA 4EA6A 4Q9AA 4WH0A 4KQ6A 1QFMA 2XTZA 1LLUA 2AHOA 4A10A 3RU3A 2F9FA 1RLTA 2WJYA 1JFLA 1II0A 1PUJA 3O26A 2FFBA 1P2GA 4XASA 2NV6A 3BWBA 5FWXA 121PA 1OTYA 1SU8A 1Y80A 4L95C 4MA0A 1TEXA 1YRQA 1E2HA 4NYMR 4QHYA 4ACAA 5FUWA 5JNWA 4MB2A 1W25A 1IZ0A 4BGIA 2ACEA 3GJRA 3E22A 3QYJA 1JAZA 1CBUA 1SD1A 1GUDA 3GELA 4IR7A 3YASA 1M33A 3Q3JB 1KXZA 1OAOA 1YS4A 1J56A 1U04A 2DWPA 1RRMA 1O6FA 4MP6A 5K0CA 1JQJC 1U3CA 1FMCA 1KZGB 4PBRA 3VNQA 4RTLA 3HCEA 5JPIA 2J7PA 2H9AA 1TMKA 5AVYA 1VCIA 3F97A 2FSVA 5I9IA 1QTIA 4MVCA 2GEJA 2FZWA 4H7IA 1UC8A 1W46A 2Q5QA 5DOVA 5I5GA 3NRBA 4CCWA 2YYYA 3CUEF 1AG9A 4ILEA 4NMXB 1D0SA 5LQCA 2FR1A 5IAAA 4BECA 4HZIA 2Q9UA 3R0ZA 4AMVA 5L6MB 1VHQA 4B4DA 1CP3A 2F8SA 2JFPA 4YGYA 5KX5F 1G9SA 4UNPA 4MEAA 2VUSA 2C2KA 1FCJA 4FEEA 4QC2A 1TNDA 3GP5A 3IA2A 3QELB 1A9XA 1U2GC 1QPZA 5F23A 1ZRSA 1YOVB 3RE1A 3TOSA 1USVA 4IO1A 2IBSA 2C7GA 2BFOA 2BJVA 3ITKA 1E3EA 4JT8A 3F0TA 2Q8QA 3G0HA 4UQOA 3WYFA 2IKQA 4ZC1A 4ENUA 1X7XB 2O8DA 1QIHA 4GL2A 3VR2D 1UWVA 4R71A 1IXZA 2A94A 3U40A 3THOA 5GJWC 4OSOA 3TB4A 1N7HA 2VWQA 1J8FA 1RHUA 4PC3A 4KQGA 2JLZA 2OZLA 4WVFA 1L4KA 4JAVC 3SYTA 4WACA 4D3YA 3EPPA 2RK4A 3D7KA 1Z4IA 5DLEA 4C4YA 3FWKA 3AU8A 4LKOA 3ANSA 4Y2UA 5A03A 4DLZA 4BNUA 3I2YX 3COWA 1N8KA 2OD7A 4JZKA 1LUAA 1U8ZA 1X80B 2IYQA 3FCCA 3T54A 2EF1A 1QDEA 2HNBA 2H57A 1TU3A 3PSAA 4OMFG 3WSVA 4F4CA 1U11A 1Z63A 4D97A 3G9TA 4Q39A 3C8ZA 2IEZA 3OX3A 3K1AA 5ERYA 3RFUA 4MS1A 3IDSA 2UUAB 4B4VA 1PKEA 2XCTB 5IJ0A 5ELMA 1BH6A 3EZ6A 4RKWA 4IEIA 3HCFA 2GZDA 2QUJA 3K0FB 4CM8B 3VA7A 1YCGA 3D3KA 2BJHA 1A1VA 4DMMA 3BE8A 5JSZA 3THXB 3ISJA 1RCTE 4LXHA 1DZ3A 1AKQA 4TSRA 3ZCPA 1WPXA 1MAWA 2QTVB 4L0CA 4IHJA 3LYAA 4EI9A 7AT1A 3ZDFA 1VG1A 1JQBA 3IHKA 1EK2A 1CG6A 2OPBA 1Z2PX 2NT3A 2IQIA 4HCJA 4RABA 4BLOA 1FMFA 1W0CA 1H05A 2HK9A 1LSJA 3KQUA 1QHNA 1PZNA 2RB4A 2RKWA 3NVAA 3VQTA 2IVFA 2QR3A 1NMSA 1NQWA 1XQ9A 2WJ4A 1OFGA 4IDQA 1VGRA 3ESDA 5I7WA 5MGNA 3B1WA 3VSBA 2QP3A 2YKGA 2Z2YA 3GCWA 4BB5A 2Q4EA 3WB9A 1H0SA 3D5EA 4K26A 2VRWA 5LOVA 1TFUA 3RJZA 3AUXA 3UJBA 3I3OA 1WSAA 1NGSA 1YBFA 3BIWA 5BW4A 1MOZA 1TYBE 3L41A 4IVRA 4B2IA 