2ZIAA

C4s dck variant of dck in complex with cladribine+udp
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
241
structure length
220
Chain Sequence
b'RIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNVGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxycytidine kinase
publication title Elucidation of different binding modes of purine nucleosides to human deoxycytidine kinase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 87
structure length 220
sequence length 241
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2008-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ziaA00
4JLAA 2FH5B 1CF4A 1OFIA 3L0PA 4K81B 4DLXA 3N70A 4GPTA 3KFXA 1E2DA 4TLEA 5DI9A 3AEZA 3UK6A 3TUJC 1L2TA 5CK5A 1KNQA 3AVPA 4H1UA 1WBBA 5AUPB 2YVUA 4Q1FA 3K9LA 4AIIA 4DDUA 4OQNA 4DCVA 1AIPA 3DMNA 1E9RA 2G77B 2K5UA 3D3QA 1AS2A 1DAEA 3GEEA 2P5TB 1KY2A 5TV2A 4CGZA 1MABA 1Z06A 3ETLA 4E22A 3U3JA 3ZZUA 3BIFA 1QBKC 1OH8A 2XOKD 2XZLA 2ZRPA 4L5BA 3RRMA 4DC9A 1W0KA 1DTSA 4OHWA 1FOEB 1NVUQ 2CHVA 4NONA 4B35A 5JCPA 3OZXA 4ZDJA 2D2EA 4B73A 4TL6A 3W3ZB 1UM8A 4AI6A 3U4QB 4M2LA 1F6BA 2QQ0A 2RAPA 4PSAA 3WBKA 1E2JA 4J0QA 3EARA 3NDBB 4XSHA 5EJEA 2OE2A 1LNZA 1KKLA 2ZANA 1R8SA 1G6HA 3RSLA 2CLCX 2W2XA 1G4AE 1NL3A 1OXXK 3WNDA 1A2KC 1PZNA 4D0GA 5GJWC 2ODWA 4FCWA 1Z0AA 2CK3D 2CNWD 3O47A 1HEIA 1CULC 2ERYA 1AKEA 4GP6A 2IYTA 2WWIA 2ZUCA 4Q1AA 1OFUX 1Q57A 1GKIA 1NI3A 4N1AA 3PJRA 1TF7A 1VG8A 2QSZA 3B13B 3QPWA 2FV8A 2XOKA 1FNMA 3T61A 3WYAA 1IXZA 4G5QA 1SVOA 1F5NA 3L82B 4UXHA 5E7JA 4G5SA 2FJUA 3FHCB 5EZ6B 5B64A 1H65A 4Q7MB 1W46A 5EP1A 2MSCB 1E0JA 1FMJA 2H92A 2I4IA 2E1RA 4WXPA 4BFYA 3K09A 4JLJA 1QHHA 4A92A 3C15C 2YWFA 2NO7A 2Z4SA 3EA0A 5FPSA 2HYDA 1TAGA 5FPTA 1GL7A 5ELXA 1NY6A 1IHUA 1KDRA 3AGQA 1KDPA 1P2TA 1CJMA 4LI0A 3B1ZA 1SKYE 2RGGA 3DDCA 1W48A 2VBCA 1UBEA 2ZI4A 3GFTA 3T5DA 3QKUA 3EZ7A 2IBMA 1YR7A 1KSHA 4JLPA 2F1RA 2OM2A 4MGKR 4JLDA 2C98A 2DYKA 3CWZA 2GXAA 2QY9A 2AD1A 2IHBA 1TEXA 5AUNB 3SYKA 1I2MA 1KI1A 1KSGA 1VCNA 2LKDA 3VAAA 5HZHA 2VHJA 3KXKA 3ZVRA 4Q7JB 5TVKA 1JI0A 3K0CA 2ATXA 5C4MA 2PT7A 5B30A 2FE4A 5FR2A 2YWEA 3CX6A 1NVXQ 3QSYA 1ANKA 3K70D 4Q7KA 2RHMA 2XXAB 2CXXA 3LXRA 5CIWA 3LX5A 1S9HA 4EPXA 721PA 3A1UA 4OJQA 4GZMA 1E79D 3QBVA 1J70A 1Z28A 1S8FA 4QBHA 3FHTA 1UJ2A 4US1R 4YMUA 2ATVA 2X1VA 2X77A 4CIDA 3HDTA 3RS7A 4QHSA 2IEZA 2QL6A 1Z08A 1EX6A 1B23P 1OB2A 2IS4A 1OXVA 5FPKA 4JZKA 5DLQC 5BYJA 5IRCD 4GZLA 3THWB 3H4MA 4Q9LA 5KNCA 4E09A 1G16A 4QFMA 4XH9B 3CF0A 3SJAA 5AJWA 1EFHA 2C04A 1TTTA 3ICEA 1RKBA 3MWJA 5TY0A 1EGAA 4D2IA 1UADA 4A8JC 4US2R 5J4VA 3O8RA 5FOTA 4TN1A 2QPTA 2ODNA 3FPAA 1PLKA 4Z8YA 4DCSA 2QE7D 3BB4A 4Q4HA 2W6JA 1QDEA 4Q66C 4A6XA 3SBDA 2BHRA 3BRWD 4WAUA 4C0BA 1OXSC 4B2IA 1EG7A 3HU1A 4UXIA 1E79A 2PX3A 3NEYA 2BMEA 1KI6A 1Z0JA 1SVIA 1ZNZA 3EWSA 3AF2A 4RY2A 4BZXA 2J7KA 2WKPA 2EWVA 3GQBA 5FUVA 1XJQA 1X8KA 1P9NA 3VR1A 3SHFA 3HU3A 1JR3A 1GL6A 4IXMA 1GITA 3MCAA 4TQAA 5GVRA 3K9GA 1ZD1A 4NYIQ 4PQFA 3IHLA 4W7SA 4A4DA 1P72A 4FI3C 1JR6A 2LKCA 2X2FA 3BAFA 2OBMA 5CB8A 4CEIA 3B5JA 1G4UR 2QRNA 1QVAA 3QXCA 3HWSA 4C0KA 1KJZA 4BEBA 3P26A 4IOKA 3AVTA 1S4QA 2ZM5A 1E1RD 1N0UA 4XWOA 1DBSA 2BM0A 4DIEA 1VIYA 2IXGA 5FPYA 3RS5A 1NBMA 3B85A 1VDZA 3FMPB 4M9SA 4PC2A 3EZFA 2P6UA 5E3HA 3TR0A 3FGNA 1NLFA 1DPFA 4S35A 1OV4A 3H0KA 3WRYC 3Q3JB 4ZI3A 1SULA 1KI7A 2J0UA 3RABA 1TADA 1ZM4A 1R0YA 1TEVA 3AB3A 3V4RA 2Q9BA 1EFRA 1VTKA 4NYMR 2C03A 2V7QD 2BKUA 3U6KA 4RD3A 1KSFX 1W49A 1YRAA 2OILA 4CZ2A 4QJ3A 4LBVA 4RVCA 3X1WA 1BIFA 2J41A 4XOIA 3GJ5A 1VCMA 1U9IC 3LX8A 4KVAA 1NG9A 3NEJA 4BFZA 2OFWA 4DEYA 4D26A 2REOA 1BO6A 2B92A 1E1RA 3DO6A 3TIFA 1E4VA 1NRJB 1KO5A 3TK1A 3ZD7A 2FWRA 2W2VA 4HI0E 5JHHB 2D06A 4MA4A 1ZRHA 2AFHE 3PIRA 3KTAB 4LGMA 5FBRB 2JLSA 3LBHA 1KI3A 3IPXA 4JVSB 1JB1A 3HPRA 3KDSE 3O8BA 5CB6A 3CRW1 4MRSA 1WRBA 1TQ2A 4AYTA 1TF2A 3EZ6A 3NC1C 2XNSA 3RWMB 4ESHA 1TNDA 2VHTA 3A1WA 1FL9A 1NKSA 1T3LA 2GILA 3P4XA 2DR3A 2ZI7A 1WBDA 3IIKA 5L3SA 2VP9A 1XPRA 1BH2A 5IF9A 4PQYA 2ZI9A 1FW6A 4Q4AB 3QPVA 5CIQA 1J8MF 1W4CA 4YQFA 1E0KA 3EWAA 5E95A 3KZ1E 2ECKA 2J9RA 1W36B 2KBEA 3B1VA 4ZPXA 4GMDA 4QM7A 2F3RA 5K8IA 3NC0C 1FX0B 5CDFA 5IDVA 2ZJ2A 2ZSDA 4MUAA 1OE0A 4LJ7A 4Y0VA 5FI0B 3U3RA 3HJNA 4WW0A 5EP3A 3BD9A 1G8HA 3NHBA 4IDNA 4IVPA 2IYLD 1A2BA 2OUKA 4LJAA 1ZU5A 421PA 3A1VA 3U4QA 2JLUA 4U00A 4ZI2A 5EE1A 1Z83A 3TH5A 4CEHB 2BM1A 4N0DA 1M8PA 4B76A 1CRPA 1YR6A 2JLQA 3WBJA 3SFVA 2CVHA 1E2LA 1LY1A 5D3QA 5L3QB 4MKIA 3CRMA 2C9YA 3QKSB 1JALA 1XEWY 2J46A 1SVWA 1TF5A 3FWYA 1DAGA 1GNRA 2F9MA 1TQ6A 3CNNA 4UNPA 2IYWA 4KVGA 5JSZA 4OBEA 4RKEA 4W5WA 1PUIA 2ODEA 4NHOA 3TUZC 3IDQA 3L43A 2F55A 3KKMA 3B60A 1XD2A 2BBOA 2PJRA 2YWGA 2CJWA 1KK1A 2PEZA 3OFND 1ZIOA 4KCGA 1A82A 2KE5A 1HT2E 2CE7A 4EIWA 1QVRA 5JRJA 2AKAB 2QQEA 2E87A 1V5WA 1DG3A 1TL7C 1PLJA 2ZYUX 3LFUA 4GOJA 4LCBA 4C30A 2C8VA 2I3BA 2OV2A 3AKYA 3SNHA 3W9YA 1P4SA 1SQ5A 1J7KA 4LJ6A 3T35A 4DB2A 4HLCA 2FPKA 3THOA 5DYGA 2Q6TA 5F2EA 4A2QA 2ZRMA 1Y63A 3GLFE 1TUEA 2G88A 3A4NA 3KKPA 4PAQA 5CK4A 4D0NA 2O8EB 3MMPA 3WHLA 3KQNA 3WYGA 5FTMA 3NDPA 3CH4B 4M1TA 1Z6XA 4HB2A 4NZYA 4TWZA 2EQBA 4DLRA 1YZNA 