4LECA

Human methyltransferase-like protein 21a
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
202
structure length
202
Chain Sequence
QKFHKPLATFSFANHTIQIRQDWRHLGVAAVVWDAAIVLSTYLEMGAVELRGRSAVELGAGTGLVGIVAALLGAHVTITDRKVALEFLKSNVQANLPPHIQTKTVVKELTWGQNLGSFSPGEFDLILGADIIYLEETFTDLLQTLEHLCSNHSVILLACRIRYERDNNFLAMLERQFTVRKVHYDPEKDVHIYEAQKRNQKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Protein-lysine methyltransferase METTL21A
publication title The Crystal Structure of Human Methyltransferase-Like Protein 21A in Complex with SAH
rcsb
source organism Homo sapiens
total genus 55
structure length 202
sequence length 202
chains with identical sequence B
ec nomenclature ec 2.1.1.-:
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10294 Methyltransf_16 Lysine methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4lecA00
5HFJA 2BM9A 2BR3A 2PX2A 4PYMA 3M33A 1EJ0A 1X1CA 2R6ZA 2HNKA 2XVAA 5BW5A 4QVKA 4GC9A 3HVIA 1UFKA 3KQQA 3UZUA 5LQUA 1NV8A 3UJCA 2OKCA 3EVFA 5K0GA 2ZBQA 2FK8A 2IIPA 3BZBA 4PYKA 4ER7A 1M6EX 4PCAA 5DM0A 3BGVA 4XUEA 4FZVA 2IP2A 2IGTA 3Q87B 4E31A 2NXNA 3MGGA 2P35A 2FPOA 1R74A 3I5UA 5JUWA 4X41A 5DXJA 3EEYA 3GRVA 3D2LA 3LPMA 3MQ2A 1KHHA 5IKMA 1EG2A 3GIWA 4IV0A 5K0BA 3A26A 2OZVA 3KKZA 4X1OA 4C05A 4YUWA 2ZIEA 3OZRA 2HV9A 3THSA 4QTTB 3X0DA 3R9XB 4PONA 3KR1A 1R8XA 4GOOD 3ID6C 1X1DA 3P2KA 2GAFA 3EVEA 5EVJA 1ZKDA 2B25A 3BWCA 3ELUA 3OU2A 4HH4A 4L7VA 3C3YA 5EMLA 2ZCJA 1NE2A 2Z6QA 1JSZA 5BP7A 2AOUB 4FGZA 2ONZA 5DTQA 5K0EA 1L3BA 4PYLA 2PT9A 3EGIA 2H11A 3E7PA 3REOA 3HA3A 3DP7A 5H02A 3OFJA 3EVCA 4JXJA 3VYWA 4R05A 5LR6A 2IBSA 5E8RA 1QAQA 3OE5A 2ZVJA 5HIMA 2AOVA 3G8BA 4EMSA 4ER0A 4AZSA 2BR5A 5EMMA 1WZNA 5E2AA 5M5BA 3NTVA 3HVKA 2ZLBA 2VS1A 3TMAA 1VPTA 2N47A 3LCCA 4FSXA 3BXOA 4XUDA 1XJ5A 2UYOA 2JHAA 1NW6A 3UJ8A 1KXZA 3LECA 2AOWA 3M6WA 4ER5A 5CVDA 4HC4A 3VC2A 3OE4A 2NXCA 2NXJA 4MQ4A 2EFJA 1ZGAA 5HIJA 2OB2A 5DTMA 5E9WA 1TW2A 3KQPA 1SVUA 3NDJA 4C07A 4CKCA 1JSXA 3MB5A 4GF5A 4F84A 5LQAA 4RSRA 2EX4A 1D2CA 1KYZA 4DA4A 3R0QA 4WXHA 2BZGA 3GCZA 3MTIA 3GRRA 2VZ9A 3TQSA 4YV0A 1UWVA 5GM1A 2PV0A 1VP3A 1DUSA 3R3HA 4OA5A 4Y2HA 1JR4A 4E32A 2Z6UA 1RJFA 3EPPA 2VP3A 4F85A 1INLA 2IPXA 4OBXA 3H2BA 2PXXA 3T7RA 1RJGA 4DZRA 1I1NA 4IWNA 1ZGJA 5KQSA 2PWYA 4UOEA 2OO3A 3FUUA 1D2HA 3MCTA 5EKUA 3KPWA 4EVIA 3L8DA 1MJFA 3CJTA 4GQBA 3NDIA 4LG1A 2ERCA 1ZHFA 3R6TA 3BGDA 3MCZA 2I62A 4YV1A 3M70A 3DULA 5G02A 2AN5A 3E23A 1NV9A 3EGVA 1L9KA 4GUAA 5CVJA 4RTPA 2I9KA 5F2OA 5CVUA 2P7HA 3KQSA 4LECA 2VDWA 5K0FA 3VC1A 1P91A 2A14A 3UJAA 2C7PA 1NBIA 5EEHA 3P9IA 2JH9A 5BXYA 2ZWVA 3NW9A 3GGDA 1RI4A 3CKKA 2G8NA 3SSMA 5DRTA 1WXWA 4RYLA 3B7PA 3SMQA 5DM1A 2ZZKA 5CD1A 3M4XA 1WS6A 3P2IA 1WG8A 3IV6A 5K0JA 4MHTA 2G70A 4RTRA 3KQTA 4RTNA 3G2MA 7MHTA 1NW8A 3LCUA 1H1DA 1I4WA 1R00A 1P1CA 3C6KA 2ZFUA 3RIEA 3EVGA 3SVZA 3ORHA 1AQIA 5T6BA 5KYGA 3E05A 3DLIA 5FADA 2P3OA 5ICGA 1OR8A 3P97A 2IH5A 5K09A 4LWPA 2F8LA 1FBNA 3TR6A 1F38A 5LQNA 4RTSA 1VP9A 1YB2A 1EQAA 2FRXA 1JQ3A 2PJDA 4V0QA 4YUZA 2YUIA 1WXXA 3ANXA 1YF3A 1G38A 5FCDA 3DXYA 2IH2A 3G2PA 3PS9A 4BLVA 1G6Q1 1JQEA 4E2ZA 5K0CA 5U4XA 3PTAA 2PSSA 2AS0A 3UBTA 1IY9A 3LBYA 3BKWA 5DTRA 5DRYA 3TRKA 2UYHA 1KYWA 2NYUA 3P9CA 4KWCA 4M37A 4DM3A 4CTJA 3GWZA 4QDJA 5LSAA 4QPPA 4QQNA 1R8YA 1IXKA 4CKEA 4FS8A 3I53A 4RVFA 4P7GA 2LD4A 3AWIA 2AOTB 1O9GA 1R6AA 3KPUA 3KQYA 3OZSA 2CMHA 3BWMA 2VDVE 3JWJA 2O57A 1VE3A 1PJZA 3DLCA 4PIPA 4QDKA 3I9FA 1XCJA 4KVZA 1JTFA 4FP9A 3SGLA 3PFGA 4RTLA 3KQVA 3ELYA 4HRAA 3HEMA 5DSXA 3AJDA 3JWHA 1P1BA 3DMHA 3SXJA 1M0EA 2AVNA 3GRUA 5FHRA 2XYRA 3EVBA 3GNLA 4ZTBA 5DX1A 5EZQA 4C04A 4ER3A 3DMFA 1ZG3A 5EKXA 5ICFA 3KR9A 3BWYA 3PLAE 3LL7A 3QV2A 1BOOA 5F2NA 1AQJA 5T67A 3NWBA 3U81A 5FQOA 3C6MA 3A4TA 5LQCA 3FUTA 4DCGA 4A6DA 2BR4A 2EG5A 4PGHA 2NXEA 10MHA 4KDRA 3G88A 2QM3A 5HOQA 4AZWA 3BGIA 3OFKA 5GIPE 4FR0A 3TM4A 3GJYA 3MERA 1SQGA 2NNWB 2OPBA 2V74B 3IEIA 4FT2A 4PYIA 4PWYA 5F2KA 3TPZA 3GDHA 1DCTA 3DXXA 2E5WA 2XYVA 1X19A 3O7WA 3DUWA 2PXAA 2PXCA 1M6YA 3UA4A 4NECA 2YXEA 2YQZA 5EQJB 3FRHA 1SG9A 4HTFB 5K01A 3NVMB 3VSEA 4X61A 3S68A 4C03A 2QRVB 3M6VA 3MTEA 5E1MA 2Y1XA 5E2BA 3A25A 1TPYA 1X1AA 2AR0A 5ERGB 5GP1A 1VLMA 4MWZA 2YXLA 4RV9A 3FPGA 5GM2A 5CCBA 3SSNA 2I6GA 4DKJA 2G72A 3QOWA 4R8SA 2XBMA 4R8RA 2B78A 2ZWAA 3HCEA 3JWIA 4GOLD 3UJ9A 5KVAA 2ZZNA 2WK1A 4HGYA 2ZULA 5GWXA 2OB1A 3P2EA 3NMUF 5EHGA 2AOUA 2H1RA 5D1HA 4F86A 3HA7A 4POOA 3LHDA 2ORED 3OCJA 1YUBA 2HTEA 3IYLW 2ZIFA 3OU6A 4PNEA 1EJ6A 1VBFA 2VDUE 3B5IA 4R6XA 4OQDA 2AN3A 4RVHA 4PIMA 5HEKA 3UWPA 1T43A 3OU7A 4ER6A 5LQJA 4RWZA 1VIDA 3GRZA 4BY9E 1YFJA 4PYNA 2C7OA 2O05A 2GPYA 3UJ6A 2R3SA 1JG1A 2ZIGA 1R18A 5CVVA 3DXZA 3FZGA 8MHTA 4KIGA 4PYOA 4RTQA 4RTMA 5CVEA 1JG4A 1P39A 4HTFA 1L1EA 3JWGA 2ESRA 4X60A 1HMYA 2CMGA 2P41A 2QRVA 3G8AA 4BLWA 4A6EA 3RODA 4RTOA 4YUXA 1YZHA 3ER8A 2AN4A 3KR2A 5EC8A 3EMDA 1Z3CA 1XDSA 2XVMA 3FPHA 3M6UA 4R6WA 5FWAA 2DULA 1RI1A 1DL5A 2PLWA 1RI5A 3CC8A 5K8VA 4PCLA 4BP1A 5DSTA 4Y30A 4CKBA 3MHTA 1NBHA 3UJ7A 2IDJA 2IBTA 4P7FA 5E8JA 4GBED 3OPNA 1X1BA 4YMGA 3PT9A 5GINE 5CCXA 4P58A 3LSTA 2P8JA 3M6XA 2PX8A 2HMYB 2FHPA 5EHIA 5FULA 5C9ZA 3KPYA 