2ZIAA

C4s dck variant of dck in complex with cladribine+udp
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
241
structure length
220
Chain Sequence
RIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNVGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Deoxycytidine kinase
publication title Elucidation of different binding modes of purine nucleosides to human deoxycytidine kinase
pubmed doi rcsb
source organism Homo sapiens
total genus 87
structure length 220
sequence length 241
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2008-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ziaA00
3FVQA 4Q7MB 1VTKA 1YZLA 1JPNA 4NDZA 2NO0A 4W5HA 2Z4SA 1CBUA 5FOTA 5C18A 2EW1A 4B73A 1G64A 3A1WA 2N46A 4B3XA 1OFUX 2J0UB 1CIPA 2WTUA 3T1TA 1BS1A 3JVVA 4MDFA 3QNUA 3WBKA 1MO5A 1S4QA 3RWMB 1Z8FA 4HI0E 3IIJA 4KSBA 3U6BA 3B7GA 3L0OA 1Q1ZA 1NIPA 1T3HA 1EWRA 3AUYA 1OH8A 1Z2CA 5EXTA 4DLSA 1G3MA 1N2CE 2J87A 3AKDA 3RRMA 2GEUA 2ZRMA 3VKHA 2FNAA 3ZH9B 1NMXA 3I3SR 4TLCA 4NPHA 1RPZA 1G8FA 1DELA 1E98A 3GJ8A 3A37A 3BB3A 2JJ2D 5FTNA 1L4YA 2P67A 2FU5C 1X86B 2GETA 1GM5A 3LV8A 2WWXA 4LHWA 1KK1A 1YHNA 2IYUA 5G41A 1R0WA 1MR3F 3U7FB 4Z51A 1F5NA 1G3RA 1KIMA 4C7OB 1HY3A 5KU1A 5IF9A 1COWA 2SHKA 3ECCA 4NYMR 3I92A 1U9IA 4RD1A 3SR0A 2FZLA 2G83A 1P4SA 3TVTA 2GBLA 2JIZA 4HLCA 5EE3A 4A0FA 1E9RA 2HEIA 1X1SA 4IVRA 1OKKD 2ZRAA 1U0LA 4LX0A 2CCJA 2A30A 3THWA 2ZU6A 1G18A 2WWIA 4XH9B 3GP8A 1SVKA 2R6DA 5HE9A 4N3NA 4ZDKA 1YJ5A 2WSSD 2WM9B 4DVGA 1P2VA 4IDNA 1N6RA 1L8QA 1U8ZA 3W8RA 1Z83A 3QUSA 3DMDA 3VR1A 3FTQA 2I1QA 2ZRFA 3BWDD 1D2NA 3I1FA 3CX6A 4FCWA 1RYHA 2OSBA 4DSUA 2ECKA 5J4LA 2CHGA 2V7QD 4TMXA 1JXMA 1L2TA 2VEDA 3RVBA 5CM8B 4ACAA 2JLUA 4UKDA 2IYVA 4QL3A 4RY2A 3T1VA 3QKRA 4RZXA 2J7PA 1CRPA 1FZQA 4R71A 4JT2A 4PC3A 1KO1A 5BN5A 2ZJAA 3K9HA 4I1OA 3NHBA 1S3GA 1T8TA 4NCHA 4QGFA 3TAUA 2OHFA 2P0EA 2WJIA 1G8GA 3B9QA 3QF4A 4OHYA 2CVFA 2JLYA 2QROA 1EFHA 1Q12A 1Z06A 3CX7A 5CDFE 1QDEA 2Q21A 4NYJQ 2VF7A 3TSWA 4ZCLA 1D2EA 1JR3A 5TMPA 2VP4A 1TAGA 5FFMA 3WP1B 3N70A 1N6IA 2Q3FA 5L3QB 1OHHD 3TQFA 3U7HB 2KE5A 5BN4A 5GVSA 4XSGA 2HF9A 1AGPA 1Q1QA 4DSOA 3ZD7A 1N0UA 4LDJA 4C2TA 4FCVA 3AVXA 3LQRA 1DAKA 2O8DA 1MABA 4K81B 3C14C 1KSFX 3THYA 3K9NA 4M22A 3EC1A 3H86A 4L5BA 3SJCA 4QGGA 5GVRA 4CYMA 1KI9A 2ZYVX 3NDPA 5B57C 1VG9B 5BXQC 3BIFA 2O8BB 1M34E 3TR5A 1OB2A 4UNNA 4BFZA 4B71A 2IS4A 1FTSA 2HUPA 1KAGA 5DH9A 1IONA 3TR0A 4PO9A 5KPJA 4ITRC 2C99A 3QENA 5FI0B 5CK4A 2ZREA 4EIWA 2J0QA 1ELOA 4KO8A 5JCPA 1Q20A 2OT3B 1KKMA 4B47A 1E2JA 4RD3A 4TYPA 1VMAA 2FJUA 2QM8A 1KMHA 4NTZA 4M21A 4B3GA 3QKSA 4GI7A 3U61B 4EPTA 2HXYA 4EUNA 4US1R 4GOJA 1UKEA 2QM7A 1AKYA 1M6NA 2IT1A 3C8UA 1E9SA 3DM5A 1SKQA 1OB5A 3NBXX 3IEVA 3QG1A 4AI6A 1RZ3A 3VR6A 4A92A 1NY5A 1XTSA 4JKYA 2Z6VA 1FW6A 3QBTA 3ZQJA 4KCGA 5HE8A 3RHFA 1JNYA 821PA 3GFTA 1KZ7B 1E2PA 2JLQA 4MITA 3NG1A 2IS2A 2G1JA 2R6AA 1P7CA 4HAWA 3I5YA 4M1SA 2ZM5A 4XD7D 1E2EA 2ZSBA 2FSFA 3IO3A 3MLEA 2IK8A 2OFWA 4GDFA 2IXEA 4EPXA 2QTVB 3ICQB 1OFTA 1V43A 3TRFA 4TMKA 4FN5A 3GLHA 2O0KA 3H4MA 5FUYA 5KSZA 4XOIA 2O8EB 1OW3B 3MGCA 1LW7A 1AS3A 1J8MF 3ND8A 4ON9A 4XVUA 1ZC3A 2WOJA 3B85A 2GF9A 1FMLA 4PC7A 4ZV4A 3GJ6A 3ONWA 4Q01A 4RFSB 3L8ZA 3SDZA 3OEED 4TL8A 4ARZB 4DWJA 1DADA 2GJAA 3B13B 4DLZA 1N6NA 5FOVA 1LVGA 1WQ1R 2QMEA 4TLBA 1G17A 5FUWA 4JJKA 2ZVPX 3CF0A 3KKMA 4KAXA 4N0EA 4WVFA 5FTKA 1E4VA 1YR9A 1XJ0A 1CJVC 2HYIC 3THXA 4QGHA 1P9WA 1D6JA 5D3MB 4A2WA 4ZIRA 4NYMQ 4JT4A 4PC6A 4MYUA 2D2EA 2UKDA 5KTYA 1WMSA 4DBLC 2J45A 1M8PA 4PSVA 1G8HA 1GDDA 1P75A 3LO5A 1EFUA 1N3BA 1OPXA 4KHZA 3SE0A 1W2GA 4O0MA 5CK5A 3GLFA 2QMOA 4BFUA 1FX0A 1Z3IX 5FBRB 1YQTA 4N0DA 3BOSA 4MQBA 4PQFA 2K5UA 2QRZA 5EZ5A 1MH1A 2OO7A 2VHJA 3IHLA 2F1JA 4N1AA 2PMKA 3IPXA 2J5XA 4PFSA 4I99A 5J4YA 1ZCAA 4A9AA 1ZCBA 5HZKA 1KY2A 2QSYA 4ESVA 1X6VA 4V0ME 3GJ4A 4PO8A 1XB2A 4JSTA 2Q9AA 2X8AA 2VHTA 4Q03A 4DIDA 2NO7A 2VTKA 1X8LA 3AGQA 2ZETA 4TZ0A 3VFDA 1NF3A 3SHWA 3KB2A 5DGXA 1NVVR 4BRWA 3WNBA 1TX4B 2H92A 2VF8A 4IHQA 4BZPA 4AKIA 1IM2A 2P5TB 4NYIR 1YZTA 5FUXA 1ZUIA 2NO6A 4ZCIA 2GILA 4WBSA 4GSYA 1R5BA 4MKIA 3R7WB 3U4QB 4ZKEA 4CIDA 2EWWA 4IOMA 1G1MA 3ZQ6A 3SYLA 3OFND 2WPDA 1N6LA 4JBYA 5A5GA 1W4BA 2GXQA 1KKLA 4LGMA 2ZI7A 2ZI4A 4P4SB 3HDTA 2WKQA 1E1QD 3AM1A 4BLQA 4G01B 1E6CA 1HH4A 2NO9A 4B76A 1YVDA 1XCPA 4PHFA 1NJFA 1II8B 2A78A 1F2TA 2XNSA 3C7KA 2HXSA 1W2HA 4TLAA 4PPNA 3KKQA 2YOHA 2QUZA 4Q66C 2GCOA 1UEIA 1ZU4A 1P62B 5DSZA 1P6XA 1E2IA 3UMFA 2XZOA 1KDOA 2CLSA 4B44A 2IF0A 4R7ZA 2O8CB 5KSYA 5SZIA 1KK2A 2VSFA 3SJBA 4OK3A 8OHMA 3NH6A 4QBGB 4UXHA 5DYIA 4BFTA 5EUMA 4TLEA 2IUSA 3NEYA 1ETUA 1XCGB 4KVAA 3I62A 1W36D 1S0UA 1UBCA 2JLRA 3SJZA 1F60A 3PITA 4GBMA 3SQWA 1FUKA 4LSGA 1SXJD 4A2QA 1HQYE 4AKGA 3PUYA 1K6MA 3UG6A 421PA 2IL1A 3NC1C 4KBFA 1D2MA 1IXSB 4M1YA 1XTQA 2J9RA 5KO2A 3Q9LA 1R8SA 3TW4A 1E1RA 1N0VC 1R5OA 3TKLA 3T5GA 1R5NA 3L0IB 1KDRA 2J46A 3PUXA 4LJ4A 3IILA 1UADA 2OCYC 1UAAA 1QG2A 1II9A 1G4AE 4URZR 1ZNWA 4US0R 2BJVA 3EZ7A 2D4HA 3WNDA 4Q02A 3IQXA 2Q9CA 4NP6A 4XTCS 2NZ8A 2Z0MA 1ZD1A 5FR2A 2IA5A 3NBYC 3RS0A 4LUCA 1Z47A 1ZW6A 1TL7C 1W7AA 3WP0A 1R4AA 2Z4RA 4L15A 2HYDA 