3VQTA 4M21A 2Z6VA 1XMIA 1II8A 1XD8A 1E9AA 1TUIA 4IEIA 2A5YB 4QG7A 2Z4RA 4A8JA 5KYKA 3NBFA 1Z6TA 3U61B 2AN9A 2IK8A 3TE6A 1GSIA 1I4TD 4PAOA 4URZR 3VU9B 4EQ6B 4C0LA 1KAOA 2GJKA 4URXR 1B0UA 3GLGA 1J8YF 4KLNA 4I99A 4EFLA 1UFQA 3I8SA 3ADBA 2VHQA 1BMFD 4Q48A 2JGNA 1HQYE 4QGHA 5JRZA 1XPUA 3ZS9A 2P2LA 1FFHA 1G8FA 1T9HA 4O25A 1YJ5A 4PHTA 3GPLA 2FZ4A 1NMYA 2AL7A 1DELA 3C7KA 2RMKA 3OIVA 1G8GA 2FNAA 3J81k 3K0AA 1XB2A 4KLZA 3VX4A 4I1SA 3DZDA 4PHGA 3T15A 5LD2B 5F9HA 4RKFA 3SYNA 2OSBA 2JCSA 5BYKA 4QBGB 5JEEA 2GAAA 3QIAA 1TQDA 4WOPA 1NY5A 4LHXA 2FFAA 2N1BA 3VR5A 4D81A 5HZKA 3VNVA 1LV7A 1VMAA 3PG5A 4BASA 1OIXA 1UAAA 2ZREA 2VL7A 1AA9A 4MYCA 1HUQA 2O5VA 2GK6A 3R8FA 5AJXA 2F1JA 1U99A 4FD2A 2FPLA 2VSFA 3QUSA 4I1UA 4EPYA 2BMFA 2HF9A 1T5LA 2BMDA 3D7MA 1JQLB 4OK3A 1SXJD 1YHNA 2ZR7A 4QC2A 4B3GA 1T0JB 3WNBA 4KFSA 4G1UC 1ZBDA 4OHXA 4LJ5A 821PA 2QMEA 5LD2C 3BB1A 1VG1A 3I32A 2Z0MA 1Z5ZA 5AJZA 1OXUA 4ARZB 2G1JA 1U9IA 3VR4A 3W5JA 2QBYA 1UKZA 1KZ7B 3IHWA 3CR8A 4TTQA 3ZVLA 3VKHA 4MGZR 3K0FB 2ZSAA 1II0A 2ZPTX 3RNLA 2IS2A 5G53C 3BH7A 1DO2A 3TKLA 3B9PA 1KO4A 2HCBA 1IN8A 3ZLJA 4MYHA 2AKYA 1G41A 5SZJA 1YZQA 2BIFA 3CZPA 5J47A 2ZJ5A 3FFBA 3NBXX 3CBQA 4RZUA 4BLOA 1MOZA 1P2VA 1QHSA 2NGRA 3PQCA 1U0HC 4BFTA 4BLTA 4Q1BA 4B3FX 1SXJE 1KDTA 5JZVA 1N6HA 1OW3B 2YOHA 4PZLA 2CCJA 3EZ9A 3F0TA 1H8HD 4Z1MD 2OBNA 2HXSA 1XEWX 2J0VA 3QXXA 4P4SA 1M6NA 2EU8A 3O8DA 3CW2A 3EC2A 1WB9A 1OH5A 4Z54A 3CNLA 1EWQA 1SVMA 2GXUA 1FPMA 1EX7A 3LLMA 2ZS9A 3AVQA 3RC8A 1GAJA 2CHQA 3BB3A 1NG1A 1M7BA 4N3NA 1NF3A 2GCNA 4URYR 1XMVA 1P73A 5TMPA 1EK0A 2BJVA 3CKLA 3CLVA 4MYTA 5EXXA 3H2YA 1JAIA 4UKDA 1XEFA 3BH0A 3AGPA 1NN1A 2ZRDA 2OLJA 1X8LA 5JJKA 2QU8A 2Z43A 2C9OA 1NN3A 1E69A 1S0UA 4B6EA 1W1WA 3TVTA 1SKYB 2F7SA 2HF8A 2MMGA 3EIEA 4LHYA 3AV0B 2CCGA 4KSCA 4Z1MA 4NMMA 3IBGA 1SVKA 5KSOA 2R62A 4Q1CA 5KDDA 4Q1EA 2Z5FA 4LSGA 4FMDB 2QAJA 4KBGA 4HZUB 3SC3A 3AF0A 1GWNA 2BBWA 2PX0A 4JJKA 4IOMA 2OCAA 1A4RA 3I3SR 1IN4A 3E70C 2H18A 1DARA 1WMSA 5C46F 1U94A 2V54A 1ZC3A 1BOFA 1Q12A 3I72A 4U5XA 2MSDB 4V0KA 2V6IA 4O2RA 1ZP6A 4BLRA 1JXMA 4OL0A 2BVNA 2YYZA 4MQBA 1C4OA 1WQ1R 4CEHA 2H17A 2O8FA 1G7RA 3TAUA 1VG9B 2IXEA 3AQ4A 3THXB 1W7AA 4AURA 4DLSA 4B34A 2DFTA 3F5FA 2FPMA 3LVQE 4I1OA 3IIJA 2QGZA 2P67A 2N46A 2P6NA 3I4LA 2RGBA 1KY3A 4DCTA 3AKCA 1KSJA 3PUVA 3GLHE 2HLDD 4IVQA 4PPFA 1Z29A 4CT4B 3KB1A 3SJCA 1M7GA 4ZCLA 1IN7A 2ZEJA 3V4FA 2XSZD 3OE7D 5TB5A 4ZIRB 2WICA 4BLPA 3EPJA 3M0EA 2O8BA 3FKQA 4UNRA 1R10A 1ZCAA 4ACBA 3IGFA 1IBRA 1F2UA 2O8EA 4PHFA 3EIHA 4EFMA 4MUBA 4Q47A 4A1FA 4V0ME 4QHTA 2QGNA 3BERA 1L8QA 3NIBA 3A1TA 1NVVQ 2HT6A 4TLDA 1J2JA 1ZNYA 3A1SA 2OCBA 4KO8A 1E9BA 1KNXA 3NH6A 3AVUA 1W2GA 3GJ6A 3ZIAD 2XZPA 2I1VB 5KHOC 2HLDA 3I62A 5A4JA 5GJBA 2J59A 1U90A 2XSZA 2DFLA 1KJYA 3OE7A 4EQ6A 1S3SA 1MR3F 2VRWA 4BE7B 2FEOA 1G7TA 1X6VA 2CLDX 1Z2CA 3PITA 1R0WA 1MO5A 1YKSA 3MLEA 1XCMA 1DVRA 1W0KD 2WSMA 5K8UA 2ZI5A 4DEXA 3EAQA 2VYFA 2QN6A 1MRNA 5JS7A 3GP8A 4DLZA 1XTIA 2VSOA 5AUOB 2WWYA 2YHSA 3LXXA 4TL9A 1EFTA 2WJGA 4H1VA 3LD9A 2EFEB 2ZE5A 2WBLC 3FOZA 2F43B 1R5OA 3ZIAA 1OIWA 4RD4A 1LS6A 3LLUA 3GMTA 1W0JA 2AHOA 3PEUA 4P0TA 1A1VA 4JKYA 3UG6A 4WA7A 2ZROA 1COWD 4CEJB 3KKOA 2ZSFA 4PXAA 5CYPA 4KAXA 3QF4A 1D9ZA 2WJIA 4DT1A 1E2PA 3EG5A 1LF0A 1D2MA 2VH5R 4NCHA 1OT3A 4LHWA 1RC8A 2GNOA 3WXMA 3GLIE 3GJ7A 3LQQA 1SGWA 1JAHA 4QBFA 4GSYA 4YDHB 1GVNB 3EA5A 4IDHA 4IHQA 5AR1A 4DSOA 3P32A 3KQKA 3QG5A 3GFPA 2FG5A 1DAKA 2ZS8A 4X8OA 3X1YA 2AX4A 4EUNA 5D3MA 5KSPA 2ZS7A 4KI0A 5K8TA 3B1YA 2VP2A 1GOTA 4Q4JA 5FTJA 2ONJA 2GEUA 2PLRA 4D80A 1N6OA 2CDNA 4D25A 2FSHA 5EUMA 1UBGA 5DISB 3T1TA 2W0MA 2EVWX 3KUDA 2W2TA 1OHHA 1QHYA 3BBPA 2P5SA 1QG4A 3L8ZA 3RHFA 1COWA 1UKEA 4URWR 2WKRA 4IVRA 4BEJA 3AF1A 5C2JB 1CKEA 4FIDA 4LDJA 4AD8A 3W6PA 4IFEA 4PPNA 2GF0A 5LBIA 1RZ3A 1W4RA 3E2IA 3CPEA 4LJYA 4YMTA 2GZDA 1RJ9A 3RAPR 4DLYA 3QKRB 5KUTA 5DI3B 4F4CA 2GXQA 4O3MA 4PSVA 2VPPA 1BYUA 2DFKB 3JZAA 5HE9A 2ERXA 4OK5A 3UKDA 3IILA 4TMTA 3WYFA 3T06B 3VR6A 4NBSA 3QEJA 3C5CA 2CVFA 2H16A 4US0R 1ZW6A 3U7GA 3THYB 2WAXA 1KO1A 3P20A 4HSEA 5EE3A 4Q7LA 1JNYA 4JKIA 3M4YA 2BKEA 2WTUA 1Z3IX 1KTVA 2UVQA 4PSKA 1F60A 5FOXA 3GLFB 3UIEA 2WWFA 4E5UA 1GFIA 4MGYR 1CU1A 4YMSA 5BWMA 3R9XA 5IK2A 4DUGA 5E7MA 3FFAA 4GL2A 1YZUA 2YOGA 3DL0A 2B8TA 4FW9A 2W6JD 3OIWA 3CR7A 4JLKA 1ZC4A 4UNSA 1WCV1 1K6MA 5AUQA 2PLFA 5IHPA 1XWIA 1XU4A 2XITA 1D2NA 2CMKA 1RRFA 2B7BA 3CH5A 1D8TA 4LBZA 3CO5A 1Z22A 121PA 2WKQA 3LBNA 3TUIC 4BFVA 1GIAA 1JR3D 2QMUA 1KMHB 4KFRA 1AK2A 2NZJA 4KODA 1E6CA 1FP7A 2IYYA 3FHOA 5DE3A 1LS1A 1XEXB 2WPDA 3F3YA 1N5KA 4LOAA 5JCZA 2O8DA 1ZINA 4NCJA 3EPHA 4V0LA 1CEEA 5JWRA 4FXPA 5EP2A 4DIDA 1G3QA 1ZM3A 1JECA 4Z8XA 4BRUA 5L3VA 1G5TA 5JS8A 4AK9A 4V03A 3U44A 1FMLA 1I4LD 4PFSA 3BH6A 3LBIA 2VQSA 1R8QA 1HA3A 4QGAA 1NBMD 4I4LA 4QM6A 4EDHA 2BV3A 1NN0A 2WJHA 5HCIA 3R9WA 1US8B 1DE0A 3CRRA 1OH7A 2CEAA 3S1AB 3QPUA 3TRFA 4AY2A 2GF9A 3QXHA 1JR3E 1RRPA 3PENA 4M4SA 3U3KA 5FOUA 2KJQA 4JYCA 4POAA 3UWKA 2ZQ5A 6Q21A 1EFRD 4QBIA 1G19A 3SI7A 2JJ2D 5HCNA 2WZQA 1U8YA 4BZQA 2QM7A 4OHVA 4MITA 1JEEA 4DLWA 1AQYA 2ORIA 4M8NE 5KDLA 1UDXA 1GNPA 3U3MA 3EASA 2HDNB 2PCLA 4TLBA 