2ZIAA

C4s dck variant of dck in complex with cladribine+udp
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
241
structure length
220
Chain Sequence
RIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNVGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxycytidine kinase
publication title Elucidation of different binding modes of purine nucleosides to human deoxycytidine kinase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 87
structure length 220
sequence length 241
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2008-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ziaA00
4JYBA 4LBYA 3SOPA 3ZZUA 3EC1A 4OQLA 2PEZA 1EWRA 3VR2A 621PA 3UIEA 2EQBA 1J90A 3NIBA 5SZHB 4UKDA 2DFNA 3GJ0A 3B1VA 2OZEA 4FXPA 4ZIRB 3O47A 1XEXB 1Z6TA 4CEIA 1YR9A 5FI0B 2A30A 1IXSB 2R62A 1NN3A 4JLJA 2P6RA 4KYUA 5A5GA 1P3JA 2CLSA 4QBFA 5JJIA 3JZMA 4B6FA 2V55B 3EASA 1VKJA 1E2GA 3FGNA 2B7CA 2GNOA 2WKRA 2DBYA 3UMRA 4TMTA 4TYYA 1Z2AA 3K0SA 1OIXA 3EC2A 3GMTA 3ZYCA 4TYNA 2FFBA 1G6HA 4R2HA 4YMVA 4A6PA 2WWFA 4C4PA 3MD0A 1A2KC 1OF1A 1ZMXA 2WZQA 2C2HA 3CF0A 3SI7A 1UKZA 3OEHD 2REOA 3OIUA 3UG7A 1LFDB 1FW6A 1R5OA 3U44A 1RC8A 3AVOA 3WMFA 2I4IA 4PO1A 4LJ4A 4QGGA 5KOYA 3WRXC 4M1SA 2WJIA 3H86A 1KSGA 3EX7C 4FD2A 1G7TA 1PLLA 2EYQA 3UXMA 5LD2B 4HB0A 4RD1A 3KJIA 2EFEB 1HE1C 2R6CA 3MWJA 1QHSA 2GRJA 1NVVQ 1AGRA 1CJVC 2P3SA 5AWFC 2W00A 3DHWC 1KMHA 3IPXA 1G64A 4KXFB 4QJ5A 4PX9A 1H8EA 1WMSA 2B21A 1DAFA 1SVWA 1ZD1A 5B57C 3N70A 4TYQA 1OXXK 3QPVA 3C8UA 3KUCA 3IDQA 2AWOA 2PMKA 3N5CA 3RDPA 1NNEA 5AK0A 3U2QA 4QOSA 4LYFA 4QL3A 1VCOA 4ZO4A 2P67A 2ZYWX 5LBIA 4QG7A 2GESA 1WF3A 3M6AA 2OV2A 1W2HA 5BN5A 5EE9A 2VSXA 3KQKA 3W8NA 4ZI3A 1W36D 2NPFA 4NYJQ 1F6BA 3B1XA 4Q9IA 4G5OA 5CLLA 3EWSA 4U00A 2ZE8A 1YRAA 1IY2A 1XEWX 2XTNA 2Z5FA 3PUZA 2H17A 3RS5A 3HPRA 1Q1EA 2YZ2A 2IYQA 3DKPA 1E2FA 1ESNA 2GXAA 2QA5A 2OESA 1DTSA 4L15A 4V0MA 3AF3A 1GOTA 1R8SA 2AD1A 3KFVA 3LXRA 4KCGA 3DDCA 1OFUX 3L0IB 3WP1B 2WWHA 3M0EA 3TSWA 2WKQA 1R5NA 2KBFA 5FBRB 2CHVA 4GRAA 3ASYA 2IC5A 1IONA 1UBGA 2JJ2D 2F43B 3AVPA 1GNRA 1UJ2A 4NL4H 4EDHA 1CXZA 3FMIA 4BFXA 3D31A 3KX2A 4WOPA 1OLOA 3AKEA 2D7DA 4EFNA 3EPHA 2J59A 2Q21A 1ELOA 1UKEA 3DMDA 1W5TA 4TYWA 2OXRA 3AM1A 3KUDA 1RJ9A 1G9XA 5DHFA 5JJKA 4Q48A 4TT3A 3J81k 3OAAA 1II8A 2REXB 4NYIR 2OFOA 4D81A 3GPLA 1YZUA 5GJWC 4B34A 2O8BB 1G21E 2GXSA 3NBYC 2F1RA 3B5JA 3KFXA 1TPZA 3DZDA 5FPSA 4IOKA 2HT6A 2ORVA 4JSYA 4KYIB 3UWOA 2E9SA 1EK0A 1OXSC 4EJSB 5M04A 4Q02A 4O0MA 1R4AA 2ZE6A 1E9DA 4TSFA 3R7WA 4FMDB 4CYMA 3IQWA 4MITA 2ZRGA 3QF4B 3JZAA 2VHUA 1R0ZA 1HT1E 3KKQA 1KOFA 2ZJAA 2OILA 2P6UA 1VPLA 4G0NA 4URVR 2C96A 4W7SA 1IXZA 3AVUA 1OH7A 1DPFA 4OI2A 2OCYC 4JLMA 2GEUA 1KO1A 2EYUA 1OXVA 1FMJA 2J7KA 4NU0A 3AKDA 4I1OA 5KYKA 1D9ZA 1U8ZA 1X8JA 2NIPA 2G88A 3FOZA 1ZM7A 2IXFA 2ZRAA 2O8FA 4GBMA 3PUWA 4F7WA 3GJXC 4S35A 5GJCA 3PG5A 1U99A 3B1ZA 4B6EA 3KXIA 3SNHA 4CEHA 2PEYA 3ZQ6A 1KO7A 4ZKEA 1EGAA 4NCKA 2VTKA 4DLRA 2WWIA 3L82B 4PAOA 1CRQA 3R9IA 3T1QA 3AH8A 1N5KA 2PL3A 2BEKA 2ZS7A 5KDOA 2QPAA 1E1RA 2WICA 3FMOB 3MLEA 3N2IA 2FGJA 2EFDB 5J47A 5KDLA 1KJWA 3IIJA 1D8TA 3AVVA 4LZZA 2XJ9A 2C78A 4UNPA 1R0XA 3THYB 4HAYA 4GSYA 3NWJA 3VR5A 2GILA 2X8AA 3P4YA 1M8PA 4LCBA 1FOEB 1KTVA 1ZCAA 3VFDA 5FPHA 2ZTSA 4JVMA 3QXXA 2FSHA 1LNZA 4NCHA 3QJYA 5EP4A 2YWEA 2FFQA 3VQTA 1XMVA 3X2SA 2Z4RA 3U3OA 4NTZA 4XWOA 1D5CA 4DSOA 1Q1QA 1RE0A 2OO7A 1U2RA 3Q8XB 5EE5B 1G3UA 3H4MA 1KDPA 1QVAA 1E9EA 4NYIQ 4V0OA 1E96A 5KU1A 1GRRA 1Q57A 3PFIA 2MMGA 1P72A 4KHZA 1RW4A 1NLYA 2BC9A 3PUXA 4PO9A 2JCSA 1ODFA 1XJQA 2O8DA 4C0KA 4AK9A 1XD2B 5FL7D 4G5QA 1W0KA 2EFHB 2G1KA 5BYJA 1Z0KA 1RYHA 2B6HA 2RGXA 3REGA 1D2NA 2W58A 3K9GA 4HZUA 5IDVA 4BE7B 2IF0A 3B9PA 2ZRMA 4JLPA 3DKVA 3RC8A 1BS1A 1XZQA 1AZTA 2PJZA 4LV8B 2G77B 3CNNA 4P4SB 5HTKA 1P2UA 1IY1A 2FWRA 2JEOA 4V0KA 4GDFA 3R9XA 1NG1A 5KSPA 2RGAA 1KJYA 2DR3A 4PQYA 4K46A 1W4CA 2DCUA 1RRCA 2C99A 2JJ1A 4OK5A 2HXYA 2H1LA 5CITA 1E2JA 3B7GA 1LF5A 3QKRB 1M7HA 2X2FA 2X77A 3JVUA 5J5CA 4ESHA 3W6NA 2PT5A 4A8JC 1KK1A 1KSFX 3QEJA 1FPMA 2Z43A 3EARA 4LHYA 2E87A 5G3YA 3NG1A 4Z1MD 4TTPA 4ITRC 4B3XA 3GLGA 2QORA 1XTRA 5H70A 1Z3IX 3QBVA 4GNKA 3FE2A 5HPYB 4KSBA 5HR5A 5JBQA 1GAJA 3OESA 1D6JA 4JLBA 3ONWA 4GPTA 1G3IA 5CYPA 1DOAA 3QQ5A 4N1AA 5HCNA 1E2LA 3I72A 2Q9AA 1XWIA 3TQFA 1XCGB 4G01B 4M9SA 3THOA 2FDCA 3MCAA 1IAQA 4RD2A 4DIEA 1DEKA 4V02A 3WYAA 1OH5A 3OEHA 3GFTA 4DCTA 1VHLA 1WE2A 3IHWA 1DARA 3GLHE 1VMAA 4CT5A 4B48A 3SYNA 2ZI7A 4JZKA 1ZD9A 2RGCA 3HP1A 4BZQA 2ZQ5A 2C95A 2GVDC 2RGNA 4MGYR 1V43A 3E2IA 4GZLA 1P73A 3LBNA 5B64A 5KTYA 2CLCX 2W0MA 3TRFA 2AX4A 1F60A 3PVSA 4BFTA 1XTSA 2LWIA 1W0JD 4L5BA 4B71A 5L3SA 1SQ5A 4OHYA 2WWWA 5CLQA 3DZ8A 4PC3A 1U8YA 1A4RA 2G6BA 3A1UA 1YZLA 1Z6XA 3MWYW 3ICQB 4GFDA 4BWYA 4Q7MB 2XNDD 1NLZA 5AJXA 2B7BA 3EZ7A 3QXJA 1G8GA 2NO0A 4C0JA 1K5GA 1S1MA 3CWZA 1N5IA 5JI2E 1QHXA 4BLQA 4ZDJA 3UMFA 4RD6A 4C3ZA 4LJ6A 4QBIA 2FE4A 3FMPB 2QM8A 1FP7A 5JHGB 4RY2A 5JECA 4BASA 4M8NE 4C7OB 1G3QA 4A0RA 3LD9A 4AG5A 4ON9A 2QAGB 3H0KA 2GKSA 3IILA 3X1ZA 1FL9A 1US8B 4NCNA 4CDGA 3MWLA 4PPNA 3OF5A 4JLVA 1XF9A 3QPWA 2GA8A 2ZYUX 3GJ3A 3HJNA 