4LECA

Human methyltransferase-like protein 21a
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
202
structure length
202
Chain Sequence
b'QKFHKPLATFSFANHTIQIRQDWRHLGVAAVVWDAAIVLSTYLEMGAVELRGRSAVELGAGTGLVGIVAALLGAHVTITDRKVALEFLKSNVQANLPPHIQTKTVVKELTWGQNLGSFSPGEFDLILGADIIYLEETFTDLLQTLEHLCSNHSVILLACRIRYERDNNFLAMLERQFTVRKVHYDPEKDVHIYEAQKRNQKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein-lysine methyltransferase METTL21A
molecule tags Transferase
source organism Homo sapiens
publication title The Crystal Structure of Human Methyltransferase-Like Protein 21A in Complex with SAH
rcsb
total genus 55
structure length 202
sequence length 202
chains with identical sequence B
ec nomenclature ec 2.1.1.-:
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10294 Methyltransf_16 Lysine methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4lecA00
3LECA 5CCBA 3KQVA 3LDGA 2NXJA 5FCDA 3OE4A 3KQOA 3FUWA 2AOTA 1JQEA 3KPVA 2AN4A 2EFJA 2H00A 3EVGA 1TW2A 5E9WA 3UFBA 10MHA 4E2YA 2PX5A 4IV8A 5DM2A 4ER3A 3I53A 2PWPA 1AF7A 3CJQA 4Y2HA 3THRA 3LPMA 3GGDA 5ICFA 3DTNA 1U2ZA 3GRZA 5CVUA 3B5IA 3G2PA 3BWBA 5E9JA 5GWXA 4CKCA 2N47A 5T6BA 2ZBPA 2OXTA 5K8VA 2WK1A 4GC9A 2HNKA 3FYCA 4YUXA 1NW7A 5HZMA 3EVDA 1ZGAA 2OBFA 3CC8A 1P1CA 3EMDA 3C3PA 3LBYA 3P2KA 5DM1A 1EJ6A 9MHTA 1P1BA 4WXHA 3PTAA 4AX8A 4C07A 5BP7A 3R24A 3KPJA 5KVAA 3DP7A 5IH3A 1L9KA 4FT4A 4FS8A 3M70A 3O4FA 5EQJB 4RTPA 1X1AA 2PT9A 3DMHA 3IV6A 3ORHA 4PYOA 1JG1A 1WG8A 3A27A 1IY9A 4HGZA 4AZWA 4YUWA 3DUWA 3DULA 5GINE 3O31A 5E8RA 1KIAA 3DXZA 3LKDA 3DXYA 3GRRA 4L7VA 3UJCA 3NJRA 1JG2A 4FZVA 2UZ4A 2KW5A 5EC8A 3SSMA 1L1EA 2EJTA 2FCAA 3M4XA 5DRTA 2YX1A 3DH0A 5DTQA 1XCJA 2WA1A 3E23A 2I6GA 2B25A 1UFKA 3I64A 4P7JA 5HOQA 3GCZA 4RX1A 4A6EA 5LSAA 3KR2A 1N7IA 3FPGA 4O29A 3UWPA 1I4WA 2AOTB 1VL5A 3E05A 3BGIA 1VPTA 3MHTA 2XYVA 3HVHA 3TPZA 4X61A 2PWYA 2A14A 5LQAA 3LKZA 3A7DA 2ZIFA 4E2XA 5CVJA 1YFJA 2IGTA 4PYLA 3NMUF 4DCGA 2G72A 5ICGA 2VDVE 2BM8A 4OA8A 3GXOA 4QPPA 4M7RA 1TW3A 5K0BA 3RIEA 1SVUA 3M6XA 1I9GA 4CTJA 3CGGA 2YVLA 3MCTA 1O9GA 4K6MA 2G70A 4LWOA 1XCLA 4PNEA 5EG5A 4OX9Y 2WA2A 5GM2A 2EX4A 2IIPA 3PX3A 4HTFA 3KR9A 1FPQA 1RJFA 4KVZA 3FUTA 3G88A 2QE6A 3IHTA 5DSTA 5FQNA 1G8AA 1X1BA 4X60A 4G56A 1VP9A 4F84A 5DXJA 3QOXA 5FWAA 1M6EX 3D2LA 3GRVA 2YR0A 1Q0SA 1RI4A 2E5WA 3AXSA 3HCAA 2ZBQA 3BUSA 3EGVA 1ZHFA 1KP9A 4BP1A 2YXDA 4RTRA 4E30A 1F3LA 3M33A 2DPMA 2ZBRA 4FSDA 4KDCA 3ER8A 4PIMA 1QZZA 2CWWA 3K6RA 1EJ0A 3MGGA 1WY7A 1YZ3A 2FK7A 3NWBA 4GC5A 4PIPA 2JHAA 2PJDA 3I58A 3M6WA 4XUDA 4QPNA 4HTFB 