1E96A 1G5PA 1NN0A 4Q9IA 2QZ4A 1ZAKA 1GUAA 1B0UA 3QF7A 5CDFA 4M1MA 1NN5A 3EAQA 2R2AA 1XZPA 2PZFA 4QKQA 2ZJ8A 1E94E 2MSCB 1SHZA 4TSFD 5L8VA 3O8CA 4BZXA 2ANBA 2YC2C 3U7GA 1DAIA 5DI3A 3C15C 1H8EA 2QEQA 1AS2A 1AN0A 2QGNA 3KJIA 1W4RA 5AWFC 2ZANA 3THOA 2D7DA 1XZQA 3O8DA 5JHGB 1LNZA 2H17A 2HJGA 3RAPR 4DRZA 3KJEA 3IBGA 1VCIA 3REFA 3KXIA 2X19A 5JFGA 4IVQA 2YOFA 3GPLA 5CB6A 2ZXUA 5AJXA 1XFAA 3C5HA 3U7EB 1Z0JA 4ZO4A 1G41A 2ZITA 1MO6A 4LJ6A 1SULA 2CE7A 3UKDA 1XTRA 4D0GA 5GJVC 1KJYA 3DZDA 4HSEA 3W5JA 2OE2A 3D31A 4NONA 5K8LA 4S2EA 3ZIAD 4EFLA 3AF1A 3G0HA 1P9NA 3PEYA 1XDBA 4L9WA 3UMSA 2ORWA 1OH6A 4DCUA 2W6ID 3H1TA 2GJKA 2JJ1D 2ASEA 4BLOA 5GADl 2ZTSA 3GEHA 5JBQA 5F9HA 2I4IA 2OLKA 2R9VA 3TJZA 3FE2A 4FMCF 4EFNA 4BASA 5AJWA 3ADCA 1W47A 1E2QA 2GAOA 2OFXA 2RHDA 1PJRA 4CT4B 2IYRA 2C96A 5IRCD 2D3WA 3CW2A 2J59A 3GJ0A 2ZJBA 1A1VA 3ZVMA 1MKYA 2I1VB 5G3ZA 2XTZA 4RD2A 3TQCA 4FXPA 3O47A 2OXRA 3P1JA 1XWIA 3VQTA 5BYJA 1NVVQ 2FOLA 2C95A 3K0CA 4G5GA 4FMDF 4Q48A 2BMJA 4NYIQ 3FOZA 1NY6A 1X1RA 3MWYW 4JVNA 2XX3A 1AQUA 2ZRLA 2CLCX 2A5GA 2YV5A 5D3MA 4YMUA 5AJVB 1LF0A 3K53A 4ERNA 2FN4A 3LX8A 1NL3A 3QKRB 4B3FX 4CEJA 1UFQA 1E69A 3SZRA 3R20A 3U6KA 4LBVA 2P6UA 3DDCA 3SEAA 4BFSA 1KO8A 1CJTC 2DB3A 1ZM9A 2QTFA 3QF4B 4OJQA 3ZD6A 2C9OA 3U44A 3CNLA 1ZNYA 4US2R 1Z08A 2PX0A 2QPOA 2PJRA 3L82B 4QFMA 2IHYA 4RVCA 3VHLB 1N25A 4B33A 4OQNA 1DARA 3R9IA 2IYXA 1JXOA 1VECA 3EG5A 1F48A 4HZUB 1T0JB 4BRUA 4JZKA 1OSNA 4TL7A 1R0XA 1W44A 3RC8A 3Q7PA 4KXFB 1LTQA 1H65A 1MABB 3EC2A 2F7SA 4MRRA 1W0KD 1DPFA 3PUWA 1J2JA 4LOAA 3IIKA 1XXHB 2FFHA 4AWXA 4BZQA 3THYB 1CULC 4XJXA 5DN6D 2VQSA 2XOKD 2IX3A 2WHXA 4ZDJA 2BMFA 4NCNA 5H8WA 1IJEA 3B1YA 4RZ2A 1TTTA 4LHVA 2ATVA 2XSZD 5FTJA 4EQ6B 2WJGA 2F3TA 3EZFA 2BMDA 3CRMA 3AP1A 2CL0X 3MCAA 4P4SA 2DWPA 3GEEA 2F1HA 4MDEA 3A6PC 1F2UA 5JI3E 3QVUA 2OBLA 1XD2A 5KYKA 2OUKA 1NN1A 3PG5A 1II8A 2QPTA 3DEFA 4P4TA 5C46F 4GOKA 4JLPA 1E9CA 2QE7D 2ZE6A 1E2FA 4MH0R 1EXMA 3QKSB 1ONBA 1R7RA 2YWGA 3SHFA 4DUGA 2HLDA 3MFYA 3QOFA 1KJWA 4EPVA 3M4YA 4CRWB 1NN3A 2JLSA 4LC0A 4QNRA 3QI2A 1JB1A 5K8UA 4RCYA 2REOA 5TDHA 5F98A 1X8KA 5FI1B 2PEZA 4LWZA 5CLQA 3R9XA 2FWRA 1WXQA 4PR0A 5C2JB 4IFEA 3PQCA 4BFXA 1XEXA 2ANCA 3I73A 5FL7A 5FPKA 1TUEA 3D6TB 1NBMA 4NH0A 5C4GB 4BEBA 4ZDIA 1HV8A 3KUCA 4FMDB 4OK5A 3RS5A 3UWKA 1Q1EA 1JR3E 4LJYA 3AQ4A 4F92B 1XMVA 1QHGA 4DHEA 1M7GA 3E2IA 5J4HA 1MRSA 2ZI3A 3QJYA 3LLMA 1E0SA 4OQLA 4TN1A 2QBYA 3ZJYA 3H2YA 4G1UC 2WIBA 3VR4A 4C0KA 3KKOA 3C16C 3QXSA 4B35A 3VR5A 1YRBA 4R2IA 1JAIA 4LPSA 3BK7A 1GKUB 1G8PA 4XSHA 4MGYR 4GL2A 3BB4A 4A0HA 5CM9C 4PZZA 3LXXA 4AYWA 3LXRA 3LDAA 2D74A 4CT5A 3Q85A 3K1JA 4I4LA 2X1VA 5J5CA 3V4FA 5CB8A 4EJSC 3ZGXA 2J7KA 1WDTA 3MJRA 2AD1A 4M1OA 2H5EA 3CH4B 1G6OA 4DLWA 3THXB 2C78A 2GWHA 2W83A 5AK0A 3VTKA 4ZIRB 4MRSA 5FOWA 3LBHA 1VG1A 1CXZA 2WVJA 1N6OA 3PUZA 4V02A 1GTVA 2R44A 5H1YA 4RKFA 4AURA 2XZLA 4U7DA 3GLFB 3WYGA 3ND9A 1BMFA 1FX0B 2RGDA 2IF2A 2RGBA 4QRHA 1DEKA 2VP2A 1G21E 1QZXA 1D5CA 1O87A 5JWHA 3TLXA 1I4LD 4QBIA 4U02A 5JCZA 1L7VC 4BPBA 2C04A 2WSMA 5AUPB 2OG2A 4QJ4A 5B30A 2QP9X 1CR4A 4LV6A 1XTKA 3ZYCA 4F93B 4BLPA 3W6NA 3IPYA 3AUXA 3EA0A 4IOJA 1EFRA 4OQXA 2LCFA 5CIWA 5L3RA 3AF2A 1IN8A 5AUNB 1M74A 1XEFA 3V9PA 4ASUA 1JQLB 3DO6A 1J8YF 1S2MA 6Q21A 5LPNA 2R65A 5H68A 4PAOA 3GD7A 3GLHE 1P2SA 3KFXA 2X2EA 1F3OA 5TY0A 4KFTA 1YR8A 3OIUA 2OV2A 4PXAA 3CONA 1LFDB 1SVOA 3GJ7A 3K70C 3L0SA 4UNSA 1GKIA 4Q7JB 2N42A 4WXPA 5SZKB 1Z6GA 3K70B 1OIXA 2JJ2A 3D8BA 1DAMA 2DWQA 3TE6A 3BRWD 2IXFA 2P6RA 2CVHA 2OBNA 4RZUA 2A5DA 5FUVA 2RKOA 2F9MA 1IXZA 2ZE5A 4TMTA 1G7CA 2FX3A 2ZRIA 3T34A 1F2TB 3RS7A 1KI7A 3BFKA 2GCOB 2DFTA 2ZS8A 1OE0A 4G5RA 1E0KA 1P3JA 2KJQA 2VA8A 4WZ6A 2W0MA 2ZE8A 3F5FA 2QENA 1WE2A 1G19A 4Q1CA 4OQMA 3CLVA 3V00A 3A1UA 5KNDA 2P3SA 1ZM2A 3SI7A 2PT5A 3GLFE 4Z8YA 2YKGA 4NMMA 4Q1FA 2WSSA 3HU3A 1GZSA 1NIJA 3A4LA 2ZI6A 2YHSA 4MYCA 1RRGA 3SS8A 3FKSD 4ZPXA 3EZ6A 5E7JA 3CZQA 3QXHA 4JLNA 3BH7A 1Z0DA 2ATXA 4LRWA 3CNOA 2V7QA 5JWOA 4L8GA 3HWSA 5FBWB 2RH5A 1RYFA 2J1LA 2VH5R 3CRQA 4MKGA 3CRVA 4DDUA 2FV8A 4IKEA 2JLVA 3W6OA 1W36C 1ZIPA 1RC8A 2GVZC 1R2QA 3EARA 1N5LA 3HPRA 4HZUA 2RMKA 1SXJC 1OXTA 1U0JA 1ZC4A 2GJ9A 2O0HA 5FTMA 4LYJA 2XGJA 2RCNA 3WMGA 4P32A 3DPUA 2P5SA 3CF6R 3OIYA 1XXHA 3FGNA 4G3XA 3GJ5A 4M8NE 4EKDA 4RD4A 3PCRB 3U3KA 3FHOA 3KTAA 3KQLA 2UZ3A 2XB4A 2E9SA 2ZUBA 3SYKA 4A2PA 1G7SA 1KI8A 1Z0IA 2REXB 4RZ3A 3QPVA 1YR6A 2GXUA 4RJLA 2KSQA 4EQ6A 5JSZA 2JA1A 1TQ2A 3W90A 2FSIA 1XMJA 2V55B 4JJZA 2AXNA 1GFIA 2OAP1 1P2UA 2GK7A 4KU4A 1E9FA 4M53A 4JL5A 5EQTA 5BN3A 1AS0A 5FTLA 4O2LA 3G82C 4A0RA 3B8HA 3K9LA 3SBEA 1XBTA 4YDSA 1X8JA 2JEOA 4BLTA 4WW0A 5DI3B 4E22A 3L8YA 3RRZA 3MSXA 4BFYA 3CR7A 2F9LA 1VIYA 4DCVA 4F91B 3BAFA 2AFHE 1U94A 1WRBA 2BM0A 2JAQA 5IDVA 4D25A 2WBLC 1HT2E 1TQDA 3K8YA 4EPRA 1DO0A 4C2UA 3CWZA 3CBQA 4GFDA 2P65A 5J4VA 2PLFA 4OHWA 2WJHA 2BKEA 3K0SA 1ZUNB 2JATA 2OESA 2IW3A 2PZEA 3AVOA 3FFBA 4HAZA 621PA 4YMWA 1UBGA 3LVRE 3UK6A 3AVWA 4IDOA 2JLXA 2WZQA 3H84A 5DYGA 4RSGA 5FOXA 3GMTA 1TEXA 2NOAA 1FFHA 5E7MA 1G7TA 4MGKR 4D4KA 3BH6A 1E79D 4A6PA 1QHIA 4MRNA 4OHVA 3CM0A 3LD9A 4O2RA 2ZROA 4OI1A 4IFBA 