2FCAA 5E1BA 3NVKI 3SR4A 4HGZA 2AOXA 5DM4A 4C06A 2WA2A 3CJRA 1MHTA 4E2YA 2YR0A 3SX0A 1XDUA 4B17A 2G1PA 5DX0A 3HVHA 4M36A 2PBFA 3AXSA 2KW5A 1XCLA 4PINA 4DCMA 3K0BA 4E30A 1F3LA 3UA3A 2ZZMA 1SUSA 3G7UA 3ELWA 4QQKA 1NT2A 5KQRA 3MAGA 4QTUB 1YZ3A 1U2ZA 2I7CA 2H00A 3G2QA 5HILA 2ONYA 4OX9Y 3GRYA 3FRIA 3HNRA 3G5TA 3HCDA 5FQNA 4GOND 3UFBA 3V97A 3V8VA 2GA9A 2P3LA 3PVCA 4QVGA 4RX1A 5HZMA 3LDFA 4U7TB 2JH8A 1VL5A 3T7SA 2C7QA 2EJTA 2IH4A 3KHKA 5EMJA 3BWBA 5FTWA 1QANA 2G71A 4YUVA 1XTPA 3T0IA 4H0NA 1ZQ9A 3HA5A 1EIZA 3OZTA 4C4AA 3FTDA 4V0RA 2EJUA 2DPMA 2PKWA 3NJRA 1JG2A 3FUVA 4PGGA 2B3TA 1D2GA 3HCFA 5FHQA 4CTKA 3FUWA 3LBFA 3C0KA 4E70A 1ORHA 3LDGA 3KPVA 3LKDA 5E9JA 2CKDA 3FPFA 1NKVA 3KU1A 1Q0SA 1G8SA 1G60A 3GO4A 2JHPA 2OYRA 3FTCA 1ORIA 2PY6A 4YMHA 4IV8A 2CL5A 3DMGA 4AZTA 4OA8A 4DF3A 5JR3A 3B89A 3FUXA 5EZSA 3T7TA 1G8AA 1O54A 2OXTA 1QYRA 1XDZA 1XXLA 2GLUA 3ELDA 1KIAA 4KW7A 5T64A 3O4FA 5FUBA 2JG3A 9MHTA 3KPJA 3P8ZA 4CWAA 4M7RA 4MTLA 5LQRA 2WA1A 3Q7EA 5CM2Z 4IKPA 4U7PB 2UYCA 5ICCA 1L3IA 4XCXA 5P8WA 5D1NA 5FWDA 4E2XA 2QE6A 2O0LA 3A7DA 4E33A 2O07A 2JHCA 3BT7A 5EEGA 2BM8A 1SQFA 1UIRA 1V39A 1BC5A 1FPQA 3IHTA 4ISCA 4AZVA 4AUKA 3THRA 1NW3A 3TLJA 1YFLA 2OBFA 1B42A 2HR1A 2PX4A 4OBWA 3TM5A 2FK7A 3B3FA 3NWEA 4GC5A 1RJEA 1BHJA 2AOTA 2Q41A 4HSGA 4XUCA 4AX8A 3LCVB 1KPHA 2YTZA 2ZBPA 1RI3A 2O06A 1AV6A 1N2XA 5GOZA 3CBGA 1QAOA 4PYJA 2YXDA 4GEKA 3UJBA 3PB3A 3G89A 3UJDA 4Z2YA 1XVAA 2HWKA 3G5LA 3PFHA 3A27A 2P3QA 2JJQA 3PX3A 3EEOA 5CUQA 3I58A 1RJDA 3KQOA 4WVLA 2PWPA 3CCFA 3CJQA 4RVGA 4K6MA 2NP6A 3I64A 1JG3A 3HCCA 3CVOA 2PT6A 5DT2A 1AF7A 3AXTA 5C0OE 3B3JA 1KPGA 4E2WA 4YUYA 1Y8CA 4RTJA 2Z6AA 4MIKA 4P7JA 3ME5A 5E1OA 2CWWA 4OQEA 3BUSA 3GXOA 5IH3A 4FT4A 3LGAA 4EKIA 1VQ1A 3BKXA 5BW4A 5KS2A 4FSDA 3EVDA 4BP3A 5HIKA 3FYCA 4EQZA 2UZ4A 2B9EA 2UYQA 3KR0A 1SKMA 5EPEA 2FYTA 5EOVA 3K6RA 1TW3A 5K0LA 2GB4A 5DLYA 5DWQA 1NW5A 1EAMA 1JTEA 1KR5A 2P7IA 2PX5A 5DM2A 5K0NA 4C08A 5C1IA 2QY6A 5ICEA 2IDKA 3E8SA 1IM8A 1I9GA 1JQDA 1KPIA 1KP9A 2AVDA 2ZTHA 3TFWA 4EKGA 3SM3A 2IFTA 3FPEA 5HIIA 5DPMA 5FA8A 3ERCA 4KRGA 3DR5A 4LWOA 5FA5A 3TKYA 2XYQA 3TOSA 5EMKA 1HNNA 4DQ0A 4GOMD 5LQKA 4KDCA 4P7KA 3WSTA 1PRYA 3HCBA 3DOUA 2QYOA 3F4KA 4G56A 3HVJA 3TKAA 1RI2A 3R24A 5E9QA 5MHTA 2PGXA 3ER9A 1FP1D 3EMBA 2YX1A 3O31A 5DXAA 3DH0A 5EG5A 1O9HA 2B2CA 3GU3A 1N7IA 5EGSA 4X63A 1Q0TA 5E1DA 2OY0A 5B1SA 1QZZA 1QAMA 4BLUA 4QPNA 4O29A 2K4MA 1WY7A 1SUIA 2BH2A 3HTXA 2Y1WA 3HM2A 3FYDA 3B3GA 1G55A 2ZW9A 3C3PA 4KIFA 5K03A 5CIYA 3HCAA 4DMGA 2ZBRA 1BKYA 3QOXA 4YV2A 3G2OA 3EGEA 4RVDA 2ZSUA 5EIWA 3DTNA 2GH1A 1NW7A 3EVAA 2P40A 5EIFA 2PVCA 4EK9A 3AY0A 1FJXA 2NP7A 3P9KA 1L3CA 1N7JA 2GS9A 3FTFA 5DX8A 2P1DA 3LX6A 3KQMA 4PYQA 2ADMA 3LKZA 3CGGA 3HP7A 4CXMA 4HG2A 5GIOE 3EVZA 3PX2A 2AZTA 5K05A 2V7EA 4ATNA 2YVLA 3FTEA 2C7RA 4RTKA 3P71T 1FP2A 3SSOA 3RW9A 3A7EA 3LDUA 4M38A 3FPJA 3P9NA 3KQWA
chains in the Genus database with same CATH superfamily
1YKFA 3IERA 5DNYB 4G5OA 5MDHA 2XVAA 2WV7A 3CNEA 3RU7A 2A59A 1RIFA 5ILOA 2ZU0C 1N0HA 2IT1A 3SM9A 4IDNA 1CB0A 1EWRA 1NQ5A 1P4AA 3NOOA 4J07A 1L7NA 1ABEA 1P74A 1Q19A 4MW6A 5AKKA 4D4GA 3VNVA 4E03A 3BGVA 5D87A 2ZRHA 2HWWA 4B85A 4KFTA 1NDHA 3LUCA 3SBXA 2WIKA 4W5JA 1N6RA 3W8RA 4KOEC 2P35A 3VX4A 1R4AA 1RRCA 1KKUA 3H2KA 1A8SA 1HDYA 1MG0A 1I7QB 1Y4ZA 3RRXA 3A11A 3RHTA 1LBIA 4OQFA 1I5RA 4AUMA 3GJ5A 2J7PD 4DM4A 1C3JA 2BHLA 4ALLA 2OZVA 1GUDA 4IIGA 4AB1A 5KVVA 1WAMA 1KEPA 3EG9A 4JJEA 1Q0UA 3QEJA 3JQCA 3OM0A 2GYYA 1DHTA 1DE0A 2QSUA 2XEDA 3PYLA 4REQB 5C52B 4JFAA 4AF6A 2GK6A 3UV7A 2H6EA 3U26A 2GAFA 4OIFA 3AEUA 4MCAA 3VKHA 1JA0A 1G2OA 2H1HA 3OHPA 3DEYX 4BFUA 2X6TA 3ZU3A 3C3EA 3R7AA 5FOXA 4CU2A 3REOA 1M2NA 1SXJE 1U9IC 3FWKA 4YK7A 3EIEA 2HJVA 2EATA 5F1PA 2PUFA 4B5LA 3AKCA 4AO7A 2YMLA 1DU4A 4LGMA 1LNQA 4IHJA 5E8RA 4IXNA 4MCJA 4AXXA 1CHDA 1JLMA 1LW6E 1X1EA 2BMAA 1H4VB 3G8BA 3THXA 1M6WA 3IVGA 1Z2CA 3NTVA 1C7FA 3HFGA 4WGGA 2VZ0A 1NA5A 1QJ4A 3QLTA 1YBMA 4MCHA 4URYR 3IPAA 5KI6A 9ATCA 1LTHR 1ZMTA 3M6WA 3DEAA 1SZDA 4URUR 3AUYA 4LJ5A 3WK5A 3M4YA 2H7CA 1DC4A 3WNQA 2CD9A 4DNQA 3RU3A 1I7SB 3H2JA 3AY7A 2C77A 1A9XA 3QX8A 1IMOA 3FHLA 5AVWA 3A1FA 3B82A 5LQAA 3M7IA 1F2TA 2O2YA 2PSEA 4JWTA 4M6WB 2I1WA 4MP8A 4ALNA 3FKSD 4OQ4A 2WTAA 1QP0A 2FPWA 3EUWA 2ZWMA 2ZJFA 3S55A 3N8IA 1TFUA 4M8IA 5IDVA 4I1OA 6GPBA 2CCKA 2RGNC 3AM1A 4JKOA 2FTKE 2GM9A 3Q5DA 4JN6B 4RZXA 3RJTA 3DE0X 4DYVA 2AMFA 4DSZA 2QTGA 2VP3A 3JAKB 4I9NA 1GGEA 5KNDA 3W6PA 1E9RA 4DG9A 5AVVA 1QZUA 2RHTA 3ROEA 1FDVA 1TJ5A 2IEDA 3Q8MA 2WZDA 2OXFA 4K2HA 1KZ1A 2I55A 1WCXA 3R7BA 1HLFA 1Q84A 2QQGA 2VZ8A 3TQIA 3IQEA 1CUCA 1V6AA 4M0UA 4WK4B 1Z06A 3LZCA 1DG9A 3GNQA 3KAJA 3VTKA 1QDUA 2VO1A 1NV9A 4XJSA 3LP8A 5C1OA 2XOKA 1K4MA 2P9GA 2ZBGA 2ZIUB 3OPYA 4U8GA 4QTYA 3W2TA 1T1RA 5E4JA 3ZGVA 2F1JA 2HCBA 2D59A 1ZONA 3AETA 3B3QA 4DUZB 4J4BA 2H5EA 3WK6A 3N05A 3TEJA 2HA0A 3QXSA 1V3QE 1P9LA 3I92A 1AN9A 1AQYA 2EWMA 2WAAA 4YRTA 2H18A 4U9IS 4XOIA 2W6JA 1MG5A 5GADl 2YWRA 4AKIA 4WZAA 1X15A 4YQZA 1NXTA 5IBRA 4LKRA 3O82A 2OBYA 3KBOA 4QYIA 1SKUA 4MXDA 2AXQA 3ZKWA 2NT4A 3ER9A 4RBNA 4PLYA 1VL8A 3WXMA 3T1QA 4ZI7A 1AKYA 2CVZA 1CC1S 1CVLA 2P79A 3H2SA 1PEAA 5AJXA 3P4YA 