2ZIAA

C4s dck variant of dck in complex with cladribine+udp
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
241
structure length
220
Chain Sequence
RIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNVGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Elucidation of different binding modes of purine nucleosides to human deoxycytidine kinase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Deoxycytidine kinase
total genus 87
structure length 220
sequence length 241
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2008-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ziaA00
2HCJB 3WBKA 2F1RA 3EG5A 4KAXA 5TARA 4DLTA 4BFSA 3ZH9B 3ZIAD 1T9HA 2OCYC 4CVNA 1KY2A 1R7RA 2ZRLA 3GFTA 2EFDB 3PQCA 4UNQA 2XTNA 1XP8A 3AVUA 2FZ4A 2C8VA 3E5HA 3KQKA 3I3SR 3MJHA 2PCLA 3JVUA 2WJIA 1KI3A 4Z51A 1I2MA 4IDOA 4TZ6A 4RJLA 3PEVA 1QVRA 1W36C 4O25A 4RZ3A 2RKOA 4Q66C 4BFZA 3SDZA 2VP9A 3EZ2A 2EWWA 2RGCA 3OFND 2OO7A 2JJ1A 2ZSBA 5G3YA 1VHLA 1SVLA 3BFVA 4LPSA 4UXJA 3KKNA 2OFWA 3FMFA 4QHSA 5B57C 3H84A 3IDQA 2CL6X 3EZ7A 2AK2A 3VNUA 3EPJA 4CEIB 5EUMA 3BFKA 1J8MF 1U0JA 1R0WA 2ZR9A 4US1R 4RZXA 4C4PA 1HE1C 1EK0A 4PPQA 4B35A 3ND9A 5TXGA 1YZGA 1G41A 3IBGA 4B73A 5B64A 1SGWA 4I1SA 1EX6A 3QJYA 1HTWA 2LKCA 2G0TA 2Z4SA 3EPHA 3QG5A 1ZVQA 2Z6VA 3HU3A 4GNKA 1KDOA 4JL8A 4KVGA 4C0QC 2J3EA 4L15A 4E09A 2WMNB 2B7BA 1SVIA 2HXSA 1S9HA 1OYWA 2NPIA 4UNSA 3U3RA 2AKYA 2YHSA 1GNQA 1LTQA 2G1JA 1AGPA 2FGJA 3JZAA 4D81A 3KQLA 3IILA 4HAUA 4FMDB 3QF4B 3THWB 2VA8A 3B1XA 2Y8EA 2GZAA 1U8YA 2ORVA 4A4DA 4LI0A 3F8TA 1GIAA 1JALA 5JRZA 1D8TA 1HEIA 5JI3E 1GP2A 3CPEA 3QXSA 5AJXA 4EDHA 2OAQ1 3OIVA 1RJ9A 1ZNYA 1QHHA 4S35A 4ASUD 1XPRA 1XTJA 4DSNA 5BN3A 3LRPA 721PA 1P9NA 2J1LA 4PHTA 1SKYE 2VHUA 3A36A 1CLUA 5EE0A 1XNJA 1E1QA 2GEUA 3S1AA 3W34A 3ZD6A 1A5TA 2WWWA 4DB4A 1Z5ZA 3ZS9A 3KB1A 3VNVA 1CJVC 2QAGB 4A9AA 4EJSA 3K0AA 3THWA 5BYKA 1OXUA 3CF0A 3CX7A 4CYMA 2W58A 4MDFA 4JLPA 1MT0A 4B75A 2PX3A 1R5BA 3F3YA 3CF2A 3VR1A 3KQNA 3A1VA 2QEQA 5D3MB 4D0GA 3PUWA 1KDPA 3HP1A 1HQCA 1D2EA 3LO5A 1G1MA 3TE6A 2FSGA 3ZQJA 4DHEA 4JLKA 5BW8A 4JYBA 4XTRA 4F91B 4U7DA 1R0ZA 2IYVA 1OFUX 4XVQA 1BH2A 2CNWD 2ZI7A 3TR5A 3SR0A 2DFNA 2GHIA 3KXKA 1MO4A 1IN6A 1XCMA 4UXIA 3K70D 1G7TA 2IW3A 2LCFA 1C9KA 5F9HA 3QKSA 4JL5A 2K5UA 1JECA 3TQCA 2JGNA 2QG6A 2ODBA 2AK3A 5TB5A 2IL1A 2JLZA 3NBZC 1NBMD 3GLHA 2X2EA 1D9ZA 3BC1A 4MH0R 4TSFA 4O3MA 1A4RA 1E0AA 2F43A 2GJ9A 4H1UA 2OBNA 2J0UA 4A36A 2BV3A 3D6TB 1PLKA 5HPYB 3U6BA 1UADA 3WY9A 3RWMB 3ADDA 1M7GA 1NSFA 2VO1A 1U0HC 3X1XA 4UXHA 1QHSA 1X1SA 2C03A 4OQFA 1NVWQ 1DAGA 3QF4A 4TL9A 4V03A 5AUOB 3VTKA 2XZOA 1GUAA 2HJVA 1U8AA 1G5PA 2QP3A 3MJRA 2DBYA 5GVRA 2QT0A 1V43A 3LLMA 1KK3A 3DO6A 1DAKA 1A2KC 2W2XA 4NBSA 3T15A 2R6DA 5JHGB 4Y0VA 4B6EA 4WXRA 5EE3A 4BLTA 3PUZA 4P4TA 3GLIA 4I1UA 2J87A 2BCGY 1LS1A 2IS6A 2PCJA 4K8OA 1G291 1HY3A 2DR3A 3UG7A 3QKRA 1IXRC 2JAQA 2GF0A 1IN4A 3VFDA 1DS6A 2YC4C 4DLUA 4IXMA 3A1SA 1WP9A 4OI4A 3RDPA 3REFA 3EWSA 4M9ZA 4MYCA 1KAGA 4MGIR 1SVKA 1E2NA 1KO4A 3X1YA 2AWOA 4HEJA 2OILA 5KDLA 2YNMA 5K8TA 4IDQA 2W83A 4JS0A 4C0SA 5JECA 2ZYWX 1DE0A 3TJZA 2FF7A 1N5IA 2WTUA 2CHVA 2ZI3A 1JI0A 4FMCB 3FMOB 1CJKC 2BVNA 3L8YA 3ND8A 1Z63A 4DLSA 4TMXA 4BE7B 5CJPA 4JVSB 3C8UA 4M22A 3Q9LA 4BLSA 2O8DA 1BMFD 3IKJA 4B6FA 4JLVA 3GMTA 4M2LA 4ARZA 4LJ4A 4BECA 1CTQA 2PH1A 3P20A 1EFTA 1TU4A 3GCGA 3ICQB 2ODNA 4IVPA 3C15C 4E22A 1U2RA 2PMKA 4V02A 1UKZA 1KDTA 3TW8B 2RGAA 2WVJA 2ZJYA 4A0RA 2D06A 1N6LA 4IFEA 4Q7LA 2ERXA 3BOSA 1HQYE 1KK1A 2FJUA 4LJ8A 4MITA 4PFSA 1ZD9A 4D82A 4Z54A 1IY0A 4OQLA 2H5EA 2OFXA 1ZM2A 4DRZA 5KNBA 2O0JA 1D2MA 2GDJA 3PVSA 1SVOA 2P67A 1FUUA 3UANA 3NEJA 1NN0A 1ZNWA 1A7JA 1IY2A 3H4MA 4ON9A 1ZM3A 3I32A 4MGZR 4TLCA 1ZNXA 1P2SA 3HU1A 3QPUA 1XCGB 621PA 4HYYA 1ETUA 1KHTA 2WV9A 4M9SA 1P4SA 3LQQA 2R2AA 4PPNA 2ZYUX 4M1WA 3E70C 1E2IA 3IGFA 1SXJE 1KO7A 1UKEA 2KBFA 1T8UA 2H16A 2NMVA 3CRVA 5JJIA 1GTVA 4NP6A 3BAFA 1CIPA 2QUZA 3BH7A 5JLJA 2BC9A 2FA9A 2MSCB 2A5YB 4DT1B 3T35A 3NBFA 3KB2A 5HKKA 3H1TA 1XMIA 2C9CA 5TY0A 5DIFA 1T4GA 1E69A 4DLYA 3P4YA 5FOVA 1US8A 1CS4C 4EJSB 1VIAA 3AVQA 3GEHA 2IYTA 2IYZA 2WJJA 3BB3A 1G16A 2IXEA 2WPDA 3DZDA 5CJ2A 5FBRB 2QE7D 1E2FA 3OIWA 2ZI6A 4NE2A 4IJMA 3NC0C 4YC7A 3U7HB 5DH9A 2QRZA 3THYA 1MO6A 2JIZD 4IOLA 1OHHA 1FPMA 4QJ4A 4Y0AA 4FWIB 1NKTA 4QGGA 2GEDA 4HDQB 5H68A 2N46A 1G7SA 2WM9B 1MH1A 5HR5A 5TV2A 5JWHA 1J7KA 2OEPA 4JBYA 4P4SB 1AZTA 5P21A 3WRYC 4B47A 4EQ6B 5JEDA 1LFDB 4JLBA 2ZRBA 4LYJA 2B6HA 5L3VA 1ZNZA 3EPLA 1XD2B 4TMVA 2I3BA 2GAAA 4OHXA 2QPAA 4IVQA 4ERNA 3GPLA 3RABA 4DB2A 3EXAA 2CCKA 3BBPA 1J2JA 2MSDB 2D3WA 4NMMA 1R4AA 1N6HA 2BCJQ 2RGNA 3AH8A 1DO0A 1DG3A 1TQDA 1UF9A 2B8WA 1MR3F 3EC1A 3GQBA 3I73A 4FXPA 4B3XA 3PR1A 1SKYB 2UZ3A 1EXMA 2OESA 5FTLA 1YR9A 3TRFA 1E3MA 4G01B 4LPKA 3BK7A 2MMGA 1TEXA 4B2LA 1Z2CA 2AL7A 4TYQA 1P72A 3MWKA 3DVLA 4DLRA 4L9WA 3AUYA 4PO1A 2OFOA 4C2TA 1N5JA 5JI2E 1XWIA 3CRQA 3CWZA 5JEEA 3W5JA 2ZUBA 4OI0A 2ATXA 2IYRA 3U7GA 1W5SA 3B1WA 1GAJA 2RGDA 4W5JA 5KOYA 4HZUB 4AK9A 2A5GA 4RFSA 2OCPA 2B21A 3AM1A 1JQJC 4TL8A 5FOSA 5CITA 2FE4A 1UBCA 4GP6A 3VR4A 2J5XA 2AX4A 1XPUA 