4V03A 3TW4A 2XGJA 4MRPA 4WIAA 3UK6A 3ZZ0A 1V5WA 3GLIA 2JLYA 3BFXA 4MYCA 1G5PA 2Q6TA 1KDTA 5SZKB 3WBKA 5JEDA 2IWHA 1P9WA 4URZR 4MGIR 1ZNXA 1JALA 5BN3A 3RRZA 5HZKA 3IBGA 4DLZA 2A5YB 1OIWA 3I73A 3K09C 5EUMA 1RRPA 4A0GA 2ZXUA 2O52A 1XXHE 1Y3AA 3Q5DA 3DPUA 1XD8A 1Z28A 2QRZA 1P60A 4NH0A 1G8YA 4ABYA 2D2FA 4EPRA 1EX6A 3H2YA 2D3WA 2WHXA 4JBXA 2YV5A 3AVTA 2A7QA 2QL6A 3TUJC 3V9PA 1JXMA 2J45A 1IY0A 4XD7A 4BFYA 1CKEA 2ZI4A 4DHEA 2HV8A 2IYLD 3IIMA 3BC1A 4KJZA 3RS2A 2WWXA 2UVQA 4O2LA 2FX3A 5AJZA 4TLBA 3FMFA 1P2SA 1B23P 2OLKA 3BS4A 4NKRA 5FPYA 4B2PA 3PEYA 1IN8A 4RFSB 4B43A 1KI7A 3U6KA 3FHCB 4D0NA 4AKIA 2RB4A 4D4JA 3QUSA 1TL7C 1O87A 3SZRA 4LBZA 3SU8A 2CBZA 3GLHA 3DEFA 1E6CA 3HWSA 1WA5A 2ZIAA 3GLFA 2H5EA 1N2CE 3TLXA 1KIMA 3DMNA 3CNOA 2GXUA 3ZD6A 2ZJOA 3RWOA 5B58C 5KNCA 2ZRKA 5JMTA 4P4UA 3ZIAD 4Q66C 2IYRA 2D7CA 3LVRE 3TR5A 1AA9A 4C0BA 4E07A 4F91B 2J46A 4Q4JA 1AJEA 1T5LA 2QGNA 5C18A 1SVLA 2W0SA 2XX3A 4HB2A 4BGDA 2XXAA 3SBEA 2N46A 3S1AB 1SKYB 2QAJA 4X8HA 1Z47A 1UF9A 3PEWA 5EJEA 5BWMA 1ZD8A 3K0CA 4M1KA 3AV0B 1QDEA 5KPJA 3SJBA 3AQ4A 5DYGA 2IUSA 3W3ZB 4ARZB 2B8TA 3CBQA 1OSNA 4C30A 4LBVA 3EXAA 4R98A 1TNDA 3TJZA 4BLRA 1AS3A 2YWFA 1QF9A 3VR3A 1Z0AA 4US2R 3K0FB 4P32A 2JLRA 1UBFA 3THWB 2NQ2C 4NYMR 2REBA 3TW8B 3BH7A 4IXMA 3HR7A 3QVVA 3D8BA 4PHFA 4PPFA 4MDFA 1E0AA 1AIPA 5E7IA 2BBTA 1OXUA 1NN1A 2ODEA 2QT1A 4MRRA 1JECA 1NVXQ 2PT7A 5BW8A 5L3QA 2C03A 1KYIA 4WA7A 1KAOA 2BDTA 4ZDWA 2JJ8A 4Y0VA 2ZR0A 1AK2A 4Q01A 5EXTA 1SVIA 2CVFA 4IOLA 5JRZA 1VG9B 1E32A 1WCV1 1RYFA 5CK4A 4DC9A 1HE8B 1QHHA 4CEIB 4W9MC 1TUIA 3U3JA 2ZS9A 1HY3A 2NO6A 2VSFA 3B1YA 4OQMA 3AVXA 4RD0A 4EPTA 1OKKA 4PPGA 1T3SA 3L0SA 2C9YA 3C16C 3HPQA 1Z5ZA 1YZNA 2YHSA 1NF3A 3NVAA 4BRWA 1G3RA 3QXHA 3IIKA 2HDNB 5J4KA 3BORA 2ZYVX 5GJBA 1XXHA 4A0HA 3EPLA 4NP6A 2WJGA 3ZD7A 4JVSB 1U0HC 2ZR9A 3UKDA 4NCJA 2EW1A 3QEOA 5DI3A 1G7RA 1YE8A 3NHAA 2A5FA 4XVQA 1FMLA 1TQ2A 2AKAB 1E1RD 2ZREA 1WDTA 2ZANA 5K8IA 2J7PD 2WV9A 1XTQA 2F7SA 3U44B 1GNQA 1ZU5A 2Q9BA 3IO3A 2H7VA 1KDOA 2VHCA 1RRGA 2XSZD 5H68A 5FTJA 5F2EA 1QHNA 1E9FA 3A8TA 4HLUC 2CXXA 3I5XA 2GEVA 4A0FA 1MO4A 1U98A 3M1IA 4V0LA 1S96A 4XSHA 3RRMA 4YXWD 2ASEA 1KMHB 1JB1A 4GOKA 2FPLA 1G8HA 2ZRLA 1X8KA 1PV4A 5CIWA 3LW8A 3RS7A 1RVDA 2C98A 3W5IA 3CUEF 3SJAA 3OE7A 3TQCA 2ZJYA 1U9IA 1Z08A 4QFMA 2NTYC 2QQ0A 3RSLA 4M1WA 1CS4C 1A2BA 1NKSA 3DM5A 2ZM5A 1M74A 2XTMA 4MGZR 2OUKA 2WVJA 1T5IA 2OCAA 3W34A 3KQLA 4R7ZA 1CR4A 2ZUBA 4DSUA 4V0ME 4PC6A 4PQFA 5LB4A 5JCPA 4ARZA 2MSDB 1QVRA 4XSGA 4CF7A 1ZJ6A 2QENA 5FH9A 4US1R 1I2DA 3WHLA 1EFRD 4KFTA 5FTLA 1R6BX 721PA 2ZSAA 4TMKA 1W0JA 3HYTA 2WM9B 4RJLA 1E2EA 3PUYA 1VHTA 3P32A 1XB2A 2VLIA 2NZJA 5CM8B 2WMOB 2R8RA 3JVVA 3U60B 2FMXA 4QKQA 3E5HA 2JJ1D 2XNDA 2DY1A 3ZLJA 4TLCA 4A15A 4A4DA 5BYKA 4HAXA 1YZGA 1NY5A 4Q5IA 4BLPA 5BN4A 5HKKD 3PUVA 3CPJB 3NXSA 4UQOA 4MA4A 4K81B 5GADl 5G40A 1RJ9B 3I1FA 3GJ4A 2J41A 3NKVA 1SVKA 1S1CA 1P75A 2KE5A 3W6OA 3LY5A 5DN6A 1KSHA 5GJVC 2ATVA 1II8B 3ADKA 2BHRA 1MABA 3CW2A 3FVQA 2IHYA 1N0WA 4XVUA 2QT0A 2GBLA 4HUQA 3VNUA 3P4XA 1SXJC 5FPTA 4BQSA 1OT3A 1D2EA 1Z6YA 2BM0A 2FZ4A 3PXGA 5P21A 4PFSA 3VX4A 4ZCMA 4PO8A 1IOZA 4QHYA 3R7WB 2VRWA 2CL7X 3NHBA 4X8OA 2CJWA 2BJWA 3K9NA 3LQRA 3MUFA 4PZZA 1GKUB 3ND8A 4C0QC 5DSZA 2CL6X 1AQUA 2O0KA 3C41J 2C8VA 2R65A 2ATXA 4QHTA 4F93B 1LS6A 1R5BA 1JEEA 1SZPA 1TF2A 3BIFA 4GMDA 3RVBA 3B82A 2R6GA 1NSTA 2IS6A 2B8WA 4PC2A 5BXQC 4QXAA 3MMPA 1OB5A 2J0UA 5KUTA 5FUVA 5KO2A 4A82A 3ZVNA 4CRWB 1XMIA 2VO1A 3BFVA 2O8FB 3WHKA 1U81A 1II9A 1MT0A 3PEVA 4LX0A 5K8LA 2ZPTX 1OYYA 5HE9A 4CEHB 521PA 3W6PA 3I3SR 2XNSA 5AJWA 4ESVA 1Q1ZA 4Q1DA 3F8TA 5D3MA 1YZKA 1BIFA 3BRWD 4PC7A 4UNSA 5EP3A 3A6PC 2IBMA 4A9AA 1EESA 421PA 4Z51A 1OH8A 2ONKA 4GP6A 3T61A 3VKGA 3QKUA 2FPKA 4TMZA 1F5NA 3AKYA 1FNMA 5C4MA 1UEIA 4AC9A 2ZJBA 2ZRHA 2V7QD 3Q9LA 2ZE5A 4PTLA 5J4VA 4ACBA 5F9HA 3MGCA 3A4NA 1Q3TA 1KO4A 1RRFA 2PZEA 1NN0A 2QN6A 3CR7A 4LK2A 2IHBA 3HU1A 4JLNA 3W90A 1GRNA 2IYYA 1KK2A 1VCIA 3I92A 3NEJA 3U3RA 3ZIAA 1NMXA 4DEYA 2VYFA 1E2DA 1FUKA 4P4TA 1T4GA 2FEOA 4AI6A 2GJ9A 3KKNA 1A5TA 1E2QA 1X86B 4MUAA 5DH9A 2RCNA 3RS4A 3LXXA 1MRNA 4LYJA 4D6PA 4PR0A 4BLOA 5FOXA 1N3BA 2WIBA 1ZU4A 2AD5A 3D3QA 1E69A 1G18A 4HB3A 4MRNA 4XJXA 3TKLA 3L8ZA 4LHWA 4LJ7A 2QBYA 1UKVY 4N0DA 2O8DB 3KQNA 4RCZA 3KKMA 3A1VA 2IA5A 2V8OA 1C9KA 3PITA 1JJ7A 2DPXA 1F2UB 4Q03A 3R8CA 3EZ9A 4OYHA 1WP9A 2EFGA 1ZRHA 4HZUB 1GNPA 2OCBA 4TQUS 2Z6VA 1YQTA 4N0EA 1T8UA 4P31A 4LPKA 1G1MA 1Z63A 4ERNA 2XZLA 3LBHA 1J8YF 3BH6A 2AK2A 4JL8A 4HI0E 5DO9A 2BMFA 3BB3A 2I1QA 3WY9A 5LD2C 4XD7D 2A5GA 3FKSD 5ELXA 4GT1A 2HF9A 3GLGE 1KI4A 2IYZA 4URWR 1BKDR 1VIAA 2I1VB 4DT1A 2IYXA 2ZAMA 2D4HA 2QI9C 4DLVA 1XNJA 1IQPA 3RS0A 3U3MA 3LLUA 1UPTA 2YVUA 3PR1A 3VKWA 1I2MA 3AB3A 4DB2A 3WMGA 1XP8A 3GLGB 2YOHA 2ZJ5A 3GJ5A 3BH0A 2O5VA 1ZUHA 1MKYA 4F4IA 1M6NA 1DAIA 2AR7A 1DG3A 1X3SA 1NJGA 4NMMA 4Q1AA 2A9KA 2P65A 2RKOA 3C7KA 3R20A 4I99A 4URUR 2KB0A 4NPHA 4KSCA 2F9LA 4DWJA 1XTIA 2GZHA 1OHHD 3RANA 2GK7A 3OZXA 4CGZA 1W4AA 3AP2A 3SYKA 3FFAA 2IS4A 3HDTA 4DVGA 3LW7A 4FIDA 3K70D 2GZAA 5TV2A 2RGDA 2Q3HA 2OLJA 4OK3A 5JZVA 1Z2CA 2XZOA 2J7PA 2JA1A 2ORIA 