1XXLA 3TKYA 5GIOE 5C1IA 3LCVB 3V8VA 1VE3A 4ISCA 5GOZA 3HA7A 3B3FA 1Z3CA 2NYUA 4FSXA 3TMAA 1NBIA 4GOND 3B89A 4IWNA 4RTSA 3KQTA 2OPBA 4LWPA 2AVNA 3GU3A 1QAMA 3EPPA 1V39A 2AR0A 3GNLA 3MCZA 2P40A 4OBXA 3UA3A 5M5BA 2F8LA 2VS1A 3FPEA 3LDFA 1HMYA 2AVDA 3GWZA 4QTTB 4DQ0A 3EVAA 3OU2A 5EZQA 4QTUB 3PB3A 2ZWAA 4X41A 4Y30A 3UJBA 2OB2A 3GO4A 5C9ZA 1JQ3A 4KW7A 3KR1A 2VP3A 2VZ9A 4IV0A 5DX1A 5FQOA 1XTPA 1FP1D 1G38A 2IP2A 3VYWA 4NECA 3R3HA 5E1BA 4AZVA 3SSOA 3FTCA 5JR3A 3NDJA 4P7KA 3TRKA 4GUAA 4RTNA 1BHJA 2FPOA 5EMKA 1HNNA 2H11A 3VC1A 3LGAA 2ONYA 3G5LA 4C08A 5K0EA 3KPUA 4ATNA 3DMGA 3DOUA 3KKZA 4P58A 4PYNA 3LSTA 3G89A 5ERGB 2IH4A 3R9XB 2IBTA 1FP2A 3SX0A 1KYWA 2OO3A 1T43A 3P97A 3HP7A 3FTFA 1VBFA 3C6KA 3RW9A 3UJDA 2QYOA 4IKPA 3LDUA 3CJTA 2R6ZA 5E2AA 2GH1A 4PGHA 4R05A 5F2NA 4C04A 3MTEA 4V0RA 3SSNA 4MQ4A 3TOSA 2PXAA 3UJAA 2GA9A 2P3LA 3VC2A 4YV0A 3OCJA 4GEKA 5LQCA 3EGIA 1QANA 5E1MA 3AJDA 3KQPA 3OZSA 2IFTA 2EJUA 5ICEA 3FUVA 2YTZA 3KR0A 3TM5A 3OPNA 5KS2A 3QOWA 2AOUA 1R8YA 3G5TA 5BXYA 2NP7A 4GF5A 2OYRA 2C7QA 3C6MA 3Q87B 3GRYA 5KYGA 3P9IA 5U4XA 2ZWVA 2P1DA 5P8WA 2BH2A 1DL5A 4PYJA 5FUBA 2XBMA 3ERCA 1ZKDA 5EMMA 4E2ZA 1P39A 2DULA 2P35A 4EMSA 1G55A 5JUWA 1JSXA 4KIGA 3V97A 3ANXA 3DXXA 5K0LA 8MHTA 4P7FA 1SUIA 1JR4A 3FYDA 4QDJA 3TM4A 1G6Q1 1OR8A 5GIPE 4PCAA 5B1SA 2GS9A 2ZIGA 3OFKA 1XDZA 2QY6A 3FPJA 4OA5A 5LQRA 3PS9A 5G02A 4BP3A 5LQNA 3OE5A 2NXEA 4V0QA 5KQRA 4GBED 1RI2A 2BR3A 5DX0A 5FA8A 4PGGA 1KXZA 5EPEA 4JXJA 3BWMA 3FRIA 1BOOA 5EIFA 4RTOA 5EEHA 3NVMB 1ORIA 3PLAE 1XDSA 4HC4A 1KHHA 3I5UA 5D1NA 4M37A 5EKXA 5DM4A 1EIZA 4R8SA 5HILA 3PFHA 1RI3A 4KIFA 2PX2A 3KPWA 2PXCA 4AZSA 2PX4A 2NXCA 5F2OA 3HM2A 3LCUA 5EKUA 3NDIA 2B3TA 2OKCA 3ELUA 3GJYA 2OY0A 3KQQA 3R6TA 4EKIA 2P7HA 3FRHA 5BW5A 2FYTA 3PFGA 4DF3A 2ZW9A 3FZGA 4YMGA 4OQDA 5K09A 5CCXA 4MTLA 2FK8A 2FRXA 4LECA 4E33A 4ER7A 5EGSA 3HCCA 4RVGA 3UJ9A 4EK9A 4Z2YA 3NTVA 2YXEA 1WS6A 5K0CA 3FTEA 5E1OA 5MHTA 4BY9E 2AOUB 4PYIA 1IM8A 2ZULA 5LR6A 5E9QA 1YF3A 2ZIEA 3EMBA 2IDJA 3UA4A 3SM3A 3FTDA 4AUKA 4C06A 5EOVA 4U7PB 5K05A 3LBFA 3EVEA 4XUEA 3P9CA 3AY0A 1X19A 1IXKA 2BM9A 2P8JA 1G60A 2O06A 2XVMA 3UJ6A 3UJ8A 4QDKA 4B17A 5T67A 4C05A 4WVLA 1NV9A 2NNWB 4E70A 2I7CA 1I1NA 5EVJA 4F85A 3G8AA 3C3YA 5CVEA 2ZZMA 2V74B 1M6YA 3KHKA 2YXLA 3UZUA 3LCCA 1EG2A 1KPHA 2P41A 2O07A 3P9NA 1D2CA 2AN3A 3JWHA 1MJFA 4QQNA 3SR4A 1NV8A 4RTLA 1L3CA 1AV6A 4R6XA 3F4KA 3G8BA 1D2GA 4DCMA 3BWCA 2FHPA 3HVIA 1O9HA 2IH2A 4QQKA 5E2BA 2JHPA 2P3OA 3HEMA 5CUQA 5FTWA 2G8NA 4CXMA 5E1DA 1YUBA 4PINA 3HA3A 4EQZA 4FR0A 2IH5A 3EVBA 4PYMA 1P91A 3HCFA 1NW5A 