1W8IA 2BJVA 3QJ5A 2I2DA 1B2RA 2FKNA 3O2QB 3QOFA 2H31A 1PD1A 4HPXB 3OPXA 1C1DA 1CUSA 2J32A 2M6KA 1XD8A 4XWKA 4HAOA 3JQQA 2OVFA 3CZRA 4H7HA 3NCTA 2DECA 4MYHA 4TYWA 2J9FB 3AF6A 2GBLA 2CLIB 3EXHC 5CJJA 4C4PA 2EW2A 1PFQA 3JD3A 1E1MA 3Q3IA 5B6JA 4KNWA 4UTPA 3OQHA 2QD5A 4E2ZA 1I13A 4EG4A 2YJTD 4LYHA 5CB8A 3TCKA 4BX0A 1MXFA 2PSSA 2PK3A 2R5WA 3HSKA 1LBTA 4QQ8A 4D0GA 2OZLB 1BWPA 3IDZA 2RAFA 2PMEA 5KAPA 3RHSA 5AVTA 1QBGA 4LF9B 1MIOB 3HLTA 1XZAA 2QNIA 4E5MA 4Y6SA 2FXVA 1ONNA 3EUFA 3OZFA 4P31A 1YR9A 4OSOA 5A3JA 2IUFA 5HJ2A 1RYNA 2WKSA 4CKEA 4RDXA 4P33A 3PL5A 1G5QA 3AWIA 3FMFA 1G8JA 2YXBA 5AKZA 5GJCA 2AC4A 4CLRA 3U4DA 1CY0A 1SVNA 2WIBA 3I9FA 3R7NA 3VKWA 2P27A 1JNXX 2Q3FA 5AW6A 3LLUA 1BDBA 1JJ7A 2SECE 4IIUA 2EYUA 3L7DA 1FL9A 3AVVA 5I7FA 5DX1A 5BR4A 1Q6ZA 3BHNA 4IXMA 3ZIAD 3JQFA 1JDPA 2P6NA 5CH3A 1XPRA 4QYSA 5CFPA 2Y2VA 3EUEA 1AJEA 3PC2A 1AE1A 1DC3A 2R97A 1TJNA 1R88A 4PPGA 2RH8A 3OHSX 3PGVA 2C2BA 3O8OA 4ZOAA 3H11A 5H16A 3UB3A 1NQVA 2NSHA 3DOOA 7REQA 5HTOA 3JQPA 3T5BA 3ECAA 4D5GA 1CFZA 5BSMA 4ARAA 1ODLA 3BA6A 3HJUA 4H3HB 1DIHA 5DP1A 2XVXA 1SK8A 3QPUA 1Y81A 1LK5A 3NVMB 1QXSA 1IUNA 4OREX 1JFTA 1WW2A 3FNGA 3Q9UA 4DY4A 7ADHA 3RARA 3KQKA 5BN3A 1G4HA 4GE3A 3U7GA 4O4LF 4XGRA 2I6GA 4ZQGA 5F35A 4TMXA 3B9RA 1A9RA 1WL8A 3FGPA 2X1MA 5CH8A 3RM3A 2HNBA 1CIJA 3R0ZA 2H1RA 1XAGA 3FPLA 4DWWA 4PS1A 3MD0A 2FY8A 3D7MA 3Q85A 4X7RA 3L8HA 3TIFA 3GEGA 3N53A 1V16B 3F8SA 1ZIDA 2DLDA 4OQDA 5CNMA 1RJ9B 4QWMA 4ER6A 3T1YB 1TE2A 2NQTA 1L5SA 3ADOA 4GSLA 4LRTB 2CFSA 5AXDA 1SCJA 3RASA 5AKYA 4UOQA 2QF7A 3WLPA 2AE2A 3JZIA 2RGCA 3HEAA 1EVQA 2X23A 2R8EA 4BAUA 5DTEA 2ZB7A 3E22A 4R2HA 4Y1FA 2NUAB 5AOVA 2MYPA 3GRCA 4OVKA 4HTFA 4ZC8A 1KSFX 4EJSC 3EXHB 1JFSA 2JJYA 6REQB 4RTOA 2H1WA 2IYWA 5EVCA 5GPBA 2O2XA 3USCS 4FEEA 2J9GA 5DYGA 3C87A 1TRKA 1RXUA 4ZRMA 4IWXA 4JJGA 5K8VA 1W0CA 3C45A 3DR3A 1P72A 3WMEA 1O95C 4B82A 2D7DA 1GPUA 4X24A 4LZLA 4F4CA 2HMYB 3GBSA 1QGYA 4BGIA 4X84A 2LDBA 4WJKB 5ABPA 3QHPA 1DBPA 3PITA 2DFPA 1AC5A 1CJTC 4TTQA 3A6KA 3JAWA 2PZFA 4B17A 1UPXA 1P6UA 1KIFA 2JB9A 1DTWA 4X00A 3KAQA 3W5BA 5JJKA 5CYFA 3G49A 4M0CA 4Y6QA 3UAOA 4MUIA 4CUKA 4QQKA 1IK4A 2NU7B 4CDRA 1J9EA 1NT2A 5SYAA 3LVRE 3HXMA 2CSXA 1NMSA 2I1LA 1ACJA 3G0OA 1FJHA 3R20A 5ITSA 1HYQA 2KMLA 2VTDA 2IUYA 3COZA 4YR7A 4MRMB 5CLLA 3D6NB 4JU9A 4NCBA 3M9LA 2GWRA 1Z16A 2AG0A 1Q21A 3GFGA 3BMNB 3BORA 1ZGHA 1EZ4A 3HNRA 4LXXA 4CM3A 1FEZA 3V8VA 1CUAA 1Q20A 3PVCA 2HWUA 3CXUA 3IDSA 3K35A 2JHGA 3RT7A 4DLBA 1IB6A 2VAPA 1XRQA 2VNAA 4LC0A 3T7SA 4W8OA 5EIHA 2A30A 4Z7JA 3AKEA 3BWBA 3M3PA 5CB4A 2YHSA 3HA5A 2BFBA 1JYFA 4GYWA 1QQTA 3VR4D 2JAOA 5DKFA 2B8JA 5FHQA 3ZWVA 2JJ1A 1OTYA 1POWA 1H5NA 2QSYA 3SCZA 4BTVA 4JHLA 5KYTA 1JN0A 2CV0A 4JKYA 4FYJA 2ZR7A 1T35A 3LT2A 5COAA 4DEYA 4G0PA 2JHPA 4UM5A 1JWBB 1OFTA 3DAGA 2OP1A 4JB0A 2TMDA 1Z5VA 4XPZA 1J90A 3CPSA 3DLPX 5IBPA 3WYDA 1JEYB 2DTDA 2NTEA 3O03A 5EZSA 3R1IA 3DEIA 1O54A 4MR7A 1N2CA 1T3GA 3PTZA 4GPAA 2Q5LA 5FUQA 3DCNA 4N6GA 3K2BA 2D3WA 5DNEA 2ZRCA 3PYXA 5DISB 5LQRA 1MTOA 2GF0A 1U0EA 4QSHA 5IEBA 1DP4A 4UMVA 5BV1A 4WACA 1FLNA 1GZ6A 1XX6A 2JFZA 2C5EA 1Y8RB 4L2IB 4H7FA 3WK9A 4NHEA 1E7YA 1TK2A 3LBNA 3BT7A 1R6UA 3A6DA 1M1ZA 2IKSA 2WBLC 4JY7A 5AJTA 1W0JA 2W8ZA 1OFVA 1XU9A 1YH3A 3GK3A 1SR8A 2OK8A 1JHXA 4KBGA 3ZDYB 1LLQA 2HUNA 3H13A 4FKBA 1QWOA 1XLWA 4ED9A 2O5VA 2YQ5A 2FW8A 1DTEA 4HSGA 2Q41A 3PRHA 1P2FA 3WWPA 1ZVJA 4EF6A 1NR1A 2VQDA 3KC2A 4KK4A 4HRVA 3FGNA 5M5BA 3L6OO 1ECCA 4M1KA 4ITUA 2HWKA 4KR7A 4URXR 5DGCA 4Q9IA 2PX6A 4QU8A 1RQGA 4GICA 3KHSA 1O87A 2PWPA 1KU0A 2OO5C 5BYBA 2O7RA 2E4UA 3RYHB 4ZPJA 3LWDA 2B2NA 2GI4A 3CVOA 4RVCA 1JU4A 4ECEA 2J33A 4MB6A 4YASA 4P3OA 3WHIA 1UP7A 4AJKA 1T4GA 1GL3A 4UEJA 3LGXA 2OFWA 3K4PA 3O0TA 3OM9A 4B44A 4D3FA 3RIXA 2BDTA 3IP3A 1TGVA 5J4KA 3SF8B 4TMKA 2YV5A 5BVGB 1VQ1A 1EK6A 1ZUIA 4EA8A 2V8BA 4OLAA 5F12A 1KL7A 2OM2A 1A04A 1PWYE 4M7WA 2IOQA 2XLBA 3RFUA 5HKBA 3D4BA 3KE8A 1KHTA 2VSXA 1YK1A 2FYTA 5CU7A 1M33A 3EWAA 4YN3A 3NPMA 4JV5B 1D8AA 2PIDA 3JZMA 3Q1LA 2R6AA 5LBTA 2MYNA 5HGJA 1Q7BA 1A95A 1T9DA 3HUFA 4P35A 3A36A 3W6ZA 2CHGA 1KEEB 3T9BA 5JAIA 2ZUDA 4CLHA 4EARA 3ETLA 5F4BA 2NZ2A 4CG3A 3DQZA 1ZY2A 1S9HA 2QTZA 4LNUB 2IL1A 3FM9A 3R3UA 3D3KA 4W1SA 4DL9A 4B3GA 4RC9A 3WSTA 3OUZA 3K6SA 4HDAA 4OLBA 2QN1A 3FMOB 4C20A 5H3HA 3ZZ0A 3Q72A 1VKHA 1XF9A 3TRJA 1Z0KA 2YX1A 3KJEA 1ZOIA 2HFJA 3UMMA 1CXZA 3CT4A 4N0QA 5B1SA 1F0KA 4Q4AA 2CE7A 3AUXA 3PEUA 4PN7A 1CUIA 1SQSA 4O29A 5AOBA 4KG7A 3UJ3X 4GLFA 1J5XA 2O8VA 5GOTA 1SBIA 1XTJA 1W19A 3LMKA 4AG6A 1TQ6A 3RTDA 2BHTA 1E66A 3EGEA 4G1MB 4PZLA 2EFHB 3SKXA 5EPOA 3GP3A 5KOHA 1TADA 5J5VA 5J4YA 3GPBA 3MMPA 4GXRA 4JDPA 1ZLXA 3RFXA 3D4IA 4UUQA 3KKLA 4YCCA 4CQMB 3LOUA 3FCYA 2V1XA 2XMBA 4BFLA 1X39A 2W6ZA 4TLMB 1CP2A 1YL7A 3B60A 5ADVA 2PT5A 5MN4A 1JDUA 2XVYA 3HP7A 3TAHA 3SS7X 4C0WA 1KI7A 4QFMA 4KO3S 1O0SA 1Z35A 2FSGA 3AM3A 4ZOEA 4ZALA 3OX4A 2YJ6A 1LPNA 3PKZA 4GBMA 4EYSA 2JCBA 1OTXA 2UYYA 1HUQA 2BC9A 2PZJA 2W2MA 3KQWA 2JGDB 3DL2A 4H31A 1BX3A 1FTWA 5AKHA 3S2FA 3AU8A 2I22A 3VMFA 3ICQB 3HVIA 1L7BA 1UFKA 2OK7A 3AR3A 4EFLA 3LZDA 4GMHA 3QXHA 3HCWA 4GKBA 5TT0A 1KSGA 4F6LA 2FPPB 2WYWA 4MW1A 1KMHA 5EZ5A 3D43A 3K0KA 