4LECA

Human methyltransferase-like protein 21a
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
202
structure length
202
Chain Sequence
QKFHKPLATFSFANHTIQIRQDWRHLGVAAVVWDAAIVLSTYLEMGAVELRGRSAVELGAGTGLVGIVAALLGAHVTITDRKVALEFLKSNVQANLPPHIQTKTVVKELTWGQNLGSFSPGEFDLILGADIIYLEETFTDLLQTLEHLCSNHSVILLACRIRYERDNNFLAMLERQFTVRKVHYDPEKDVHIYEAQKRNQKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein-lysine methyltransferase METTL21A
publication title The Crystal Structure of Human Methyltransferase-Like Protein 21A in Complex with SAH
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 55
structure length 202
sequence length 202
chains with identical sequence B
ec nomenclature ec 2.1.1.-:
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10294 Methyltransf_16 Lysine methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4lecA00
2BR3A 4FR0A 3SSNA 3P71T 3R0QA 5CVDA 3HCDA 1KPGA 1UWVA 3PB3A 2NYUA 2AZTA 3G8BA 1KPIA 3UJDA 9MHTA 4GF5A 3EGVA 1FP2A 1G6Q1 2ZVJA 3C6MA 2AOXA 2PBFA 3NJRA 5EOVA 4XCXA 4FSDA 4KDRA 2IBTA 3EMDA 1XXLA 2R3SA 2HR1A 1NV8A 1WZNA 3VYWA 3ER8A 5E8JA 3HVHA 5LR6A 4DA4A 2HMYB 2CMHA 2BZGA 3FYCA 3DLCA 1KYZA 3BWYA 4C08A 4E31A 2VDVE 5EIFA 5GM1A 5GIOE 1KYWA 1ZGJA 3KQVA 3P2EA 3UJ6A 4ATNA 5CIYA 3O31A 2G70A 3ME5A 1M6EX 2QE6A 3HVJA 4P58A 2IDJA 1DL5A 1O54A 2F8LA 3A7DA 5HIJA 5GP1A 4U7PB 2O06A 5HIIA 3I53A 2ZCJA 3I64A 5K0NA 4PWYA 3VC1A 1N7JA 1XCJA 2PXAA 3HVKA 3ORHA 4PYQA 5CD1A 4MHTA 2ZSUA 3R24A 1MHTA 3EMBA 2YX1A 1NBIA 2B3TA 2Z6UA 1BKYA 1BOOA 2PY6A 2YXDA 4RTLA 4XUCA 1Q0TA 5FWDA 1R00A 3BXOA 1WG8A 2Z6AA 4YV1A 1AQIA 3FRHA 4DMGA 3DMFA 4K6MA 5FADA 4OQDA 1Y8CA 3G5LA 4BP1A 2JHAA 4ISCA 5K05A 1JG1A 2EG5A 2FK7A 1RI1A 3EVZA 2JH8A 3FUWA 3CC8A 3NWBA 5EMLA 3T7RA 4WVLA 2EX4A 4BLUA 3G2OA 3A27A 5E9JA 1QZZA 1H1DA 3EVEA 3BWCA 3ID6C 2VZ9A 2ZZKA 5M5BA 4MTLA 3B7PA 3E8SA 1ZGAA 3HA7A 2ESRA 2B2CA 3LHDA 1QYRA 3OU2A 4GOND 3GRZA 2P7IA 4GBED 2VS1A 1ZKDA 3FPEA 4WXHA 2IDKA 4PYNA 2QYOA 3DUWA 3KR1A 2BH2A 4FT2A 4IKPA 4KVZA 3T7TA 4C03A 4YV0A 2HV9A 3CJTA 3GDHA 3OZRA 5ICGA 1JR4A 1X1AA 4FS8A 1G8SA 5FULA 3P8ZA 1SQGA 2NXJA 5KQRA 5DM2A 3KQPA 1NW3A 3T0IA 1I4WA 4PYLA 3DMHA 5K8VA 5EIWA 2NXEA 3E23A 2YXLA 3FPFA 1XJ5A 3KQWA 4G56A 1YZ3A 4LWPA 2JJQA 3ER9A 3EVFA 2G1PA 3HVIA 3GIWA 5EMJA 2NNWB 2PT6A 4HSGA 3T7SA 3S68A 1WXXA 3O4FA 1UIRA 3MERA 5DSTA 3UZUA 1I9GA 1Q0SA 2PX4A 4MQ4A 1EIZA 3UJ9A 2ZZMA 4CKCA 4P7FA 4U7TB 3EEOA 1Z3CA 1EJ6A 3KKZA 4PYMA 1VE3A 3UJAA 3EPPA 4PCAA 4PYKA 5FA8A 4AZWA 3IHTA 3QOWA 4ER5A 5DTRA 2IH2A 5E8RA 5K0FA 1G8AA 5K01A 2P40A 4R05A 1YFLA 2PX8A 3EVDA 1MJFA 2G72A 1O9GA 1FP1D 3ELUA 2AOTB 1RI5A 3C0KA 5DRTA 5LQUA 5KVAA 2I6GA 2BM9A 1RJFA 2PWPA 5GOZA 2GH1A 5CCBA 2DULA 3A25A 2JG3A 1JG3A 2G8NA 4FP9A 3TMAA 5CUQA 3BKXA 4YUWA 4DKJA 3ELYA 3KR2A 1SG9A 3OZTA 3UJ7A 5H02A 4DZRA 2OKCA 2VP3A 1N2XA 5DXJA 4E70A 3ANXA 5JUWA 2AN5A 3CJQA 3LKZA 3GGDA 4DCGA 3G5TA 3LDGA 5U4XA 4RTMA 1ORHA 3KPJA 3OFJA 3FUUA 3MHTA 4MWZA 1ZHFA 2YR0A 3CBGA 3R6TA 4C06A 1D2HA 4M38A 3GRYA 3GRRA 3HCFA 3LBFA 5EG5A 1V39A 4RVFA 2OXTA 5BW5A 3TQSA 3OZSA 2OZVA 3ELWA 5T6BA 4GUAA 3TKYA 4AZTA 5CCXA 1JQ3A 4E33A 3BWMA 2H1RA 3G2PA 3CJRA 4IV0A 1QANA 1IM8A 1AF7A 3SVZA 4E30A 2ZW9A 4YUXA 5HOQA 5EEHA 3EVBA 1QAMA 2OB2A 1IXKA 3DLIA 3SR4A 3TR6A 2P7HA 2H00A 7MHTA 3E7PA 4H0NA 4XUEA 4QVGA 4DCMA 4YUYA 3DXZA 3LX6A 1YZHA 4C04A 3UJ8A 2VDUE 4KIFA 4UOEA 5K0JA 4RTNA 2FK8A 1XCLA 2YQZA 4ER6A 4RTRA 4HG2A 4A6DA 1SVUA 1RJEA 3HA5A 4PGGA 4RV9A 3FTDA 4M7RA 4CWAA 1P1CA 3KQTA 5ERGB 2I7CA 2JHCA 4GEKA 4DF3A 4F86A 5DPMA 3OFKA 1ORIA 3VC2A 1HNNA 2ZZNA 4GQBA 4M37A 1ZQ9A 3UA4A 4X63A 3NTVA 2I62A 3IYLW 5K0CA 8MHTA 3M4XA 4QQNA 4A6EA 3GRVA 1P91A 3BWBA 4R8RA 4B17A 3Q87B 1FBNA 1INLA 2FPOA 1OR8A 1NW7A 1L1EA 2C7RA 2IPXA 2Q41A 3P9IA 4RVDA 5E9QA 4CTKA 4ER7A 3LL7A 4GC9A 4P7GA 3BGVA 3Q7EA 5DM4A 1NBHA 1U2ZA 1NKVA 2YXEA 4Y2HA 2UYHA 1B42A 2ZWAA 5BW4A 4RTQA 1KIAA 2DPMA 3NVMB 1KP9A 3FPJA 3UBTA 3HTXA 1R8YA 1L3BA 3KU1A 4E2ZA 2IFTA 3NDJA 2B25A 2BR4A 4GOMD 3MTEA 1SUIA 3L8DA 4MIKA 5CM2Z 3CKKA 3KPYA 5DSXA 3H2BA 3MCTA 3RIEA 1TW2A 3MAGA 5F2KA 3RW9A 2AOUB 3FUXA 3GJYA 4KWCA 5GINE 4PYJA 2PT9A 2LD4A 2PXXA 4OBXA 4CTJA 1SKMA 2PVCA 3P97A 3TOSA 4C05A 3LDUA 4QDKA 2JHPA 5LQKA 2EJTA 2A14A 5EZSA 1VIDA 4QPPA 5FA5A 2P35A 3MB5A 2IP2A 3FRIA 3I5UA 3MCZA 4BP3A 4YMHA 4X1OA 2GB4A 4RVHA 3TM5A 3KQYA 3LBYA 4QTUB 5DTMA 3TFWA 2C7QA 1M0EA 3OU6A 5FUBA 4KIGA 1EG2A 2CL5A 3HCEA 1RI4A 1WXWA 3FPHA 3KPUA 3PX3A 3THRA 5DT2A 4OBWA 4ER0A 2UYQA 4R6WA 4OA5A 5DTQA 4F84A 3OPNA 1BC5A 1VQ1A 1I1NA 2QRVB 3PS9A 2FRXA 3AWIA 4RSRA 3G88A 4RTKA 4HTFB 3M33A 4C4AA 5EVJA 2CWWA 1SQFA 3FYDA 4AZSA 2GAFA 5FQNA 1YFJA 2ONZA 5EC8A 4YMGA 2XYRA 4ER3A 5LQJA 4CKBA 3ELDA 3DP7A 3B3JA 4FT4A 4GC5A 3P2KA 4PIMA 1DCTA 2O07A 1AQJA 3LSTA 1VP3A 3KQOA 4RTOA 5C9ZA 2HNKA 3TKAA 2QM3A 5DX0A 1NW8A 1KXZA 3HCBA 4YUVA 5E2BA 4FGZA 3X0DA 2IGTA 3IEIA 5HIMA 2AOTA 3SXJA 4X61A 3UA3A 3V97A 2H11A 5CVVA 4RTPA 2P41A 1VL5A 3BGIA 4OQEA 1RJDA 3NDIA 3THSA 3G2QA 5FWAA 4BY9E 1L3CA 1HMYA 5CVUA 5T64A 4L7VA 5BXYA 3UJBA 3HCCA 3PFHA 4LG1A 3C6KA 1RJGA 1TPYA 5GWXA 1XDUA 4E2YA 3FTFA 3DTNA 5BP7A 2ZFUA 3MQ2A 2CKDA 5FQOA 2OO3A 2E5WA 3G7UA 