3CKKA 2V7EA 1JTFA 4E2WA 1L3BA 4OQEA 5CVDA 4PCLA 2O0LA 2HV9A 2IDKA 2Y1XA 3ELWA 3SMQA 4HH4A 2C7RA 4ER6A 2UYHA 1Q0TA 2YQZA 3AXTA 1SQGA 2PXXA 1RI5A 5T64A 3PT9A 2QRVB 1EQAA 1NW8A 4QVGA 4FT2A 4X1OA 2ORED 3C0KA 5DSXA 1AQIA 1VQ1A 5KQSA 2O57A 4PONA 1UWVA 5HIIA 5K0FA 4RTJA 4KWCA 3BGDA 3HCBA 4DMGA 5K0NA 3FPFA 3BXOA 5EMJA 2IPXA 3H2BA 5F2KA 3VSEA 3OFJA 2ZCJA 3B3JA 5GP1A 2OZVA 1VP3A 2YUIA 3A7EA 3Q7EA 1ORHA 2HWKA 4FGZA 5K01A 5HEKA 4MHTA 2B9EA 5EHGA 1JTEA 1WXXA 4R6WA 1SQFA 4RTQA 4C4AA 3BT7A 4HSGA 3E8SA 3KQWA 4GOLD 2ZTHA 3TKAA 2ESRA 2I62A 3G2QA 2ZSUA 2PKWA 3EVZA 3G7UA 3A4TA 2HMYB 3NW9A 5HFJA 5H02A 3ID6C 2CMGA 1R74A 4ER5A 4MWZA 4M36A 4RWZA 5DTRA 2BR5A 2PX8A 5DXAA 3MQ2A 1AQJA 2PV0A 2JJQA 3SGLA 2K4MA 5DPMA 5EHIA 3IYLW 2VDWA 3GRUA 3NWEA 4YV2A 5ICCA 4YMHA 2CKDA 1X1DA 3KU1A 3EVFA 3L8DA 5CVVA 3KPYA 5HIKA 2OB1A 1JG4A 1TPYA 3E7PA 2JHCA 3ME5A 4KDRA 4HRAA 5K0JA 4YUVA 3G2MA 3REOA 3BKXA 3A25A 5DT2A 4U7TB 5C0OE 1N2XA 1NBHA 3HTXA 3T7TA 2BZGA 1RJEA 2GB4A 3TFWA 1YFLA 2ZZNA 3MTIA 3OZRA 2G71A 1D2HA 1JSZA 2PT6A 3TQSA 3OU7A 1KPIA 3HNRA 1NKVA 4R8RA 2P7IA 3MERA 3CCFA 1QAQA 3TR6A 2R3SA 4A6DA 3A26A 2EG5A 3BWYA 3CBGA 3PX2A 4PWYA 2UYQA 1R8XA 1JG3A 5HIMA 1JQDA 4YV1A 3MB5A 3FUUA 1SUSA 1VIDA 3P2IA 1KR5A 4C03A 4RVHA 2AOVA 3P8ZA 3BZBA 3LHDA 2CMHA 3R0QA 3PVCA 3T7SA 4AZTA 3T0IA 1BKYA 2JH9A 5EZSA 2GPYA 5IKMA 3KQSA 1RI1A 3DLCA 4H0NA 1F38A 2ZLBA 4MIKA 4FP9A 5FULA 3BGVA 3HCEA 3AWIA 1NE2A 5GM1A 1XJ5A 2P3QA 3OZTA 5E8JA 4CTKA 4E32A 4F86A 1QAOA 4LG1A 2ZVJA 4CKBA 3SVZA 3HA5A 1O54A 3DR5A 3THSA 2PBFA 4RV9A 3LX6A 3B7PA 1ZG3A 5EMLA 4EKGA 2XVAA 3S68A 2ERCA 4XUCA 1QYRA 3FPHA 1Y8CA 3CJRA 3JWGA 2ZZKA 4RVFA 3ELYA 4DZRA 1XVAA 3T7RA 3M6UA 2LD4A 2PY6A 3P2EA 4EVIA 5LQUA 2I9KA 2ZFUA 1R18A 3LL7A 2NP6A 4GOOD 2BR4A 4RTMA 4POOA 2Z6UA 3I9FA 4PYKA 1DCTA 5CM2Z 4KRGA 2GLUA 2NXNA 3EVCA 3HVJA 1ZGJA 2UYOA 3FUXA 4GOMD 1FJXA 3RODA 3KQYA 3UBTA 1M0EA 4UOEA 1WXWA 4GQBA 4OBWA 5HIJA 5EIWA 1R6AA 1RJDA 4BLUA 5DLYA 5DTMA 2G1PA 3B3GA 3DLIA 3MAGA 5FHQA 5D1HA 2C7OA 1SG9A 1INLA 3GIWA 4HG2A 1RJGA 1EAMA 1DUSA 3JWJA 1NT2A 3WSTA 4CWAA 4HGYA 4M38A 3OU6A 1B42A 2AN5A 3QV2A 2CL5A 3IEIA 1PJZA 2QM3A 1PRYA 4RVDA 4RYLA 4YUYA 2AOWA 4DM3A 5BW4A 4ZTBA 2HR1A 5K0GA 2IBSA 1ZQ9A 3K0BA 5DRYA 3DMFA 3ELDA 2H1RA 3EEOA 4E31A 1H1DA 3O7WA 4YUZA 1VLMA 1XDUA 4BLWA 1BC5A 1SKMA 4X63A 2AZTA 2AS0A 3G2OA 3U81A 5LQKA 1N7JA 2ADMA 3P71T 1UIRA 1L3IA 2O05A 3SXJA 3KQMA 5DM0A 4DA4A 1NW3A 4ER0A 1WZNA 2JH8A 3EGEA 3ER9A 2QRVA 1R00A 3EEYA 5K03A 1NW6A 2B2CA 5CD1A 5FWDA 3TLJA 2ONZA 1KYZA 2PLWA 2Q41A 2PSSA 2PGXA 4CKEA 3NVKI 1YB2A 5FHRA 1YZHA 2HTEA 3GDHA 3HVKA 5CIYA 3JWIA 2B78A 2AOXA 4RTKA 2Z6QA 1FBNA 1KPGA 4BLVA 7MHTA 2VDUE 3UJ7A 3BKWA 4DKJA 3X0DA 1MHTA 2Z6AA 4QVKA 5DX8A 5LQJA 5EEGA 2GAFA 3P9KA 4P7GA 4XCXA 5FADA 1G8SA 1X1CA 3CVOA 3HCDA 4RSRA 5FA5A 4PYQA 2JG3A 2UYCA 3M6VA 2C7PA 2PVCA 5DWQA 2XYQA 2Y1WA 2XYRA