5LD2C 4J1QA 4L74A 1Z0ZA 1FVHA 5FLYA 3WAGA 4S1OA 5EJGA 2ZI3A 5KYYA 5CTJA 3R5TA 3B78A 3RF6A 2PN1A 5FR1A 2GETA 4Y6RA 3GQBA 1B8OA 1CUEA 3T5CA 4M98A 3EBLA 4J0KA 2AI1A 3KM0A 1AIPA 2NZXA 1V25A 2VPWA 4FXPA 5DT9A 1ETHA 1MA3A 1VPLA 4BCCA 4D80A 3NBAA 3RVJA 2PUJA 1TUBB 4FJ1A 4IIDA 2C8JA 4V0LA 5IF3A 1XZMA 4TMZA 1S2NA 2O2DA 2QRPA 4IRMA 2JEYA 3TLMA 2YHUA 1O96A 3WR5A 2FU5C 3ZWQA 3G8DA 4XAQA 3DZHA 3SJUA 1K7EB 3ZVRA 1U80A 3P2KA 1KTIA 4ZV9A 4BEJA 1EFRD 1GPKA 1U98A 3GEPA 3OU2A 1Q7GA 4DXHA 5JFTA 5LMUB 3V8BA 4ZIRA 2GZDA 3KETA 2BKAA 1FU8A 1QYWA 4N4AA 4PYLA 1LU9A 5H59A 4E07A 5JI3E 3IT2A 5TIIA 4G67A 1KOGA 4UW9A 3WSVA 3MINA 1EUYA 1D4ZA 1KI4A 2YQ4A 1UZAA 3QBEA 1ISJA 2BCEA 2VP9A 1JMVA 1IQRA 3HNOA 2J0QA 1IBCA 2O2JA 2G9VA 5E2AA 2VJKA 4XWYA 4ANFA 2DFDA 4KREA 3HVKA 2ZLBA 1KS9A 1UDBA 2M6RA 1R64A 1XBTA 2N47A 4H1VA 3VU9B 4JQSA 4UD6A 4ZQIA 1N6HA 3ZYZA 1A9TA 1ZIOA 3U7QA 1GQQA 1NVGA 2P9QA 4LHVA 4RHFA 4I9GA 3RVOA 3BSSA 2ZWPA 1SU6A 4K9RA 2OB2A 3AKYA 3NX4A 4ZVTA 5TGZA 3ZJUA 3AF1A 3KOOA 2O59A 1IN6A 2FLVA 3EGOA 2WUDA 1J42A 2HCTA 2UUOA 3GC6A 3TBFA 4WA8A 4BNIA 4F84A 1W36D 3CURA 4W9NA 5LL6P 2XYHA 3RT1A 1DQRA 1EGAA 3DHEA 2R1UA 3I0NA 3F7TA 2H52A 4QM6A 1I2AA 3FLMA 5GM1A 3HNPA 1NYRA 3V8RA 3TLGB 3NAGA 4QFDA 1TF2A 1LVHA 4FHCA 4IMPA 2IWRA 2JJ2D 4C2AA 3OECA 5TSDA 2P5TB 1DZIA 4L8WB 4Y6PA 1R5BA 2Q4DA 3ZI0A 3WLSA 4HMPA 3LUDA 4HB3A 1Z73A 5DBGA 4IUDS 2JAQA 3JVIA 5EIAA 5H9VA 5JNWA 3O94A 1PGPA 3AHDA 4RD6A 1XZIA 1ODJA 1SXJA 2GD2A 3J7TA 2LKDA 2FPLA 3KYDB 2OO3A 3FUUA 2WD8A 3IAFA 4PLGA 2R1TB 3HYSA 4MA0A 3P27A 3T9AA 5AM2A 5JXJA 4YJ2A 3O8CA 1U1GA 1YCGA 3RI3A 2DX7A 4NV1A 2CCGA 1P4RA 5G02A 3HU5A 4M0LA 4G5HA 3RJMA 4BV2A 3I6MA 1V9CA 1E9VA 4H6WA 2FW0A 1K75A 1R1DA 4I4TA 4F11A 1C8BA 4I7EA 5EEHA 3VNAA 1RQLA 3CT6A 3IL2A 3MCVA 4LBZA 1U3FA 3PSHA 1TVCA 2G8NA 2PJUA 3E9CA 2QJWA 3SOPA 2JD0A 3IIIA 4GVXA 3GL9A 4FMDB 2PYDA 2PUTA 2DQZA 3U3XA 5J63A 4IS3A 1RQRA 3ZZTA 4MHTA 1T0JB 3KVVA 2HYDA 3KK0A 1T36B 1Z0IA 2R8YA 3G6WA 1I4WA 3C6KA 3J81A 3EQ2A 1VCIA 4HVAA 1T0BA 2DCUA 3H4TA 4HQFA 5DHQA 4Z9FA 5IAJA 1KOFA 3CW8X 2J30A 2ARKA 4CL0A 5KTPA 4Z3OA 5AK6A 2CUKA 3SJCA 2L0XA 2XTZA 1QVRA 2LVBA 1U9CA 5K4AA 5ICGA 2V7QD 1J0DA 4F45A 1W93A 5KNCH 4ZA2A 2W8BA 4CCAA 4EHJA 3B5JA 3UAYA 1CR2A 1E4OA 1KAGA 1YXMA 3OQ1A 3ZBQA 2X9QA 2HIHA 4M53A 2Q5EA 4FOLA 1TA4A 4OHWA 5M04A 4R1QA 2ZWIA 1T0HB 4WOJA 1NMXA 4J6FA 2OGTA 5FCDA 1G6Q1 3TGWA 4EQ6B 2EV9A 3V7WA 1Z2OX 3AESA 4B3DA 2ENWA 4BBPA 2VYCA 1D0VA 4DW8A 4X66B 3U4IA 4X1IB 2R8RA 1U5AA 4DQUA 2AEJA 4WFKA 2VATA 3KYIB 5L3SB 1JIVA 2R25B 4MWCA 4PXAA 3DMRA 2IELA 2XBUA 1LFAA 2IZOA 4KODA 2WU4A 2YNMC 2CUTA 5FV7A 4F5YA 3GZJA 1V7QA 1QCZA 1HSZA 3KKNA 1TVMA 4JBNA 3ZIUA 4AROA 3CO5A 4J76A 2RGXA 1GNVA 4YA6A 4QPCA 5HX7A 4Y1EA 4HNSA 4MNTA 5KSOA 4A2QA 3TRIA 1TOAA 1OZGA 2DWPA 4YHBA 4KLAA 4FINA 3P52A 3W2EA 1RRPA 2HADA 2JZOA 1NRIA 1ZD2P 2AJTA 4PTZA 1XA0A 1LX6A 3AW9A 2AQHA 3ZWMA 1USIA 3EVTA 4BVJA 3ZQUA 3HZZA 3A4YA 4EF4A 2GCNA 5MN5A 3HI4A 1U31A 4A6DA 3KYJB 5I8PA 1E2IA 2E4WA 2BR4A 2F4NA 3KFVA 2COEA 3PGXA 1JDZA 4G0UA 5EHXA 3IMCA 3EQ6A 1TM7E 2CK3A 2ZB3A 1JSCA 2DLCX 1VM6A 3PF9A 5ITVA 4S1VA 1DAKA 2VRNA 3U7EB 2GARA 3HHEA 2DHRA 3HUUA 1H6BA 1BVUA 4PWYA 4QGAA 4LXUA 4IOKA 4PLVA 1RPAA 3DXXA 3INRA 1Y8QB 1YACA 1M6VA 3UCEA 1NXPA 2QMOA 4JVNA 2IEGA 1BGXT 2WJZB 2YXEA 4KNVA 5DLEA 1FLDA 1FLAA 1NDQA 1CY8A 2C0QA 4OHMA 5IN5A 4MDEA 2D6FA 3GI1A 3MTEA 5E1MA 2ANCA 2C4MA 3W9YA 2Z9CA 4Q7LA 1EP2B 2XMCA 4B33A 2FG7C 3FI9A 4LK3A 4CQJA 3AK4A 2PRKA 1VI6A 3B48A 1UMDA 4GMXA 1DQZA 2BLLA 3NWJA 2KHZA 4B6JA 2DBVO 1SC6A 1GARA 4BDTA 3HH8A 1XALA 1IY2A 221PA 3GZNB 2WK1A 4J7XA 4RZUA 5EJ2A 1LRKA 3PR3A 4L95C 3BEDA 1LUAA 5EWMB 2QZPA 4A0HA 1CJKC 3I01A 3RKSA 1XRMA 2AZDA 3RS3A 4UU8A 2Z8XA 2PQ0A 1X7XB 1ZI8A 4UQOA 2C0PA 4UPEA 3OIYA 3L93A 4INJA 2AN3A 4RVHA 3TO5A 3VDQA 4V1CA 3OU7A 1GLVA 4RWZA 3NIWA 2AFHB 2IODA 1EXVA 2I54A 2ZUBA 2O05A 2GPYA 4QTXA 3UJ6A 3HS3A 5HQTA 4YRCA 1A4RA 1RU3A 2PLNA 4URHA 1JEQA 1GKUB 3V1TC 4QUJA 4S35A 5A3QA 4Q03A 1SY7A 1HMYA 3G8AA 2GCGA 4NE7A 5D7NA 2JFXA 3HPRA 2DPXA 2QTLA 2XKKA 5G40A 3C7TA 4JI3B 2QNBA 3ZWDA 2JANA 4YRGA 5A7FA 2ZCVA 4TZ0A 5KJEA 2PLWA 1RI5A 2BELA 3WYEA 2BFFB 4M8NE 1GGKA 4Y30A 1YS4A 1CRZA 3UMFA 4CKBA 3H9CA 3F0TA 3AUSA 1ZVMA 2OYSA 2HEGA 5DGTA 5GINE 4KE7A 1HDZA 1P6QA 1DIAA 1SCAA 4LFCB 4QL3A 3K9GA 4J8PA 1A50B 2FCAA 3AILA 2DLNA 5EYPA 1DX9A 3U1BA 4IO0A 4P0TA 3NVDA 3ZW9A 1M3SA 3CXRA 3I2IA 4ZK6A 1U7HA 4DDMA 2FN4A 1HYEA 5DX0A 3FHOA 5BQXA 2KW5A 5FOVA 3ZVLA 4PHTA 1KDVA 1VCMA 3SYKA 1ML4A 3TSCA 4HVCA 3QKSB 3L77A 1E94E 1NUTA 2C2GA 3IJRA 1QCDA 4MLDA 1XAHA 2JL1A 2YOFA 1TPZA 3MAGA 1BE8A 1B3RA 1FUYB 3PHBE 4PLWA 3T3GA 5IVHA 3D7NA 3ICCA 4TZKA 4ZVSA 5BW8A 1K66A 1CUUA 2HLNA 2MSWA 4MKRA 4AN1A 3RSHA 2R7KA 3LQ2A 2J1LA 1W2WB 5AKLA 5B1YA 5ER6A 2VHJA 3L7YA 1P7YA 3LX4A 3MLAA 1T3SA 2H2WA 3BRQA 1D4AA 2OCAA 1E32A 4RX1A 1OZHA 5DASA 5JAUA 2OL4A 3OESA 3RNOA 4PZDA 4RK1A 1E2GA 3N0RA 2ATXA 1YHZA 3HYLA 1HOTA 2VH5R 4IDGA 4EL0A 2G0AA 1NJFA 2OENG 2VCEA 4FOTA 2VF2A 1B1AA 2VXOA 2V6BA 3AFNA 3RC2A 2YYSA 4DWVA 1EINA 2EJUA 2GEJA 2AQIA 3DAOA 4OB7A 4RK4A 3F6YA 4A2PA 3FN4A 2F3SA 3FUWA 2ZSBA 4LX8A 5EWLA 1G5PA 3AEUB 3K0SA 4JENA 3WHPA 1CB7A 