1VYTA 3HU2A 3LAWA 4C0LA 2BCGY 3SEAA 4PSKA 3F5FA 4LV6A 2XSZA 5F98A 4Q9KA 1UBEA 1OV4A 4KBGA 4W5WA 1X6VA 4B2LA 4DCUA 4LV5B 5SZIA 1BYIA 1R7RA 1Q12A 2QMHA 4KLNA 2P6NA 2UZIR 1KZGB 1KMQA 1DAKA 4YXWA 2KSQA 5JJLA 4JT4A 4X8LA 5AUNB 4KV9A 2YWHA 3GEEA 2GAAA 5EE1A 1JEDA 1F3OA 1S8FA 5L3SB 1I4LD 1VG0B 3QXCA 2NG1A 3BBPA 3KTAA 4G1UC 3NC0C 4I4LA 4F92B 2O8EB 1FFHA 2XB4A 2Q0HA 1NIJA 4DLYA 1E1QD 4B76A 1FTSA 2FOLA 5AUOB 1G5RA 1XFAA 3QSYA 4XIGS 1N6HA 2MMCA 4LGMA 1PJRA 4HLQB 1Y63A 1W36B 4AYWA 2ZRJA 5TARA 3EIEA 3O8CA 1EXMA 4EJSC 1NL3A 1F2UA 2RGEA 4MUBA 3T1OA 2NGRA 1Q0UA 4RZXA 5F3WB 5FR1A 1LS1A 2YKGA 1EFRA 4Q4LA 3FTQA 3OFNA 1OKKD 3GLIE 3ETLA 3IUYA 2OE2A 3VAAA 4R71A 5K8TA 3M4YA 2PH1A 1S2MA 3WNDA 3FHTA 4B3DA 5SZJA 5EXXA 1GITA 1N5JA 2ZUCA 2IT1A 2OBLA 4K8OA 3U4QA 3NEYA 5JI3E 1FP6A 1JQJC 4DBLC 4LI0A 3R9WA 5FBQB 3GLIB 1ZM4A 4DCVA 5DGXA 5IHPA 4DUGD 5HKKA 4DCSA 1LTQA 3ZS8A 221PA 1DO0A 2GHIA 4MKHA 3NC1C 1FNNA 5LB2A 2JLVA 1JPNA 2J1LA 2QMEA 2HJGA 3T34A 1E9CA 1CP2A 2IXEA 2ZSFA 3GJ7A 3TK1A 1G3MA 1G41A 2EWWA 2B92A 3KJGA 5FOWA 4M1OA 1I4TD 1E0JA 4Q1FA 4HATA 5FBLB 1X8LA 3BXZA 1ONBA 4YONB 1JXOA 2CK3A 3RS3A 2VF8A 1VG1A 3K0AA 4JLKA 3CLVA 4C9BA 4QGFA 4OQFA 3L0PA 3SR0A 5KHOC 2J3EA 4LC1A 4RZUA 4DLXA 1F2TA 2YINC 5IK2A 2D74A 3ZGXA 1OIVA 3OE7D 1HTWA 4KVAA 4N3NA 1VG8A 2ZITA 1XMJA 3SDZA 4D4LA 5DISB 2DWOA 5H8WA 3KB1A 4LYAA 3GLFE 2KJQA 4JLOA 4QBGB 4BZPA 4A8JA 2W83A 5EE3A 1E2IA 1ZNZA 2C5LA 5IF9A 4OHXA 1P2TA 3ADDA 1T6NA 2BKEA 2VP2A 1VECA 2ZU6A 3GLHB 4BFZA 1K6MA 3GJ6A 4DLTA 4PANA 3GLFB 3BGWA 4OBEA 2IYVA 4JBWA 4HDCA 1QZXA 2BKUA 2ERYA 4WW0A 3Q85A 4GOXA 3TUIC 3U6BA 5FFMA 2WJHA 4PHGA 2FG5A 5C46F 2IX3A 1J99A 3GEHA 2HYDA 3C4JA 2NPIA 2QEQA 2O8EA 4ZV4A 4Q4JB 4BUJA 2WJYA 1G4UR 2PMDA 1Z0FA 1FX0A 2V9PA 5EUQB 5HCIA 3HYRA 1OFTA 2WOOA 4YDSA 3K70B 4DXAA 2XXAB 1P2VA 2C77A 4LHZA 2IXGA 4JYCA 4A1FA 3U7EB 3T1TA 2HT1A 3GEIA 4LYHA 4TMWA 4KITB 2ZETA 5L3RA 1CLUA 2V7QA 4DZZA 5DN6D 3AP3A 2Q3MA 3K53A 4CEJA 4CW7A 3QVUA 4PC1A 1YJ5A 4IXNA 4YC7A 4ASUD 1NSFA 4AURA 8OHMA 4ZCLA 3QG1A 1AQYA 1WB9A 3U3KA 2WTUA 1TU4A 2WSMA 1II0A 1M1YE 4EFMA 1G19A 5EZ5A 1DADA 1KHTA 1G291 2A78A 1FUUA 3NH9A 2RH5A 1NI3A 3CRVA 2XJ4A 3Q5EA 5FOUA 1XMSA 1W47A 4QNMA 3VR6A 2GCPA 2BBSA 2GJKA 3SQXA 1ZUNB 4YLGA 5L3QB 5JWOA 3D6TB 2XITA 3TBKA 1R2QA 5ANRB 3I4LA 1U94A 1CIPA 1GSIA 2WMNB 4M22A 1L7VC 2CE2X 3LH5A 3EWAA 2IK8A 4Q9JA 1QHHB 3K0EA 5GVRA 5KNBA 4HLCA 3V4RA 5CB8A 2F1HA 2J9RA 2IYUA 2IWRA 2ODBA 4HAUA 4Q1CA 1S3SA 2ZRCA 5FOSA 1NJFA 3L8YA 3P1JA 3QOFA 1HH4A 2W6ID 3LO5A 3LNCA 3QKSA 4RD3A 1PZNA 4PHHA 1M2OB 3X1YA 1NKTA 2J5XA 2Z83A 3SJZA 3T5GA 1E9AA 4Q7KA 5JS7A 5IRCD 1IN5A 1SXJD 3FKSA 1ZP6A 4WZAE 5JLJA 1XXHB 2FV8A 4L8GA 3FFBA 1WBDA 1ZIPA 1EFUA 2VSOA 1VCNA 1GTVA 1E0SA 4W5JA 5DI3B 2QSYA 1X1RA 3W5JA 2EWVA 4TQ9A 5J4YA 4LWZA 2CLDX 3MRSA 3CH5A 3U7FB 3KKOA 2O8CA 3KJHA 4B2IA 4PSVA 1O3YA 4TL6A 1B0UA 4XTRA 3K09A 4DEXA 5KSOA 3I61A 1DG1G 1UDXA 3BB1A 3EA5A 2KBEA 4ZI2A 4C2UA 1EG7A 1SULA 3CH4B 5KPDA 3VHLB 2QP3A 2BVNA 1K8RA 3OIWA 2G83A 2P5TB 1DS6A 1OB2A 4LHVA 4ACAA 2V6JA 1CJKC 1OHHA 1XJCA 3EPKA 3TR0A 4KODA 4IFBA 4Q9HA 3R8FA 4U7DA 4DDVA 1MR3F 2JAQA 5CYOA 5EP2A 5J4LA 1KJZA 4RZ3A 1H8HD 1DE0A 3KL4A 1E99A 2QAGC 3LRPA 2FSIA 5BQ5A 2QTVB 1TUEA 2R44A 2ORWA 4DLSA 2XB2A 1EWQA 2JIZA 1P61B 1YZQA 2UKDA 1KI6A 2ZROA 4G3XA 3QENA 1T9HA 2XEXA 1P7CA 2IF2A 3NDPA 1U90A 4EPWA 3NBXX 2LKCA 3VR1A 5CIQA 4EKDA 2OG2A 3A37A 1DELA 2J0VA 1VTKA 4PQRA 1NLFA 5DI9A 2GEDA 1JR3D 4MKIA 2GCOA 1GM5A 1NMZA 1E79A 2EVWX 2PCJA 3A1SA 1IM2A 1KI2A 2GJSA 5TDHA 4M1TA 1TAGA 3OIYA 4IDPA 4NONA 1H65A 3REFA 4I1SA 4CIDA 1AM4D 1ZCBA 4UJ3A 2ONJA 1LF0A 3B9QA 4G5SA 1BMFA 1RFLA 2J87A 4B74A 1S3GA 2FA9A 4I81A 4LHXA 2W2XA 1E9RA 2XOKD 3AKCA 3P27A 1HEIA 1S4QA 2NO7A 3PQCA 1E1QA 2CL0X 2QZ4A 2ZU0C 4IDQA 4BRUA 2D2EA 4D4MA 5LPNA 1XTJA 4FI3C 4TQAA 3FWYA 2WWYA 1EFCA 2ZRIA 3WBJA 2ANBA 4BFUA 2J0QA 5D3QA 2H16A 1YVDA 3RSOA 2VA8A 4JLAA 5FR2A 4A2QA 5FUYA 1KDRA 2F1JA 3PCRB 4UXJA 4L9SA 2QY9A 3C14C 4Q7LA 5TY0A 1VIYA 3RLFA 4EQ6A 1IN6A 1MABB 2BM1A 3B85A 4L16A 3BE4A 4I1UA 3CX6A 4HUQB 1QG2A 2AWNA 2YOGA 4H9GA 1CR2A 1Z8FA 1P4SA 4FWIB 2G3YA 4DLUA 4IFEA 1T0JB 4D25A 5CB6A 1S0UA 4DUGA 3RABA 1SVOA 2VP0A 1P9NA 1A7JA 2JLSA 4B35A 2AKYA 2PX3A 3BOSA 3AP1A 2CJWB 3RYTC 4RKEA 1RPZA 1AGPA 1Z0JA 4V0NA 1W44A 5C4GB 3OEED 2QP9X 1DO2A 2JDIA 3CM0A 3MG9A 5K8UA 3CZPA 3AF2A 2AXNA 4E22A 1TF7A 1ZIOA 1HV8A 4RVCA 3IQXA 3SQWA 3FHOA 2QTFA 1T0HB 1CR0A 1TX4B 2PLFA 2IW3A 4QNRA 3SHFA 3X1WA 2IYTA 2F55A 1GVNB 3MJHA 4RSGA 2J0UB 4E03A 1OXTA 2ECKA 1D9XA 2OHFA 1N6IA 2WOJA 4DKXA 1G16A 2ZSEA 4M1YA 4FMBB 4QBHA 2ZI9A 1Z0DA 2QPOA 4MH0R 5FOVA 1KY3A 3KDSE 3TH5A 4R9UC 5J40A 2ODWA 4G5GA 1CBUA 1JJVA 1YRBA 2WBLC 5CDFE 3B78A 3ZZTA 3KQHA 3O8DA 4DSTA 2FNAA 2QP4A 2HEIA 1TEVA 4AYTA 2SHKA 4HDQB 4HAWA 5D3MB 4A2PA 4UNRA 1WBBA 4NYMQ 2ZVPX 2VP9A 1GILA 1LB1B 2CHGA 3VU9A 1PVOA 1Q44A 5JSZA 2PLRA 2QM7A 5CK5A 2C04A 1E2KA 2G1JA 1E0KA 2N42A 4B47A 1GG2A 2ZSBA 3IGFA 1Q1BA 4HSEA 3C5HA 4CVNA 4HLUA 3OFND 5L3VA 4PHTA 4WZBE 4UNNA 2QRNA 4OI0A 3D7MA 4MGKR 3QIAA 3G82C 2QE7A 2YC2C 3CKLA 4TLAA 3ZS9A 4JKYA 4FMCB 1BOFA 2QPTA 4HLDA 1NG9A 1GUAA 2OFXA 