4AUKA 2FCAA 2AOWA 3SX0A 5LQAA 4F85A 1G60A 2HWKA 3K0BA 5DXAA 1PRYA 5E9WA 2PWYA 4PNEA 3NMUF 1D2GA 1M6YA 1L9KA 1X1BA 4YV2A 4EKIA 1NE2A 1YB2A 1NW6A 3KQSA 3HEMA 2AVNA 4QPNA 5FCDA 4E2XA 4RTSA 1VLMA 5KYGA 5DRYA 3GCZA 1TW3A 3FUTA 3KPVA 3SM3A 2ZULA 3JWHA 4RVGA 4DQ0A 4E2WA 3M6XA 3CGGA 3A4TA 4HGZA 5CVEA 2XYQA 4BLVA 3P9KA 2Z6QA 3DMGA 1G38A 3DR5A 2IH5A 4E32A 1XDZA 4CKEA 2P1DA 5E2AA 4XUDA 4QVKA 3RODA 3ERCA 5DM1A 2PLWA 1VBFA 3B89A 2YUIA 4HC4A 2BM8A 5ICEA 5K0EA 2OBFA 5C0OE 5E1DA 5FHQA 3KPWA 1P39A 5EKXA 3QV2A 2C7PA 1FPQA 5F2NA 3DXXA 4IV8A 4RTJA 2IH4A 3EVCA 3GRUA 3HNRA 5C1IA 1EQAA 3P9CA 3LPMA 3AY0A 2OPBA 4KW7A 4PYIA 3FPGA 5DWQA 1PJZA 4Z2YA 5LQCA 5EPEA 2YTZA 3JWIA 5LQRA 3NWEA 2KW5A 3OE5A 4PONA 2ORED 4RYLA 5CVJA 3UJCA 2UZ4A 1UFKA 4M36A 4EMSA 1KPHA 2O57A 2PV0A 2ZIEA 5KQSA 3VSEA 4R6XA 3JWJA 3R3HA 2P8JA 2GLUA 2ZBQA 2GPYA 3B5IA 1L3IA 3DOUA 1X1CA 3BKWA 4OA8A 2JH9A 5HZMA 5K09A 5K0BA 2C7OA 3KHKA 5G02A 3F4KA 4RWZA 1P1BA 2PJDA 2PX5A 3D2LA 3E05A 3GO4A 3KR9A 3DH0A 3OCJA 3OE4A 1VPTA 2R6ZA 5IKMA 4V0RA 3UFBA 1JSZA 5EMKA 1FJXA 5EKUA 5EEGA 10MHA 3BUSA 3FUVA 4EQZA 1QAQA 3BGDA 1VP9A 5B1SA 2PXCA 3EVGA 5F2OA 4QDJA 5EZQA 3IV6A 4ZTBA 2O05A 2ZBPA 3I9FA 1SUSA 1XVAA 2G71A 1R8XA 2AOUA 3M6UA 3LECA 4NECA 3PVCA 5E1MA 2GS9A 5GM2A 2OYRA 4IWNA 1WS6A 1R74A 2XBMA 5T67A 2P3LA 2FYTA 4KDCA 1X1DA 2AR0A 3B3GA 4HH4A 2AN4A 2HTEA 4LECA 1JG4A 5FHRA 1WY7A 5K03A 2B78A 2ZLBA 3LCVB 3P9NA 2IIPA 2WA2A 3LCUA 3GU3A 1KR5A 3KQMA 2YVLA 1ZG3A 1YUBA 2BR5A 4GOOD 3V8VA 4R8SA 2VDWA 3TLJA 5LSAA 2GA9A 1IY9A 5ICCA 5LQNA 1NW5A 2OB1A 3EGIA 3GWZA 3HM2A 2QRVA 5P8WA 5HILA 4HTFA 2Y1XA 2XYVA 3DXYA 1G55A 2ONYA 3REOA 5K0GA 3C3PA 3G2MA 2PSSA 4FSXA 2I9KA 1JQEA 1N7IA 1F38A 3DULA 3PFGA 3I58A 2P3OA 3FTEA 2AN3A 1JQDA 4RX1A 2OY0A 3AXSA 1EJ0A 3WSTA 3EGEA 4O29A 5JR3A 3BZBA 3CVOA 4C07A 3O7WA 2B9EA 2EFJA 5MHTA 2EJUA 1AV6A 3MTIA 5E1OA 5GIPE 3SMQA 5FTWA 2ZWVA 3JWGA 5DLYA 2PKWA 3BT7A 2CMGA 1RI3A 3EVAA 1X19A 5DX1A 4POOA 3AJDA 3GNLA 4AX8A 3KQQA 3LGAA 5DX8A 4OX9Y 1NV9A 5IH3A 3PLAE 1T43A 2V7EA 3FTCA 4V0QA 2UYOA 5D1NA 3U81A 4KRGA 3NW9A 4EVIA 3P2IA 4QTTB 4DM3A 3FZGA 1R18A 5EGSA 3R9XB 5DM0A 3SSOA 3MGGA 3M6WA 2P3QA 4PINA 3EEYA 5EHGA 2AOVA 4PGHA 2ZBRA 1R6AA 1KHHA 4JXJA 5KS2A 4GOLD 2ERCA 3A7EA 4PCLA 2ZIGA 4X41A 1JTEA 5D1HA 3PX2A 4YUZA 4PIPA 3TPZA 2NXCA 1DUSA 4P7KA 3LCCA 1BHJA 1QAOA 2PGXA 3M70A 4HGYA 1JG2A 4FZVA 2AVDA 5K0LA 3G89A 3GXOA 5HIKA 4AZVA 3HCAA 4EKGA 2V74B 2XVMA 4QQKA 3HP7A 3LKDA 4BLWA 5HEKA 1YF3A 4LWOA 1EAMA 3OU7A 1XTPA 2N47A 3LDFA 4PYOA 3SSMA 1XDSA 2PX2A 2ADMA 5EHIA 3UWPA 2WK1A 2XVAA 4X60A 3KR0A 3NVKI 1RI2A 2NXNA 2AS0A 1D2CA 2IBSA 3AXTA 4HRAA 5E1BA 5EMMA 3QOXA 2K4MA 4CXMA 2FHPA 4EK9A 3SGLA 2ZTHA 2Y1WA 5ICFA 3G8AA 1JSXA 3TM4A 3B3FA 3TRKA 3K6RA 2ZIFA 1JTFA 2NP6A 2NP7A 3PT9A 4P7JA 5EQJB 4Y30A 3M6VA 2QY6A 1NT2A 2O0LA 3PTAA 3HA3A 2UYCA 2WA1A 1F3LA 3C3YA 3A26A 5HFJA 1O9HA 3CCFA
chains in the Genus database with same CATH superfamily
2QMEA 4RIHA 1AUQA 4WY2A 3QMWA 4RC9A 4RXMA 1LK0A 4E5KA 4R01A 2OZEA 2PKYX 3IQEA 1MQ9A 3MAAC 1QHNA 1FP2A 2IYSA 2C0QA 2J4FA 2NZVG 2PGDA 2PMCA 1VJDA 3GLIA 3RQIA 4W5NA 1CP3A 3N6XA 1GZ4A 4F93B 2OFWA 3D3NA 3DMPA 2O8EA 4XD7D 3BH0A 4AF7A 3K0FA 5JSUA 5EXDA 1E77A 1AJEA 2GN9A 1MDBA 4ZCSA 2QENA 4BV9A 3RYCB 2BZGA 5EFZA 3TBKA 4CIYA 3D8HA 4E31A 2VDVE 1DAMA 1SCQA 4IIXA 4RACA 1A9XA 4BX8A 2QSJA 2DLNA 3DV9A 5CYOA 2Y27A 1W75A 3FWYA 3Q15C 2RHHA 2MSLA 4BNKA 1JAHA 4XYGA 1J22A 2H1FA 1ACMA 4Z4CA 2WJ3A 1U2TA 1HQKA 1HLPA 1S3GA 5L3SB 3FSGA 2GLTA 3PXBA 4MLZA 1Z0UA 1ZUWA 4ITVA 1RAFA 3EZYA 1TUIA 2VDJA 2WIBA 4NIMA 1IRXA 1F6DA 3W5DA 4UAVA 1AQUA 3HFSA 3LT4A 1JIKA 2DEUA 3VR5A 4KODA 2D2VA 4IO0A 1AQIA 1RKQA 1PNRA 2VQDA 1XJ0A 5HKLA 2DFKB 1U0OC 3SDZA 1G7CA 1C7RA 2VJAA 3ILYA 3UNXA 1G5RA 3GVCA 3DKVA 1P8JA 5HZKA 2FMIA 3GUVA 2Q5EA 3KL4A 3RADC 3DT8A 4GD3Q 5H3LA 4OYYA 5JQGA 2WINI 3I9NA 3KYDB 3V8RA 4GI1A 3KB2A 4DIDA 3F5FA 4EJFA 5LUAA 4ABYA 4TV8B 3FCOA 4FLFA 5KO2A 3W2TA 1Q0LA 1V7CA 2V7QA 2R6CA 2SCUB 3FPEA 5HG0A 2F9FA 5BWMA 3PP8A 2JANA 4NZYA 4TUYB 5CH8A 3VZRA 3UGJA 2Q3LA 5EP1A 4Z9FA 4PZ9A 4D8VA 2O7QA 3OZBA 3WL8A 5JFOA 1RHMA 1B8VA 2YIDA 4X5OA 4G81A 4J0CA 1V3UA 3JQBA 3Q1KA 4EG3A 3ADCA 4KIJA 3OZIA 3DMHA 4HNRA 3RS7A 3WKEA 1LPMA 4L57A 1ESMA 4LWPA 1PEKE 3DEIA 1PZEA 3ZQKA 1BE6A 4U2FA 4MYUA 3ZXYA 1XU7A 4QECA 2HPZA 1E6UA 3O4FA 2X5OA 3MERA 6REQB 3P4UA 2ZSIA 1GVHA 1GUBA 3B1FA 5AW6A 3A04A 3F5MA 3PUVA 5TSDA 3ADKA 1Z3CA 4ILKA 3KKMA 3KKZA 3ZNNA 2QN3A 2ZI3A 3HKDA 3CNOA 4AQ7A 4G26A 1H0RA 2IH2A 4LRTB 4MX8A 2IX9A 2B0CA 3CY6A 4IFTA 2Z5GA 1YR9A 3V2HA 3D5QA 1PNVA 1V48A 2I6TA 3IR7A 4DGSA 4TTIA 5KVAA 2ZRLA 1YDMA 2CE7A 4G4IA 3I0NA 5EE5B 1W88B 2PWPA 2BTQB 1DQRA 2QQFA 1E7YA 3C6ZA 1A9PA 2JGDB 5JQWA 2P6UA 1L8OA 1IOLA 2WC1A 1EGVB 3TMAA 3G3EA 1TFUA 1U6IA 3R5KA 3OZTA 4COOA 2R2AA 3TDKA 1CSEE 2O3UA 3OZVA 4BUCA 2FZWA 3EXEA 1H2BA 3BWEA 4UM9B 4MUNA 3Q6MA 2F90A 4I2VA 1GYQA 4TWRA 4U6NA 5TY0A 2PTHA 4FOTA 2BF4A 4JOCA 4R0MA 3TLKA 1RD4A 3G5TA 4O1MA 5DISB 2A5DA 4C4RA 4JJEA 1IWOA 4V03A 5BNFA 3CBGA 2DXIA 1YQEA 1DWOA 4EELA 2VAPA 4M46A 2GARA 3GRRA 2A86A 4PQYA 1GFIA 3WRWA 3GUCA 3WWOA 1ZFNA 5CGZA 1A9RA 2IEBA 3U4IA 2XCSB 4ZOLF 4GP9A 3SHOA 4GIBA 