2XMGA 2Q2OA 3OSUA 1U04A 2XQJA 1V71A 4OMDA 1ZGZA 4QRDA 3WMWA 1Q0SA 2FDCA 4XDYA 3GO4A 4BMZA 1J09A 1TXGA 4ETIA 2GBLC 1JAZA 5GMOA 1C0PA 2GEUA 2FZEA 5THQA 1NQWA 3FUXA 4IG9A 1NRWA 1DZ3A 1PR0A 1W6RA 2A1IA 4BO9A 4MAFA 2E4XA 4RXMA 5AW5A 4MMYB 4GPD1 3THXB 1WVGA 3LUJA 3LPAA 4H15A 1JH9A 121PA 1C7ZA 4D45A 3VYRB 3KJXA 2A3NA 1GRQA 1OXSC 3L1HA 3WQBA 1DO8A 3AR2A 4OPMA 3V3KA 1VKJA 1RMQA 2MYUA 2PGJA 3ZDBA 4KE6A 2HWYA 2IYNA 3LIIA 2EJBA 4KYTA 3A3NA 1P31A 4KQIA 4GDMA 1EWKA 4QWWA 1IULA 2NZUG 1A9XB 1FB5A 1R0CA 1KVRA 1R0YA 4QXMA 4WKBA 3U31A 3IHTA 5K51A 2HR1A 2Q2VA 4RU1A 3U16A 3W9SA 2V9CA 1RWPA 3Q0TA 3KKKA 3GARA 2C03A 6REQA 1NULA 1JXAA 4HL6A 4PR3A 4TT8A 4BMNA 3TBHA 3UJDA 4DQVA 1L7OA 5F9HA 1YI8A 5F9MA 3KLPX 3QPBA 5LBUA 3JQFC 5HS4A 5AMXA 2P3QA 2PVPA 1FFHA 4P84A 4R1TA 5CUQA 1WDKA 2VT3A 1RJDA 5CEJA 4LYJA 3I64A 4M1OA 4Q39A 2PM8A 3TZKA 1Y1RA 3JQAB 4ARBA 1SXQA 2JKYA 1P5RA 3VHXA 4M1TA 5C0OE 4M1EA 2ATCA 4YUYA 3I0MA 3I2KA 3O2SB 3H5WA 2OLJA 1W1WA 1UPFA 4DEVA 5EE5B 3UN1A 1OWMA 4M9SA 5IUJC 1TM3E 1VL0A 4KKVA 4EX6A 3IV9A 4GZLA 5BW4A 2DF8A 1H9BA 1GADO 3AGPA 3OPYB 4FW9A 4PX2A 5C8XA 5JW6A 3FYCA 1P7ZA 3ZDAA 1GIAA 4EQZA 4JS0A 3AETB 3AYXB 5G2OA 5FL3A 1BXGB 1NN1A 2YV3A 1R10A 2M1XA 1PJ8A 4X45A 2P7IA 3QGMA 4JKIA 4UZEA 5CG1A 1UAAA 4BPBA 2J4CA 3K1ZA 2VUIB 4WK2B 2CYBA 4EHDA 1HE2A 4WZAB 5FKJA 3TJRA 1C80A 2HRRA 4QYIB 3FVQA 2MSNA 1JVBA 4RK5A 5B4TA 1C1YA 5DLQC 3ZKWB 4G63A 4ZI7B 4DQ0A 3SC2A 2F8MA 4CF6A 1M54A 5LOVA 1NJSA 3OM1A 3SQXA 1C1DB 3PQDA 3X1XA 4DNXA 4K3UA 1E9SA 4PICA 1NPYA 3I23A 3PXEA 2VNKA 2V3VA 2F3PA 3PEEA 4H1WA 1XI2A 2IC5A 2JLQA 3E1GA 3ZU6A 5F23A 2CD7A 3P19A 4X63A 1ORTA 3LGSA 4IUBS 1ORWA 3L9XA 4NC9A 7GPBA 5JCPA 4CEHB 3RVSA 1GG5A 4NU0A 2GEDA 4DLTA 4QNRA 2GK3A 2F59A 1EVZA 3WZMA 1NP7A 1A5BB 1PGNA 1V7ZA 3UGQA 4HX2A 1CS4C 3FOAA 4O4HF 5FBKA 3CEPB 3NU1A 1LI7A 2P5SA 1WHTA 4AS3A 2PUCA 4LXGA 1KTVA 5C4MA 1WRBA 5BOSA 2QN8A 1IFXA 2ZRNA 1FJXA 4LV5B 1BU8A 5F33A 4RY8A 4ALIA 2V6IA 1C8LA 1VE9A 1GHTA 1W87A 3VHLB 4CKEB 1FMJA 2AG5A 4D8VA 3DZGA 3SHTA 4S1WA 2BMWA 4KPGA 1P17A 4CLRB 2TECE 3FCEA 3M2PA 2PYZA 4LOLA 5AKJA 3EDCA 3F4BA 2HFKA 4Q3EA 1Z0FA 3DVRX 3VPGA 5K8IA 1WZIA 1W46A 2C9CA 2ZYTX 4UHBA 3RS8A 2QZSA 3GFRA 1P4SA 3BD9A 3IDQA 3CW2A 3I9OA 4LHXA 4EL5A 3USES 1U2QA 3P9NA 4KXFB 1R0SA 1RYMA 2VRCA 3RWMB 1BXKA 3UKDA 3V46A 2IX9A 4NDZA 3ZQKA 5KNBA 5FPTA 1T2DA 4GLBA 2I4IA 2O3QA 1P29A 4HDRA 4N9QA 3WIEA 3TEMA 5LQUA 2BCGY 1S02A 4B40A 4EY5A 4I08A 3B52X 3MTGA 1L4YA 2WNHA 3TNDA 4X54A 3O8OB 3TW8A 3OBBA 1DFHA 3T12A 2OBLA 3CA8A 3RVDA 3A05A 1F0NA 3OJCA 4EPWA 3RSFA 1OH8A 3CRVA 5B55A 2DTXA 4Q1CA 1I0LA 3A1UA 3F1LA 1RNLA 3DAHA 4U6SA 2QJOA 2ODNA 2YWHA 4OXNA 4G4GA 2A9RA 5C8YA 4GBJA 4OM8A 3WTCA 3BM5A 4FTWA 3X0DA 2Q8NA 5BN3B 4TXJA 2QJTA 4MVXA 2G07A 5EVJA 4BS9A 3Q12A 3BK2A 3IP1A 4MDYA 1YCDA 3CLSD 1Q50A 2R4QA 4JITA 4RLQA 4AXBA 5BP7A 2WJWA 5HBGA 5IP5A 3WBJA 3GLFE 1E5TA 3FOEC 3NIDB 1QGUA 3IQDB 3ZQ4A 4B3MB 3KZVA 4JQZA 1L1FA 1A7KA 4M8LA 4JR2A 3W4IA 1CBUA 4TQAA 5C53B 2RK4A 1OGJA 3QELA 4MV0A 3QRWA 4Q15A 1ODKA 4UBNA 2Z5GA 1UJ5A 3HO1A 5CX4A 4D8YA 2H1VA 3IVRA 1YNOA 3NOXA 2HDHA 1EGMB 2IPOA 2JRLA 2BKLA 13PKA 3E22B 2C95A 3FBGA 3GGPA 2AW5A 3DOHA 5DK6A 5KVQA 5AI0A 4YBRA 5HNKA 2AOWA 3WJ2A 4M55A 2B1IA 6ABPA 3MJEA 4Q7JB 1VJ1A 2PU7A 4TTPA 1M72A 1JHYA 2XUFA 1CZOA 4PU0A 4I8XA 3L0OA 2CB9A 3QX7A 4TWRA 2JLSA 1UJMA 3RVQA 5E3HA 1KH1A 1ZH8A 3ENKA 4E0BA 1ZGBA 2GJAA 1CR0A 2ASEA 2G9RA 3G2IA 3L04A 2GAOA 3R5FA 4FFRA 4ESVA 1ZJWA 5LNK6 2LP4Y 2XRFA 3DE2X 4QXOA 1H8HD 3IURA 5BWLA 2UUPA 1E3IA 3G8CA 5K3EA 2RFLA 1UWLA 1VPEA 1WW3A 4JLDA 2Z2XA 3S8MA 4P8RA 4WK6A 1SCDA 3KNZA 1DFGA 2P62A 3L1JA 3QKRA 1DELA 1ZA2A 1XRNA 3AHJA 3JAWB 4IXWA 5JWHA 4EB0A 1J25A 1VI5A 1DTWB 1MB9A 3JWPA 4WDRA 4BUCA 2XLCA 4RXTA 3AINA 4AFNA 4BNZA 4A4DA 3RRNA 1NVUQ 3OX1A 2J9YB 2YBDA 4JJIA 2HK8A 2ZBUA 3DCJA 5K0ZA 3E9QA 4IIFA 2JATA 2PZBA 1V5EA 2I3ZA 4NDAA 3UK2A 1ZAKA 4BNMA 3QY9A 4II3A 1XFAA 3AQIA 4R2MA 4DPMA 4DIMA 1PNTA 4N82A 4XI9A 5ALIA 4LDPA 3ZG6A 1U6IA 1Z4PX 4K8OA 3CX4A 4DMCA 1UC5B 1LLUA 5HK8A 3GGDA 3T9FA 3Q7PA 5BSRA 4E14A 5FX2A 2FSPA 3OZCA 3K9QO 2BTOA 4MVJD 4IDOA 2RGUA 2Z4TA 1ZMOA 2I2AA 2QUZA 1L5RA 3NATA 3K71B 3ITNA 2FMKA 2BFBB 1Z4IA 2C4VA 2GMWA 2EFEB 4E1VA 1GM5A 4ZHQA 2IPLA 4UU7A 1Y9AA 2J9XB 3KP1A 1OH6A 2ZJOA 3D81A 2ZFUA 2OLKA 4JLUA 2OBBA 1CK4A 4BVGA 4P3XA 4RNCA 4F38A 2ST1A 3FOFC 1QYVA 3ULKA 3B20A 3BIOA 5JAMA 1SIOA 4TXHA 1Q1EA 1KFBB 3ZDRA 4F9GA 1SBNE 5LQDA 4ZO9A 1IHXA 2P6UA 5K6RA 1MQ8B 4JYAB 4MR7B 1N2CB 1YB2A 5CM8B 2FMHA 1JIJA 2GN2A 1Y6JA 3BXXA 4PZ9A 1FU7A 4FYPA 1Z39A 4B4KA 3R0XA 1DQYA 4H2DA 3LK7A 2B4AA 3N2KA 5T6MA 5K0CA 1QG0A 3FWHA 5JRZA 3OC6A 4CCYB 3WKBA 2XB9A 2ZRAA 2Q3BA 3IBYA 2COKA 2QBYA 3E48A 2RGAA 3U3OA 4B8WA 3ENZA 2R8BA 1YDMA 4MWBA 4C03A 2BEVB 3SHVA 2CJXA 3RE1A 4LAFA 1G7SA 2AX3A 1N2OA 1A69A 1KZ6A 4IDCA 4E15A 1QP8A 3C43A 2R6JA 1Q15A 4J1NA 4K9NA 3RYIA 4XD7A 5IZ4A 5HRUA 2FG6C 2RCNA 1P44A 1CRWG 2O9JA 1DWPA 4TSFA 2Z8YM 1CD5A 3NV9A 3QXXA 2CMHA 3OKAA 1QH8A 1T6YA 2DG2A 3DLCA 3I9JA 4PIPA 3K9CA 4F8JA 3KWLA 3ANNA 4HR7A 5FOUA 3WKAA 5C4IA 2HK9A 4HRAA 3L6CA 2ETXA 1G0OA 2HXGA 3HXLA 4XLLA 2EFYA 2WYOA 4OAOA 1EK2A 1H0RA 4LJYA 4DRXA 3BWYA 4Q12A 