2ZIAA

C4s dck variant of dck in complex with cladribine+udp
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
241
structure length
220
Chain Sequence
RIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNVGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Elucidation of different binding modes of purine nucleosides to human deoxycytidine kinase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Deoxycytidine kinase
total genus 87
structure length 220
sequence length 241
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2008-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ziaA00
4WZBE 3R9WA 4D25A 4HYYA 4Q7LA 3BFVA 4ZDIA 2CCGA 2EFEB 3PUYA 1BYUA 2F9LA 3FYHA 3CF6R 1SGWA 1G3IA 4U5XA 2ZS8A 3AF4A 3F5FA 3QVVA 5B30A 4GSYA 3ZS9A 2B7BA 3QG1A 1XPOA 1G41A 3DMDA 2VSFA 1TX4B 4K8OA 1XCPA 4TYQA 4XWAA 1KI6B 5G40A 3DMNA 2QEQA 2J45A 4PHHA 3R9IA 4EQ6B 2QN6A 1N6OA 1M7GA 1OF1A 1WXQA 2Q9AA 4JL8A 5AJVB 1E4YA 3GPLA 1VCIA 2EWWA 3NWJA 1AS3A 1AQYA 2QBYB 1KMHA 1COWD 1RRGA 2OFOA 4RFVA 3KKQA 1NVVQ 1GVNB 1Q57A 1R5NA 3GD7A 3GEEA 4JL5A 2ZSDA 4MGKR 5F9HA 4NKRA 1D9XA 3CRQA 3I61A 4TLAA 4MQBA 1U9IA 3PV0A 3VTKA 2BMEA 4US1R 5DISB 2QI9C 2JJ1D 1R4AA 2CHGA 2Z43A 4G0NA 5AJZA 4LJYA 3EW9A 1Y3AA 4YONB 4MRSA 5EUQB 1NNEA 4Q01A 2WIBA 1BMFD 2GEVA 3BE4A 3WRYC 3QVUA 1XB2A 1W4AA 2GZHA 5UKDA 3T1VA 1QHYA 2A5YB 3HP1A 3ZH9B 4B2PA 2QNRA 5AJYA 2J7KA 4OHWA 5F2EA 3U2QA 2PL3A 3GLIE 2L0XA 1WBDA 2A78A 5JZVA 1Z6YA 2WIAA 3LY5A 1NG1A 1YU9A 2O0KA 4W5JA 1KAGA 2JLXA 1KSHA 3EA5A 3KZ1E 4I1UA 4JVSB 4B3CA 2GXQA 1MABB 1JQLB 5CJ2A 2G0NA 3IDQA 3AH8A 1IY1A 2OCAA 4RD1A 5E7IA 5J40A 2QSYA 1WP9A 2JAQA 2OEPA 4BEBA 1Z83A 5GVSA 1G7CA 3NC0C 1VDZA 3QKUA 4BLQA 4EFNA 3U5ZB 4M21A 1CEEA 1K5DA 3TK1A 1ZYUA 2N42A 2VYFA 1J8YF 3MCAA 3ZVRA 3TMKA 3NHAA 4LV8B 3P4XA 3SHFA 4U00A 5DI9A 1P2SA 4JBYA 4JKIA 1FUUA 1XD9A 1ONBA 5FR2A 1U94A 3NDPA 2BM0A 2ORIA 5BN5A 2PMKA 2NTYC 2NMVA 3R7WA 4NDZA 1MABA 3T34A 1W46A 2LKDA 4HDOB 1G8PA 1E2IA 1SVMA 2MSCB 5DSZA 1WA5A 1F48A 1JQJC 2W2TA 4LYJA 2P65A 5CITA 3VAAA 2CL0X 4FWTA 4E03A 3Q7QA 4URWR 2I1QA 4RFSA 2WTUA 4O2RA 1A1VA 1XPRA 2OESA 1I2DA 2CE7A 2CCKA 3LVRE 1E9RA 2UZ3A 4PQYA 4YXWA 2D4HA 4TMKA 3ND9A 4QOSA 1U8YA 4PHFA 4DSTA 3CF2A 2OV2A 3K9NA 4CGZA 3BWDD 3I8XA 1JB1A 5FBWB 2EFDB 3TUIC 2WPDD 3V00A 3EC1A 3R7WB 5TB5A 1X8LA 1Z29A 3SFZA 2WAXA 3TQCA 1NF3A 3EIQA 5IRCD 3F0TA 2C99A 2F1JA 4DIEA 5GJBA 4BFUA 2JLQA 4UNQA 1FFHA 3EWAA 1OH5A 1KSJA 1FQJA 3BGWA 4BQSA 3AVXA 2RGCA 4QJ5A 5KTYA 3F3YA 1SZPA 4L16A 4Q48A 2RKOA 4KFUA 1IBRA 1E79A 1K8RA 1DEKA 3TNFA 5CDFE 2OSBA 2IA5A 4BLTA 5BW8A 2RGGA 3CRMA 5BXQC 3VMFA 2VP5A 1V5WA 3C15C 4PAMA 3AQ4A 1KKLA 2P0EA 3UWKA 4B3FX 2FE4A 4TTRA 5JI2E 1QBKC 3CB4A 4RCZA 1DBSA 1CR1A 5CYPA 5EP1A 3QY0A 5FOTA 4H1UA 4QL3A 4D82A 2JGNA 3PEVA 2YOGA 3H4MA 1OHHA 3A4NA 4XSHA 3HR8A 2WSMA 3LVQE 1G20E 2VP2A 3MJRA 3ADBA 4MDEA 1S4QA 4LC0A 4QBHA 3WNCA 3VX4A 5H70A 1IHUA 4WAUA 5DLQC 4A8JC 4TL6A 4HDQB 4LHVA 2IWHA 2O0JA 3NXSA 2ONJA 1GRQA 3X1WA 2H8KA 4Y0AA 1LF0A 1RYFA 4MYTA 2QTHA 4FXPA 1NIPA 4LK2A 1M2OB 4LBYA 2QA5A 4D6PA 3L82B 4JSTA 2WV9A 1X86B 3BIFA 1A4RA 4KHZA 2NIPA 5LBIA 1XD8A 2BDTA 1ZW6A 2FPKA 5FBLB 5JWOA 4CEIB 1JJ7A 1US8B 2CDNA 4XTCS 3X1XA 3UWOA 4WZAE 1YR6A 1GNPA 1E0JA 2ZSBA 4ZIRA 1UKYA 1U9IC 3VR5A 2WWIA 3AVOA 3FFBA 3KXKA 1RJ9A 3JZAA 1S8FA 4ZCMA 4MH0R 5C18A 4KVGA 3WY9A 4Q03A 3SNHA 3BJIC 4UJ3A 3VX3A 1AQUA 1OHHD 1V43A 3KUDA 1RW4A 4KCGA 3AF2A 4DLSA 2KBFA 1CRQA 1HQCA 5FI1B 5E3HA 1KDTA 4R7ZA 3KQHA 2WKPA 4DCSA 4A92A 3EPHA 1OIXA 1YR9A 3LFUA 5J5CA 1Q1EA 5HCIA 1GTVA 4BFZA 3QKRB 1KK2A 4PHTA 2ZAOA 3OIWA 1UBFA 1GSIA 1E0KA 1G64A 3AVUA 3PEYA 1N6KA 1ZD9A 2QQ0A 2Z4SA 4JSYA 4D0GA 2QUZA 1PUIA 3GFTA 5HZHA 1IN8A 2O8FB 4RSGA 1W0JD 5L3SA 3FGNA 1LS6A 5G3YA 3SFVA 1KO7A 3PR1A 4ZCIA 2A5JA 3T35A 2BM1A 2GXAA 1KHTA 4LYFA 2CJWB 2WJGA 3C5CA 4POAA 3QF7A 2RMKA 2EW1A 5BN3A 5KU1A 5KPJA 1ZM9A 4B3DA 2AWNA 3EIHA 3DZDA 4B74A 4DCNA 3EASA 3CM0A 1CULC 1W0KA 5DI3B 3TW4A 4B33A 4AIIA 4AKHA 3VKGA 2R6DA 1MT0A 5B64A 4BRWA 4Q1AA 3I8SA 1T3LA 2DFTA 4LRWA 3B85A 5F3WB 2YWGA 3Q5DA 3O8RA 2J7PA 2CNWA 3VNUA 1FMJA 3U7GA 5AUQA 3CZPA 2JJ2A 2DFKB 5EE3A 1EFUA 3DOFA 4AYXA 2IC5A 2O8BA 3SN6A 2GVDC 2QAGB 2IYSA 2ZI5A 4PO9A 3NHBA 4OJKA 2QL6A 4CEHA 2PT5A 1XXHB 1H8ED 4LYHA 3AKEA 2REOA 4Q7MB 4EUNA 3AVYA 4BLSA 1G16A 2ZTSA 3HYRA 3Q85A 1XXHE 2ZRFA 2PJZA 4XIGS 2G83A 2QMHA 1FP6A 3QI2A 5FUVA 2KB0A 1G5TA 1HY3A 1MO3A 1R8SA 2QT1A 4B3BA 1MO4A 2FJUA 4BASA 3CPEA 2OLKA 4FI3C 4MKHA 2RAPA 2B92A 4Q7JB 5H8WA 1FX0A 1P61B 4KBFA 1ANKA 1IXZA 4ESVA 3SJZA 1NKSA 4ZV4A 1DAIA 1XNJA 2VHJA 4M2LA 3NG1A 2F3TA 1L7VC 4KODA 5L8VA 1HT2E 3MSXA 3Q9LA 2WVJA 2V54A 1OYYA 2HEIA 4RD0A 4NL4H 4YDHB 3SU8A 2ZE5A 3AKCA 4ZKEA 5JS7A 4PQFA 5JSZB 2DB3A 4Z54A 1BOFA 1XTRA 2BCGY 4ZO4A 3KFXA 1II9A 4M22A 1O3YA 1IJEA 4IXMA 1XTJA 5FPKA 5KDDA 2R44A 5DHFA 3GLIA 2ODNA 1TEXA 4KFTA 5KPDA 3QXCA 1KJYA 2AR7A 4GBMA 4QGFA 3B78A 1ZU5A 1SVLA 3CUEF 3BH7A 4I4LA 2LWIA 3U6BA 2D2EA 5C4GB 2ZSEA 2R65A 2G9NA 2ZXUA 1N6RA 1T9HA 1W2HA 5JFGA 1R8QA 4A2PA 5L3QB 1I4DD 2XZLA 2JJ1A 4Q9HA 2CHQA 1O87A 2E1RA 1X1SA 1GKIA 1EXMA 3TSOA 2DWPA 2VRWA 4KLNA 4MDFA 