1HX7A 4W8HA 3E7FA 3PQFA 4PIPA 4YC7A 3VM6A 1OMOA 1MHTA 2GK3A 3IGFA 4OFZA 4Y2HA 5EPUA 4HX9A 3ZE8A 4YQFA 1S8FA 1SULA 4ETMA 2H2HA 3MJ4A 3TL2A 2BHRA 2RH9B 5ITWA 2UYOA 5AD1A 1BD4A 3IB3A 3R0QA 4NNOA 4M7WA 4WXEA 3NXKA 5ETJA 4M6WA 2R8ZA 1VRCA 3OTOB 1RTKA 2ZZMA 2DLCX 1TTHA 3EMVA 5C80A 2BKEA 3FY4A 4QNMA 1CDEA 5EWMA 2HWKA 3EAQA 1YQEA 4DUPA 4H6XA 2H7XA 2WWGA 3AFMA 4HF7A 4ABTA 4DIKA 1G64A 3FMOB 3TINA 3FVVA 4Z1OA 4V0KA 4IEFB 3PRJA 2F4NA 1XIVA 5A9SB 2WR8A 4L3WA 2FMFA 5ALIA 1QH1A 4DLBA 1WCYA 1QZXA 4AKTA 2WM9B 2GMWA 4KOEC 4NJEB 5I01A 4TZTA 2SKCA 1CUVA 4FDAA 3RVBA 3RS5A 2HW8A 2LKCA 3DEYX 1EA5A 4Q34A 2ZJ5A 3MILA 2FG5A 1GQYA 4LXQA 1Y1LA 1Z0JA 3USES 1TJPB 4NK4A 5E6RB 5HIMA 4D6PA 1EGVB 1G6Q1 3FTNA 4Q6WA 3WNDA 1MX1A 1GUBA 3SQOA 2IX9A 3OF3A 4TXLA 3VC2A 2X5NA 4DBVO 4PBTA 4BGEA 3N7TA 4C7BA 3EXG1 2XTMA 1FY2A 5AYVA 4KO8A 4AY3A 2XWPA 4P35A 3K6SA 1BZYA 2LDBA 3R5JA 4DDWA 4S24A 2JI6A 4KXUA 4RK1A 4GMDA 3EDOA 1WW8A 2CHVA 1K7XB 4C87A 3HB5X 4U5QA 4I2VA 4B6EA 4C4ZA 4XUCA 4M38A 2RJ3A 4FE4A 1SUSA 1V48A 2JBWA 3F7NA 4X5OA 2JDIA 2C04A 3B6EA 5DSXA 3JQCA 4YCSA 1Z33A 1TAUA 3BWMA 1E7SA 3RNLA 1LQTA 1L4YA 4WLOA 4R5MA 5IF3A 2VAPA 2FPLA 3Q1LA 4DVJA 4ZDKA 5K4HA 4KAXA 3ZGOA 1Q7BA 2OT3B 4KG7A 4DB2A 1FL9A 5KJEA 1M66A 3LPLA 2XQIA 4IHJF 5EERA 3NBQA 3N8IA 5KWJA 5ES3A 1E5TA 3L6BA 3V55A 4BBZA 1NFFA 1OXMA 2XUAA 1DKRA 1E18A 1QC5B 5M04A 4HFRA 3MB5A 3N74A 3NANA 4WERA 5DVZA 2ORYA 2FMIA 2QGNA 4ZOBA 1IRXA 5LZ7A 1JMVA 4LVNA 3X2EA 1Z6ZA 3OC6A 3BQMB 1Y7LA 1Z4JA 3M7IA 4XW2A 5FJIA 1UINA 3NKLA 3U60B 1NONA 4YDSA 3BC1A 3CLHA 2IXAA 3QGMA 1X8KA 3G7SA 5AVVA 3OZBA 1ZC3A 1RTTA 5LOVF 3OM9A 4GVLA 3T9CA 2MOKA 1MT3A 3NBUA 3JVDA 1EGHA 5SY4A 3LVRE 1XHLA 4MQEA 4NV0A 1MAVA 1PX0A 4BY9E 3UBTA 1UKVY 4FC6A 3LUKA 5FLEX 3RC3A 3NDPA 4RPHA 1DI0A 3O8RA 2IEDA 5ENDA 4AY2A 2V5AA 2Y66A 2FMHA 2PEZA 3QMPA 2F3PA 4JEHA 3OCWA 2MWMA 5IG2A 3U7EB 1Z0UA 3HDHA 1UC5B 4HFNA 4FI3F 5EE5B 3BDIA 3MFQA 4A82A 4P93A 3O5AA 5L9AA 1JG7A 1A8UA 2EG5A 2OY0A 2GUGA 3MQFA 1ZJ5A 4EMTA 3M6FA 5A1TA 2PRYA 2Q2QA 2DBYA 2CLKB 3MBKA 3MRTA 1Z82A 2D1TA 1QHGA 4HQFA 4WDRA 4DHEA 2X58A 1FP1D 1MAAA 