5T6BA 5EKDA 4KXYA 3VU8A 3WISA 4X24A 1XPOA 1QGDA 2BGLA 1PUXA 2PPVA 4KAXA 1TC1A 2VQSA 3QG5A 4FMCF 4UJ5A 2IBMA 3K1AB 5E9AA 3SVZA 2NNLD 3EC1A 3PDIA 1H5UA 1QAMA 2JFXA 2P4EA 1LRLA 3DLIA 4ARUA 2WUGA 4MI1A 3D4OA 2P7HA 2IHZA 1FFSA 3LGXA 3WJ1A 4NTZA 2YZMA 3QKRB 1EXDA 1QUEA 2E6KA 4QU0A 2VDUE 2HMAA 3TD6A 5K0JA 1G3MA 2Q0QA 4D4MA 3SQDA 1JMVA 4N18A 4M8KA 4BC1A 4PGGA 1YMVA 3BB3A 1I2CA 4RV9A 4ZI7B 3GZTB 4JJGA 5ERGB 1XE3A 3KYIB 4GEKA 2VHEA 2FR0A 1Q7RA 2A94A 1YSCA 4WADA 1XEXB 1MJHA 2BC9A 1E9RA 1BHSA 3W5BA 3R41A 4FGKA 1M34E 4A0RA 3BMOB 3K0AB 1SUBA 3IYLW 2ZWIA 2Q62A 5TGDA 4QQNA 5J5CA 4A6EA 1ULHA 1DZIA 3LK7A 3N2KB 4QYIB 5BSMA 4C0BA 4D3DA 5L40A 4FDVA 4J4TA 2BSAA 3G5AA 3PQ7A 4WMLA 5T4FA 4BRUA 5LQSA 2VCHA 3MS2A 4XWYA 2DVMA 2IF0A 3WIVA 5BUCA 3EPRA 4M0PA 1TZBA 1DUVG 1OXTA 2DR3A 1L1EA 2DUJA 2VKTA 1FP6A 3A8TA 3IDSA 4OU4A 3CYFA 3P9IA 2O2XA 1GPH1 3DQZA 3AR9A 3UAXA 3BIJA 1MABA 1Z4LA 5D7NA 4CM8B 1GNVA 4N3GA 1KZ9A 5BW4A 3N1UA 1KIAA 4G37A 1SUPA 3UMVA 5K0FA 4LAFA 5ALOA 3T5PA 3P9YA 4QUAA 4NARA 3SE7A 2QLMA 1G8HA 2HSGA 1D7OA 1Q22A 2ZXUA 2XCIA 3C41J 1UXGA 1T5BA 3FKQA 3K4QA 3KJEA 3QVTA 4UVDA 4XWTA 5I9SA 3ZVKA 5CK4A 1IBKB 2G25A 3MMZA 2JZNA 3CKKA 1ISFA 3KPYA 4PS0A 3N6VA 3I1YA 5ESWA 5JRJA 1U5CA 3CNLA 3MJTA 4LTDA 4R1LA 4U8HA 1ZJ6A 4RMNA 3VOTA 2PS0A 4BGVA 1CW2B 3UMGA 1RXVA 3OEED 1SKMA 3TOZA 5FUMA 2QROA 3PQ5A 3AG5A 4ENUA 3TCXB 3CXUA 3L4BA 3S8EA 5ENDA 3S1AA 4J03A 3GJ6A 3T1OA 5FF9A 1JRLA 1HE8B 4MVXA 5IUNC 2C7BA 1OA0A 1A96A 2PX0A 2JZCA 4DWVA 1TF7A 2OFOA 3HCEA 1XLTA 1UKAA 3IHLA 3LI2A 4G5OA 4RM2A 4LOKA 3F47A 1KE2A 1JDBC 3BTVA 3OPNA 1W0JA 1MGOA 2LP4Y 4Q7MB 4W5QA 1D3AA 3P2MA 3AWIA 3R0XA 4HTFB 5TMDA 2XUAA 1OPXA 1USKA 4I5DA 4RNDB 1X70A 2ECPA 2FSIA 4WXYB 5H5JA 3UXHA 3VH4A 4DJFC 4RVSA 3H1TA 1UC4B 5EQTA 2ZUVA 2YOGA 5E6UA 2DHDA 1W4CA 3UT0A 4BKQA 4DA8A 2CXNA 4PZ0A 1DRUA 1F0YA 5JMTA 1NQOA 1Z2OX 2VP9A 1FMCA 1UP4A 5J1SB 3KDAA 3V3KA 3WSWA 3F8TA 1C5KA 5CLLA 3J81k 4NJOA 4L2IB 1G3IA 1TGYA 1JR3D 4RE5A 2Y1CA 1HE2A 5KINB 4GE0A 2IGTA 4M3NA 4XJTA 4ZEWA 4PLGA 2VNSA 1O6BA 3V97A 3WRXA 5BOSB 4UU8A 3E9ZA 3GEPA 3U7FB 1WXIA 2Q1YA 3JPWA 2DH6A 4M0KA 1OI3A 1HETA 1VPWA 4NS4A 3KT3A 3B12A 3RWMB 5ALKA 1SWVA 2ZSKA 3BL5A 3WK5A 4E2YA 2E7ZA 1KSHA 3Q3EA 5BP7A 1TK9A 7AT1A 1XKQA 5FQOA 4FXPA 5FLEX 4AUKA 5EZ6B 4AJNA 4XQ9A 5HX7A 7ABPA 3E35A 3KVVA 2AE2A 2HF8A 4LVUA 4NEQA 4BU0A 4NICA 5JCJD 3OCCA 1SUAA 2F43A 3EY4A 4PNEA 1E3IA 4X84A 3WL4A 3X3HA 4W5OA 1CRWG 3RJTA 4EW2A 2GJ4A 2XGJA 5JECA 1Z7WA 4K9MA 3FUTA 4B4WA 2OA0A 4MCAA 1UMDA 4A1FA 3PPWA 3OZDA 1V8OA 3KAQA 5T4EA 3CLTC 3FVRA 4R2HA 3WYCA 3QLUA 5ALZA 1FA9A 1Y3DE 3EXHA 1FPMA 1JEAA 2B94A 4ETWA 3THOA 1QB7A 3EIHA 3SCZA 3BK7A 2HBYA 4KZPA 5GTDA 1R4MB 2GN1A 4FLMA 3S2UA 4XUDA 3HB5X 2GYUA 2YVKA 1RKXA 3L7MA 4J2HA 2ZR0A 4UQPA 2BM8A 1FYVA 3LT1A 2DYKA 4HWRA 4A27A 1Z0DA 1VYTA 5IF9A 1EH5A 4TLLB 2VCEA 4MA0A 2BT4A 2P6NA 3T5TA 4DNQA 4DV2B 1Z4OA 1Y8RA 2CGEA 5IUKC 1EYZA 5K8JB 3P9CA 5IM4A 3KELA 1Q6ZA 1X7YB 1K86A 1H2ZA 3FKSA 3QE4A 4E03A 9ATCA 3CKMA 4TKMA 2YTZA 2J3MA 3MWKA 3AFIA 3JD4A 3G59A 2KW5A 1XAJA 3BRCA 2GCOB 1VMDA 4LEIA 2J3IA 3O2SB 4HDSB 3AH8A 1NULA 1WJGA 1W87A 1YD7A 4H3KB 4P93A 1VG0B 5I4CA 4C7XA 2H4XA 5DGTA 1B15A 3VSEA 1FNSA 2D1SA 3AFMA 1OWOA 4KFCA 4IGEA 3E1GA 1E1DA 1CTQA 3A1FA 4XB1A 1P4JA 3GCXA 4QJ5A 3RI3A 2H06A 3TQFA 1SKQA 1WL8A 2PMBA 2RH5A 1C8VB 4BB0A 1M7BA 3ICVA 4A0QA 3C3EA 2ZB3A 4UCQA 4DLWA 2LCIA 3IEPA 5MFZA 1D0VA 5BUZA 1NF9A 1PR4A 2MWMA 2R6ZA 3JASA 1B3RA 4EY7A 1MG0A 3WLAA 1RQNA 4NVRA 4CKWB 1Y5MA 5T8KA 5ITVA 4Q21A 1KQGA 2I34A 2QI9F 1R6BX 1FYDA 3C8UA 4GOKA 3MRSA 3U9SA 4AO6A 4AZ3A 4HZUA 4YQFA 1XA3A 1T8PA 5LLSA 1COWA 1CKEA 221PA 3FROA 2GM9A 4RENA 5T3YA 1G18A 1A2BA 2FSGA 2GNAA 1C1XB 1VYVA 1ZD3A 2GDZA 2O4CA 4I5FA 4LY3A 1E98A 4Z0PA 5M3BA 4IRXA 3TPCA 2IHVA 3NCHA 1A1SA 2AR0A 2IQIA 1T0HB 1E9FA 4GKKB 1TZCA 3D3WA 4NV3A 2AJCA 3V4OA 2G6TA 3LCVB 2JVIA 3A1VA 1RJWA 4EB6B 2JCGA 1EP2B 3OSUA 3VPHA 5AW1A 3YASA 2WAYA 2XSZA 3RF6A 2I2WA 3L1VA 5EA2A 3V8VA 3TSYA 1L4NA 2R1VB 4R1MA 1TQ2A 5EQDA 2NZXA 4DXDA 4QGSA 3O8RA 3BQNB 2VG8A 4N7JA 1ZIPA 5P8WA 4D99A 1YK1A 4D2IA 4NEHB 2FZCA 1FFXA 1QDLB 2XYVA 3HN7A 3WDMA 2VAXA 3C5HA 2XADA 2CEAA 5A1JA 3FLBA 3QMPA 3PFGA 3K32A 2AN3A 1CS4C 1QHGA 1EJ0A 3TH5A 3NH9A 1F48A 3S2ZA 4DG9A 4Z4FA 5ABPA 2WFMA 3AP1A 5ARDA 1GT91 2H4ZA 4Q1AA 3R8FA 1JWLA 1W36C 3WGHA 3GELA 1DG1G 3BFXA 3D4NA 2XE7A 3AUXA 3WYEA 1JLSA 1QDEA 1V8BA 1W5AA 2Z9DA 2H16A 3E84A 2LRHA 3CSDA 4KE6A 5JDIA 4POOA 5K6AC 3DTYA 3M8KA 4WGGA 2LKDA 3I0ZA 3HV2A 1DP4A 3FTCA 2BZSA 4KO4S 4WBXC 5F98A 2J3DA 2WFLB 3P52A 3IKLA 3FZGA 5HP4A 1O8CA 3LBHA 1GQYA 3N8IA 4JB3A 4TV9A 4YAIA 3TSZA 3K0EA 5JYBA 5KNBD 1TE2A 4MV1A 5CP8A 2I1VB 4H7JA 2QN9A 3R7SA 4OI4A 4OQPA 4E1AA 1M8PA 1TU3A 2PZFA 4PQEA 3I62A 2VPQA 3D0RA 3TGPA 4WNAB 3HCPA 2ORVA 2C84A 3MAJA 2HT6A 3LYLA 3MMSA 4YAJA 4ON9A 5GJVC 3D3JA 5I6DA 5KJFA 1G3UA 4A82A 3FOAA 4G0XA 4X64B 2WHRA 2D59A 2FY8A 3C3WA 1QAOA 1WKVA 3LC7O 3AB8A 3LUBA 4HGYA 2AI2A 1KVSA 1Y7TA 2HHAA 3ASUA 1O94A 4C78A 4CFZA 1J06A 5AQEA 5JNRA 4BTVA 2YNMC 4G2NA 2VQFB 1XFAA 5AK6A 1W48A 1XVVA 5HEKA 4DUPA 4UASA 3I5MA 4I1PA 1JA9A 1QRTA 4Y0NA 3UGKA 1QU3A 4QSHA 3I2GA 5DCYA 4B3JA 4K9PA 4QBFA 