5EUQB 5LB2A 2YV5A 2FMXA 3QVUA 3HR8A 3T5GA 1FUUA 1NBME 1XJ0A 1KO7A 4LYJA 3LDAA 3DKPA 2ZJAA 2FDCA 4D6PA 4D4JA 2QMHA 2O8CB 1CRQA 3EPKA 1Z07A 4M9XA 4M22A 2NTYC 5FUWA 1R5NA 1MKYA 4IOLA 2JJ2A 1G6OA 4IDPA 3FDIA 3R7WB 4RFSA 5CLLA 4C0AC 3SZRA 2QAGB 4WBSA 4P4UA 5EZ5A 2RGAA 2CCKA 1E0SA 2C99A 1G1MA 2KI5A 1OXTA 1SXJB 4RJLA 4FWTA 5LB4A 2IUUA 4RD1A 4C2UA 2ZRJA 4AWXA 3LA6A 3NG1A 4JT4A 5GJVC 4Q1DA 3K8YA 3UATA 1GL9B 3TW4A 4C0QC 1IJEA 2W6ID 2J7PD 2BJWA 1E2EA 2C95A 2VP6A 4MH0R 3PEYA 3LO5A 3P4YA 4HUQB 1UBFA 2VO1A 3FVQA 5DN6A 5JMTA 2NG1A 4GMXA 5B57C 4XVUA 2EFGA 4QXAA 2W58A 2QT1A 2ODBA 3QF7A 2FOLA 2RGEA 4CEJA 3SQWA 4F93B 4OQXA 3GJ4A 5EE9A 4C4PA 1E2GA 1MO6A 1MV5A 2C2HA 1T5IA 1G18A 2HYIC 3MG9A 3AM1A 2JJ8A 2D2FA 1GTVA 1HY3A 4TYQA 5KOYA 2NIPA 2J3EA 3NBYC 1WF3A 3IKJA 3BJIC 3UMSA 4DDWA 2JATA 4A0FA 1HH4A 5CDFE 3BGWA 3GJ0A 1XXHE 1M2OB 3IPYA 4F4IA 3AVVA 2YOFA 3FMFA 4NU0A 4DB4A 2RGDA 4TTRA 4X8HA 1SVSA 2J0SA 1CTQA 2W6IA 3MJRA 1C1YA 2J7PA 3IEUA 3E1SA 4LPKA 3WRXC 1MO3A 1ELOA 4PO9A 1ZUIA 2IUSA 4M1MA 4TL8A 1RRCA 2R6AA 5EXPA 1G64A 1KOFA 1IY2A 4B32A 2QRZA 2OLKA 1WDTA 1ZM2A 4CVNA 1FQJA 4IDOA 1KI2A 2ZRKA 5HKKA 1M1YE 4PANA 2YC2C 1XCPA 1E9FA 1CJTC 3KX2A 4ZKEA 1Q1BA 4OI2A 4ERNA 3RANA 4HLUC 4O2LA 4RSGA 4NL4H 2CL7X 1YZTA 1DO0A 5JJLA 2DBYA 3B82A 1QHIA 3NBZC 4JMPA 3HU2A 4BUJA 4ZDIA 1W36C 2JLZA 2KBFA 2GKSA 4OI0A 3A58B 2GVDC 1E2NA 5H68A 4GOXA 1E99A 2P65A 1RYHA 1T8UA 1F2TB 3AP1A 2ZITA 3C14C 2DWPA 4L9WA 3BFVA 2ZE7A 1OKKD 4V02A 2A7QA 2ZUDA 4UJ5A 2AXPA 3SQXA 1NLZA 1U2RA 2F3TA 2J5XA 4EJSB 3IEVA 1J99A 3DM9B 2JJ1D 2WWHA 3GLHB 4ILEA 2ZAMA 3NH9A 3TLXA 1LTQA 1ZD8A 1G5RA 1Z0KA 2V4ZA 3GCGA 5CM9C 1XFAA 4KFTA 3CF2A 5UKDA 4OJKA 4EPVA 4KV9A 4PZYA 5JHGB 1MRSA 5F98A 3PVSA 3RDPA 2BWJA 3B2EA 3G5UA 3LV8A 4JBYA 2V1XA 3C5HA 4U02A 2CBZA 2RHDA 1G291 3GLFA 2V1UA 2CE2X 2PMKA 1MH1A 4DKXA 1TPZA 3I5YA 2D7CA 1NJGA 4FN5A 1E2MA 4TTPA 5CLQA 2WJVA 2IYVA 3ZZTA 5KPJA 3GLGE 3EW9A 1OKKA 1YE8A 1Z0FA 1XPOA 2XXAA 2ZYTX 1Q1EA 4LRWA 4XWKA 5EQTA 4ZCIA 2JJ1A 4ZV4A 2MMCA 2ZRIA 3C8UA 3TSOA 2LCFA 4BZPA 3BC1A 4R98A 5FBLB 3QOFA 1CJVC 3GEIA 4Y0AA 1E9SA 2IS1A 4CRWB 1XP8A 4ESVA 3H86A 3KJGA 3RS0A 1E2FA 4YXWD 3THWA 4RZ2A 2HV8A 2IC5A 2GDJA 4WXRA 3CUEF 1IM2A 3IO5A 2ORVA 4CF7A 4B47A 1IY0A 4X8MA 1ESMA 4PZZA 4HYYA 2ZJ8A 4Q21A 4KBFA 5L3RA 3X1DA 4LX0A 2XJ9A 1P2UA 3HP1A 2GHIA 2HXYA 3QEOA 3LQRA 4IOJA 4LJ8A 3NWJA 3QXJA 4G5GA 4NP6A 4ZO4A 4EPTA 5JECA 4WZBE 1JPNA 2OCYC 3CRQA 3VX3A 3ZDQA 3A36A 2O0HA 5FBVB 1XTQA 1UKVY 2FSGA 4LYHA 4YMWA 1E2HA 2A3RA 3ZQJA 4JJZA 5J5CA 3MFYA 4IJMA 5H8WA 4NYJQ 3R8CA 1D2EA 4Q9KA 3OEED 5TDHA 2QTVB 4Q01A 1AZSC 3T12A 2REXB 3AP2A 2P0EA 1D6JA 2Q9AA 4EPRA 3H84A 2IYRA 4MKFA 2GJ9A 2VP0A 3K1JA 1JXOA 4II7A 4YXWA 3ZJYA 3DOEA 3RS2A 1AS3A 3X1ZA 2WV9A 2IA5A 3AH8A 4H9GA 3RS4A 4XJXA 3ZS8A 1DAFA 3HYRA 4TQ9A 3GLIB 1OF1A 1XX6A 1YZLA 1YQTA 4TZ0A 4LJ4A 2A5JA 3ZH9B 2BCJQ 3TSZA 2OAP1 3KJIA 3RC3A 2OXRA 3T34A 4FMDF 1AGPA 4QL3A 3AKEA 1U0LA 3NKVA 1P9RA 2PZFA 4PC6A 2RGCA 1OLOA 2CL0X 2QENA 3TQFA 4JLVA 2R6FA 4OK6A 4ABYA 1GRRA 2W0SA 2BDTA 2XX3A 2ZRFA 4LYFA 2FGKA 2B8WA 4HLDA 3U7HB 4BPBA 3UMRA 3OEEA 4AKGA 2NZ8A 2PBRA 3GJ3A 1GZSA 1N6RA 1KK0A 4CT5A 1EWRA 2ZJZA 3QBTA 4HZIA 4URUR 3VHXA 1R0ZA 1KHTA 1NMXA 2XEXA 4FMCB 2DPXA 2YC4C 3B78A 1NKTA 1L7VC 4RD6A 1YZGA 3K53A 3KFVA 1G7SA 5JI2E 2WSSA 2RGXA 3L0SA 3LRPA 4R7ZA 1PJRA 4RD0A 4W5HA 3VR2A 5GVSA 1ZUHA 1W36D 1FQKA 1P5ZB 2A2ZA 5H1YA 3FTQA 4IEEA 5CJ2A 3MRSA 3UANA 4R9UC 4Q9JA 1N2CE 1ZUNB 2PH1A 2IYZA 3KTAA 2AK3A 1NMZA 3ASYA 3ND8A 4CW7A 4DZZA 2CL6X 5JLJA 1QHHB 1W2HA 2A5FA 3Q9LA 3IIMA 1XBTA 2FGJA 1UEIA 2XB4A 2XJ4A 5C1BA 2YWHA 4JLOA 1ETUA 3AVWA 3I73A 2Q3HA 4QGGA 4XD7A 2VHUA 5DSZA 3AVYA 2VF8A 4IRUB 2YZ2A 1L4UA 3CX8A 4B74A 4ZDKA 2IWHA 4BWYA 4A36A 4K46A 3EXAA 2Q3MA 4PR0A 4TMWA 4DLTA 1X3SA 3X2SA 1JJVA 3BOSA 1OYWA 2JLVA 2E9SA 4KYIB 2HJVA 2AR7A 4HLUA 4NKRA 3SJBA 4Q4AA 2XB2A 8OHMA 3BFKA 1NNEA 3B1XA 2ZRHA 3H1TA 1ZM7A 4Q00A 2QG6A 3RS3A 2AWNA 3A8TA 3PEVA 1FX0A 5KNDA 3I1FA 4HAZA 3IBYA 5FOWA 3SYLA 5KSYA 2J1LA 4F7WA 1XTKA 1Z0DA 1VPLA 3REFA 1P3JA 3K09C 2EW1A 1S9DA 2BOVA 3LH5A 3R20A 3KQUA 3PUXA 1QHNA 2EYUA 3BK7A 3U6BA 4QHYA 5L3QA 1N25A 3U7FB 4B3XA 2C9CA 3IQXA 3QKSA 3CWQA 2IYUA 4RFVA 4D0LB 1PV4A 4TZ6A 2AXNA 1UPTA 2GJ8A 1JPJA 4YONB 3FKSD 2ZI6A 2QORA 4HB4A 3KL4A 1S3GA 1GDDA 1HYQA 4Q4HB 4OKSA 2PT5A 5L8VA 2EYQA 2Z83A 3LY5A 3C4JA 1EFCA 3L0OA 3VHLB 3K70B 2D62A 1Q1QA 5JWHA 2YKGA 3GFOA 4HLQB 2ZSEA 3RRNA 3U7EB 1NLYA 3TNFA 4B75A 2Q0HA 4QJ5A 4BRWA 1VCOA 2N42A 4F38A 1LVGA 5FL3A 1KDOA 1E2IA 1T3HA 4LJ9A 5B58C 1PVOA 3A4LA 1LB1B 2H5EA 2PEYA 1D9XA 1DAMA 3D6TB 2OXCA 4GBMA 2GZAA 3SN6A 2UZIR 5FTLA 5HR5A 3Q5DA 1IAQA 1E9DA 1XZPA 1Z2AA 2A5DA 4JLMA 1W47A 3FMOB 1KK3A 4JBWA 4TSFA 3FKSA 4V0OA 3MSXA 3W34A 3WMEA 1HV8A 1M7HA 2OG2A 4BFUA 5JJIA 3RLFA 2GTPA 2G1KA 3DVLA 2PJZA 1CR4A 3B8HA 4I81A 1EFUA 4CEIB 3A6PC 4KXFB 4ZCMA 4PTLA 4BFWA 2TMKA 1W0JD 5EP4A 3K70C 4HDOB 4KYUA 4Q9HA 5FFMA 3QJYA 3JVUA 4P33A 1XMJA 1CJKC 2EFHB 3KXLA 1KAGA 3QI2A 4QGFA 3VU9A 4DSNA 3AF4A 2ASEA 2WOJA 3WNCA 3LAWA 4W5JA 3LVRE 4XIGS 3PUWA 4Q4LA 1IXSB 4LHZA 2J0UB 1Z8FA 1RYFA 4PQRA 3VR3A 1HURA 1AS0A 1SZPA 2G0TA 