2XMCA 1H2FA 4FFVA 3RS8A 1SKAA 3AI2A 2Q1TA 4AY5A 1CZUA 3O4FA 4MW1A 4OP2A 1A9TA 2XNJA 3A9UA 2A67A 2GF0A 3H3JA 2N75A 3M5WA 3W9YA 2LR0A 4Q48A 5IJAA 5CNKA 5EWLA 1T29A 3CTMA 1P73A 1Y8QB 4LXTA 1FFSA 5C51B 5A4AA 3I5YA 2H4FA 3ZUGA 4AJKA 3TIGA 2HLNA 2P9CA 2HFJA 3L5KA 4UUBA 5AM0A 5LC1A 3DVAB 2R48A 4ZCMA 3L79A 3SZOA 4HWGA 2OTCA 4IHKA 4HC4A 1JHDA 3ABSB 3C16C 2D5BA 2QMUA 3H0EA 4R7TA 3EULA 4C20A 5TEVA 5KU7A 1Z0KA 3N6XA 2JEOA 3OLCX 2CNWA 3ESZA 5CH5A 2QWXA 5FOXA 4TYWA 1H2BA 1RCUA 1MH1A 1KYIA 2QLJA 2B99A 3DMYA 3GLQA 3FYTA 4DMHA 1H4QA 2PUGA 3R8FA 4EVRA 4J16A 4C4RA 4EATA 1HRKA 3JR3A 1LPNA 5JWHA 3ANYB 3L0OA 1NJ1A 2F8LA 3TSCA 1XVAA 4KQFA 1GPBA 2UYCA 1GVHA 1T1SA 3GUUA 4D82A 1NPYA 1SVIA 4PQFA 2DP4E 2II6A 1XZEA 3PC7A 4LV6A 4TV8A 5K0NA 3SHFA 2HMWA 5BN3A 3L8YA 2FW6A 4J03A 5CLQA 3ZJUA 1U2EA 2CLOB 3CE9A 4KVZA 4BO4A 1H6DA 1IM8A 3AKZA 1NUAA 2Q41A 1VP9A 2W2MA 2WINI 3GAZA 4X1KB 3RKSA 2IBMA 2VG8A 3FSGD 4PYIA 4QSHA 4GOND 5BYBA 1ODLA 4WWHA 2PKCA 3A0UA 1G17A 3G49A 3S28A 4E21A 3IXLA 3FBWA 4M9RA 4WL0A 3SY8A 3K92A 1M75A 5EMHA 5DBFA 2HNKA 1GSAA 3EIUA 4FW9A 4LYDA 1SEVA 3WGOA 3VKWA 2B5WA 4ZHQA 1P0FA 1XTQA 1EJ6A 5FTKA 2MCFA 3H3FA 4DJEC 3DZFA 4NRDA 3H84A 1UC4B 1WDTA 2VSQA 3H7IA 1OGYA 1ZIPA 3K9LA 4FZ5A 5E4TA 3UFXB 5C0OE 1M6YA 4I9HA 1P0MA 1LWNA 2Y1EA 4DXDA 1O54A 3WZMA 1ZGGA 3PI7A 4Q05A 3BL8A 2WU1A 3CKMA 4RH1A 2IDKA 1GRQA 3CN7A 4FFDA 5BURA 1D3AA 1RIIA 1SXJC 3EG9A 4GW3A 3VR6A 5K3OA 3LOPA 1CY2A 2HRZA 4Y2JA 1VE6A 3NR2A 4DV5B 2XUIA 3UC9A 3WGTA 3KFXA 3DOUA 2BC9A 3ECAA 1OFTA 1XUOA 3N5KA 4MWGA 5HMMA 4MLCA 2Q6VA 4PSDA 3ZDZB 2JBAA 4MVJA 4CF3A 3DP9A 4Z9YA 1P0QA 2R1UA 1R6DA 3OEHD 1QFJA 2AF3C 4I1UA 3C5CA 5FXMA 2F4VB 2D62A 3RVSA 2GAJA 2W8BB 4MKZA 3P9SA 4YH1A 4Z9FA 4DLLA 1GN8A 2CC2A 4Q7MB 2UYGA 4QA9A 2R0QC 3G23A 3E5MA 1DHTA 3ES9A 4HL6A 1GAJA 3KYDB 5J9FA 1TCAA 1EA7A 4ZCLA 1NJSA 4DV2B 1LS6A 4ZO7A 1XCOA 1VHWA 1NR5A 4IF4A 3LUFA 2O3JA 3AEQB 4LW8A 3GQVA 1IBCA 1XZBA 1OVGA 4W9NC 5A05A 2O8EB 3QVMA 5I9MA 4GI3A 1SZCA 4IVPA 4AWBA 1C7EA 5IDQA 5A6SB 3P0HA 5E2AA 1PNVA 5IM5A 2OWEA 1DJNA 2OEPA 2YHAA 4MLPA 3VNBA 3WYEA 1Y6FA 1W1WA 2QW8A 