1X8JA 2IYLD 4GOXA 3VQTA 5B58C 2O8DA 4B6FA 3I73A 3E2IA 1KI4A 1ZNWA 3PEUA 3DL0A 1COWA 3GLIB 1JBKA 4Q21A 1G19A 3ASYA 4WXRA 3QIAA 1WDTA 4OI2A 3H84A 2FMXA 2G77B 4TMTA 4DB2A 2ZEJA 4RZ2A 3GFPA 5DN6D 3NBFA 2VHQA 3E1SA 5KSZA 5FUWA 4IHQA 2GBLA 3GJ0A 2HYIC 2GAAA 4DSUA 3AB3A 3H1TA 4N0DA 4AY2A 3G82C 4G1UC 5K8IA 4XD7A 1TADA 5FBRB 4FN5A 2DWQA 1EX6A 1IONA 4PC3A 1JXOA 4DCTA 2FOLA 1RC8A 3I62A 2ZRBA 4TSFD 2Z5FA 2XNSA 1CJMA 3K0CA 2FEMA 3RABA 3VR3A 3UG7A 5GADl 3PG5A 2NO9A 2GCNA 4BZXA 1XTSA 3KX2A 1TL7C 2Q6TA 4KBGA 4TMZA 3ICQB 3HPRA 1G1MA 1NN5A 5JCPA 1SXJB 2V8OA 1TQDA 3TUJC 1XWIA 4F93B 3CNNA 4M1WA 1AS2A 1EWRA 2BKEA 2J87A 2VL7A 5AK0A 5LB2A 4A0FA 3N70A 1E96A 4GMDA 3RC3A 1Z0FA 1MKYA 2OBNA 1R10A 1DAHA 2GETA 3MRSA 4LOAA 4QBIA 2W83A 3CWQA 1JPJA 3PJRA 1L8QA 2ZI3A 2ZRAA 1NMYA 5EE0A 1CBUA 1Z6TA 3P1JA 3KQNA 3CRVA 1FMLA 3CIOA 3H2YA 2OE2A 2VF7A 3EPLA 2XOKA 2IEZA 3RWOA 4YMTA 2VHTA 1L2TA 2ZUBA 2I4IA 4XSGA 5HTKA 1M1YE 4NYIR 3TSZA 4EFLA 2RCNA 4TT3A 5FTNA 3UIEA 4EQ6A 3CX7A 3GQBA 3B1WA 3UKDA 4AWXA 1F6BA 4P0TA 4GZLA 1GP2A 1KMHB 1GL7A 4IRUB 2N46A 4M9XA 2Z0MA 5FOWA 3SYLA 1G7RA 3THWA 5C1BA 3LLMA 1CJUC 3EZ7A 2FF7A 1OH8A 3QPVA 2Q3HA 2FGJA 421PA 1P75A 3T1QA 3KL4A 2F1RA 5F9FA 3K09A 1HV8A 5G53C 3LH5A 3GJ3A 2CHVA 2ERXA 3T5GA 4L5BA 2QENA 3VKHA 2GZDA 1D2EA 1UBEA 2ZE6A 5TV2A 4MKFA 1SXJD 4C7OB 4LHYA 2RGNC 3KXLA 4BE7B 1EFRA 2G3YA 4I1SA 1U8AA 4OI0A 4F91B 4PZZA 4A36A 1DOAA 1Z22A 2ANCA 1IM2A 3TRFA 3QEOA 2D3WA 1W44A 3QUSA 2OAQ1 4WOPA 2FPMA 3A58B 3C16C 3RVBA 5GJCA 4P4SB 4FD2A 2O8EA 1WRBA 4DUGA 3DM5A 3T15A 2W0SA 1W5TA 2ZYVX 3AEZA 4Q18A 1G4AE 4Q4AA 5TVKA 1IN7A 3K70B 3C41J 4URUR 1S9DA 1YKSA 1NVWQ 4LJ8A 4B3XA 2MMCA 4Q00A 2BCJQ 3FKQA 4Q9IA 3WNDA 4WBSA 2XAUA 1DG1G 2ODEA 4NPHA 4URZR 1T8TA 1GDDA 1E9DA 3WMFA 3RRYA 4ZKDA 3HR7A 4NCIA 1TMKA 2JJ8A 3C7KA 4ZIRB 5ELXA 4WIAA 4XWOA 4N3NA 3GP8A 3Q3JB 2IWRA 3BOSA 3EWSA 2C78A 4V02A 2XNDD 1E0AA 2YZ2A 5HKKA 2OAP1 1NJFA 3EA0A 4Q4AB 3WXMA 4NTZA 4D4LA 1FW6A 2H16A 4DLRA 1U98A 4Z8XA 5DNYB 4M9ZA 3J81k 2O5VA 3DKVA 2HJVA 4TZ6A 3GJ7A 3QBVA 2VEDA 4IOLA 5FUXA 1JJVA 2A3RA 4KV9A 4NYIQ 2AFIE 5FH9A 2FPLA 4AYTA 5JECA 3ND8A 3M0EA 4RFSB 1RRFA 1KTVA 3PUXA 4RKEA 2ZRMA 5D3MB 5FTKA 1IN5A 1NSTA 1NVUQ 3ZD6A 3VU9A 3D6TB 4PPGA 3CPHA 2WWGA 4CT5A 2HDNB 3ZVLA 1G6HA 5K8TA 1GOTA 1XPUA 1D2MA 5JJIA 2YVUA 1C1YA 2X2FA 4OL0A 4DC9A 5JCZA 5J4YA 1DE0A 1MH1A 1MOZA 4N1AA 4QHYA 1MO6A 1A82A 4PAOA 4Q1FA 4RCYA 5FFMA 3UMSA 5L3SB 5JJLA 4A6XA 4Z1MA 4C3ZA 2F43A 1YVDA 4PXAA 1EFTA 2F1HA 3QF4B 1XMVA 1QHHB 3BRWD 1E94E 4LZZA 3ZZTA 2IBMA 4YMSA 2ZM5A 2JEOA 2G6BA 2RGEA 1QZXA 1E1QD 4PPQA 1E9CA 1DO0A 4LPSA 2PLFA 3AKYA 3MLEA 2PLRA 2Y8EA 3P20A 4G5RA 4LCBA 4V0LA 3RAPR 4TYNA 5DYGA 4AG6A 2WJJA 5L3VA 3RS2A 2ZU6A 1OE0A 1U8ZA 3ICEA 3NBXX 1GITA 1Q20A 3IUYA 1JI0A 1FTSA 4HSEA 5C4MA 3A1SA 3UK6A 3GLFE 4DDTA 3VHLB 1HUQA 2FN4A 3IQXA 1KJWA 1U90A 1M74A 2OILA 1TQ6A 3CLVA 3SR0A 1KI7A 1H8EA 4JLJA 1ZIOA 4CEIA 1ETUA 3CWZA 3D7MA 2PH1A 3Q5EA 1OXXK 4EPVA 3UMRA 3VFDA 4RZ3A 1LB1B 2CK3D 1T91A 4B43A 2PEYA 3TAHA 4EIWA 3N2EA 1XU4A 2DBYA 4OQNA 4RJLA 3QXHA 4DLTA 2GWHA 3VKWA 1XD2B 4FMDF 4UJ5A 2X77A 1Q3TA 3B1YA 4KO8A 4YMVA 3S1AB 2GEDA 4QXAA 4NHOA 3BFXA 5IK2A 4AG5A 1E3MA 4KJZA 4XVRA 3W8RA 3A36A 4XVUA 2WJIA 4Q1CA 3B8HA 1KY2A 4L15A 1AZTA 3NDBB 2ZQ5A 3T61A 1TQ2A 2WWFA 2P6RA 3PUVA 5FTMA 1CJTC 4Q7KA 2J1LA 5AUPB 4L4UA 5CM9C 3T06B 2VBCA 2OG2A 2G88A 3PIRA 4GP7A 2Q3FA 4R2HA 1GNQA 1DG3A 4B48A 4KSCA 2PJRA 3GLGB 1CR4A 1TAGA 4MKGA 5AJXA 1D8TA 1GRNA 2XJ9A 4ZI2A 1NY6A 4L9SA 2EU8A 1UDWA 3CRRA 2IX3A 3QNUA 3K09C 1MV5A 1P9RA 4P32A 2HF9A 1J90A 3P26A 4OHZA 2NO7A 4M1TA 4QHTA 3SE0A 3L0OA 3WNBA 1AJEA 1QHXA 5L3RA 3LXRA 1JR6A 1XP8A 4TMWA 2ZI4A 3U7EB 1JAHA 1XTKA 2FG5A 4RZXA 2ZRLA 3AVQA 3CR8A 1LW7A 1WQ1R 2FGKA 2GESA 2IXFA 3O47A 2TMKA 4JMPA 4P31A 4E07A 5FOUA 1E2JA 1D9ZA 1ZCBA 2C04A 1P73A 2RGAA 5CDFA 1E2KA 3BH6A 5CK4A 2CE2X 3CRW1 3C4JA 4B32A 4LX0A 1PVOA 2O8DB 3K0AB 1EGAA 4DB4A 4D81A 2HCBA 1E2GA 2QRZA 4MGZR 1G6OA 4E09A 2IEYA 1TUEA 1NJGA 3EZ2A 3GCGA 4EDHA 1R6BX 1LNZA 3LX5A 2UZIR 2HCJB 5TY0A 1H8HD 1M7BA 1DAEA 1BYIA 1T0JB 2ANBA 1DADA 2H57A 3SDZA 1EWQA 1Z0KA 3ZIAA 5CIQA 2J0UA 4TLCA 3DOEA 2R8RA 1G8FA 2HT6A 1E2EA 4MYCA 4TLBA 2CBZA 2WZQA 2REBA 3U3RA 3B13B 5EE9A 2XZOA 2ZYWX 1MRNA 3LBIA 4TWZA 3B1ZA 1FNMA 4WW0A 1IOZA 1OXSC 2A5FA 4EPWA 1E2DA 4IOJA 3KJGA 2BMDA 2OZEA 3LO5A 4O3MA 2F9MA 1NN0A 5FBQB 4TMVA 4FWIB 1XMJA 2GK6A 2V9PA 3CW2A 3K53A 821PA 5CIWA 3BS4A 2YWHA 4B73A 2YOHA 3L0PA 4Q02A 5SZIA 4M1KA 4KITB 1NMZA 2G0TA 2OUKA 4KYUA 3FB4A 4TSFA 3TVDA 3JZMA 3TUZC 1E6CA 3EZ9A 4EPRA 2BJWA 1Z6XA 4C0AC 3IBGA 1SVWA 3FMIA 1VECA 2GJAA 4TTPA 1ZNZA 3MAAC 2WKRA 4KFSA 3K70C 3UANA 1YE8A 2XTNA 1N0VC 2GCPA 1E79D 1RE0A 1VCOA 3PUWA 1KI2A 2WMOB 2AK3A 5CB8A 1UKEA 2Z6VA 4IDNA 1OYWA 2ZE7A 1ZINA 1A2KC 3U44A 4OHYA 3CR7A 2C9CA 4QGHA 5SZJA 4B3GA 2WMNB 1VCMA 3R8FA 4JT4A 2WAYA 2IXGA 4IOMA 3N5CA 4FMBB 4TL7A 4G3XA 2BEJA 5C2JB 3I72A 4TL9A 2OCYC 2A30A 1Y63A 3FVQA 4HZIA 2OBMA 5BQ5A 2W6JA 2ASEA 4V0MA 4JZKA 4A82A 1KOFA 1JEDA 1G3QA 2J46A 2AX4A 2XXAB 2G1KA 2VO1A 2JLSA 1NG9A 2WHXA 4HLDA 3CNLA 3IIKA 4D4JA 4OI4A 3U4QB 5J4VA 3U44B 2Z4RA 4GI7A 4OK5A 