2ZAOA 3RRZA 2HT1A 1W5TA 3V00A 2ZR0A 1KI4A 3CPJB 3FE2A 4P3YA 2ZIAA 4AKEA 5P21A 3N2IA 1M74A 2BCGY 3I61A 4DRZA 1XTSA 4TYYA 1QHXA 4AG5A 1OHHD 2NOAA 1Q3HA 5JFGA 1G7CA 3ND9A 4LC1A 3OIUA 2FX3A 1TU4A 4OQMA 3O8CA 3IQWA 1DOAA 1YR8A 3ZGXA 4EPWA 3WHKA 2G9NA 2WM9B 2X2EA 3JVVA 5FOSA 1AKYA 1SVLA 4LK2A 4NTZA 4XTRA 3CM0A 4LWZA 1IN6A 4TYNA 2OESA 4JSTA 3KJHA 3OEHD 5DHAA 5FPHA 2J0QA 2C77A 4K8OA 3ZD6A 2ZRLA 4HEJA 2JDIA 3EIQA 5L3SB 1XDBA 2QROA 4L16A 2DY1A 2FF7A 1U98A 4LV8B 2NPIA 2OFOA 1WE2A 4B3DA 1ESNA 1OB5A 2L0XA 2XTMA 1Q22A 2PMDA 4BGDA 3GLIA 2EWWA 4ARZA 1T6NA 1ZNXA 3BXZA 4FINA 4TYPA 4YMVA 4ASUA 1XXHB 5H70A 4HUTA 4DCNA 2JLXA 3C16C 1GRNA 3DHWC 3NVAA 4ACAA 1KZGB 3KQHA 2V3CC 2GCPA 3K0FA 2IF2A 2QTHA 3PXGA 2FA9A 4B71A 3FYHA 2GJSA 3B1WA 3FB4A 5DNYB 3ADDA 3L0IB 4UXJA 2WJYA 5TARA 1RVDA 4RCZA 3OEHA 5BW8A 1ZCBA 4KITB 4CYMA 5IK2D 3SE0A 4DUGD 2KWIA 2CLSA 3CF6R 4FMBB 1XD9A 5LDDC 2ZYVX 2R44A 4DJTA 3ASZA 3TVDA 4QJ4A 5BN3A 1Z63A 2H1LA 4L9SA 3PUZA 1DS6A 3DM5A 2J45A 4PHHA 5JSZB 1P75A 1QG2A 4HB3A 5JBQA 2IX3A 2GZHA 3BE4A 3T1OA 4PO8A 1A7JA 4W9MC 2R2AA 3RYTC 4AKHA 3ZZ0A 3CZQA 1XD2B 2VTKA 2CJWB 1N6IA 4A15A 1OH6A 2QT0A 2NQ2C 4DBLC 4BECA 3U5ZB 1Q1ZA 5AJVB 1YVDA 1WP9A 2ZRNA 5G41A 1FP6A 4A0HA 3ADCA 4NYIR 2WPDD 1W5SA 3MWKA 2NO6A 4LV6A 4DXAA 2O0KA 4HAVA 1G9XA 1NJFA 2IL1A 1NSTA 4P32A 1IONA 5KPDA 4TMKA 5DYIA 2IXFA 4AYXA 2IUTA 2ZRAA 1EXMA 1R4AA 3NHAA 3QVVA 2CK3A 2CNWA 4QNMA 3N2EA 4G5OA 4DCUA 4JL6A 5JI3E 3JZMA 4HAWA 5KU1A 4GOKA 2R6DA 4DHEA 3HR7A 1II8B 1MO4A 3TAHA 1A5TA 1XF9A 1ZIPA 4FCTA 3SEAA 2ZYWX 4A8JB 4BQSA 1JBKA 2HCJB 2OHFA 3I5XA 2ZSBA 2F9LA 2A78A 2GESA 3FMIA 5IT5A 4HZUA 5BXQC 4TMXA 1AJEA 4RD2A 4GI7A 2FFHA 1X86B 2O0JA 3V9PA 1ZM9A 3UPUA 1F48A 4NCNA 3ZVMA 5DH9A 4Q02A 3GLGB 1W4BA 2H57A 2MSEB 2IEYA 2ZJOA 2JLRA 3PFIA 3A37A 4V0NA 5F3WB 2GCOB 2GRJA 4YC7A 1HQCA 2ANCA 4GP7A 1VCIA 2P6RA 5AWFC 1LF5A 1OSNA 2VHCA 4AC9A 2FU5C 4XTCS 2KB0A 4URVR 1QHGA 221PA 3EC1A 1NIPA 2FFBA 2HEIA 2OT3B 2DHRA 4Q9IA 3K0AB 2R6CA 1XZQA 3THXA 4F91B 2G83A 1ZVQA 2WAYA 4JVLA 2D74A 3TR5A 1Q0UA 1NVWQ 2GJAA 4HDCA 5FTKA 5K8LA 3M1IA 1R5BA 3B6EA 4GNKA 4JT2A 2ZRBA 2ZUBA 4M53A 1O87A 4B2PA 3SDZA 3QQ5A 4GRAA 5JWOA 2OO7A 1XTJA 1E0AA 3MWLA 4R2IA 1UDWA 3UMFA 2AD5A 4HB0A 5FUYA 4XVQA 4TYWA 3ECCA 1KJWA 2A5GA 3IUYA 4ZIRA 1VYVA 1CJUC 3PCRB 2ZE8A 3E5HA 5FUXA 1VHLA 3T1VA 2YJTD 1G17A 2UZ3A 5EE0A 1C9KA 2X8AA 5G3ZA 1G3MA 2ZTSA 4PPGA 2VEDA 4ZKDA 2F1HA 2RGNC 2ZJBA 1QF9A 1LFDB 2Q21A 5TXGA 2G0NA 3L8YA 2GEVA 4IKEA 4P31A 1RRGA 2QBYB 1IY1A 4X8LA 1L4YA 3SR0A 1IN5A 2QE7A 2BMJA 2X19A 4LY6A 1GRQA 5FBQB 2OEPA 4MGIR 2F6RA 3WP1B 1OFHA 2ZI3A 5DN6D 2W00A 5SZHB 1AZTA 3ZYCA 5JEDA 5E7IA 5HE8A 2GAOA 2DWQA 1N5IA 2HUPA 3PUYA 3OAAD 1VG0B 2ZE6A 4AG6A 4AYWA 5SZIA 1E32A 3TQCA 4JYBA 3SOPA 5CJPA 2WHXA 2LWIA 3LW8A 4G3XA 1RPZA 2IYXA 2QZ4A 4TQUS 1YR9A 4OI1A 1RE0A 4G0NA 2IWRA 5ANRB 3VTKA 3DEFA 2BEJA 2R6GA 4MRRA 4FWIB 4KSBA 4LUCA 4P4SB 2GXSA 5FOVA 4AKIA 3B7GA 3TSWA 1VIAA 2V6JA 2CHGA 4N0EA 4QRHA 5G40A 3HYTA 3T1QA 1E96A 2OCPA 1Q20A 4B3BA 2WJJA 4EAQA 2F43A 2B21A 1Y3AA 2ZVPX 3QKTA 5E4FA 3AVXA 2WWGA 2RH5A 3OHMA 1G21E 2I1QA 2JA1A 2QUZA 3QE0A 4JS0A 5HKKD 4JBXA 2DWOA 2R65A 3SBEA 1GUAA 1G5PA 3OAAA 2ZXUA 5HPYB 3W8NA 3SU8A 1KI8A 1E94E 4B48A 1Z6GA 4C0SA 2REBA 3MUFA 4PC1A 2ZRCA 2FEMA 2QAGC 1E3MA 1E98A 1NIJA 2HJGA 3Q7PA 1MT0A 4NCIA 1S1MA 1AN0A 3W3AA 1W44A 1T8TA 1W4AA 4DDVA 3GJXC 1WXQA 2RKOA 3K9NA 3LWNA 1SXJC 1KO8A 3WP0A 2F1IA 5BN4A 3PR1A 1ODFA 2DCUA 2PZEA 1X1SA 3KB2A 2IYQA 2V7QA 3KXIA 3OIYA 1JEDA 2Y8EA 4XSGA 5GADl 3M6AA 1N3BA 2AWOA 2BBSA 2QI9C 4BFXA 1CIPA 1KMQA 4Q5IA 4IFBA 3L2OB 4NCKA 3EX7C 2QSYA 4LZZA 4O0MA 1N6NA 1XXHA 4JL8A 1RFLA 4LV5B 4XVRA 1E9CA 1Z6YA 3QG1A 5FH9A 3TGPA 2PCJA 3QENA 2ZR9A 2R9VA 1FTSA 1TQ4A 4PPQA 3U2QA 2ZU6A 2WMOB 3EPLA 4B3CA 1K5DA 3ICQB 4RZ3A 2O8FB 2IS6A 1BKDR 3EZ2A 4G5RA 5GJCA 2FN4A 1J90A 2WIAA 4CDGA 1S96A 1QZXA 2YINC 3QKRA 3RSOA 2IYSA 2A9KA 4NYMQ 5DI3A 2C96A 1JQJC 1P7CA 3DPUA 1E2KA 4JVMA 3G0HA 5BN5A 5F9FA 1P6XA 1N6PA 3TJZA 2JIZD 2ZVQX 3B9QA 4MRPA 4OYHA 1U8AA 621PA 4ZDWA 1IJFA 5DHFA 2ZU0C 2D3WA 2FZLA 1DAIA 1ZU4A 2XTNA 3NXSA 2QMOA 3WY9A 4JLBA 1IOZA 4NYJR 1XNJA 2C5LA 4D82A 4C7OB 3AKDA 3I92A 4DDTA 5A5GA 3THYA 4YDSA 2D4HA 1HT1E 4D4LA 521PA 1KI9A 4LPSA 4PO1A 1X1RA 4BFSA 2XGJA 1T0HB 4XWAA 2O8BB 1CR2A 4QNRA 4DVGA 4LBYA 2GA8A 4Z51A 3N5CA 1I2DA 1VECA 5SZKB 1F2UB 2WIBA 2XNDD 4M9QA 1F3OA 1FUKA 5EXTA 4HAYA 2B6HA 4DSUA 1N6LA 3AVOA 2JIZA 4NH0A 1T4GA 3C41J 3CX7A 4LC0A 5KNBA 2IF0A 1TU3A 3DZ8A 1U8ZA 2VF7A 4HATA 3BFXA 2QP9X 4PX9A 4EJSC 3OFNA 4B44A 4C0JA 1KIMA 4C9BA 4M0LA 1EESA 3BWDD 4IDQA 2VSXA 1KMHA 4PAMA 4B2LA 4KJZA 4DWJA 4L4UA 4FCVA 5DGXA 2QA5A 2JLWA 1XEXA 2VA8A 3SHWA 1G3RA 3LNCA 2R8RA 3Q8XB 1BYIA 1CR1A 2GCOA 4FMCF 4WZ6A 4Q03A 1P61B 2XNDA 1U0JA 4MDFA 4B6FA 4TMVA 3DOFA 5J40A 2OBLA 1Z6AA 2EFDB 4BLQA 1E1QD 1GILA 4TT3D 1E4YA 2H7VA 1IQPA 3QNUA 3SFZA 5G3YA 1S1CA 2RGNA 4PC3A 1SHKA 4OHYA 4D4MA 1GM5A 3RWOA 1GP2A 2JLYA 1UF9A 3U3OA 3CONA 2IW3A 1OPXA 1CLUA 1US8A 1TX4B 2NO0A 1YZKA 2ZJYA 5CM8B 3S1AA 1CBUA 1M34E 3QF4B 4A6PA 4B43A 2GEDA 4DT1B 1N0VC 1T3SA 1MABB 2WWWA 4JIMA 5C18A 1BMFA 2QPAA 5DO9A 3BS4A 