1US8B 3BS4A 1JBKA 4XD7A 4HYYA 1IQPA 1UDWA 2DY1A 4URWR 4BEJA 1UEJA 3BORA 5FR1A 1G3UA 2C9CA 4LBWA 2CCGA 2C03A 1AGRA 1PUJA 3QPWA 3K0CC 3RC3A 1I2DA 4B34A 2W2XA 1MV5A 1Z6AA 2A5YB 2OILA 4QGAA 1KAOA 5HCNA 3TMKA 1AKEA 3K0FA 1T5LA 3MD0A 4J0QA 3WHKA 1EG7A 4D0NA 5HR5A 2A5JA 3BXZA 2FE4A 2HV8A 1T8UA 3Q7QA 4OK6A 4URYR 4V0NA 3J81k 2FFQA 4M9XA 2RB4A 3OEEA 2IWHA 3CF2A 3CO5A 1CEEA 5JZVA 4CEJB 1KGDA 2IYQA 3WHLA 3AVUA 3VNUA 1U81A 1KJZA 1U8YA 5F3WB 2GK6A 3L0PA 4MUAA 1DVRA 1Y63A 4NKRA 4NL4H 3RDPA 4DDTA 4LHYA 4D2IA 3I4LA 3U44B 2QORA 4WZBE 2FFBA 2GXSA 4CEIA 1CTQA 2A3RA 4RD6A 4D4MA 2QI9C 2RGXA 2CEAA 3LY5A 2FPMA 4RD0A 2GCPA 4E03A 5AJZA 4H1VA 4LI0A 1G5TA 1FMJA 3C4JA 4PSKA 4A0GA 4AK9A 2TMKA 3AV0B 3DL0A 4WOPA 2FSHA 3LBIA 5J47A 3GQBA 1DG1G 2BBOA 1DBSA 1YZNA 3L2OB 3NIBA 2ZI5A 2WKRA 3WRYC 2AWNA 2BV3A 3KKPA 3B2EA 1S1MA 3UIEA 1OH5A 4NCJA 1NRJB 1HURA 1K5GA 2EQBA 1QG4A 3A1TA 3BERA 3U2QA 221PA 2DFLA 4XVQA 4CDGA 3TGPA 2QRNA 1VHTA 1PVOA 1KMQA 2GDJA 1RE0A 3U3RA 1NNEA 3ASZA 5TVKA 3OF5A 2DPXA 1F2UB 4KFUA 4A82A 1Z6YA 1XD2B 4I81A 4QHTA 1OT3A 4MKFA 1E9DA 2QAJA 2D62A 2ZUDA 3B1ZA 2FEOA 2KBFA 3NBZC 2RGNA 3IIMA 2MSDB 3K0AB 3OFNA 1VG0B 4L16A 3GLIA 1Q57A 1KYIA 1XU4A 5E4FA 1TEVA 3GFOA 3QE0A 3V4RA 5EP4A 1E1QA 1Z0KA 2DFKB 3ADKA 4LC1A 5F2EA 1GSIA 3EIEA 1KK0A 5LDDC 2PJZA 1SKYB 3P20A 1OIWA 3CB4A 1EESA 3T1OA 3CWQA 3QPUA 3SN6A 3CR8A 1XEXB 3ZZ0A 4A36A 3B60A 1VHLA 4U00A 3ETLA 1T9HA 4L4UA 1CS4C 3F0TA 1VYUA 2OZEA 3PEUA 2FA9A 1DE0A 4PSAA 4XWOA 1DAGA 1KY3A 2W0SA 2A7QA 1LS6A 3OEHD 4UJ5A 4DT1A 1ZM7A 1HTWA 2BBSA 1FL9A 1W0JD 1E9AA 3M1IA 4TL9A 3W3ZB 2H7VA 2QBYB 3R8FA 4B48A 3P4YA 2JDID 4HAYA 4B2PA 3BD9A 4HLQB 3U5ZB 4AKEA 2W6JD 3AKYA 3IHWA 3U3JA 4XWKA 4CGZA 1GOTA 3LLUA 2XXAA 3NBFA 2NPFA 2GESA 3AF3A 1PUIA 1SXJA 4KI0A 2ZSDA 1Z6TA 2IEYA 4QHSA 2V8OA 1U0HC 4TYYA 3Q3JB 3BFVA 4OI0A 1DG3A 2RGAA 1XD9A 1G3IA 2HT1A 3TUZC 3OAAA 2XNDD 3DMNA 5BYKA 1M7BA 1CJKC 3U60B 1GNQA 1ZM3A 4C9BA 2EYQA 3JVUA 3AVYA 2ZRKA 2BM1A 3DOFA 1ZD8A 4KJZA 3ZVNA 3OE7D 2UZIR 5FH9A 3VNVA 1XD8A 2ZE7A 1RJ9B 4IEEA 4LJ8A 4PC2A 3EPKA 1HE8B 4O3MA 4JBWA 1JECA 4Q4LA 1W48A 2GNOA 4ZKDA 2GA8A 3TVDA 5EXPA 1IN4A 3R8CA 3TAHA 2Q3HA 1QVRA 1YKSA 1C4OA 1QHHA 4OHXA 1Z6XA 4FD2A 2FGJA 1E2MA 1FQJA 1KK3A 4Q7KA 4CF7A 3IO5A 2FH5B 2OFOA 1SKYE 3EASA 4W9MC 1KSJA 1RRCA 4A8JC 4PQYA 1AA9A 3OZXA 5B58C 4LHXA 3BH0A 1QHXA 5EE5B 1ZUHA 1SGWA 1IOZA 1FP7A 3EZ9A 5DIFA 2VBCA 4ZCMA 3MUFA 4TSFA 4II7A 2QQEA 1JAHA 2Q0HA 2BBWA 2WAXA 4NCKA 4DCTA 2ORIA 4JVSB 2PX3A 2ZJ5A 3SC3A 1NVUQ 4HLDA 4QG7A 1T91A 5CIQA 2VHCA 1QRAA 3IQWA 4B43A 3VAAA 4Q9KA 2F3RA 2A5FA 4JL8A 3JZAA 3P4XA 4TT3D 2H18A 4OBEA 4PHHA 3ZVLA 2DCUA 3KZ1E 1FQKA 3VU9A 2ZYWX 4IDHA 1H8HD 1US8A 5LB4A 2ZRGA 4GP6A 1KI4A 2CNWD 2IYTA 4CW7A 1IY0A 1VCMA 3ZIAA 4JSYA 2WAYA 4K46A 2PT7A 1SQ5A 2RGCA 2W00A 2WWHA 2J3EA 2W6IA 5E3HA 2JJ1A 2IHBA 2B8WA 3FMOB 3NWJA 2ONJA 2PMDA 3GLGA 2E87A 3LQQA 1RRFA 3KQKA 2VHUA 4QJ5A 3TW8B 1GVNB 2ZJ2A 1KO4A 3GJXC 2ODNA 1RFLA 3X1DA 4TMVA 4YXWD 1GRNA 4KODA 4URVR 1D8TA 2F55A 1JJVA 3U3MA 4D0LB 2F43A 5HKKD 2VP9A 3T61A 2WMNB 4Q4HB 3REGA 2ZR9A 1C9KA 3PENA 5GJWC 3KUDA 2QAGC 1GP2A 2KBEA 3QXCA 3JZMA 2AXPA 1KDPA 3ZZTA 4B3DA 4PQRA 4TQ9A 3UG7A 4C0LA 2FG5A 1UKZA 4B3CA 2GXAA 5FBQB 1Y3AA 2B7CA 1Q22A 1CLUA 3FYHA 4X8LA 2MMCA 4CEHA 1DAFA 2ONKA 4MRPA 2V1XA 4TYNA 1E9EA 4TTQA 2CJWB 4PHTA 4QXAA 4HATA 1T6NA 2VP6A 1R8QA 4LHZA 2PCJA 3QSYA 5IK2D 4B3BA 2BIFA 5KSOA 3EPJA 2GVDC 2WKPA 3A1SA 4PZYA 2PEYA 4E09A 3KQUA 4FWIB 4W5JA 2IXGA 2WIAA 4L9SA 4LCBA 5FOUA 1N6HA 5AUQA 1DO2A 5UKDA 4PAQA 5E7IA 3O8RA 3SJAA 2H16A 1R0YA 3SU8A 3Q5DA 3W9YA 1UM8A 1XPUA 3AB3A 3KFVA 1OXUA 4V0OA 2OCPA 1GWNA 5DISB 3RNLA 2O52A 1BYUA 2ZSEA 3KTAB 5EXXA 1WF3A 2IS6A 4OI4A 5JJLA 2GZDA 4JYBA 1CU1A 1OV4A 3HR7A 1YZQA 3QKTA 5JSZB 4Q7LA 3HYTA 2HCBA 3T06B 3I8XA 1JPJA 1U90A 2ZJZA 1FNMA 4JIMA 4EFMA 4YQFA 3M6AA 4WIAA 1FNNA 4GPTA 3AP3A 1RVDA 4Q18A 2O8FA 1IN6A 1W0KA 4JLOA 5CYPA 1OJLA 3X2SA 2FDCA 5ANRB 1Q21A 3VHXA 2XOKA 4Q4JB 2LWIA 3PEVA 3OHMA 4Q1EA 2PLRA 5B64A 4B32A 4PTLA 1GRRA 1EK0A 2H57A 2XSZA 2AK2A 3K9GA 3OIWA 3SYNA 4F7WA 5B2ZA 3F8TA 3AKEA 2GJSA 3K0AA 3R9WA 2EWVA 2BJWA 3X1ZA 4JL6A 4OYHA 3QIAA 1ZINA 4Q21A 3HPQA 4DC9A 1ODFA 4URXR 5KUTA 4BFVA 1MO3A 4FMCB 4MRVA 3OESA 3B1XA 4D6PA 1A2KC 1QF9A 2YC4C 1ZMXA 2QN6A 1SVMA 4MGZR 4NCIA 2OXCA 3BC1A 4Z1MD 1E99A 4Q4AA 4YDHB 2DBYA 5JHHB 4FWTA 1FPMA 4OHZA 1WBDA 4JMPA 2V6JA 4UXIA 5KNCA 2R6GA 3A4NA 3AF4A 2ZSFA 2QE7A 1HT1E 1Z29A 1QBKC 1R6BX 4C0HA 4KBGA 1EFTA 5JEDA 2D7CA 4YMSA 3Q5EA 1KI2A 2DFNA 1XP8A 1EFCA 3CPJB 4MYHA 2QG6A 1Q0UA 1KHTA 1XMIA 1HUQA 2MSEB 2FMXA 4ZDWA 3ZZUA 1HEIA 4M0LA 1GRQA 3SBDA 1XTJA 2DR3A 2J0SA 1MO4A 1U2RA 1CR0A 3NC0C 4M9ZA 2YOGA 2NG1A 2ZYTX 5CITA 2AWOA 2YWHA 3LH5A 2ZRHA 1P2TA 4FMBB 4HUTA 1XXHE 3RSLA 2FGKA 4R98A 1AM4D 4H1UA 4C0AC 4KYIB 2R6CA 5LBIA 2ZJOA 1MOZA 3BBPA 4RKEA 5JS8A 2ZEJA 5KNBA 1VKJA 1XCMA 721PA 2IYZA 2G3YA 1XTIA 2O0JA 3FKQA 3BB1A 4Q19A 5C4MA 1VIAA 1A7JA 1Z5ZA 3QEOA 2RGEA 3KJHA 2CK3D 4EJSB 2IEZA 3TSOA 4KITB 4DDVA 1S9HA 1TF5A 3K0FB 2CMKA 3G5UA 4LZZA 3UANA 2V3CC 4OJKA 1L4UA 1A4RA 2WV9A 3E5HA 2PBRA 2VO1A 1W1WA 1OLOA 3CUEF 3EZ2A 4JLDA 4Q47A 4GZMA 