3IBYA 3CZQA 4KFRA 3TSOA 1PUIA 3TVDA 1BO6A 5F9FA 5JRJA 4OI4A 1AKEA 1G20E 1MV5A 4LBWA 2X1VA 3WYFA 3G0HA 1G17A 2GCNA 1MRSA 1W5SA 3I32A 2QBYB 4HUTA 3KXKA 1YZTA 2P2LA 4NYJR 1KK3A 1BYUA 4JJZA 1VDZA 4PXAA 3LQQA 3T5DA 4OHZA 1G8FA 4YMUA 4Q4HA 3ADCA 2ZS8A 1WXQA 2OCPA 2VHQA 4ASUA 2PCLA 1A82A 1PLJA 1T3LA 3QBTA 2CK3D 4FWTA 1GL6A 1HA3A 2ZE7A 3EZFA 1UEJA 5DHAA 2FU5C 3BFKA 4F4CA 2F6RA 5JWRA 3KB2A 1RIFA 1KI1A 1YR7A 4W5HA 4QM6A 3GFPA 4FW9A 1TQ6A 5IK2D 2VL7A 4WAUA 3KJEA 2FZLA 4HYYA 1ZUIA 2H18A 4BFVA 1XU4A 2NZ8A 2NO1A 4DT1B 4B75A 2DFKB 3U7HB 1YR6A 4D82A 3THXA 2OXCA 1UBCA 2RGGA 2ZRBA 2IS1A 3CPEA 3A4LA 1EFHA 1ESMA 4B73A 1KK0A 2A3RA 4IOMA 3TAHA 4ILEA 4ZDKA 4AKGA 4HEJA 5AJVB 3UPUA 4EPVA 3EIHA 1TTTA 4OL0A 1TQ4A 2WJJA 2W6IA 3SS8A 3VMFA 4AIIA 1J8MF 3NDBB 1QRAA 2UZ3A 1JBKA 2VEDA 1FTNA 3MFYA 1W1WA 4JL6A 1XCPA 3WXMA 1CJTC 1SXJA 4XOIA 3FB4A 3W9YA 1NY6A 4AYXA 2NOAA 2C9CA 4QJ3A 4JJKA 3ECCA 2WSSD 5C1BA 2ZR7A 2AFIE 1NBMA 3QPUA 3A4MA 2ANCA 1KI3A 4DDUA 3Q3JB 1Z83A 4Q4AA 2ZSDA 4IDNA 1U8AA 5CDFA 2G0TA 3WMEA 1P6XA 3DOEA 1E2PA 1CR1A 3I5YA 5A4JA 2R2AA 1TEXA 2DFLA 2KI5A 2MSEB 2VIIA 1KKLA 3BJIC 2FSFA 2HLDD 3MJRA 2XAUA 4FCVA 1GL9B 5J4HA 1TQDA 3FPAA 1KY2A 4I1VA 1W46A 3NH6A 4KFSA 4P3YA 1W7AA 4U02A 4LJ5A 1TADA 1XX6A 1NIPA 2QGZA 4HB4A 2IYWA 4KO8A 1SHZA 4J0QA 2FJUA 1X1SA 2AXPA 2RMKA 1H8HA 1Z07A 4LJ8A 5C2JB 5E7MA 2W6JD 1R10A 3FDIA 1E94E 1DBSA 3KTAB 4X8MA 3DO6A 3VNVA 4FINA 3ASZA 5FL3A 4EFLA 1Q21A 3TAUA 3FKQA 2VHJA 4Z54A 2HCBA 4IOJA 1Q20A 3CPHA 4AWXA 1KKMA 4U5XA 3DOFA 1N5LA 4US0R 2V6IA 1JR3A 4BFWA 3IO5A 3GQBA 3TE6A 5TMPA 2OAP1 3NBFA 2LCFA 3MWKA 4QC2A 4YMWA 2TMKA 1JNYA 4WZ6A 3CIOA 4RKFA 1G4AE 4Q47A 4JL5A 4L9WA 4ZIRA 4O3MA 4BEBA 1XEXA 2RAPA 3TGPA 2Q3FA 3CO5A 2XOKA 4JSTA 4Q18A 1UAAA 3NBZC 2VP5A 2IEZA 4GI7A 2DB3A 2K5UA 3IEUA 4AKEA 3U4QB 2CNWD 1LY1A 4POAA 4LUCA 2YOFA 2AK3A 3DL0A 4HZIA 5LDDC 1COWA 2CHQA 2GAOA 1HURA 1MO3A 1A1VA 4Q19A 4OI1A 2CE7A 1GIAA 1QG4A 1DAGA 2AN9A 4B3FX 1E2NA 2Z0MA 1YU9A 3C5CA 2A5DA 4GMXA 3KQUA 1N6KA 1Z6GA 2FGKA 1JAIA 4A36A 2BIFA 4O2RA 1M7BA 3ZVRA 1T8TA 3QXSA 3U5ZB 1CF4A 3LDAA 3EAQA 1GKYA 3AEZA 3K0AB 3Q7PA 5JS8A 3K1JA 4FCTA 4QHSA 4F38A 4MKFA 2GZDA 121PA 2KWIA 2QROA 3RWMB 1G7CA 3P26A 4TMXA 1F2TB 3RAPR 1CULC 1N6LA 4OJQA 2HXSA 2HF8A 2Y8EA 1FZQA 4JBYA 4IDOA 4TL8A 1W4BA 2WIAA 2JIZD 4B32A 1C4OA 3T06B 4TYPA 1UFQA 3CNLA 3SC3A 1YHNA 1J7KA 3OEEA 2PBRA 5FUXA 1L2TA 4A8JB 3HU3A 3K9LA 3H84A 4M1MA 1CJUC 4AY2A 2AL7A 4YQFA 2JLUA 2VBCA 3RC3A 4MRVA 4NZYA 3KKPA 1E79D 2N1BA 3T35A 5EXSA 2VP4A 1UM8A 2GETA 5A0FA 4MQBA 1S9HA 1XEFA 2ZEJA 5EQTA 4IDHA 2R6DA 2GXQA 4KAXA 2JLWA 3CRW1 3CB4A 3A36A 1LW7A 1BMFD 4PAQA 1JAHA 3SN6A 4MDEA 1KSJA 3CRMA 2QG6A 2GK6A 2ZVQX 1ZINA 4TMVA 3ADBA 4TLEA 2CMKA 4OHWA 2YWGA 4RD4A 4TZ0A 1ZAKA 2FFHA 2BCJQ 1FX0B 3HR8A 1SVMA 3CX7A 5EE0A 2X2EA 4QRHA 5JHHB 1M34E 2G0NA 1W49A 4HDOB 4LJYA 1E2HA 1PUJA 3ZVMA 2V4ZA 4JLDA 2FSGA 1DVRA 3SE0A 3VHXA 2F43A 1W4RA 3AUXA 1XRJA 3B2EA 5FUWA 1XJ0A 1U0LA 4OQXA 4BEJA 4EUNA 1QBKC 3DVLA 1FQKA 1PLKA 1ZYUA 4CEJB 1IJFA 2DHRA 3B13B 4QGAA 2ZJ8A 1GFIA 4IRUB 4KLZA 3ZDQA 3U7GA 1P9RA 2BMDA 4DSNA 4XH9B 1E2MA 4BLTA 4TTQA 3A1WA 821PA 1N6RA 4M9QA 1Z06A 1XTKA 3IPYA 2O8BA 1UKYA 3UATA 4IEEA 2V1XA 1EFTA 3L43A 5CJ2A 3LWNA 3O8RA 4GP7A 1NMYA 1RKBA 2W2VA 4O25A 3WNCA 4PSAA 4E09A 3CONA 4LY6A 3GP8A 2IUTA 4NCIA 2XZPA 2MSCB 2F1IA 1Q3HA 1IBRA 2JDID 3WP0A 4EJSA 4Z8XA 1N6NA 2ZAOA 4Y0AA 2OFWA 1N6PA 2FEMA 2WPDD 2XTZA 3QI2A 2E1RA 4M53A 3K8YA 3QF4A 4DRZA 1CTQA 3Q72A 4F4JA 5FPKA 4UXHA 4Q00A 4B3CA 3EPJA 5H1YA 1SGWA 1UDWA 1NP6A 3B1WA 3I8XA 5DLQC 1JI0A 5HE8A 5FOTA 3QKSB 3IEVA 3A1TA 6Q21A 1XZPA 3EG5A 3ND9A 2RGNC 4IVRA 1BH2A 4MYTA 1ZBDA 4TZ6A 3KZ1E 1E3MA 3EW9A 2VH5R 2GF0A 2NMVA 3QE0A 2W2TA 2ZJZA 3UWKA 4M4SA 3K9HA 3VX3A 1E4VA 4KU4A 1XPUA 2X19A 4YDHB 2PX0A 2O8CB 4DDWA 2IYSA 5B2ZA 1VYUA 2V54A 2ZYTX 4P0TA 4M9XA 3L2OB 4IW3B 2BMJA 3G5UA 1L4YA 4KBFA 1Z6AA 4WXPA 4PAMA 3F3YA 4URXR 5AUPB 1MOZA 2GJ8A 4D0LB 1W36C 4XTCS 4DIDA 2ZRPA 1GWNA 3AVWA 1S9DA 3L0OA 2QE7D 3THYA 2WSSA 4FMCF 1AS2A 4Q1BA 1I4DD 4EPXA 2CCKA 3CRQA 2AHOA 3BB4A 4EIWA 3CWQA 3VR4A 4B3GA 5FTMA 2JLQA 4LC0A 1MH1A 1KI9A 2O0HA 1OH6A 4DDTA 3AGPA 5FTKA 4C0SA 1KI6B 2H92A 2QNRA 1W2GA 3ZVLA 3V00A 4CZ2A 3AF0A 4DB4A 2OAQ1 2QU8A 5JWHA 2CCGA 2PZFA 4QM7A 4AKHA 1ETUA 2RHMA 4NHOA 3PV0A 4H1VA 5JEEA 2QMUA 3BK7A 3ICEA 1HYQA 1KAGA 1SKQA 1ZW6A 1JQLB 2GCOB 2HLDA 2VPPA 1K5DA 4E5UA 4YMTA 1TF5A 1ZNWA 1ZNYA 3BERA 3WYGA 4D80A 5JFGA 4B3BA 5E4FA 1G6OA 3UANA 3RRYA 1XD2A 5EXPA 4NE2A 1AZSC 3GD7A 4OK6A 3BAFA 2HUPA 1WRBA 2W6JA 4LRWA 2VHTA 5KNDA 1OFIA 2O0JA 2RGBA 3LA6A 3W3AA 4IKEA 1CEEA 3OIVA 2BBWA 5DNYB 4CT4B 4LJ9A 1NVUQ 4JKIA 5FBWB 3LVQE 3MSXA 5GVSA 1L8QA 4P4SA 3AF1A 2WWGA 1IN7A 1ZM3A 2VP6A 4YMSA 1QHGA 3LBIA 1E9SA 4IVQA 2WAXA 1KZ7B 3QNUA 2DYKA 5G3ZA 4B44A 3SBDA 2V3CC 2JJ2A 3QKRA 4ZDIA 1KNXA 2L0XA 4M9ZA 1N6OA 4UXIA 2JLXA 2ZUDA 1CU1A 1M7GA 4JVLA 3QKTA 2OEPA 4JS0A 3B8HA 3ZJYA 3E70C 4XWAA 4EQ6B 5FI1B 2P0EA 3SYLA 4HAZA 3TMKA 4XWKA 4UJ5A 3BD9A 1YR8A 4C2TA 2F3RA 1YKSA 1DAHA 4IEIA 5G53C 4EPYA 2FFAA 1E98A 4ZKDA 3Q7QA 5JCZA 2CNWA 4WXRA 2WAYA 2I3BA 1NBMD 2ZI6A 4JT2A 2D06A 5E95A 2PJRA 