1MAHA 2PHZA 5F77A 1G20A 3F8TA 4R1MA 3K0EA 4EPVA 4N0PA 4FQ7A 2YJ5A 4A8JC 3U4QB 5EKDA 3OECA 2EOAA 1IVYA 2J0UB 4WK4B 1SBYA 1FDWA 2MMGA 1QZTA 2ZYDA 3BJZA 4H2DA 2FSSA 2O3SA 3V97A 1LF5A 2P30A 4GL4A 5I7SA 1GPUA 1YWGO 2JGFA 2PMFA 1P81A 1D1TA 3BSWA 1KKLA 1ZAYA 3TKYA 1MQ9A 3BKWA 3DYIA 5HK8A 4Z7OB 2CUTA 3KAKA 3KZ1E 3NHZA 4JXZA 2G1AA 4GWLA 4M9SA 5F1KA 2J5KA 2NTJA 3EVFA 3GEIA 1W5TA 5G1PA 3ZGNA 4CG0A 7GPBA 3TVTA 4S1NA 1DMSA 1VSBA 1B6RA 3ILVA 4GI7A 3LA6A 3WKEA 1ZN9A 3Q7SA 4RHFA 2Y71A 5A6VA 4TV8F 3I04A 2FE1A 3O3OB 5TJHA 1K63A 3F6PA 5MGBA 3CVYA 1XZDA 3FPHA 4CPDA 3X1KA 5ICSA 4GNKA 4GXNA 3AEYA 1M6VB 2CBZA 2YN0A 3W05A 2FDCA 3C5VA 2CYAA 1L6IA 1ZD9A 2VA8A 4U0JA 3NHPA 1YO6A 1MJHA 5GONA 3STHA 3U4QA 1H4SA 3DDUA 2J7KA 4HUQA 4WESB 4YV7A 1F8UA 2OOSA 4TWAA 2GD2A 3PGVA 1YNSA 2CL7X 3SICE 5HUJA 4MGZR 4CHTA 4MWTA 3AVVA 4ZYYA 2NV0A 1D8AA 4KEAA 1NBEA 3F6RA 3TDNA 3WMEA 4UCFA 4B3CA 4HNTA 1GYQA 4CG3A 2O19A 5HTKA 3HJCA 3T15A 2QN1A 3BKXA 1HL7A 2YCBA 3O1HB 4MCJA 3UJ7A 1J97A 2MSLA 5CT9A 5D3QA 3TVDA 1C4OA 3JAWA 2ESRA 3JWPA 1ZH6A 4YPOA 1B4DA 1M1NA 1V95A 1Z0AA 4Q00A 3MWEA 5LP6A 1IUKA 3OZDA 3H6KA 4ZKDA 5JRJA 1WJGA 3HM2A 3SOPA 1ULUA 2Q1XA 3QE2A 4C0HA 5KNCD 2RK3A 4PLZA 3CLRC 3TUZC 3MXTA 1FQJA 4CIAA 4CGZA 3MWDB 3T8YA 4MVJF 4CMAA 1H69A 1Y5LA 2VXYA 3AOEA 4IIXA 4RPIA 2NSLA 3QU7A 1RWKA 5ECYA 3HCRA 3PICA 4FHFA 4LPKA 3KRTA 2O05A 1M0EA 3G2MA 4JBIA 4PLFA 3BM5A 1K7YA 3QE3A 1WNFA 3L6EA 4I8XA 1VCMA 3VNUA 1IZYA 2Z5GA 3PUVA 2DX7A 3JQ9C 3D7MA 3KOXA 1FFHA 2OLKA 2C2MA 2BISA 2DFVA 3O03A 4AP6A 1L5RA 4YJHB 1EZ4A 5G3ZA 1HE1C 5HKAA 5KJ1A 3WGIA 1Z56C 4MI1A 1BCSA 4DPLA 4LF4B 1WU8A 4FFBA 5DT9A 5K51A 4UDNA 3WLOA 8ADHA 3PX3A 4PR0A 4CM9D 1W9HA 1JHVA 3H2JA 2KJQA 2NU7B 1A76A 4HTFA 4R16A 5BOVA 3NAMA 3IYLW 4CIVA 4DJFC 3OFJA 4X93A 1GIAA 2UU9B 1ZZEA 3ELDA 4FLMA 1FVXA 3KUCA 4YUZA 5CUQA 5PGMA 2J5RA 1XD2B 3C15C 2VNSA 3HBJA 3N0RA 2G1JA 4WK2B 5E7QA 4WK6A 4TVOA 3CH7A 3QFFA 3VHXA 3FOCA 5DH9A 3TI7A 5DX1A 1FRQA 1VSVA 2GGSA 3AL3A 4MKRA 4NONA 1QFYA 4F2GA 1S89A 2H9YA 1ZIOA 3RIMA 4QODA 1V4VA 3QVGB 5H82A 4DQXA 1HBJA 2YIVX 2XRFA 2CXPA 2P78A 4B1FA 2GJAA 2OVFA 