3JZMA 4HSEA 2RMKA 5EUQB 1COWD 3PXGA 3TAUA 2QU8A 4ASUA 2CBZA 4QFMA 3DOFA 4PANA 4GZMA 4UKDA 3W5IA 4EFNA 1TL7C 3UK6A 1E9DA 1OW3B 2HCBA 2C95A 1T5IA 1LY1A 2BBSA 4QBIA 3QKUA 521PA 3EA0A 1P61B 2V54A 3FMIA 3L2OB 4M1OA 4CGZA 5K8UA 4GMXA 3VR5A 1Z22A 4ZKDA 5J4HA 1W2HA 1Q1BA 3V00A 4KODA 5BN5A 3AVOA 5FOXA 4Q9KA 1HURA 4TLBA 1AS3A 3CLVA 5CLLA 2X1VA 3SC3A 2QPOA 1K6MA 5L3SA 3U44B 4MUAA 4Q9LA 4N3NA 4NU0A 2CXXA 3J81k 5AJZA 4ZDWA 4ZO4A 2JLXA 2PBRA 4RSGA 2ZRHA 421PA 3ZVNA 3THOA 2ZSDA 3VR2A 4N0EA 1F2TA 4L9SA 1DBSA 3LW7A 4DVGA 2RHMA 2R44A 5C4GB 1KI1A 4Z1MD 2FSIA 3C5CA 4X8LA 4EFLA 2B7CA 1SZPA 3EARA 5DISB 4EUNA 4M1YA 4MQBA 1N0WA 3GEEA 2OT3B 4PZZA 2FZLA 1KI7A 4KLZA 4A2WA 5C4MA 4LOAA 4DWJA 1I2DA 2HT6A 4PPFA 4RKFA 4M4SA 1AGRA 3U7FB 5EP2A 4QNRA 3IIKA 2R9VA 4PR0A 3A4LA 1AZSC 3A4NA 4B2IA 1IOZA 2GBLC 2RCNA 4QC2A 4RFSB 1E32A 1JQLB 2VSXA 1QHNA 1ZINA 3QY0A 1L2TA 2WBLC 5DHAA 1YZQA 4O0MA 2FH5B 5LDDC 1W0KA 1JAIA 3LX5A 4IW3B 3KUCA 5DO9A 1JXOA 3GP8A 1FMJA 2VP4A 4KSCA 1G6OA 5E7IA 1ONBA 4POAA 4LYAA 2ZAOA 4Z8XA 2PEZA 3SJBA 2JLWA 1EFCA 4DLWA 4DT1A 4HI0E 4Q18A 3RHFA 2I4IA 3CBQA 1SVWA 4XJXA 1VCOA 5FPHA 4F92B 2P6UA 3AKCA 3L0SA 1K8RA 1EX7A 2O8BA 4LV5B 4DDTA 1M7HA 4CW7A 4I99A 3VHXA 3WXMA 1P2TA 3T5GA 3G82C 1RKBA 4KXFB 3VMFA 1G6HA 4C0JA 2GVDC 5FI0B 5EP3A 4XVRA 3DL0A 4R98A 4ZV4A 1A2BA 2D4HA 4ZIRB 1A82A 4OBEA 3WP0A 1E0KA 4IOJA 3GLFE 5G3ZA 4EQ6A 1AKEA 1MRNA 2L0XA 4DUGD 1JB1A 3GJ7A 1YZUA 5J5CA 3RNLA 1KSGA 4EPXA 4QM6A 2VF8A 3AGQA 5GJWC 4P3YA 1ELOA 1XFAA 3HPRA 3N5CA 2CHQA 1ZIPA 3TSOA 1WBDA 5FPYA 1E9RA 3TH5A 1RPZA 2WAYA 4FMCF 4XSHA 2JLVA 3AVVA 4L8GA 3CWQA 1EFRD 1Q3HA 2UKDA 1E99A 2OXRA 3ZZ0A 3Q85A 1M6NA 5FUVA 3L8ZA 1E4YA 1TQ4A 1EG7A 4GOKA 3ZVMA 1U9IC 4ZKEA 1YZTA 3R20A 3CPJB 2XITA 5J4LA 5C2JB 1E4VA 1UAAA 4II7A 2VHJA 4ACBA 2J7PA 3MGCA 4AC9A 1S96A 1CR4A 1QHXA 1NMXA 2CLCX 2C78A 2DFKB 3N70A 5AJWA 2NO1A 1VYVA 3PV0A 4Z8YA 2BHRA 4QNMA 1NL3A 2AFIE 5DI3A 2P6NA 3VR6A 3ZLJA 4HLCA 1J90A 2QSZA 4CEHB 1NN3A 3KTAB 5FR1A 4LHZA 1G21E 1B23P 3RANA 1KZ7B 3KQUA 1IJFA 1KI8A 4OQNA 1VG9B 1FTNA 2ZR7A 4MGYR 3RWOA 4TZ0A 1P9RA 3LQRA 1PV4A 3GJXC 2JLYA 2Q6TA 4I81A 2CVHA 2OE2A 4KBFA 1WF3A 1TTTA 3BB4A 4NL4H 3AF0A 1XXHE 3P32A 4BZPA 4GMDA 3GLGE 5CIWA 1UJ2A 3UMSA 2IYWA 1NSTA 5CDFE 2R6CA 2XJ4A 1AN0A 1N25A 5DE3A 1W7AA 1P73A 1SXJA 3EA5A 5CIQA 1NBME 5FBLB 2VHQA 2ZI5A 3EIQA 4TN1A 3OHMA 3RC3A 4D4LA 4HAXA 2Q3FA 3CH5A 2JJ8A 3AF3A 4K81B 4Q21A 3WBJA 3Q8XB 1Q21A 4MUBA 1T5LA 2IEZA 1SXJB 2C77A 2NO9A 3IHLA 4Q1DA 4QOSA 4F93B 2XNDD 5JSZB 2BBTA 5JCZA 1AS2A 4LUCA 4DLXA 4A2QA 1DAFA 2G83A 4TYPA 2XSZA 1TNDA 2NO0A 1ZC4A 1F48A 4TTRA 2NZ8A 3AKEA 3I92A 3SYNA 1KI2A 3AVWA 4C7OA 4UQOA 2G88A 2AN9A 4C0LA 1WB9A 2B92A 2P3SA 1Z06A 4FW9A 3BH6A 1OFIA 3E1SA 2IS1A 1Z6YA 2Z0MA 4KVAA 1VCIA 1RC8A 1IONA 4M8NE 4ZPXA 1ZAKA 1W49A 1E2PA 5FBWB 5KSPA 5JRJA 2VEDA 1OKKD 4BLQA 3MLEA 3LD9A 2WWIA 5AUQA 2DPXA 2H17A 4E03A 1ZUNB 2ZJ8A 4PSAA 4WZAE 4Q1EA 1XD2A 2O0KA 2ODWA 3K0AB 4JLOA 5LPNA 5FOUA 2ZANA 2ZE5A 4XVUA 3K0SA 1T0JB 1NVXQ 1NP6A 1Q44A 2HYDA 2RH5A 1NG9A 1XBTA 1WDTA 4IHQA 4PHHA 2FFAA 3REGA 4PHGA 2XZLA 2YZ2A 1JR3D 2G0NA 1G4UR 1KNXA 3V9PA 1QHHB 2J0UB 2HEIA 1IHUA 2WZQA 3CB4A 1T8TA 2ZRJA 1II9A 1FW6A 1RW4A 3B1ZA 4CRWB 3MUFA 1ZCAA 1QG2A 1KK0A 2CJWB 1US8B 4LBVA 3HR7A 2ZE8A 5JS8A 5KSYA 3AQ4A 4BLOA 3RAPR 2ZRIA 4LY6A 2HT1A 1NY6A 3TLXA 4PAMA 2IUSA 3CM0A 1G19A 2WMOB 3T34A 1QZXA 2ZSAA 3ETLA 3NBXX 3K1JA 121PA 2ZR0A 4AYTA 2YVUA 2QAJA 3C16C 3KKQA 4DEYA 2ANBA 3EIEA 4GSYA 4FMBB 1S3GA 2ZYTX 3Q72A 4W5HA 4C0AC 3U5ZB 3PUYA 4LX0A 2EU8A 4NPHA 1VYTA 4ZIRA 221PA 4GDFA 1L7VC 2P5TB 3PEWA 2VPPA 2V4ZA 4TQUS 1NVVQ 1PUIA 1NF3A 1RE0A 1KJYA 1L4UA 1OT3A 2OAP1 2QT1A 5AR1A 2WPDD 4DJTA 4ZI3A 2BEJA 3SYLA 1YZNA 4OQMA 1YR8A 4JJZA 1MABB 2IWRA 1E98A 4K46A 1LF0A 5AWFC 2FEMA 2BBWA 4MYUA 4Q7MB 1XF9A 3AF2A 4MYTA 4QXAA 4AWXA 5HKKD 2REOA 1II0A 5FL3A 5E7MA 2HLDA 2EQBA 4NKRA 4L4UA 2ZTSA 2IEYA 1JBKA 3DM5A 1LS6A 1R2QA 1WQ1R 3CIOA 2F3TA 2EFEB 1E1RD 3FHTA 3B82A 4Q4HA 2VIIA 2ZEJA 5KPJA 2VP2A 1XEXA 3EAQA 3B78A 5KNDA 4TT3A 5KDOA 3DHWC 1W4BA 4NYJR 2JA1A 2J0SA 4GBMA 2FV8A 4Q7KA 1G3IA 2PX0A 2VP5A 1J70A 3QXJA 4LHYA 1RRCA 3SBDA 2Q9CA 4BFYA 2BDTA 1N0UA 5DI9A 1HUQA 2QGNA 1MO3A 4R7ZA 4LDJA 5GJVC 4TWZA 4BEJA 1W4RA 4TLAA 3WRXC 2IS4A 3CRW1 3U3MA 4BASA 1P6XA 1OXSC 4NZYA 4HB2A 5HZHA 4NCKA 1W2GA 4DCNA 2ZITA 1AK2A 1H8ED 4LSGA 3HPQA 1NI3A 4JYCA 2VHCA 3FFAA 5FTNA 4KCGA 1ZC3A 1ZM4A 3HJNA 3PCRB 4URYR 1MOZA 2C99A 3RS4A 3BERA 4QKQA 1ZM7A 4R9UC 4OI1A 3QKRB 4D26A 5K8LA 1WCV1 1NVVR 2ZUDA 3DPUA 3CONA 4UJ5A 3I8SA 4CEIA 4EPVA 1W44A 4Q19A 2G6BA 1PUJA 2EFGA 3EWAA 4LCBA 4G0NA 4E07A 1UBGA 1SULA 2GJAA 2ZVPX 4Q7JB 5L3SB 3U44A 1DO2A 2XEXA 3QG1A 3ZDQA 4QM7A 1TUEA 2NZJA 4CDGA 3WHKA 5H8WA 3AKDA 1EWRA 2ZRMA 4MRSA 3ONWA 3SE0A 3IIJA 1Z07A 2WWFA 2UVQA 2ZREA 2QAGC 1ANKA 1ESNA 2CNWA 2Z5FA 2GXSA 5L3QB 4Q1BA 1GL7A 2GETA 2J41A 3LXRA 4TTQA 1M1YE 1N2CE 3BJIC 2YWEA 3DEFA 2W2TA 2I1VB 3R7WA 4D0NA 3IUYA 1CJUC 3EZFA 4IDHA 4OHVA 4U00A 5EZ5A 2XB2A 2A2ZA 1KDRA 1VPLA 2ZYVX 4UNRA 2QP9X 4TSFD 1RIFA 3I8XA 3LBNA 3K9GA 1XTQA 4KO8A 5C1BA 5FBVB 1KNQA 3AF1A 5CLQA 1XD8A 2AHOA 2B8TA 2SHKA 5FH9A 5LBIA 