1LV7A 3LLMA 1HUQA 2OBMA 4C0AC 5AUQA 2IS2A 4RFVA 2JASA 3QG5A 3F0TA 1R8QA 4URYR 2CEAA 1HQYE 2BWJA 2YJTD 2BJVA 3PEUA 4A2WA 4LOAA 3CF6R 1RZ3A 1TU3A 1T3HA 1H8ED 2CVHA 1OW3B 4H1UA 4HAVA 4FN5A 3NTUA 3QF7A 3I8SA 4TWZA 3AF4A 2BBOA 4TLDA 3K70C 4OHVA 2C9OA 4BFSA 4JIMA 3SFZA 3SHWA 2PZGA 5DYIA 3EZ6A 4R2IA 1QHYA 3U61B 1XEWY 1IN4A 2R6AA 2GTPA 1IXRC 1QHIA 2OBNA 4D26A 3K0CC 3SJCA 2IEYA 3QY0A 2DFTA 5FTNA 4LJAA 3BWDD 4DCNA 4PZLA 1KO8A 1OFHA 1G5TA 2GVZC 3EZ2A 4DLWA 5L8VA 3DM9B 4IJMA 1SVSA 2FH5B 2FN4A 4L4UA 3TUZC 1T91A 5CJPA 4KFUA 4WVFA 4ZCIA 1SKYE 4OJKA 2WKPA 5G41A 4II7A 1XD9A 4A6XA 2QSZA 3VU9B 1TMKA 2QTHA 2HCJB 1CRPA 1XBTA 1AKYA 1J2JA 1XCMA 4Q1EA 5JSZB 4TL9A 3AUYA 3LFUA 5TVKA 3UMSA 1AN0A 1VCMA 3CF2A 1MO6A 4ZPXA 4JVNA 4PPQA 4OQNA 3B60A 1GRQA 3PIRA 2F9MA 3T12A 3GJ8A 2YNMA 1KO5A 2NO9A 3B6EA 2OT3B 1SHKA 4QGHA 5DE3A 1GKIA 1E9BA 4C7OA 4LSGA 4TT3D 5DIFA 2V1UA 2QAGA 4PZYA 3OAAD 4RZ2A 4MRSA 2DWQA 4S2EA 3X1XA 5KDDA 2YYZA 1F48A 4Q21A 4B33A 2ZRNA 1CJMA 3IKJA 2ZI3A 1US8A 2A2ZA 1OYWA 4KVGA 3PENA 4IVPA 3ZQJA 1JPJA 1COWD 1IJEA 3P20A 5CM9C 1IHUA 3AVQA 4FCWA 2R9VA 1DAMA 4OKSA 1OE0A 1R0YA 4D0GA 3T1VA 2DWPA 4M0LA 4NDZA 2OM2A 4BECA 3CX8A 5KSZA 1NVWQ 4FMDF 4TSFD 3I62A 3EIQA 1Z29A 5AR1A 1KNQA 3TNFA 4Q4HB 3LX5A 2GJAA 1KGDA 2CCJA 1MO5A 2AFHE 4MYHA 5FBVB 2JLZA 2ZJ2A 1W48A 5FL7A 4QJ4A 4Z8YA 4TTRA 1LVGA 1XPOA 3PJRA 2ZRFA 2IL1A 3C15C 3V4FA 3KXLA 1XDBA 2RHDA 4LDJA 1FQJA 1UADA 1ZVQA 3LV8A 2A5JA 3RHFA 4WBSA 4AG6A 4GOJA 2BV3A 2YC4C 3AVYA 1GP2A 3GFOA 2P5SA 2VQSA 3THXB 1ANKA 1GL7A 3X1DA 3T15A 3H1TA 1ZM9A 2WPDA 5EP1A 5EZ6B 3O8BA 1SXJE 1WQ1R 2QMOA 3CR8A 1U9IC 1J70A 3E1SA 1N25A 3RNLA 4C0HA 2Q9CA 2BOVA 4D2IA 1XPRA 1E4YA 2R6FA 1OJLA 1C1YA 1NBME 2GF9A 2QQEA 1Z0IA 4UNQA 4AD8A 4GL2A 3VTKA 4P33A 4RFSA 4Q9LA 1L4UA 3W8RA 1AS0A 1G7SA 5TB5A 3WNBA 4Z1MA 1G8PA 5TXGA 4XVRA 4BZXA 1HT2E 1P62B 1SXJB 1VYVA 2BEJA 3GCGA 4RCYA 3MAAC 2VF7A 1OPXA 4NBSA 1ZC3A 2OSBA 1R0WA 1ZC4A 2EFCB 1P5ZB 3VKHA 2FF7A 3TIFA 5B30A 1KI8A 3AGQA 2HYIC 3CRRA 1NRJB 4MKGA 2H57A 4M2LA 4G5RA 4EAQA 1N0UA 1Q22A 1DAEA 2IUUA 4Q4AB 4TN1A 2ERXA 3WRYC 5KSYA 4DJTA 4D4KA 2Z4SA 2H8KA 2EU8A 3N2EA 5UKDA 3S1AA 2CDNA 3UG6A 2G9NA 1NVVR 4GZMA 4MYUA 1NN5A 2BMEA 3EA0A 2JGNA 5E7JA 2GWHA 5E3HA 2QUZA 5IT5A 2D62A 3ZH9B 1W0KD 1GDDA 1HQCA 3FYHA 5AJYA 1U0JA 4LPSA 2ODNA 3SFVA 4JMPA 1Z22A 2LKDA 4M21A 4BLSA 2ZRDA 3RRNA 1JR3E 2GDJA 2JATA 5HZHA 3TSZA 3OHMA 3A58B 2J0SA 1EX7A 2HJVA 4BPBA 1GZSA 2GBLC 3K0FA 4TL7A 3THWA 4KI0A 1JR6A 2FPMA 1N0VC 2WJVA 3IHLA 4Q7JB 4IHQA 3LX8A 4A92A 2F3TA 3TVTA 1ZM2A 1D2MA 2ZI5A
chains in the Genus database with same CATH superfamily
3RKUA 3GQBB 4LBYA 2WRZA 2D00A 2A0YA 1T15A 4OQLA 4HNRA 3FPSA 2PEZA 1RYDA 4NOMA 3UIEA 2CUTA 3MUEA 3WAJA 1Y6RA 1JKXA 5BNFA 5SZHB 4DV0B 4UKDA 3OI7A 4TPKA 5AKJA 4PGAA 3B1VA 2IXTA 2NWQA 1JBEA 4QPNA 3R75A 3IKVA 1UIMA 4CEIA 2XVAA 1YR9A 1TA4A 3H8WA 3FVVA 4ED9A 2P6RA 4KYUA 5IF3A 3V7YA 3GCXA 1L8XA 1P3JA 4QBFA 2PWBA 4TVSA 3JZMA 3NJRA 5JJIA 1TZJA 1CE8A 3EASA 4LRQA 5TRTA 3WQRA 2HWWA 3WWPA 5CFQA 4X1KA 1L5ZA 2IXBA 4G89A 4LXIA 2J33A 1J42A 2J30A 2R68A 3NHLA 4LWPA 3WLOA 2YDXA 2C2BA 5G0SA 3ZHZA 1AA6A 1K4YA 4MO9A 1SO8A 4TYYA 1YS6A 1N9GB 3IP7A 2BHNA 4TRRA 4YMVA 3NVMB 4MVJG 4A6PA 3BL6A 4HDMA 3MD0A 1OGYA 1A2KC 5LZ8A 3JALB 1XYGA 3L4SO 4ICIA 4HGOA 3SI7A 5KNDH 3U13A 5ARBA 3OIUA 1N2BA 1G0OA 4YLEA 4EHFA 1LFDB 1FW6A 1Q77A 1QDUA 1R5OA 2XTAA 1ZK4A 4UE6A 1V25A 3WMFA 3FF1A 5ALQA 2VTEA 3ZDYB 4E11A 2PYIA 2JJQA 3Q1LA 4KPYA 3BCRA 1KSGA 3EX7C 1TGYA 5AOAA 1MAAA 5LP6B 3H3JA 2CXSA 2EYQA 3X44A 4QLAA 3KJIA 3PGKA 4ANFA 4W8HA 1HE1C 1BDMA 1LK7A 1WZCA 1O5OA 3IQFA 3JVEA 5BW6B 1LPSA 1FJGB 4WLEA 1X0VA 4EG7A 1G64A 2F9FA 2FXVA 1O08A 2QRHA 3AX6A 3VZSA 4YRKA 1FRVA 1ZIXA 1BX1A 3FF4A 1DAFA 1ZD1A 2OOSA 2AWOA 2J9YB 3N5CA 4GMKA 4UE2A 3HJTA 1GAQA 2IZ7A 1SCJA 4FFPA 4ZAGA 2Q5OA 4QL3A 1VCOA 2CDRA 3PJFA 2P67A 4G1MB 2ZYWX 5I9IA 3AEQA 2GESA 3M6AA 4ZT5A 1EVEA 4FGKA 4CMEC 3RQSA 4JQCA 1W36D 1B6TA 4NOLA 4AFNA 3PGA1 4E70A 4AULA 5C3UA 4QTXA 3H9CA 3PT9A 1NASA 2VNIA 1E6MA 3PUZA 2H17A 4YCJA 2RHRA 3L01A 3NHSA 4JBGA 4ND4A 3RIYA 4Z7JA 5ADVA 5MGNA 1W29A 4ABTA 4QLBA 3O8NA 2GXAA 1N2IA 3P97A 1I33A 4M0FA 3IMKA 2OESA 4EHKA 1AB6A 4L15A 4IIFA 4KCGA 2LZ0A 1Q7RA 3LXRA 5DASA 1OILA 3L0IB 2H4ZA 5GP1A 1O94D 2K87A 3E22A 3WP1B 3PTAA 5IKPA 3GX1A 3LCMA 4W8OA 4XA8A 5FBRB 3GLTA 1VHDA 3ITNA 1Y6FA 3BIJA 4NBUA 1SB9A 2NZVG 1GNSA 1UBGA 2E5FA 2FN7A 2JJ2D 2F43B 2PT9A 3EQ9A 5T5QA 3VHXB 4F56A 3OQNA 5LKAA 4EDHA 4Y2RA 1KAQA 4G4SO 1KQNA 3VO9A 4BFXA 3D31A 4X1IB 4A0SA 5JALA 2C00A 1PZXA 4EYQA 5DCWA 5K3DA 5ELMA 1D09A 1ESEA 3LYHA 1ELOA 1UKEA 3UM9A 1DT3A 1N2GA 3F4KA 3LM8A 3OQJA 1EM8A 4GOLD 2VTBB 5F1YA 5D6OA 3AM1A 1X3LA 4G85A 4KYTA 4WLVA 4TT3A 2A57A 2NVUA 3EBLA 1A4XA 3OAAA 1X1EA 1II8A 2REXB 3NDJA 2OFOA 1YZUA 2VJLA 4G2NA 4TWIA 2ZT6A 2WMYA 4QRIA 2OYRA 1UOOA 1AF7A 1G21E 2CNNA 4ILKA 3RVPA 3EMVA 2F1RA 3B5JA 3A2MA 4QSHA 5IBRA 1TPZA 1CUWA 2F62A 2PM8A 2ZLBA 3ZPXA 2AEFA 1IZYA 3QKWA 1TM3E 3RQIA 4BNHA 3F73A 1J22A 1SWVA 3DMYA 4G37A 5DM4A 3WGMA 4KYIB 4WPGA 1BXRA 1LPBB 4A73A 2XVXA 1YMUA 1VPWA 1J5EB 4O0MA 1MX3A 1R4AA 1E9DA 4L4ZA 4TSFA 3R7WA 3VKVA 