4PHGA 2ZJ2A 4US0R 4DVGA 1N6HA 1AN0A 3GLGE 1E2NA 1J2JA 4GDFA 1ZD1A 1DPFA 4TLDA 5P21A 3MGCA 3IHWA 3K0SA 3RSOA 1UEIA 5CK5A 5KDOA 3HU2A 4PANA 1KI8A 3EX7C 4LJ6A 1GL6A 5EP3A 4GPTA 1NBMA 3ZQ6A 2DHRA 3U7FB 1QG4A 3PVSA 4M0LA 2ZUCA 1S2MA 2IYQA 2VHUA 2QT0A 1Z6GA 2WJHA 2WJVA 2DFNA 2YYZA 3AKDA 2YC2C 3HU3A 3RYTC 1P7CA 3G0HA 1G3RA 2W6ID 2P2LA 1RVDA 4I1VA 4RKFA 4UNPA 2GTPA 3EZFA 621PA 4RD6A 3UXMA 4AKEA 4C0SA 1UKVY 1E9BA 1E2PA 3CF0A 4TQUS 4O25A 2ZJOA 5G41A 1J8MF 1T3SA 5BYKA 1CKEA 1OXTA 4WA7A 3O8BA 4BFYA 3SJCA 2IF2A 2AHOA 1RRPA 1W2GA 2QMUA 3BBPA 4DKXA 2GJ9A 2GXUA 1LV7A 3JVUA 4DJTA 5EXSA 2JLWA 4DZZA 2BOVA 2W58A 1NVXQ 3L43A 4G5QA 3W8NA 1KGDA 2NQ2C 3B1VA 3KJIA 4HUQB 2I1VB 2C9OA 3W90A 4AYWA 3K0FB 1XTIA 4EPYA 4EJSC 3WP0A 1T3HA 4US2R 2IS6A 5SZKB 4P4TA 1VCNA 2C95A 5HCNA 1EFCA 4DCUA 4AKIA 1GNRA 3PITA 5KUTA 4OQLA 2RGBA 3PUZA 3SEAA 3B6EA 2GK7A 3WYAA 1VTKA 4JLOA 3B9PA 4JLBA 3CH4B 3FKSA 4JVMA 5KOYA 3A4MA 3RS0A 2BBSA 3P32A 3BFKA 2JDIA 2V4ZA 3EXAA 2QU8A 2JASA 2Q3MA 3P4YA 4JS0A 3ZYCA 5FPHA 4DBLC 1AKYA 1LVGA 1XRJA 4TYWA 2ZVPX 3K9GA 1R7RA 1YZGA 2HV8A 2CLSA 4MGIR 1W1WA 5AJWA 3AP1A 4D80A 3OHMA 4QGGA 1EESA 1KI6A 1RFLA 1SQ5A 3BC1A 3CPJB 2XOKD 3QF4A 3ZZ0A 3TR0A 4QGAA 5J4LA 4AI6A 1Q1QA 3C14C 2P67A 1W0JA 1CRPA 1GAJA 2QE7A 2V6JA 3W6PA 1Q3HA 1JR3E 2EFGA 1KZ7B 3TJZA 2J41A 3X2SA 2BBOA 3FMOB 2ZRDA 1CR2A 5D3QA 4XVQA 4LBZA 2ZYTX 1IQPA 1PLKA 4DXAA 4HAWA 4LGMA 1P60A 3BB1A 5EE1A 1NIJA 1Z08A 1OB2A 3KKPA 1J99A 2QQEA 2FDCA 3T5DA 3GJ6A 1OH6A 3A37A 3OEHD 1Z63A 4M8NE 4A6PA 4Q5IA 2EFCB 3RSLA 4U02A 3AF3A 3EZ6A 5FOSA 3OEHA 3CONA 3ZGXA 1AK2A 4IOKA 3M1IA 4QM6A 1NP6A 3KXIA 5BWMA 1Q21A 5DHAA 3I4LA 3TVTA 1GM5A 2XXAA 4UNRA 2O52A 1AS0A 2F1IA 4LWZA 1E2MA 3AUXA 5EP2A 1NRJB 4P4SA 4IXNA 4DEYA 4A8JA 4TMXA 2ZETA 2KWIA 4Q4JA 4P33A 3FPAA 4A15A 1M34E 1C9KA 1Q1ZA 1Q12A 2MMGA 2NZJA 1YZTA 2EVWX 3HPQA 4NCNA 4R2IA 2F7SA 4TQAA 1Z0IA 2WKQA 3BERA 3PXGA 2QE7D 3OIYA 4IFEA 1W4CA 3FWYA 1XDBA 4LJ5A 4TZ0A 2HUPA 4MRVA 4ASUA 4PR0A 4RD3A 2KSQA 5IDVA 3R20A 2ZYUX 3FTQA 4DLVA 5SZHB 4Q1EA 1N5JA 5JS8A 4A2WA 1ZIPA 4ESHA 5DI3A 4PTLA 3IHLA 3GLGA 4MRRA 2H18A 2YNMA 4DSNA 4PC6A 5KSYA 2QPOA 3L0IB 3DEFA 2JDID 1NVVR 2QMEA 1KY3A 2EQBA 3CNOA 3GMTA 3ASZA 3W5JA 3EARA 3O8CA 5AR1A 1EFHA 3LBHA 2AK2A 3VHXA 1CU1A 3U3JA 3U6KA 2NG1A 2ZAMA 4MKIA 5KYKA 2H5EA 1DAFA 2D74A 3A1WA 2BMJA 2Q9BA 2XSZA 2R6CA 1E2FA 1M8PA 1NN3A 2P5TB 4JL6A 1R0ZA 3GLHA 2AD5A 1YR7A 1WB9A 5FL3A 4HLUC 1HE1C 3ZZUA 3FFAA 4DLYA 1DTSA 4DT1A 4PQRA 1WF3A 2ZRPA 3MWLA 2K5UA 2WSSD 3T1TA 1T4GA 1OB5A 3PFIA 2VIIA 4KYIB 2V1XA 1VG0B 3NBYC 3RWMB 3WMEA 3QSYA 2AL7A 3I1FA 1UAAA 4OKSA 3FOZA 5JLJA 1UFQA 1I4LD 1VYVA 2F55A 3R9XA 1R0WA 4CIDA 3I3SR 1WE2A 2QTFA 3DDCA 4HATA 3VR4A 1OH7A 4XTRA 1NN1A 3LDAA 3K9LA 4Q9KA 2PZGA 2OXCA 1XFAA 2W00A 4DWJA 4R98A 5GJVC 2VA8A 2GCOB 4ARZB 1F2UA 1F60A 2F3RA 2ZREA 1NL3A 2WJYA 4K46A 3RC8A 221PA 4YXWD 1G5PA 1IAQA 1Z0DA 1OV4A 1XMSA 1OIVA 4RD2A 6Q21A 3OFND 1OXVA 4DSOA 3BD9A 1NBMD 5EQTA 3B60A 3G5UA 4PSAA 3SZRA 2JLZA 1X6VA 1TF5A 4CEJB 3FHTA 5J47A 1HYQA 2W2VA 3LW8A 3OEED 1KI9A 1LTQA 3OZXA 4H9GA 4HAUA 3TKLA 1E98A 2FX3A 4LJ4A 5CYOA 4D0NA 2BBWA 4GFDA 4URXR 2H1LA 1RRCA 3H86A 1P2UA 2PCJA 2VSOA 5L3QA 1GZSA 3B9QA 2IYWA 1LFDB 4GRAA 3L2OB 3RRNA 4MUAA 2BKUA 4G5GA 1KO4A 4F4JA 1XD2A 4C0JA 5C46F 2CL6X 3PCRB 3AGQA 1E4VA 2KJQA 1W0KD 5A4JA 1T5LA 2V3CC 5LDDC 1TNDA 1Z28A 3QBTA 5DYIA 5JWHA 2CMKA 4DCVA 5DGXA 1VYTA 4DRZA 3SYNA 1S1CA 4TL8A 1YHNA 1Z2AA 5EE5B 4BEJA 1SULA 4V03A 1OFTA 5CJPA 2FFQA 2GNOA 4A0GA 2WSSA 1IN6A 2G1JA 4OQMA 4Q1DA 4DDUA 2WM9B 2YHSA 2XGJA 4JVNA 2DCUA 5FBVB 1US8A 5LB4A 2IS2A 1P62B 1JR3D 2ZE8A 3AP3A 3ZDQA 3ZVNA 3DHWC 3A8TA 3A1TA 4W7SA 3LV8A 3WBKA 4QG7A 4S2EA 2BV3A 4LYAA 3QXJA 4ILEA 2EWVA 3IGFA 3TLXA 1F2TA 4UXIA 2FEOA 1CIPA 1FL9A 3NBZC 4X8MA 3U60B 3W3ZB 2H92A 4ACBA 1YRAA 521PA 3QPUA 1FUKA 1XEFA 4D4MA 1SHKA 2QAGC 2CCJA 2A2ZA 1OT3A 4A2QA 1QHSA 1J70A 5LD2B 4B35A 4I99A 1G8YA 4EPXA 5AWFC 1G9XA 3AUYA 4YLGA 1YZUA 2B8TA 4MITA 4UXHA 3RS5A 4ZDJA 2ZR9A 3HJNA 1N5KA 4MYUA 4LSGA 2DR3A 4LHZA 5FPTA 2HXYA 1XTQA 1E0SA 1DVRA 4KSBA 3Q8XB 2B21A 4OK6A 4JBXA 2ODWA 4NONA 4NU0A 4AC9A 2EFHB 3IIMA 4ASUD 4C4PA 1EX7A 2ZI6A 1W36D 2V55B 1NLZA 1PJRA 2A7QA 1OFUX 2C96A 4M1MA 1G17A 1SVIA 1FOEB 5ANRB 2CEAA 2CJWA 4W5WA 5G3ZA 2IT1A 4DLZA 2BEKA 2Q9CA 2ZROA 2R2AA 1KK0A 3QKSB 4YMWA 3GLHB 1GIAA 4QC2A 2QSZA 2EYQA 2XB2A 2ORWA 4PAQA 5TMPA 3NH6A 4LJ9A 5JEDA 1FNNA 2ODBA 4E22A 4IDOA 4C0HA 5IF9A 1NSFA 1J7KA 1KK3A 4G5OA 4P4UA 2R62A 2GRJA 2P3SA 3LNCA 2C9YA 2FFAA 2F6RA 4F7WA 4LV6A 1T6NA 1TU3A 4NYJQ 1BS1A 4F4IA 1OXUA 3IILA 2QBYA 3RRMA 2RHDA 3FE2A 2DPXA 4BFWA 4LPKA 4AKGA 1Q44A 3AM1A 4A4DA 3WBJA 1E2QA 4EFMA 1MRSA 3X1ZA 1P9WA 1RIFA 3RS3A 4BECA 2C8VA 4TLEA 2GCOA 2IUSA 3ZQJA 2AXPA 2VTKA 1ZNXA 1HQYE 2KBEA 4FCTA 2CL7X 3BXZA 4D2IA 2V1UA 1II8A 2FSIA 4GOKA 2IYRA 2JLRA 2YINC 4FIDA 3TE6A 1R5OA 2YC4C 1SKYE 2ZI9A 1Q1BA 3UATA 2A9KA 2EYUA 5FR1A 1W4RA 5K8LA 4HZUA 1E9FA 1BIFA 3KQLA 721PA 4ITRC 4QFMA 1OPXA 3CKLA 1KDPA 3RS4A 4FCVA 3WRXC 4DLUA 4TN1A 3A4LA 1CJVC 3MWYW 2OHFA 2P6NA 3NTUA 4RY2A 2BVNA 4A9AA 4OHVA 3LD9A 4PFSA 2UKDA 1VKJA 3SQWA 3FKSD 5A5GA 1WBBA 2YWEA 