2XAUA 2OAQ1 2PL3A 4LV8B 1XEWY 3FB4A 2YVUA 4QHYA 2V54A 3UMRA 5JJIA 1RJ9A 4DEXA 1J90A 1N5KA 1SHKA 4M1TA 1TU4A 4UNPA 1PLKA 4F4JA 2B7BA 4IXMA 2NIPA 3ZDQA 2B8TA 2OLJA 1KDTA 2R6FA 4LYHA 1VDZA 1OXVA 3EWSA 5FPYA 4KFRA 4CEIB 2VHQA 3S1AB 1YZKA 2OM2A 4F4CA 1NKTA 1CF4A 1E2GA 1E2LA 3O8BA 3MWKA 4AIIA 2GHIA 2P6NA 4M1KA 2G77B 1A2BA 4A8JA 3TUJC 2ORVA 1OFIA 2MMGA 2IYSA 3BGWA 1CJUC 1D9ZA 1I4TD 1KTVA 4NBSA 5HPYB 1UKVY 3I8SA 1EFRD 1TQ4A 4S35A 2CDNA 3WMEA 4AG6A 4ZI3A 4ASUD 1NSFA 1TF2A 1E0AA 3LFUA 4GOXA 2W2TA 2YWFA 1KNXA 1E3MA 2FF7A 2HCJB 2Y8EA 2ZR7A 2F6RA 4KFSA 5DHAA 1AJEA 2QMUA 2I3BA 5CJ2A 1COWD 2FEMA 4PX9A 1VYVA 3CNNA 1G291 1TUIA 1JQJC 4G5SA 2WJYA 1AQYA 5SZJA 1VPLA 2AX4A 4P4UA 2R8RA 2JIZD 5G3YA 3RYTC 4ESHA 4DIEA 1EX7A 2QT1A 4IVPA 2XEXA 5EE1A 1P72A 3P27A 2AD5A 4PPFA 4JS0A 4R9UC 2A9KA 4B75A 3CRRA 4HUQA 3KL4A 3AVTA 1S9DA 2CL7X 2RGNC 2ODEA 1UBEA 1T4GA 3T12A 4KYUA 2EVWX 5L3SA 5FPHA 5EE0A 1Z07A 1I4DD 1GNRA 3GLIB 5JECA 2QL6A 3RLFA 2ZUCA 1FP6A 1IXRC 1OKKA 2C98A 3LBNA 5LD2C 2GEVA 4MKHA 1S8FA 4TYQA 1VG8A 1II0A 2ZJYA 2V6IA 3AVPA 3MWJA 4GZLA 4YMVA 5LD2B 3FHTA 2ODWA 4Q4HA 1N6PA 5FPSA 3B82A 1P61B 3M0EA 3D7MA 5EXSA 2J7PD 1IBRA 2JGNA 4Q00A 2QAGA 2V1UA 4Y0VA 2ODBA 2JLWA 2GF0A 2WJVA 2QQ0A 1SVWA 4Q9JA 1W5SA 2AFIE 2W58A 2ZS7A 2GKSA 5K8IA 3ICEA 1E2HA 4D26A 3ZS8A 2WOOA 4DT1B 3MJHA 2VSOA 1YR7A 1E32A 1JEEA 121PA 1UF9A 2NQ2C 4IDPA 2IUTA 4Z8XA 1IN5A 3PXGA 4NHOA 1UDXA 4GT1A 4JBXA 1N0WA 2CJWA 3A4MA 3OIVA 1JR3D 2VSXA 1N5JA 1CKEA 1RIFA 4LYAA 4Q5IA 1PV4A 3FMIA 3TBKA 3KB1A 2GZHA 1G16A 4TTRA 5TARA 4HB0A 2ZRJA 2ZRDA 3FKSA 1M1YE 1W36B 3LVQE 1D9XA 2XZPA 4BQSA 2XXAB 5GJBA 2VIIA 4XIGS 5JS7A 4FCTA 1SXJB 1Z0FA 3DZ8A 2JJ8A 3PFIA 5FBVB 4M9QA 3LW8A 1GL9B 2QU8A 1LB1B 1QHNA 1KSGA 1G9XA 1NLYA 4D82A 1S96A 2BKUA 1IN7A 2WICA 1OHHA 2P2LA 3QBVA 2IYLD 2FPLA 3VKWA 2KB0A 3E1SA 3HYRA 3NVAA 4EPYA 4A15A 4IJMA 2ZS9A 4Q9HA 1KI1A 2NO1A 5DO9A 2EU8A 2PZGA 2H8KA 2QP4A 2PH1A 4JLVA 5EP1A 3FFAA 4Q4JA 4B74A 3GLIE 4B2LA 3TK1A 3MMPA 2N1BA 3I32A 3SQXA 1QHHB 1NSTA 5K8TA 1DAHA 5M04A 3EPHA 5CYOA 1SVSA 2G9NA 3KXKA 3BE4A 3ADDA 3AH8A 5J40A 1TF7A 3K09A 2ZAMA 1PLLA 4R2HA 4OL0A 3RS2A 3FMFA 3SNHA 2F1IA 4DLUA 3TUIC 3BJIC 1ZYUA 4GMDA 5EP2A 1ZIOA 4G5QA 4IEIA 3CRW1 1KI6B 2Q9BA 3ZS9A 1CR2A 1V5WA 2CLDX 3PUVA 5JRJA 2J0VA 1F6BA 1UJ2A 3B1VA 3VKGA 1WBBA 2ZSAA 3NH9A 3EA5A 3AEZA 1CP2A 2EFCB 4QC2A 4HAUA 4JLBA 1ESMA 4P3YA 4YMTA 1A5TA 3BFXA 3QKUA 3F3YA 3W3AA 5J4KA 4JLMA 2BEJA 4LJ5A 4D4JA 3KQHA 4TWZA 2YWEA 4ACBA 2XTMA 1TU3A 1SXJE 4HB3A 4W7SA 2BDTA 3W34A 3D3QA 4IOKA 3RWOA 5JLJA 2BMEA 1E9BA 2YNMA 4YLGA 3VU9B 2JASA 5F9FA 4E5UA 1Q3HA 1XEWX 4EDHA 1ANKA 5G53C 4BLSA 4BLRA 1G6HA 3C5CA 1WB9A 2V9PA 3PR1A 4P0TA 1E2DA 2ZPTX 3EWAA 4TMZA 3TNFA 4EJSA 3FWYA 4CVNA 3GLGB 2CCKA 3NHAA 4YC7A 4AYXA 5IHPA 1E79A 3DM9B 2IS1A 1P73A 2BOVA 3E70C 2AKYA 1EWQA 1WCV1 1IJFA 2F43B 1VCOA 2ZQ5A 4BECA 5L3VA 2L0XA 1JI0A 2ZRPA 5JRZA 2BHRA 5DE3A 5HTKA 2BCGY 1TMKA 2WWWA 1PZNA 1XPOA 2B92A 2BC9A 1DOAA 4TQUS 3AP2A 4JLJA 4F38A 3QQ5A 2ERXA 2WMOB 3HR8A 3WMFA 4HEJA 1TADA 3W8NA 3HU1A 2ZRBA 4HLUA 3S1AA 2FFAA 1SZPA 4NZYA 1J7KA 2EFDB 2GEDA 3KJGA 2DWOA 4Q1AA 4CEHB 2EFGA 2HF8A 5D3QA 5KHOC 3GCGA 1MRNA 2ZI9A 1ZNZA 3B78A 3LAWA 4GRAA 4UJ3A 4DLYA 4MA4A 1VYTA 4X8MA 4BUJA 5TXGA 2FPKA 3EX7C 1UKYA 2WWGA 3QVVA 4MYTA 1O3YA 4TLDA 3SOPA 2J0UA 2VP5A 2G88A 1G3QA 4DLTA 4AKHA 1CJMA 5KDDA 5KOYA 2C9YA 3KQNA 5G40A 3B6EA 3B9PA 3KKNA 4ILEA 5CLLA 1E0JA 4K8OA 3SFVA 2ZVQX 2WWFA 1G20E 4LJ7A 2QSZA 1ZVQA 3UATA 2KWIA 1HA3A 2GRJA 5KPDA 1S3SA 1YZGA 2IBMA 4BWYA 4DSTA 2AN9A 4QM6A 1DS6A 1E2NA 1GG2A 4WAUA 1NI3A 4A4DA 3IBYA 2ZR0A 3ZVRA 1RRPA 3K70D 1BH2A 5KDLA 2WPDD 1NP6A 2VP0A 4AY2A 2O8FB 3UWOA 3WBJA 2B6HA 3T15A 4MGIR 1QVAA 2CHVA 3NKVA 1P5ZB 2BCJQ 4BFWA 1YU9A 3EIHA 1SVLA 3A8TA 1BIFA 2CE2X 3GLGE 4C7OA 3QXXA 2NGRA 1AZTA 1IHUA 3AF0A 2VL7A 3IDQA 3VMFA 2WJJA 4KSCA 1AK2A 2AR7A 2R62A 3VR2A 2D06A 3RANA 3Q8XB 4MUBA 3WRXC 2LKDA 5GJCA 1CR1A 4TMWA 4HAVA 1BKDR 3P32A 4PPGA 2ZRCA 1NMZA 1OF1A 1Z28A 2ZAOA 3A58B 3GJ3A 3HP1A 3PV0A 1J99A 1MT0A 2DHRA 4Q1DA 2BWJA 4V03A 5AJYA 1YRAA 3NDBB 4Y0AA 4DLRA 4IW3B 2OCAA 2IYYA 5EUQB 4Q4AB 5TV2A 2A2ZA 1G7RA 1J70A 3TSZA 2CL6X 4C0QC 4IOLA 2AL7A 5IT5A 1GILA 1Q44A 2CBZA 3TH5A 2Z5FA 1FUUA 1M2OB 2XB2A 4Q9LA 1LY1A 4GNKA 1JALA 2YYZA 4B6EA 3W6PA 1YZUA 3EIQA 4QBHA 3LA6A 1JR6A 5BWMA 1T5IA 3MRSA 1Z0AA 4NE2A 2D2FA 4QNMA 1WA5A 3N5CA 4AYTA 1NKSA 1ZM4A 3ADBA 3I61A 2OCBA 5EE9A 1WP9A 1Z2AA 3VX4A 4JVMA 4F4IA 2Q3MA 3DKVA 3I72A 2CXXA 1TQ6A 4I1SA 4V0LA 3P26A 1IY1A 2LKCA 2XTNA 1E1RD 1XMSA 2IWRA 2O5VA 2NMVA 1P9RA 1XNJA 4KLNA 2REBA 2QGZA 2G0NA 1I2MA 4UNRA 3K0EA 3OEHA 1NMYA 4DKXA 4X8OA 2XITA 5TB5A 4M4SA 1HQCA 3LNCA 1W0JA 5EZ6B 1B23P 4DB2A 4PHGA 2G0TA 3KX2A 1EX6A 2GJ8A 3VX3A 2JDIA 2EFEB 3U3OA 2W6JA 2DYKA 4BE7B 5L3QA 3C41J 3N2EA 3QG5A 2J41A 2HDNB 3OAAD 4LY6A 4TTPA 1GNPA 1P60A 1R10A 5BQ5A 1GAJA 3PVSA 4C0JA 1GKYA 5FPTA 1CRQA 1LV7A 1KOFA 3IGFA 4G0NA 1ZJ6A 1BO6A 1IY2A 3AVQA 4WZAE 4JKIA 3SFZA 3WY9A 1XJQA 2UVQA 4DEYA 1XX6A 4C3ZA 1Z63A 4CZ2A 4WXRA 2QTHA 3LW7A 1PLJA 3EW9A 4TQAA 2XNDA 4UNQA 4IRUB 3RABA 5HZHA 1ZBDA 2VLIA 4EPWA 3RS3A 1RW4A 2O8BA 4ABYA 2E1RA 