3RAEC 1NMEA 1BWQA 2ZRGA 2LD4A 5FBHA 3VNBA 3WICA 3GWZA 4DBLE 1XKTA 1K27A 3GZ4A 3NR2A 4ZU1X 3KKQA 5CYGA 1ZGGA 4HTFA 3N0XA 7YASA 4IIJB 1EX9A 1YKFA 2BFBB 4GD3Q 4URVR 2C96A 4W7SA 4UBNA 1J2UA 4GNRA 2GD2A 4IR7A 4OI2A 2OCYC 1H3FA 3WWOA 2HPAA 5FX2A 3C1AA 3IDAA 4QUHA 4I9HA 4NU0A 2CL5A 1YMQA 5AK3A 4QODA 3OLVA 2P30A 1N77A 2ZYIA 2YVQA 3KALA 3MA0A 4D74A 4KRXA 2NIPA 4LXUA 3N05A 3I04M 3FOZA 2JCGA 1FFAA 1S4MA 2QZ9A 4RULA 2PTGA 2QB5A 1OREA 3PUWA 5KNCD 3HJUA 1WULS 2V4MA 1Y1QA 2Z8ZA 1DUVG 3GJXC 5GJCA 3RTCA 3W9BA 4XGIA 4C6TA 3SNHA 4CQMA 3LBYA 2PA3A 2NXWA 4DLRA 2VTKA 1E20A 2WWIA 1IATA 3R9IA 4E88A 1M8JA 3AH8A 3MQ4A 1EFVB 3G8DA 3IR7A 2PL3A 1QE5A 4LG1A 5TR9A 4CTMA 3QQPA 1NR5A 1XROA 1E1RA 3FMOB 5K3BA 1O0BA 4ITVA 4F9EA 5TGTA 2BFCB 2EFDB 1H6BA 2R47A 5J47A 5GPBA 3ZDDA 1DCKA 1X38A 3RAGA 1JMKC 4V0SA 1AGYA 2YRXA 2CUZA 4R83A 3JV7A 3TFQA 3ZWCA 3THYB 5LU9A 4F2PA 1D1PA 3L40A 5EJ9A 3A1EA 3KXDA 3P4YA 3EEOA 1FOEB 5B4TA 1K06A 4HNVA 2GPBA 2WTNA 3AW9A 2Q3JA 3ZLUA 1KZ4A 4RHXA 5DGCA 1JDJA 2FSHA 1JWAB 3QJYA 5EP4A 3KCQA 5EWLA 2YIMA 4GH5A 3VQTA 3X2SA 3JWJA 3KBOA 4DM4A 4YCSA 5ALUA 4YRQA 1AT1A 2XYRA 1D5CA 2QG4A 4DSOA 2BFFB 2EP8A 4O4HF 4MPTA 3O2JA 1DQYA 3H4MA 3RJZA 2AMVA 3QNMA 1WR8A 3PFIA 2MMGA 1PG0A 5LMUB 1FFXA 4L76A 4WVLA 3AOEC 3PUXA 3AHCA 4JK3A 4KREA 1YRYE 3PQEA 4R54A 1NPTO 1ZBQA 3R4CA 1SCKA 2JCSA 1XJQA 5IJXA 2TMGA 1RPTA 1CJSA 2EZ8A 1V2HE 5FB3A 3MTIA 4C0KA 4ZYTA 4MDFA 1Q1NA 1W0KA 5BYJA 3CXUA 1XCOA 1PFUA 6YASA 3MYYA 3VYUB 4E2ZA 1RYHA 1XXLA 5K0ZA 4MQEA 2AEEA 2RGXA 3MMXA 2QUAA 4EW2A 1D2NA 4P3PA 3QV2A 4JI7B 2XF2A 1DEHA 3T7IA 3HBJA 4BE7B 1PDWA 1ULTA 3AT1A 2ZRMA 4NLLA 1ZD5A 2YQ5A 4IJ6A 4JC5A 4EBFA 1AZTA 4L27A 3CNNA 4P4SB 3SSAA 1CZKA 1UBKS 4K6MA 2FWRA 4UEQA 1RWKA 2ZBVA 1RWBA 4O8CA 1NG1A 4YJGB 4F9GA 1W4ZA 2RGAA 3MINA 4I1PA 5I7FA 4PQYA 4K46A 1SUAA 2WF7A 1XA0A 3RR2A 4B85A 1JG4A 2C99A 3HVKA 2IPAB 4EA6A 4JIGA 1FDWA 3GUHA 4FBMA 1LF5A 2X77A 3JVUA 1RQPA 5L4LA 4XYMA 1H69A 4ZYYA 4Q7EA 3KU1A 1MOPA 3UUGA 2BN4A 3NS7A 5ALKA 3QEJA 3EARA 4LHYA 4BBAA 1MC1A 1N2HA 4HDNA 1BFDA 5G3YA 4EKGA 5B6JA 1SHJA 1SC4A 4EHHA 2XUDA 1MJHA 1B0PA 3AESB 1YAHA 2QF7A 2QORA 3H5RA 4H18A 1XTRA 4HFNA 3ZY5A 1CDZA 1I32A 1P77A 2C2GA 3EG9B 3M6LA 5H70A 3VO1A 1X80A 4AJ1A 4GNKA 5K0BA 3OZDA 4D8UA 4M8SA 4KSBA 4BNYA 4EF5A 4L9AA 1DT5A 2BFEB 3JYOA 4M8IA 1XRSB 3OESA 3DT6A 4TWBA 3E0QA 1EJ2A 3H87A 4A5OA 1XJ5A 1FVHA 3HVHA 4MLPA 3S68A 5LA6B 1GSOA 1VQ1A 3EFOA 1TZCA 1INLA 1XWIA 1XCGB 3M6WA 4S1PA 3I0ZA 1FJ2A 4ERXA 1RPAA 2Y77A 2SNIE 4KWTA 4M9SA 3THOA 2FDCA 2PHZA 4JB2A 1OWPA 1PF7E 3LT5A 1W9HA 4MA5A 5LQCA 1N3IA 4RVUA 5DGDA 2ZDGA 3WLNA 2J9XB 1VHLA 4FS8A 4A5SA 4MWTA 3BG5A 2IY7A 1RLIA 2YY7A 3D7RA 3L93A 4AX4A 3BSYA 2QRJA 3LQ2A 4X84A 1USGA 2GH1A 2VG8A 3HP1A 4BZQA 1JRLA 2J9FA 3CVWA 1PJSA 4RZIA 4BQRA 2GLTA 4P84A 2I7CA 2RGNA 3EVZA 5E4YA 5CIYA 1RWWA 4UTOA 1AH2A 2IP4A 3E2IA 3L7MA 3D2CA 4TM8A 5TQ2B 2GPSA 1JFFB 4KDFA 3QWIA 2CLCX 4Z3KA 1VP3A 1I3NA 3WO0A 3CIFA 4K9KA 3PVSA 1CFJA 2A1TR 5BP7A 5L3SA 3F6BX 4JJIA 2YHBA 3DZ8A 1U8YA 1CR6A 3VSEA 3ZCSA 1V45E 3L1UA 3OH8A 4GWLA 1ULSA 5KVSA 3DBHA 1OZGA 3FUCA 3HDYA 3NRBA 1Z6XA 2QZZA 4GFDA 4G5XA 4Q7MB 3TL2A 2R25B 4H4DA 5EGSA 1XRPA 3B6ZA 4P9NA 3RK0A 2NYRA 1S1MA 1CY2A 4KQWA 2E1PA 5ENDA 3CWZA 3UK0A 3RGGA 1RE1A 4J4TA 4DLPA 3L4BC 4CQNA 2WYWA 3HN7A 3UKJA 4BLQA 4TKUA 3FW1A 4RD6A 3F7OA 5D6NA 5AVZA 4C3ZA 3R5FA 1IUOA 5KINB 1E7RA 3ZE8A 3D0KA 1ULZA 1FP7A 4WNIA 3RT9A 5JHGB 3UJ6A 1W5EA 3CEPB 1TO1E 3GLSA 4OYRA 4RY2A 3TOZA 3G49A 1GUZA 5CDUA 3WR5A 1G60A 5I3ZA 3LZCA 2HAEA 5K3EA 2IY9A 5I48A 3IILA 3X1ZA 1K97A 3JQ9C 1US8B 4CCYA 1QFYA 2XOEA 1F0KA 3MWLA 4M99A 4PPNA 4UBIA 3OX3A 1QAOA 5JZOA 3QPWA 1P1RA 1TZMA 1U4SA 1XTTA 2WDPA 2GA8A 5B7PA 1GLGA 3P9KA 1BMQA 3QU9A 1X39A 5CJJA 4WIAA 4DG5A 2JLYA 1V5WA 1K75A 2X9LA 2RJNA 3EXEA 4YTEA 3V1LA 4X85A 3CKYA 5JEDA 2XUFA 3U5TA 2CDAA 7ADHA 4H15A 1NJ2A 5KJCA 3KLOA 1SXGA 5IM4A 2NXNA 1ZNXA 2JFXA 2ZGVA 1ZIYA 4KMRA 5BN3A 3CVVA 3ZJ4A 3CUSA 3IVMA 4EGFA 2DT5A 2A5YB 3L6CA 2LIPA 3MWDA 4CNBA 2YR0A 3LUPA 4KN6A 1FLNA 3FMGA 1TLLA 1YI8A 4HNQA 4QUGA 2CZGA 3LT4A 3LHSA 3DPUA 2QRZA 1QPGA 1E8MA 3Q5DA 4PVDA 5I51A 1Q7GA 3B12A 2NTEA 5C7IO 4KPFC 2D2FA 5IXJA 4YJ3F 3TG2A 2A0XA 3FDZA 3BT7A 4P54A 3I2FA 1R12A 2WHXA 2QI9F 1MTZA 3M6VA 1ZRMA 4A6DA 3ZWXA 1BX3A 4RQAA 2A7QA 2QL6A 2RI1A 3D54D 3V9PA 1I2CA 4FSHA 4NBVA 1YCHA 2GASA 1ORRA 5AVWA 1CRWG 4FGZA 1PZEA 1L7OA 2HV8A 2VATA 2O0MA 2IYLD 2ZB2A 3EIUA 3IIMA 2P6OA 4KJZA 4WBNB 5AJZA 3UV3A 1HDRA 4TLBA 2W71A 4RENA 4JXZA 3CC8A 4NKRA 1IN8A 4RFSB 3C7DB 2R5NA 2HRZA 4BNIA 3FHCB 4D0NA 1J8VA 4GW3A 4MR9A 3U6KA 4D4JA 3HCPA 2GK4A 3QUSA 4GI5A 4TV9F 3G17A 2WNSA 4IQ4A 1RWPA 3SU8A 2CBZA 1MAUA 3FWNA 3HCNA 4L8FA 1E6CA 3R76A 3GLFA 1S2IA 3JCZA 4ZOEA 5AHWA 1AHIA 5AP9A 5E6UA 4YR9A 2PMBA 2VQ3A 3HXOA 3TLXA 3L7KA 1JDBC 1V39A 2GXUA 5G0TA 2H2HA 4FNMA 1T0UA 2Y1CA 3DFUA 2ZRKA 2OCDA 3DBRB 3JYPA 2QAIA 3OPMA 4TS4A 2Z58A 2FWJA 1GTRA 5H82A 1C8LA 4MWGA 1T5LA 4UAGA 4IS3A 1NF2A 1RWVA 2OXTA 2XX3A 3I2JA 1JFTA 3PFKA 4NPAA 1YVEI 1GFSA 2XXAA 3L4EA 2N46A 1V3UA 3P7MA 1SKYB 2IOYA 4A3SA 3WBFA 2PS0A 1Z47A 1AKQA 1NUAA 2OV1A 3CRZA 5EJEA 2NQ8A 4HEHA 2FEPA 4NS1A 