1L4UA 2DFLA 2WPDA 4KVAA 4GOJA 4PC2A 2ATVA 2V7QD 3BB3A 3MWKA 3NKVA 3TH5A 4HB4A 4BZQA 1UM8A 4DDWA 2OFXA 2HYDA 1YZNA 5HZKA 1R0XA 2IYXA 5TARA 4HAYA 5IK2D 3TGPA 1U99A 3REGA 1KSFX 2NOAA 2J0QA 4NYMQ 1TU4A 5B2ZA 1W47A 1LS1A 3FMFA 3IQWA 1D5CA 2RGDA 4HB0A 1Z0AA 2UVQA 3RRZA 2IXEA 5KNBA 1X8KA 4JVLA 4BLOA 4NYJR 1VG9B 4JT2A 2H7VA 3OFNA 1NLYA 1N6IA 3I5XA 1TEVA 4C2UA 4IKEA 1NBME 2PEZA 1N6NA 4X8OA 2RGNA 3GFOA 2B8WA 3WMGA 1W36B 3SQXA 2O8FA 5FOXA 2FSGA 2H17A 4B76A 3VU9B 1Z3IX 1H65A 3B5JA 3BH0A 3GLHE 2P6UA 3LBNA 1XX6A 4D0LB 3EC2A 4IEEA 4QJ3A 4JYCA 1E99A 3K0FA 2FFHA 4LI0A 1VYUA 2O8CA 1E9SA 4D26A 1Q0UA 4RD4A 4V0KA 5EJEA 1GWNA 1E1QA 3NH9A 4UQOA 2MSDB 2CVFA 4UNNA 1W5SA 2IHBA 1T5IA 4Q9LA 4BFTA 1II0A 1UF9A 2ZU0C 2E87A 2ZR7A 2F43B 1QF9A 1E9AA 3CBQA 1FQKA 3D3QA 1KK1A 5JBQA 4Z8YA 4J0QA 2RHMA 4PO8A 3ZS8A 1RPZA 2FSHA 2PT7A 1CP2A 5F98A 2NPFA 2QAGA 3X1YA 3C8UA 2XSZD 4OJQA 3MJHA 3SJAA 3U3OA 5KNCA 2O8CB 1Z06A 1D6JA 1KIMA 1Z5ZA 2IYZA 3IIJA 3GJ4A 2C77A 4MUBA 1W48A 4PPFA 1N0UA 5FUYA 3I92A 4DIDA 4C0KA 2J0VA 2W6JD 4M9QA 4N0EA 5B57C 3UPUA 1MR3F 4GZMA 3AVPA 1PLJA 1ZU4A 4MGYR 3QXXA 5HE8A 2ZUDA 1XCGB 4MRNA 5JWRA 1AM4D 2XNDA 4U7DA 2OCPA 1UBGA 2XJ4A 4CYMA 2REXB 4TQ9A 3SBEA 1KO1A 3ADDA 2WBLC 2FA9A 4WVFA 4I1OA 3S1AA 2HJGA 1VMAA 3IEVA 1L4YA 1ZD8A 5HR5A 1VHLA 4LUCA 4BLPA 4PZLA 5JI3E 3KDSE 3QE0A 5DE3A 3RLFA 1N6LA 5JSZA 5KDLA 1HT1E 3TAUA 4LY6A 2AN9A 5TXGA 1XEWX 1LF5A 1P9NA 1E69A 4IDPA 1ELOA 2QPTA 2ZRGA 3OE7D 3OAAD 4RVCA 1VG1A 3AF0A 1Z07A 1Z2CA 4B47A 5CB6A 3ADCA 1U0HC 3THOA 4B75A 4DUGD 5KO2A 2GAOA 4MYHA 1VPLA 1HH4A 1DO2A 1HA3A 1U0LA 2VQSA 2E9SA 3O8DA 3T12A 4ZI3A 2AXNA 1YZLA 3EPKA 2PX0A 3GLFB 1G18A 2YV5A 1UBCA 2PX3A 4NZYA 2IS4A 2QY9A 3B82A 1FP7A 2GJSA 5M04A 4QBGB 5KNDA 3SYKA 3VR1A 2IYVA 2FSFA 2HXSA 3WP1B 4HB3A 4C0LA 1WCV1 3TR5A 3NIBA 2JIZA 4JLNA 2GF9A 2AFHE 1XMIA 2ZJYA 4M1SA 3A1UA 5KSOA 1UADA 1GRRA 1HE8B 1ZM4A 2XZPA 4F92B 3HWSA 1RJ9B 1G7TA 4GP6A 1YZQA 4IDQA 1H8HA 3IO3A 1KI1A 2V6IA 3PQCA 3THXB 5FL7D 2FFBA 4B2IA 4OQFA 2J9RA 3NEJA 2PBRA 2ZRIA 4O0MA 3LX8A 4M9SA 4OQXA 4E5UA 4TT3D 1G291 1SVSA 5JMTA 2YJTD 5FL7A 1WMSA 3LLUA 4JYBA 3VR6A 4Q4LA 5EXTA 1GFIA 3AVTA 1B0UA 1E9EA 4ABYA 4FMCF 2GHIA 2IW3A 3IKJA 4DEXA 5CLLA 3RS7A 2IYUA 1SXJC 1E2HA 1LY1A 2HF8A 1QVRA 4C30A 3THXA 1S9HA 2P5SA 2HLDD 2Q21A 3U3KA 5FPSA 2QGNA 2ZRCA 4LBVA 2R9VA 4BUJA 3QPWA 5EZ5A 1ZUNB 2WOJA 1UJ2A 3W6NA 1S3GA 1N6PA 1YR8A 1E1RA 1RZ3A 3CZQA 4TYPA 3GJ8A 2MSEB 2FH5B 1DELA 2GVZC 3SC3A 1C4OA 1OIWA 3M6AA 4DLXA 4UKDA 4ARZA 4D4KA 4B71A 1UKZA 1F5NA 2VH5R 4CF7A 1QHGA 1DAKA 4X8HA 3BAFA 1G4UR 3MMPA 1F3OA 4V0OA 4URVR 4MRPA 1SKQA 5A0FA 3K9HA 5BYJA 1Q22A 1OFHA 4RZUA 1ZCAA 5FTJA 3KKOA 1P6XA 5TDHA 4F38A 2W6IA 2GILA 3AGPA 1PZNA 1SHZA 1SVKA 1XZQA 2O8BB 4LBWA 3AF1A 4Q19A 2WWYA 3OIVA 1QDEA 4CEHB 3E70C 3OEEA 1CXZA 1XXHA 4R71A 1KAOA 2CK3A 3THWB 4C2TA 1JECA 2PCLA 5CM8B 4KLZA 3W9YA 3A6PC 2GF0A 3DVLA 1IXSB 1SKYB 2J5XA 3QQ5A 1FPMA 1ODFA 3SS8A 5FPYA 1OKKA 1UEJA 1AGPA 4BZPA 5JEEA 1W36C 3K8YA 4QBFA 5GJWC 3ECCA 1XEWY 3W6OA 1G8HA 2R6GA 3CX6A 4JLDA 4GT1A 3PEWA 4CEJA 1XBTA 4ZDKA 2OBLA 1ZM2A 3B1XA 4JLMA 1FX0B 3OIUA 4A0HA 1KNXA 3FMPB 5EXPA 4YDSA 1IJFA 2ZRJA 1M7HA 4ACAA 2D7CA 2NO6A 3KTAB 4F4CA 3WYFA 2B7CA 2AKYA 1N0WA 2CVHA 5H1YA 2OLJA 3ZVMA 1GL9B 1N25A 4KXFB 2O8EB 4M4SA 1II8B 2ZRKA 5AUNB 3BK7A 1OLOA 4KAXA 4Q4HA 1QG2A 1GUAA 2BWJA 4QKQA 1ZC3A 1JEEA 3LQQA 3B7GA 3N2IA 4IVRA 1G7SA 1P2VA 5DH9A 2GBLC 1VHTA 2WICA 2QROA 4DLWA 1DS6A 1AZSC 3I32A 4GMXA 3REFA 4Z1MD 3NC1C 2ZR0A 1ESMA 4CRWB 1MO5A 3X1DA 3SHWA 5E7JA 4W5HA 1GILA 2KE5A 3KB1A 3K0CC 5JJKA 5GVRA 5E95A 5JRZA 4NMMA 2OO7A 5LPNA 1K5GA 3LWNA 1S1MA 2FV8A 1EG7A 2ORVA 4Q4HB 4ZCLA 1DAGA 3DO6A 1N3BA 2NO0A 1IN4A 3MWJA 3EPJA 2QPAA 4LC1A 1ZC4A 3SJBA 1KDRA 4XOIA 3ZJYA 3V4RA 4L9WA 2ZVQX 5IT5A 3V4FA 3KFVA 4HUQA 4TTQA 3VR2A 5D3MA 1OKKD 1DAMA 1U0JA 5HKKD 4HI0E 3WHKA 4YMUA 2KI5A 2FZ4A 3PENA 4XWKA 4C9BA 2D06A 1OSNA 2BBTA 4BWYA 1YQTA 4EAQA 2QM8A 4HLQB 4QJ4A 2WWHA 2QAJA 2BHRA 2ZI7A 3KKNA 1KKMA 1NMXA 1OJLA 4HEJA 2JLYA 2RB4A 2JJ2D 2NGRA 2GDJA 4TYYA 3A1VA 2XEXA 3H0KA 3LXXA 4LHWA 2VHCA 2FU5C 2J7PD 1GKUB 2XTMA 3WYGA 2V7QA 2IUUA 4QNRA 2NZ8A 2ZPTX 4OYHA 1TF2A 3THYB 2C98A 2SHKA 2ZANA 3M4YA 2O0HA 2QORA 1T8UA 4PSVA 1A2BA 4V0NA 2R6FA 1IY2A 4EJSB 3FHOA 2LCFA 3DZ8A 1P3JA 3D31A 1CF4A 3B2EA 4XH9B 3KQUA 4PPNA 4XJXA 2C5LA 5FTLA 4V0ME 3QKSA 2VP6A 4M1YA 4ON9A 3GJXC 3FHCB 4HLCA 4I81A 4HUTA 2VP0A 3QKTA 1TQ4A 2IHYA 1EFRD 1P4SA 4WXPA 3GEHA 2DWOA 4GNKA 5HPYB 1SXJA 2B6HA 1D2NA 2NPIA 2W2XA 5DO9A 4NH0A 1TPZA 2C2HA 2QP3A 2YWFA 2GJ8A 2PZFA 1ZAKA 1Z47A 1W4BA 3HDTA 4HAVA 4LHXA 4JBWA 3AV0B 1AGRA 1QHNA 1N5IA 1S96A 2OT3B 3HU1A 4PC1A 4EJSA 4Z51A 5LD2C 3EG5A 4C0BA 4H1VA 4BPBA 1JAIA 4K81B 1A7JA 5EP4A 4JLKA 1RKBA 1Z8FA 4IDHA 1ZMXA 3TQFA 3UG6A 1AKEA 1N5LA 3L8YA 4FCWA 2ECKA 1PV4A 4L8GA 2ZJAA 1IXRC 1BKDR 2ZRNA 3L8ZA 1U2RA 4CT4B 1NKTA 2VP9A 4CVNA 2OXRA 3TSWA 4IW3B 4M1OA 4PZYA 3CX8A 1G21E 1TTTA 4G01B 2VP4A 1G3UA 2XTZA 3F8TA 4HZUB 1X1RA 3LAWA 5E4FA 1OW3B 1W49A 1XF9A 3R8CA 2GKSA 4FINA 3ADKA 2ZJBA 2VSXA 3DKPA 3DPUA 4B44A 3KTAA 1CR0A 2JIZD 4DDVA 4R9UC 1I2MA 3UMFA 2JLUA 4ZDWA 2ZS9A 5KHOC 4BFXA 