chains in the Genus database with same CATH superfamily
4QXAA 3U44A 2V59A 2YQ4A 3MZ0A 4DIBA 5LOVB 4V2IA 3U3OA 4FE7A 4TYWA 2JA2A 1II8B 1ISPA 3LLMA 3UFBA 1EMDA 3ONWA 2V6FA 3AUSA 4E2YA 4MVYA 3KEGA 3IRUA 1LJLA 3O92A 3VTKA 4C7OA 3CJQA 1I4LD 1TLLA 1X9HA 4RJIA 5EYPA 3WWYA 4GOKA 5IMSA 5JY1A 3JQFA 5LVAA 3TSZA 1TT5B 4MQ6A 3GD5A 4J2OA 4Q3EA 4AULA 4BUCA 5M3BA 2IGBA 4H0CA 4IHJF 4DJEC 5I7WA 2OFWA 1LDMA 4LSWA 4IEFB 2IXEA 2PH1A 3VDQA 5EHQA 2BIFA 3E1KA 4PPGA 2J46A 1SPXA 5KTSA 1M8FA 1HDCA 1L9KA 4KPUA 3LYLA 3COSA 4DLYA 1QQ5A 1J2EA 5DN9A 4F38A 5DN6D 2CE7A 2MSEB 4D4LA 1E99A 1KK3A 1KOJA 2ZRDA 1H8HA 3ZWDA 4CDMA 4OJYA 2I4NA 4FFVA 4FZJA 1YQUA 4IM7A 4MEJA 4D43A 1DT5A 3SYLA 3ZW9A 1U9ZA 1KHTA 1Z4MA 1E4YA 4X45A 1ZISA 4MJXA 3BD6A 3E9CA 3I6IA 2Z4RA 3DVLA 3DKIA 3A4VA 1M6WA 1X8LA 4NDNE 4XE5A 3SSMA 4R84A 3ECAA 1ZDMA 3S2GA 2WA1A 2ORYA 3VO8A 1XD2A 2ZS9A 4X7MA 3WLEA 5CNMA 1PFKA 4LJRA 3VVMA 4DFDA 4DJTA 1XBTA 4BV9A 2UZAA 3B38A 2YOFA 4W8GA 1NDUA 3ZBQA 4PNPA 4M9CA 2ZJ3A 4A2PA 3T3NA 2Z30A 2AOTB 1XQ6A 2O5RA 3DMDA 4BAUA 4MKGA 5JZVA 1N5IA 1TUBA 2F4VB 4R54A 3N2GB 1S2MA 1A5ZA 1NTRA 1KI2A 4YFVA 5ECGC 3ZOZA 4KPGA 2H4JA 4G0NA 4WL0A 4KREA 4NE9A 4G5SA 3FCEA 4CEHA 2QNIA 5IANA 5AVKA 2W58A 3HS3A 1G2QA 3P1JA 4XJSA 2ZM6B 5FOTA 3VBEA 5KYXB 3E3NA 4QPPA 2OAP1 1TW3A 3QKSB 3OIUA 3BDAA 2AJ8A 3T3IA 3PKIA 3U3JA 2QPTA 3UT5B 4MQBA 2C4MA 3PEEA 5FOUA 1ONOA 1B7GO 4L6CA 4UBMA 3UK2A 3NOVA 4JR1A 4B7XA 1SQ0A 3HBNA 4Q7MB 1X0VA 2CJWB 1IMOA 1N8KA 2EX4A 3SR3A 4TTJA 1FRNA 3FCXA 5EAIA 1XQ9A 2WHYA 5TF4A 1KY2A 2WV9A 5KNBH 3FGZA 3THYA 1U5AA 4UNIA 4F56A 5E9AA 3GZNB 4KGVA 1QLHA 2EFCB 5DGTA 2AYYA 2BKEA 2BOVA 3I28A 1DAHA 4RD1A 1H5QA 1XF9A 1E6EA 2CYBA 1BS1A 1Y6RA 2OZLA 3CIOA 3IQZA 1O96B 4EGAA 5A9SB 3ADCA 4U6SA 1PN3A 1AE1A 5DI3A 2DETA 2Q0XA 4K9OA 3TKAA 5AK4A 2ZXFA 3NWBA 4R9SA 2QEQA 3F4BA 3NONA 4G01B 4M55A 2B7CA 3WWCA 4RLSA 1ND5A 2HQOA 1JAYA 3QX8A 3BORA 2GCPA 3QIAA 3SJZA 3WE7A 3IIIA 5FWNA 1IM5A 3Q9NA 5EZ5A 3Q3HA 1E2UA 2QN7A 3TMAA 4E7PA 3GROA 2D00A 3B89A 1VLQA 4IDPA 4G8BA 1TF2A 2FCRA 1N0WA 1UFQA 2QRJA 2XCQA 3GLKA 3JALA 4MV5A 2HCBA 4IX9A 5KVSA 1PL7A 1JDBC 1YRYE 2CYCA 4OHOA 4D46A 3ZI0A 1W49A 1YOBA 4JJ6A 5EIHA 4NLLA 2ZDGA 4NEGA 3VKUA 2HIMA 1PWYE 1QF7A 3HB9A 1ZNZA 1RHKA 3IQGX 1R4MA 4Z99A 3DZFA 2LTAA 5HFNA 3WV4A 1XTUA 2F2TA 3OEHD 