4BLOA 4AT1A 1I1OA 1NFRA 1X14A 1H2XA 1XTZA 4AL4A 2XHZA 4HRAA 3QVWA 3JRWA 3EQ8A 3MJ4A 1JKXA 2C8KA 2K4MA 2O2SA 3QBEA 3ZUGA 3N7UA 5G1NA 4LQDA 1P5ZB 3H5VA 4J4BA 4CM3A 4YJ2A 1J0XO 1OX4B 1QQBA 9GPBA 1BIFA 4P82A 2BKAA 2ZIFA 4KE8A 4L0QA 4MQFA 4R2LA 1CR1A 3S3TA 2NP7A 1XA4A 3ICPA 1YKGA 4YBRA 4B81A 1FFAA 2WQ6A 3P0EA 1U2GA 2RC5A 1F3LA 1J8QA 4PSDA 4TRJA 3AI3A 2XT0A 4C01A 3W9SA 1EVJA 1XZJA 2ID7A 1JHMA 3C24A 3DGEC 4PLFA 2C4TA 2BOVA 3TK1A 1DQSA 3GBPA 5CVDA 3M6LA 4BYGA 3STYA 5FFNA 3FW1A 4QU8A 4EP1A 4QAQA 3O3NB 4EL5A 3WO1A 1NXSA 2QN1A 3EGVA 3MWDB 3FETA 3PHIA 2FGJA 2AOXA 3G0CA 3GLIB 3O83A 1J07A 4Y9TA 4RZXA 1ZW1A 2O8EB 1RHUA 2R5NA 1R5JA 1QR2A 1JWBB 2ZS9A 3PUIA 1UBNA 1KYZA 2BE7A 2OV4A 3RU3A 4D9JA 5EHXA 2QTGA 3Q41A 3UTDA 3SY8A 3TRDA 4B45A 1A9XB 3NHBA 1DIGA 2PUBA 2ST1A 2G70A 3O4GA 1HDEA 3QXSA 1BE0A 1UZLA 2IDJA 3I04M 5FTLA 4IOJA 4YS6A 5FUWA 1SWWA 1X0VA 4ZCTA 4XRRA 2HU7A 3HP4A 5BUQA 3MK31 1MENA 5REQA 2EFHB 3VMMA 2G40A 4PX9A 2RH4A 5DGDA 1ZOPA 5C7IO 4Z4IA 2QUIA 3PCXA 5IAOA 5U4QA 2P27A 4XUGB 2JGRA 3S1SA 4Y6LA 3MN1A 1U3DA 1BOOA 1Q0TA 4OXIA 4DC1A 2JK0A 1VIMA 4N5IX 4RA6B 5ALNA 4F9EA 4BTEA 5FI5A 1L5WA 5FTJA 4PXSA 1NUAA 2RKOA 5G3ZA 1X86B 4QDUA 1CZOA 1ZA1A 3W7AA 2ZWOA 2E37A 4FFRA 4G0MA 4JODA 2QD2A 4RPCA 2VRNA 3UOGA 1SHTX 1VOTA 3AU9A 3HLYA 1LD3A 1WB9A 4WVLA 4KGVA 4AAYA 5DHQA 4LFAB 2WIJA 2XMPA 4IHAA 5CJPA 4TTAA 2CUTA 4DR5B 2EKQA 3HB1A 3TJZA 5JQGB 1HPLA 2REOA 1K2WA 2ZZKA 3K35A 4LF6B 1ZIXA 3B3AA 5FRDA 2XZLA 4CM4A 3E3AA 2VS1A 4PR0A 3AF6A 4XEUA 2B99A 4ZAXA 2WP8J 3DUWA 3ZQUA 3LUPA 2OXEA 4RLFA 4CR8A 5K0ZA 4C03A 2WLSA 4PFQA 2IZ1A 1YDEA 1RLUA 4EGSA 5TQ0B 5DM2A 4DNFA 2DSTA 2VOJA 2W6NA 1W76A 2RAFA 5K8VA 4DXHA 3C97A 4G56A 1L4FA 3O7MA 4QUBA 4C1NA 1NF8A 4TYQA 2G5PA 4HN2A 3O0DA 4I2NA 4WZBB 5EMJA 3PL1A 4ROTA 4EUKA 3ADBA 3KKOA 3Q3GE 1H2WA 4HUQA 1HRKA 5DSTA 3SQWA 1Q15A 4UXHA 4WOKA 1U7OA 4C0JA 5CAEA 1GLNA 1QTRA 4W1SA 4PRZA 5BRAA 3H8VA 3GMDA 4KXMA 1JB1A 4D9CA 2ZI5A 3HKDB 2J9FA 3UENA 1CUJA 1Q3HA 3FPAA 3DNFA 3I1FA 5B3JA 3U60B 2J0EA 1E2NA 2PX8A 1NBMA 3ELUA 2G72A 4IR7A 6YASA 1RI5A 2ROQA 2X4LA 5DRTA 4L51A 3FNFA 2HWXA 4RDXA 3EC7A 5K9ZA 3FGPA 1BXGA 2RGWA 4A8JC 1K89A 1EP3B 4G8CA 3K2EA 4E5NA 5KZMB 5C1BA 3NORA 2UXDB 1M8FA 5HPYB 4FP9A 1UBJS 4HGNA 3UUEA 1ZMXA 4OQXA 5EJFA 1HDZA 4RMJA 2WOJA 4JS0A 3ECCA 4RPLA 2J30A 1L7OA 1NSTA 2LVBA 2PA0A 4KLZA 2WF7A 4MCHA 2HJWA 1XSEA 1EP9A 3E53A 3CJQA 3NNSA 4Z4HA 3OF3A 3VRHA 1K3FA 1XZEA 1PV2A 4AJ9A 1VHLA 4AURA 2HFJA 5KOJB 3GZ4A 2Q1UA 3RTBA 2ZB7A 2EGGA 4R2WA 1D1QA 5SYMA 2B7BA 1RNLA 2ZSFA 4TGLA 5TF4A 1VL0A 4IPTA 4WLUA 1IIBA 5EJ4A 2V7TA 1P8AA 3LWBA 4MVJF 4QOGA 4BKUA 5JD6A 3AFGA 1LBTA 1TCVA 4CT0A 5JT1A 2PN1A 4IX1A 3PFCA 4HNAA 2AMFA 3RRNA 3A31A 3INYA 4G24A 3RB8A 5LXTA 1E2HA 2HFKA 3I32A 5H70A 3CA8A 3SQMA 3I5AA 4F5WA 5AVRA 4LE0A 1G2OA 1BQEA 4BVLA 2BCEA 4JXKA 1RTKA 5IUJC 1PK7A 3GJZA 1UJ6A 2GM3A 4G5RA 1Z2EA 5AVQA 4D5EA 4Q3AA 4RLQA 1PVDA 4N48A 4ZJZA 3CBQA 2FK8A 3QWFA 4JLAA 4MRRA 3U31A 3KB6A 5AIBA 3VNAA 5AVTA 1OI4A 3ZVNA 1QCYA 5F3DA 2CCJA 1KR2A 4GG1A 4HK4A 2WM8A 1XNQB 3VC2A 5C34B 2C3UA 5CDSA 4DIFA 2NGRA 3AB7A 2CB0A 4CUJA 3DB1A 2Z9CA 2DECA 2NUAA 3THXA 4LDJA 3BWBA 2YVAA 3GP5A 1VYHA 4MUFA 5CEFA 1NVTA 4PBSA 1E7QA 2CLEB 1N3BA 3IKTA 1BWSA 3F7NA 1TVEA 2ZIVB 1NW7A 3OY2A 3SZUA 4YGXB 1R88A 2Q41A 1RYFA 3WRYA 2AYYA 1LXCA 3MBOA 3TFQA 4CTMA 2GD1O 1B6GA 3CWCA 3RC8A 4FX5A 4XI9A 1NKSA 5HDQA 3U49A 1SZJG 1X9GA 1GP2A 1JYEA 1MABB 1ORWA 2ATVA 2GPNA 2YXEA 3BXGA 5JSKA 5IN5A 4N41A 4P8RA 4EECA 3BXHA 2C77A 1JR6A 3WGOA 5CXXA 5IABA 1NYLA 5HJ5A 4OHYA 1GNLA 4MYDA 4K46A 3G1TA 2IX3A 4B2LA 5BMVA 2CWDA 2YASA 4DV7B 2XCTB 4XVRA 3P4YA 1UPTA 4JVOA 1DJQA 4AU1A 3U13A 1FU8A 3L0SA 5ALRA 1LS1A 2BZ1A 1L6RA 2NU7A 1AKTA 3FUXA 4LC1A 3STUA 1I6WA 2LD4A 4EFLA 4F5ZA 3K16A 1OXVA 2I54A 3CLSC 3P97A 3WV4A 2FPSA 2R8PA 3EW9A 2AG6A 1NJ6A 2Y0BA 1XEFA 2WICA 2X41A 4WKCA 6ABPA 1JU4A 1W94A 4ND3A 2F48A 2HCTA 2QXYA 2ZOSA 4DCCA 1X7ZA 1OMOA 3I5UA 2PU7A 1L1QA 2OQRA 2Q4DA 4F2HA 2CNNA 4IIJA 3S1AB 4O1IA 3ESXA 4MAMA 1U04A 4MB2A 1S2LA 5IM5A 3TFWA 2QMQA 4Q1BA 4XYEA 2NZJA 3R6DA 3GAZA 1AQYA 2Z5FA 3KV1A 3D4PA 5DTQA 1QGUA 3PEFA 4R6WA 2VPWA 2Y0EA 1E6WA 4I4TF 4LDQA 4XYLA 4KL8S 3TIFA 5HUQA 1JYFA 3F67A 1M34A 3TMKA 3BRQA 4G09A 3D6UA 4A0GA 4LMBA 3PJEA 2BEUB 3DYVA 2FRDA 4L28A 3SG0A 3BG5A 3KLMX 4A10A 4LSWA 4NCAA 2PQ6A 3E9NA 5E6UB 2QSUA 1AKMA 1SA0B 3W7VA 4US0R 2NOAA 3ZLBA 1CS0A 1ZGHA 4GC5A 4D5GA 2FKAA 1HLFA 4TS9A 2IS1A 1YQXA 1IEWA 4C21A 2Z6VA 1WCWA 4HYQA 3T35A 2VUTA 3IJPA 2ZAYA 4GYWA 3R7WA 3FM9A 3B60A 3O75A 3SXJA 3FIJA 3Q7QA 1MAVA 1PR1A 1RJDA 1B8UA 1KEUA 3JQAA 3T41A 4CJXA 1E9SA 1TX4B 5AOAA 5BYBA 3F73A 5IDXA 3ZE7A 4N03A 5B58C 3UJBA 5CDYA 1GPLA 3LE8A 3UY4A 1CUEA 4JYAB 3H99A 3C2QA 1ETHA 3E2MA 2CW5A 3KB8A 2R1ZA 4IM7A 4F2GA 2OAQ1 4J7CA 5I9TA 5EUQB 1LLDA 3IBSA 3NASA 1R5BA 2VHXA 5LIRA 1P19A 2WTAA 3IQXA 3NS7A 4ZVQA 4OHMA 4L78A 2WYUA 4D0NA 1PQ4A 3CLKA 3L8HA 4MW9A 2JLXA 4JLDA 3AI2A 4AB1A 1AKNA 1M1NB 3SLRA 5TMBA 4AIRA 4BBPA 1HM5A 4YEDA 4BNXA 1DIAA 1DXOA 2XH8A 3GCZA 4EWLA 3DBLA 3W5CA 3UEOA 1QCDA 3ESAA 3VR3A 1XTJA 1REQA 3BC1A 2RHTA 3DBRA 4F1KA 3IT0A 4H7IA 4BLVA 1RQLA 4K3VA 3EXHB 2FPPA 4KXNA 1OVGA 2IYNA 1HYGA 1L5SA 