5A0FA 1H8ED 3L43A 2AHOA 4H9GA 2RHMA 1NLZA 1T3LA 1ZNXA 2VRWA 3DVLA 3EPLA 3GFPA 3OE7A 4A8JB 3QXJA 3I5XA 4I1UA 3UXMA 1NBME 3AVVA 4LBYA 1HYQA 4YONB 1ZU5A 2QMHA 4BGDA 4WA7A 1VCNA 4PPQA 4FW9A 4XWAA 4OI2A 5SZHB 5H70A 4LYFA 4D81A 4UQOA 1KI6A 5P21A 3RRYA 1Q1BA 4HB2A 4XTRA 1HE1C 5ELXA 4JYCA 4DJTA 2C8VA 3B5JA 1XJCA 4LK2A 1OFHA 3CX8A 2FSGA 2EYUA 2JCSA 1GL7A 3A36A 2QY9A 5BW8A 2V4ZA 3T1QA 2CHQA 1OIVA 1ZD9A 4DLXA 4GP7A 1S1CA 4I1VA 4U5XA 4V0MA 4JVLA 2GCNA 1JEDA 1NG1A 3X1YA 1U99A 3QY0A 4HUQB 3CZPA 2HT6A 2NPIA 3CPHA 2YZ2A 1U9IC 3HU2A 2IUUA 2Z83A 5L3SB 4G5OA 2GBLC 3PIRA 4LPKA 2IYWA 4QJ3A 2XJ9A 3CH5A 1NLFA 2PCLA 3DKPA 3KDSE 4TT3A 2O8EA 1T3SA 4POAA 1H8HA 2B21A 3THWB 2H1LA 4DXAA 2CNWA 1NVXQ 3LRPA 2Z43A 1R0ZA 3DOEA 2RAPA 4PO1A 4IXNA 4RFSA 3ZLJA 3RS4A 1XF9A 2GAAA 3A1VA 521PA 4ARZA 2C77A 1QHSA 4D80A 2QAGB 3B1WA 2X2FA 4XVRA 5LB2A 4URUR 1XRJA 5CJPA 1U8AA 4C0BA 2YINC 5FBLB 4C0SA 2JLZA 3HJNA 2GZAA 3EXAA 1K8RA 1UBFA 2Q6TA 2YJTD 4JLAA 4YXWA 2RGGA 5JEEA 4W5WA 1ZP6A 2AK3A 4PAMA 5EJEA 1XPRA 5HKKA 1ESNA 4OQFA 3LX5A 3PJRA 5HCIA 4FINA 4Z54A 2FZ4A 2ZYUX 1JJ7A 1T0HB 3T35A 3RRNA 1W4CA 1TNDA 1X3SA 4LBZA 1KNQA 5DLQC 3WXMA 1IAQA 4TZ6A 1OXXK 2QT0A 3DHWC 4HB4A 1E4YA 1SVIA 4C4PA 1BOFA 4HDCA 3MAAC 3N2IA 3T5DA 1M7HA 3X1XA 1KI3A 3CPEA 4X8HA 5DHFA 3CIOA 4JLKA 5IK2A 2NTYC 5C1BA 1EGAA 2QP3A 3AKCA 2HJVA 3QEJA 5KDOA 4M1WA 3IKJA 5JJKA 3PEWA 1FTNA 1W5TA 1AZSC 2BEKA 3MWLA 4DSNA 2G6BA 4OKSA 2O8DB 1NG9A 3GEIA 4PZLA 1GIAA 4E07A 5DN6A 2BBTA 2WWYA 4DZZA 2IC5A 3H0KA 3LWNA 1BYIA 1G8YA 2QNRA 1E2KA 2XJ4A 5FL3A 4M2LA 5JI2E 3R7WA 3U4QA 4DLVA 2EFHB 3K09C 5A4JA 4DUGD 3Q72A 2HLDD 5AUOB 1C1YA 4P33A 2OEPA 1KZGB 2QPAA 1N6KA 3FHCB 4P31A 4QOSA 4UXJA 4HDOB 4PC1A 1FOEB 1LS1A 4LJAA 1QHYA 4KLZA 1Z22A 1TPZA 4M9SA 1KSHA 4DCSA 5DI9A 4DDWA 4KV9A 4NU0A 3IUYA 4QBFA 1KMHB 2VYFA 4B2IA 5FL7D 4NYJR 4ZI2A 3TIFA 1DTSA 1NBMD 4AC9A 3NTUA 4Q1BA 3RSOA 1Q3TA 4DCNA 3NEJA 1U98A 3MG9A 2O8CA 5JWRA 2ZRNA 4PANA 4Z1MA 3WYFA 1N5IA 2ERYA 4LV5B 2BVNA 3X1WA 3FPAA 2F1RA 5EP3A 1KO7A 1G4UR 1AIPA 1DAEA 3VR3A 1KO5A 1ZRHA 1UPTA 4IDQA 4V0KA 1OYWA 4HZIA 4FIDA 4DB4A 3KXLA 1GITA 2C2HA 4QM7A 4HAXA 3WYAA 2X77A 5KSPA 2C5LA 2OBMA 4AG5A 4LJ9A 2AKAB 3AGPA 1YE8A 5E95A 2VPPA 4A6XA 3CKLA 1OH7A 1NJGA 3GLHB 3NXSA 2NZJA 1G5RA 5DNYB 2W2VA 1A82A 4FI3C 2GTPA 1OXSC 4HDQB 2ZU0C 3FMPB 4GMXA 1W4AA 3W5IA 3UPUA 2QA5A 1LF5A 4RCZA 2G1KA 4A1FA 3IEUA 4O25A 5JMTA 1W46A 3WNCA 1NVWQ 4TL6A 4C30A 4D4LA 1RKBA 4B6FA 2KI5A 1W49A 4KVGA 1OYYA 1GL6A 3ASYA 2CK3A 2ZIAA 4AD8A 4TYWA 1K5DA 1BMFD 3FDIA 4HLUC 4RFVA 5AR1A 5FOSA 4EAQA
chains in the Genus database with same CATH superfamily
4BNVA 5C1DA 3ZJVA 2EIXA 3K8QA 3PEEA 1I1OA 2XCLA 3DHVA 4QZVA 1IWOA 1MJGA 3OICA 4KC0A 3WJ2A 1GDHA 2ZUTA 2UYHA 5C18A 4C2BA 3GGSA 4BEWA 1G64A 2R8PA 3A2NA 4G63A 2DFDA 4JJIA 2BFBB 5KINB 3TF5A 2WTUA 3MIIA 1QYCA 1BS1A 2O1WA 4BP9A 3QVJA 4X41A 3TO5A 1FTGA 4MDFA 1YDHA 1S4QA 3EULA 4M87A 3U6BA 2RK3A 3B7GA 3DF9A 1OC2A 1Q1ZA 3WLEA 1EWRA 4YUAA 1B42A 1N2CE 2ZWOA 3RTBA 2JC3A 3R3WA 2N9UA 4Q9NA 1QFZA 1P7ZA 2AIRA 3OTOB 4TLCA 4NPHA 3LXMA 4E31A 1E98A 4XARA 3IE1A 3BB3A 2JJ2D 1EM8A 2FU5C 4MUMA 5IT0A 2GETA 4OSEA 1JMVA 3HGMA 4LHWA 3R7BA 3RTCA 3U5TA 3CXUA 4LJRA 2IYUA 4LRTB 2FW7A 1OGJA 3NNSA 4WOBA 2O3TA 1EKXA 1K6JA 4E5YA 1FSPA 3FYCA 2GD2A 3QMMA 3ZK8A 4EB8A 1E3WB 4Z51A 1G3RA 3DBRB 1AHIA 4WESB 2YWRA 1OREA 1YL6A 1ZFNA 3F5DA 3M5PA 2B3TA 1RADA 4DTCA 5IF9A 2CMDA 3ECCA 5LQJA 1JF8A 4D3YA 2XW6A 3I1YA 2FZLA 2G17A 2G83A 4BZZA 1QIIA 1WUJS 3QHPA 2ETVA 1GT6A 3H75A 3IA7A 4LX0A 2CCJA 1FVHA 1H2WA 1PL0A 4GM1A 2ZDGA 4L8VA 4QECA 5JTTA 2ZU6A 1G18A 3LU1A 2WI8A 1T2EA 3KWMA 4JHLA 2NSHA 4ZYZA 3GP8A 2X8JA 2C8KA 4JGIA 1P3DA 2AXQA 4ZDKA 5FQNA 3G1TA 1B3RA 3OURA 3OG9A 5C5EA 4ZGWA 1GZDA 3HACA 2FWPA 1N6RA 1W9HA 3ABIA 3DV0A 4BC0A 4BLUA 1T5SA 2ZWAA 4WPGA 3PS9A 3V4OA 2BFAA 1D2NA 3I76A 3IOCA 2RKBA 4GU5A 3IV6A 3VPHA 2Z2IA 1VSBA 3OU7A 1XMPA 4MVJM 4AZ3A 4DSUA 3M33A 5J4LA 1UXKA 4TMXA 4ROSA 1JXMA 1UP6A 1Q83A 5CPBA 1R1DA 1VZ2A 3RQSA 2QYOA 2PFKA 4QL3A 4RY2A 1DBRA 2OZLA 1A9TA 1Z39A 1H3NA 3I2IA 1BTOA 4ED9A 3NOVA 4O2AF 4R71A 4JT2A 4IZHA 1R0RE 3HXQA 1KO1A 4MJ3A 2JFQA 5TGZA 1T8TA 3AFOA 4L72A 4YGYA 1G8GA 4QU5A 5D86A 3QF4A 1JXQA 4QPPA 4RQUA 3HK2A 3BCRA 3ET4A 3MXOA 4E1BA 3T4EA 1J33A 3AR8A 3CF4G 3G6WA 2JLYA 1QGZA 1UR5A 1SQFA 3A31A 1NRWA 2C97A 1WEHA 2QX4A 4FWBA 5ESDA 1K88A 5TC4A 2Q21A 2ZKIA 3B6KA 4PGHA 1JQEA 1ZHOA 4YYZA 2AG6A 4XYGA 3MS7A 5TMPA 2ON6A 4P5PA 2VP4A 1Z34A 4X5OA 3KWLA 4ZOCA 5L3QB 2TYSB 3E7FA 4IRMA 2RHCA 3TQFA 1FSFA 4L02A 3V8MA 1MB0A 4CTOA 4L07A 4NJEA 4OH7A 2DJIA 5B12A 2VG8A 4PCLA 4DSOA 2FETA 4I5IA 4DR5B 4ZHQA 1K3TA 1N0UA 4FHZA 1B0AA 4UZEA 2ZK7A 3L1UA 2O8DA 5K0LA 1MVNA 1XPJA 1BVRA 1H0RA 2JGFA 3JARA 1TXGA 1RJFA 3K9NA 3H86A 3NHRA 3ZWDA 3D6HA 4CYMA 3P9YA 1MVOA 4OQYA 4RZHA 4EHLA 3BMNA 2CMFA 2NXNA 2NUPA 5DTIA 5BQXA 1MNAA 3D8SA 2P1ZA 8ABPA 1E1LA 3P5BA 3Q2OA 1HE3A 1OB2A 3L40A 4B71A 1FTSA 2AOTA 3A1DA 2OC4A 3O4FA 1KAGA 1GTL1 2XTAA 3TR0A 1IONA 4PO9A 4G1VA 5I9MA 4ITRC 3C3BA 4WECA 4BNTA 2HNBA 3OZGA 2ZREA 2YV1A 4D0RA 3BGOS 5IJAA 1JE0A 1Q20A 4MV6A 1E2JA 1ECLA 2GNPA 4QJIA 4YY3B 4L95C 3OHPA 3USCS 