1BO6A 2YOFA 4JJKA 4CZ2A 4Y0VA 2QP4A 2GA8A 3KUCA 3DM9B 3CH5A 3WHLA 1NLFA 1XEXB 5BN4A 3TIFA 4IFBA 4C7OA 3GJ5A 3U7HB 2BIFA 3L0SA 2JATA 3IEUA 4ZPXA 1KNQA 4LJAA 3K0EA 3HYTA 3QJYA 3CO5A 2QG6A 3OAAA 3OE7A 1FTNA 4HAZA 4G5SA 4NP6A 1U81A 4KI0A 3SBDA 2A5DA 4IVQA 2ATXA 2LKCA 4OK3A 4XD7D 1ZP6A 1KO8A 4S35A 5AUOB 1I4TD 1E32A 2OM2A 2ONKA 2WOOA 1W7AA 3MUFA 5J4KA 4NCKA 2IUTA 1VIYA 1ZNYA 2IS1A 1CS4C 1ZJ6A 1XEXA 4YQFA 2I3BA 1FZQA 5DN6A 4NYMR 2FZLA 2GXSA 1AA9A 4DT1B 4JLVA 1X3SA 1Z0JA 1JR3A 2J0UB 4GL2A 5K8UA 1HURA 4HB2A 3QOFA 2X1VA 2PMDA 3K70D 1N2CE 3QKRA 4URYR 3RNLA 2WWWA 2YKGA 2J0SA 4CW7A 2FWRA 1TUIA 5JHGB 4LDJA 1R0YA 8OHMA 2WWXA 3IBYA 1R5BA 2BJVA 5KSPA 3QXSA 2ZJ8A 3BORA 1BH2A 2N1BA 4B6EA 1KYIA 2NO1A 4IVPA 4QRHA 4Q47A 1OFIA 3TBKA 1S0UA 3P27A 1YRBA 3MFYA 1S3SA 1P2TA 4BRUA 3THYA 2X2EA 3NVAA 2XX3A 3LA6A 2DY1A 1QVAA 1JALA 1PUJA 2AD1A 3Q7PA 3U3MA 2IYTA 1XZPA 3KJEA 1UPTA 1KI3A 3T1OA 3E5HA 2HT1A 4A1FA 2XITA 3MG9A 3W5IA 1UDXA 1F2UB 3AVVA 4BGDA 3U61B 2QMOA 2IF0A 2ZS7A 4CDGA 2QP9X 2ZSAA 3RHFA 2J3EA 2IYYA 4X8LA 2CLCX 4AURA 4UXJA 3W34A 4YC7A 4NCHA 1ZUIA 3QG5A 1KDOA 1GKYA 1VIAA 5JRJA 1XJ0A 2D2FA 3D8BA 1HEIA 4IEIA 3AVWA 1P72A 1B23P 4HLUA 4BFSA 1QHHA 3OF5A 4OI1A 1YZKA 1IY0A 1ZM3A 4OHXA 3MD0A 4FW9A 1XJCA 2Z83A 4PO1A 2JA1A 2D7DA 1TF7A 5EUMA 5DIFA 3I5YA 4Q1BA 3JVVA 4QHSA 3SOPA 4P3YA 5IHPA 2BC9A 3BB4A 1JNYA 2ZJZA 3LRPA 3GEIA 1AIPA 4AD8A 3EAQA 3RANA 1PLLA 2A5GA 2FNAA 3K1JA 3V9PA 4EKDA 2CLDX 1ESNA 1G8GA 2ERYA 3IPYA 5FI0B 1XCMA 4ERNA 3AP2A 4UNSA 1QRAA 2ZIAA 4BFVA 4Q9JA 1E1RD 1G5RA 2QGZA 1DARA 2GJKA 2JCSA 3SI7A 3QENA 1KZGB 1K6MA 3IPXA 4KFRA 3U4QA 5FOVA 1F2TB 4AK9A 1CJKC 4QNMA 1JPNA 2HLDA 2XB4A 4Q66C 3ONWA 2ZJ5A 2JLVA 1KMQA 5JHHB 3GLFA 3VNVA 2CNWD 1XJQA 5CLQA 5J4HA 1M6NA 4LV5B 1ZUHA 1QHIA 4BLRA 4JKYA 2GZAA 1BMFA 4O2LA 3ZIAD 4NBSA 4B2LA 1GG2A 4DHEA 4II7A 2RH5A 4JIMA 2X8AA 1NY5A 2CXXA 4LJ7A 2QM7A 3W3AA 4M53A 2IK8A 4NCJA 3RDPA 1SXJE 2OFWA 2X19A 2ZSFA 3LQRA 4OBEA 4C0QC 2AWOA 2C03A 4A8JB 1HTWA 1ZRHA 4FMDB 2IL1A 4PSKA 2J59A 2RGXA 3IO5A 4Q4JB 2Q0HA 1ZBDA 2W0MA 3ETLA 3KJHA 4JLAA 4PC7A 4B34A 5EXXA 2QRNA 3NEYA 2ZRHA 2BMFA 4IJMA 2VPPA 1A5TA 1VG8A 1RYHA 4HDCA 1YJ5A 4PX9A 5HE9A 3KB2A 4MA4A 4W9MC 3EIEA 2QZ4A 1CTQA 1SVOA 1CLUA 1NI3A 3OESA 2QTVB 3FDIA 1KO5A 121PA 2GEUA 3QEJA 4FMCB 5E7MA 5H68A 2VF8A 3ZD7A 3C5HA 4JLPA 4NE2A 2DYKA 1KJZA 1E2LA 2VLIA 1P5ZB 4WZ6A 4KU4A 2OCBA 3Q72A 4A0RA 2D62A 4JJZA 1KSGA 2ZITA 4EPTA 3KKMA 1EK0A 1G3MA 3ZLJA 1ZM7A 3TW8B 3LW7A 1Z6AA 4QM7A 3KQKA 2PZEA 2R6AA 3K0AA 1ZVQA 4HAXA 1T0HB 2AKAB 1JXMA 1R2QA 5EZ6B
chains in the Genus database with same CATH superfamily
2PH5A 3R9WA 2D0IA 3GPIA 1T26A 4AUMA 1XDUA 2I03A 4IZ6A 3BFVA 4Q7LA 1PGOA 3PUYA 4U5XA 4BP1A 3CF6R 1G3IA 2ZS8A 1GUZA 1VHJA 5B30A 4GSYA 3CZAA 1W35A 5KMGB 4G81A 1JLHA 3DMDA 1WXWA 1TX4B 2AEEA 1EGQA 2JVJA 1XCPA 3LC2O 5DP2A 1KI6B 4OUKX 3DMNA 5G40A 3ZLVA 1HDYA 1PG0A 1PVVA 3EQ9A 4PHHA 4J1SA 3VYRB 1MW9X 3BUSA 4U7PB 5HUJA 5M5BA 2ZWMA 4ZD6A 1M7GA 2Q9AA 4I3HA 3T99A 5IWAB 4JL8A 4YAFA 4KAFA 1JDVA 1VCIA 1SUCA 3NWJA 3REQA 2R6HA 1AQYA 2NZUG 4Z99A 1COWD 4I55A 2AYXA 3WDSA 3KKQA 2HA0A 1NVVQ 3GD7A 3LWBA 4DQXA 3SM9A 2ZSDA 2Q6VA 4XJSA 1J6UA 4UTPA 4MQBA 4L5CA 5HJ7A 2PGAA 1D09A 4D3ZA 3HJBA 4RPIA 1C9NA 2BKAA 2PGLA 3O1IC 3S2IA 1LPPA 1R4AA 3C6XA 2HMUA 2BGMA 2R8BA 4H1TA 1U63A 4MRSA 1O6GA 2W2PA 1X7GA 2AMJA 1TAHA 2OCIA 1U7PA 2WIBA 1AF7A 2X0IA 1AUXA 2GEVA 2MOKA 3BE4A 3C3YA 1FFXA 1EP9A 1XB2A 2GZHA 1JYEA 3PDIB 4OG2A 3LHDA 1T9DA 1ES9A 3OJ0A 3JTMA 1MEJA 1YAHA 2OGSA 2YS6A 3H1BA 3N6XA 4QDOA 4WGFA 1XMQB 3FTNA 2O6HA 1JEYA 5E8JA 2XGSA 3FFXA 5AJYA 1M2VA 4WDRA 2Y92A 4YP0A 4HTFB 3GLIE 4LIPD 9ATCA 1NXXA 4J0HA 4PG8A 4CIBA 1WBDA 3IP5A 2A78A 3H83A 2XRZA 1B16A 2F8LA 1NTRA 2CJXA 5A5EA 3RYCB 5GY7A 1KAGA 1GSOA 1RAAA 3IV6A 3JQGB 1PNOA 2QN8A 1R27A 4I1UA 3ROGA 3RIMA 1NE7A 1JQLB 2CHUA 1YTLA 2G0NA 1L7NA 1C30B 3GVHA 2Q5IA 5BWNA 5F7OA 5K7SA 3JR7A 2AJLI 2DPLA 4J3FA 2XMCA 1MENA 3S6JA 5DM0A 5F51A 1I3KA 4D42A 5J40A 1LLCA 4FUQA 5BWCA 2PX6A 4CR6A 1QIMA 3M9WA 4II3A 3COPA 3KUXA 3KV3O 3OQJA 1UODA 4FTWA 3U5ZB 1CEEA 2N42A 2VYFA 2QM3A 2IY7A 1L5WA 1V47A 2WUEA 3TMKA 2QDKA 2IRWA 3CIFA 3UCXA 3ZVRA 3NHAA 4LV8B 1ADGA 1JG3A 1Q0PA 4U00A 3NBKA 5CTJA 3NHYA 5AVJA 1P2SA 3C70A 1NW9B 3LF2A 4JKIA 4RIHA 3WFIA 1QCYA 1U94A 1RYZA 4MLZA 4UUMA 2BW0A 4WFQA 1EJ2A 2PMKA 4PTYA 4TKMA 3PQ4A 3H65A 4NJOA 3R7WA 1VJ5A 4H6WA 2NMVA 2WF6A 3G0CA 1YZ3A 1W46A 2LKDA 2OM6A 3O38A 4R1SA 4UULA 2MSCB 4Z0PA 4PQGA 1WA5A 4L6CA 4LYJA 5FA6A 5C9ZA 4E03A 1O97C 2AQHA 4TOIA 4KDEA 5I5EA 3TQQA 3UN1A 4URWR 4AFNA 3WIEA 3W2TA 3I76A 3OPYI 5KINB 2NACA 2LPMA 1DKUA 3RH0A 1WETA 2OESA 1I2DA 4RL4A 3G9QA 3TLZA 1A8QA 4M76B 1QH8B 3K0HA 4BZZA 5DBEX 5B3AA 3DMPA 1PJSA 1IUKA 1NJ1A 3D3NA 3TRHA 5C3MA 3CF2A 2OV2A 2HJRA 1YB6A 3FTDA 3BWDD 3SQNA 3OPYB 2JFOA 4IIXA 2DQSA 5FLEX 4D02A 1JQ3A 1XVAA 4U7FA 5TB5A 4KIGA 3ZWBA 4BC1A 1XV5A 2P2NA 1Z29A 3D6AA 3DV2A 3OLQA 2O2JA 3Q6MA 3UAOA 2JFPA 4EEXA 4COOA 3OOSA 2XWBF 2ZIFA 5HOQA 5GJBA 1XAJA 1WPXA 1BE6A 3GFRA 3EWAA 4UNQA 2MCFA 5K5EA 5E6SA 4KIJA 1ND6A 2ZDGA 2BR3A 2ZTMA 2DR0A 2AHRA 2RGCA 1XFDA 4RHCA 2FUG6 2H3EA 1N4AA 4BB0A 5KTYA 