3UXMA 2ONKA 2D7DA 2B7CA 3AF3A 2OZEA 1RIFA 1XTRA 2WSSD 1E1QA 1OIVA 2NMVA 5AJYA 2ZETA 4TT3A 3TMKA 3KKQA 1U81A 2Q9CA 3WMFA 2GBLC 1PUJA 3IO3A 1TMKA 2G6BA 4HDQB 4M1YA 4TLAA 5D3MB 4A0RA 1JJ7A 4Q4JB 3MD0A 4G01B 2V9PA 3OF5A 2SHKA 1RW4A 1DG1G 3KJEA 1CXZA 5FL7D 1G8PA 2VLIA 4MKHA 4NE2A 1GNQA 3R9IA 1VYUA 4XD7D 3X1XA 2QP4A 4JL5A 1KYIA 1G3IA 1O3YA 2O8CA 1AM4D 1ZAKA 2DFNA 3AP3A 3ZQ6A 2J87A 5FBWB 1P62B 5AK0A 3W6NA 2DB3A 3W8RA 4EFNA 4OQFA 4UNNA 4WZAE 2FSFA 1YU9A 3R7WA 4RZXA 2QAGA 4D4KA 4KFUA 2G3YA 4L15A 1NN5A 1RJ9B 1OFTA 4ITRC 1E9EA 2XZOA 2KSQA 5FI1B 3HPQA 4M1SA 1N0WA 3CIOA 3UG7A 1SXJA 2QNRA 2VP5A 3MGCA 1R7RA 3TW8B 2QPOA 3Q85A 3UWOA 1S2MA 4C2TA 4Q19A 1R0XA 3GEHA 3Q7QA 2FSIA 1E2QA 4Q18A 5FL7A 4EKDA 3DKVA 3NTUA 3K9HA 1VKJA 4UNQA 1ONBA 2GVZC 5J4KA 4R71A 4JLNA 4L8GA 4A2PA 2BC9A 4JVNA 1VYTA 4GT1A 4HUQA 2GETA 1GG2A 4F92B 4DLUA 1K8RA 1WA5A 2JASA 1FTNA 1X8JA 3P1JA 1OJLA 1BS1A 4LHVA 4RCYA 5FR1A 4PC7A 5DIFA 2OAQ1 2OFXA 1HE8B 5J4HA 1CS4C 2XAUA 3TBKA 4OHZA 3MJHA 4TL7A 2WWXA 1NVVR 5J4YA 4P4TA 3U60B 1GKUB 1DEKA 3QY0A 4I1VA 3D31A 1XJCA 2JEOA 4QOSA 1NP6A 4M9ZA 3Q72A 4NPHA 3CRVA 2FFQA 1H8HA 1DADA 1KGDA 1Q44A 4TMZA 3VFDA 2XTZA 5KO2A 4U7DA 1SKQA 1HE1C 1UBCA 1YRBA 4WVFA 2WMNB 1Q21A 2WOOA 3I8XA 1OYYA 1ZMXA 1HTWA 2PZGA 2NO1A 4UQOA 3VKGA 2GWHA 3W5IA 1DAHA 4M1KA 4TLCA 3KUCA 4ON9A 3CNOA 3KKNA 5KDOA 3RVBA 4KU4A 5FTNA 4TSFD 2O8DB 4HAXA 3LW7A 4MRNA 3CPHA 3ONWA 1AQUA 1UEJA 4LBWA 1XCGB 1G3UA 1ZD9A 1P60A 4LYAA 4YLGA 4C3ZA 3P27A 3ZVNA 3PV0A 3K0CC 3Q5EA 3A4MA 1SHZA 3U44B 4JSYA 4S2EA 3MAAC 5EXSA 5M04A 1LW7A 4M1WA 1K5GA 3REGA 4C0HA 4GFDA 3RRYA 1II9A 3K0EA 1H8ED 2RCNA 1KI6B 1F2TA 2P3SA 4F4JA 2PL3A 2YNMA 4MKGA 1PLLA 5CYOA 2QP3A 4KHZA 3G82C 2ORWA 2H8KA 4E03A 2EFCB 1Z47A 1T91A 4GDFA 1KK2A 2WVJA 4EJSA 1V43A 1IXRC 4A2WA 2VIIA 3GLHA 3F8TA 4HAUA 1R2QA 2NPFA 3W6OA 1Z0IA 3OESA 2QM8A 4C7OA 2BEKA 1N5JA 1ZJ6A 5B2ZA 2UKDA 5KSZA 4IW3B 4A82A 4MDEA 1XRJA 5KTYA 4E07A 1KKMA 5LPNA 1FNNA 1VHTA 1G20E 1FZQA 3D8BA 2V55B 4MYUA 1H8EA 3KQLA 4V0MA 4IXNA 4MRVA 3AUYA 1QRAA 1UKYA 2AK2A 5HTKA 4BLSA 1G8YA 5EE5B 2GK7A 3CB4A 2IT1A 3VKWA 2V8OA 4DSTA 2O52A 1N5LA 2JAQA 1D5CA 2Q3FA 1CR0A 3VMFA 3BORA 1NSFA 1N6KA 2RB4A 2VP4A 5A0FA 4DLVA 3VNUA 4QKQA 5CITA 2C78A 3SS8A 2AFIE 4A9AA 2NO9A 2W83A 3WMGA 5BQ5A 4NDZA 2ZRGA 4OI4A 2JDID 3GJ8A 2QEQA 1ZYUA 2QTFA 4A0GA 1P2SA 3GD7A 4RFSB 3PEWA 2A30A 3MWYW 1I4DD 2IHYA 4M1OA 1P9WA 4B33A 4R2HA 1ZNWA 4WIAA 3DMDA 3K0SA 1CP2A 4OQLA 3AUXA 2ANBA 4ASUD 1Q3TA 3QXSA 2BBTA 4UJ3A 5J4LA 5C4GB 3W90A 1R6BX 1GKYA 3ADKA 1XMSA 2GBLA 1AGRA 3SJZA
chains in the Genus database with same CATH superfamily
3AW9A 2D1RA 4L72A 4I66A 5LA6B 1MEEA 2FH5B 1GPLA 2P90A 4KQMA 2RE8A 1OLXB 4RKWA 3IAM6 3N70A 1HDYA 2VJCA 1E2DA 2QD3A 4TLEA 1P0MA 5DI9A 5BURA 2VF5X 1EZ1A 3TVYA 4R84A 2X6QA 3UK6A 5L40A 4K05A 2H0QA 3RK4A 3TUJC 4ZMRA 1E1LA 4U8HA 3R3SA 4NATA 3RVDA 2O50A 1C30A 1WBBA 4Q1FA 3K9LA 4IMPA 3B20A 4EO4A 1QGUA 4DDUA 1U3UA 4KO4S 4XIJA 5IJ0A 1FYVA 2IXBA 1VKZA 2UZAA 5TE9A 3FCUB 3H7IA 3D3QA 3FXAA 3MB5A 5EEGA 2FPOA 5BWLA 1DC4A 5IM4A 1Q1NA 2RGWA 3E58A 4PN7A 4CGZA 1Z06A 1YFJA 3R75A 1I1QB 2AUTA 3BHIA 4E22A 2RHWA 2XUQA 2I87A 1JMVA 1QBKC 1IXKA 4IDGA 2A14A 1QAQA 1M0TA 4TRJA 4UASA 5AO9A 4C6SA 2P2SA 4L4RA 3DE7X 4LF4B 1OBFO 1DTSA 3OPYA 2YIMA 4P3XA 4REOA 5AVUA 3D3JA 4ZDJA 2D2EA 2X1LA 4KWEA 1OAAA 3KJNA 4TL6A 2EWMA 2Z08A 3W3ZB 4B73A 3UHPA 2P1RA 4M2LA 1NI4A 4YROA 5IUJC 4LJKA 5KREA 2RAPA 3WBKA 1IQ0A 2FUKA 3EUAA 3I6MA 2W7TA 4MVCA 4QUBA 3OTHA 2CLCX 3FY4A 2Z57A 2R86A 1GG9A 3BQNB 2WAAA 4N0MA 1PZNA 2HGSA 3ACBA 5GJWC 5I9TA 2Y2UA 1HF3A 2EW8A 3L1IA 4F3TA 4Y1RB 1C7QA 2CNWD 4IFTA 4J29A 4GX1A 1HEIA 3GPIA 3RO7A 2PG3A 4Q9DA 1GKIA 2E85A 3PJRA 1JJIA 2QSZA 1VG8A 4B83A 1WULS 1R4ZA 2XOKA 1QQTA 1T1IA 5DYTA 3WYAA 4G5QA 2PYZA 4R1TA 1I5OA 2Q0QA 1ULHA 3LTEA 1MA3A 2PYIA 3AI1A 5B64A 1L5WA 1I3LA 1CDDA 5IP5A 1FMJA 3ZDRA 1NMEA 3H2ZA 1N4AA 4UU0A 4IGAA 4LMAA 1NBOA 3WJAA 5CFLA 4ER3A 2I4IA 2WFAA 3JRWA 2IU6A 4WPGA 4KSYA 1KU6A 4AECA 4BFYA 3CLKA 3K2BA 1KYWA 3OOSA 4L95C 1JILA 4WHMA 5IKMA 1OTYA 2RIRA 1C8VB 3PXBA 3REQB 3V1KA 1QHHA 4CHGA 1DHRA 1P8JA 5HJEA 5FPSA 1DRKA 3O4HA 2HYDA 1TAGA 5DWQA 1GL7A 1QCCA 2QVLA 1FXWF 3B1ZA 1EIWA 4JR1A 1W48A 3AV3A 4G8BA 3CSDA 1CVLA 3MGAA 3INYA 4KXUA 2WLTA 1EE1A 2FFJA 4WLEA 1YR7A 5KNCD 2CZGA 4MQUA 1XLUA 2B82A 5T64A 1O7JA 1P2BA 1TEXA 2PRYA 2C2WA 1L8LA 1KSGA 3N8HA 2ACEA 4ND1A 3VAAA 3UHJA 3ZVRA 4B6JA 5BMVF 3RUHA 5JAPA 1JI0A 3K0CA 3NGMA 4AP5A 1C9EA 2F4VB 3F78A 3QLEA 3LBFA 1EWYA 3GL9A 2H0RA 3CX6A 1CP3A 1PZXA 3C8MA 3S2IA 2D0PB 2CXXA 4X95A 3DYBA 1NASA 3RTBA 4N5LA 4EGAA 1H42A 1P1RA 1FLVA 1NF2A 2RARA 2YWBA 3OEYA 2GYUA 4K40A 4O4HF 2X1VA 1H4QA 4W1SA 3ETEA 3RC9A 3IRVA 1JG2A 2XWJI 4ZEWA 3RS7A 2XWQA 2IEZA 2QL6A 4OA5A 3RKSA 1OXVA 2CMGA 2Z58A 4WOBA 4YHBA 5EKUA 4DPLA 5FPKA 4Y9RA 5DLQC 5BYJA 5IRCD 4RIEA 3IQHX 3H4MA 4Q9LA 4ZTZB 4AO8A 4E09A 2PGDA 2Q07A 1I7NA 2ZATA 3OPMA 4YI5A 3R44A 4DIMA 3RUCA 5KOIA 2HM7A 5AJWA 1D0SA 3WGOA 4LXYA 2C04A 4ZARA 1TTTA 1KPIA 2L19A 1V8OA 2ECFA 4JQSA 3W5CA 3DTVB 5DNWA 3B7WA 4OYRA 4MJLA 4TN1A 3FPAA 3DL2A 1PLKA 1N32B 4Q4HA 2A9PA 2JH9A 3AESB 3VPXA 4AP9A 2CN1A 