5C4MA 2CN1A 2AG6A 4DDVA 1CQIA 4XPIA 1B00A 1TOAA 5EWJB 4RNCA 1KK2A 2XHZA 4IJUA 2NTNA 4RDCA 2HCTA 4I8DA 5AI6A 5G0VA 4FHFA 4GQAA 4MIEA 1E9AA 3TRKA 2C3PA 4DLAA 3CNQS 1N9ZA 1CTQA 2MINA 1NX9A 3A06A 2HHHB 2ZJ8A 3ENVA 4NOKA 2EKDA 3VX4A 4TMXA 4H3HB 5HWSA 1VL0A 3KKZA 4D25A 3ILVA 4RHTA 3P97A 1ZD5A 2A58A 1EK5A 5HUQA 1UK7A 2A7XA 4L85A 4FXOA 4LK3A 3JD0A 1GPYA 1VBFA 2QHXA 2AEJA 4M22A 3UJDA 4IHJB 3ZYZA 5I9MA 4UAJA 3AGQA 3QY0A 5MGNA 3IUBA 3UH1A 1CNMA 1CIPA 4EUSA 2CLIB 1TAHA 2TMYA 3G5AA 1IPFA 4J0QA 3TFQA 4ZKDA 3T5GA 3EGIA 4UEJA 2OV3A 1X9IA 4PHFA 2KHZA 5FKJA 5IARA 1DEOA 1FRVA 3EWSA 4U6QA 1E0JA 3NATA 3HGQA 4FNGA 4GZLA 1S7CA 4RPIA 3HCOA 3BM5A 1U1IA 2YMQA 3ZQJA 1EM8A 4YCNA 2O0KA 1AZLA 1T5HX 2L18A 1P39A 4PBSA 4EMSA 5A9RA 1OWOA 3IUPA 5JZBA 4E11A 3ILXA 1HE8B 1JDPA 2ZREA 2BMWA 3L8ZA 4PCAA 5FOVA 3WDSA 3VTAA 4CI9A 4OL0A 1XDZA 3K8ZA 3SR0A 2Q6OA 2FMTA 4E94A 4RK4A 4H9GA 4CF6A 2HK8A 1R0ZA 4BO6A 1AO0A 4HDAA 2WTXA 4KE9A 2ZSBA 1COZA 2UYGA 4EW6A 2D1TA 1GL3A 3WJ2A 3KT3A 4YT8A 4LHWA 4ZGWA 4HO1X 1X70A 4AKSA 4HAZA 1NDHA 4OHFA 4B84A 2XTZA 2ZIVB 5CBPB 1QVZA 1XDSA 2QTHA 4HI0E 1F2TB 1NFFA 5TEWA 2XXBA 2X40A 1OMOA 4YP7A 5BXQC 2Q6TA 1JIKA 3BAFA 4R9UC 3UMRA 4A5OA 4LDAA 1OGYA 4ZC8A 5D3MB 1VLLA 4JLWA 1OXTA 4JVMA 4WW0A 2H1SA 1UAGA 2WIAA 2OCKA 1QBGA 2ZVPX 3G23A 2IHJA 2IYXA 4XLZA 1S89A 2CDCA 1C5KA 1HE5A 1U0OC 3ORFA 3UN1A 4DF3A 4Q39A 4ZMSA 4X1IB 2I2FA 4ZDIA 1CIJA 5TF0A 2I4LA 3QBTA 1Y1PA 4K40A 4Y2SA 5H83A 4LF4B 1W0KA 4P5EA 1GU0A 2X42A 2BTQB 3T0FA 4EHLA 4IGKA 4HT3B 4Z2YA 2HK6A 2IZOA 1WS6A 3QU4A 4B4VA 1V47A 4YV7A 4QOSA 3O8QB 5HCUA 3QEBZ 2FWBA 4Q9DA 1IM8A 5A06A 4QYIA 3JQ7A 3HA2A 4NSNA 1JJVA 2J0UA 4KBYA 4K9DA 5DLEA 4YP5A 1KRXA 2HIGA 5EJIA 1FNCA 2AE1A 5FBLB 4FUQA 4G4SO 4B5LA 4ZDJA 1EUZA 1W0JD 1YHNA 3U0BA 5CW1A 5TPZD 3ZE1B 3N7UA 4FWIB 4D0NA 1ZZEA 3HZHA 5LDGA 3WLPA 2C54A 4D99A 3BMQA 2J9ZB 1LLCA 4RY2A 2JLXA 1J0XO 4BVAA 2G0NA 3FDFA 3U62A 1UUFA 1KEWA 2IPNA 4JBWA 1SCDA 4OMFG 3LT5A 3AM3A 4R1TA 4KZKA 1LNSA 2X9LA 4W82A 5JW6A 1K8QA 5CVEA 3F9CA 1KEVA 4LXTA 1DAKA 1W85B 2VJYA 3DL0A 2WUWE 1CS4C 3NP9A 4QOFA 3ZIDA 4D80A 3QVSA 3DOIA 5F52A 1KPHA 5KPDA 2X4IA 3TUJC 5KQGA 3RJZA 3CU5A 1P0FA 1FU4A 1WDLA 1L3CA 5I45A 1OXBB 4IFIA 5LQSA 2XB4A 1RLJA 1AKQA 1NJ6A 1ATIA 2FHPA 2G17A 1E2JA 2V3WA 2Z4TA 3IB6A 3P4UA 3CZQA 3R8CA 3TO5A 3IOCA 3M1AA 4G5FA 5EJ2A 4BFUA 5FTWA 4K0RA 1BQ4A 3KOMA 2IHTA 3ZGZA 1XZEA 1YSCA 2CBGA 1K7CA 2QX6A 3OP1A 3X2EA 1KZ9A 2FZVA 3NYIA 4M9UA 4NENA 2FPUA 2XNJA 3AF2A 2G63A 3GNTA 1Y4SA 4EG3A 4TKMA 4B1FA 4F92B 3MNFA 3QELB 3WWZA 1ZPDA 4NATA 2IS2A 1JTVA 1ZH0A 3O8BA 2XUPA 1ISGA 