5JPCA 1QDEA 5KPJA 3OOSA 2JG3A 1T1GA 5I8ZA 5ALVA 5DYGA 2IUSA 3PL5A 3D4PA 3SD7A 4UFPA 2QVBA 3ZDCA 2NT4A 4LDRA 2Q7OE 3OKAA 4TTSA 1DXOA 2PANA 2FMUA 2Q5FA 4XYLA 2OGZA 3I2GA 3IMCA 3EXAA 4L57A 1TNDA 4BLRA 3EGXB 1LI5A 3QLVA 2QVLA 2Y9MB 2AOTB 2OCGA 1Z0AA 1E62A 5IVIA 4P32A 1RI1A 1FXWF 3EEIA 1F17A 3HXMA 4O4LA 1UAYA 4EHIA 4E7PA 3M1AA 3BH7A 4HGQA 4M0UA 3CJTA 2PMFA 1Z12A 1K9SA 1W93A 4HMOA 4A2CA 2CVQA 4PPFA 2RAVA 1D6NA 1OXUA 2ODEA 2QT1A 4MRRA 1QQ5A 5DBOA 5L45A 2BI4A 2PT7A 2W22A 1ZUNA 4DG9A 5BW8A 4FEYA 1M6VA 2BDTA 4PYIA 4D1YA 4ZDWA 2EIHA 1D2CA 3BKWA 4GOOD 1SVIA 2CVFA 2CXQA 4J0GA 5HMLA 1T5SA 1VG9B 4AJHA 4FQ8A 3DXZA 3O4HA 2DAPA 3K3PA 1YA6A 2J3KA 5CUQA 3EAFA 1J20A 2Q1TA 3B1YA 3GW8A 2H3HA 4OQMA 4RD0A 2XDAA 3BXXA 1OKKA 3FLAA 1GZ7A 3V8BA 3L0SA 5B1SA 3H5IA 4XIJA 1NF3A 4XB2A 3KR2A 4JZYA 3T1NA 3CUWA 3QXHA 2QVZX 1K98A 2YFQA 1Q50A 1X1TA 1T4BA 3BSSA 4I8XA 1XLTC 1WF6A 5F2OA 2LV8A 2ZYVX 4RO0A 3HBLA 3FVWA 2FPGA 4MS3A 4OLHA 1V9CA 5ALIA 4JVSB 3HB0A 2IITA 4DBVO 5EWMB 3NUZA 3EOBI 3A05A 1D5WA 4GYWA 2I34A 1VJCA 3QEOA 1YE8A 3T1HB 3NHAA 2A5FA 1ULBA 4GC9A 4GQIA 4QTYA 2HK9A 3TX2A 2ZREA 5JC8A 4AMZA 5K8IA 2J7PD 1XTQA 5GOZA 3ZE7A 3I2HA 3VOSA 4A1OA 2I6FA 1FRZA 2VHCA 3OIGA 1PE0A 1YNSA 1E63A 2ZJ0A 3BXEA 5F2EA 1QHNA 1E9FA 1JQ3A 1A9ZA 3A8TA 4OY3A 3JATA 4U9UA 2YZNA 1Y1LA 2QE6A 4HLUC 4RH0A 2CXXA 1KPHA 3RIXA 3UW1A 2GEVA 5BV7A 2JRCA 4H0FA 1NVTA 3JVIA 1U98A 2BZ0A 1BQ4A 3PRYA 3D6VA 4JKOA 3ZWWA 2GZ2A 4MX8A 5AW1A 2NUAB 4MYSA 4X6LA 1JB1A 1PFYA 2QRLA 3DQZA 2BR5A 3CG0A 2XMDA 3ZK8A 4X6XA 3RS7A 1RVDA 3G2HA 3M9WA 2WI8A 3E27A 1UFKA 1U9IA 1Z08A 3JAMA 2NTYC 1RZRA 3B1KA 3RSLA 5C8XA 2OO5C 5HUJA 1PT6A 2H2AA 1CS4C 1A2BA 1H2BA 3D1VA 5ESXA 1J2YA 2ZM5A 1M74A 3MN1A 1Z37A 3KYCB 2XTMA 1ID1A 3KV1A 1JEOA 2WVJA 1T5IA 4KE9A 3QEKA 4DSUA 1TTHA 2ZQZA 3KQSA 5DP1A 3IV6A 4DPLA 2EGGA 5JCPA 3WK7A 3ODPA 2R66A 3NWEA 4ZWNA 2QENA 3OETA 4IVNA 1MQAA 1JKJA 3JQQA 1I2DA 4R2JA 3WZLA 1OBOA 3L84A 4MQUA 1PR2A 3WWEA 1LQ2A 4UULA 1VHTA 1K4MA 3DFZA 2P41A 4KQEA 1XB2A 4UHCA 3ZWOA 4BP9A 1R3DA 4MQFB 4XJTA 5CM8B 2R8RA 4JDPA 2FMXA 2EQ5A 3E5HA 1DPGA 2R96A 2OPBA 3MELA 2JJ1D 4KEAA 1N2SA 3NHZA 3HXTA 2QTCA 1JDVA 1Z36A 2OZVA 3H11A 2QTRA 1VL0A 1NY5A 2WJ3A 4K2HA 4V39A 4BLPA 5L9AA 1PP4A 3PUVA 1ZRNA 2P9QA 3CPJB 1VZ2A 4V1CA 4RQBA 5HIJA 3A9RA 3EQ7A 1E2BA 3WZ2A 3H9EO 5G40A 5EJMA 4R1NA 1DSSG 1KYXA 3I1FA 1SVKA 2KE5A 1P75A 4MIKA 1DLJA 3B9BA 4ALLA 1JILA 1RMTA 2ATVA 2WVAA 1FTQA 1VHWA 2AOXA 2MSKA 2NN3C 5GJVC 3SLKA 3K31A 3NETA 3CW2A 4CL0A 3FVQA 3A6JA 3QVGA 1GYPA 4URFA 2GPAA 3DD1A 1Q7CA 1GQFA 4HNGA 3P4XA 1FYXA 1SXJC 5FPTA 3UVEA 1D2EA 3EC7A 4A8PA 4BQSA 4C4RA 3LSTA 4ZFNA 1U3FA 1D2HA 4PWZA 2I5PO 2QR5A 3VX4A 4ZCMA 5KKNB 4L2IB 1IOZA 3RUHA 1NPDA 1M2NA 3JAWA 1E1DA 2CL7X 4DM7A 2C2WA 2Q6VA 3F78A 3KDAA 2J6HA 4PZZA 4EX7A 4C0QC 5KX5B 5CCDA 1ST2A 3ND8A 1KFBB 4OHBA 2PD4A 3U16A 1LZLA 2VZLA 3TRKA 5JNSA 2C8VA 2ATXA 4QHTA 1LS6A 2B5WA 3CBGA 3EUFA 2W42A 4LIPD 2DX7A 2BD0A 5C34B 4WLNA 2FWPA 4E30A 2DBQA 3IBTA 4N65A 1JL3A 2HREA 2PIAA 2IS6A 3B36A 2B8WA 1J07A 2G80A 2Z1DA 3EMKA 3L8GA 4PC2A 5AW7A 4GXRA 3PC2A 3WQBA 4DIEA 3E7DA 4CG0A 1KC1A 5CPBA 1N36B 2J0UA 5KO2A 5FUVA 1JEAA 1XMIA 4F6CA 4F2HA 2AYZA 3BFVA 5CDYA 1EXDA 5FORA 1WMFA 2O8FB 1K63A 1U81A 4DABA 1B6RA 3UAZA 5LOVB 4WEOA 1A9QA 1R3UA 5IANA 1OPRA 4OMCA 4JFRA 2ZPTX 1CD5A 5ALXA 2AUTA 2POQX 3UAVA 3H2GA 521PA 2B3DA 2QN2A 2DFVA 5AJWA 5T4FA 5ERGB 4X6UA 4AKTA 3EF0A 3OPNA 4UNSA 5SY4A 2VA9A 2XVMA 2CMHA 1Y8QB 3BWCA 2DERA 3KLPX 1G8KA 3PKZA 3WKCA 4UM5A 4JP3A 4QSMA 3GU3A 3T5BA 3HADA 3ZHXA 3WRXA 1Z3CA 1RI3A 3AKYA 1ADFA 2GAIA 2C1ZA 2V7QD 2PH7A 3Q9LA 1IOLA 2VUSA 1HZZC 4M54A 3SM9A 3KQMA 4F4UA 3MGCA 1Q3TA 1PL8A 2PZEA 4N76A 1T25A 1UPXA 2IHBA 4JLNA 1QYRA 1GRNA 2IYYA 1VCIA 2OYSA 1DRJA 2GK3A 3HWWA 3I92A 4YRJA 5SY9A 3SLRA 1UJ5A 2VYFA 3WRVA 4OH1A 2TSYB 2C42A 3I6QA 4DIOA 3HNRA 2FEOA 3ZJTA 3MGBA 5EUCA 4RMHA 3RS4A 3LXXA 4CCWA 5FOXA 3IFSA 3VMMA 3TKLA 2JS7A 3JD4A 4MVXA 2HIGA 3RYHB 3VR6D 4FGWA 1I4OA 4XRRA 4KPUA 4N3CA 4JOQA 2IHUA 1UKVY 5EA2A 5AKHA 5FBKA 3PZBA 2F8TA 5FCDA 2O8DB 3BD8A 3A1VA 2IA5A 4GSKA 1CUCA 1PVDA 4J0DA 4ZQIA 2CFSA 2DPXA 4HH0A 2D8AA 3QX7A 4MKZA 3VZCA 1QK3A 4Q3NA 2EG9A 1OI7A 5JQWA 1LRLA 4HZUB 1GNPA 2JFWA 2QG9A 5CA0A 2XBUA 3W8DA 4TQUS 4F4HA 5JXHA 4P31A 3FR8A 2X0KA 3L79A 1G1MA 5DT2A 4ERNA 3IB3A 1Z63A 1R6XA 1J8YF 2ZWAA 4MZDA 1F9AA 3UOAB 1KY5A 1VPDA 2BMFA 3SY8A 4BO7A 1MLDA 3ITKA 4GLOA 3I23A 3FKSD 4EHLA 2OXFA 2CVPA 2G0AA 3PRHA 4GT1A 3TLAA 1N7IA 1X42A 1TVEA 1SCUA 5BUQA 5C8DA 2Q4TA 1BRMA 3GCZA 2QHXA 2E6UX 3C6QA 1VOTA 4DT1A 1SNYA 1NJ5A 3C8DA 2ZAMA 5T67A 3AEKB 5IM5A 4DMGA 4HDKB 4F6RA 1HTTA 1XNJA 1XDUA 5G1PA 3RS0A 3BMQB 4J4BA 3T3EA 1JHQA 1X87A 5L51A 1C3EA 1PDOA 3VU8A 2VT2A 4C06A 2JARA 5KYTA 2X0RA 2YUTA 3C7CB 3KCNA 3WMGA 1XP8A 4Y6OA 3GLGB 2ZJ5A 1OGIA 3GJ5A 4X71A 4HXGA 5ALOA 4ENUA 2NU6B 3BH0A 2O5VA 4MLZA 1E1KA 1DEAA 3OLQA 3FVTA 4NMMA 2A9KA 2P65A 4Y1GA 4URUR 5I3CA 3LC0A 4E6PA 2AYXA 1E1NA 4MV4A 2F9LA 4W9RA 1W5AA 3CO0S 4YAEA 4CF3A 2ACEA 2PUEA 1GAEO 1GJRA 3JTMA 4D3SA 1LSOA 2W37A 4EI7A 2GK7A 5IC6A 3C6XA 5BVGA 1V8BA 5DYYA 3TOCA 3ROEA 3AP2A 2JFFA 1JA1A 3COVA 3IYLW 1CYEA 3FFAA 