4NDNE 5E3IA 3VR5H 2B36A 3D4OA 4CKWA 1PX2A 4KR0A 4IHQA 1I3NA 1NPTO 5DNEA 1KA9H 2E1PA 2VYND 5HF5A 1D07A 1N9KA 2PGAA 3KOOA 5GM1A 1RIFA 1UQUA 2X0KA 3FHJA 4OO3A 2X6QA 1KVRA 5J63A 2ORED 4MUEA 1AXRA 2P90A 4JZYA 5GONF 1XCLA 4UM9B 4Y9SA 4BNXA 5HDQA 4K88A 3ZNQA 3EGWA 4HB3A 1FTNA 4EY8A 2GPWA 5EJFA 1N2CE 3RJ5A 1ZSNA 2C4NA 4J9UE 2ZVJA 4UHFA 1GARA 1PFWA 1L7AA 2FVYA 3NEAA 4V3CA 2BELA 1OKKA 1YS9A 2P77A 2A9FA 4PEVA 5A0TA 1GRRA 4TLCA 3WYBA 2DJIA 4IMRA 4R9SA 3TBFA 2HA7A 1EUDA 3DJYA 1AQLA 1GEEA 1THZA 2DWQA 4FT4A 1TB4A 4QDJA 3N76A 4M46A 3S29A 4K5QA 3C8MA 1WXQA 2Q28A 2JL1A 2V3VA 1XRSB 3VR0A 1Z8NA 2WE7A 1VLLA 3P9IA 4ICIA 1V2HE 1F4PA 3GV0A 4RETA 3RV3A 3EDMA 1Z6PA 3TGWA 2FN7A 4MUIA 1CZKA 1SPXA 5FR2A 4JHXA 4KSCA 4DLXA 3L4KA 2VP0A 2C5BA 2H4XA 2J67A 2Q0XA 3B2EA 4QQFA 1IAVA 3NHUA 2PVSA 3ELBA 5HJ2A 2C84A 1BH2A 3DKPA 4RGYA 4UNIA 5CM9C 1JQDA 4GX2A 4BGUA 4W1RA 3PA8A 3I28A 3I92A 4XGNA 6CHYA 4Q18A 3ONFA 1JWAB 4CMGA 1AY0A 1NI5A 3FCXA 5IVDA 4WIAA 1H2WA 4K1XA 3DB2A 3GZJA 3TS1A 1NVXQ 1TMOA 2BHSA 3I2HA 1IL0A 3I9LA 3LQYA 1ZMTA 2ST1A 2CUNA 3L8HA 1CCWA 4XJVA 1TZJA 4EJFA 3N6RA 1SKBA 3VBEA 3A6PC 4OP3A 2WV9A 4E3WA 4UHDA 3B1ZA 5EQJB 4L2IA 1JZQA 3DCJA 1SAYA 1RBZA 3CA8A 3EQ9A 3QENA 4PQEA 2JAXA 5AMXA 5FULA 3SSAA 3Q8WA 3UMJA 4BQEA 1PAUA 3SIPA 3WP1B 1XT6A 2FG7C 4R5HA 4TYNA 1M72A 4HS9A 4JOCA 1T5HX 2LWIA 2RC6A 1YE5A 2JGEA 4HGYA 3H2GA 3RHSA 2C2WA 2QD2A 4GZ6A 1IOZA 3F8WA 4Y1RB 4EJSC 2CD7A 4BKQA 4EQ6A 4LVOA 5DM70 3HADA 3HYSA 2MYNA 4GYWA 5GP1A 5JMTA 1J8QA 4LSWA 3U56A 2FSUA 3LQ1A 1V6SA 3MFYA 3R5KA 1JHPA 1OI2A 4I66A 1N0WA 2UZ3A 3KEOA 2CVZA 3VO8A 1RACA 1KJ9A 3CH5A 1UMCA 3HMKA 1KAEA 3Q2IA 4EQZA 4R54A 3K2QA 1NTRA 3KUUA 3VC3A 4E88A 1HG1A 1O97C 1RPNA 3T7DA 1PUIA 4XIGS 1PEAA 4EI2A 4ND4A 2AJLI 4CT0A 2XDQB 2I4NA 1PJCA 3DTYA 2B2XA 3CWZA 4EF5A 1QVAA 3IIMA 4UBMA 2LCQA 1OX5A 2QMOA 1SU7A 4LOJA 2IV2X 4QRIA 1E3TA 1UMBA 3SX0A 5K2OA 5IAEA 1KOGA 4GBJA 3IMCA 2M6LA 1E6KA 4YIHA 2QPOA 2EW1A 3O4RA 5F5NA 2V7VA 1DG9A 3WYGA 5D00A 1YTLA 1XPOA 3NNDA 1P31A 2FPMA 4U7HA 2GB4A 4GECA 5ITZA 4K03A 1WSBA 4ZGBA 2PMEA 3SHTA 1P61B 4M1QA 3D59A 2RE8A 2EF0A 