4A0GA 5JWOA 1R0YA 2G1KA 4C30A 3CH4B 4CZ2A 1HH4A 1VKJA 3TAHA 1KZGB 1XXHB 1Z0FA 1BYIA 5CYPA 2CL7X 4GOXA 1O3YA 3MAAC 2WIAA 1GOTA 1NLFA 1Q1QA 2J7PD 2X8AA 2EWVA 3ASYA 2HDNB 4YMSA 4WZ6A 3U4QA 5EP4A 1GSIA 1HV8A 3EX7C 4HUQA 1UDWA 4Q4LA 5FFMA 3SI7A 2ZRAA 4FMDF 4C0HA 2GVZC 2GRJA 2A5DA 2JCSA 4JKIA 4W9MC 2AD5A 2QP4A 1XZQA 4FI3C 3MWJA 3MFYA 3QSYA 1AKYA 1VG8A 2QBYB 1Q20A 3OESA 4PC7A 1WXQA 2V1UA 4IRUB 5IHPA 3R9IA 4M1KA 3CNNA 2F55A 3PFIA 2X2FA 1KO8A 2YOHA 1T0HB 1EFUA 5FOWA 3OIUA 2FMXA 4OK5A 2D2FA 3NEYA 3I4LA 3DZ8A 1DVRA 3RS3A 4DCTA 2WWXA 3K9HA 5EXXA 1GITA 4RD0A 4BRUA 5LB4A 2NOAA 5FUYA 5KU1A 2GZDA 4KFRA 4RZUA 3FVQA 4YQFA 1ZYUA 4WBSA 5ELXA 1ZBDA 3IPXA 3QKTA 1KSHA 1RJ9B 3DKVA 4I4LA 2PT5A 3QI2A 3U2QA 2FFHA 1JR3A 3THYB 4RVCA 4ESVA 4P32A 1ZRHA 3SQXA 3VX4A 3I62A 1G7RA 5AUPB 4KFTA 4XWOA 2A9KA 5JZVA 4PSKA 2ZJAA 3CR8A 5L3QA 1E0JA 3QEOA 4OI2A 4HLUC 1IM2A 2DWQA 2O52A 2VHTA 4LJAA 4RD1A 4DEXA 2O8CA 4BFXA 1G3MA 3W8NA 1YKSA 3EC2A 3GJ8A 3PG5A 3TGPA 5TVKA 4UNNA 2KB0A 1Q3TA 2ZROA 3AVTA 1Z28A 2CDNA 1GRNA 2FWRA 5HCIA 3B5JA 2OSBA 2X77A 2W6ID 3AEZA 3IHWA 1OE0A 1N5KA 3BS4A 4YONB 3MWLA 1GL6A 2FPMA 3RS0A 1KSFX 1IXSB 3ZZUA 2FU5C 3IO5A 1OXTA 3GLGA 5DYIA 4PC1A 3U4QB 1VCNA 1IN8A 5AJYA 5L3RA 2VP6A 4MRVA 1TU3A 1Z6GA 1Z6AA 2CCGA 2WJGA 3BB1A 3D7MA 2HUPA 1J8YF 3FOZA 2Q3MA 1CR1A 1UBFA 3QVVA 3L0PA 2CLSA 2XJ9A 2XOKA 2GESA 2YWFA 4IXNA 4H9GA 3OE7D 4URVR 3C7KA 4KYIB 3QNUA 3GJ4A 3SFVA 2J9RA 1AM4D 3QIAA 3QEJA 1OKKA 3UWKA 3CRRA 4LWZA 3CZPA 4YXWD 4UNPA 2J46A 1G3UA 2IT1A 2ZS9A 2IHYA 2BM0A 1W4CA 5H1YA 4EJSC 2IK8A 4JL6A 5EE1A 3B8HA 3GLIE 4AG5A 1X8KA 1XEXB 3FTQA 1BMFA 4BZXA 1U8ZA 4BFTA 1LF5A 3W90A 4PXAA 2N42A 2WSMA 1XTIA 4M53A 3CR7A 1QHYA 2XSZD 4BWYA 1E2MA 4WIAA 3FYHA 5BN4A 4RZ2A 2ORIA 4BUJA 2WWGA 1O87A 3NTUA 1AJEA 3KQHA 3OAAA 2XXAB 4BRWA 1ZD1A 2E9SA 5CB6A 1AS0A 2XNDA 3OEEA 2D7DA 1SVMA 4LGMA 1IXZA 2P5SA 4U5XA 2GNOA 1V5WA 3H2YA 2ZRCA 4A92A 3RS5A 5L8VA 2O8CB 1Z08A 3GJ0A 2QNRA 4YMUA 3UWOA 3GLIB 3PUVA 3D3QA 2UZIR 1E9SA 1FOEB 3K09A 1SXJD 4JBXA 1Z0IA 4HLUA 4LHXA 4M1SA 4ZI2A 4Q1FA 2GKSA 1PJRA 1H8EA 2QQ0A 5EE5B 2QTVB 2NPFA 3B13B 2NIPA 2IF0A 5DSZA 3SZRA 2OCBA 1RYHA 5F3WB 1KKLA 1CF4A 1S4QA 2QE7A 5FPSA 2VYFA 2WWHA 2GK6A 2RGXA 4XOIA 2RGNC 1YVDA 4ITRC 1IY1A 4Q9IA 3CUEF 1SQ5A 2ANCA 2CMKA 2VTKA 2YWGA 2ZPTX 2CJWA 2W2VA 1YU9A 5DYGA 4JKYA 5CK4A 2P6RA 4ACAA 2QM8A 1G64A 4OK3A 1QDEA 4TT3D 3SEAA 3CX6A 1GRQA 1DAEA 4ZCIA 4PQFA 3FWYA 2H1LA 3NH9A 2VF7A 2HYIC 4JBWA 1JEEA 4DDUA 1DARA 1DG1G 2ZS7A 3Q5EA 2QN6A 4AIIA 2GCPA 1GKIA 2Z4RA 1UFQA 1EFHA 4V0LA 2QBYA 5J47A 1CU1A 1G8PA 3CRMA 4L5BA 1CJTC 3KJEA 2FGKA 4Q1CA 4B43A 1YR6A 5EE9A 1E2LA 3UXMA 4WOPA 3FDIA 1DEKA 1R0XA 1UEJA 1OFTA 3QVUA 1WBBA 3AP2A 3NBYC 4FCTA 3G5UA 3H86A 3UATA 1G18A 3MWYW 4F7WA 2DYKA 5UKDA 1JR6A 2WICA 2A7QA 1OIXA 1QRAA 3RC8A 4HB3A 5KPDA 2KE5A 1YHNA 2PMDA 3TMKA 3GLHE 4LC0A 4D25A 3K0CC 5KO2A 5HE8A 1S8FA 2FFBA 3WNCA 2EW1A 4DSTA 3IEVA 4V0MA 3TK1A 5A4JA 3WYAA 3TSZA 1FX0B 3B85A 1DELA 2H7VA 1MKYA 3Q7PA 4LBWA 3ADCA 3A1UA 1LW7A 4NYIQ 4A0FA 4ZDJA 4Q4AA 1E9CA 1X8JA 4C7OB 2TMKA 1G7CA 4QBHA 4Z1MA 2PZEA 2E1RA 1CR2A 2MSEB 4QHTA 3Q3JB 1G8GA 1KSJA 3FKSD 3A1WA 2F1IA 4JLDA 2O8DB 1GILA 1HYQA 2IC5A 2JDIA 1G8YA 5AJVB 3MCAA 4ZDIA 3UMRA 5SZHB 4I1OA 1ZUHA 3UPUA 3THXB 1FTSA 4GL2A 5KYKA 3IO3A 4OQXA 4BPBA 2HXYA 4Q47A 1FUKA 1HE8B 1KK2A 4WAUA 2ZU6A 4KLNA 3GLFB 4DLVA 1I4LD 4M1MA 1W1WA 1Q22A 3EW9A 3QBTA 4HB4A 3U3KA 1FP6A 1KOFA 1KMQA 4LJ5A 4URZR 4V0NA 1P3JA 4BZQA 3KX2A 5GJBA 1E9AA 2QPTA 1OF1A 2R62A 3QPVA 5G53C 1UKVY 4N0DA 1KI4A 2C04A 4JZKA 4AURA 5LD2B 2AR7A 3W8RA 2XXAA 3R9XA 2AKAB 3DKPA 2G9NA 2O8FB 2CLDX 4HAVA 4ZCMA 2YV5A 4EAQA 3GJ5A 4HAZA 2ZIAA 4NYJQ 2AD1A 1HT1E 5FPKA 5JHHB 5K8IA 4LK2A 3KJGA 4AKGA 2REXB 3QQ5A 2BM1A 4GRAA 3NHBA 1RYFA 4CEJB 4HAWA 1KO1A 3WYFA 5FOTA 4B2PA 2OCAA 1RVDA 3A4MA 1G5TA 1TF5A 3O8DA 1VDZA 1NIPA 1E94E 1VG0B 2YWHA 3AP3A 3PEUA 2ZRDA 4GOJA 4JVLA 1D9XA 2ERYA 2WJYA 3FHCB 2AFHE 5JS7A 2BOVA 3QXHA 4DDWA 2ATVA 1Q1EA 3NC1C 4BGDA 3LLUA 3DMDA 1T6NA 4XSGA 4V0ME 4QRHA 4NCJA 4LYFA 1G3RA 2GK7A 5JSZA 3SYKA 4JT2A 1C1YA 2JJ1D 3SBEA 5KTYA 1OH6A 1G5RA 1TMKA 4MKGA 3B60A 2ASEA 3X1ZA 5G40A 5J4VA 2R6GA 4TQ9A 5BWMA 3VHLB 1M2OB 1RRGA 4HZUA 4OKSA 4DCSA 1Q57A 1ZIOA 4F38A 1VCMA 3BXZA 1QG4A 4BEBA 2XNSA 4QGAA 2QORA 3BWDD 4KU4A 4MGKR 1XX6A 2GCOA 3K53A 1R8SA 3U6KA 2XGJA 1F2UB 5KUTA 4LJ9A 4Q4JB 4DCVA 5SZJA 3R8CA 3HR8A 3OEHA 3LAWA 2X19A 2CK3D 3GLGB 1DAIA 5KSZA 2QROA 1E9BA 4TLEA 1JPNA 4JIMA 1Y3AA 3E2IA 1N6OA 2BIFA 1P60A 2FSHA 3WP1B 4PO8A 3A8TA 1LB1B 1ZMXA 4I1VA 4LHVA 4OJQA 3TNFA 3B9PA 3NDPA 2WKRA 2Z43A 2DHRA 4B34A 2JLSA 4C9BA 2IYQA 3KTAA 4LRWA 3O8RA 2ZXUA 3EPKA 3ZD7A 3ZJYA 5H70A 3LVQE 2GCNA 4PTLA 1NJFA 4QL3A 4M21A 4Q03A 4G3XA 4LV8B 2QGZA 5CM8B 1D5CA 4HLQB 4AY2A 4D4MA 3H0KA 1E1RA 1NLZA 1NG1A 2ONJA 4QBFA 2J7KA 2WOJA 2C9YA 3I5XA 3AVPA 4D6PA 1T3HA 3M1IA 2O5VA 4AKHA 4EPWA 2VQSA 2YC2C 4G5QA 5JBQA 2QA5A 2ZE7A 3KKPA 2ZETA 3VU9A 2V3CC 2QMOA 5DHFA 5BQ5A 3NKVA 2WSSA 4D2IA 1TAGA 1KMHA 5FTJA 5BYJA 4EFMA 1N5LA 3FMPB 1IAQA 1TX4B 2DWPA 3CNOA 5E4FA 4JLNA 4TYWA 4EPRA 4NCIA 4B3CA 4JSYA 1NN1A 4W7SA 2QMHA 2XX3A 2CK3A 1EFRA 3DMNA 2R6FA 