2YJ5A 2WT4A 3WB1A 4BQNA 1PS9A 1B43A 2QVXX 1NBMD 3TQOA 5CK5A 3GH3A 1PIWA 2OFXA 2VRBA 10MHA 1ZD9A 1C30A 2P4UA 5TQ2A 1Y6GA 2HMWA 1DPFA 1VIVA 2KBEA 3VZPA 1V8BA 3GJYA 2FCRA 2IXAA 3WDKA 3MFQA 1EQUA 1QFZA 2ATEA 2XUPA 4IL5A 1E58A 2VYVD 1M9NA 2E5FA 2XMDA 3FFXA 2BHRA 3L6RA 4MYSA 1EP1B 3RTAA 3EOZA 2O0MA 3OQOA 3MC1A 5C2JB 5LYJB 4MQLA 4MV6A 4GU5A 3HJHA 1IZ8A 1T4BA 3M6VA 5EHNA 1W4ZA 2Z2ZA 3UQZA 2I4MA 3A25A 1NY5A 2BISA 2Q4BA 1BJTA 4U00A 5DN9A 3Q98A 4MWZA 3NKFA 1O3YA 2WHYA 3SZRA 1ATIA 1QRUA 4RF2A 1AH2A 1Y4SA 3SSNA 1U0LA 4ID9A 4JEIA 3U0VA 2Q3JA 3LC0A 2XF2A 4UCFA 4ZCLA 1ZN2A 3OO1A 4HLNA 2RI0A 2RKWA 3F4LA 4YAJA 2AC7A 4RANA 3CNQS 4ZXPA 1UXKA 5AI5A 1P1IA 1P0FA 1Z5UA 2CZQA 2JAUA 1YUBA 3DO8A 4BMCA 3THYB 4BU0A 4KLRA 4H35A 2ZAIA 3Q9NA 2IYYA 2Q6IA 1XIVA 1TDJA 1WZEA 1YDEA 3W8FA 2PLRA 1KI2A 1CFJA 4URZR 4XDZA 4ZYWA 1J06A 3ACBA 4GMFA 1WB9A 3AI1A 4Q4AB 4R1UA 3ND5A 4KE9A 3ONDA 3DXZA 1YIDA 2BFAA 3AIOA 3OWHA 4YCAA 4YDRA 1EJBA 3QKUA 3Q7QA 2ESRA 2BMDA 3IX7A 1XNJA 3KOUA 2ZAOA 4EITA 1E7QA 4W9NC 4Q4LA 2PBRA 1BSVA 1DLIA 5DV9A 1ZU4A 3K20A 2XVMA 3PDUA 1WP4A 3BEOA 2IYLD 4G5XA 2J6HA 4X7MA 3RJ5A 3SXUA 5HF6A 1FRZA 2G4CA 3QVOA 3RIGA 4JLAA 3ZD8A 1QVWA 4G0QA 3ZE8A 2CNLA 2QB5A 3DKPA 2EFDB 4DAEA 4UM9B 1FTGA 3GNTA 2E18A 2MYTA 1BHO1 1EU1A 1SHKA 2RHJA 3EZ6A 3M6XA 4NAUA 3MAJA 1C9MA 4QUBA 1DSSG 5AKEA 3ORSA 621PA 1NG9A 1SXJC 1WZUA 1VKZA 4OK6A 3F90A 4Q3OA 2YICA 4TZ6A 4JIMA 4CZ2A 4X97A 1ZL0A 5JQWA 3QF4A 4CM5A 5IKPA 2IQ5A 3SX0A 1S7CA 2OZEA 2QR3A 2X22A 4DA8A 1GILA 4WXMA 4RL4A 4L3VA 4PINA 4MJ3A 1CE8A 3G8YA 3ZGZA 1T5BA 1F3LA 4IPTA 3G9TA 3F7NA 4KX3A 4CTMA 2DHCA 1L5HA 3QW4B 4MO9A 3V00A 3L1UA 2JCYA 1QU3A 1SHLA 3LIPA 4PE5B 1X3LA 1KMHB 1RWQA 5LMNB 1QJCA 2AZ4A 1KIMA 3EXIA 4F46A 4BNGA 4BEBA 3IBCA 4QDZA 2OCDA 4UPDA 5KYYB 1A8HA 1G16A 3T1VA 3KJFA 1LDNA 4JLKA 2TRSB 1NTOA 3EZNA 4MVJF 1TIKA 3KLMX 2CUNA 4L3OA 4MB2A 3GT4A 3MNFA 3EWIA 1JKMA 1SVIA 1ZNZA 3NBQA 3OIWA 3OY7A 4U7TB 2C58A 3AM5A 2KLBA 3FNFA 3B1JA 3W5CA 2VAXA 1BWSA 2ZE6A 4UE6A 4CKXA 4RFLA 1ZU5A 3NUZA 2PZ8A 1I1HA 1ZQ9A 3R5XA 5ALDA 3P9SA 5E6RA 1KC3A 3FTDA 1R5NA 3QVGA 1TZJA 1VHLA 2ACKA 4V0RA 1OLXA 3KSZO 2NT3A 2B3TA 4PTYA 3R3XA 1NF9A 4CQMD 4NQZA 3SU8A 4HPWA 1WOMA 3KU1A 1T3ZA 4ZIRB 4KACA 3V8NA 2EFGA 2O8DA 1Y82A 4YMHA 4MP3A 3QJYA 1N7HA 4ND4A 2H1SA 1YR6A 1RBMA 3IEPA 4P32A 1FNNA 3MINB 3PUVA 2QT9A 3AEXA 2WJGA 3GUVA 1XDZA 4KQHA 1U1IA 2ZJBA 3DC2A 3SQWA 1IE3A 1LH0A 4UCWA 2BF7A 5GJVC 3ELDA 3WNZA 4LYDA 2J07A 2BLNA 1TO6A 4KVFA 1WEKA 3D7LA 1ZCBA 1XGKA 1W96A 2QD3A 2ZRGA 3GJTA 3LQQA 4OHKA 2DFTA 2QORA 3PFFA 4RAOA 3U7QB 1A98A 1ZRHA 2NO4A 1CKEA 3HJNA 4FILA 1RRVA 2MJLA 4GLLA 3WIVA 4DREA 3NFRA 4PYRA 5IN4A 2O07A 3CN9A 3E4CA 4UNPA 3QUAA 4MVJG 1NUQA 3RS4A 4EX7A 4G4SO 2BM8A 1L8QA 2GERA 1X1TA 3BHJA 2V7GA 4LOKA 4UUAA 1NFRA 1KWKA 3DHYA 1YJ5A 5LYJA 1NI5A 1PWHA 1BXZA 1IH8A 2AOTA 5SZIA 1E5DA 2A4KA 3EOBI 2B30A 4PF1A 4XUGB 2I5PO 3DAPA 3ZW8A 3D6VA 4YT4A 5JZMA 3SN6A 2EHDA 5L7YA 1JPJA 2OCXA 2BW0A 3B1VA 3C6ZA 3K94A 4OXXA 2ZS7A 5FH9A 1Y3IA 1D2EA 1B0ZA 1QHNA 4X94A 2R8OA 3OT4A 1OX4A 4HUJA 2X8JB 5IT4A 1YVEI 1G21E 2GWHA 2WM3A 1ISFA 2PLAA 3E1SA 3HFJA 3FZNA 1IYZA 1SXJB 1J33A 3DOIA 3HU3A 3NOVA 3PXAA 4NBVA 4PNPA 4QJ5A 5CA1B 2O6LA 1CF2O 1GDTA 1SU4A 4ZO8A 1KDRA 1E2PA 1EB9A 4C0QC 5DNDA 5LDDC 1MAUA 2Q5HA 4RF4A 4YJ2B 3TMYA 1QPBA 4RMJA 4ZREA 3O2JA 5E1OA 3EFBA 4HNAB 3HDVA 4MUJA 3CLRC 4NEQA 4TL7A 1XZJA 1CQIA 1FRQA 4HAZA 4LV8B 2YJ4A 3U4CA 4YRKA 1QQBA 5CDTA 2J46A 1MP0A 2OHJA 2VNIA 4RV4A 2C96A 2R60A 3EYAA 4GYJA 4UNIA 3RRFA 1WU8A 5JH7A 4I4TB 4XRGA 1N5OX 5T5QA 3NTLA 4Q01A 1L4BA 1K7XB 4R01A 1QLJA 3OPVA 1HE4A 1ZN9A 2Y6UA 4PQGA 1SKMA 1KJJA 3LF2A 4MOWA 4P4NA 1WDTA 1T9GS 1ZBDA 1M2VA 3EBPA 3HKEA 1YA6A 4KO1S 4RKRA 4ZTUB 1YZQA 3LPLA 5DHPA 1G3IA 1Y9ZA 2QY6A 2WE7A 1I9GA 1UBFA 5C3UA 3ROZA 1LPOA 2II6A 3GELA 1UDXA 3H75A 4CF5A 1OC4A 1L5OA 1UT6A 3FLBA 3V55A 1ZN7A 2FFRA 2YKGA 3TMKA 1HNNA 4E09A 4FEAA 4DV0B 1JF8A 3C7CB 3COPA 3H4MA 4LZJA 4P7KA 1RADA 2H0QA 2W6MA 1B00A 2OBXA 3R5SA 3PJEA 1KYYA 1MU0A 4PLTA 1EFKA 4XIJA 1C3EA 5ALTA 2R8PA 1ISIA 2W8BB 1QMGA 3B1ZA 1Z5PA 5E9QA 1ODTC 3UKOA 3R3ZA 5JWRA 4WI1A 1SOMA 1ZJ6A 3BH6A 2H1LA 1G2PA 3HTXA 2ZREA 5B6IA 4FGWA 9GPBA 3AESB 3IUJA 3HWWA 2QY9A 4UAUA 3HCAA 5LZ4A 4A0SA 2C4WA 4BQRA 5F3DA 4RVDA 4EVQA 3T1HB 2IXBA 3UMSA 3P9QA 5EIFA 1ECFA 1RQ2A 1VE6A 2XZPA 3FLEA 3VNQA 2I6TA 2PSHA 3IPLA 1RSZA 4N5LA 5LP1A 3R7WA 2WF5A 1P5HA 1UJNA 2ZJ6A 3P0EA 3STXA 2GKSA 3H5TA 2P1DA 4ZOQI 4DV5B 1EK5A 1YJBA 1EE1A 1M6NA 4WW0A 2JW5A 4YP9A 4EGSA 1A77A 4ZAXA 4RA6A 3HB0A 1OXMA 4J9VA 4CXMA 3DEZA 4YJHB 1OWOA 4U9UA 5MGBA 3JX9A 3DM9B 5HUHA 3RBVA 4CN9A 3ICVA 3ZK7A 5KNLA 1AO3A 1VG1A 2VOEA 1FP2A 3DHWC 4PXYA 3G0IA 5GV8A 3ZVNA 1RIIA 3KOXA 3NHWA 4HSEA 3SC6A 2F8TA 1G1AA 3TCXB 3C3KA 2BM9A 1P45A 1E7WA 5CFLA 5AP9A 3F6EX 4UPVA 3ZHZA 3E81A 4C2BA 3H83A 4UDXX 2IX3A 4H6PA 1KA9H 4D56A 4RF3A 3RSOA 3VO9A 3AHCA 2A84A 2PQ6A 1MA0A 1M6EX 4BNHA 3R2JA 1SFRA 2HREA 4RJLA 4A2CA 5I7WA 4PC7A 3U4HA 3BG5A 4L28A 2I7VA 2I4OA 3AZPA 1OWLA 3HB4X 5F9FA 3L07A 1M6VB 4S1TA 3NEPX 2WWYA 3NBFA 3LYAA 4PX3A 3VHRA 1ZUWA 3NVAA 1KYVA 3ANYB 4Y98A 4B7XA 3MW8A 3GIWA 1PO7A 1BHQ1 1LDGA 4I5EA 3JYNA 4JQOA 3UOWA 4AG3A 