3H8JA 3PF8A 4H27A 4JQCA 4Q4CA 1S1CA 2YIVX 1T4MA 4CKEA 5I7HA 3QHPA 1R9GA 4BGEA 4DWOA 5JAHA 1R9JA 1H3EA 3PC3A 821PA 3ERCA 3GVHA 3L0CA 1R10A 4AF6A 4I19A 1UAGA 4Q12A 2C7VA 4DEVA 3D81A 4O2LA 4YRCA 4B7UA 2OD7A 1A7UA 5MDHA 2DHCA 3PDUA 3JZAA 3SE0A 1FFWA 2BEKA 2V6GA 3DZBA 1KYQA 4FN4A 1NQVA 1Y8RB 4FONA 2HF2A 5JHHB 2L42A 1XZPA 4HNTA 3GPDG 4L8GA 4LXGA 3WLNA 3NDPA 3TW4A 3EZXA 4RZ3A 4LGYA 4YR9A 1TKCA 3PXEA 3L43A 1E5TA 2VWHA 2H63A 2PH7A 4GLFA 4ZD6A 3A4NA 1K4KA 3K73O 4EMSA 3PE4A 2Z43A 3HACA 1U63A 1DADA 5IT5A 4YVFA 4A0FA 3DEJA 4FKMA 4DMFA 5E7QA 5BSTA 2B2XA 4CLHA 1M2JA 1FMTA 1VL2A 2PL5A 1BMDA 2REXB 2ZBQA 4YNBA 3SLKA 4EBFA 1P1KA 2Z04A 1GL9B 5BSVA 2GUGA 4O2AA 5AJVB 4L85A 1KRHA 1EXVA 3IB6A 5AT1A 2CJYA 2GEVA 1GY8A 1GZUA 4EEZA 1ATZA 2FETA 3KR9A 4J1TC 3RRJA 2AQKA 2VJDA 1UH5A 4YRSA 1LNSA 1SXJD 1W2HA 4JJ4A 4O08A 5CB4F 2XCUA 4E5YA 1PR6A 3LBNA 2DG2A 4Y8VA 1XQ9A 1B2LA 1KKMA 2HXGA 1TXGA 3CNBA 2CJWA 4Q01A 4CBVA 1I3KA 1TKRA 2UXCB 3EBPA 4TKUB 4PNHA 3OUTA 2NZUG 4LQCA 4WBNF 1H1TA 2O8BB 1K7YA 4AZ3B 3RHSA 4HZUB 4HHEA 2W8BA 4B8YA 2VYVD 4R1QA 1ILEA 1QU2A 3KQLA 1N4AA 4UUOA 2W90A 1CE8A 4NHEA 1NAHA 2G0NA 2P3LA 2Y93A 5BSHA 4J7UA 1ZOOA 4ZEVA 4Z4GA 3HZZA 4CN8A 3CLHA 4RHCA 1RHQA 1V37A 3AX6A 4KSYA 3E1SA 3D3WB 2VRWA 2FG7C 3AY7A 3LFUA 2IOYA 1U1CA 4HQRA 3Q7IA 2BSXA 3GU3A 4TWJA 4ZVTA 3VNBA 4YCMA 3KWMA 3CLRC 4B76A 1RWOA 2GUWA 1S2OA 4MR7A 5KMGB 1JIUA 2HW8A 5ICCA 3ED5A 1DDGA 4LKRA 1K6IA 3EGIA 5DCLA 4Z86A 3I2IA 1Z22A 4QQKA 4TVSA 1ODFA 4BQEA 3EQZA 3E5RA 1FFXB 4G01B 3Q11A 4LISA 4RD2A 1N7IA 1RYEA 3EBOA 4GR4A 4TWBA 4I3HA 1A9OA 3BCUA 4MQEB 2UV8A 2R8XA 4ZP1A 3SEFA 1W5EA 1EP1B 3ZLUA 3E9YA 4O29A 2QNBA 3EF3A 1OUMA 1TCAA 2AZDA 1RFLA 2EFJA 1F5SA 3JYHA 1N2ZA 1Z16A 4IWYA 1UFOA 2IRWA 1GNPA 2JBAA 4YC7A 1GG5A 1BJRE 2ZUCA 4GRDA 5E1OA 2ZWVA 4GVPA 1KERA 2ACEA 2LIPA 4X62B 4NFHA 5JIBA 3NEYA 4O4JA 1JEJA 2GBLC 4AX8A 3LGAA 1NJSA 2XZOA 4OQFA 5CU7A 3MGCA 2W48A 3NGLA 3OVMA 3ZX5A 2VEOA 2EJWA 1UKYA 2XD9A 3PK0A 3LZCA 4KRGA 4LDNA 2NO9A 4MUKA 4UEQA 2HPVA 4Z3OA 1FUEA 1QQAA 3FJYA 5C2JB 3FTFA 1R18A 4L8YA 3G9TA 3BD9A 1IAVA 2DMRA 3JTEA 4UBLA 3GDGA 4UNNA 4X54A 4CL8A 4MW1A 1CRPA 3E03A 4ZAWA 1H8HA 3QEJA 1L4EA 1L4KA 1B6TA 1L7XA 2IUFA 3OJEA 5J40A 4OIFA 5IAAA 1BVUA 4LHSA 4YUZA 2VUIB 4GICA 5C8YF 4ACAA 3LCCA 1N9ZA 1VPLA 4IDCA 4UTOA 1F3OA 4DB4A 5EJEA 2ZUFA 5TJHA 2YWCA 1AKYA 4G1VA 1S3IA 4ZT7A 5G0VA 5FI3A 4BRZA 1YJXA 3IP9A 3VNUA 1CQJB 4YT5A 1T26A 3RS4A 1TT7A 1QJCA 2UAGA 5KJ1A 4NXMB 3RBAA 2HKIA 3LUFA 1IY0A 5MFPA 1A5BB 4HZIA 3UWPA 3TTWA 2XVAA 1QF9A 2PDAA 4V2IA 1CVIA 1SHJA 2C8JA 4CMGA 1D2CA 3NVAA 1KAHA 4ZJPA 1XN4A 3BXPA 4NJEB 4BVFA 3ANNA 1NVWQ 3O2NA 2FHPA 1ZM9A 1ULAA 4BRSA 1O87A 1PS9A 2BFBA 1KP2A 3V8MA 3BJZA 5G0SA 4CV1A 2CFCA 3PUZA 4JD5A 3ROEA 2GT1A 3DEHA 4G6ZA 4GW3A 3PR2B 4CMKA 3LUGA 5KBYA 3CKYA 3D6JA 5KWJA 1M74A 1NMEA 3QF7A 2W4QA 3VV2A 4OB8A 2R62A 2EATA 3HDHA 3KNZA 3GNSA 3LHSA 4WZZA 2WD7B 4EPTA 1D0SA 5IDQA 2WHYA 5B2EA 3L5OA 1BFDA 4LYEA 2OCPA 3JW8A 4HKTA 3ZGVA 1VG1A 1DJLA 1DSSG 1U7PA 2GFQA 4KNVA 4CMEC 2PQMA 3DV0A 4Q9HA 1JWAB 4EHKA 4BNNA 3L7LA 2G9NA 2CHFA 3DPIA 3P5BA 5EOVA 4DAOA 2R3SA 2CV2A 2CZQA 3DZHA 4P31A 5FNVA 5HUHA 2HDHA 3RYFB 4XR9A 2YWXA 4EHDA 5ICMA 2HMYB 3N75A 3OO0A 4MYRA 3KRTA 1W0KA 4EF5A 4M1WA 3CZAA 3KQVA 5C8XA 4DLAA 2FU5C 1FVXA 2XCOA 1QHHA 3T7KA 4QBKA 2NVBA 5JJIA 1XTKA 2FSFA 2VDNB 3GEHA 2OG1A 4KSBA 3PDCA 5LMCA 2P75A 4JEIA 2WJZB 4G0NA 4AROA 3DHNA 2OQ2A 2ZSEA 4S2UA 3L8YA 1WW2A 1GGEA 4JUFA 2HCBA 5REQB 3N86A 1E9VA 3NYWA 1NOJA 5CX4A 1ZPDA 5DEOA 2YFHA 1JQJC 3T95A 4CETA 4R71A 5I5GA 1YB7A 4XUCA 3WICA 1FRVA 4HLQB 2IZ0A 2OHGA 5FL7D 3COPA 4DJ5X 2D6FA 4LJLA 1Z5ZA 3ASVA 1C30A 4N54A 4HLUA 4K6CA 1X1SA 3V2IA 3Q3CA 1WVGA 1AS0A 2XY4A 2OQVA 5CDUA 4TYYA 3V00A 5JXWA 4RXUA 4KLRA 3CVXA 3RM3A 2AK3A 3IXMA 3ISJA 1VPEA 4MVJE 4EYKA 3D1VA 4NATA 3VO1A 1YCHA 4PZLA 1PZXA 5JASA 4GOND 2JATA 1WV1A 3JRNA 3QVOA 1ZXBA 3USES 2I76A 3GRZA 3L8ZA 3UXYA 4CI0B 4NBWA 4WA8A 5BV0A 4PYNA 4Y6QA 2P68A 1F5NA 4FQ8A 4QXOA 3T9CA 3BXFA 2DR2A 2JLUA 1E9CA 1R37A 5FOXA 3GDHA 3OZRA 5BR7A 1ZH8A 3GPBA 4DLXA 1AX9A 4DA6A 3HUUA 4BQQA 4Z0HO 2EFCB 3RTGA 3T0IA 2X4IA 3T99A 1KOGA 4EY8A 3R3SA 3CT4A 2F3RA 2X4DA 1XMIA 3GJ0A 1A4XA 4H9GA 2Q1XA 5AKHA 1S7GA 1KAEA 4JZYA 5JNSA 1MMFB 1E1KA 2CLKB 4B8ZA 1I0IA 4PF1A 3T7SA 2WZBA 1EM8B 3S68A 5ETJA 4BNLA 4EM6A 1UIRA 1PQPA 4HUQB 3LTNC 2ZYGA 2EU8A 3A6FA 5HW0A 4CKBB 5CAEB 5K0SA 2HLPA 2YHSA 4WT7A 1ZH4A 4PYMA 3EEBA 1JZSA 4AZWA 3CX8A 4GDFA 1I3CA 2OC4A 2W43A 3H2HA 3HQ4O 3MT9A 4YUAA 1BCSA 1MGPA 5HIAA 1C0IA 1YMQA 3NV7A 2OD2A 4LHWA 2PKRA 1MJFA 2JLAA 1XEWX 2MSKA 3L41A 1HURA 1DWQA 2EV9A 2Q2WA 2GAJA 5LVAA 3ZHUA 1BXGB 2D5AA 1MC1A 1U11A 2OOSA 5I47A 4M8SA 1XMVA 1XMJA 2WFAA 3R6WA 4I1UA 4JUAA 4EHJA 2CLHB 3BERA 1PNQA 3UICA 1Q12A 2CB9A 2PUAA 3PNQA 3PE3A 3DKKA 3O2JA 4YJ3F 3HJCA 2F1JA 3A6EA 4B4UA 3C3MA 5JUWA 4MAAA 4ZOLA 4H1WA 4EJ2A 1QZXA 3INTA 2WM2A 4QWWA 4XOUA 4BAZA 3MELA 2OCAA 3COJA 1TZMA 3ZIDA 5KDOA 1PJBA 3RT1A 3A9SA 4PSCA 5EE3A 5I5EA 2ILTA 2C1ZA 1MQSA 3ZHXA 5BRJA 5DHSA 2Y05A 2ZCUA 4QODA 1NVBA 4M60A 4EKYA 3KJIA 4M89A 1NQUA 5COBA 2EDCA 4N3BA 2AJTA 2ZWMA 3SQXA 2PUTA 3DE0X 5EEHA 3EVBA 4OQMA 3GT0A 3WHLA 3MBKA 5EN4A 