1M74A 1XTKA 2V8OA 2XZPA 1VMAA 3NH6A 4J0QA 1ZCBA 2C9OA 1JXMA 1S2MA 1ZP6A 1PLLA 1KYIA 2V6JA 3IIMA 1X1RA 2OV2A 4LJ7A 2RAPA 3U60B 1FMLA 1FX0A 5KHOC 3SJZA 5TMPA 4AYXA 1KI9A 3U3JA 3BH0A 3P4XA 2BMDA 1H65A 4YXWA 3ZQ6A 1L8QA 1E96A 1R5OA 4A8JC 3GFPA 2IWHA 4PPGA 3TQFA 3TVTA 2CEAA 1E2DA 5BXQC 1HT2E 2FN4A 4BFUA 3CKLA 5GJCA 3P27A 4RD4A 4C2UA 2QTFA 3W6PA 1VECA 2OHFA 5M04A 5J4KA 1AA9A 4PAOA 1ODFA 4BLRA 1R6BX 3PJRA 2BMFA 4IOKA 4WZBE 4NONA 1P62B 2OBMA 2EVWX 2IYLD 2V7QA 1Z47A 2PLFA 2YOGA 5DN6A 3B2EA 4B48A 5FBQB 2FPKA 1G9XA 3SFZA 1W47A 4RD6A 1KJWA 1XCPA 3V4RA 4D80A 2GXQA 3NXSA 4GFDA 1S0UA 4WA7A 1WA5A 1MO5A 2CL0X 2N1BA 5IDVA 1F2UA 2WJVA 2ECKA 4ARZB 3R7WB 5IRCD 4LV6A 1XB2A 2GAOA 1YRAA 4TL6A 3KZ1E 4HAYA 2PL3A 4P4UA 1GG2A 1U81A 5FTMA 4FD2A 3M0EA 4A15A 2NGRA 3U61B 1GWNA 4OYHA 4URWR 4ZCLA 3BORA 1NNEA 2VSOA 2GILA 2H18A 2Q0HA 4KI0A 4WXPA 1N6RA 3B1YA 5DN6D 2PEYA 5B58C 2KJQA 2XOKD 2IX3A 4NH0A 2IYSA 2GJSA 1JNYA 1OIVA 4RY2A 3VQTA 1CR0A 1FP7A 2AXPA 2RGEA 3PITA 4IEEA 2HF9A 2WWYA 1P5ZB 5IT5A 4TMTA 5AUNB 3MSXA 1P2VA 2NO7A 3PUXA 3FKSA 2CE2X 4JLJA 2Q9BA 4R2IA 4O2LA 3TVDA 1GZSA 4BLPA 4CEHA 3K8YA 3KKMA 2J0QA 3L0IB 5HE9A 3AUXA 2JLRA 4N1AA 1NMZA 4LBZA 3ZZTA 1AQYA 3UG6A 4A6XA 5JFGA 3W6NA 3OEED 3K70B 1MRSA 3N2EA 2JLUA 1RFLA 3NG1A 3AB3A 1Z0JA 2G77B 1OB2A 3LV8A 3G0HA 3RRZA 2QQEA 4V0OA 2FDCA 1W0JA 5JWRA 2D2EA 3BGWA 4AYWA 2EYQA 2QMUA 3F5FA 1IJEA 5J40A 2IHBA 1E79A 2VH5R 4PC2A 1OFHA 1C4OA 4FN5A 4MKFA 3QBVA 3WHLA 3K70C 1OH5A 1LV7A 3AGPA 4DLZA 4GP7A 1BO6A 4NYIR 3VU9B 2P0EA 4FIDA 2VP0A 1FQKA 4B3GA 4EKDA 1JJVA 2FG5A 3OF5A 3TIFA 1G4AE 2HF8A 3IPYA 4FCWA 4YDSA 1BOFA 1F5NA 2O8EB 3GLHB 1FQJA 2W6IA 3O47A 1CKEA 4D4KA 1QBKC 3KKOA 2IXFA 3D31A 1CRPA 2GJKA 1CBUA 1Z0DA 4CT5A 4M9QA 3KL4A 2PZGA 3HDTA 1XTSA 3QKSB 4M9XA 2ZRKA 2GA8A 1OIWA 2BWJA 2A78A 3M4YA 1OB5A 2REBA 1YQTA 5EP1A 5CB8A 4S2EA 4Q01A 1XU4A 3VKGA 1TEVA 1KTVA 2CCJA 2AXNA 4XH9B 1GNPA 2IUTA 3EZ6A 1OV4A 2J45A 3HWSA 4PX9A 2ZRPA 3NIBA 4G5SA 2R6AA 2VBCA 1Z83A 4AG6A 5C18A 3U7EB 4C0BA 2IYYA 5E3HA 1GKUB 1Z2AA 1NIJA 1AIPA 2PT7A 4AKIA 2WOOA 3AVYA 1B0UA 1T3LA 3FHOA 5DGXA 3RSOA 1CJMA 2W0SA 2BJWA 5E95A 2ZJ2A 1E79D 3X1WA 1JAHA 2ZRNA 4Q1AA 2C98A 4X8OA 2ZQ5A 2BMEA 3V4FA 3LX8A 4GPTA 4LJ6A 3ZVRA 3LWNA 1OXXK 1TUIA 4KHZA 4Q48A 2GXUA 2RB4A 2BEKA 4EPTA 1M34E 4QBGB 1MV5A 3S1AB 4MKHA 3QENA 3CX8A 3ECCA 2BKUA 5A5GA 1LVGA 2XTZA 2A5FA 1IQPA 4LYHA 4XD7D 2O8EA 3TR0A 1T3SA 1Z6XA 2IYXA 1SHZA 1S1CA 2IS2A 4F4JA 2GBLA 4B3FX 5LB2A 2YINC 5IF9A 4NCNA 1U0LA 1IN7A 3K9LA 4KSBA 5D3QA 1GDDA 1ZU5A 2EFHB 3W3AA 4F4IA 1KAOA 1RRPA 2HV8A 1WRBA 3WMGA 2Z83A 3RS7A 1IN5A 3AF4A 4RFVA 4B44A 3OFNA 3SU8A 3R8FA 1XTRA 2ZRFA 1S9DA 1NY5A 4CEJA 3K09C 4TMWA 1U90A 4MRPA 1EWQA 3B9QA 4M0LA 4KITB 1L4YA 3MD0A 4KFUA 4PZLA 1E2GA 1G17A 4QHYA 4YMVA 5DLQC 1H8HD 2DCUA 2O8FA 1ZU4A 4TLDA 1GKYA 3ICEA 3SN6A 1P2UA 1F3OA 1KJZA 2P65A 2VSFA 4PQRA 4DKXA 5GADl 3F0TA 3QXCA 2ZJ5A 2Q21A 5AK0A 1YZKA 5B30A 1CEEA 1PVOA 4BQSA 4FWTA 1A1VA 4TYNA 2Q3HA 1XDBA 1XZPA 1KY3A 4Q4JA 5EXSA 3TUZC 4DCUA 5HCNA 1XEWX 3JVVA 3GEIA 5CDFA 4US0R 1PZNA 1XXHA 2D62A 4FCVA 1J99A 4W5WA 5EZ6B 3B7GA 4AD8A 2VL7A 4O2RA 4X8MA 4BFVA 4Q9HA 4HDOB 3LBIA 1X6VA 1DPFA 4NDZA 3X1DA 6Q21A 1COWA 3GD7A 2RGBA 1EGAA 2GTPA 3ASZA 2A5JA 1FFHA 2W6JD 1YZLA 1JPJA 3KUDA 1P7CA 4NCHA 1NRJB 1WE2A 3TUIC 3I72A 3QOFA 2JJ2A 3T1TA 4IDPA 3CZQA 3LFUA 4TMKA 5F98A 4WVFA 4KFSA 4MA4A 1QF9A 3T5DA 4ILEA 1VYUA 1W4AA 1OSNA 5F9FA 1N6NA 2JJ2D 1QHGA 1E2EA 5FTKA 1Z0KA 4Q4HB 3OZXA 3RRYA 3P1JA 5G41A 3LXXA 2P2LA 4A82A 1E2QA 3LY5A 4OJKA 2R65A 2R8RA 3EASA 1S1MA 4PC6A 1UEIA 3DM9B 5CM9C 3UIEA 3VR3A 1ZM9A 1X3SA 4FINA 4G5RA 1N6KA 4P33A 3MMPA 1XJCA 5ANRB 2ZI4A 5EQTA 1G20E 1CXZA 3HYRA 3CPHA 4PAQA 3ADKA 2FFQA 3RLFA 1OJLA 4XTCS 4A2PA 5JCPA 5B2ZA 3L43A 1XD9A 2OG2A 2QENA 2PJZA 4TQAA 1KO5A 3SQWA 1Z3IX 1AQUA 3KXIA 5EXPA 2ZJZA 2H92A 5KDDA 1II8A 1XJ0A 4P31A 1QVAA 2ZSEA 3LDAA 3RRNA 2FSFA 1TQ2A 3TBKA 2O8BB 4OL0A 1EESA 2QM7A 3A1TA 3GJ6A 4KYUA 4RD2A 2F9LA 2OM2A 2ZJBA 2MMCA 3TW4A 2W6JA 4TMZA 5KSOA 3LVRE 4P4SA 2FNAA 5IK2D 4GZLA 5FR2A 5D3MA 4PC3A 4URXR 2V9PA 5GVSA 3ZIAA 4V0KA 4TYYA 2PLRA 3EZ9A 1ZUIA 1U94A 3CF6R 1SXJC 1W0KD 1JEDA 3KJHA 4B74A 2ZAMA 1CRQA 1N6IA 4MRNA 4PZYA 3SHFA 2A3RA 2DFLA 2NTYC 2YJTD 1CULC 2JATA 2WSSD 1JJ7A 1YR7A 1I4DD 4Q4AB 5FUWA 2IYUA 3T1OA 1P9WA 1YRBA 3C4JA 3GFOA 3KXLA 3RSLA 4HDCA 3SJCA 1UPTA 1W0JD 2OXCA 5TDHA 2QTHA 3FGNA 3OEHD 2LWIA 2GWHA 4LBYA 3QPWA 4ABYA 1TF7A 1NKSA 1TF2A 3A37A 5KNCA 5JJLA 3AV0B 4C3ZA 3DDCA 3K0FB 1BYUA 1SVSA 5SZIA 2KBEA 1FNMA 2DB3A 4X8HA 4URUR 2RGGA 2C5LA 4B71A 2ONKA 5J4YA 1KKMA 3SNHA 1ESMA 2CHGA 3OAAD 1ZW6A 4XWAA 5CYOA 5FPTA 3D8BA 3W6OA 1KGDA 4CT4B 1CP2A 2KWIA 3A58B 3X2SA 5LD2C 3PENA 2W0MA 1TQ6A 2VLIA 3VKWA 3BFXA 4DBLC 3AVXA 1DTSA 3T61A 3O8CA 2C2HA 4QJ3A 4EPYA 3NVAA 4Q00A 5EXTA 2KSQA 1KI6A 1R8QA 1Y63A 1Q1ZA 3I1FA 5HTKA 1D6JA 2KI5A 1K5GA 2WJHA 4A1FA 1E0SA 3T12A 3B1VA 4HB0A 3T1VA 4RCZA 1XPOA 2FOLA 4JVMA 2GCOB 4D0LB 1PLJA 2ODEA 3C5HA 2GXAA 3FB4A 1XRJA 3KFVA 1WMSA 3QXXA 4OHWA 2QSYA 4G5OA 1QHIA 3AKYA 4Q9JA 1GVNB 5C46F 1E1QD 3K0CA 4A8JB 1OYYA 1TPZA 1FL9A 1SHKA 4L16A 4TTPA 2O0HA 1YE8A 3CW2A 1W46A 