3G17A 2YFKA 2C9ZA 3ZWDA 3SBDA 2NZ2A 3ZWMA 2W6CX 1GGFA 3BRWD 3Q9SA 4L50A 1U9YA 3E27A 2HBZA 3N76A 3PICA 4P8RA 5JMWA 4TWBA 1E79A 3QPBA 4DJDC 1TW2A 4X20B 5KKAA 3Q7RA 5JR3A 1CYEA 1RZRD 2ZAGA 2J7KA 4ND5A 1MVNA 3GQBA 1I30A 4JK3A 2IXTA 1C0KA 2Z1DA 4XR4A 1M8KA 1P9NA 2CLKB 2WMDA 4FKBA 3HU3A 4W9NC 1M34B 3VR1A 4BMYA 2I2DA 2XYRA 3MCVA 4IXMA 1GITA 5EJ7A 13PKA 4M7OA 2C3OA 4AL4A 1ZD1A 3K8OE 3D7NA 2P9TA 4EI7A 4JOSA 1N4DA 1FFXA 4RLFA 1KZ1A 1P72A 4CDNA 4BNDA 3R7DA 2X2FA 5TX7A 2OBMA 5CB8A 3PRHA 4L57A 3GNSA 2IYAA 3NANA 3QXCA 4KK4A 4MTCA 5FBKA 4Q82A 4BEBA 3CNEA 3NKFA 4MI3A 4BMZA 5A9SA 3QJGA 2G70A 2ZUTA 2BM0A 2QD5A 2SNIE 1VIYA 4DIEA 2R47A 3LIIA 5FLEX 3UKOA 3VNBA 4M9SA 4MIKA 2H85A 3JQQA 4PC2A 1DDOA 1I7QB 1IMOA 3F7MA 2P6UA 3EGOA 2ZYAA 5E3HA 5DM1A 2V6FA 2WYHA 3GAZA 1CDEA 5COBA 1BQ3A 1NLFA 1OV4A 1YCGA 3Q2OA 4JXXA 3G5AA 4M9UA 2UVDA 3T94A 5KTPA 2XADA 2J0UA 4MWCA 3OJXA 4MB0A 3RABA 5HGXA 2CNKA 4IHAA 1OA0A 3NLLA 1W2WB 3AB3A 4RKYA 3F49S 1YBMA 4FWBA 1X7HA 4HX2A 2PT9A 4UEQA 2C03A 3PTAA 5C7LO 1YRAA 2OILA 4E7OA 4RVCA 1W30A 2J41A 3EG9B 3FDXA 1LNQA 1VCMA 3OA0A 5A04A 2Y4OA 1NG9A 3S5UA 1E1YA 4XLTA 3SBOA 4BFZA 3KSAC 4YUVA 1GTG1 1YIDA 2XNHA 4RXTA 3GLSA 3GUUA 4NAHA 4D26A 1E4VA 1O8CA 1G0NA 2B1RA 3G79A 2CF5A 4FOOA 2W2VA 4M0FA 5MFPA 1MDBA 1ZRHA 2M98A 3AW8A 3ZHCA 3W5DA 5A0TA 3FZEA 2HOQA 2JLSA 3IQZA 3KJFA 4U7JA 4Z7NB 1KI3A 2C3PA 3H9GA 2DR0A 3LY8A 2FCAA 4J9UE 2ZZMA 1GPNA 1V5GA 3E48A 3H5RA 3O8BA 3UPTA 4OYYA 3PC7A 1SO8A 5GWXA 3SZLA 3ZDCA 2YHIA 3V7WA 3WKDA 1TF2A 3NC1C 4FR5A 4RVHA 4AYTA 4WNAB 3LK7A 3RSQA 4ESHA 3RQIA 1PV2A 2ERCA 2XQVA 1NKSA 2NV6A 2Z56A 2ZBFA 2FPIA 5K03A 4N6GA 2DR3A 3IH5A 2ZI7A 5JCJA 4U2KA 3RRXA 1IHXA 4YDQA 3ANTA 3QFFA 1NQVA 4WZZA 1TEHA 2X7XA 3A1CA 3ROGA 1M9NA 4F6RA 3QPVA 5K3DA 3R2JA 3UAXA 1W4CA 4ZOAA 4YQFA 4JYAB 1GA1A 1TKRA 5E95A 2ECKA 5AVZA 3WK6A 3UUGA 1W36B 1LH0A 2F3RA 1SVNA 5DX8A 4ZZIA 4GXNA 4TLLB 1FX0B 1XHEA 3CZMA 3WGUA 3DVAB 1ID8A 2LIVA 4FYYA 3U3RA 2V0NA 4LJ7A 3RVMA 2FWPA 4ABTA 2ALJA 1I7LA 2EJUA 1O5TA 5FYQA 1TA4A 2NNLD 3AFOA 3NJ8A 4IVPA 3KYCB 4MHOA 3K5WA 1A2BA 2DQZA 3C3MA 1ZK1A 1ZU5A 1QG0A 5AW4A 2VPWA 2IEIA 2VAMA 2YJ5A 1GZ7A 2D5AA 5EE1A 4ZI2A 2WIFA 4CEHB 1PSWA 1FRFS 5ES4B 2Q3BA 4B76A 1JP7A 1GCOA 2JLQA 3WBJA 2CVHA 3ZHZA 4Q3BA 1AKVA 5BVHB 4MKIA 2QYTA 3PL5A 3SQNA 3FWZA 3D0KA 1MUUA 1XEWY 1GU1A 2J46A 5LDGA 4RK7A 4ZMSA 1TF5A 3UK1A 2OKCA 4PZ0A 2EG9A 3UFXA 2CDCA 4B82A 2LCQA 5FT9A 5JSZA 1N7GA 1PF7E 4Q39A 4HXGA 3WWPA 1YONA 3TPFA 3HHPA 4AY5A 1NVDA 2WF5A 1AKUA 4TRNA 4NHOA 2ZYSA 1Y5MA 4YAWA 1IEXA 4EBFA 4NZPA 1T3GA 3DMRA 4Q93A 2O1XA 1L7EA 3FCSB 1KE2A 3EF0A 3QWFA 1EK6A 5JY6A 3IDAA 2CJWA 2JVKA 2PEZA 4KCGA 2ZCJA 2PQMA 3W9SA 3R4CA 1GCUA 2CE7A 1LA2A 4EIWA 5DNCA 3TZ6A 5JRJA 5ED4A 2X22A 3PQEA 3QLJA 1YCDA 4HDNB 3VYTB 3ZV7A 3HB0A 5DM70 1VA4A 4C30A 1ILEA 1SAYA 1P4SA 5T3YA 1B6RA 5LBTA 4YCCA 4MW9A 2EJVA 2XE4A 5GONA 5F2EA 4EF4A 2QX7A 3AJ8A 4EHIA 4K86A 1Q2XA 3N0VA 2G88A 5CK4A 4KXYA 2O8EB 3FPLA 2M32A 4S1WA 3NUQA 2HV9A 4G0QA 1AH2A 3NDPA 3CH4B 4M1TA 3FCOA 4ZU1X 5B55A 1Z6XA 4DY4A 1BVUA 5CPFA 1X15A 1ZEJA 2EQBA 4GE3A 2UXBB 3S99A 4L85A 3VQTA 3T0GA 4M21A 3CEPB 4BGVA 1XD8A 4Y7CA 2H6EA 1H2ZA 4QG7A 1OX5A 2Z4RA 2CJFA 5FBHA 1G20B 2R7MA 1WXGA 4OUKX 3ZE9A 2K4MA 3DMTA 3ZHXA 2OB2A 3LUJA 1GPWB 1NXOA 3UGTA 1Q3KA 4U0JA 1FNSA 3GDFA 4KWIA 5IZ4A 3I8SA 3HLYA 1G6Q1 5MN5A 3ADBA 2GDZA 1X7ZA 3F6RA 4I9HA 4OQDA 5BW4A 1HQYE 3PQ5A 1TA0A 5G0SA 2AS0A 3SVTA 4HFNA 4F8YA 5JRZA 2JEZA 2A0WA 5KC9A 4YYZA 2AFIB 3AYZB 5EWMB 4GZ3A 4M0KA 5H3HA 2IVFA 2SKCA 1RWMA 3CEHA 3G8BA 4O25A 3T4UA 2ZZNA 3GPLA 2VDQB 3E0QA 1ZIDA 1DELA 3LC0A 3C4QA 2FNAA 1RNLA 5LJIA 4KLZA 1XVVA 2EJBA 4DNOA 5F9HA 3ZZUA 3OTQA 4D92A 3H9EO 3T9EA 5LD2B 2GD0A 4IJKA 4KQ1A 1FJXA 2OSBA 2JCSA 3H1AA 4B8ZA 3HCWA 1L5OA 3P2IA 1DFGA 5I5GA 3PC2A 3QIAA 1FJGB 3WISA 5CA1B 1QGAA 4LHXA 5AW2A 2WU3A 3IOCA 1H5UA 4K6OA 2JGJA 3HZZA 4R4JA 3A0RB 4FYJA 3KV1A 1RKVA 4WZBA 3F6SA 3VNVA 1VMAA 3BMCA 1ZH2A 3WLFA 1XJ5A 2ZREA 3FRIA 3PFBA 3PUHA 4HF7A 4L0QA 1PQPA 1V3VA 3R8FA 1FLNA 1VL0A 2K2QB 2X4LA 4JITA 4BFWA 1U99A 3KJQA 4FD2A 2VSFA 4X20A 2OHVA 4JV5B 2VK1A 2X0RA 1ISFA 3TBFA 2RSLA 4I1UA 4EPYA 2BMFA 2P91A 3STTA 2DOKA 3GIWA 3ZPXA 1U4OA 2A1UA 4BB5A 2JBAB 1QP0A 1GYPA 2WU0A 3FLEA 5CBPA 3F9IA 1MTZA 3BEDA 2VATA 1QR2A 2OGZA 3A26A 2ZTUA 1KZHA 2ZR7A 1AVTA 3KUUA 3EGXB 3I53A 3B53X 3CNBA 1T35A 3EC7A 1L7XA 2QMEA 4ND6A 4KQ9A 4WLFA 1FTWA 2AW3A 2XGMA 3R09A 5IC6A 3UH0A 4BIMA 1MOSA 5EKXA 1IBCA 2QBYA 1XRLA 4RHYA 4TTQA 3CR8A 4COKA 2V8BA 4GOMD 2G63A 1PV1A 2I7DA 3MRTA 3RF7A 4YMIA 1XP5A 3QVJA 1II0A 2HZBA 2CMDA 2ZPTX 4OUDB 3A7DA 3DFUA 1DO2A 5G53C 2UZ4A 2QJRA 1MB2A 1C3VA 4FOPA 5DOVA 4UM7A 4PZ9A 1KVTA 1H0KA 1DWPA 3W0LB 2A94A 3TZKA 5ALRA 3RIYA 3CBQA 1MG0A 1MGOA 1QHSA 3BKXA 3L6BA 2VF4X 5AW6A 5M5BA 5CM2Z 1GPKA 4BFTA 3STWA 4BLTA 1L7AA 4X3CA 2AKEA 2XZTA 2QTCA 2QU7A 3IBSA 4LQDA 1KDTA 4BCDA 3Q8KA 4QQFA 1H05A 1OW3B 2ZLBA 3EZ9A 2Z6QA 3G8DA 2Y05A 3LT0A 4X6LA 1M6NA 4RESA 2EU8A 1D09A 1OH5A 1GXSA 4TUYA 3ZOKA 4Z54A 4P3KA 1NQUA 1F7UA 4YY3B 1GNLA 3NHZA 4EVIA 3CLTC 3DMGA 1JG7A 3N74A 1XR3A 1RU3A 1M7BA 2G76A 2GJ4A 2GCNA 2QD4A 3LKBA 3N8KA 3UHFA 5FXMA 5TMPA 