2AJBA 5DW0A 5EWLA 4P7JA 1HNXB 1SZPA 4K9QA 4RA9B 4L16A 4ML3A 4KX3A 2OZVA 3SVLA 1OGYA 2WABA 5LMNB 1JRLA 3FRJA 1SOAA 1F06A 2QVYX 1SRQA 2JL1A 2Q1XA 5HDBB 1UBKS 4FOSA 1HETA 1I9GA 3N3BC 3MHPA 3D2LA 1IBRA 3A05A 3EGOA 2HD4A 4KW7A 1OXMA 2FLKA 2P4UA 3I01M 1IU9A 2OSBA 3BE6A 2RGGA 3CRMA 5LP6F 2Z2YA 4RV4A 3VMFA 2VP5A 3C15C 1A9SA 2J9GA 3AQ4A 3H1GA 5KQMA 3FOAA 3OY7A 2FE4A 5IKOA 1KETA 1PD1A 2O2EA 3HNRA 3BE5A 3DOHA 4KN8A 1DBSA 2A4MA 3D02A 1CFZA 3IS3A 4MPJA 4H1UA 3P9RA 5FOTA 1JHRA 2JGNA 1XGKA 3KO8A 3PEVA 3PPWA 2BGIA 1K6IA 3ZYZA 1YCDA 2H1RA 1A9YA 2WSMA 3HXTA 2FYTA 3LVQE 4EYKA 3RRXA 3TOSA 3UMYA 5AM3A 2ZAIA 4CQLB 4ONEA 4LC0A 3WNCA 1TIPA 4O3FA 4D8UA 5CVCA 3VX4A 3QK7A 1UBMS 1XXLA 2E4AA 2NO5A 4IDGA 1PG5A 3ED1A 1IHUA 1XQXA 5BOVA 4A8JC 2FRDC 4LHVA 1D1QA 2N75A 4ME6A 2B30A 2OWDA 3G7NA 3N58A 1H4QA 4F1JA 2JI9A 2OY0A 1MJGA 1WSDA 2M98A 1YL6A 2EKDA 1DKQA 3TZHA 3K5WA 1TM3E 3A9VA 4E46A 4FXPA 3UPTA 1IZ8A 2JFYA 3CG0A 1MMFB 3I45A 4XWYA 4D6PA 1GCUA 2BFCB 4YUZA 2LV8A 2WV9A 1VLJA 4CUKA 5JZOA 3QVTA 3O6VA 1A4RA 4KHZA 1XD8A 1ACMA 3TZKA 1H2RS 1L4KA 3BHMA 4ZMBA 3EVGA 1JJ7A 3PUHA 2DQZA 4CMIA 3A25A 3IQDB 1OZGA 2OVFA 1OUMA 3E9CA 4KE8A 3X1XA 4WZAE 1QOPB 2LTAA 1E0JA 4HBGA 4XYMA 3BWEA 1VZ2A 5CBPA 1VSBA 2G7ZA 2ZIXA 3AR3A 4PSCA 2IDJA 1AQIA 4M98A 2JGMA 1N1EA 1CE8A 2JIPA 3FFBA 3Q9SA 1NU8A 2FVYA 2P40A 2MDTA 4KVGA 1F0KA 1YOVA 1QCCA 4FFLA 4R41A 4MA5A 8LDHA 1RLOA 1AQUA 1RQGA 3Q7RA 2H11A 5K45A 1CYDA 3IT3A 4G0MA 3KUDA 4PG7A 5DNWA 4U2FA 3DCYA 5DMXA 3ZCPA 4J0KA 1GPMA 1RW4A 2FEKA 3LT4A 3OF3A 3K1AA 4UUOA 2FP4B 3ZHBA 5IJ9A 3AF2A 3O1HB 1Y1TA 1CRQA 1SUPA 1E1MA 3QUBA 1KDTA 5CPBA 3WLQA 5E3HA 4CMIB 3OZIA 4CIWA 4E5DA 2Y4OA 1T2EA 4P93A 3AJAA 5J5CA 3ND5A 1Q1EA 1CDEA 1ICEA 4PHTA 4AICA 4TTAA 4BTEA 4FYJA 3G0DA 1G64A 4MGHA 1M6VB 4R2JA 4W7IA 5ER9A 1N6KA 2Z4SA 3G0IA 3KLMX 2XYGA 1P80A 1QJCA 5LZ4A 5AVVA 1V1RB 3VVBA 1LS6A 1RI3A 1GLGA 5COQA 2ZJ1A 1FDSA 2AJCA 1QO7A 1R6XA 2J5KA 1XA4A 5CFQA 2ES4A 1C1XA 2H4ZA 3PUJA 4H0NA 4OREX 2G7MC 4RS3A 5AH0A 2XZDA 4GXQA 5J5AA 5LMCA 3AFGA 4WCFB 5LMZA 4B33A 4AIIA 4BE4A 3RI3A 1JA0A 3E1GA 2H2HA 1JH9A 4BRWA 1NVMB 3NHSA 3JQEA 4HFRA 1B6TA 3EGIA 1P4JA 2JJYA 5DWQA 5HGXA 3Q40A 4ND2A 1EUCA 1R9NA 2B78A 1EAMA 2OCLA 3PXAA 1GU1A 2YWGA 3Q5DA 5JMPA 2OHOA 5F5NA 1DWPA 1DMRA 3VNUA 1B8PA 1HT3A 2KX7A 3QYJA 3U7GA 1UIRA 3KTOA 1ZL0A 2DFKB 2ZWAA 2IC5A 4W9RA 2GT1A 1FYXA 3IRVA 4BO0A 2DLDA 3SN6A 3WAJA 3FBWA 2O8BA 1IZYA 3RYFB 1YFLA 3HUUA 3T3EA 2IYSA 2LUOA 4PO9A 3NHBA 2B4YA 2JZOA 1PU2A 2PT5A 1XXHB 2W6MA 1O89A 1H8ED 4GE0A 1HDCA 1VJ0A 3AKEA 5F21A 5C8XA 5BYBA 3AVYA 2J9ZB 4OQEA 5COAA 1A9OA 1E7SA 4G5FA 3E0XA 4MVJP 5BW6B 4EG7A 3OQ6A 2ZRFA 3W5AA 2PJZA 4XIGS 5CX1B 1V7CA 1FTGA 1FP6A 4MP8A 3NKLA 2HF7A 2QLFA 4IP0A 4M49A 1MO3A 3U31A 5A4IS 3IA2A 3JAWA 1TVCA 1SAYA 4IG9A 2IYPA 4QWWA 3D0OA 2ATIA 5B1IA 5JANA 2ECQA 4FLFA 1BROA 1LPNA 1XE3A 3CPEA 5EWJB 4Q7JB 4MIYA 2VRCD 3CRNA 2YHAA 4CF5A 4Y2YA 1IXZA 4FHFA 3SJZA 4EEKA 2VHJA 1G8SA 4M2LA 3O3NB 3AEYA 3B53X 3O2SB 5L8VA 1KERA 3MSXA 4ZQCB 1GFSA 3Q9NA 2UVPA 3MTAA 4YCBA 2HEIA 3KETA 1FFGA 4YDHB 2ZE5A 2WAAA 3AKCA 1ZPDA 5JS7A 3UT5A 3HZOA 2AN5A 4IICA 4GZ6A 1TKBA 3UAWA 2DB3A 2BCGY 4IY1A 1X9HA 3INTA 1II9A 4M22A 2J4FA 4PNZA 4IXMA 1C1DB 3G9TA 5C37A 5KDDA 5I9IA 3CSSA 1W5EA 2R5WA 3O93A 3ST7A 5IABA 3CVUA 3UWMA 1DOZA 1DLIA 2NYUA 2Q3EA 4QGFA 5EIAA 1E5XA 1SVLA 3KPUA 3BH7A 1R6VA 2VPYA 4RH1A 5HK8A 3IOBA 2D2EA 2E5WA 2FWMX 2ZSEA 2E2WA 2WNSA 1W2HA 1C14A 2VXCA 5BQXA 4A2PA 2JBWA 3V8QA 4PGGA 1FFXB 5T4BA 5JPIA 1O87A 5KNBH 4OYRA 2RBEA 3A2LA 2JGJA 3R7DA 3TSOA 3RR2A 1X8JA 2R48A 4FZRA 4C7BA 2WV7A 2O8DA 1TECE 4RF5A 3OTHA 3WG9A 5IN5A 1QQAA 3HI4A 1GU0A 1M1UA 3E2IA 2AFVA 1OGJA 1OYOA 2UYHA 3PE3A 1COWA 4AM8A 4JK3A 5HUHA 2EGHA 2ZPUA 3NMUF 5AHKA 2DBRA 2B94A 3BD6A 3QPBA 4NVRA 1BCSB 2G77B 3FPHA 4TMTA 1NM5C 2QE6A 5DM1A 1AKQA 2YS7A 5KOJA 4R3NA 4RZ2A 2G72A 4RSHA 4NBUA 2R5FA 4D7AA 2GBLA 4E4RA 1RKVA 2D5BA 3QYPA 2GAAA 1Z5PA 2EV9A 3H1TA 3EGEA 1QYCA 2XECA 5E1OA 5EINA 3TG2A 4GGOA 1ST3A 2IXDA 1RWXA 3COZA 5E9WA 1QQ7A 5IJAA 1XG5A 4XD7A 4EG5A 2DWQA 2ZB8A 3EOAI 3L7OA 2IPOA 4WBNB 1RC8A 2FOLA 1TE2A 2BMVA 2XNSA 3K0CA 2VXYA 1RADA 1RBZA 3VR3A 4MYSA 3UG7A 3HYSA 3PG5A 5LA6B 4FD3A 3G2KA 1G0OA 2XUOA 1MQSA 4BZXA 1FYEA 1TL7C 3CH7A 4JDPA 2G4LA 1DRJA 3ICWA 5BPHA 1G1MA 4ITVA 4XFKA 3AU8A 3BWCA 2ET6A 3NB0A 3Q3VA 1SXJB 2EKPA 1DRWA 1QV7A 4JLUA 3TUJC 1VBMA 2H3HA 1CQWA 4MQ4A 3KSRA 4FZ5A 1HOTA 2PG3A 1DJOA 1EWRA 3ZH2A 1W5FA 2XCSB 1Q0SA 3OD5A 3JPWA 1MC8A 4TKLA 4MVWA 1E96A 4OJNA 5F2NA 1Z0FA 1TO6A 2OBNA 3QWAA 1R10A 2OPHA 1XTZA 2EAUA 1J1ZA 2G8LA 3MRSA 3ONEA 1TK9A 1PCXA 2GTHA 3C7TA 2ACKA 3CMCO 4ND8A 1U9ZA 1DXYA 2W83A 4QBKA 3CWQA 1JPJA 4WZBA 5EGNA 1J9ZA 2D0OB 3GOQA 3QTTA 4KJXA 1DZIA 3AHCA 2ZRAA 4QVGA 5EE0A 1CBUA 1YL7A 3NETA 5GAJA 4EHHA 1BMQA 1EK5A 1TRKA 4RY8A 4U7GA 1XJWA 3CIOA 4FQ8A 3O3CA 4LNAA 4B3RB 1RBYA 2OE2A 2R8YA 4GL4A 3EPLA 1WU8A 2O2XA 2XOKA 4MJ7A 1KH3A 4NECA 3JQAA 1L2TA 4DV3B 1ENYA 1SD1A 4G24A 4FEGA 4LK3A 3E48A 4NYIR 2XMGA 1CUFA 1BXKA 1ZQ1A 3GI1A 3EVTA 1U0TA 3QZUA 2JPDA 4YI5A 1Y6JA 4TT3A 1RZRA 4UE3S 5FTNA 4EQ6A 2PKRA 3GQBA 5C51B 3G8CA 3QEAZ 4AWXA 4P0TA 3RFVA 4GZLA 