4EIWA 3QE0A 2OZEA 3OIYA 4GI7A 1X86B 3L0OA 2WKQA 3A6PC 1DAMA 3LH5A 4QGFA 2WAXA 2GEVA 4KJZA 2NO6A 2QY9A 2F1JA 3BRWD 3UMFA 3W9YA 1KIMA 3WNDA 4DSOA 2IUUA 1UM8A 3RS2A 2V55B 3K0EA 3FPAA 4JVNA 4OHZA 1XEWY 4GT1A 4B32A 3M6AA 1JR3E 4BFWA 1ZD8A 2IXGA 3T1QA 4C0KA 4KBGA 2J0VA 3HYTA 4IFBA 2OUKA 1NJGA 3RVBA 4R71A 5FUXA 1NBMA 2CVFA 1GNRA 3O8BA 4KV9A 4YLGA 3VAAA 4IVRA 3MRSA 8OHMA 5IK2A 1Z8FA 1F6BA 1ZJ6A 2BKEA 2DWOA 2GZHA 1BKDR 4JMPA 1VHTA 4IDNA 5E7JA 1UBEA 2WHXA 4HLDA 1GRRA 1Z0AA 2YOFA 4R2HA 4B3BA 4HZIA 2ZUCA 4DUGA 2AWNA 2RHDA 2V7QD 4LC1A 3ZVLA 1Q0UA 3N2IA 4U02A 3T06B 5HZKA 1UKYA 3DOEA 2FPLA 4DIDA 4XIGS 4F4CA 3GLFA 4DSUA 4PQYA 3BD9A 3NHAA 3THXA 2WIBA 4D4JA 2GJ8A 2F43B 2EYUA 3B6EA 2JDID 3EIHA 3K9NA 4RD3A 4A8JA 1BS1A 2DFTA 3MG9A 4ZDKA 1N6PA 1XMSA 2F6RA 4HATA 1OH7A 4RCYA 3C14C 1Z29A 4P0TA 4ESHA 1XJQA 4JLMA 4A0HA 3VX3A 2W00A 2ZS8A 4IOMA 5DNYB 4YMWA 3IQXA 4DC9A 1HA3A 3WMEA 5JMTA 1M8PA 2ZSFA 3BIFA 3PIRA 1VTKA 3ZS8A 4CF7A 3BE4A 2JEOA 1KI6B 2E87A 4LJYA 3W3ZB 1UDXA 2H8KA 4B3DA 1BIFA 4LHWA 1NN5A 2Q9AA 4DZZA 4DXAA 1W48A 4JSTA 2ZU0C 4PSVA 2QRNA 3WNBA 1MABA 3RRMA 1E2HA 4MYHA 4IEIA 3PEYA 5JJKA 2I1QA 2ZI9A 4B76A 4PHFA 4HUQB 5FI1B 4QG7A 4H1VA 1N3BA 1P75A 1GL9B 3KJIA 2BJVA 4IKEA 3LA6A 1VG1A 3U3OA 2JASA 3VKHA 3Q7QA 3FE2A 4G5GA 2OLJA 4JT4A 2FEOA 3I5YA 1F60A 4CIDA 2VRWA 2F7SA 2CE7A 2H57A 2XB4A 1Q12A 3GJ3A 4YDHB 5DI3B 3QUSA 4Q02A 4XD7A 4OK6A 5FL7D 4M1TA 3KFXA 2ZRGA 2PZFA 3LNCA 1Z6TA 3K0FA 1VIYA 2QAGA 2NG1A 1U9IA 1XEFA 2OBLA 1X8LA 1XMJA 3KDSE 4QJ5A 4A6PA 4DIEA 1U99A 1W36D 1FZQA 4MDEA 4AI6A 3NWJA 3CNLA 4DDVA 1NLYA 1W5TA 1H8HA 2IBMA 4NTZA 1DOAA 2ZJOA 3R9WA 2F3RA 2QMEA 3C41J 3TKLA 4NHOA 2NQ2C 1W36B 4OHYA 3FKQA 2HLDD 1IBRA 1DAHA 2IA5A 2QL6A 2LKDA 2ORWA 3WMFA 3I61A 2WKPA 3LW8A 4NYMR 1OHHD 4WW0A 4XWKA 2HJGA 821PA 2YKGA 1GM5A 2QZ4A 4LZZA 4JJKA 4E5UA 1D2NA 1NMYA 2D74A 2FX3A 1T91A 2G3YA 4PO9A 4QGHA 2ZM5A 3SJAA 4MKIA 1M7BA 2YYZA 1DADA 2DY1A 1KMHB 3LBHA 4RKEA 3ZYCA 4US2R 2V1XA 1R10A 1I4TD 2XTMA 1OH8A 1U98A 1XMVA 5SZKB 1GFIA 4HUTA 5CK5A 2IF2A 2EFCB 5F2EA 3P26A 3CO5A 2C96A 3AP1A 3SHWA 3QF7A 1E6CA 1OPXA 1G8HA 1YJ5A 4Q5IA 4MRRA 2PJRA 1OLOA 2ZE6A 4UJ3A 3NDBB 1RZ3A 3TUJC 2ZVQX 1TADA 3TSWA 1II8B 2OLKA 4G1UC 3IQWA 4YMTA 4JLAA 1R5NA 2J59A 5A0FA 4B33A 5FL7A 3L82B 1F2TB 2F1HA 1N0VC 2V6IA 1G8FA 1K5DA 3HU2A 1RRFA 3ADBA 3UKDA 2XAUA 1G3QA 3SS8A 3SOPA 2JIZA 1E9EA 1FNNA 2GF9A 1OXVA 4NYMQ 3Q5DA 4TL7A 3OE7A 2BMJA 1NVUQ 4AKEA 2F9MA 2QI9C 3ZGXA 3FFBA 3IBYA 1E9FA 2BBOA 1E2KA 2JLQA 2A30A 1SKQA 1S3SA 2D7CA 3WYGA 3RYTC 5EJEA 3IEUA 1LNZA 1E2JA
chains in the Genus database with same CATH superfamily
1QYIA 3FNHA 1Q17A 3ZYZA 1CUXA 2FWPA 2P5UA 1T9HA 2D4AA 3QU4A 2WVGA 4YMHA 3FIUA 1Y7PA 1O5OA 1R7RA 2ZRLA 3GFTA 2HL6A 1RJDA 1L5YA 2E4XA 3PQCA 1XCLA 1XP8A 5M34A 1WB5A 2Q49A 3V3KA 1NLUA 3ZU6A 4UOQA 1K68A 5KBYA 2C8VA 1UBRS 1V1JA 3H5VA 2FLWA 3EGWA 4E51A 1HL7A 2PIDA 2BGNA 4JB0A 1EBFA 1PW7A 1R0BA 1TM1E 3DFZA 3TD6A 4TZ6A 5G0WA 1QVRA 1VFPA 4KXQA 4DR5B 2DPGA 2NZUG 2HMTA 4C0XA 4HX5A 1XT6A 4K87A 2EWWA 1VJ1A 3V97A 1I6KA 1TVCA 1BGWA 2ZSBA 2J0EA 3LRXA 4TWRA 3UJPA 2VPZA 4X63A 3BFVA 3PQEA 4UXJA 5CLGA 5B57C 2OFWA 3KJNA 4QHSA 3IDQA 5I3CA 4GE3A 3RWBA 1B3BA 2P0YA 5JBIA 4MJ7A 1L5NA 1S8NA 5EUMA 1REQB 1DRWA 1YVUA 1XLTC 3VSAA 4HGZA 1KP2A 2FPPB 1Z5PA 2KS6A 4C4PA 5KVVA 4CLXA 1GU7A 3DAHA 5TXGA 4LXXA 3OPYA 1U1IA 4KDFA 5B64A 4I1SA 3ANTA 3EDRA 3JVDA 3QJYA 4EEKA 4YPFA 2G0TA 1ITZA 1LI5A 3HYLA 3EPHA 4DG5A 5TQ0A 4KIFA 3D3KA 4JL8A 3A11A 1SCDA 2O54A 1NVEA 4L15A 4E09A 1L5RA 1QK4A 2WMNB 3ENWA 3F3SA 5JNVA 2HXSA 4M49A 1P0MA 1YR3A 5JXWA 1SB8A 5DK4A 3U1TA 1VBKA 5IYZA 1AGPA 4AF6A 1GPMA 3BQMB 1P6QA 1SCNE 4HAUA 4FMDB 3QF4B 1GEGA 3H3FA 2VA8A 4NMHA 4RK0A 4NZZA 2E49A 3B7PA 4B81A 1E4EB 5ILQA 1THZA 1KQGA 1UBSB 1U8YA 1VGVA 1M76A 4LI0A 3F8TA 3N2ZB 1NZFA 4HQ6A 3GPBA 4HSGA 5CJJA 2PXCA 4LQDA 1Y8ZA 4U5QA 3A70A 4KR7A 3W8EA 3ZV6A 1NW5A 4X95A 5DGCA 3DLPX 2BKAA 3A4YA 3I0ZA 3L7YA 5A3RA 3N0RA 4S35A 1JDPA 3TTTA 3HTXA 2MIIA 1XTJA 3VTFA 2Z1DA 1P9NA 3HJRA 5CX1B 1VOTA 1TECE 3A36A 3BREA 1CLUA 2NZWA 1VSVA 1XNJA 3HUEA 4Z3KA 3E03A 4ZI5A 4ZCRA 1OV6A 3ZD6A 2WWWA 3TOXA 2IZOA 1Z5ZA 4DB4A 2RARA 1YBVA 2QQ5A 3ZS9A 3VNVA 1DTEA 2AXEA 2QAGB 3L8HA 3OTQA 2H4HA 3EQ7A 4CDMA 4EJSA 4QYXA 5SYMA 3GT4A 4CMBA 3OO0A 8LDHA 2NUAB 5BYKA 1OXUA 1DMSA 5I45A 4ENPA 3CF0A 1CUVA 4QUBA 3WK4A 4DPKA 4MDFA 4MMYB 1MT0A 1R5BA 3F3YA 3K9BA 1CE8A 1IVYA 3Q1LA 4Z7QB 1D4ZA 3VR1A 4XAQA 1V9CA 3A1VA 5CVVA 4D0GA 3GHHA 2P91A 3PUWA 3ESZA 1KDPA 3HP1A 3PNOA 3C3CA 1U7OA 1ID1A 3T4PA 1MAUA 4ZO8A 3ZQJA 2PUAA 4BE4A 1M0WA 1E5VA 2H0AA 4RPIA 1PS0A 3H9GA 4PYOA 3BA1A 5B4TA 1REQA 1S7GA 2CNWD 3Q6IA 3JQ7A 5BT9A 1N1DA 2DFNA 2GHIA 3BWCA 3KXKA 5D7NA 1IN6A 1W29A 1XCMA 3R3VA 2D1FA 4UXIA 3K70D 2IW3A 4TKVA 4NCAA 1C9KA 4MAFA 2AVNA 3OH8A 3AU8A 1YDHA 1EBBA 3ZU3A 1O4WA 1B26A 5LWQA 2BFPA 2C3YA 2ODBA 4Y9TA 1BCSB 2IL1A 1VJDA 1CY6A 1T4CB 3D0KA 4MWSA 2JLZA 2XQFA 3FUVA 4NAUA 1NBMD 3GLHA 2J9XB 3WIOA 4MH0R 1JIQA 3BC1A 4RV5A 4O3MA 4FT2A 3BICA 3O1JC 4H1UA 2OBNA 4MEJA 5LQRA 2TS1A 4WKNA 2BV3A 3D6TB 1PLKA 4DCJA 3FD8A 4JP1A 4AKSA 1UADA 4X65B 3RWMB 1RCFA 1LI4A 2X2OA 3W8DA 2EARA 