3M3DA 1MOPA 3TR6A 4JB2A 3Q8XB 3U16A 1H05A 3VI4B 1KMHA 3SZ3A 4IHKA 4E5UA 1WV0A 4A2QA 4BFSA 2GJAA 3BZWA 3FHTA 2HQ1A 5ALYA 4L5JA 2ZE8A 2JB9A 2YQZA 4NPAA 4O0MA 4HB0A 4LV8B 4QHYA 2C2ZA 4QLBA 4E7PA 4OXQA 4F6RB 3DOHA 4M7RA 3U1VA 2ZIAA 1I3LA 5GMOA 4AS3A 3GAAA 2ZE7A 4DF3A 1ZR2A 1MW8X 4H6VA 1TI7A 2QZSA 2XPCA 5DGCA 3HJFA 1A88A 1QP8A 1RCFA 3N7AA 3V1TC 3NO4A 1UBHS 4MKZA 4QGBA 4DW8A 2I62A 4MI6A 3U3RA 5IXYA 1JNXX 3OETA 4N7BA 1MW9X 4DDUA 2NUAB 4L08A 1RWBA 5ALIA 4ZN6A 1T1RA 1K7CA 4GBGA 5DT9A 2VPZA 4B6QA 1ZEJA 1RZUA 4QKQA 1XLVA 4S3MA 4RVDA 3BYZA 1YL6A 4HQLA 1I7LA 3PWKA 1E58A 4UPVA 3RDPA 2OHIA 1J9EA 3SBEA 4MITA 3WXBA 1RQRA 1I2MA 2OBNA 4Y2HA 4CQMA 4D4GA 3DJYA 3IVXA 4CCAA 4Z49A 1M6HA 3AFNA 1KP9A 3FPJA 5AJTA 4FHGA 1X9HA 3ANMA 1UR5A 2PL3A 3IP3A 1YCDA 2EERA 4GOMD 1L5ZA 3DOEA 5C35A 4Q6WA 4LYGA 4MWOA 2G9RA 2KX7A 2WJHA 3LC1O 2WG0A 4M0FA 5BMVB 5IXJA 5IRCD 1E3LA 4HDOB 1NF2A 4ZO8A 4MGZR 4XJSA 5L9AA 3T3IA 4H18A 4F11A 2NU7B 1S0UA 2BKLA 1SBQA 2LIVA 4CCWA 3CM0A 3E22A 2W2OA 3D4IA 3U7HB 4U0KA 2A14A 3T7DA 1VIDA 5KQMA 1R27A 2YH2A 4YMHA 1X7ZB 2NT4A 3ONWA 1YS2X 3HS3A 3MJSA 3VNQA 2IYXA 1WXWA 3GLQA 4Z0NA 1QV9A 1GSAA 4YP5A 4AJ4A 5K3EA 1I7DA 3TQIA 4BO1A 5BY2A 2HA5A 2W6OA 4DCNA 3W8EA 3UOWA 5LZ2A 1MEJA 3ABIA 1IFXA 2QF7A 1TUEA 3BXEA 1VQ1A 3EGDA 5K1ZA 3T3GA 1NNSA 1HTWA 3VQTA 5JADA 2WB2A 4GQAA 1UWKA 3TBHA 2W4MA 3COSA 3ZY4A 2CWWA 2G9VA 2FOXA 3I1JA 3JQCA 3U9LA 1RM0A 5L7YA 2PZMA 3C3DA 121PA 3WJ7A 2KMLA 4IG4A 4F3KA 5JY6A 4GR5A 1OLXA 3VR4D 1CUBA 1VE5A 4G36A 2IOHA 4F9TA 2P5UA 2VI5A 4KUHA 1CS0B 3E27A 1S8NA 4U7GA 1O95D 1UBKS 1D4OA 2C2YA 1KH1A 3DCYA 2HNKA 2ASEA 3IDZA 2FW1A 3TKAA 4C0LA 2WWHA 3TZLA 2Q7OE 3KSZO 2DCUA 2WJPA 3JQ8B 3MGBA 2AFHE 3R7WB 3RARA 2H11A 2I3DA 3NAZA 3FRJA 4NBSA 1Y0BA 5ALPA 3UK1A 2DLDA 4AJ2A 2AWNA 1CNEA 1PWHA 3FPCA 4QD3A 1NX9A 2DRIA 4B75A 3AKYA 3UANA 5IULC 2XGMA 5AI5A 4TL9A 1YFKA 2I6QA 2OBLA 2SICE 2GEJA 3DB2A 2C3OA 3F6CA 1ACJA 4JIMA 2VHYA 3R5SA 2YWEA 4BFYA 5DB4A 4PXAA 1P0QA 4RPJA 1BA3A 1KU0A 2ERYA 1TC2A 2MIIA 1P0PA 5CX1A 3QA3E 1D2GA 1WM1A 1Y4SA 2B34A 2R4TA 3JWEA 4YJDA 1IZ7A 3VTKA 4BO3A 2GR9A 3PI6A 4ZVOA 5LOVA 2IZOA 4NF2A 4UULA 4YJ3B 4B6SA 4BZWA 1EGMB 1OFHA 2PGNA 3DD5A 2FN9A 4LVOA 3FMOB 4RKWA 4UHDA 1QIIA 3E9DA 3MWEA 3IJ5A 2WU1A 1SD1A 2M1XA 3KE8A 4IXDA 1TKBA 1RHRA 4HGZA 4JC4A 5DMXA 4YRPA 4E08A 1AUPA 1F9EA 1SVIA 2V1XA 4LOIA 4M6WB 4X7RA 3C8HA 1PAUA 4MQBA 4RD0A 2FWRA 2VF8A 2WHPB 3B2EA 3NPMA 2FPPB 4N0EA 3VPXA 4E32A 2IXEA 4D4LA 1EUDA 1YJBA 4IF4A 2WQZA 1SK9A 4ZIRA 3D54D 4RIFA 3RODA 5CDTA 3MTGA 1C9JA 1CXZA 4J0KA 2DOKA 3SYKA 4K0KB 2INGX 4HC4A 1N77A 3BULA 1VJ0A 3IUJA 4GP6A 4Y1FA 5JAZA 2QT0A 2AZ4A 1QFJA 4EHAA 5F35A 5DFAA 1X8LA 3II6X 1TJNA 3QEKA 4M98A 3UKDA 3CKLA 4GR9A 2WF9A 3M2TA 5BVHA 3HNRA 5FPKA 4XGIA 2HCJB 4Y0AA 4C7OB 3UHOA 5B4VA 4AXBA 4HAOA 3RRYA 3OPQA 1SD2A 4HDNA 3RFVA 2ZJFA 2BBSA 3SOPA 3VOSA 5B4TA 1IN6A 1W6RA 5F4ZA 1XL1A 3P9XA 3PFIA 4V02A 4DMHA 4U6QA 5GQSA 3K2IA 3T7IA 2EL9A 1UBGA 5BURA 4CKYA 4QBHA 2ZB8A 2GLUA 3TLCA 3ROFA 2X0FA 4DR3B 3EZNA 1F8UA 3FZNA 1LNQA 2CDCA 3OEHA 2F3UA 4O2AB 1P1BA 2PJDA 5BNIA 3D2LA 3E05A 4A3SA 1M6NA 5C5DA 5CLJA 4INZA 1BE8A 4R9RA 4YAFA 1H2HA 1VPTA 4IINA 4PAQA 4C4OA 2B6HA 1BMFA 3AKDA 5AKEA 1CEQA 4GZ3A 4JJ8A 1IXZA 1LGYA 3M89A 1EB9A 4PTLA 2CJWB 2V0CA 1ADBA 1L7PA 4C20A 5LLTA 1XIVA 3DZFA 5FOQA 1QAQA 2HMTA 2FOLA 4QNMA 4FFNA 2D1YA 1YIDA 3V80A 2ZTUA 2AQHA 4ZU6X 3L8FA 1ZQ1A 1KVUA 3BCSA 1QVWA 3ENKA 5JDCC 5TPWA 2AKEA 1JJAA 2W8BB 1O4VA 4TKLA 4TM8A 1GAQA 3GYBA 2RIRA 3M0EA 3U19A 2B4YA 1CE8B 4P9NA 4PX2A 5T67A 3VJRA 2BEVA 2P9QA 2ZBUA 4YPFA 1X1DA 3NT2A 3HEAA 1AC5A 4HH4A 3CH7A 4LHXA 4PX5A 4ZHSA 2OV2A 1JG4A 3CTPA 1C3XA 3C1UA 4TMWA 2GAOA 2R2GA 2AN9A 2JBWA 3FVVA 3QRWA 1K92A 2WA2A 3HKEA 5TE9A 3SD7A 3W6NA 3L5KA 3WBFA 5LMUB 3TTVA 3MIIA 1YUBA 1JT2A 5A9SB 2JD1A 1WVIA 1J5EB 2WWVD 4BQIA 4MR7B 3BDIA 4L50A 4HQNA 4NESA 4MQMA 4DGQA 1PDVA 5CEEA 4PPQA 5ESRA 3OLYA 3I6YA 5I7SA 5A5GA 5IJXA 3TW8B 1AIPA 4NCJA 3LQYA 2JEYA 2P3OA 2I6FA 4JELA 1QH1B 2J7PA 1ZMTA 3HN6A 3ZE1B 2FEOA 1ABBA 2RAUA 5GV7A 3QELA 5EZYA 3AUYA 4M53A 1R4NA 2B9EA 3O7WA 5A3VA 4DLTA 3TLGB 3QNUA 3FJOA 2HLHA 4B43A 3QFCA 5HNKA 4H2DA 5DLYA 1YS6A 4GFDA 4JI6B 1M0SA 4MB0A 2C9YA 3A70A 2E5FA 2QNRA 1LBEA 2JFFA 1JDZA 1Q1ZA 4FFWA 4UHJA 5AKYA 3E5NA 2GK7A 1T29A 1FS4A 2V7EA 3IPCA 3OD5A 3KCNA 1D5WA 2L19A 1NC1A 2A88A 1VKHA 2P77A 4WEQA 5F51A 4QTTB 3TNLA 1HE4A 2QM0A 4L9RA 4R9NA 621PA 1KJNA 3G9XA 3MJDA 2NU8B 3RSFA 5EGSA 3H4VA 4E4RA 1CV2A 1VLLA 2IUYA 3DEAA 4QT0A 5G53C 3COZA 2C9BA 1NL3A 3KYCA 3QXCA 3K9GA 2PCJA 3G1WA 5IWCA 1X94A 5BSKA 3NHPA 4BVJA 3AKZA 3M9XA 3OKCA 2JCYA 4KQJA 3IUSA 5IMBA 4QA9A 3FF1A 3QI2A 1CJKC 2DM6A 2VOEA 2P4QA 3HY6A 3DKRA 3L92A 2WRZA 3PLRA 3U7IA 1FW8A 5IAKA 4FR2A 3V46A 4TLEA 1Y6RA 4FOOA 4G4JA 3I0MA 1Y4AE 2ZT7A 5K3FB 1QS0B 3GFVA 4HMOA 4E22A 5HUJA 2VT2A 1F0PA 4G9EA 1VSVA 1Z4QA 4ICIA 3ILHA 2VPXA 1CYDA 5CDHA 3DVLA 1KEZA 4CIDA 2XJ9A 4TWIA 4EEKA 2WYWA 3R3JA 5KPDA 2PX6A 1RBZA 2V7XA 1LV8A 4ARSA 4CQJA 4DQVA 1L7RA 2YN4A 1PFGA 2WJ4A 3KEGA 2O6HA 3LA8A 2IBSA 3T3PB 4HGPA 4RZQA 4KYVA 5CMLA 2ZPTX 1T2AA 5M34A 4CXMA 3L7JA 1UFRA 3RJ9A 3Q8MA 4P0PB 3WLIA 3JQ9C 1K98A 2Y6VA 5HMLA 4CF6A 4YXWD 