4N47A 3DM5A 3OO0A 2G5GX 2CCGA 2QDXA 4TUYA 2IY7A 3ZDQA 1AZTA 4ID9A 4P3KA 4HB3A 3ZIAA 3K3PA 3RRXA 3X1ZA 4PANA 1QUEA 1G98A 3DYBA 4LZJA 1DG9A 5F2KA 5EQDA 2FJUA 5BYBA 1U7OA 5JECA 3PWSA 1AUQA 2ZBFA 3E27A 3N0XA 1JTEA 2ZRJA 2X2OA 1U3FA 4Z0PA 4R98A 2G25A 1T35A 3KQWA 4GOLD 3I9LA 4BDTA 4TM7A 2VT3A 3OEHA 3BRQA 3MOGA 2K7ZA 4EHHA 2D1FA 2QMZA 4IV5A 5EJ8A 2JFPA 2XOKA 4PSUA 2R87A 3VR4D 4ETMA 3QRWA 3HV2A 1BXGA 4IHAA 2JDID 3TQCA 5I7UA 2ZM5A 1YS4A 2Q7XA 2XZDA 5CH8A 5JWHA 1BAPA 1YFKA 1YKFA 3JATB 2F90A 1P7PA 3ZHSA 3G2NA 3BTOA 3D6HA 2J0SA 1XKQA 1RQLA 3DV0B 1TPYA 2JEOA 3IHLA 1M7BA 3LBNA 5F5NA 4MOWA 5H68A 2RGNA 3NOXA 4PZPA 4B7CA 4F7WA 1S8FA 2ZR7A 1EJBA 3IPXA 1C8BA 3UC5A 3U0VA 5H5JA 1U65A 1ADGA 3L18A 3QXHA 3M5DA 3B7WA 4NCIA 5LJIA 1D2HA 2AR7A 1NDQA 1N3IA 1PW7A 4X3PA 1DFHA 5BR8B 3V6LA 3WGJA 3W78A 4LYAA 1GQYA 1BX3A 3I5AA 2F43B 1W73A 4A6DA 3A05A 5IPFA 3PX2A 1HC7A 3A8TA 4RPHA 3EQ9A 5C8VA 4Q66C 2G76A 4K8OA 1PGQA 3WA6A 2RGCA 4QRDA 1SUSA 4NVRA 3NYQA 4MGZR 5H3LA 3G85A 3IXMA 1SXHA 4MDHA 4AK9A 1PL0A 3QWBA 2Q9UA 3L7CA 4I4LA 3KHUA 3LUDA 4TV9B 5F9MA 3KZCA 2W6JA 1E3WA 5ERXA 4KG7A 4QIHA 4OLHA 4E32A 5HR5A 5JV5A 5IMBA 1CHNA 1XD9A 3GJ3A 5THXA 5BYJA 1ISMA 2ZRQA 3EEIA 2QU8A 2A5DA 1XALA 2CXHA 3B7PA 5FH9A 1BJKA 2CHQA 2NZ8A 4RZHA 1HNZB 4QXOA 1HRDA 1QP0A 1OLUB 3RVKA 4IWYA 4GD3Q 4GLOA 1RAIA 3MJSA 3ZWXA 4E6EA 4RVFA 2DBYA 4A0QA 2WSLA 1Z63A 1PKXA 3BBLA 4W8HA 5CIWA 1TZBA 5REQA 4CNBA 2ZFUA 1R18A 2C84A 4I6EA 5SYMA 5FDFA 1FX1A 2VUHB 1OX4B 2QRKA 1MGOA 2VJNA 1FMJA 4JKOA 3DR3A 4HGOA 4C0KA 4D8WA 2V55B 4G86A 4IIGA 3M83A 2C7RA 3TZQA 1ZGJA 4NQRA 1C14A 2BFBA 3CG0A 1WHTB 2COUA 4LYFA 4CM1A 2JVKA 2WTUA 2C5EA 3BH6A 2PKCA 2CXQA 4MH0R 4P4LA 1NOJA 4ACAA 4C0LA 3A9VA 3BD9A 1H4SA 3A9CA 4K9LA 1R27A 3NTLA 3T7AA 3VGJA 1ULHA 3CCCA 1SG9A 3QX9A 4A2CA 2IZ0A 1FL9A 1H2WA 3UHAA 1CQIB 4XPIB 2ADOA 3IHWA 1GVNB 4XA8A 4O4IA 5AFSA 1NVMB 3U37A 4RVDA 1CJKC 1VL1A 3BQNB 1TF7A 1YB4A 3QXSA 2XMGA 4ZTBA 2CSXA 3QJGA 3RR2A 2WUDA 1RJ9A 2A1TR 3IDZA 3O47A 4CVNA 2O5CA 3ELDA 2RIPA 3JSXA 2RAUA 4IJQA 4EJSC 2FUCA 1Y1LA 1C3LA 1DNPA 2PS3A 4N8DA 4OD0A 3STTA 3T1TA 3G2OA 1Q77A 4CLRA 3LRPA 3EQ2A 1W0JA 1KTIA 4PC6A 1WW8A 2AMJA 2ZYWX 3F74A 3FWNA 1BO6A 3RSCA 5C2JB 1W5BA 1Y37A 3GCWA 4ER0A 2P4EA 3OG9A 2EYQA 1Z0SA 1C3OB 2VK1A 5JO0A 5LXTF 1R00A 1IZ0A 2OHIA 3EEYA 4DHEA 3K0AA 3FWYA 5AVJA 4TVSA 1SCJA 5C53B 2ONZA 4B43A 1YR8A 2FR0A 2HTEA 4OKSA 2QTNA 3NIWA 4OK3A 4TSRA 3KT8A 4ZJPA 1FBNA 2JIDA 1RXVA 2PS1A 1ACLA 3E53A 1Q0RA 2Z4SA 3GZNA 2DHDA 2HWWA 4W99A 5LQJA 5IFLA 1I1QB 1A1VA 3M6VA 4MR7A 2XYQA 4M1KA 3L7DA 2HEIA 2FEKA 1RZ3A 2XYRA 3BULA 