3ADDA 1U8CB 2GHRA 4D8YA 2Y71A 1NKVA 3T4XA 1BW9B 4ZFNA 3DP7A 4ZQCB 2ZCVA 1U0HC 4CTKA 5FA6A 1KL7A 3ZJ4A 2OTCA 1C1DB 1X1SA 2C03A 4TL9A 1DAGA 3QF4A 4H0NA 4AMGA 3VTKA 1I24A 3DBRA 1EM6A 1GUAA 2VFAA 1G5PA 4PE5B 2QP3A 1OGIA 1DJQA 3GGOA 3L0BA 2BELA 3OTOB 4PHCA 4DANA 3V8PA 1K66A 1OPRA 3LOPA 3PTZA 4XYBA 4Q05A 1YZYA 1GQ2A 1KK3A 2DT5A 4UU1A 4XM0A 1DAKA 1RE1A 3CLRC 3ZHQA 2DJ5A 3C8ZA 2Z95A 2QIPA 3LK7A 4WXRA 3T41A 1Q5PA 1ESCA 3QEKA 4XFJA 4ZWNA 3GLIA 4I1UA 4YAOA 2BCGY 1QS0A 2XQJA 5GGXA 5GQSA 2PCJA 3O4RA 1IAVA 4K8OA 1HY3A 4EDFA 2JGIA 1VKZA 5C5DA 2IUEA 1T3ZA 3D1VA 4EVQA 1NXOA 5FEUA 3KTFA 2ILVA 2RBGA 5I5GA 3O2JA 3HKDA 3BMCA 4BZZA 4JYAB 1GQYA 4OQQA 4RF4A 3T7CA 1ZEMA 4P7JA 4UBOA 1CUJA 2QX7A 1QS0B 1YQXA 2DT8A 4HRXA 5FWYB 4CIBA 1QRDA 1N4DA 1YRLA 5JSYA 3D7SA 3EWSA 2Q5QA 4TRJA 4XEUA 1NAHA 1JFVA 1F17A 1J8DA 4QSMA 1SVKA 2CLHB 1GSAA 4NVRA 2HIGA 4GOLD 1YD7A 4HEJA 2OILA 5KDLA 5IKMA 3JQDA 5EHNA 1EXVA 2H59A 4XB1A 5G0VA 2F90A 2W4MA 3TJZA 5KOJB 3BDAA 1N2GA 1ZD3A 4UUMA 1LBSA 3ND8A 3W4IA 3P9IA 4BV3A 5KQMA 4TMXA 1B6SA 5A7FA 4JVSB 1PX2A 2Z1MA 3Q9LA 1FE8A 4NDNE 2PWAA 3IKJA 2JIOA 1J0AA 3C1AA 1EZ4A 1SHUX 3QLVA 3NKLA 4OUDA 2F9FA 4BVEA 3EG9A 1D03A 3BE8A 1B8NA 2WV7A 3COJA 2B1QA 3AUSA 1SZDA 4K6HA 3SEQA 5I7RA 2ODNA 2IKQA 3YASA 4E22A 2WF5A 2OZKA 1J8FA 4TM7A 4C6HA 2XKJE 3T1YB 2G76A 1KDTA 5JY6A 2VHYA 4E7PA 3DCNA 3BSSA 2R00C 1LBEA 3GB9A 1HQYE 4K9DA 2FJUA 4Q7LA 1N77A 1QFYA 2IS6A 4Z54A 4KWTA 4YT5A 4OQLA 2H5EA 1VKRA 4QG3A 5KNBA 1J2TA 3Q7SA 1C0KA 1GQQA 1QV7A 3R3ZA 2P9QA 4NBRA 5GP1A 3DV0B 1D04A 2IV2X 3CVWA 5IWCA 1ZNWA 4MI3A 3GVHA 1Y5LA 5HF6A 3LL4A 3KJZA 4G5HA 3I32A 4MGZR 2OCLA 4Y30A 3UUEA 1ZNXA 3LMKA 4FHFA 5AOVA 1DWOA 1IH8A 4MYSA 1KHTA 1S8OA 2ZWIA 4M9SA 5AHRA 4Q15A 1P4SA 3LQQA 2R2AA 1UFOA 4WL0A 3AK4A 4PPNA 4GLFA 2IGBA 3OKAA 1KE1A 1U7DA 5B1YA 1N78A 4DMRA 2YHUA 2PPVA 3MMNA 3QK7A 3OC0A 4M60A 5K0JA 3S44A 3DOCA 4EI8A 3SVTA 1LDEA 1EZZA 2FPGB 2XCOA 1CIPA 1OD6A 1FS4A 1N8SA 3T99A 4I8IA 1SKAA 3ZBQA 1BS2A 1PVDA 2EW2A 3O21A 3NV9A 1E58A 1XMIA 5TNXA 3L05A 2BSAA 4K2AA 2HK8A 2CLOB 2PGOA 3GT3A 5BO5A 5P8WA 5A62A 2FZEA 2PV7A 1L9KA 3T5MA 1YDEA 5JXHA 5JTTA 1BC5A 2Q07A 3AVQA 2IYTA 2COKA 2WJJA 3FSJX 3L1UA 3N07A 2E82A 1RM5A 5FBRB 4MYRA 2QE7D 1DC6A 1Z4JA 3TTUA 4CM5A 1IWOA 4IXTA 3THYA 9GPBA 4ZARA 4PLGA 5ES3A 4IOLA 4UREA 4KH0A 4PU0A 1FPMA 2RHJA 3KTOA 4QJ4A 2ZWVA 3RIHA 1FYFA 1L1QA 4HNUA 2PXHA 3P52A 2WM9B 3D8NA 4QU5A 4YRMA 5JJCA 2C7QA 1Z4OA 3AY0A 3C6YA 5HR5A 3GHYA 4QTYA 4JXZA 4X0EA 1J7KA 4LOIA 4RDIA 1PD1A 1YBAA 5I7AA 4JBYA 3MW8A 4WFJA 1AZTA 1QR2A 1O9BA 3BK1A 2ZIEA 2JI6A 3IV7A 4N39A 3MCUA 3OCJA 4HJXA 3INNA 4UUAA 1ADBA 1IOLA 4I55B 1FVFA 3GZTB 3EUWA 3CCBA 2N3ZA 1CC1S 2I3BA 3W9SA 2FN9A 4OHXA 4ERNA 3UFXB 3EXAA 3BBPA 2P8SA 3IXLA 4H1TA 3RK4A 2MSDB 3VKVA 3CEMA 3QU7A 1QUEA 3TZEA 1BKSB 2OHXA 3FPKA 3AH8A 3VH4A 5JG7A 3FBGA 1UJNA 1UF9A 2VDWB 2PG3A 4O2BB 2IYEA 2K2WA 4HQFA 1PS8A 1C29B 1SKYB 2UZ3A 3H4TA 3D2LA 4KE9A 4M55A 3WLOA 1I8TA 4FCCA 3VKUA 1CUEA 1NUTA 2FMFA 4JI3B 4G01B 1SU4A 3BK7A 1D0IA 4B2LA 1Z2CA 4NU8X 1SOMA 4DLRA 1FSSA 1BQ3A 2BZ1A 2ISSD 2R47A 4JHLA 1X7DA 4PO1A 5CHYA 4DLPA 4U7PB 3FTCA 3WXBA 2D1QA 2QS9A 2RH4A 1HL3A 1XWIA 3QU9A 4K6FA 2QG9A 4KYVA 3WGMA 1KPIA 4C21A 3W5JA 3II6X 2ZUBA 4YCBA 3VZQA 4WBNB 3I5MA 3FOBA 3GRRA 1IZ9A 2A0UA 3QKWA 5AM2A 1AKQA 4Z4IA 1W5SA 4JKOA 2O1SA 5GIOE 1ATIA 3KSUA 3WGKA 3T5BA 4AK9A 5LMCA 3SR3A 2A5GA 4JBIA 4YN3A 2Q2WA 5ER6A 5CITA 5GINE 3VDNB 3MCVA 4G0XA 2RHRA 3EZGA 2YIDA 4HWPA 1JSZA 1C81A 2NNWB 3JASB 4PR3A 2AX4A 2HWKA 4ZEWA 3TBHA 2RHOA 3B3GA 4IAOA 2Y1XA 5EUQB 3TAUA 1TGVA 5ERYA 2QU8A 1NUUA 3ONVA 1F38A 1H2HA 4B3IA 4CG0A 3AR9A 1BHJA 3I9V6 4UKDA 3FDZA 4K3UA 5EHZA 4RXUA 1PX0A 2PSFA 2XB2A 4IXDA 3RNOA 2BBSA 3S99A 4CUJA 7AT1A 5TT0A 1O6BA 1VHQA 2HI0A 3DAFA 2QW0X 3TL2A 3FMIA 1A8IA 1FP4B 5HA5A 3PQDA 1X1EA 1M2EA 1KR5A 1Z22A 2HB6A 2YMPA 2NU7A 3UAXA 4AW9A 4EW2A 1XMOB 3TSYA 3EF3A 2ZJ1A 2H2WA 2P75A 1I2ZA 3I39X 2R6R1 2X1VA 5KJ1A 3IBTA 3ICVA 1K6MA 1EUYA 2F4VB 2PH3A 3UHJA 4NU0A 2NO5A 5AJZA 1DBVO 2G4VA 5AM1A 4BCCA 1Y42X 5AVSA 2GR9A 1PGPA 4LF6B 3C3PA 1PJ3A 4PRLA 3KXPA 5JNLA 3THOA 4NESA 3VR2A 3ABRB 4L8LA 3R7NA 4NJMA 3OMWA 2X1LA 4KKXB 3F8WA 3PKIA 4BE9A 4YUZA 5GTDA 4Z1MD 4ZYYA 1KI1A 3MCTA 4YAIA 1CJSA 3F96A 3DO5A 4FQ5A 1EE2A 1Z75A 2XZTA 3C5CA 3L9XA 2WQZA 1Z35A 4MVYA 3OE4A 1JTFA 1X80B 3AHJA 1T6XA 2I8AA 2B3TA 5L51A 1KI7A 1OREA 4KLZA 4M0UA 3A9UA 3AIKA 3LHKA 5THQA 3WL7A 4YTEA 3BK2A 4DWJA 1JEJA 4WBNF 1AGRA 1WKCA 4H59A 5ALTA 2H7CA 3IIKA 3ZW8A 5KI6A 4PR0A 4BB0A 3A4LA 4ND8A 4FGJA 3DWEX 1SIOA 1RXUA 4RFSB 3PTLA 4PAGA 1L4GA 1KFBB 3U48A 1B8OA 3QY0A 2OGTA 2E4AA 2HK9A 2APJA 1CHDA 1YZQA 2V7TA 2OHIA 4E1VA 4AWBA 4OTZA 1JAIA 2GH1A 2BMVA 4IIHA 4WBNA 3GC6A 2VJMA 3QWIA 3RVDA 1RC0A 1FMJA 3B9BA 4JGBA 4KSCA 1G6OA 5JVDF 2FRVA 4OXKA 1YIAA 3FWZA 3MWGA 2DLNA 3JVIA 4CLHA 2ZATA 2G4CA 2WG0A 3OD1A 4IDFA 4JHXA 3VPAA 4DJDC 3ZWBA 5DZSA 1V4VA 2GJ4A 2AE1A 2OOKA 4XJVA 1RLJA 4HTFA 1JWBB 1LPAB 3CBQA 1RVV1 4N8DA 4AL4A 4B8YA 6PFKA 2WTBA 3HLYA 4O4HB 3W2GA 2P6UA 3OEYA 2PQ0A 2ZTMA 3PX3A 3QWFA 4HDMA 1PT8A 3HH8A 4WJZA 1FDWA 4DDTA 1TTHA 1H2FA 3IUSA 1ADJA 1UZAA 4DTCA 1ZH6A 5FA5A 