4BRUA 4X1OA 1LJ8A 3IP5A 2ZDGA 1PEYA 3N0XA 1NIPA 5BUSA 4D57A 1CS0A 1WXFA 3T3MB 3JQ9C 4OL0A 1UMDB 2ZT5A 3PHGA 2WJPA 4LVCA 1H2WA 3NIGB 1AA6A 3KQNA 1RXVA 1GTJ1 2QAJA 3EVEA 4R9RA 2JLUA 2C2MA 5DEOA 5BMVA 4FFLA 5EMLA 3RWBA 2PEYA 2FF5A 4B76A 3EQZA 3TD2A 1PQYA 3LC2O 4RPIA 5AR1A 2I29A 4GNKA 2WPNA 3MJTA 5ED0A 3W6OA 3GD5A 1J39A 3E7PA 3HA3A 5H02A 4JXJA 3S2UA 3VYWA 2ZYHA 3L7AA 2JH3A 4HEHA 3NNDA 1II9A 4I14A 4V1CB 4UQLA 3DDNA 1B74A 3HYCA 4ERNA 1FLVA 1M5UA 3DYVA 4UUNA 2BI8A 1DS6A 2O20A 4G86A 5EMMA 2F1OA 4I81A 5IMSA 1KRWA 4HQKA 1FCJA 3D3QA 2W7TA 3TMAA 2VF4X 3NR2A 1NAIA 4IDEA 5AM3A 3RK0A 5HJ7A 2VF8A 1JEQB 1NVBA 1ENZA 5C31A 1X38A 3PUJA 3ORFA 2WOOA 3DC7A 1USKA 3NM4A 2X0FA 1CZLA 4QDXA 4XTCS 5CFOA 4BNXA 4W82A 1WTAA 4ZV4A 2ZQZA 1XD2A 5H5JA 3LFUA 1KK3A 1PYGA 3L4EA 3NDJA 3I0ZA 4FNOA 2E7ZA 4HLCA 1ZRNA 2GUGA 2G63A 4XQGA 2GRAA 3PIDA 1KBZA 4MYCA 4XFKA 4HNGA 1ACMA 5IAGA 1VMEA 1P0PA 2BZGA 2ZUUA 3IB6A 4CKBB 2GD0A 1AGPA 4OI1A 3ZWWA 4GL2A 1NF3A 1PQ4A 1LSUA 3CQ9A 3RR2A 4R1PA 3R3HA 1WB5A 1UBCA 2J5QA 2Z43A 3ZZ1A 4TYYA 2K5UA 1WM1A 2X6QA 4HBGA 5EYPB 4DKXA 4P7BA 2QVZX 5D01A 4LWQA 5TPWA 3R3SA 3VH4A 2IPXA 4HPJB 6YASA 5E7MA 5LQMA 2PXXA 2BTQA 2YZMA 1WMAA 3INNA 5KYVA 3O95A 4DMHA 3A2KA 4LBYA 4BFSA 3ESAA 5JBQA 1NF2A 2R47A 3Q11A 5LZ5A 3QVKA 4BWGA 2INGX 3KVRA 3KXDA 5HQ3A 5ENDA 4BGEA 1OY1A 3NHBA 5JNSA 2AF3C 1T24A 1XTTA 2EKZA 1RYYA 1IL0A 1FDOA 1SCQA 1ZMXA 1ZUNA 3QMPA 4PC6A 5JAQA 4BKRA 3VJKA 1Z6XA 2OV6A 2P2SA 3MWDA 4MW0A 4C7XA 1O1YA 3PCXA 5FAXA 4TYQA 2BEUA 1YZYA 1TTQB 4PG7A 4K9LA 1R0KA 2J3HA 3WB9A 4AZ0A 4BN5A 1H2RS 3WV5A 2H2AA 4FYHA 4GVLA 4KKXB 4DC9A 4LVOA 2C3MA 2P5YA 3TFOA 3U4MA 4DMKA 3AEZA 3ADBA 5KTTA 5JD6A 5TQVA 1XLTA 2QVCA 1TZMA 1NW8A 3LVFO 3NB0A 3M6MD 1M6HA 3L18A 4UUPA 4A82A 1MB2A 1KO7A 2JKZA 3A3YA 1ICEA 3VKFA 1K6IA 2Q3CA 1K92A 4OJKA 3S4YA 2O0HA 1LF0A 1VL6A 4FQ7A 1JR2A 5BRNA 3X2FA 5IPFA 2VDRB 3NETA 4HAIA 2W70A 4GPTA 3TNYA 3TR6A 3D6AA 5U4QA 1F38A 3UPDA 2OSVA 1XZLA 2JZNA 4ADSG 4L9WA 3Q4GA 4Y1GA 5DCYA 4CM4B 3QVMA 3UYKA 4MLCA 3LLMA 3Q3EA 3DXYA 4J0QA 3PS9A 3GT0A 1MIHA 4BFZA 3GVXA 3QV1A 3IOBA 1ONBA 2AS0A 4GL4A 4EDFA 3GGGA 4EZBA 1EMDA 3DE3X 4MMZB 3WNDA 5DRYA 3KLNA 4PNHA 1EHIA 1T9HA 3ENVA 3S1AA 3V1NA 3P9CA 1YZKA 4IKEA 4KWCA 2C59A 2DWOA 1GDHA 1UXJA 1EFHA 5AUOB 3LUAA 4N47A 5LSAA 1TIBA 1QK5A 4DRZA 4E2FA 4NPCA 3CINA 2C4HA 4P7GA 1BD4A 1P33A 4FMDF 1I51A 5IZCA 1RLJA 2Q21A 1SD2A 3DDCA 3T3NA 2B4RO 2O57A 4QDKA 4JOBA 1NJGA 3JQGA 1OROA 1RZVA 1V3UA 4X3PA 4MITA 1VC2A 4URFA 5H4GA 2IHZA 4XIFA 1CJSA 3HEMA 3NTXA 4B9AA 3EGXA 1HE5A 2VHQA 3JWHA 1XJ0A 3E5RA 2MT9A 4KP7A 2AVNA 4ZO6A 3D7KA 1GZ5A 1M75A 1R6DA 4I4IA 1ZG3A 2QN3A 2Z3ZA 2XUKA 3RADC 5F2NA 1JQKA 4GSYA 3A4TA 1RS0A 4WNAA 4C29A 4DCGA 5JSZA 3VHXB 1AZTA 4II7A 1F48A 1CPYA 1WXDA 2PGLA 4W5WA 3SWWA 1ULTA 4AZWA 5JXHA 3KT3A 2DFVA 4NEHB 4WA7A 4ENUA 1YBFA 4CMEA 2QA5A 1G4UR 1S3SA 4PHGA 3H42B 4D74A 4M8KA 1GSOA 2IXGA 1VYUA 2EKBA 2NV6A 3RFVA 4UVHA 4EGAA 1H23A 4DSNA 4LHWA 1ZESA 4QOIA 1U7PA 4GHWA 4GZ6A 1K7YA 3LM8A 1IPHA 4QXPA 1UZNA 1BEUB 3L6DA 3RB8A 5HRCA 1HI9A 3X1JA 1FJGB 4FNAA 1VYHA 3VPDA 3E1KA 2I6QA 1AHHA 1E1RA 1BCRA 3MTDA 4ZEVA 4R0MA 1ENOA 3RUFA 5TMEA 5FORA 5G4KA 4EPVA 5L95A 1XCOA 3G2JA 4GOLD 4UBLA 5DLPA 4BO4A 5AHXA 7ABPA 2H2HA 4OHCA 1G8FA 5GWXA 1GJRA 2B8TA 1NP3A 3ILSA 3QU4A 4BFXA 1NG1A 2QL6A 1MEOA 2Z2KA 1ZOSA 4IH4A 4JP3A 1HM5A 4PNEA 5LOVB 3CKLA 3GT7A 1NUHA 4G07A 3K1JA 1B26A 4N3NA 2C7VA 2XRYA 5KJFA 3UGTA 2GM4A 2F3TA 5AH0A 3W34A 1KJIA 3FX2A 3D9QX 1VSBA 1FXUA 3V7FA 3WWDA 3ZNPA 4EFMA 4R54A 1F0PA 5FTJA 4BVAA 3ZHVA 4E3ZA 1W2GA 1FXWF 4WZBE 3VPCA 4JBWA 4TWZA 1SWWA 2GK7A 2A0WA 4BNJA 4TOIA 2V65A 4RA9A 4JT2A 4Y7CA 2ZRIA 1GAEO 3IR5A 2QRVA 1VJTA 2QGNA 5I3CA 1ZK2A 3FR8A 1WHTB 5JBIA 1EVJA 1TZBA 2Y1DA 4K87A 1YJ8A 1DG1G 4KQ2A 4G0ZA 1ZFNA 1IZ9A 1GPDG 4HYTA 3UY4A 1UH5A 3ZDEA 1NBEA 4TRMA 3RIHA 4BP1A 2IBMA 3R3WA 4ML3A 3MJCA 1P0MA 3DMDA 1FNBA 3IOCA 2IBTA 3D8UA 1X1BA 4WOPA 4EVSA 1X1SA 5JXWA 2C8LA 1AG9A 2PPVA 4ZHSA 5KQLA 4RABA 1GYQA 2VCHA 1OIVA 4G84A 2ZIVB 4E4RA 4DLVA 4RJJA 2CXRA 2UZAA 3KQUA 2IA5A 1R5OA 2IXTA 1XDUA 5IS2A 2G1PA 2W83A 2PYIA 3FPBA 4V03A 2PBFA 1E1YA 2I2FA 2QK4A 4IGEA 5TMDA 3O38A 1FVXA 3DFMA 4WN9A 3ONVA 3T7KA 2XB2A 2BKUA 3EPKA 5IHXA 3SF0A 1Q3KA 1YZ3A 2WG1A 2I7CA 3MTQA 3MYYA 4R4JA 1S8FA 3DV9A 3C3BA 4N3GA 1W5TA 3EZXA 3FWNA 4RZHA 5DOZA 3TW8B 2V9ZA 1U94A 3I09A 1CWUA 2PRSA 5FQNA 1TYCA 3ILVA 4KU4A 4CLDA 1CIPA 3PZRA 1SKYE 2NO0A 3S2ZA 5KPJA 1N8KA 4FYYA 4G0OA 1U4OA 3PXUA 4MUKA 3VV3A 1A8IA 2ZRDA 1MRSA 5FLXA 1DJNA 5EMJA 5JV5A 1GWNA 3DAFA 5DFAA 2G71A 3SXPA 5C8YB 1JE1A 3C8DA 3HN7A 3RFTA 1YQXA 4XM1A 1NN0A 1HYBA 5DBOA 3PQFA 2VBFA 2DPMA 1O97C 1RHJA 4B09A 5F3WB 3DW1X 1AKRA 1WUJS 2J3KA 4OHVA 4X7PA 4CG2A 2PRJA 1GCUA 2WTMA 3ES9A 2CKDA 1G8SA 5B2EA 4NEGA 3KQHA 1O58A 1GRNA 3LLCA 2O52A 3BSYA 1ORIA 1QGUB 4LSMA 4Y9SA 3ODGA 4INAA 3ZDZB 2LPMA 4P4UA 4PAQA 1WV1A 2O14A 2IV3A 4BRZA 1YVPA 5AJZA 4I50B 4MH0R 3CF4G 4YRIA 4IVRA 1J7KA 4ACBA 5AI9A 2WAMA 3AL3A 4MW2A 1JDSA 3LH5A 1V9SA 2IF2A 2C29D 1VMIA 2PWAA 5HW0A 1A4IA 2JGAA 3H6HA 4M7RA 4LCEA 4X1KA 1IDOA 2RG1A 3ZZNA 4UXJA 3G3EA 1O9BA 1QONA 2FW6A 2IS6A 1UXOA 1XCPA 1TLFA 1MB3A 1KEUA 2CL7X 2Q6OA 4XOUA 3R7FA 