2OL4A 4PEVA 1O03A 5DBEX 4YREA 3TTXA 5LMZA 1SO8A 3KPVA 4RCZA 1Z2EA 1GQ2A 1KJ9A 4X7BA 3ETCA 2E1PA 1JIXA 4MKZA 5FTJA 4DIDA 2GZ2A 4DLXA 2WG2A 1JSCA 1FMLA 2EZ8A 4IV8A 2TSYB 4MXDA 1DKUA 3BEDA 4Y9RA 2FZGA 3IDAA 1AF7A 2FEOA 5LFAA 1GTSA 3PRJA 4OSEA 1E1CA 1J42A 4E07A 3K4HA 2VCYA 5CRIA 1SG0A 2FN3A 3I6MA 3IXQA 4JITA 1ZK3A 4EELA 1OI7A 4N7JA 3NR2A 1JFFB 3ZCRA 1LPNA 1WMEA 2GK6A 2IXBA 1O6FA 4ZI2A 5L7TA 1CJSA 2C00A 1ZJYA 1MNQA 3JCZA 3VUFA 3EVDA 3K1ZA 4IZ6A 4WGGA 3R3XA 4CR7A 2OCGA 1NMSA 5ALTA 3LT4A 4PZCA 4DCTA 1JU3A 1II9A 1NULA 3AOGA 4D81A 3E03A 2Y1FA 5J2TB 3B1ZA 4JC0A 3C3EA 3WWEA 621PA 3QU5A 1IL0A 1DBWA 1EX6A 4IOKA 4AKIA 3UAWA 2LVBA 3BH0A 1HEYA 4HS4A 4IDAA 5E4FA 3BCUA 4CRWB 2DSTA 1PIWA 1NVBA 4RTPA 3OPYI 1CB0A 4RJJA 1AKNA 3AT1A 2W2VA 1AF4A 2YWJA 5GINE 1LRLA 3LTEA 2AXPA 3ZJ5A 1KS2A 4UUBA 1E69A 3LVRE 2DP4E 4PU0A 1I5EA 3NCTA 5ENVA 4N3NA 5JAQA 1QQTA 1H05A 2AC4A 1RIIA 3OJFA 4IJWA 1N25A 1Q7TA 2NV0A 4IDBA 3WP1B 3X43A 4UHDA 4CM6A 4EVQA 2JDIA 2HL6A 2IZ5A 3PSAA 2JAWA 3I2FA 5JO9A 3OJOA 1NWHA 4P7JA 1J2RA 4YAKA 2GFQA 5D3MA 2FW7A 5A0TA 2FPPA 4G5XA 3F3KA 1US8B 4GI2A 3OEWA 5AVYA 4TM8A 1IUKA 3UMJA 4FOPA 5D5HA 4HDNA 4ZRDA 1MG5A 5FF9A 1DP4A 2V4MA 2ZI5A 2GM9A 4RQBA 4L73A 4EARA 3OLCX 4JYCA 4U6NA 4ZDWA 2VHZA 2VK4A 1WX1A 2H9AA 1Q19A 1E9FA 4CIWA 1HDXA 1A82A 4JP8A 4KK3A 3RPEA 1RT9A 4XWYA 2VYVA 3TW4A 3GBSA 2LCIA 2XUHA 2JJ2A 2VYND 2NUBA 1LW6E 4YFYA 1U6KA 5ALNA 1KJYA 2O1XA 5D3ZA 1O9GA 1II8A 4JS0A 4L8GA 2GZMA 4F4UA 1EVLA 1C7IA 3KXKA 3VYVA 5TMPA 4H7HA 5HIAA 4YT4A 1SXPA 2WA2A 3C97A 1LJUA 4GLBA 3GYGA 2HYDA 3CKMA 5U4QA 3ISJA 3DEYX 4J7CA 4DV5B 3M5PA 2OQIA 3IHTA 1Z8HA 1G8AA 1HI9A 1XAIA 2B6NA 2ENWA 3K0EA 4K05A 2OVBA 2QRQA 2ZYHA 1IVNA 5FPSA 1N5DA 1XDWA 4CN8A 5A7FA 1U3DA 1KDRA 4M54A 3VR1A 5JJKA 4IEEA 1E64A 2NZXA 5CURA 3KZVA 4HB4A 3QLEA 4L4UA 1IHDA 1RWQA 2C96A 4R9NA 1U1CA 4MI3A 1V7QA 2WIDA 5B1DA 521PA 2ZPUA 1AQYA 1OLSB 2RHLA 3R0ZA 4BVLA 2JGLA 1KC3A 1UXIA 4GKVA 4KYUA 4B75A 4JBIA 5ADWA 2RCNA 4QL3A 4F91B 5DHUA 1ZY2A 3AUUA 5AVWA 4NAVA 4QPNA 3QXGA 1XSEA 2JIOA 1KQOA 1T3SA 5GOTA 1O3YA 4R1OA 5J4VA 1NVXQ 1W88A 1VRVA 4X90A 4ENQA 1TVEA 1JPUA 3M4JA 1O57A 3F7MA 4GR4A 4BMVA 4L75A 3ESQA 5EE9A 1X7DA 2PD4A 3RFXA 1A2OA 2OQRA 1CK4A 3G1WA 3JTMA 4IWNA 2IWRA 1YIOA 3GU3A 1QK4A 1RQRA 3NRCA 1CR4A 4N5DA 5DSZA 4BX0A 1NU6A 4LCEA 1VPLA 3I5YA 1JZSA 2V9CA 2YC4C 3OZWA 2WSYB 4QTTB 2Y0BA 4I1RA 4RA6A 3F2IA 1IONA 5DP2A 3U60B 4XGIA 1PE0A 3KZMA 3NAZA 3W5UA 1GARA 2ECKA 1ZA2A 4HH3C 3GLGE 1S2GA 1XQ1A 3JYQA 4Q4HB 1G41A 1V1MA 2G5CA 4BRZA 3IQFA 1QNLA 3R3HA 5J4LA 1KL7A 4K9MA 2PL9A 3FCAA 4ED9A 2YWXA 