4ZYTA 3WL8A 2O7RA 1P2TA 3G82C 4J4TA 3SJUA 3EGDB 2WD9A 4KREA 3F4BA 2X4DA 3UZUA 5AQ1A 1A50B 4IWNA 4QBTA 5FX2A 5C52B 2C9BA 1A2BA 1TW3A 3IBFA 3MELA 5E0KB 1HZZC 3E3LA 5KYVA 2JD1A 9ABPA 3A6GA 1U2ZA 2IJGX 4AJ4A 4EECA 2IYNA 1MRNA 2RHBA 2G1AA 3ISJA 4FGUA 3MOSA 4Q37A 4ZGGA 1TAUA 3E58A 5FBZA 3IT3A 2IGTA 3U4CA 1KBZA 4BGEA 2AI1A 1T13A 5BYAA 3CT6A 1NE7A 2XKKA 1EJ0A 3M6FA 4OGKA 1W1UA 4YRDA 2F8LA 1ZIPA 1MB0A 2RHCA 1WBDA 4QU9A 3UM9A 3PQFA 5DOZA 3RTBA 1QIGA 5IN5A 4EW6A 4MS1B 4YRGA 5KQGA 1ZMRA 4JWTA 4L8GA 5EHIA 5C35A 5EIXA 2BH2A 3AVVA 2UKDA 3ELUA 4PQGA 2XCUA 2I6UA 2JGDB 1PWXA 2EW8A 2OK7A 3EGOA 2OGZA 1JEAA 2PO5A 2R8OA 5JCJA 4C14A 3OZEA 1ZR4A 3B52X 4JK3A 1CW2B 1DU4A 3L8ZA 3W1WA 3S5UA 1EG7A 4Z86A 3EAFA 1U7WA 5GOTA 2JG3A 3JWJA 1NDQA 1T8YA 4PQEA 5AW1A 2X8LA 4CFSA 1K7EB 3CPJB 1W6UA 3F6BX 2LP4Y 5J4LA 2MR5A 4WOJA 4RH0A 1SCBA 2ZRQA 3U0BA 4G1BA 4II7A 1UAAA 4A2CA 4ACBA 5B1HA 3MGCA 3W77A 4WWHA 1DQRA 1S8AA 1CR4A 3B36A 3J80A 1QHXA 4O5AA 1G55A 2POQX 4KGVA 2OC9A 1FU7A 3D1LA 5D51S 3PV0A 3RFFA 5FWYA 4Z8YA 5CG2A 1EXDA 2BHRA 1EINA 4H3SA 2XT0A 4WXMA 1NL3A 1FLDA 3GW8A 4JEMA 3VR6A 2J4FA 5KYGA 2QTLA 4CEHB 2O2YA 2D13A 1NN3A 4GXNA 3SC4A 1U02A 1M1YB 4F72A 1MVNA 5FR1A 4JYMA 2WG1A 5DSTA 3RANA 1B23P 1EE9A 3HJGA 1JEYA 3H2IA 4L3VA 3EJ6A 1K2VN 4F6RA 3DLCA 2RGYA 5I7WA 1SCAA 4MGYR 4B83A 2FN8A 5CNKA 5LVAA 2VJLA 1MAVA 3NDIA 3X0DA 4EHIA 2GM9A 1QQBA 3RSHA 1U3VA 4KO4S 4KBFA 3LSYA 3GELA 4LMRA 2XMCA 1TTTA 1BE1A 1FFGA 3OZDA 1H42A 3BB4A 3V4VB 4F8EA 2WSYB 1YWGO 1XXHE 3KE8A 3MJFA 1UXOA 5HSGA 3GLGE 1UIMA 1XN4A 4GMDA 2BF4A 1I7LA 1G8MA 3F9IA 1V6AA 5DNCA 4C7KA 1AN0A 2D8MA 2IEGA 1N25A 4C7VA 2JCVA 2OZLA 2Z09A 3G7SA 5CH5A 3ZX4A 1CR6A 5DE3A 2FXVA 1QGZA 1A5SB 1KEVA 5JNTA 1NBME 2EC5A 2ZI5A 4GIBA 4TN1A 4QOHA 1O8CA 1EFPB 1ZI9A 1CS0B 3H4VA 3OHMA 1WL8A 5F7OA 4HT3B 2WJAA 3GRZA 2C1EA 3CH5A 4Q21A 3WSTA 4CFYA 4F3YA 3C3WA 4K03A 3QHQA 4E5SA 1JR2A 3SF8B 2NO9A 1C7ZA 1DRKA 2JKVA 4KJXA 4F93B 2BBTA 2AFIA 1YA8A 2HAEA 4GOMD 4ZO9A 4YT2A 2V8BA 3EFOA 3ZGZA 2XUOA 1AMOA 3AHIA 1ZC4A 4TTRA 1F48A 4LOKA 3ESQA 3U31A 3ONEA 2FFRA 3HL4A 3OA0A 5GONA 4EGQA 1BE8A 4L1KA 4OFBA 3AVWA 1GRVA 1NVFA 1WY5A 3W6ZA 1FFWA 3UXEA 3ZWVA 3B8EA 4N82A 2GZ3A 3K32A 4BNUA 4LFBB 1XP5A 3T3HA 1RADA 3UUWA 4NCBA 1U8UA 1WZIA 5BQFA 3G23A 1Q19A 1RS0A 2GNAA 4ZCQA 3LPNA 4MW9A 2EJBA 5AKXA 3EGXA 4M8NE 2BM8A 4ZPXA 2Q1WA 3R3HA 3DOUA 1U8EA 4NZ9A 4BNJA 2QKYA 2Y0CA 4HXGA 1DKPA 4BLQA 3PT9A 1CD5A 3OZWA 4G1VA 4JYPA 4K9RA 3LD9A 3WLKX 1HK7A 2BR3A 2FW1A 2CXOA 5EJAA 1AHPA 2DPXA 4RC9A 4D42A 4BP3A 1Y6FA 1F5SA 2BGIA 2C2OA 2H17A 3O0DA 3WGOA 4LFAB 5JY1A 1CUHA 1E77A 4OAQA 2PA3A 3PPXA 5K0CA 1T0PA 1XD2A 2O0KA 5IAJA 3K0AB 4HGOA 3OQNA 5FOUA 4TN5A 4PC7A 1QOPB 2DUMA 1T0JB 4L4SA 1T5BA 2AEEA 1NVXQ 3A1FA 3E4CA 2IU0A 1ISSA 3HWWA 3EWIA 4UBMA 5K3FB 4R1NA 3MD9A 3F46A 2YXNA 4TGLA 3REGA 4CDNA 1E6MA 2XZLA 3IFSA 1DDGA 1JR3D 2G0NA 1KNXA 3PC8A 3P0FA 5AK3A 2J0UB 2YVQA 5LBTA 3E5MA 2ZP1A 3FGOA 3T7AA 3U9SA 1IHUA 4J4BA 3RVMA 3O73A 1FFDA 3DMYA 1PIWA 5EFZA 1FW6A 4OHFA 3C70A 4F2PA 3F71A 1ZCAA 4ZV9A 2CJWB 4ZVPA 3NWEA 4CGZA 5ALEA 4JEIA 1JE0A 2ZB7A 3I6MA 2VPYA 3FSGD 4QUDA 5KSYA 4ZCSA 1UZUA 3ZE8A 4LY6A 4C4OA 3IB3A 3DWFA 1XMXA 3TLXA 3CM0A 1G2OA 3NBXX 3OX4A 4ONEA 2B30A 2R11A 3L1JA 3OQPA 1CVRA 1XNGA 3HKCA 3SJ7A 4DEYA 3W1VA 3U4MA 1JIUA 3WWYA 4NFHA 4JOSA 5EI5A 5IKXA 3Q72A 4CUKA 3GNTA 5C5EA 1MRZA 4RA6A 5IJ9B 1K6JA 3EPPA 2CMHA 3CN7A 2ECOA 2EU8A 3K1TA 5KX5A 2Q5IA 3PEEA 3ZWXA 3IA2A 1UWVA 4Q39A 2JD0A 2VPPA 2IFTA 5TGZA 1KPHA 3UQYS 4ENQA 1NVVQ 1XRSB 2BGTA 3FTNA 2A58A 2A0WA 2XBUA 3INRA 1CY4A 4LXYA 1Q7GA 5JATA 4J4HA 3QVTA 4YO7A 3E48A 2GHQA 5LQNA 3KEMA 4KQGA 3REOA 3MRTA 1NW6A 4P81A 4BVJA 1C9NA 4H7HA 4B17A 1Q1AA 4B6SA 3ONNA 5CB4F 4N6NA 1RTKA 3W5VA 4QQ8A 2FEMA 4MYUA 5KTNA 1L9XA 2Y2UA 5HKKD 1MB2A 3R6GA 2B1GA 1II0A 5FL3A 1R74A 1SNYA 4L72A 2EQBA 1ZK2A 2I2CA 2ZTSA 3M6LA 5AXAA 3RBVA 1E9VA 2PR7A 3VSCA 2Z8YM 3ROQA 1HEUA 5H83A 4Z4FA 3KVYA 5IFLA 4O02B 3CINA 4Q4HA 4BBPA 3ZZ0A 2BF7A 3EAQA 2J07A 1YA4A 3HCPA 3IEXA 4WESA 3TL3A 3W2FA 1BXRA 1N7JA 4U7WA 1S01A 3DHWC 1W4BA 5F21A 1G59A 1JKJB 2UU9B 2ADFA 3QRWA 2J0SA 4OMUA 2J3IA 2FV8A 4Q7KA 4U3JA 1I7NA 1BH6A 1XTVA 1RNLA 5EZYF 3GFBA 4EYKA 4UUBA 4U2CA 4E2FA 2WU3A 3QXJA 3ZN2A 2J6BA 4ZVNA 4K6OA 2BTOA 3TPFA 2BTQA 3ANLA 1EUQA 2P1ZA 3SY8A 1B76A 1MO3A 3NNNA 4NBWA 5GJVC 1QQTA 4NV1A 4QJBA 1W4RA 1Z2EA 4OCZA 1QH1A 3GPCA 3GN2A 1JVSA 4MZXA 3RVNA 1KJQA 3TXYA 4DCNA 4LSGA 5BRJA 4FTWA 2XVMA 1UM9B 1Q15A 1XRQA 4UD6A 5DGTA 2C99A 3ODPA 4ENVA 2C2BA 3RHZA 2C07A 1V2HE 2RH8A 1BA2A 1E6EA 3L7JA 4OI1A 4D26A 4EB3A 1GLNA 3ACCA 1DC4A 5DHSA 5K3EA 2I29A 3I37X 2P2DA 4X97A 4CEIA 4EPVA 2X23A 1UM9A 2NZ2A 4IJUA 3VGJA 2JS7A 1P4RA 2EFGA 1G5IA 2J9ZB 1F6DA 2GPWA 4G0NA 1DLJA 1GADO 3VR2D 3MHTA 2H1VA 5JAIA 2GJAA 1PU2A 5DNEA 3FLBA 1LKZA 5K0LA 1DO2A 2XEXA 3GXOA 3UJNA 1FUYB 1M8KA 1EKXA 2JZNA 2OZPA 2HA5A 3HKBA 1PR0A 3K6KA 4AJ2A 1TUEA 4EB0A 1RBZA 4CDGA 2O8NA 2ZRMA 1IEVA 4F5ZA 5LZ8A 1P7WA 1Z07A 2BGUA 2UVQA 2QAGC 4YH1A 2C4MA 3MB8A 1ZQ9A 3SMQA 1EGMB 1P0CA 2P3OA 1MNAA 4LY0A 2WLTA 4DCMA 3PPYA 4E30A 2VJQA 4ZOLB 3FETA 1TK3A 2X0FA 3S2IA 2WW8A 3FCAA 5JROA 5L3QB 4Q1BA 