2OYRA 1X2EA 3H2YA 5KQGA 1QU2A 5IT0A 2GPAA 4KBYA 5DF1A 2NXNA 4YP0A 3JQGB 3A6DA 2OLJA 2CLEB 3RJMA 2QU8A 2C9OA 1NN3A 5E1MA 2V7XA 1JKJB 3E9EA 1S0UA 4E31A 2QX6A 3UC5A 5EVJA 3VTFA 3T6KA 2MMGA 1KARA 1W5FA 4KKVA 4QXMA 3FHJA 1HLGA 4RHEA 4KSCA 5K3CA 5G4LA 2QR3A 1Z7GA 1PUXA 2QRVA 2R62A 3ANSA 3HBNA 4CT0A 5LMCA 3Q1LA 4INJA 1ODSA 2YV3A 3OLXA 3ZGLA 4KBGA 2QAJA 3SC3A 4HZUB 1OV6A 2O1SA 3GJSA 1XYYA 2PX0A 3ZWBA 1T6BY 2X1HA 1BCRB 4JJKA 2XW6A 2OXTA 1BH6A 4DV6B 3GG9A 2ON6A 1NZJA 1DARA 3OPYI 5AI9A 5DN9A 3K0KA 5C51B 4UEKA 5HW0A 3TD2A 4I4TB 3WIDA 1QDUA 1ZC3A 2D59A 1L7NA 1S2IA 1WSDA 2RHJA 4QDOA 3SHQA 4G6ZA 3KYCA 3PGJA 1ZA2A 4O2RA 3USCS 3TJRA 3ZHOA 3N39C 2JD0A 1XU9A 3BQMB 3H13A 2VDWB 1QANA 5EIHA 3RG2A 1C4OA 1NC3A 1TGYA 3JR7A 2UUBB 4CEHA 4AJ1A 3WJ2A 4GBED 3MIIA 1G7RA 1JYFA 2IXEA 4PF1A 5EHIA 1GZ6A 1W7AA 2CVPA 1CY0A 5ECWA 4ZWNA 1VI6A 4ZVUA 2A1IA 3NCTA 1VL1A 1HC7A 3LVQE 2GM4A 4GR9A 1H0SA 1Q1GA 3Q7EA 1TFRA 4J4BA 3SVZA 5KVSA 3IIJA 2N46A 2O7VA 5C1DA 4OAOA 3C3KA 1WW8A 3PUVA 4IVQA 2VUTA 4AU1A 1Z29A 5EJGA 4CT4B 3JQPA 3SJCA 4L7QA 4ZCLA 2ZEJA 2PFGA 2OUIA 1NUQA 2W42A 5GMOA 4UHHA 2WICA 3O4IA 4BLPA 1UQUA 1H6AA 4WBNB 2O8BA 4P81A 3STVA 4F97A 3GH3A 1LEHA 2DUUA 4UNRA 4ACBA 1ZCAA 1SZDA 4IDFA 1K6JA 3IGFA 3EUEA 4N0QA 3KZXA 1P45A 4PYLA 3NNSA 3FX2A 3NZEA 3V42A 5A4FS 2O8EA 2PUEA 2RBGA 1S02A 3TMYA 4Q47A 4EFMA 8AT1A 4K6GA 4IF6A 1EVJA 3VYUB 4GXQA 2QGNA 3VM6A 1FP4A 1GUDA 5JSUA 4WXEA 4B6GA 3GWGA 3HBLA 3LYUA 1R8JA 2GCIA 1E5QA 1NVVQ 4YRPA 2C1XA 3NWPA 1ZNYA 4RPJA 5IJ9A 1E9BA 1SOUA 2WU4A 4NXNB 2KW5A 1W2GA 4O4LB 3AVUA 3ZIAD 4FC6A 5AQ1A 4H1TA 4E6PA 3LKVA 1G20A 2EKDA 2QR5A 1SN7A 1WXDA 4KPYA 1JU9A 1THMA 3T7JA 3ZBTA 1OYVA 4YGYA 1FQWA 3OZSA 4TV8B 5ARCA 4ARVA 2XSZA 2DFLA 3OE7A 1JHYA 2WHPB 1MR3F 1YV9A 2BF7A 1V1RB 2H51A 2PX4A 3FGOA 3IODA 3PNOA 4MVJG 3KAKA 4BNFA 1QV9A 2Q46A 4OSOA 4AY6A 1P29A 3OD1A 1MN6A 1I80A 5L4NA 3PITA 2PKRA 4IRXA 4OQPA 1A8PA 1IZ8A 1WMAA 3HYCA 1E64A 1J25A 4HGYA 4W5NA 3P2EA 3D2CA 1O6BA 3EEIA 3IESA 1UBJS 4X63A 5AUOB 2WWYA 3MQ2A 3QFRA 2CVQA 1D2AA 4H1VA 1NPTO 3LD9A 4D8XA 4EBBA 1ZQ1A 2PMWB 2ZE5A 2FPSA 3O7WA 4QUKA 4BVGA 1OAOC 3EVFA 4E3WA 1R5OA 4M0CA 3DCNA 3DR5A 1BDBA 2EP7A 3O26A 5D84A 2JZCA 1LS6A 4AZ3A 2H5LA 4WA7A 4BE4A 4D9IA 1I3CA 1COWD 2Q3DA 4PW0A 5KIAA 1GTSA 4HH0A 4YRMA 1K1EA 3IDSA 4OO3A 2PWBA 4FE7A 2GS9A 2AYYA 4JR2A 3ANLA 3GP3A 3X1KA 3GO4A 2AG8A 5DTIA 1LF0A 1GGJA 4WI1A 3IQEA 2HO4A 4NCHA 5IHXA 4C4YA 1L5QA 2JFXA 4LF6B 4P7FA 1RS0A 2ISQA 3FZQA 1JAHA 4FK8A 4UMEA 1GFZA 4KO2S 4GSYA 4YDHB 1K97A 1GVNB 1VYHA 4UREA 3KQKA 4I46A 2ZUEA 3LHFA 2JBAA 4FFOA 2ZS8A 1PR6A 4X8OA 1KETA 3UJCA 5IBQA 1L7RA 2AX4A 1VKOA 3KPUA 2ZS7A 5KSPA 4EUNA 1R6VA 4KH0A 1HT0A 3B1YA 4Q4JA 2HMSA 5C53B 3PKIA 2PLRA 5F51A 5AD1A 3AWIA 5FAKA 3JTEA 1UBGA 3OLYA 5DISB 3S44A 2Q1YA 4RXMA 3V8EA 1ISPA 2W2TA 1QHYA 2D2VA 3WRVA 2P5SA 1QG4A 2F48A 4PCLA 3VO2A 4JUDX 5BV1A 1LPSA 1UKEA 1OBHA 4XCVA 4DMKA 5HS4A 3V3TA 1RHMA 1JQAA 2NPOA 4NDNE 5CVUA 4J3NA 4IVRA 4PE5B 4CNBA 4I9FA 1E5VA 1NYLA 2IHUA 3CJQA 1NUSA 2VHEA 3AUAA 5C2JB 2RIPA 4DMLA 2AOTB 4FTWA 4AD8A 3ZU2A 1WEKA 3KNZA 4K8RB 3W6PA 1A0OA 4PCVA 4IFEA 3LQ4A 5KYWB 1V16B 5B58T 3CXRA 4X71A 1LLDA 1RZ3A 1W4RA 1NNUA 5DTJA 5LBIA 1YCHA 2IZZA 4Y1GA 4DLYA 3STYA 1BU5A 3F47A 5KYNA 1TYEB 2CFRA 4RAQA 3FNHA 3FVRA 2HXGA 4B4OA 2BFMA 2PKCA 4QUHA 2J9ZB 1ZOLA 5F78A 5I9IA 4O3MA 1ULBA 1OBOA 1Y4DE 3SEQA 1D7OA 3A11A 3AUJB 4J0FA 5A7GA 3WL3A 4F86A 3UB3A 3HVJA 4EA6A 2JB9A 3IILA 4TMTA 4XPIA 1V6AA 3BA6A 2WI8A 2J67A 5JAUA 1P31A 3HXQA 3VR6A 2C7BA 1XU7A 2HN9A 1VGRA 2DWUA 4LMPA 2FZCA 4CHTA 1L1QA 1QONA 1ABEA 1ZW6A 3RAFC 1ST3A 1S7CA 3P20A 5KC8A 2P2YA 4HSEA 4QT4A 5EE3A 3WLAA 2P0YA 1AQLA 4MQLA 4R6XA 4RZSA 3A06A 4YPOA 1SIUA 1Z3IX 1AZLA 3EY4A 1EGVB 2UVQA 1A4XA 4IDDA 4PSKA 3ZWYA 2OA0A 4HEQA 1UPCA 3O8QB 1PD0A 5E38A 1GFIA 1RJFA 2H1FA 3I12A 3O75A 4YMSA 1QYDA 5IK2A 1CZKA 3TI9A 4EW2A 1SR8A 2VJQA 2C94A 2B8TA 1I7SB 2OK8A 4OYLA 5GOTA 3GY0A 1NJ5A 1XZIA 1ZC4A 3I1YA 4HDKB 4FB5A 1UOEA 3C5WP 1J06A 5AM2A 2A9JA 2OXFA 1HG0A 2XITA 1NUTA 4YP1A 5BQXA 5LVAA 1USIA 2CBGA 4PZDA 1LZLA 3FYSA 2CMKA 4GQAA 2IW1A 1SUSA 3CH5A 5FTWA 5KYUA 3VSEA 1BVRA 4CKYA 4N12A 2D5LA 3BMQB 1X92A 3BGSA 121PA 5JPIA 3RC1A 4F0JA 1JJAA 3BXEA 4JJ8A 1PT6A 3FFTA 1NBEA 1GIAA 5DX0A 3VPBA 3E4DA 1F4VA 4FSXA 4JASB 4AJ4A 4MGHA 4KODA 3QRWA 4LSMA 1M2VB 2P78A 1H0RA 1GPBA 1XEXB 2WPDA 4PLZA 4RIIA 4I4TA 3WZLA 4AZ0B 5KU7A 3VOTA 2I3ZA 1CEEA 3D6VA 3KLOA 1XDZA 5GTDA 1U31A 4JWKA 4L1KA 4RLHA 4ZZ2A 2QRJA 1JECA 2O6HA 4MWDA 1N7JA 4PS0A 4RZIA 2PGLA 1QB8A 5EJAA 5L3VA 5JDIA 3PGVA 4RPCA 1I4LD 3ZU4A 3FOFC 5B3JC 5CFQA 1HT3A 1R8QA 2LVBA 2X7HA 3HJBA 1VRWA 3Q6IA 1F8UA 2JFGA 4PSDA 5I9SA 1QGYA 3FOWA 2R5WA 5K0NA 3T3PB 5LUAA 3CZ9A 4WRRA 5A06A 4QM6A 2B99A 5IC4A 2BV3A 2WJHA 3GK3A 1US8B 1R8YA 3C6KA 1QF7A 3LT4A 4JI6B 1RAHA 1D2RA 2C7VA 2QAIA 3G8CA 5TF0A 3ZGYA 3I2FA 3TRFA 2DR2A 2JIDA 1KYZA 3QXHA 2J3JA 3FJOA 3GRCA 3NYQA 3OLQA 1YI0A 2PSEA 1RHKA 3FWHA 4OMCA 4GH5A 4DJJA 3H05A 3R3YA 4OATA 4Y9DA 4YP6A 4TKVA 2XCIA 4JYCA 5CFNA 3ASUA 4QDXA 5AI0A 2E4ZA 4HN2A 3KKLA 3QU4A 4QTXA 3IBTA 1U8YA 1SKUA 2QG9A 5EOVA 3LUHA 1NWHA 3S4YA 1JH9A 1L4LA 2Z6AA 3F7TA 