4W7HA 1LDEA 4P8RA 1QBKC 1HDOA 1PDWA 1QQ5A 1PDOA 3HUDA 3N58A 2VYQA 4GEKA 3PNSA 2BR5A 1CDDA 4W82A 4DM7A 5BNFA 2CWDA 3H5OA 3W5IA 1YU6A 1OXSC 1WSWA 2GN2A 1OBOA 1PV1A 2CHEA 2HBZA 2WD9A 1ZNYA 5HBGA 2EFHB 5EZ6B 2EJVA 2PYZA 2PX8A 4MA5A 5GV8A 3RTDA 3V2UA 4AQDA 4RTPA 2DTEA 1HNZB 2C2ZA 4L08A 3NTLA 2NADA 1EJ2A 1KMNA 1H22A 3HA7A 3PHLA 1JDSA 4JYPA 1RE1A 3WDMA 3I2GA 5A02A 5JD5A 1Y9AA 3A4IA 4TWRA 1JVSA 1QK3A 5E6SA 2W4IA 2PFKA 1WXIA 1TLTA 2Q3DA 3QA3E 1OF1A 4J4BA 2GLXA 4OQDA 3T7KA 5A4KA 4CETA 1TA0A 3ZU5A 4AG6A 3A28A 1PNOA 3WTBA 3SS7X 4AF7A 1NW8A 1XVUA 4J0HA 1DKMA 3NEYA 5EZ5A 3TNFA 4NOMA 4UU8A 5TE9A 5BORA 3WGMA 1CZOA 2Y4NA 1J90A 2ATXA 3C98A 4P5PA 4UVHA 5HGXA 5LJLA 4YXFA 1M5RA 5FV7A 4X91A 1KAHA 4EJ0A 2NU9B 1DO2A 2Q5FA 2H51A 1UOEA 1US8A 1Z2DA 3OQPA 5AQEA 1IHUA 4RUKA 2AOXA 3O8QB 1JDPA 3CVVA 1XTZA 3I1YA 3EZLA 1O96A 1QB7A 2ONJA 4F45A 4LF6B 4TWZA 1PZMA 5CDSA 1V45E 2BF4A 3O21A 4V0LA 1R5BA 3VR4A 4BPBA 2C97A 3W77A 1Q6ZA 2D00A 2GCEA 4IWNA 1Q1BA 1PK8A 2JLBA 2B3TA 4EW3A 4EFLA 1F2TB 1V7PC 1NAHA 4IZOA 2XNDD 1D4OA 4LZPA 1UZLA 3AR2A 4EA8A 2HPAA 5H02A 4GP6A 1I1QB 1ARZA 4TLEA 3TTYA 2BM0A 5CBPB 3K32A 4I9FA 6ADHA 3ZWNA 1N2CB 3QWHA 2FMTA 3FGPA 4LNAA 2YX1A 3AEKB 4B9AA 2O5VA 1HRDA 1JLKA 5E4FA 3ZEIA 2I4MA 5GOZA 1HLDA 1UADA 3MLAA 4QPDA 4MKHA 4MLDA 5THQA 5AM5A 2Q4OA 5L4SA 1XG5A 1P29A 4NAHA 3GT7A 1S9HA 3L1IA 2NXEA 2FQWA 5LQSA 1H9BA 2XOKD 3PQ3A 1HDZA 2XCLA 4C0QC 1L8AA 1OH5A 4ZVPA 2NVUB 2ZUUA 1WNTA 3NHKA 3TIFA 1J0CA 1P39A 3E9MA 1GNQA 1PUXA 2HRCA 3QK7A 3SLGA 2V6BA 2QBYA 1ZOSA 2ZCUA 4EMBA 1OAKA 3ZGZA 5DRTA 4ZQCB 3K8OE 2IP4A 3A1NA 3WLFA 3EXAA 4F9GA 1XE3A 2NYAA 4TLMB 1I0IA 1FMTA 2YJZA 2Z98A 1XBTA 3GT0A 4KKXB 4KYUA 4DA4A 4M0DA 1BMQA 2DKNA 1XDSA 2JZCA 2V6GA 2UZ1A 1GRCA 2XYPA 5LU8A 3QNMA 3PBKA 4M21A 3VPXA 4Q3KA 3EEBA 4CV3A 1P6XA 3GPLA 1FUEA 3R7WA 3GC6A 4JGIA 1XWWA 1K27A 3RYTC 2EBWA 3T1QA 3Q2KA 1A4RA 2I03A 2WF7A 3ICPA 1UOQA 2YRFA 1TKRA 4FGUA 1K8YB 4FOSA 4H27A 2GZ2A 4ZT6A 4AP9A 4C9BA 4DSZA 4TS1A 1VYUA 1QPGA 1JNXX 2BFFB 4PPNA 1EVYA 1W88A 2I6QA 1BW9B 2AMVA 2VNKA 3D5QA 2WMDA 3OSUA 4M8SA 4A2PA 3HKBA 3NLLA 3RLFA 2YV4A 