3R0IA 4XLLA 1J9GA 1QC5B 2FJUA 4LJKA 2QM8A 3FYSA 1KMHA 1RE1A 2P40A 3QPBA 3C6YA 3ROMA 4DYHA 3QYJA 4B3GA 4O4HA 2OENG 2HXYA 3AHCA 4US1R 2JJYA 1QUEA 2VT6A 1C50A 3KTFA 1OWMA 2A8YA 5J58A 4PM4A 4A0QA 3NBXX 1OB5A 3IEVA 5DHUA 5FCDA 3AESB 2BSQA 1JHUA 1XTSA 1IVSA 2P9FA 3B9BA 4GVPA 4MAFA 1K89A 3T7RA 3M6UA 2CXUA 4HNHA 3Q8KA 3MJVA 3WB9A 2Y71A 3LYUA 5JQGB 2F00A 2ID8A 2LD4A 4KR2A 2ATCA 1E2PA 2JLQA 2WP8J 5LDGA 1GVHA 1NSYA 3NG1A 3PX3A 3AIMA 2HWKA 1XKQA 3WSTA 5SYNA 5AD1A 5TMEA 4NLLA 3DVQX 2ZM5A 2ZSBA 1DSSG 4QELA 2FSFA 3TRJA 3WGIA 3MLEA 2OFWA 4GQIA 2E4WA 1PHPA 2IXEA 3JD0A 4A2CA 4GDFA 3NHSA 2AOUA 2HA7A 1OFTA 1V43A 3JWGA 3RC7A 1VHDA 1U9CA 3ICQB 1ZXBA 5KYNA 2QJTA 3FUTA 5H81A 2R86A 3H4MA 2YVLA 3C3KA 1Z5GA 1UK9A 3MGCA 4XOIA 5AJUA 1LW7A 4ON9A 1RHQA 2OHHA 3AEQB 3IT0A 1IVNA 4QOHA 2GF9A 2PVPA 4KXVA 4PC7A 3EFOB 3EIXA 5DP1A 3VSBA 4P92A 4Q01A 1XDWA 3C4QA 3MRXA 3CUWA 4TKMA 3PRJA 3SDZA 5GV7A 1X9HA 4MW2A 3A32A 4ARZB 1DADA 5EPUA 4ZT6A 1N6NA 3GUHA 4PSDA 2QMEA 2PO7A 1G17A 5CT5A 2XNCA 4JJKA 2ZVPX 3KKMA 4KAXA 3R75A 4WVFA 3BXGA 1E4VA 4YB8A 1CJVC 4Y1RA 5C3UA 3ANSA 1WF6A 1B26A 3KLMX 4RMHA 5E0OA 4QOJA 2QXYA 5DT2A 1NVDA 2H0QA 2PZMA 2W11A 5BY2A 5JS6A 2QTLA 3JQGA 1YL7A 4DBLC 1Y9AA 2J45A 1M8PA 4COKA 2TECE 1GDDA 4FOLA 4QDOA 4Y3UA 1CY7A 1PV1A 1N3BA 1OPXA 1ZD3A 3TTUA 2H51A 2PV7A 1KARA 1X1DA 2ORED 5CK5A 1Z35A 3P9RA 5LXTB 1WKBA 2H2IA 2CC2A 1FX0A 5F5XA 3LS2A 5BV7A 4L9RA 4EDFA 5AQ1A 4HWRA 4ZVPA 3FLAA 4PQFA 1WL8A 3T1NA 3JTEA 2YQ4A 4N9QA 5LA6A 1U0EA 5EZ5A 2OO7A 3SEFA 2I78A 3IHLA 1KDVA 2PMKA 3NTLA 5EC8A 4PRKA 3PNSA 1H5UA 3V1NA 2XVAA 1JA0A 1EFPB 2FK8A 1ZOSA 4A9AA 4EYEA 2YWBA 3JQAD 2VJMA 3GJ4A 4QXQA 3BL6A 1ZOPA 1EU1A 2QRHA 1R4NA 1YUMA 1PWYE 1RJWA 2GS9A 3M8KA 4HS9A 3MCUA 2DLDA 1QO7A 4RK4A 3CMCO 4QSMA 3RJ9A 3OLWA 3WDKA 2QM0A 4ND3A 5JPDA 1EUQA 1QF7A 2VDLB 4IIJF 1EVKA 2P30A 2K7ZA 3FUWA 2MR5A 1EHCA 3RTDA 4TSRA 1TX4B 2H92A 1V9LA 4IHQA 4KACA 5H3LA 4BRWA 3EGVA 1M1YA 3MT7A 5FUXA 1GFWA 5JCXA 1PKXA 4FGLA 4FC6A 4XVHA 2FPIB 3FH0A 4B4KA 3GCZA 3DVSX 3WA7A 1I7QB 2GILA 3W5DA 2O4CA 2OD2A 1K3UB 1DMRA 3O4RA 5CCBA 1PGQA 1R5BA 4MKIA 3LPAA 4DIUA 4AY6A 4CIDA 2OV3A 3H05A 3IOBA 5EZYA 1X1AA 3RUHA 4BVHA 4YRKA 5JO0A 2JI9A 4D5GA 2J3IA 4UTVA 3RYFB 2WPDA 3IHTA 5A5GA 3G8YA 2YBEA 1YQWA 2YFYA 3HDTA 2WKQA 3I3OA 3OCXA 3B53X 4FNOA 4P81A 3AM1A 3EPRA 5AW7A 4HRAA 4AG3A 4BVGA 1SRQA 3WWDA 5JH7A 1VKHA 2I3AA 3FMGA 4QD3A 5HDBB 3SIPA 3TWOA 4PXSA 1YVDA 4QWMA 4CDRA 1KEEA 1BE8A 3NJ8A 4FEAA 3TD2A 3FDZB 4WGGA 2OA0A 3CVJA 4PPNA 3FZYA 3KKQA 2YOHA 1T9DA 2QUZA 1UBUS 2PKWA 3FJ1A 3IAXA 3OWXA 3BHNA 3EEYA 1E2IA 3I2KA 4FJ2A 4GXQA 5BOVA 3UMFA 1CC1S 3N6XA 4B44A 3WXBA 2W98A 2Q2WA 2VI5A 2FE1A 3P4UA 5EINA 3FRIA 4MCIA 2LZ0A 4Y2XA 4KR6A 4D42A 2A4MA 3OCCA 3RVMA 4QNNA 4BGVA 3SJBA 5CH8A 3K1TA 5EQJB 8OHMA 2JEZA 1HFJA 5IN5A 2FZCA 4BFTA 4J03A 1U7UA 2AFHA 1OBVA 2B37A 4OAQA 1XCGB 2W4QA 2D0OB 3AILA 4JOQA 4KH0A 4NZNA 4OJMX 1S0UA 1SQ0A 3GZTB 5GINE 5E9WA 2PD3A 1EZ1A 4GBMA 3WLKX 1QE5A 2PJUA 5HKAA 2VUHB 1KZ6A 3GT4A 3Q3EA 3DT8A 4MW0A 4CV1A 2PWZA 5DM4A 4AKGA 5H3CA 1K6MA 4RUKA 2YWCA 4FYHA 2WFLA 1F2DA 1MBZA 3MWFA 2VDUE 3JWHA 1KKUA 1XTQA 5AHRA 2QMZA 5KYXA 5KO2A 3Q9LA 1ZR4A 4RDIA 1H94A 1PG5A 1QTRA 5K0TA 1ZLYA 5JFOA 5EKDA 1N0VC 1R5OA 3SLGA 4D9FA 2ZIXA 2XXBA 1XQWA 3I42A 1K08A 3OQIB 3PFFA 1U5BB 3OPYA 3I53A 1R5NA 3K7EA 1GFSA 1KDRA 2J46A 2C0QA 3IQZA 5HQ3B 3J7TA 2QTZA 2Z57A 3BE5A 4Y7DA 3OWOA 5BMVA 1QG2A 3F49S 1KEPA 4BNHA 3CNBA 5KOHB 1JJFA 4BAGA 3EFBA 4WLEA 3ZOZA 4HNAA 2ZBGA 1UDCA 3I45A 3D1VA 2VNJA 2OHOA 2FWNA 2B7LA 2D4HA 4HDMA 3HO8A 3REQA 4CHGA 3F5MA 2Q9CA 4MVJP 4NP6A 2IZ6A 3PVZA 4CMAA 2PRYA 2Z0MA 5I4KA 4OJNA 3NBYC 5JXJA 2VNAA 4WHMA 2GN4A 4N7RA 4UVEA 3IDSA 3R5XA 2XCSB 3U56A 1TL7C 4AUEA 3NM5A 1R4AA 1E61A 1PQPA 1EEHA 2VDKB 1NN0A 1ZKDA 1MEOA 3PFNA 2P3LA 1GUAA 1B0UA 1U8EA 2V98A 3QF7A 4EO4A 5FUMA 1DP4A 1O6CA 2I54A 3IP6A 1TVEA 4KV7A 1JFVA 4DPKA 3EY9A 1XZPA 3B9RA 1BKSB 1IQRA 5FNVA 2ZJ8A 4HX5A 1SC3A 5K1ZA 3THSA 3SD7A 1CRWG 1QGED 1V1JA 4A5OA 3DYBA 3WWZA 4RYDA 4BZXA 1KJQA 2YC2C 1ZMOA 3OP1A 3ONFA 4MUFA 4WA8A 5AK5A 5DI3A 3ZDFA 2FRDA 1E1DA 2C2OA 4EHHA 1NONA 4NNPA 4RZQA 1K63A 4JB8A 2VTBA 2HCTA 3FD8A 4ZQFA 3RAPR 2CB0A 3L0CA 3AG6A 2PS9A 3IBGA 3REFA 4AS3A 1Z5UA 1EXDA 3TINA 5JFGA 1ZZEA 2XWJI 3GPLA 3QLVA 3BWYA 4NS1A 1MDBA 1WCXA 5A5EA 2X4GA 1Z0JA 3L4BC 3HUDA 5K09A 1G41A 1ZGHA 1KPHA 1MO6A 1QFXA 2I29A 2ZITA 1GKLA 1SULA 3BFPA 4LQLA 3NDJA 4QO8A 1EK1A 4UUMA 4ITVA 5I47A 1NVEA 1XN4A 3BTUA 1KJYA 2EKLA 2TMYA 2DGDA 4HSEA 4MR9B 5CB4A 2DQ4A 1IRXA 2R4TA 4C6SA 2Y1GA 5AM1A 3FR8A 3QU9A 4EFLA 3PEYA 1Y4ZA 1P9NA 3G0HA 3Q3IA 3UMSA 4EB0A 2WFZA 3CNEA 3NANA 3O8LA 4FD3A 3ENVA 1IOVA 5GADl 1C9DB 2JI7A 4BO3A 4R6WA 2P2NA 1P5JA 4OBWA 3WFJA 4E5SA 2R00A 4BKMA 5F1KA 4BASA 1QGUA 4F0JA 3HA5A 3GRVA 3E03A 4GHWA 3ADCA 3KT3A 2YN0A 1FS5A 3IXLA 4UCQA 2IDKA 5JNSA 4DXDA 3PRKE 2P3OA 4JJ4A 4RABA 1QLHA 3CW2A 3GJ0A 2I1VB 3TQCA 4RD2A 1OXKB 1F17A 3H7IA 2E85A 3NCTA 2O3SA 1ND6A 4UMEA 2XMRA 4ETIA 2FOLA 3A9WA 4NYIQ 1JG3A 2YWJA 4CM5A 3PHCA 4MAMA 1RMYA 2ZRLA 4BPRA 1EFKA 2A5GA 2EWMA 5D3MA 4YMUA 1JJIA 4WNAB 1WXWA 1TM4E 1J4AA 3K53A 3W2IA 4C07A 3LP8A 2FN4A 5I6DA 