4TTTS 4UC0A 4BBJA 3TM4A 3PV0A 1S3FA 3TRKA 3QMMA 2IYPA 1XWWA 1ZIYA 4IIUA 1FUIA 4P7JA 4Y30A 2H1IA 5JO9A 1PD0A 2M98A 5KJ6A 2P5SA 4FMBB 1E89A 1PSZA 2PFSA 1GITA 2V7GA 3T15A 3NTOA 3AUUA 3RKUA 3LQ1A 3K4PA 2WIGA 2PMDA 1RW4A 3AEZA 4D46A 4EH1A 5FLXA 7GPBA 2AZTA 3AVXA 3LQRA 1D4FA 2PUWA 3IX7A 1IC6A 2IHJA 3OI7A 3KD2A 3DZIA 1E6LA 5GJWC 3W2EA 1POWA 3DV0B 1T5IA 4B3MB 2PKQO 3JS5A 3EUFA 4YMLA 1HNWB 3VYWA 2WPDA 1T3GA 1QIJA 2X42A 3HVHA 3LGSA 5TIIA 4ZQIA 5FNVB 3FYCA 4E14A 3VZCA 4DM7A 1YI8A 3R4CA 1E2BA 2X9VA 2XNHA 3EGOA 2ECOA 2G83A 2ZB2A 3EIUA 1U9JA 3LSYA 3WJAA 4M9XA 1FZTA 4Q34A 2HU8A 1MNAA 3L9WA 4KH0A 5CIYA 2BFEB 3SJ7A 1FQJA 3HVJA 1HV8A 1L5QA 1QHHB 1R8JA 3G49A 4Y9SA 2YV2A 2DBRA 3ZNQA 5TEVA 1NNI1 4JNCA 5HIIA 4M8IA 5I9BA 1SQ6A 4PWYA 1N7JA 4BIIA 4L0CA 4K6OA 4PG6A 5E3HA 3HWRA 4EAAA 1D09A 5F1KA 3NRJA 4GBMA 4IAOA 1WU7A 3C6YA 5DTIA 3FZEA 2FPGA 4O2BA 4AUMA 5JC1A 4XFKA 3X43A 4UM8B 5JYCA 2IXGA 1IN5A 1GXSB 1KZ6A 1U2PA 1XAGA 1HUQA 2QP9X 2CVPA 2H1SA 3VHQA 3FSRA 4JL5A 2UUBB 4WLNA 5IFLA 3RVBA 1PTJA 2C82A 2KYRA 3W05A 5LM3A 3PJRA 1C30B 1EGAA 2ZR8A 1P6XA 1USWA 5FADA 1M2WA 3RF7A 3TD2A 5JS6A 5J23A 2ZI7A 4K2AA 5EAIA 2H2WA 1FP7A 5ENVA 1U7UA 3QLJA 4LV5B 3U5ZB 3T7RA 1DDIA 1EBUA 3TZ6A 3ZWAA 1W5BA 4KVFA 3W2GA 4I3FA 3AV3A 1QZZA 1RLMA 3OQPA 2H5LA 2BEWB 2PZAA 3EFEA 4LZPA 4DNXA 3OQVA 1GARA 3QWHA 3IOEA 3IUMA 1VSUA 4KTVE 2F59A 4RKQA 3WE7A 1T1EA 2DUMA 4ND2A 3TTXA 4AS2A 1MQAA 3OM8A 3C3AA 4D4JA 4REQA 4ENWA 1O08A 2IDKA 2Q5QA 1CCWA 3L4JA 3WK7A 4W5HA 4IKPA 2PFGA 4YV0A 3LP8A 2OO5C 1I94B 4X3OA 4UEJA 3KX2A 1Z6PA 2O50A 4MQUA 5KCMA 1QH0A 2WUVA 5HS4A 1LWOA 3KQPA 1ZD9A 3CURA 3SXUA 2O2ZA 4YWHA 3VR1A 5EIWA 1YQGA 3L1KA 3O84A 4NDNE 4S2EA 2CJXA 2E4WA 2ONCA 1QGZA 3LUDA 3R8XA 3SDSA 1DRWA 1HFJA 3O3CA 1CIPA 4W8HA 2J85A 3P96A 1N6OA 4LHYA 5E0KB 3V8NA 3ASYA 4Q4HA 4OK6A 4IH4A 3G9QA 1VSQA 3H1BA 3B52X 1UK9A 4Q1DA 4OSPA 3UJ9A 2GCEA 3AMVA 4D1YA 3EXIA 2BHSA 3G2NA 4KXLA 3PEYA 3ETHA 3H87A 3BMQB 5GJCA 1FMLA 3IUEA 4BMSA 2QN8A 5CNIA 1SVLA 4C9BA 3SM9A 3AW8A 4ZO4A 3NRCA 1A7JA 4V1CA 4QEDA 1BCSB 1CUVA 2A5JA 3KLPX 4JCCA 1Q77A 3NOVA 4TMKA 5SZKB 1U9IC 4YP6A 2QLNA 4UNRA 1MO6A 3D0OA 1NU8A 5GV8A 4MRPA 1EVLA 2JFVA 4IVQA 4Q9IA 5U9CA 4YCAA 2WT9A 3VDQA 3KQNA 1TRHA 5DGXA 3SZOA 3T7EA 1J8VA 1QGYA 4M86A 1E79A 1GQRA 3BOSA 5LJIA 4DZRA 3NHSA 2DBZA 3WX0A 4LZNA 4DHEA 2BDEA 1IATA 1NN5A 1SXIA 1XQWA 1ZRSA 1D2NA 2FLWA 2MHCA 5KVQA 3GA7A 2BJVA 3B82A 1HQYE 2VAVA 3SKVA 3VTFA 3MHTA 1VDZA 2YR0A 2B82A 1D2HA 3KK0A 1ZD8A 2R6FA 3QHAA 1N0IA 2QEQA 4MYHA 4TOIA 3DHWC 2P65A 5CFOA 5FWYA 3BRWD 1R6UA 3QH4A 3KT8A 4FR5A 4Y2UA 4HT3B 2ZU6A 4WDRA 4AZTA 2FE4A 2PNJA 1T8UA 3BIWA 1UCFA 5K8TA 3G23A 1DJOA 1G5PA 3KSUA 4IV0A 3QHQA 4C0KA 1B23P 3K9NA 3VC3A 4YUXA 5HOQA 5E7IA 1TM7E 1C7ZA 3O8CA 2GN4A 4QHSA 2MU1A 5AKGA 1L0BA 3G2JA 1NLUA 3I8OA 4AF8A 2RB4A 4FX2A 4XIYA 4EO9A 3NHMA 1QK4A 5AM3A 5K4GA 4RTRA 3STVA 3T3NA 3OZFA 3O74A 1V47A 2I7XA 4DUYB 1DG3A 3BHNA 5AVSA 3KQTA 1BS2A 1V16A 1YB5A 2JHCA 5DN6A 5C52B 1ORIA 2HQOA 2TS1A 2QV7A 2ZBGA 5ECYA 3VPCA 4IUYA 5AVJA 1K5DA 2WQ7A 3KYBA 3BK1A 1P91A 2Y92A 3SHWA 1Y82A 4WBSA 3DYBA 3Q87B 5ECGC 3ROMA 1QSGA 2EW8A 5B3KA 1R3UA 3RTEA 3SVTA 5L6MB 2R6GA 2V6MA 3EAGA 3E3LA 2JCXA 3HVUA 1MCZA 1X87A 2O1SA 3MINB 5IZ4A 3CVJA 2JJMA 3ABSB 1XZKA 2NACA 1MJGM 3M4YA 1U2ZA 3JAWA 4B5KA 1IK4A 2I67A 2RGUA 3T9FA 3EE6A 3OFNA 4L8LA 3LH5A 4CQMB 4U63A 1KMQA 4ENPA 2ZYSA 3NHWA 3LZ6A 5E6SA 3ZGYA 1FMJA 2J5KA 1RXIA 3GA5A 1G59A 4Y2QA 1EE2A 2V3VA 3RRBA 3HFJA 5F21A 3BTUA 3W7BA 1F7UA 3QQPA 3TZKA 4PBRA 3VAZA 2O54A 4RHXA 1WUTA 1TQ6A 3GJ4A 1P4RA 2VDOB 3D6MA 4RCVA 3F1LA 4URYR 3D3QA 4QO7A 4B82A 2VTBA 3EBLA 3GLRA 3RIEA 4BLPA 1LRJA 2IEGA 3PXXA 2J3EA 4KWCA 4LSZA 4W9NC 2EL7A 2Z3VA 5IK2D 2IPMA 2PXXA 2GO1A 3TO5A 3IDQA 3N05A 2FSVC 1M0WA 2Z9BA 3KG2A 3LBAA 4N49A 3ZXIA 3E22B 1JKFA 3OICA 2KHZA 4P32A 1PW5A 2EYUA 3A06A 1PL7A 2YCLA 4I4TA 3H9CA 4MP3A 4QPPA 3ZIAA 5LP6B 3FRIA 4AZ0A 1GPAA 2C7GA 2X77A 3F46A 5JG7A 3WBBA 1LW7A 1D6MA 1N6RA 4RIEA 1ODCA 2EHDA 1ETUA 1P7YA 3KUUA 4JYZA 3DAYA 4RL6A 1EG2A 3P9PA 2WAXA 1IG3A 3GXBA 3VX4A 2CY0A 2IYRA 3WIUA 3PUJA 4ER0A 1P44A 3AYXB 4J43A 4NCKA 2HL6A 5L3RA 3RR2A 1PYGA 2HMUA 1X2EA 3SF8A 1S7CA 3OQHA 1QP0A 2EIXA 4PG5A 2IWHA 3FDZA 4DLZA 1U8XX 3L8EA 4ND5A 2QSZA 4J16C 3QXGA 2FN4A 1KZHA 4WHMA 4TKVA 2D1QA 2CLIB 1XVTA 4PM4A 5LBIA 5CCEA 2UXBB 1GCOA 3AR4A 4QJIA 4DDHA 1TM5E 2BHLA 4KP7A 2XB9A 3QEMA 1OLXB 1MTOA 1R64A 4FK8A 1WU8A 4W5JA 1GEEA 1U0JA 2M6LA 5B7NA 3GF4A 1H2RS 4RJJA 3UXMA 1K3TA 1N6KA 1CZUA 3BGWA 2AXPA 5AVZA 1Q7TA 4S05A 1BX1A 4FEEA 4GNKA 5KDDA 1VMAA 1D1PA 1L7NA 2BI8A 4RKRA 1L5KA 3QUQA 3I73A 2NPFA 3BSFA 4PV7A 3WLMA 2AOTA 5I7VA 1USUA 2C88A 1SUFA 5K6AA 3IXLA 2MINB 1MVNA 3WLKX 3GHYA 3IEVA 2BY4A 5H4GA 4LIPD 3M5WA 3NLLA 3ZY6A 4F3NA 3SZLA 3KUXA 5DOZA 4EENA 3DZDA 4LG1A 4OG2A 1RBMA 3OTQA 3QYJA 4ZA2A 4RE6A 3AP2A 3K0KA 1J7JA 3I23A 4YRIA 2P9FA 5CA0F 5AWFC 4XCQA 1KVTA 2ZRHA 2MR6A 3ZWMA 4UCXA 5KKCA 1DEKA 3I52A 1P3DA 3O4IA 4JP3A 4X6XA 4PRKA 1NVGA 1NURA 4YHHB 1QQTA 3K15A 1M7GA 3WLSA 4MB6A 4P53A 4D9EA 4DV4B 1RYYA 1PYDA 3DLPX 2C83A 1JJ7A 1FUYB 2HTFA 1BSVA 4LJ7A 4V2UA 1DFIA 1SOMA 3V4VB 2BKVA 1E1RD 2XWJI 4PZAA 5HKAA 5DYIA 2YNMA 1EVQA 1ND5A 