1ULAA 3RF7A 2C4KA 2X2EA 1CD5A 1ZM9A 2ZATA 3BWDD 3G02A 3HZOA 2GKOA 4EITA 5EOVA 3ZNPA 2O8CB 3WLKX 4K28A 4JLMA 4XTRA 3CJQA 3OQ1A 4N03A 3D7NA 4FTWA 4QDUA 4EDHA 4ZTZB 4CCAA 1UWLA 5IRCD 4GGOA 1XRLA 3GFBA 1IEWA 4FCTA 3N2ZB 4QDTA 4RESA 1DC7A 2NO5A 3ZGYA 2X5KO 4PSCA 2ZPUA 4U2CA 1OYYA 3DG9A 4ZCPA 3DCYA 3U1TA 2DULA 4ES6A 3UUEA 5AM1A 2PY6A 1KIAA 4HDSA 5E1DA 2NOAA 1APBA 1PJRA 4CJXA 1VRVA 2O2IA 4COKA 5BR1A 4NOJA 2HJVA 1QWSA 2BEWB 3PI6A 1FYFA 4UZEA 3CVJA 2C99A 3OEED 3ZHYA 5FYDA 4YRGA 4XB1A 4C0XA 3EZGA 5GM2A 3EGDB 4P3NA 1I13A 4YB8A 4ZAXA 3ZLUA 2QXTA 1J24A 2PNFA 5LFAA 1ZVKA 3K94A 4ZYZA 1GAXA 4MX8A 1K6XA 2C3YA 1DO8A 3A6JA 2YASA 3CNNA 2IEBA 4PLPA 3QMWA 5C52B 4EF4A 1RQ2A 1MF7A 1R0SA 3PK0A 4FSHA 2CXXA 4YAWA 3RTBA 1ZGJA 2ODPA 4BMPB 4IDFA 3RQSA 4OGLA 1HLPA 1HT0A 1U1GA 2FY8A 5F21A 4UQPA 3LDAA 4LY0A 1JLSA 2I54A 3DPUA 3IKMB 3DMTA 4N6OA 4PGAA 3V8EA 1Q7GA 5TGZA 2FQ1A 3NYQA 3SMVA 4D6YA 3LKBA 4N8SA 1NVMB 4C6TA 3ZE2B 1J7KA 2JC3A 1RPAA 3C8UA 4KBYA 1AKWA 1X9HA 1BWSA 4MJ3A 5JZOA 3GG9A 4LBVA 4Y9RA 3ZCXA 3R24A 3AWIA 5FD8A 4Q4HA 4QHSA 2W0SA 3RH0A 1ISMA 4Q82A 1I7SB 1PJZA 2B1JA 4MRRA 2O2GA 1FVHA 2RHCA 5AVQA 3A58B 1LK0A 1MCZA 2QTBA 3AFNA 3M81A 4IW3B 4ER0A 3U09A 4XD7D 3GAMA 4IO0A 3N9IA 1QVVA 3C87A 1S2DA 3OHMA 1NYTA 3P7MA 5HKBA 5SICE 4GGPA 1PT6A 4X1IA 2QRKA 1K7CA 2XVMA 3DVLA 2REOA 1R0BA 1SN7A 2FCAA 2VTKA 3GA7A 2A86A 4EELA 3OQOA 4KLCA 1YZFA 1X1DA 2ANCA 2WD8A 3BXXA 4LUCA 4OU4A 5E8RA 3X43A 2HGZA 5ILOA 4IJVA 2I22A 3QKRA 1TUIA 4PYJA 1CZNA 2ZI9A 2MINB 5FEMA 1TK9A 3BXFA 2I6TA 3LSYA 3SHVA 2QW0X 4LHSA 1LBHA 3WWOA 2GYYA 4UEQA 4I5IA 3L6CA 2O8FB 2ZB2A 5K9ZA 1KYXA 1NUTA 4BLUA 4OYYA 2WWFA 4ZYUA 2J6HA 4RZIA 1QHFA 1XPRA 1NQXA 4E2XA 4Y2RA 2HMAA 3TBHA 2NXWA 1ZR2A 3M6AA 1DAFA 2J59A 4R1PA 3QY9A 1N2ZA 3DZKA 2NZVG 3GNQA 1M67A 5IT9A 4FWTA 2BUCA 2Y0EA 3VISA 2OXCA 5BR8B 3PTLA 3BH6A 4RHUA 4HDNB 1EIWA 3LCCA 4PX2A 1T5TA 3FOFC 4ASUA 4KR6A 1AHPA 1AQIA 2IDZA 4LX8A 3FOZA 1DBQA 4TXHA 3U17A 1XWIA 2AKAB 2I1WA 5A9RA 3WGZA 3ZI7A 1IN6A 5A4MS 1NUPA 3D43A 2D8AA 2W2KB 3OA2A 4RE6A 4U7WA 3IVXA 2FF5A 3LTEA 4UUQA 4Y9UA 2WF6A 1IEQA 2AS0A 2WIGA 3C7CB 