1GL7A 5BVHA 5K5EA 2NSYA 1DEAA 1XRLA 3V80A 4D98A 3DEFA 4FZJA 2XMSA 4QQKA 1JDBC 4PXYA 1BEZA 2XNHA 3EZFA 4IDHA 4U00A 5MN5A 1MAAA 3R6DA 1JSRA 4ISBA 3RUCA 3IAM1 4AXBA 3QE2A 3UXHA 5AVVA 4ND5A 4KFCA 2WJZB 3HN6A 2AHOA 2BR5A 2PMEA 1X3LA 1GYRA 4C30A 2KPOA 3UMMA 2Q4DA 4XDZA 3QE3A 3F6RA 3ZJ5A 4CV1A 1HH4A 2RCYA 2QHXA 2UVPA 1KZGB 3E61A 4R5MA 1BYIA 1QNLA 7ADHA 5K8VA 3AHHA 3O3MB 2MSLA 2DUJA 2WIAA 3TQSA 4E11A 2K7FA 5DTMA 3U56A 4FJ2A 3SX2A 3KEOA 2LR0A 2EGUA 3DBLA 2PFGA 2BGLA 4UW9A 2HDNB 4FNMA 1RWQA 4YMSA 1JKXA 1FMTA 1GSIA 1HV8A 3EX7C 4OEHA 4Q4LA 3T54A 2GN8A 2PKYX 2ZT6A 3LT0A 5AVWA 3WB1A 3R3XA 1TZKA 3JTMA 3S40A 3ZCRA 5DLEA 2EL9A 4JKIA 3QOYA 1GAEO 1ZA2A 2VAMA 3B38A 3MFYA 2WE8A 5DT2A 5CPBA 1U0BB 3PFCA 4J75A 4EG8A 2XUZA 2VZ0A 4QDZA 3OESA 1SC3A 1TZ2A 4P7GA 3Q7IA 2IZ1A 2V1UA 2Y05A 2YHBA 3C3BA 1MDFA 3O9VA 1LBQA 4H7DA 4NJEB 2F55A 2ZUTA 1OJ7A 1XZAA 1E20A 4ZVMA 1L6IA 1O0CA 1IHDA 5EZSA 1KO8A 3E84A 4PYLA 3UPTA 5FOWA 5B58T 1VSQA 1HTBA 4BLWA 5FEMA 4F1JA 1NYLA 2D2FA 3G2KA 3I4LA 3MOGA 1Q7TA 3G2OA 1U5CA 1ZH0A 2RFLA 2HW8A 1UT5A 4DCTA 2WWXA 3K9HA 5EXXA 1GITA 1HMYA 1ZH2A 1KQPA 4JT8A 1UQTA 2NOAA 2ZZKA 4UHKA 2AJ8A 5LZ7A 5I9NA 3PX2A 1QGDA 3GVIA 2KMLA 1SQSA 4TRRA 4WBSA 1RM3A 4ZU3A 4PM4A 5IKEA 1M5UA 5B53A 5HW0A 3UJ9A 1ZEJA 1SBZA 3GJRA 3GA5A 5FLEX 2GM4A 2FFHA 3FN4A 1FSGA 2DPYA 2OXEA 2JIBA 3GA7A 3D6FA 3RF6A 3VX4A 1G7RA 2XBLA 4DQUA 3I62A 3EXIB 4KFTA 1L5HA 1NUAA 1EVYA 4KOEC 2ZJAA 5IM4A 5F3RA 3P5SA 2HTEA 4GPIB 4Y6GB 2IZ5A 2ZYAA 4HLUC 5E1DA 1TFUA 3P0EA 4Y2SA 2DWQA 2O52A 2VHTA 4G9GA 4JGGA 2C5SA 3TO5A 2QV7A 1TO2E 2O8CA 1M5TA 4AKTA 2QXTA 3RW9A 1BRMA 1NT4A 1FP2A 1JT2A 5CGQB 3RR2A 1H2ZA 1DEHA 2VN8A 3QBEA 5FLXA 2KB0A 3OP1A 3SLRA 1ISJA 2QNBA 5FQOA 5J2TA 2JA2A 3F3MA 4I9UA 4C6SA 3AVTA 5LUBA 5TS3A 4JJ8A 2H0QA 3ASUA 3NYRA 2F48A 4IJQA 2UYGA 5HCIA 4E2XA 1DC8A 1DZIA 3WLPA 3AEZA 3Q10A 4IH9A 3DWGA 2E18A 3BF7A 4BMOB 2B99A 2FEXA 1FYEA 1NBHA 1E63A 5IVIA 3VKFA 1Y4DE 3IAUA 3R1IA 3RS0A 3USCS 3SEFA 3AOGA 3C8DA 3K0KA 5A1TA 1CZUA 3DVRX 4ID3A 1PFUA 4PS0A 1VCNA 1ZJJA 2RI6A 3NHKA 3FTFA 3BA6A 1BX0A 4MRVA 1TU3A 2Z3VA 2VDMB 4HQOA 4MR8B 3CEHA 4X1YB 1IL0A 2YMLA 3D7MA 1U5BB 3V1TC 1XA3A 3P9PA 4HH3C 4MVJI 1CR1A 1UBFA 2Y3IA 3P5BA 3TQQA 3L0PA 2HV9A 1WHTB 4IXNA 4ENSA 3OE7D 2CNKA 1R4MB 4JBHA 3NYIA 3STYA 3Q0TA 3QNUA 3GJ4A 4WKGA 5E1BA 3ZHRA 4PZ9A 2NSLA 3ISVA 4EL0A 3QIAA 1MDBA 5K3BA 1OKKA 5HQJA 2B2CA 3UWKA 4GKBA 1RQPA 4RCVA 5C31A 5GAJA 4L5YA 4X3OA 4YXWD 4H31A 3DYVA 3I2HA 5CVCA 3H99A 1R4MA 5AICA 2ZS9A 2BM0A 1T35A 4YRBA 1BS9A 3MLBA 2E4ZA 2IK8A 4JL6A 3V8RA 3TDNA 4B0OA 3QTBA 3GLIE 2X7XA 1R37A 2JRLA 4CIVA 1FRFS 1I2AA 4U2KA 3PD1A 1PJ8A 2P1DA 2YIJA 3M6UA 2AOWA 4BNZA 1KRHA 1FFSA 2EJWA 1FTQA 1GNVA 3T5TA 4M53A 3CR7A 3HO6A 1NU8A 3D1JA 4RGQA 3HLTA 5DTIA 3FYHA 5BUSA 4O4HA 3NVKI 4RZ2A 5HUQA 2B3DA 2ORIA 5E3JA 2Q0XA 3A0RB 3FCOA 1MIOB 1XRRA 4UBKA 3TQTA 2D5CA 2OQIA 4R9SA 5EHGA 3KQHA 4KC0A 4OSEA 3PDIA 1JHDA 1LDNA 4KQKA 4XPIA 3MWEA 3N8GA 2ZXFA 3DE5X 3I09A 3NS7A 5G1PA 1K92A 2C4WA 3CKYA 3HKDB 4YXFA 1KQOA 3L07A 4XM1A 5JD3A 1GA6A 2P5SA 1Y9AA 3I30X 1U6IA 4U5XA 1PEKE 4XB2A 4J1TA 3RS5A 2IUFA 2CFIA 4A92A 1C3EA 4D43A 5L8VA 2Y0PA 1HYGA 1T24A 2QNRA 2O8CB 3PUVA 1JWLA 1E9SA 1HLPA 3K1AA 1HC7A 3A9CA 1RP7A 4JBXA 3I58A 3WQRA 4AM8A 4P4NA 4YRRA 3LQ1A 3C97A 3RRBA 1BWPA 2GCGA 2R1VA 2ZVDA 3F2IA 3R75A 2NTNA 2JKYA 4M0PA 2AG6A 1QDUA 3B13B 3GDWA 4JBNA 4L9RA 4CM8A 1H3EA 5TMBA 1N1MA 4ZQHA 2EP5A 2GPAA 3L93A 4Q6WA 5BOSA 2RIPA 4D9CA 2HQSA 2ARKA 3DR5A 1G0OA 2VYFA 3NIDB 1T34A 2GK6A 3BHMA 4RZHA 4IXWA 1IY1A 1C1DA 5ICGA 1F7VA 4BTEA 4M89A 5BOVA 2CMKA 2R8XA 2Q1TA 1YU9A 1KBOA 4O4JA 4RNCA 4CQMD 1O95A 4P92A 2OXIA 4M8SA 2FEWB 5CK4A 2VXBA 1A77A 1Z82A 2VDRB 4NE9A 1QDEA 3SZMA 4GYWA 3IVMA 3OQBA 2Z5VA 3CX6A 3G2QA 3AF6A 2HA4A 1FYDA 2VAWA 4WRRA 1GRQA 1W5FA 1KEUA 1JW9B 1ZLYA 3FWYA 3C3JA 4I9HA 4NU5A 3A04A 4ZCIA 2VF7A 3MZ0A 3NHWA 4FJ1A 4KE7A 1DARA 4BQNA 3IA7A 3QWBA 2GCPA 4J1QA 4ZQEA 4AIIA 4BAZA 4EI9A 4M3NA 1L7NA 2NSJA 4E5VA 3CG0A 1IQ0A 1V48A 2DF8A 4HDNB 4KXXA 4LY3A 2OQ2A 5EAIA 3KJEA 2G04A 2VHVA 1Y8QA 1BA3A 3DBHB 4JUIA 4FR2A 4HH0A 5EIBD 4BRSA 1ZUNA 3MGBA 2I6XA 3O4IA 1OFTA 1WBBA 4M1EA 4Y6SA 2OY0A 4JDUA 1GNLA 1JRLA 3X1MA 3ZXYA 1Z39A 3H86A 3O26A 5CB4A 5JT1A 3UATA 1VLMA 3CKMA 4K9NA 2WICA 1JR6A 1B1CA 3DV0A 1SIBE 1QRAA 3N86A 2F3UA 1GFZA 5KPDA 1Y34E 2C83A 2VYVA 3GLHE 1PK9A 1RYBA 3FYUC 2N75A 1S8FA 4UDNA 5CVEA 4BVHA 2EW1A 4UM8B 1H0HA 3TZHA 3QW2A 4HFMA 1XU7A 1WW2A 2YMMA 3TSZA 4B4KA 2HGZA 4FONA 3O5AA 1XK7A 4G24A 3BIOA 4LBWA 5EINA 4GX0A 3V46A 5KQLA 2OYSA 4NYIQ 4ZDJA 3ADCA 2WD8A 2GN6A 1F4LA 2EIHA 1T0UA 2ACWA 2Q5CA 1RM0A 4QBHA 4Z1MA 1TD9A 2YFKA 4WCFC 4XUGB 4JJAA 2MSEB 5BN1A 3E2PA 3M6WA 2YN0A 1JIIA 1G8GA 1KSJA 3S2EA 5KHAA 4RTRA 1GILA 3JQBA 1AG9A 3LIIA 1T1GA 3FF1A 2JDIA 3OZUA 3JPYA 4I4IA 1A04A 5EHXA 5IAKA 3MCAA 2WE7A 1ZVJA 4XKJA 3SQMA 3UMRA 2JK1A 3UPUA 1ZUHA 3LLVA 3Q11A 4TWAA 3WA6A 1Q7BA 2EEPA 4GVLA 2Q7DA 1FFEA 3QBJA 3K15A 4DPLA 3GBSA 3HRKA 1IRIA 2DBRA 3I0NA 3U39A 2XB6A 3QPCA 4PYRA 4UFOA 4KLNA 4BQPA 3GLFB 2ZSIA 4EFDA 2IQ5A 4BYMA 3OM8A 4CTMA 5KTMA 1DX6A 2AYXA 2VDPB 4OH1A 2EHJA 3U3KA 4LQCA 4N7RA 2A67A 2CVZA 4LJ5A