1Y8QA 3MWEB 3OBIA 1IE3A 4P34A 2RARA 4PSKA 3RJZA 2GNPA 4JZKA 4CG0A 3IE1A 1WXEA 4XVUA 4MKFA 2FQYA 6CHYA 1RRCA 1KI9A 4O4LF 3WWZA 3NGXA 2IH5A 1NI5A 1CY7A 1A5AB 3G79A 2CDRA 3NBZC 4GKBA 2PNFA 4DQUA 1EUDB 4O4IA 3GOQA 5BXQC 5JWOA 4S04A 4BQOA 4ZIRB 1WZCA 3NYQA 3VYTB 3IAFA 4RO0A 1J0BA 2GHIA 3VZQA 5IH7A 3HKCA 5KYWB 2DWUA 3ZWVA 2H1WA 5L7WA 4BVBA 4BNFA 1P39A 1SC4A 4F2WA 1OFUX 4E07A 3WKBA 5AKZA 4C6HA 5H9WA 1G3RA 4D6YA 5CA1A 3DXXA 1J2EA 3DWGA 1NUTA 3EWIA 3PXUA 4CGYA 4YFYA 5JWRA 1KQOA 1WMEA 1YR1A 1MAWA 2GGSA 1E2QA 3H7IA 1T9BA 4UM9D 2AFHA 4IIEA 3QIVA 1ISSA 1AUXA 1FFCA 4N8DA 4CEIA 1YH3A 1BCRA 4XQEA 3T0FA 2DPGA 2UZ0A 1OCEA 1THMA 1IN4A 3HUEA 1EG7A 2VYNA 4FGLA 5FUXA 2XNCA 1N32B 2JAUA 3CUEF 3DDNA 4P92A 3PNKA 4ZHQF 3LLMA 1E60A 4BMYA 1QG2A 2FJUA 2FPIA 3DFUA 1YBMA 2IHYA 4IXNA 4UKDA 2MMGA 2AJ8A 3SEAA 4U5XA 5JXIA 1E7SA 1ADCA 4RJ2A 4Z4QA 4JEUA 1Z73A 1Y6FA 4TLDA 2XNJA 4BBZA 3N8GA 4D7AA 2H2AA 2JJ1A 4UOZA 4OF4A 5JZVA 2Q3BA 3B85A 1XPJA 4L73A 1F12A 1NWHA 4DBZA 2PS9A 4J49A 1JKJB 4YJKA 3ZLJA 4L07A 1LTHR 2DFDA 4A26A 3EWAA 4MAFA 2HHHB 1AZSC 3MPUA 1OYWA 1PJSA 3TSCA 4X8MA 2Q28A 1PZFA 4EQZA 4XVHA 1EFKA 1WA5A 2Y0PA 1CULC 1MEEA 4XDZA 3TRFA 2YY7A 2PXCA 3DQQA 3JSAA 4ZZ3A 5KJCA 2SECE 3L7NA 4RNCA 1QGED 3KO8A 3A0UA 1ULZA 2AOUA 2R9VA 3W2FA 3CZRA 3R5JA 4UBIA 5GM2A 1Q0PA 1KOLA 4AO8A 3KSMA 5B30A 5BWCA 2FA9A 1PWYE 2YHIA 4IGAA 4PGFA 1GR1A 1P9RA 1ZVQA 2D1RA 3FX2A 1T15A 3R1IA 2DX7A 4G0WA 3VHXA 2BEVB 2YZKA 3DOCA 2H1VA 3FCAA 2ZRAA 2NYAA 5K03A 3DHYA 3P9NA 3LCUA 1CVRA 4MUGA 1RRFA 1DPFA 2QAIA 3HKEB 4AI6A 2YKGA 4DUGA 2FZEA 3M6MD 1EXNA 1KIFA 4O4HF 4UPEA 2W2MA 3NQ41 3F6PA 2O3SA 1V9LA 1Z4JA 4IX9A 4ZZ0A 5FH9A 2WZDA 1GNRA 1YZUA 4YGYA 4LXTA 2YRFA 1DAIA 2C8LA 2ZJ2A 3KOWA 4WLVA 3DXYA 1A72A 1L4MA 2RHLA 2PSSA 4EFDA 2HREA 4Q47A 4MMXB 1DTSA 2CCKA 1GQ2A 3VDNB 5DNVA 3ZE6A 1AH2A 4JC0A 2GKOA 2ZE5A 1Y6JA 5IXSA 4Q9JA 4WWHA 2G5GX 2WHXA 5EZYB 3QXXA 4N9QA 2FGKA 1R4NB 2EJUA 3DWFA 1R1DA 4FDUA 3A3KA 3B1KA 4FCCA 3PIRA 1YQWA 4N39A 5BPFA 4KVAA 3PNSA 1GT6A 3V8BA 4D96A 4FGSA 1XNRB 5DX1A 3CB2A 3ED1A 3GNLA 4Q24A 3ZWKA 3FMPB 4Z9BA 1NWCA 4ZO7A 1TFRA 2R8RA 4LJSA 1T43A 3OZAA 1V2HE 1NYTA 2WF6A 4ZODA 4NYJQ 2GF9A 3DZKA 2ZREA 3NHRA 1F2VA 3K30A 1KI2A 3IQZA 4RK4A 2QD5A 3QBDA 2EKLA 1IM5A 5JFGA 1DBVO 2Q21A 3KYCB 4PHHA 1VPDA 2XA2A 1PJ8A 1VJCA 2DWQA 3L7IA 5AW3A 3MYRA 2HRZA 3OQIB 3NIFB 3V1MA 4RLHA 3SX2A 5CFQA 1W25A 1MG5A 2X76A 3NT5A 4FW9A 3GLFE 2HDWA 3S2GA 4Q3CA 5IVIA 3LUKA 1QTQA 2D7JA 5EIHA 4BLWA 1T1GA 1GL7A 4ZAFA 3NVDA 1SXJC 2HQBA 2CFRA 4YRLA 4URZR 3FKJA 2ODAA 3DSRA 3INRA 3HXQA 2REQA 5AOVA 3TNJA 2W22A 3CLVA 4HN4B 3SSMA 3GVPA 5LKAA 1AM4D 3AOGA 2XVXA 4H7KA 4ZCIA 5D6OA 3OURA 3H2IA 3QJ5A 5CNMA 1HWYA 1QIGA 3BGOS 4RJTA 5ALWA 3WYBA 2CXTA 2RHOA 3RS3A 4WD3A 2CUZA 4FEGA 5JD3A 5C4GB 4YDHB 1ECJA 4GPTA 1RRPA 1PNOA 2HK9A 3A9TA 3E3MA 4UNIA 4BEJA 3B3FA 1BN6A 1DAPA 1JLLB 2BN4A 3LVRE 5CLHA 3UKJA 2QUZA 1EEXB 1DOHA 2CFSA 1J21A 3TLYA 3PTAA 2UYCA 2GXUA 2HRDA 5LZ4A 4CF3A 1ZUD1 1I5RA 2YWBA 4JLKA 3PQEA 2HJ9A 4ESOA 2Q6KA 1K6XA 2QNIA 4OYHA 2GJ9A 2ZYHA 1EMDA 1XU9A 1G8JA 1OHHD 1ZCAA 4LJ6A 3IH5A 1UEJA 4Z3DA 3CVWA 1G7RA 3OIDA 2J08A 2BMWA 1VZ2A 2MOKA 4FSDA 5F5NA 1B73A 4WX2B 2GZDA 1QE5A 4WUTA 2Q8QA 3IJRA 5CURA 5G40A 2YMLA 3WMRA 3EVNA 1KAMA 1UODA 1USGA 4C08A 1U7TA 1KJQA 5EIFA 1H1LB 4G9BA 4ZHQB 2ZEJA 4J2OA 3JARA 2WD8A 1ARZA 1FLDA 3L6DA 1QZTA 3P2EA 4YCBA 4F04A 5FEUA 2F8LA 2QUBA 4DLNA 4B3IA 2BPOA 2KI5A 1K7SN 4QQFA 3KFVA 3WIDA 4HAZA 3T0GA 1WY5A 3EB9A 3GMSA 4LJYA 4PYQA 3IVAA 4RK5A 3OQBA 3ZWYA 4PN3A 1JIQA 2RBKA 4WXRA 5FLKA 1YE5A 3F96A 3WMFA 3R5FA 1UXOA 4O2BB 2FPGB 1YFLA 2ZAMA 4BLQA 4LZLA 4BE9A 3AF5A 3EJWA 1BHO1 3ZD9A 5KNCA 1QGOA 3GWGA 2YINC 1BXZA 1N2CE 1T1IA 2D1TA 3C1TA 3DQPA 4K6MA 2Q6OA 4RHFA 5FOSA 3UXEA 4DMGA 2Q5JA 2ECQA 1I0ZA 5JANA 4K8RB 1M3SA 4L0DA 1KU6A 1PT7A 3FPKA 1RI1A 3BX1A 1XNHA 2EX4A 3DE4X 4M49A 1XP8A 2HO4A 1P81A 3MWYW 4ZMBA 3C7TA 1E1NA 3OE7A 3SNKA 1EDBA 1YTUA 3FHOA 4ID9A 5JCZA 2N1MA 3RJ5A 5M5BA 5K6TA 4ERXA 1P2UA 1UK6A 3BF7A 1U3TA 3ZVLA 1ECGA 2RKBA 2QLJA 4O4HB 1Y81A 3ETNA 3WP1B 1EESA 1B1AA 4JSYA 4CM9D 3LVBA 1UMCA 3DAHA 5CJJA 3KR1A 4ZTZB 4YI5A 1Z38A 4X3CA 1KDPA 3WXMA 1FOEB 4BP8A 2HMSA 4TXHA 2VJBA 3D7KA 2HMVA 3ZYCA 1SQGA 5KQRA 3KSRA 4NBLA 4TMXA 2QJTA 2PZ8A 4RBNA 3IKJA 1VBNA 4MWEA 4UUBA 1RWNA 2J9YB 4HLNA 2IEAA 3ORYA 4TSKA 4XSHA 2D2XA 4Q03A 2XRFA 3SIRA 4R41A 3WQHA 3PX7A 2GMWA 2L2QA 2R00C 1LBHA 2OHOA 4HSGA 4EW6A 1CUXA 1TDJA 2PANA 1X1EA 4K40A 1V7ZA 1I9GA 4MLCA 2PX4A 3FVWA 1SC1A 4R83A 2GJSA 4P36A 4AJKA 1BHQ1 3WFJA 4CKCA 1AURA 2XE6A 5JSYA 2R6DA 2UYYA 2O8DA 2ENWA 3L6BA 1FLNA 3PGLA 4JJZA 2A9QA 1YGYA 4DCJA 1VECA 4FC6A 2IYTA 1JG6A 1MO3A 1Y4UA 1WCXA 2B0JA 1JEOA 4IMPA 2AIRA 4R1TA 4F4DA 3ZD7A 1YZYA 2QS9A 4PCUA 5G1OA 3P0FA 2B1IA 5L51A 2PK3A 4UTVA 3QWBA 2BTEA 3H2KA 3KZMA 5CCBA 1B00A 1LDMA 2WVAA 4EB3A 5DK6A 4FNAA 3VO2A 2IEYA 2VDQB 1C8BA 4HWKA 4DLBA 2JG3A 1JLRA 1K2VN 4G67A 2J6CA 4K8OA 5TVKA 1MO5A 1SZPA 1KSGA 4GQIA 1CUWA 4S1VA 3PICA 4HFRA 4LI0A 5DH9A 4KEAA 4ND1A 3V1LA 1ZXLA 4BEVA 1KTIA 3JXEA 1J8YF 3U44A 1M8KA 4U7HA 3V42A 1GNTA 2C1EA 3WNBA 4BFTA 3IESA 1C41A 3AHEA 4JVNA 3E5MA 2ZBFA 3L6EA 2DF8A 1B8NA 3AERA 2KSQA 2CNWD <