4JJAA 3RVNA 1KMHB 1XWFA 1GL7A 3C6KA 1FVHA 2N46A 2QTGA 2X13A 3FVRA 3PF9A 4JC5A 3TOVA 5CT9A 5K8VA 5D7BA 2Z0MA 2FN7A 4HQNA 2NN3C 1EP2B 1LCIA 3H19A 4NAVA 3ZU3A 3O83A 1E7WA 3LXMA 4D92A 2Q3HA 4ENRA 1W96A 3UM9A 2HZ7A 3TL2A 1XYYA 3GAAA 1CZKA 2A0XA 2X2OA 5HF5A 2C3OA 3AF5A 3HH8A 5JMWA 5EA2A 1C5KA 3DDWA 2I3ZA 3V8NA 3OUTA 2GBFA 4K03A 4ISBA 2RI1A 1GDTA 3DGEC 1ESDA 2EATA 3GJ3A 4COKA 2CNOA 1FDTA 3DZFA 4N18A 5DGDA 4BQOA 3VKHA 2GZDA 1Z73A 4MR7B 5EPOA 4C7OB 2RGNC 4QYWA 3EXG1 3JQDA 4I1SA 4AO7A 3UJBA 4OI0A 1DEOA 4F91B 1UJ6A 2YIJA 1VI2A 1ORIA 3AUAA 1DOAA 1Z22A 4NMLA 4PZZA 4ALNA 4AJIA 1IDOA 3QUSA 4JB8A 3A58B 1EK2A 4DMUB 4P8RA 2MYPA 4MV9A 4EATA 2O8EA 2Z9BA 1NRXA 1OASA 1N2SA 3DM5A 2I99A 1H1LA 3NBQA 3T15A 5EHNA 4RTPA 3ZDBA 4TWAA 4E7PA 1O6FA 2CY0A 3AEZA 1UC4B 3FRIA 1G4AE 4HR7A 1VLZA 3F7TA 1Y1KE 3V42A 4J3NA 4FWBA 3K70B 2CJYA 4L78A 2ZT6A 1UOEA 3CH6A 2ABWA 3ZHQA 3EGDB 1WW3A 3C41J 1FMFA 2I4TA 1GCGA 1J9EA 5EMKA 1C3OB 2O50A 4Q00A 3PE6A 4GKBA 3LBAA 3WNDA 2XAUA 1PFQA 2ODEA 2YY5A 4NPHA 3RARA 5KJ6A 2XDYA 4FFSA 1AV7A 3CGWA 3GYGA 3O95A 4LTDA 3AR5A 4Y9TA 1ZVVA 4ZKDA 5B1YA 3HR7A 4NCIA 1NULA 1WXDA 4PE5B 4BFUA 2JJ8A 5D1HA 1BRTA 2NT3A 4ZIRB 3SFTA 5TMBA 4N3CA 2XT6A 1EFAA 5DRYA 1SRRA 3R3JA 3ZNQA 4BO7A 5KYWB 1XVVA 3TFQA 3GH1A 2XNDD 1KFJB 3TZLA 4XDHA 2PV0A 1VGVA 3KSZO 3WXMA 4D4LA 2H16A 3INNA 3RKRA 1NVTA 1Y6QA 4R2XA 4R9NA 3WVNA 1EBUA 4QYIB 4M9ZA 4RH0A 4N39A 5MN5A 1E3EA 3Q8LA 3WYBA 1GTSA 1J39A 3OT1B 3VR5H 5BVGA 1SB9A 3DQQA 2X0EA 3UJAA 4AY6A 2A3RA 4KTTE 4BO2A 4E6EA 1T0BA 5FH9A 1YS7A 1NNSA 1V16A 4RM2A 3HN7A 4NZZA 4X45A 3M0EA 4AYTA 4RFSB 3ELDA 1RRFA 1KTVA 1X1CA 1G60A 3FYUB 3PUXA 2EZUA 5E4JA 3UKOA 5BOSA 1CYEA 5FTKA 3MW8A 3UYLA 1IN5A 1NSTA 1ECGA 4PYLA 3MERA 1E9VA 5K6AC 3LRXA 1UMCA 4RE5A 5KQLA 1ZLXA 1RQ7A 1QV9A 1GOTA 1YQUA 3L7MA 4MO9A 2X86A 2CYBA 1EVQA 3N8HA 4PBSA 2NLOA 2X2FA 4OL0A 4YRZA 1TMYA 2REQB 5J4YA 1DE0A 4N1AA 3T4EA 4CFYA 5JH7B 1MXHA 1LI4A 1ZOPA 1A82A 1EXNA 4Q1FA 5FFMA 3T3MB 3V7YA 1M2FA 1KAEA 4A6XA 1U4OA 3BRWA 4C3ZA 3RBAA 2F43A 4DGSA 5HJ5A 1EDOA 1MG0A 1HZJA 4PXAA 1EFTA 3DAHA 1XMVA 4TWIA 1QHHB 5JISA 4LECA 1Z9BA 3OEWA 2EFYA 4O1MA 2CLIB 3ZZTA 2FHPA 2IBMA 3UB2A 2ZM5A 3BT7A 2PZLA 1REQB 2G6BA 1JP7A 2RGEA 4ND8B 4RLQA 4ANFA 1E9CA 3KVYA 1AKNA 3RCBA 3M5WA 3MLEA 3TM4A 2R4QA 1KARA 1QH1B 4V0LA 3ZWYA 4YRAA 1DPGA 1XQ1A 3O2NA 3H9UA 3Q0TA 4YALA 1NTOA 2HMWA 5T8KA 4ZTBA 4M8IA 5I47A 2DFDA 4G1MB 3WAKA 2OQIA 1Q20A 2L82A 1U1EA 1DJNA 2NYAA 1LPSA 1H66A 1M33A 1RQ2A 3UK6A 4BBPA 2P9HA 3WNQA 3VHLB 1GARA 2Y6UA 1KJWA 1LVHA 3SEQA 3D2CA 2ZPAA 1M10A 3L7JA 2YUIA 1M74A 4ZOBA 1IEVA 2BFDB 2HGSA 2ZJ4A 1BEUB 1MVOA 1NFRA 3GRCA 4B09A 1WZ2A 1KI7A 1TB4A 3JYNA 4P86A 3WZ2A 2FMHA 4AS1A 1Z2OX 3D7MA 3R4CA 1CR6A 2FOXA 3GRKA 2AVDA 1TCUA 3QBDA 4R0NA 1X1QA 5F4ZA 4XYBA 1ZR4A 3HDGA 4PM4A 2XNJA 1XU4A 4WOKA 4NRDA 4OQNA 5U4QA 1PRYA 3PRJA 3DAYA 3PXDA 4I46A 4HZGA 4QYSA 4YMVA 1UBUS 1E18A 1AXGA 2QLTA 4TKZA 1X1AA 2Q6OA 2XD9A 2JANA 3CKMA 1Q15A 2V7VA 3BFXA 5IK2A 3RRFA 2HQSA 4KJZA 1ZY2A 4MW1A 4XVRA 4V1CI 4Y2QA 1NR7A 2EIHA 1MC4A 3A36A 1BMDA 1IRXA 1YKFA 1IHYA 1OBOA 2I55A 4A6DA 2HCRA 4J4TA 1KY2A 1RU3A 1VA5A 1AZTA 2I6XA 3JQBA 3T61A 5L4SA 2G04A 1M2OA 4TMFA 3PUVA 3PXEA 4EMTA 5FTMA 1YRQA 4Q7KA 3W79A 3M34A 1QR2A 1I7DA 2VBCA 1CZLA 5B5SA 4V1CB 1V1MA 4P35A 2FZWA 4AB1A 2RK3A 3I04A 4NICA 4QBTA 4R2HA 5CYGA 2J9YB 4OXRA 3WKBA 4B48A 4NBRA 3PC4A 4ZC1A 5DTJA 4MKGA 3C4QA 3NAQA 3AEXA 3HB1A 2R8EA 2XJ9A 2FXIA 4ZI2A 3S8EA 1L5MA 2FP3A 1KJIA 5AJUA 1I33A 5EHXA 4HWSA 2BFFB 3IAUA 3QE3A 5LR6A 4QG3A 2HTEA 1YMQA 2CUZA 4P32A 2HF9A 2LVBA 3G7UA 4BU1A 4B4UA 3P26A 2AMYA 3RNOA 3VSCA 4XQ0A 3SE0A 3PA6A 3UK1A 2A92A 3SKVA 1N78A 1SH7A 3NJ8A 4C6SA 1IL0A 4J49A 3U13A 3K5HA 1S6YA 5GMOA 4BIMA 2ZI4A 4EWLA 3BJMA 1XTKA 1KEEA 3AVQA 4O5AA 3CR8A 4PF1A 3HGQA 3NOOA 1LW7A 4R6WA 4WTOA 3TOCA 2IXFA 2OXEA 2ZBGA 3O47A 2TMKA 5C7YA 4K0KB 1O95C 2C04A 1KMCA 1ZCBA 4KX5A 4ZAXA 2RGAA 1USKA 1E2KA 2YHIA 3TBHA 4BVJA 1K4MA 4FJ0A 4RVOA 1XDGA 4UFNA 1KRHA 2VATA 3K0AB 1JBEA 1JMYA 2P27A 4XZ3A 2OENG 1E2GA 2ZM6B 2QRZA 3UWPA 4GZ5A 4MGZR 3WB1A 5JZ9A 2NW6A 1WZCA 3ZHYA 1DTWB 5BNWA 2O54A 1TUEA 3EZ2A 2CVZA 4MVYA 2JIMA 4EDHA 3LX5A 2UZIR 3IAEA 2ZDQA 4PZ9A 1NOKA 1H8HD 4Q7EA 2CMFA 3RYHA 1DADA 4DQUA 4FFWA 5DNCA 3BDVA 3K4QA 2WP0A 1CEYA 3HUFA 4YJHA 1XSEA 3LYLA 3FTFA 2J0UA 1V5EA 3DOEA 4CV0A 5JDCC 2R8RA 2JIRA 2FN9A 4QDXA 3OQBA 3ROQA 3U3RA 1RNLA 4W9NA 1G8JA 3OOHA 1U0EA 4P83A 2W4IA 1FDRA 2ID7A 3EIUA 4B3IA 5JZBA 1MRNA 3HO1A 3ZEAA 2X76A 1G4HA 4FDMA 2ZUTA 1XROA 1W1IA 5NLLA 4PY2A 5BSEA 3O5AA 2WU1A 4JH0A 1PHPA 1J21A 2P0AA 3GUZA 4AZSA 1ZK1A 2YRXA 5JTUA 1AZLA 4NZ9A 1ODTC 3BWBA 3ON5A 1NN0A 3PC2A 5EZSA 3VSAA 4C22A 4XPIA 4CM6A 5HEKA 4KE9A 2GK6A 2V9PA 3PHCA 4BGEA 5F1PA 4QQKA 3WJ2A 3MT0A 2OMKA 4Q02A 1Z38A 3E23A 4IFTA 5SZIA 1YMVA 4Y8VA 2LD4A 4DNPA 4KITB 1NMZA 4F5DA 1L0BA 2CW5A 4E7OA 4DLLA 4IIGA 4QE3A 3JQ7A 4A2CA 1KOLA 4AL4A 1K3UB 2DVMA 2P78A 3WHPA 4CM4A 1E6CA 5HUQA 4G89A 1XZMA 3H2JA 1PDOA 4EPRA 1Z6XA 2P2YA 3Q7SA 1F9AA 5E8RA 3FMIA 1VECA 2JB9A 4H0CA 4TTPA 4YY3B 1W5AA 4JGBA 3UANA 1YE8A 4G85A 1DLJA 2PUVA 2APJA 5BSWA 4A16A 2RC6A 3QMVA 4YBRA 1RE0A 2DJIA 1T9KA 