4F56A 2XF8A 3R77A 3SZMA 2DP4E 2HBYA 1RXCA 1FS4A 1SZJG 2ZBPA 3GEMA 5BN5B 4LKOA 3EMVA 3SZRA 3L0ZA 2P6UA 2XDQA 4LBVA 4BFSA 1NQ5A 4DR1B 3I6YA 4JI5B 1AOXA 1PKEA 2QTFA 4A8PA 5CBPA 2C9OA 2ZZMA 3U44A 5K3AA 5HQJA 1Z08A 2PX0A 3RK1A 2IEAA 2YJ3A 2YV4A 4O1IA 3O9VA 1ZK1A 4K9PA 3QJ5A 1SU8A 3QTLA 3O8QB 4Y2SA 3WSWA 4B3IA 4ZVRA 1DARA 5AK4A 2G36A 2UUPA 3R9IA 4EY3A 4BTLA 4Q4CA 1FRNA 4IKOA 2OXTA 4TXMA 1ZEMA 2IHUA 3B1FA 1VECA 4NJOA 1F48A 4HZUB 1U3WA 2YW9A 3GLKA 4BRUA 3KOXA 5A02A 3I2YX 3L7NA 2IYOA 3NTVA 4FP9A 1KBQA 2HPHA 1B73A 4KXFB 3NI2A 1H65A 1TZKA 3A04A 3FM9A 2F7SA 3HP7A 1Y37A 4ZVTA 4MRRA 4LOAA 3D2BA 4ND8A 3THYB 2OGWA 4DRXB 4LQ4A 5JVDA 1NVFA 2XOKD 3LMKA 2Z98A 4WKOA 4ARSA 1JPUA 2BLLA 4ZDJA 1LBIA 3E9QA 3HDHA 3MBIA 3GRKA 4Y2UA 4ER3A 1TTTA 4HDRA 3M1AA 4MW9A 5LMNB 3UB4A 3MM4A 4HYEA 4GI5A 4DA6A 3WWOA 2F3TA 2BONA 2CL0X 5DHSA 1T43A 1A9RA 3S40A 2BM8A 4V0RA 2IGBA 4I2VA 2PG3A 5E9JA 2F1HA 3W79A 4WY5A 4CF5A 3IUNA 1WAMA 4FGJA 4LYYA 5JW6A 2OAGA 4M0DA 5SYAA 3MN1A 4EUHA 1V8OA 3CV3A 3WJ7A 5KYKA 2Q5JA 3UICA 2OUKA 1NN1A 3PG5A 2AC7A 5EHZA 5JAQA 1II8A 2V5AA 4DJEC 4L5JA 4F04A 4DCPA 2NYAA 1DBIA 4MH0R 1EXMA 3M9WA 1JLHA 3FLBA 3QKSB 1ONBA 3TX2A 3ED1A 5BP7A 5K3SA 4HGNA 3MFYA 1I7NA 1Y5MA 1ECJA 5BURA 4EPVA 3M4YA 2ZSHA 1NN3A 3B20A 3FPHA 5I3CA 2A88A 2YDYA 3EVFA 1T5BA 1TCCA 3QI2A 4QNRA 5F1YA 3V2HA 3LBFA 1J23A 4JK3A 5TDHA 4OKNA 5I7EA 1ID8A 1K6XA 4DQKA 2QVBA 1GGJA 1N7GA 1I5EA 2BPOA 3R9XA 4BBZA 2FWRA 3ZZMA 1K98A 2JI4A 4BFXA 1XEXA 3DDOA 3DMRA 3Q3CA 1LLQA 4I6GA 5FL7A 5IN4A 4NH0A 4QYTA 1M67A 5B6PA 5C4GB 1RHMA 4RADA 1BN6A 4JT8A 3UMYA 4FMDB 1JMYA 4U6QA 1KVRA 1BXRB 1SXPA 4IP0A 5BUSA 1SBYA 3VZPA 3EYWA 5KNBD 2I33A 1QHGA 1EDOA 3O3MB 1WR8A 3E2IA 1CVLA 1GPDG 3DBOB 5HMMA 1N5RA 3UJDA 2DUMA 2J3MA 3JWIA 1GXSA 4HYQA 3ABQB 1RFGE 2WRZA 4GLLA 4OQLA 1ATIA 4LEIA 5DOVA 3RVRA 3T7AA 1GDTA 2QBYA 4NWIA 2WLSA 2WIBA 1L5WA 3VR4A 2CLMB 2X4DA 3KKOA 3P9PA 4ESVA 3Q0TA 1F8GA 2R8XA 1OTYA 3G0OA 1O7JA 4J0HA 3HUUA 3TEFA 1GKUB 1G8PA 1EZZA 5KTTA 5E2AA 4GL2A 3I01M 3HBLA 2GM3A 4ICIA 2XKBA 4NK5A 4CFYA 2Q50A 3LXXA 4BNZA 5CA1B 3T8YA 3LDAA 1Y7HA 3D4IA 4L1KA 1FUIA 5GMOA 3X43A 3IQGX 1OZFA 2BEWB 5CB8A 5EOVA 4HGYA 3J81A 4CMJA 3MJRA 2XUAA 2SKEA 2CNKA 2RCYA 5J9FA 2W2MA 4B87A 1G6OA 1BWSA 3THXB 2GWHA 3O93A 2P9CA 2H52A 4Y2TA 2JCBA 5AK0A 3E22B 3U9TA 1DIRA 3M4XA 3KU1A 1RI1A 1B4DA 2NXEA 3P9QA 1J8QA 3ITKA 4MPRA 2WVJA 5DNAA 4V02A 3JQ9C 4RCVA 4AM8A 2CLOB 3P9CA 2ABWA 5THKA 2XZLA 2V6FA 3O84A 5A1JA 3EF0A 1ODKA 3SKYA 2P9ZA 3GLFB 3LL4A 3ND9A 5B2EA 4XX0A 2DBRA 2RGDA 1THTA 1E1KA 3L3BA 3HUFA 2VP2A 2A1TS 5CX4A 3DH0A 3TLXA 5JCZA 1L7VC 4F2DA 2C04A 4DSZA 1HDZA 1T2VA 4B85A 3JX9A 1VI6A 1JSRA 3ET5A 2P2ZA 2QP9X 3WL7A 1XTKA 4YRGA 3GXOA 2DECA 2AFIB 1VMEA 2KS6A 2GWRA 1KYWA 1V5FA 1BD4A 1MH9A 1DEHA 3JSXA 3N8HA 1FJ2A 3E18A 3IPYA 4Q16A 3OOHA 4BNMA 1TMYA 4N12A 3IP7A 4C4ZA 2W48A 4F8JA 1W30A 5K3EA 4NK4A 2VK1A 2E49A 4Z9FA 1A69A 2HREA 1P0PA 2WM3A 2XNJA 1JQLB 2HADA 3DO6A 3MWEA 1TGVA 4R68A 3NIWA 5JCJD 3IMEA 3NJ4A 6Q21A 1X42A 1TIBA 4UFPA 2R65A 2EBFX 4OLAA 4I55F 4PAOA 3EVCA 4HFJA 2P90A 2X2EA 3DWEX 4E0BA 2W2NA 4XM1A 5EMKA 5LC1A 3THRA 4PXAA 3NHZA 1E77A 1SVOA 2QD5A 1ZL0A 4LI3X 2P8SA 1NOKA 2X22A 3L0SA 3PUKA 2VQDA 5SZKB 3WISA 3K70B 1Z6GA 2P11A 3FTEA 1RPNA 2UUBB 3I05A 3E53A 3V4LA 4QUDA 5BSWA 2DWQA 3IBSA 1P2BA 3C1TA 3MGGA 3BRWD 3CSDA 3FSEA 3TE6A 5T41A 4P0QB 2CBGA 2H4FA 2ZUEA 1M2VB 1NJ1A 2W2KB 4IFTA 4JQYA 1KQPA 1SCKA 3H5TA 1NZFA 4Z4CA 5HUJA 5I4BA 1LBEA 2A9PA 1T2AA 2ZE5A 3LOUA 3PXAA 3UB2A 5LZ4A 2FR8C 1M5TA 3HKDB 4S24A 1ISMA 1G7CA 1MG5A 2YUIA 2AVNA 4XIJA 3SSNA 2NNLD 1IWPB 5LYJF 5HEKA 3UAWA 3BFKA 2VHWA 4F3KA 1SQSA 4WDRA 4F6RB 5JC1A 3INTA 3GLRA 1L8OA 4P5EA 2OSVA 4K9MA 4BU0A 1QNLA 4FJ1A 3BK1A 2W0MA 2Y1CA 3F5FA 1KXZA 2J08A 1NXOA 1E3EA 1WE2A 4GLOA 3EGCA 8ADHA 3ZDYB 3CLVA 4N5HX 3X2FA 2A0UA 3VPGA 3A1UA 4R1QA 5KNDA 1ZM2A 1GD1O 1R15A 3L9WA 1OBFO 2C7GA 5DW3A 4DEVA 5BSFA 2BJHA 3M83A 2WB2A 3MTIA 2YKGA 3ZHUA 1OLUA 1ZBQA 2WSSA 3HU3A 5IVKA 2MINB 2ZI6A 3NYRA 2DLNA 4PLCA 5JAZA 1GZVA 3P97A 2OCXA 3EZ6A 2MWMA 3ISJA 3RAFC 1BWQA 5E7JA 6REQB 3LLVA 1FJXA 5C4IA 3BH7A 3GHYA 1RWNA 2ATXA 2HPVA 1DIAA 1NNLA 1ZWKA 3N0RA 1BX0A 4LRWA 4MVWA 4QDTA 1ZLXA 5JWOA 4J1NA 1USIA 2J1LA 2HTEA 3N75A 3O8OA 5IJWA 3CRQA 4MKGA 3CRVA 3O7WA 2FV8A 1JLSA 1SEVA 1JX6A 2YY6A 1A50B 4IKEA 4JI0B 2H4HA 4TV8A 5MGBA 1N78A 5LR6A 4IUBS 5EWJB 5FPPA 5BV2P 1P44A 2AOWA 3EARA 2YCLA 1HT0A 3ONDA 2RMKA 3GX1A 1J8DA 1ZC4A 1MB2A 3WLOA 4K6KA 2QTRA 3N8GA 1V11B 4IUDS 4CFSA 2IKSA 4GZ5A 4KO2S 4P32A 2I8LA 3OT1A 4UE6A 3H16A 4EKDA 1UPFA 4RD4A 4G0QA 4Y7CA 1OU4A 2VZLA 4I4TB 5ITVA 1MAUA 2JZOA 1FJGB 2R25B 2PKXA 2W4IA 1ZMBA 3FHOA 1M5RA 4JAVC 5IDWA 2XB4A 4OUDB 4OYLA 1J2UA 1Z0IA 2REXB 3H2KA 4MUGA 4TKVB 5FJJA 1YR6A 5ITWA 5BR7A 2X8BA 3DDSA 4RJLA 5JSZA 3GA0A 4KGXA 4S3MA 1SO8A 5G0WA 1TQ2A 1I3OA 3MJEA 2HSGA 1Z33A 3IC5A 3VI4B 2LP4Y 1CFJA 4ZT2A 3LQYA 3QI7A 4M53A 2OCGA 3U7QB 5EQTA 2CDAA 4AMGA 5BN3A 5FTLA 4Y9SA 4O2LA 5TQ2B 4RHEA 3G82C 2HRZA 5ECGC 3PKJA 2ODQA 3BWVA 3K9LA 2YVKA 1X8JA 1WCIB 3ZDBA 3KZOA 4BLTA 4MQ6A 5FLXA 1XWWA 4E5VA 1L3IA 2O0MA 1NUUA 3G7UA 2WK1A 5YASA 4B9EA 2VDNB 5CYGA 1YK1A 2O19A 