5BR8B 5L3ZA 2EFCB 1G41A 3I6ZA 3G7NA 1M1XB 2WTNA 1V7PC 4DYHA 1MAHA 1TVEA 3L2OB 1WBBA 1OTHA 4AS1A 4D4LA 2NSLA 4N3BA 4I36A 1G19A 4QU9A 1OILA 4MIYA 3STHA 2ZTUA 2DR0A 1PW7A 3WMXA 4CGZA 4HUQA 4ZVLA 1GZSA 3B3FA 3EDOA 4AP5A 3JPWA 4AX8A 1ILEA 3A31A 3GV0A 1NUUA 3B6ZA 3UT0A 2ZBPA 3HRIA 3ZK8A 3UT6A 2XAUA 3CPJB 2FI1A 5GOZA 3EIFA 3T52A 1H8ED 2BTEA 1EI9A 4PSVA 1TD1A 1G64A 4MEAA 3AJ8A 2EOAA 5ALYA 5SZHB 3SX2A 5HE8A 1XKTA 1VSVA 1DUVG 3PEWA 4GKVA 4G41A 3DOFA 1LJUA 4OHOA 1XMSA 4CMAA 3HY4A 1EDZA 2CLKB 4Q9DA 4WVLA 5D5HA 4KV9A 1M34E 4QPDA 3UWKA 2XRMA 2AF4C 2X2OA 3V48A 4IHJF 2O7SA 2HD4A 2DHEA 1HPLA 2ZUCA 3B3JA 3F5SA 4LCJA 2G5CA 4DXAA 4CU5A 4RFVA 1IHUA 3TOXA 4V38A 5KPDA 4KJXA 1AGXA 3GP5A 1WQ4A 1F8GA 4XSVA 4UOZA 8OHMA 2YZGA 1O2DA 1REQA 1UC4B 2ZE7A 3O75A 2DSTA 2ZSFA 4FSDA 5FYQA 5IBQA 1CUHA 4Z7OB 5JNRA 4TX1A 3MMZA 4XEHA 4DA9A 2O50A 4RV5A 4UJ3A 3KR0A 4Z3KA 1ESEA 2RB4A 2XCIA 5L3VA 4HV4A 3KAKA 5KYWA 2AUNA 1NW5A 4GPIB 1F8UA 1IC6A 3E03A 3FDIA 4EYOA 5LXTA 3CLVA 1VB5A 1JPNA 2P68A 2HDWA 3HXTA 5HFNA 4E51A 4EECA 4K6FA 5SY9A 2F43A 1AS2A 1XDBA 3EHDA 3S2GA 1NVFA 1Z0DA 1JBKA 2IW3A 3H65A 1VJCA 2UZ1A 3HBLA 5G1OA 4MWEA 3KKPA 2V4UA 1RZRA 3GCXA 1R7RA 3KYBA 3UIEA 2GZ3A 3NBMA 1GQSA 1UZUA 1ZK4A 3VFDA 1T25A 5DHAA 3LQ1A 1G8PA 1K89A 4D96A 4KX5A 3RAJA 2P90A 2HEIA 4UMEA 3PNYA 5GONA 5CGZA 5FL7A 1E8NA 3ZGXA 2ZM6B 4WEOA 2YY5A 4WY8A 4CM6A 1VPDA 1XQVA 4JI8B 4UHHA 4KRFA 3TZBA 1G21A 3X3HA 1UPTA 5AJUA 3AX6A 5DZSA 3UGKA 1FP1D 1QZ3A 4RK6A 1WXHA 3O31A 5IJWA 2B2CA 3I1IA 3LYLA 4YP6A 1T1GA 1ZQ1A 2GUWA 2RHOA 4W4TA 3UC5A 1N92A 4U7WA 3TLAA 1KWGA 1G7CA 2PWBA 1HZJA 3N2KB 4UTNA 1NX6A 3R3YA 4HBZA 5E9AA 5T41A 4EHFA 2ZPTX 1NBAA 1Z2DA 4KIFA 2QPTA 2QBYB 3MUEA 3QOXA 5C1BA 1FPMA 4LF8B 4QUAA 2EBUA 1X9GA 5G53C 4KR2A 3C7KA 4L8LA 3BSWA 4GRAA 4DDUA 4Z54A 1N57A 2X9VA 1JHZA 3GFFA 4FC7A 2BKEA 1DWQA 1WCYA 1LRJA 2CBGA 2WJAA 4LMBA 4PBSA 4TN1A 1AVTA 5EKSA 2NPFA 3BRCA 4E88A 5KYXB 1VIYA 3FKJA 2EP8A 3NWPA 2BMEA 3I1FA 4AN4A 2N46A 5ESXA 4CLOB 2OFFA 3PX2A 2PGDA 4ATNA 3CLTC 1JLRA 3B3AA 3DS8A 5SICE 1GPJA 2IPMA 2PKYX 4GGPA 5SY4A 5FA6A 3R6DA 4KDEA 2W2KA 3WQSB 4EJ2A 1Z8NA 3AVOA 4DRXB 3QU2A 3I04M 1NVTA 3F3YA 3RC1A 1HC7A 4FX2A 2WILA 4ARUA 1XQ6A 1HURA 1C30B 5AT1A 1C4OA 1F5SA 4NH0A 5TQ2B 3WK8A 1TA0A 1QE0A 3ZNOA 4QUEA 5FO0A 3ZYCA 4V0KA 1NL3A 3H2HA 1ESCA 4JB3A 1EVEA 2R1VB 2FFHA 2C2OA 5JUWA 2SICE 5DXJA 3ZD6A 4B4VA 3CUWA 4JT8A 3PICA 3BJZA 4D9CA 3F2IA 4QA9A 1VI2A 1PCXA 2NVOA 3S2YA 1ISPA 1C8VB 3N3AC 4JX8A 1TEZA 1UAGA 3GIDA 1PG2A 2HT1A 4FD3A 4K1XA 5A0VA 1VHQA 4ZT6A 3UVEA 1NW4A 4ZICA 1J00A 1TCUA 4OLJA 5CDYA 1X13A 1H9AA 1JE0A 2DAPA 3PD7A 3E70C 3B12A 4CF4A 2BEWA 3NJ4A 4TXMA 4TZTA 1XEWY 4JJFA 5A6SB 3B85A 2YL2A 2ZI4A 3PPIA 1CV2A 2VT7A 4CMIA 1O7JA 3NZEA 1VG9B 4JVMA 4QOGA 3ZCPA 4RDHA 4IX1A 4AKTA 1PHRA 3TRFA 3KOZA 1EXDA 1IOVA 2HU2A 4W1PA 5ILQA 1WZNA 1L4HA 3H1TA 4QJ3A 5A0TA 1GRVA 4NSNA 1HNZB 1E7RA 3B8EA 3LCCA 4FSXA 4KTTE 4R8MA 4RE6A 2RGWA 2H2FA 3CZ4A 4BKUA 1KXZA 3H84A 1NPDA 2KWIA 2KBFA 3HUDA 2Z2JA 4RQTA 4W9RA 3ZEIA 5BVHA 1A4XA 1E6KA 3S44A 3ZI7A 2GNPA 5IG2A 4UNRA 2RJOA 2IRWA 5CYPA 4GPBA 1D6SA 4FEGA 3SXUB 4B7AA 1D2CA 2VJYA 4N6OA 2YIDA 3KZCA 1ZA1A 1I2BA 3MRTA 2IP1A 4O1IA 3HEBA 3N2GA 4UKDA 2Y8EA 1ZRMA 4BFCA 1LK7A 1W4LA 2JVJA 4WKCA 5ALWA 2PV0A 5ISMA 4EI9A 1G0NA 5CT4A 1DEHA 3ESXA 2FWNA 4K05A 4KV7A 2BUBA 4KSBA 4MPDA 1INLA 2XY4A 3ZS8A 1JAHA 1TZCA 3QF4B 3T7RA 4J1TA 3VJRA 4BVKA 3FNIA 2I2WA 4OQYA 1HMPA 3UG7A 4B0OA 1CE8B 1X80A 1R6XA 1UQUA 4XARA 2GYWA 2FUCA 1D2HA 1V4BA 2UKDA 3QE3A 4DR5B 3ED1A 1L5HB 2PS3A 2ZVPX 2FSHA 1KP2A 3QUBA 2H7VA 4ZRDA 4BN0A 2XNDA 5GTDA 2ERCA 2IITA 3DONA 3I76A 4Z0PA 3GH1A 2HSGA 1ZX1A 2X2FA 1V11A 4Q21A 4WBSA 3EXIB 2Y1EA 2WSMA 1AHNA 4LVNA 3BX1A 3EGVA 1XWFA 3VJMA 1T9KA 2J09A 2Q6TA 2FSIA 3WGLA 1GA1A 3N76A 3PUIA 3DKVA 2W71A 3PVZA 1UDRA 3U40A 5AVUA 5FTLA 1HR0B 4UARA 5IRCD 1ECLA 1L0BA 4Z1OA 4F96A 1Y80A 1HL7A 4V3CA 5LMZA 3RH0A 3E9DA 4RD4A 1OGYA 1E6LA 1Z6AA 4OLFA 2FWIA 1XK7A 5TQ0A 2FFBA 3JR7A 1W94A 4NFHA 1U3VA 1XTZA 5E6RB 3CW9A 3UMJA 4B3HA 5DCWA 3QVGB 3FFTA 3VZDA 4AWXA 1OLXB 1MVLA 4OHYA 2X40A 3C3AA 4R8LA 1MH1A 3E9YA 1J9ZA 3U7IA 4CCWA 3EVGA 1TB4A 2G0NA 2H1CA 3ZKAA 2O5CA 2HQRA 2DT5A 4AZ3A 5EJ8A 2O8DB 5ELXA 4Z1MA 3MBOA 1DXOA 4LY0A 5IFKA 3M6AA 3G17A 1E9EA 1MFZA 3NHAA 5ESRA 5HQJA 1BWRA 4IJMA 1K7CA 1U7ZA 1XR3A 3QEMA 1BIFA 2P1RA 3TDKA 4RTSA 4PC2A 3KSBC 4LCBA 4EI7A 1NX9A 4YAUA 4FFSA 2VBGA 3G2NA 5KC8A 4ZZIA 1T5LA 4OMFG 3GVCA 4U8HA 3RBXA 3ANXA 3BFPA 1M1NA 4GYKA 2RD2A 1D0SA 3EZ7A 4PZEA 4F71A 4Q6WA 1NZFA 3HDHA 5CEEA 1QO0D 5ILGA 5DTRA 3TRKA 2AHOA 1U63A 3D0OA 3DE7X 4TL6A 1MH9A 3KD3A 1DBQA 4MA5A 4BLPA 4BQFA 4BUJA 1P1KA 4WDQA 1RC1A 4WXRA 3LY7A 1IXKA 3U61B 5D3QA 3LAWA 1OFIA 2VYND 1JDBB 5G0UA 3V4PB 1PFWA 1X7GA 4L75A 2AOTB 5CB4F 2JIPA 5I4BA 4FVTA 3WB0A 4E11A 1PT5A 5CDFE 1R12A 4PRYA 5EGNA 3URMA 2VEDA 3DWIA 4EMBA 4YXFA 2B8EA 2AL7A 4HN9A 3QSGA 4MUHA 4CQNA 2BT4A 3S40A 2PVSA 2YOHA 3HO8A 4ZZ1A 1SCBA 1JKIA 1R50A 3AJDA 3Q5EA 2EBHX 1OX4B 3HG7A 4NJEA 1KKLA 5CW2A 1P3Y1 3EVBA 4ER3A 1ADYA 5ICFA 3COJA 3QV2A 3Q9LA 2C31A 2PE5A 3RKRA 3Q2KA 1Q14A 4WMLA 2H07A 5LQCA 3FUTA 4NVRA 3DJYA 2ECQA 4YIHA 3X2SA 4EGJA 1PJ3A 2NZWA 2G1UA