4R81A 2YJTD 5ED0A 1HKUA 4ZT2A 2XCRB 3JRWA 3FOBA 2JIDA 3EYAA 2IHVA 3PC8A 4FWIB 3V7YA 3TPZA 2G77B 5K0JA 2V96A 1D0VA 1NW3A 1VL6A 2WK1A 3IFSA 1Y3FE 3AYXB 1SIWA 4J0QA 4NNPA 1XNQB 1JG4A 3F46A 4NBWA 1CRWG 4MV6A 5JYDA 2GK7A 2WAXA 4CKYA 3EPJA 1Z8FA 3GWGA 4AJ2A 1XA4A 4AMBA 4W1PA 1W2GA 3ESXA 3NASA 5J2TA 4LAFA 1GZDA 2XHEA 3MGBA 3Q3CA 1XRMA 1CFZA 2O2JA 3CZPA 4CM7A 2R6DA 2M1XA 4ZODA 2Q2NA 1A5BB 4DILA 3X44A 2X13A 1TW3A 3AUYA 3NBYC 4M88A 3LUJA 2EYUA 1P4GA 2WG2A 1TMYA 1I5RA 2QT9A 3HJGA 3ZQUA 4DSAA 3P2KA 2IP2A 2H9IA 1XCMA 1RWMA 3HY4A 2H2AA 5B4TA 3R09A 1Y8AA 2HXGA 3D7RA 3GW8A 1KP9A 2BEKA 4TTRA 4DYHA 1UT6A 1GFWA 2VJPA 3WB0A 2XAAA 1T26A 1GLVA 1Z6QA 2O0HA 3ETLA 3MS4A 2IEAA 2ID8A 4C78A 3IKLA 5AW6A 1UP6A 1FSFA 3AVPA 2R8EA 1EXNA 3OZIA 4ROSA 4YMLA 2L17A 1XMQB 1TIKA 3F3SA 2AMJA 3INRA 1YIAA 3OT4A 4QZVA 3F5DA 3F7OA 4EHNA 1EE1A 1REQB 1SQ6A 3I3SR 3DOCA 2WWVD 1Q19A 5HX7A 1FK8A 3MAAC 3ZNOA 1Q0QA 3HUUA 1N2EA 2E82A 3SF8A 3WNCA 2N46A 2FPUA 3Q9UA 1QTNA 1CQXA 1FMJA 5ERGB 3ETHA 1QUEA 4AKGA 1E4OA 4Q7JB 3MYYA 1EJBA 3JQRA 4DLSA 3UKOA 4CR8A 3DNFA 3M6UA 1P72A 1B8NA 1CJVC 2O7QA 1D04A 3TG8A 4FJ0A 4M0PA 1EFPB 4R2JA 5EHIA 4EG4A 4ERXA 2QM8A 3GFVA 2UXDB 3IUPA 4ZOQI 5EC8A 1KQOA 1BKDR 3ETNA 4QX6A 1M8GA 4TS3A 5EIAA 1SOUA 3S1LA 1W9MA 4EVQA 4AKEA 4RANA 3RW9A 4N7RA 3D4NA 2B5VA 1BE6A 3QJ5A 4HLUA 4EG0A 1C3LA 3I76A 2CDNA 4RK5A 4EDFA 1PZEA 4CFZA 1W29A 1UPFA 2YVKA 3BJRA 4OQNA 3GRVA 1DOZA 4NATA 2KPOA 5IYZF 2I3DA 4XOUA 1FFCA 1GR1A 1KYQA 2A6PA 4X54A 3KQHA 3QFHA 3KD2A 1YR8A 3OM8A 4TT3A 1JQEA 4EUSA 5EXXA 3EZ2A 4H7HA 4OL0A 3TKLA 2X3FA 5JXHA 4ESOA 3ZY6A 3QKIA 2FKNA 2GCNA 3CO5A 3COVA 4KMMA 4M1OA 4CQJA 4FGZA 5F33A 1C7FA 5DF1A 5HZKA 4DNXA 2VNHA 3FH0A 1IBLB 3G82C 4Q9JA 4FFPA 3VO9A 1IZ9A 3PNMA 3CVXA 1CUEA 3RSLA 2OZVA 4TWBA 1QS0A 5AIAA 3H9GA 3T9DA 3B6KA 2CDAA 3MPOA 2C98A 2BTQB 3GRPA 3LBHA 3QOWA 4MVXA 2COEA 2RI6A 4NAVA 4DM3A 4JJIA 3UAWA 1WCV1 2B6HA 4R7GA 4X1OA 3LQQA 3H9CA 2JAPA 2WIJA 2JI8A 1WXDA 2VP4A 4WZBB 5FWYB 5BQPA 3TWOA 1U5AA 3PDHA 3NB0A 1WQ4A 2X8WA 1UBEA 3PGKA 3BMCA 4M0KA 3FW1A 4EPRA 1CP2A 4YR9A 2CN1A 5I5EA 4AKHA 2H5IA 3CNLA