3OUZA 4CL3A 1AN9A 1PV2A 1R4MA 3KQOA 4UM9B 3OFVA 1R6XA 2AFHE 2QUKA 1MFZA 3W3AD 3QLVC 1ZJZA 2CF6A 5LZ5A 5DM2A 2YFHA 5ADUS 1LCIA 1TQDA 1Y6QA 2WUFA 3P94A 4PLWA 2EJVA 4RANA 1EFVB 3OLYA 4NDAA 1KQOA 1OV6A 3MA0A 1ZH4A 3CWZA 3OTGA 5DB4A 2PMWB 3C3JA 3E9ZA 1JDSA 3FFWA 2GTHA 4MUNA 4QUIA 3ZKWB 4QLOA 1GN8A 1WP4A 4DQXA 2PLFA 2FPRA 1WW8A 4P38A 2BKEA 3K0SA 1T36B 4JQSA 4ARCA 2IW3A 1Q5PA 1FMFA 2XWPA 3HKCA 4HMQA 1UBGA 2J09A 3JPWA 3IOEA 4UUNA 4UU1A 4YMWA 1TYEB 1XLVA 1O95C 4O8CA 3GXBA 2JLXA 5DYGA 4RSGA 1G20B 1TEXA 1Z6ZA 3A25A 1FFHA 3ESXA 3BDIA 3U26A 4R8LA 1DZIA 1LDEA 2J3QA 3BH6A 1VLVA 2A57A 2JIQA 3B48A 1VFNA 4JB3A 4OHVA 1L1FA 8AT1A 1QRUA 1BVHA 2CD9A 1U8CB 1US8B 3BS4A 3CEPB 3R3UA 4QSHA 3WGHA 1UDWA 3QVSA 4URWR 4GPAA 3G17A 4YV7A 1ENPA 1UEJA 3E7XA 4LSMA 5K05A 3QHAA 1KAMA 1YC2A 1UINA 1J2RA 3LUPA 4FR5A 3ZWWA 3SC2B 2CCGA 3O4IA 1AGRA 1RRMA 2JD0A 1PK8A 1P1IA 2EJWA 4OQ4A 1OJ7A 2HJWA 3P52A 5C8VA 4YAFA 5AW6A 1KOJA 1PT7A 2RIPA 4G5HA 1YF3A 4U2CA 1Z6AA 2A5YB 3FWPA 4QGAA 4EJSA 1H1DA 4LE1A 1AKEA 1XOIA 1T5LA 3K0FA 2F90A 1BHJA 1EG7A 1ZVKA 3UT6A 2JVJA 3A6LA 2A5JA 2P4QA 3BXZA 1L8AA 2FE4A 2OV6A 3DDNA 3EH1A 1VKRA 3GZNA 2HV8A 2XA1A 3Q7QA 4OK6A 4V0NA 1V1MB 4YRBA 3J81k 2FFQA 2YQ5A 5K6AA 1OAAA 3Q4GA 3OEEA 5AVRA 4YQEA 4RDCA 5ISMA 2XA2A 2EZ4A 3FWKA 3ZXUB 1W2WB 1YAJA 3PC7A 4GXNA 3B6ZA 4MIYA 3WHLA 4YJKA 1CUJA 1U81A 1U8YA 4TMFA 3WZ2A 3AVUA 3VNUA 4MUAA 3S0JA 4FCCA 1CG6A 1Z36A 2XUIA 1Y63A 4H2DA 2VSYA 3GGDA 4H7PA 5TMBA 3I6IA 2BMAA 1YQEA 1B1CA 4CTKA 4V38A 5G1NA 3UUEA 3E3LA 1Y1KE 2FYTA 3DOOA 2BZ1A 5G1OA 2GXSA 3A4IA 2I3GA 4JKOA 1CTQA 2J4CA 1ILEA 2C5EA 4D4MA 2QI9C 3BX1A 1Z2DA 3K5PA 4XM2A 2WU4A 2CEAA 3F1LA 1YRQA 3R5FA 4Q3BA 4NATA 4RD0A 2GCPA 3TIGA 3TG2A 4LI0A 4RLFA 1M2NA 3AV0B 1JWBB 3DL0A 4NMLA 4IMRA 3LBIA 3N7AA 5AESA 4EFDA 5J47A 4R31A 3GQBA 4BXOB 1M73E 3RAJA 1DG1G 2J85A 3EQ8A 1X3LA 3L2OB 2WIKA 3NIBA 4ALJA 2FKNA 1E7MA 4KKXB 4TV9A 3RVDA 5C51B 4KR7A 3KKPA 4J0KA 3DE3X 4JN6B 3H99A 3UIEA 4BNKA 4CNQA 2HF7A 4C4YA 4K0RA 1MC8A 1XDUA 3A1TA 3BERA 3SKVA 4GR4A 4IF4A 4OATA 2WKSA 4GPZA 4RTMA 2CWWA 5I9SA 3JYOA 1H4VB 2JRCA 2Q3JA 4P83A 5E4TA 4CDGA 5JU6A 1ADFA 1WU8A 3OTHA 2WT4A 1E3LA 3VNBA 3W5BA 1RE0A 1YFZA 3PKZA 3SM9A 4O3FA 1EHIA 3PX7A 1F2UB 2X86A 1KJIA 2R8OA 3VAYA 1Z6YA 1C3LA 5FKJA 2ZUDA 2O2CA 3UN1A 2FP3A 3KZKA 3BT7A 4CKEB 3GCWA 2FEOA 1SIUA 2V7XA 1G8AA 1H23A 1O5OA 3A9CA 3L1HA 4UM7A 3IIMA 5E8RA 1ZN2A 2MSDB 2G8LA 1K27A 5BV8A 3B6IA 4ZV7A 2D7JA 1HQDA 3ZX5A 5E4FA 2VDWB 1VI5A 3GFOA 5D01A 4LYEA 3H11A 1Z0KA 1TJYA 4Z9YA 5HP4A 1GSIA 1N7IA 1RR6A 1VZ3A 1Y1LA 3EIEA 2PJDA 2O23A 4P3OA 1R0CA 1UJNA 1WXXA 1SKYB 2E4VA 1OIWA 3CB4A 3C74A 3E23A 3K72B 1Q16A 4FONA 3T1OA 2P9YA 3QPUA 3PQ3A 1J07A 4IV5A 3QOYA 4LZJA 5IW8A 1YBFA 4EY4A 5KNBH 1Y8ZA 3B60A 1VHLA 2AJLI 3ETLA 1SWWA 3A6DA 1YS4A 4YXFA 3H8VA 1VLJA 1VYUA 1IOWA 2NU6B 3EIFA 4ZYXA 1WSWA 4XWOA 1DKOA 2MT9A 1LSJA 4LSWA 3ZHZA 1JW9B 1X1QA 2PZBA 5H7XA 4GBJA 4EITA 3HB1A 3LF1A 3DZFA 4MTCA 2VPYA 3OEHD 4YIHA 4RBNA 1T8WA 4GVXA 4OHMA 1HTWA 5JMOA 3UJNA 2LCIA 3DAHA 1QU3A 3BM5A 1RQPA 4CF4A 4TL9A 3L7JA 5IM5A 4YCLA 4L2IB 1UIMA 2J9ZB 1E59A 4HAYA 4B2PA 4BZWA 1NPDA 2FN3A 1B3BA 4HLQB 5J59A 1GRCA 7ADHA 4CIBA 5EJAA 3ZWPA 3AKYA 3JQRA 1SPXA 1ZIXA 5C8YF 4KKVA 1JEQA 3OZBA 3NBAA 1HSOA 1F2VA 3CYFA 4C6TA 1E5LA 3H1AA 3AF3A 2X13A 3QE4A 3U13A 4KI0A 5KOIA 2TMDA 5K8CA 1Z6TA 1TUBB 2HTFA 2HK8A 2IEYA 4PWZA 5KX5A 3MIZA 4ZQCB 5ALWA 1BMTA 3ZU2A 4U3JA 4TYYA 3BFVA 4OI0A 2OWDA 4QUKA 4CUZA 2RGAA 5EJ8A 1G3IA 3TUZC 3ROGA 1R12A 1OTHA 5HK9A 1M0EA 3U37A 1L5OA 1M8GA 2G40A 3D5EA 3NQ41 4CMGA 4YPVA 2EZ9A 3JVUA 4HFRA 4JODA 1CDZA 3L84A 1K1EA 1NBIA 1ZD8A 4DYDA 4U9IS 2FRXA 3E5NA 2Q0QA 5FH9A 1DCKA 1XD8A 4L3OA 4IEEA 4MRMA 5BNWA 3IBFA 4DA4A 5HF8A 5DDIP 2XMDA 2VXCA 4QQKA 5LP6C 4CM9D 3JQ7A 2QZ9A 4Q4LA 5F9MA 2VHZA 1NMQA 4G8CA 5FIUA 3OQPA 1KPIA 2PL5A 4JJFA 1YKSA 1X9IA 2Q5OA 1GNSA 4N3BA 1E2MA 3KSRA 4Q24A 4Q7KA 4CLEA 4YYEA 1HF3A 1UMCA 2ZRQA 3PGLA 4Z2AA 1KSJA 5HYVA 1BJTA 3T9BA 1RRCA 4UASA 1YDMA 4U0KA 1UZUA 2B4RO 3RTGA 2ADMA 3IELA 1QHXA 4GMFA 4EGQA 3B89A 1O0BA 1ZDMA 1Z37A 1CUVA 2NXCA 1IIBA 1Y1QA 5ESRA 2VBCA 1ZN8A 4YV2A 3ASVA 3MUFA 3CHYA 3KYCA 5IULC 2F59A 1HLFA 4II7A 2NYVA 2BHNA 4NCKA 3ZHTA 1O94A 2HL6A 2PN1A 3SC3A 1W93A 1FB5A 1NVUQ 1VDMA 3H42B 4QG7A 3PA6A 5CIQA 2WW8A 4N5LA 1QRAA 4RY8A 3S2GA 2AT1A 2RK4A 3T9FA 2VP3A 5IWCA 3JQ8A 5DLYA 5JCOA 4BMDA 4GMGA 2A5FA 4C14A 3I12A 5CDSA 1WHSB 3JZAA 4A6EA 3GDOA 3PTLA 1BQEA 4HH3C 3SXUB 2Z2JA 5KCZA 4OBEA 3S8EA 1QIDA 1S02A 5K03A 4YT4A 3ZVLA 2JFFA 4COOA 3TNYA 4YV0A 4DMLA 1SHJA 1RBZA 1GAWA 3CISA 3RYIB 1UJCA 2HRDA 2B9VA 3TI9A 3DMTC 3DOJA 2IYTA 4JSYA 3NGLA 4BO0A 2WWTA 3DW3X 1MJFA 1V16A 2BLNA 2QIOA 3GC6A 4LF7B 1E3QA 3NWJA 3FMOB 4M0UA 4R5HA 2ONJA 5JXHA 3LA8A 1Z4NA 4K3UA 3F3MA 4OF4A 2EL7A 2IZ1A 1TAQA 2QVLA 5HRCA 3MPOA 1WULS 4BIIA 1LUAA 4YXWD 1IEQA 2XBLA 1O1YA 1KU0A 4ZEMA 2I2FA 5HKKD 2VP9A 1K7CA 4B6SA 4Q4HB 3D8HA 1C9KA 4R5MA 2UXDB 3HUEA 4Y2QA 2Y0BA 1CJSA 3KUDA 2QAGC 1JI3A 2R47A 3QXCA 1Y6GA 3LO8A 4CU2A 1AKQA 2FPSA 1KDPA 2X5NA 4WMLA 3EVNA 3ZZTA 1V1RB 4J07A 2V4MA 3G0IA 3DMGA 4LXQA 3U17A 3UG7A 2FG5A 5HX7A 1UKZA 2AA3A 3EGXB 4B3CA 1AGXA