1BD3A 1NUPA 2TS1A 2WT9A 1YK0A 2OBYA 2GZAA 3UW3A 2RGDA 1CETA 2CB0A 5JZVA 2BE7A 3Q3GE 2P2NA 4JELA 2PKXA 3LAWA 1UBNA 1I0LA 5K4AA 2Y1FA 3KE8A 3F5FA 2QDKA 1EK2A 5F98A 1W6UA 1NA5A 2UUBB 1OV4A 1XKLA 5A3VA 5JD3A 1FJXA 2P35A 4LV5B 1R15A 1R7RA 4H6XA 4LRUA 1NU6A 2QMHA 3L1VA 1SAYA 5LLTA 3D02A 1D0VA 2VYCA 3H2JA 3WJ7A 2VDUE 1KZGB 1NTOA 2P9EA 4YXWA 2KSQA 3ISJA 2Q27A 3WFZA 4X8LA 4EW6A 5AUNB 1YQUA 1G59A 3VR3D 5CA1A 3T95A 3ONEA 2NUPA 2XZTA 4R2XA 4AAYA 5KYXA 4L74A 3GH1A 1MG0A 4L4RA 3E2PA 4O02B 3MJDA 1NXSA 5CGQB 3BRCA 3GNSA 2O8EB 4I14A 2VJYA 5AUOB 1FTSA 3PUJA 2YN2A 4YP9A 4JITA 2LR0A 3KC2A 4DUZB 5ERYA 3F4LA 4QDJA 4JEIA 2PUBA 2MMCA 2IU4A 1PJRA 4HLQB 1NP7A 3RFXA 3KZCA 4J0EA 4AYWA 2ZRJA 1W36B 3EIEA 4YP5A 4MI6A 4EJSC 4YAOA 5EJ2A 3A25A 3KS9A 4B3JA 1ISPA 3HCEA 1XK7A 4ZANA 5EIFA 1EUCB 1ODKA 5JU6A 3L7BA 1EFRA 1TMGE 3MWGA 1AGNA 1NC3A 3GLIE 3TEFA 1J5XA 3OBIA 2C5GA 2RHCA 1UQRA 2JK1A 1LI7A 1CDDA 4XUDA 5K8TA 2E4WA 4R16A 2GO1A 2QGFA 1S2MA 2AW3A 1ZSVA 4PR3A 3WNDA 4XGKA 2EJCA 2C9DA 1USVA 3M1LA 4WXHA 3A4YA 4E21A 1GITA 3GGSA 3KT3A 2BKVA 1WXDA 1E4EB 5ALYA 5BQPA 1GG8A 1FP6A 1FSGA 2FPIA 2GD0A 2HBYA 4DBLC 1V3VA 1AV7A 4LI0A 4REMA 3R9WA 2Z56A 2PWYA 2VJOA 1B8VA 3QVLA 5DGXA 4EB6A 4XW2A 2VWGA 3ZS8A 2GHIA 2ID7A 2PZJA 2GPWA 2I3ZA 2FJPA 2C07A 2XUOA 2QMEA 3ON5A 3GUZA 3R41A 3U3ZA 5LZ7A 2HJGA 1ZQ1A 4KR7A 1OCEA 1BA2A 1WB4A 2IXEA 3F6SA 2VBGA 2EWWA 2B92A 1OAOA 3ZHYA 2SKDA 3W4KA 2WIGA 5I8PA 5JH7B 4M1OA 3IUNA 1XKQA 1YE5A 4I4IA 4ZO6A 4HATA 4KGDA 2ECFA 2NU7B 1ZJZA 3LUGA 3RS3A 5BR7A 3I9MA 1MHPA 2X8BA 3I6BA 4JLKA 5K1ZA 4C9BA 4QGFA 4OQFA 5KZMB 3PNYA 4K9SA 3K20A 3L0PA 3SR0A 3PX7A 1Y81A 5BYAA 5HTOA 4RZUA 1WCYA 4M0DA 3PLNA 3AHEA 1DRVA 3EEYA 5IK2A 1PJ2A 3ZIUA 2D74A 2VR1A 4AZ3A 1OIVA 1QKIA 1RXYA 2AGVA 1U0RA 3ORYA 5AO9A 4ARVA 2C94A 4E33A 1CNMA 1NW6A 1USUA 1YU6A 3C3MA 1RLOA 4XYGA 4LYAA 5ESDA 2KJQA 4C3UA 4A8JA 1IBMB 1SKUA 3F96A 2I7TA 1UZAA 4ADSG 3OFJA 1WW8A 1A5BB 1H4VB 4F5ZA 5HVNA 4G5FA 4DJ5X 1DJOA 3QMMA 2A0KA 1SJ9A 4C2AA 1E3WB 1KQOA 1GGMA 1U7WA 1FU8A 5FLEX 1NPYA 1YL6A 4R9RA 3RCBA 3CT6A 3F6EX 1NF9A 4DV3B 1PR0A 1MX1A 2C8JA 3QFRA 3KEMA 2IYVA 4QU5A 5F2NA 1QZXA 4AJ2A 3HKEB 1RAGA 3HB9A 1UBSB 1PGPA 1QVVA 4QYTA 1WXIA 2FG5A 4DQKA 1M6YA 2XZDA 2OQIA 1J99A 1YS4A 1MGOA 2NPIA 5DK4A 4JXJA 1V2GA 3ZEAA 3ZKAA 3MT8A 4ZV4A 2EEPA 3OZIA 3V4VB 4BUJA 1F3LA 2AZ4A 3ZE1B 2EL9A 2PMDA 2G8NA 4YP0A 1G5QA 3HYRA 5HCIA 3K70B 4ENPA 4DR4B 2GCGA 5EKXA 1ZONA 1L5VA 1DIGA 1DLIA 4H0NA 3SBOA 2C77A 4YWHA 1A5ZA 4BWFB 3DMRA 4LHZA 5JAIA 3R3YA 2SBTA 2IDKA 3TKAA 4JYCA 3MBIA 4YRFA 4LRTB 3S2YA 2AG1A 2G5PA 4NENA 3UMBA 4TMWA 4KITB 4YAUA 2BYTA 1CLUA 3B5IA 5CG1A 2HN9A 3E03A 1X15A 2GHRA 1BRTA 1VPVA 3PDHA 4EG4A 2Q6OA 3VJLA 3F4BA 3ZW9A 4MWEA 3BJMA 3PQ8A 4IXNA 4DNFA 1NE7A 1NSFA 3ROGA 4ECEA 2H2IA 5FADA 4D9MA 3R77A 1GZ6A 3IPAA 1G98A 1B43A 4G23A 3A9CA 2DY0A 2WSMA 1PYGA 3DE6X 3ZDRA 3N6RA 4X92A 2NNLD 2RH5A 2W11A 1CY6A 3JSAA 1P3DA 2XJ4A 2I29A 3VI3B 3HG7A 4WNAA 1M8FA 4JEMA 1XMSA 1W47A 1ZUWA 2MSNA 5A2QA 2GCPA 3BREA 2BBSA 1T6BY 1KU6A 2BFDA 1CHNA 2GJKA 3T8YA 5L3QB 1WMDA 3TEJA 4C7BA 2Q2OA 2AI1A 1HSOA 3D6TB 5ALEA 4S1NA 5ANRB 1PZGA 2GPYA 3E84A 3FRIA 4ALIA 2IKSA 3A9SA 1OV6A 4WK6A 3O83A 3QZUA 5ED4A 5TPZD 3NVKI 5TS2A 2TMYA 2WMNB 3W5UA 2CVOA 5KNBA 4QPJC 3TAXA 4Q9JA 4DJFC 5GVRA 3V4RA 1I13A 5CB8A 1YDMA 3IT2A 4REQB 2OGWA 1SEPA 2ZRCA 4GM0A 3P1JA 3QOFA 4YUXA 3F74A 2XCOA 2Z9DA 4JDUA 4I0WB 1Q0ZA 3EQ8A 3TWOA 3PWZA 4CIWA 3P9QA 5CLIA 3SQOA 5JS7A 4Q7KA 1XQVA 4AKIA 1EE9A 1FS6A 1ZP6A 4WZAE 3K9FC 4BKUA 4CU5A 4MROA 4NHEA 1WBDA 1TQHA 4AZSA 3V2GA 2ZBGA 4R69A 5IYZA 1GTVA 1HE5A 1JEYB 4W5JA 1MJFA 4CIYA 3TD9A 5J4YA 4BTVA 5A3QA 3WKBA 4RETA 2AG8A 3GZJA 3IQGX 3UAWA 3CH5A 3ZK7A 5A9SA 3DYBA 1H3NA 2PXAA 4TL6A 1SU8A 4DLKA 4AJIA 3RYFA 3I61A 3KZXA 3O8LA 4HGNA 3R7SA 1UJ6A 3R6TA 2X8LA 5KPDA 2QP3A 4E2FA 2G83A 4FLFA 1DS6A 5HQ3A 4LHVA 5MN6A 1OB2A 2V6JA 4KLRA 1CJKC 1OHHA 5AJHA 2I1LA 2WT8A 3EULA 2OAEA 3HKDA 1Y3CE 1LDEA 1N8SA 3RKRA 3EPKA 2JGLA 1HFJA 3PBKA 4KODA 4IFBA 4RGQA 4U7DA 1XL1A 1O6ZA 5J4LA 1RCUA 2OGSA 2P7HA 5J5AA 2WB2A 3BMCA 5BOVA 2Q5LA 1WXGA 1KEKA 1FUIA 4PYKA 4CL2A 2QTVB 4H1WA 2PT6A 2R44A 3HYCA 1LLCA 1YZQA 2EHJA 2C2MA 2HY7A 3O1HB 4BVBA 4UAJA 3QENA 1PTJC 5K0GA 4IFIA 5JW6A 1W85B 1EDEA 2GAFA 2GZRA 2QVYX 2Y6VA 4EK9A 5LWHA 3MAGA 4CKWB 4O2BB 2QXYA 5CIQA 4EKDA 3A37A 4ZK2A 3SP1A 1NLFA 1RAAA 2EBWA 5CX1B 1JR3D 3GT3A 4IO0A 1V11B 2FX2A 2VQ6A 2EVWX 2HQSA 4WCFB 1GM5A 4G4GA 3R09A 3U19A 2NU9A 1FC0A 2VDKB 3CUUA 2GJSA 3I9V6 4LOJA 4RCVA 1C7QA 2DFDA 1Q5PA 5TDHA 1TAGA 4WLOA 4HGZA 4XDYA 3GJTA 5F4ZA 2IDMA 1HKUA 1AM4D 1ZCBA 3M8KA 4W6QA 4NEGA 1RFLA 5DNAA 1CERA 4B74A 2FA9A 1EH5A 4JJAA 4NZNA 1E9RA 2XOKD 4L22A 4R7TA 3CF4A 4JOCA 5BSUA 2V03A 2HTEA 2P5UA 2NO7A 1J06A 1L8LA 1N5DA 3O9VA 2YXNA 5IVDA 4CM8A 2QZ4A 1UMDB 3CW8X 2DP4E 2J31A 3HBMA 3A3PA 3OQIA 2QRVB 2ZSIA 4IDQA 4YHBA 4BNWA 2D2EA 5LPNA 1XTJA 4QQRA 2JPDA 3DAYA 2ZRIA 4FMPA 4YJFA 1HBJA 3WBJA 5ITZA 2J0QA 1U9ZA 2WUVA 1YVDA 2XA1A 3COJA 3KR9A 4KXVA 2AR9A 4XPIA 1X14A 2VA8A 4LWOA 4IIBA 5B3LA 1M0WA 1WB6A 5A03A 1KDRA 2XQKA 3GA5A 3PNKA 2XPCA 3W9SA 3BFPA 4QECA 3T7AA 1A2OA 4JI2B 2ILVA 3RLFA 4X66B