3L01A 4RESA 3IQGX 4B4VA 4TLMB 2W42A 1TO1E 5CB8A 2GASA 1HNNA 2O7RA 1M2KA 2ZE7A 4IDNA 5AVKA 1V6SA 1A2KC 5LDGA 4OHYA 1WCXA 4X00A 1YBMA 2QTCA 3CR7A 3F4LA 1C7RA 1IRIA 1DKMA 4MCJA 3WIVA 2IOQA 4QULA 4QGHA 3Q7TA 5SZJA 4B3GA 3AFIA 2I87A 3RVPA 2GPJA 3SJ7A 3AXTA 4N6GA 4JT4A 2WAYA 4I6EA 2F3PA 2IXGA 4FMBB 4G3XA 5JNTA 4O4HF 2NUTB 4TL9A 2IEBA 2QMZA 1T1EA 3ISJA 3F3SA 5BQ5A 2IQ5A 3U0BA 4A82A 1QE3A 1YJAA 1KOFA 3QFSA 4NBVA 4ENPA 5JIBA 2RE8A 1H6CA 2J46A 1ADJA 3MS7A 1VJCA 1IOVA 3C0KA 2VO1A 3RSZA 4HLDA 4OB8A 5THXA 3M3PA 3NRBA 3U4QB 5FFNA 3GBPA 5CXXA 3ROFA 1Z8DA 1LBEA 5CXUA 1X38A 1L4GA 1BKYA 2AE2A 1UT5A 4PBRA 3CU5A 3TW0A 1YI1A 4AVYA 2BI4A 1A9ZA 3HZZA 3GLGE 3COVA 4PVDA 4WZAA 4HDRB 4TLDA 3T9EA 3ETHA 4L22A 3FLMA 3IHWA 5FULA 3QWIA 3KEOA 3RSOA 4F6RA 1UEIA 5CB4A 1LPMA 2QLMA 3LA8A 2QXYA 5A9TA 1RLTA 4DBZA 1LQ2A 4RGVA 4F8YA 4MK4A 1Z4NA 3KQPA 3BIOA 1QG4A 2EG9A 3CEPB 2D7JA 3W5SA 3IEMA 3NPAA 2IHVA 5AVQA 4WSOA 4OLHA 3KOYA 2PAFA 5CFNA 4F4DA 2VYVD 2SKEA 1LBHA 1S2MA 2IYQA 3HBMA 3PHGA 3RHSA 3RUFA 2AOXA 2WJVA 3HU3A 2DFNA 5LQAA 3G0HA 1LJ8A 2P2LA 1W9MA 4OMFG 2I4MA 2XWQA 2CLOB 3EZFA 1SD2A 5BSHA 5I48A 1ISIA 2KLHA 3RS9A 3KYDA 3RU9A 3WR5A 1YS9A 4BMYA 1SBIA 2VK8A 1NPYA 3TLGA 3U7QA 3WJ1A 4GP9A 4RPJA 4V3CA 4O25A 2ZJOA 5G41A 1P5FA 2OXFA 2WAOA 4OGLA 3G2MA 3ZG6A 5BYKA 3F6SA 3G8AA 3TECE 3ER8A 4BFYA 1ZGAA 1NUHA 2AHOA 1RRPA 2YZMA 2JLWA 1T1SA 1U5AA 1LV7A 2GJ9A 4NMHA 4UDXX 4OA8A 3L43A 4EG0A 5FI3A 4EMBA 3ZK7A 2JI7A 2B99A 1KGDA 3W90A 5KYNA 4PX3A 4AYWA 5IYZB 4Y1FA 3K0FB 1XTIA 3IP1A 1MTOA 4EJSC 5CA0A 4XVHA 5KWSA 1WP4A 1JILA 3M70A 4AP5A 3EULA 1MB9A 4H3HB 3ENNA 2C4WA 3PFHA 5DGIA 1FU7A 4P4TA 4YMIA 1VCNA 4Y6RA 3WQQA 1PTJA 2OV3A 2PKWA 3FSGD 2OV8A 2ACVA 4LCEA 1GNRA 1H4VB 1D03A 1PZHA 4DA8A 3E2MA 1BDJA 1M83A 3OM1A 4HQ6A 1E6LA 4Y2SA 2AW5A 1FTQA 1OC4A 1J8FA 4X62B 2HBRA 4AG3A 2OYRA 1NF2A 4QXRA 3T7SA 3Q2OA 4D56A 1KA9H 4LN1A 1R8JA 4JVMA 4CMAA 2BGNA 4JNCA 1PJLA 2ZJ6A 4BO6A 5KOYA 1A8IA 5KVAA 3RS0A 2BBSA 4RX1A 2CV2A 2JDIA 1WXXA 3D4LA 1UJNA 2V8BA 1SMKA 2HHJA 3AETB 5ALXA 2Q3MA 5EWMA 1XALA 2GUWA 4XX0A 5FPHA 1KVUA 5AVXA 2EJCA 1E92A 3PDCA 4EGJA 1N2CA 1XRJA 1RZRD 3A6GA 1PNVA 2IEAA 5AW1A 4MGIR 1GGHA 1YZGA 2HV8A 1PR9A 2CLSA 1EVEA 1PD0A 1W1WA 3AP1A 3C8ZA 3ID6C 1W2WB 1VLLA 4QGGA 4D80A 4EHFA 4RULA 4Z7NB 4C76A 1A8HA 2VT3A 3ZZ0A 1FIUA 4QGAA 2VK2A 3RT9A 3UHAA 1Q1QA 1FBNA 2CMGA 2P67A 3R9KA 3WFJA 4MNTA 4JLSA 1VA4A 2OK7A 2V6JA 3W6PA 4LXQA 4ZI5A 3G2QA 3O8OA 3FNFA 2A1UB 2VG8A 5K0ZA 4PXSA 2WB2A 3ESDA 4I55B 4J4HA 5SY4A 2B4RO 2AXEA 3BF7A 3AZQA 2BBOA 1JNXX 4G8JA 3LRTA 1ZR2A 5KNDD 4IWYA 4NCBA 1JIUA 3DE2X 1K0FA 4G1CA 1IHXA 4PYQA 4RPLA 1PLKA 1KR2A 4HAWA 3A9TA 1T5BA 1AA6A 2Y0CA 3M82A 5EE1A 3CVYA 1AUQA 3R24A 1IIBA 1J99A 1NRIA 2QQEA 3C97A 1FFCA 2AJTA 3MF4A 4M8SA 1RKXA 4OMUA 5EIWA 3UOGA 4BMVA 1RPNA 1XCLA 4DCMA 2AEFA 2ZUFA 1OH6A 2P2ZA 5CFMA 1AUVA 3EY9A 4A6PA 3B2QA 2AFIA 2P2DA 4ALMA 2BFOA 4U02A 1TUGA 3OEHA 1W87A 4IOKA 3PVZA 4QM6A 4B4WA 4YACA 3LJKA 1PE0A 2SICE 3ED5A 2Z6QA 3OFVA 1T3TA 1H23A 2C94A 4GMKA 4P4SA 1WIWA 4JBIA 2FPPB 3EGVA 3OU6A 2Q1UA 1SM4A 1P1KA 1DV1A 3U3ZA 2JCYA 1H2AS 4INPA 3ZJUA 1WKBA 1Q1ZA 1SKBA 2MMGA 5TMEA 3GFFA 1YZTA 5DBIA 4R2IA 4EENA 2BTQB 2F7SA 3PXGA 2C00A 2M2IA 4OHRA 3JRNA 2I2FA 3OIYA 4TZKA 2VF4X 4OOFA 3VZCA 3BTSA 4DG8A 4GC9A 1QYIA 3E35A 4CIVA 3TG8A 4GPD1 3R20A 3V1NA 2WB4A 2ZSUA 3USCS 1A77A 4Q9DA 5JS8A 2O3RA 3MTJA 4AJ2A 4A2WA 2Q4RA 3HNPA 5LQJA 3D1JA 3F2VA 4PTLA 4MUNA 1UMCB 1YBVA 3IHLA 5EN4A 4MRRA 3C74A 5EKTA 5C8ZA 4UBJA 5KSYA 2QPOA 1T3GA 3JQ6A 3L0IB 1DBWA 3AY6A 4U7TB 3COYA 1KFBB 5B1EA 4AJ4A 2QMEA 2YWXA 2P1ZA 1EX9A 2EQBA 3D2AA 1MG5A 4GYKA 3DWEX 3KOZA 3KQMA 3LBHA 2AK2A 5GM2A 2KS6A 1R37A 1CU1A 2DETA 2UAGA 2PMCA 3G13A 2ZAMA 3DP9A 2X5KO 3PHLA 4Y67A 5KYKA 1T9ZA 5LZ9A 2Q9BA 1WD5A 1DKLA 4F9TA 1TLFA 3G3EA 1HG0A 5HCUA 4BE9A 1ZCJA 4PLHA 3UJHA 4B5LA 1NN3A 5I7WA 4ZQGA 2AEMA 4JL6A 2PD6A 4R01A 1YR7A 2GN1A 5FL3A 1HE1C 1J8QA 2W2NA 3QYFA 4MV0A 3ZZUA 4EKIA 3U4MA 1EHYA 1I6WA 3BCUA 3IR6A 1DTSA 3G9XA 2CFIA 4I50A 2ZRPA 1E7RA 3BEOA 1NXWA 4XI9A 1O94C 1T4GA 5KAPA 3R6GA 2VNJA 5LNK1 3AEUA 3FGPA 5A1JA 3C3JA 1AKMA 3IUNA 5F7JA 1O9GA 3DXZA 4ZJPA 1JN0A 3QSYA 1Y8AA 1FDIA 1Q7GA 5I9TA 5BORA 2VF2A 4PWZA 1Y37A 1HR0B 2G9RA 1VYVA 2O57A 1JLLA 3QIVA 5KCMA 4E5KA 3R77A 5AKXA 4DA4A 4L07A 2XKKA 5CRIA 1WE2A 3ANMA 3DDCA 5KTMA 1OH7A 3PGJA 4E31A 4F3YA 5K3OA 3IP3A 3FCXA 4BV9A 2PZGA 5EJ5A 2OXCA 1XFAA 4I2NA 1WB4A 2PBZA 5GJVC 4GI1A 3VOTA 2GCOB 5LLDA 1OPRA 1E3SA 4LA4A 4QUGA 4R8MA 1BDHA 1F60A 1YS4A 3NYRA 1NL3A 2NZ2A 1EUDA 4C29A 5CB4F 2DLNA 1GZUA 1VFNA 1P9OA 1XMSA 5LCXA 1VP3A 5IMBA 3K1YA 1OXVA 4DSOA 2VJBA 5EQTA 3G5UA 2XOXA 4PSAA 3UUGA 3GEGA 1TF5A 1WXHA 4CEJB 1HYQA 3O2QB 4O8CA 2VWHA 3LW8A 3QVKA 4NAUA 4KR3A 1Q14A 1KI9A 3OEED 3OZXA 3ZV5A 4M87A 1KQGA 5G0UA 2I33A 2NYVA 4WXHA 4D0NA 4QDZA 2BBWA 3MWEA 1CUWA 3NT2A 4GFDA 5JQGA 2H1LA 3WHIA 1P2UA 2XYHA 3TTWA 4BEVA 4GX5A 4QYMA 3ZI4A 2Q5EA 2NXWA 1HL3A 1ECFA 2CL6X 1T1JA 3AGQA 3I58A 3PCRB 2B82A 4UMEA 2KJQA 5H5JA 2B0CA 2VJPA 3OFKA 5A4JA 3P9PA 3A9RA 1QK5A 1T5LA 3R74A 1LLUA 2XXJA 4B7XA 5DNEA 5EJ7A 3N3AC 3QBTA 3K92A 1PV2A 2AC7A 4WNYA 1S1CA 1QIKA 4LRYA