3FPKA 1OMOA 2A0FA 2ORIA 1UDXA 1L4NA 4H4EA 1KFCB 3ECSA 3D59A 3DUWA 4I7EA 3U3MA 1XQ9A 3PFFA 5IKPA 2JBHA 2WDPA 1JJBA 2H1SA 3B38A 1QH0A 4TLBA 2CMFA 5AIAA 1EAYA 5EUQB 4EKEA 2YV5A 1R0BA 1FP1D 2WD8A 3BRCA 3QVUA 4X6YA 4Y2UA 1GGHA 5BN1A 3FTDA 4XFDA 3BCRA 3BAZA 4RVFA 4CKEA 2I55A 4FFBA 4ZREA 1STOA 3C43A 3FPHA 5KEIA 2HU8A 2H4JA 1H6CA 2OP0A 2QZZA 5ADWA 1NR5A 1VHQA 1YD7A 3D0OA 3DKPA 2G9ZA 3GFSA 3OJEA 3JY6A 4E2WA 5HUQA 1EWKA 2O8CB 1Z07A 2P40A 3ETCA 5CLHA 1D1QA 3VKVA 2VZ9A 1FTQA 2NTYC 2RONA 4HBZA 1V25A 1VMEA 4MKXA 2JJ2A 1KORA 1G6OA 3Q88A 4OQ4A 4B17A 1NONA 5CLLA 3I2JA 2DTEA 3PXDA 3GEPA 4P08A 1RC1A 2X76A 2ZSIA 4J07A 5D85A 1QB7A 2RGAA 2E6KA 2CCKA 5DNDA 4XVCA 1G1MA 1RBYA 2KI5A 1OXTA 2W2MA 3E7FA 3TW6A 4RJLA 5LB4A 1O6FA 3I9NA 3CE9A 1K7EB 1FDOA 3EIFA 3UATA 2ICAA 3TW4A 3HBMA 3IHTA 3RAJA 2W6ID 3IAXA 2C95A 1U0TA 1V7QA 3PEYA 4RDIA 3UK7A 5ARBA 4KN8A 4K7JA 3HB1A 1G21A 3P4YA 4V2IA 4BFLA 5LP6B 1D6NA 3ZBPA 3KT6A 3ELBA 3R7AA 2DLDA 3WR5A 1FFYA 3KPWA 3VUEA 4XVUA 5CDUA 4QXAA 3GA0A 4P7GA 3S2FA 2ODBA 7REQB 4TV9B 2VTBB 1H2HA 3TKAA 2Y1WA 2NU8B 3UKJA 1YQWA 4GKBA 3PNKA 5AH0A 4F93B 3SQWA 1MO6A 1MV5A 3ABQB 5DJ5A 1I14A 2D2FA 5BWCA 1R9MA 1GTVA 4IMRA 4TYQA 5J9FA 1R9NA 3O73A 3R0ZA 3IKJA 4XZ3A 3L46A 2P3QA 5DYNA 4A0FA 4EHHA 5CDFE 2WMYA 3QEAZ 3BGWA 3DF7A 2GM5A 4HSGA 4MVJD 1M2OB 4H3HB 4F4IA 3M8KA 5CT8A 3FMFA 3HWWA 3N2KA 2RGDA 1EBFA 3GOQA 1M67A 4TTRA 4DB4A 4IH1A 4IUBS 2VPXA 4CF4A 5JYEA 4OH1A 3O8OB 1C1YA 3JYHA 2A84A 3JQ8B 1XDDA 4PO9A 1RRCA 1LPPA 2R6AA 5DCLA 3TYXA 4MEJA 1G64A 3RG8A 3SQLA 4B32A 1IY2A 3GVPA 2OHOA 2QRZA 2PGOA 1JPUA 3RVLA 3W2EA 2XYQA 1Q84A 3A9CA 4MUFA 4U2GA 3MUOA 4KNVA 4PANA 4X3PA 3KXDA 4IUCS 3RSCA 2PQ0A 2I62A 4ZKEA 1VE7A 1ODKA 5H5JA 3PNPA 2XI4A 2YWDA 4JA0A 4ERNA 3HP7A 2JCYA 3N9IA 2YFQA 4KDEA 2DBYA 1URPA 3VA7A 4ZDIA 1XZMA 1WCIB 3RS9A 2HWXA 3DBVO 1SQ0A 2XUFA 2GKSA 4OI0A 4BNXA 4ENTA 5DM0A 2I6TA 2VTEA 5H68A 1E2NA 1EKXA 5TPWA 2ADMA 1RLUA 4OQEA 4OU4A 1B2LA 1H5NA 3U19A 2DWPA 1TO2E 4EUSA 6LDHA 4QE3A 4G0XA 2OGUA 1MB0A 3Q15C 4X1OA 1O9GA 1OKKD 3UUWA 4FB4A 2V7BA 3T4PA 1SD5A 1D4ZA 2WA1A 1U2RA 2R8OA 4EJSB 2JJ1D 3MERA 1N5OX 2M9MA 3OCUA 4OJMX 3EBLA 3GLHB 4PLGA 3VJRA 2ZAMA 1A9QA 2ZFUA 4DCJA 3H9BA 3SDSA 1BU8A 2V4ZA 3MCTA 4HP8A 3FYUC 1XFAA 3H2GA 1KQOA 1M76A 1AGXA 4OJKA 1ZMRA 4HWSA 4NZOA 3PFKA 1GL3A 3VZDA 3ZWPA 2ONYA 2XWBF 2I6GA 4EECA 4JBYA 3OWOA 3ES9A 5DOZA 3MOGA 5BMOA 4G5FA 2RHDA 3EMKA 1NW8A 2V1UA 3KD2A 1RWKA 2R66A 3C87A 1AUXA 4K9RA 4TKUB 5AKEA 1RM0A 1TPZA 2PH5A 2VYVA 2ZJ3A 4IIEA 1PEDA 4YJ2B 1LTHR 4RQBA 1NJGA 2JH3A 3W04A 2XQKA 3NRJA 4EJFA 4YWJA 2GN2A 3GLGE 1JBQA 3EW9A 1Z0FA 2XTAA 3BXFA 3FNRA 2EBHX 4QBKA 3KHUA 4U63A 2BTQA 3AXSA 1I0LA 2X9QA 1WUIS 4IXTA 2JHCA 1R0KA 3HDGA 4O1HA 2HPAA 2QUIA 3LQFA 4ZV4A 4FJ0A 2GLTA 2Q5CA 3K6RA 5AOAA 4R2MA 2FWBA 4BZPA 4YV7A 3UAGA 2I4OA 3QOFA 3BMQA 1SBHA 3VR6H 2OHXA 4JEMA 1ZAYA 3H97A 1VJRA 3DDSA 4BNUA 3U4MA 1LDEA 1P77A 3K9BA 3H86A 4L9RA 1SCAA 1DU4A 2YH2A 3KJGA 2ACWA 4QYWA 1YDHA 1EVEA 1FLAA 2IXDA 1ZK0A 5BUCA 1BCSB 3PWKA 2HV8A 2IC5A 1UFOA 2QUHA 1IM2A 1M2VA 1TW3A 2ORVA 2QRHA 3IBCA 2QSJA 3CJTA 3ZLBA 1SBQA 4EF6A 1LSSA 3W2GA 3DEJA 4TRRA 4ARSA 1SXPA 3I6QA 4PZZA 5SICE 5LSAA 3VKFA 4K6MA 5LU8A 3ZU3A 1O6CA 4YLYA 3KVYA 4LX0A 2XJ9A 5EZYF 1P2UA 2Q5EA 3OFSA 2HXYA 3QEOA 4NP6A 1TJYA 1XXLA 1E4EB 3KR9A 3DV2A 5CVEA 4L8VA 5JECA 1JPNA 5C8DA 3VX3A 3FWNA 3VH2A 3VMMA 1XTQA 1UKVY 4WJZA 3PCTA 1NJ6A 5E0KB 1JSLA 2VUIB 3QVMA 4AS2A 4JJZA 3HDYA 3AINA 4IJMA 1YQ9A 3TX6A 3R3VA 2AYZA 2AYXA 5TDHA 1VLHA 4DJ5X 1RCUA 2B36A 3DTTA 3ILXA 2P0EA 4IYRA 1YB6A 4OGFA 1XL1A 5D86A 3T12A 1UJNA 1NJ1A 4B46A 4EPRA 2BKAA 4MKFA 2C2XA 2B9EA 3K1JA 2AQIA 2R25B 4YXWA 1NGSA 4LZWA 4NENB 3V9AA 2IQ5A 3PGKA 4ZVOA 1FU8A 4EMUA 4FDTA 4H9GA 5A02A 3ZS8A 2Z8XA 2ACVA 2B7LA 3HCPA 4AXBA 4EKNB 1DSSG 1OF1A 2QLTA 3GLIB 4G0VA 3DMYA 4X7BA 1U1CA 4L5YA 4TZ0A 3ZH9B 3FNQA 1AMNA 5IABA 1QIMA 1K7FB 2IPOA 1Y6ZA 3C5EA 3INGA 4YA6A 3RC3A 5DGHA 3T34A 3WL6A 3DOJA 4IQ8A 1FS6A 4GEGA 3AKEA 3VR2D 2GB4A 3X2FA 3NVDA 1TZBA 1P9RA 3HEAA 1OLOA 1YDGA 4WKOA 2A4KA 2OQVA 5BVGB 3VNRA 1UK7A 2GERA 4JLVA 3FPCA 4QXOA 4EVSA 5A2QA 2VT2A 1TM2A 3KPYA 1ESEA 1R1DA 4LYFA 2ZRFA 4BMNA 4CFSA 2B8WA 4CKWA 4R31A 3UMRA 3NHKA 3OEEA 4HDRB 1Y5IA 4B40A 2ZBQA 3RYHA 1NW7A 1PHPA 2P9BA 3GJ3A 3IX7A 4KE9A 3S28A 3UA4A 2WTMA 2HMWA 4LOKA 4M99A 7AT1A 3PA6A 4M8SA 3U4HA 4Q3NA 4E5KA 4AROA 3O03A 2B4QA 4KUGA 3S68A 3DOIA 3HRIA 5AW8A 2FZKA 3GB9A 4DWVA 2B5OA 3II6X 3FYTA 2B37A 1C0PA 2CBXA 2WFZA 3BIOA 1FBNA 4HTFB 3KFLA 4C0XA 3UTCA 3DLAA 5INTA 1L7VC 4RD6A 1WU8A 1ECJA 4J49A 5A9TA 4IWYA 2RGXA 3L0SA 3IE0A 4BVJA 1PJRA 1UZMA 4RA9B 1KZ4A 2FPGB 1ZUHA 1N8TA 3MJCA 3VOBA 1XWWA 1E3DA 2A2ZA 2QNIA 1FDWA 5CJ2A 1WV1A 1I7DA 1ZUNB 2W2KA 1HNNA 5FLKA 2G1UA 4KP7A 2N47A 1ORTA 3ND8A 5LDHA 4OOEA 2DRIA 3E8MA 1IB0A 2A5FA 1USVA 3Q9LA 2HO5A 3IIMA 3QK7A 4DAEA 1PT9A 3H18A 2VCEA 2L69A 3E5MA 3AVWA 1ETUA 1RI2A 1WW2A 3I73A 1IK6A 3ZR4B 3DLHA 5CB4B 2QYHA 3AM4A 3HCBA 2YZ2A 1Q11A 2GBCA 3QPCA 5F12A 5T4BA 2ECQA 1ZUWA 1JIIA 1WL8A 2P5YA 3E9MA 4OVKA 1TJPB 1X3SA 3FZGA 4ZO6A 5JPCA 2EDCA 4YPVA 4F5DA 2VTBA 2JLVA 3WWZA 3CGWA 4NKRA 2HJVA 2AR7A 4Q4AA 3K0BA 1R6XA