2AFRA 1CY7A 4H7PA 4LRSB 4O4JB 4KXMA 3PL1A 4P83A 3HKCB 3ZZ1A 2FGKA 3T5MA 2FB9A 2II6A 2OWEA 3JALB 1JQLB 4OGKA 2WZCA 1VRCA 2YXPX 1B4DA 3A9UA 2ODPA 3FOWA 1KYWA 1ZXLA 1MG0A 1VPEA 4OHPA 1NGSA 4CLOA 4XJTA 1U8EA 3K5WA 5HPYB 3WG9A 2PUGA 1KU6A 4MWCA 1CULC 1A4UA 2Q6VA 13PKA 1JKXA 1ZVMA 3S7ZA 5D6OA 4FX2A 4YCCA 2WJPA 3UENA 3MA0A 1F1JA 2OHGA 3BGSA 5ALLA 4F4JA 3KQPA 4WNIA 2LUOA 2ANCA 4DMRA 3HNPA 3I9KA 5TARA 3TLKA 5B7PA 5I7SA 5LA6A 4HATA 4PHHA 2IXTA 5ER6A 3EFOA 3I52A 5DCLA 3TIVA 1FCJA 3UQYS 2C9BA 3BSYA 1SCUA 1S5PA 4E2ZA 4GZ6A 3WMRA 1JN0A 3I62A 1A9XB 1EIWA 1G55A 4DYDA 4M1WA 4KXWA 1LBIA 2YYYA 3DXXA 3FNRA 1R0SA 3L1UA 3LA8A 5EXPA 4ZK2A 5HOEA 4JI4B 1Q0LA 1IK4A 3UW1A 2DQZA 2JL1A 2WNIA 3FB1A 4YI5A 5TMDA 2VXYA 3D5EA 3RS9A 4DL9A 3U5TA 5DNUA 3J81k 1ZGZA 1JPVA 1JZTA 2J87A 2O52A 5KB3A 1HE2A 3MTGA 3ORSA 5A5EA 2BR3A 4MYCA 1O5OA 3JS5A 1GLVA 1UKYA 4JXJA 3RADC 1M5TA 2Y68A 2P5TB 1OBCA 2O8FB 3VOAA 1ORIA 2C2XA 4KUHA 1P3Y1 5BSUA 4D3ZA 4EB3A 4LKRA 4BE9A 2XGGA 1DIOB 1RADA 1EIZA 2JFFA 3DO5A 5JC1A 3PFHA 4D74A 3PEWA 3LAWA 4QREA 4LVCA 3ONFA 4LJ5A 1U2TA 1QK3A 3RWOA 4DV6B 2WG1A 1CKEA 1ODLA 4FCWA 4OAQA 1KS9A 1XD2B 2QR3A 1SR8A 1XK6A 2PSJA 2ZRAA 3CG4A 5FBQB 4RW0A 4YMGA 2E85A 4IIFA 1UMDA 1BCRB 4IW3B 3BE5A 1L8OA 3QI2A 3RYHA 5U1PA 4AJPA 2FRXA 4DSAA 1DINA 2EEZA 2AW5A 3DO8A 3NHKA 3L9XA 1VPDA 5LA6F 1ZINA 5C8YB 1LPBB 1POWA 2VQSA 3L40A 1T6YA 3JVDA 3PJGA 5E1OA 3V8NA 4QNMA 3J81A 3T3MB 2ZP1A 4BPBA 4UHBA 3BHJA 4LOIA 1OH5A 1V3UA 3DVAA 2O8CB 3SM3A 3UAOA 2FZ4A 4FN4A 3CW8X 5CEJA 2NZJA 2ETXA 3BE6A 3QOYA 4F0JA 1XA0A 3VH3A 1OHHA 2Q2QA 5LUAA 4JFAA 3AY0A 3O0DA 2H5LA 2VJKA 1V4VA 5A71A 4YECA 3H0KA 3IEUA 4H77A 3R5FA 4WVLA 3V80A 2BGJA 3ABIA 3GJZA 4E70A 2JLRA 4Z4CA 4FIDA 1RFGE 4WA8A 4R71A 4YVFA 4RIHA 4DW8A 1PEKE 4AUMA 1D9ZA 4FOTA 1YDHA 1T2UA 4XFJA 4QXPA 1D2CA 3I2GA 2HJWA 3JWHA 2R47A 3OKPA 2ZE6A 3KB1A 3OJWA 1QB7A 3AONB 3O90A 3QE4A 4HN9A 3B53X 5FTLA 3LS2A 2GXUA 4I9HA 5LIPA 3AI1A 3KUXA 3PDWA 2ZYTX 5JATA 4EG7A 3NEJA 1RWMA 2XR1A 1W0CA 3EDCA 4XX0A 2C94A 3I04M 3H2ZA 4BMDA 1M83A 2PYDA 3MAAC 1ZNYA 2C57A 3LUKA 3ZG6A 1PEAA 1TPZA 4O0MA 3DV0A 1PYDA 4EB6B 5BNTA 1BMDA 2JANA 5CGQB 4CT0A 2ZRKA 2IYFA 5BWMA 5KOIA 1JTFA 3ADPA 3R0XA 4LOHA 3VKVA 2WC1A 3FRJA 5GZ3A 2FETA 4GP7A 3SMQA 3GGCA 3LYUA 4YXWA 1A0OA 1GQFA 4DB2A 1Y34E 2I29A 1E20A 1X77A 1RI5A 1Z0JA 3FTQA 4GZ3A 4JU8A 3K70B 3JD4A 5CH5A 5GMOA 3U4CA 1U7DA 3C0KA 3SMVA 4ACBA 4C7KA 5IT0A 2GEJA 4BMPB 4BB5A 1VIYA 2B4YA 1UC4B 3GT3A 4YCSA 2P62A 5KVCA 2RHJA 3L8HA 3EHEA 1K9VF 3EBOA 4GYWA 1GPH1 5EFOA 4EPTA 4W5QA 1AGNA 3F46A 3IR7A 4G24A 5JYEA 1USVA 2B9EA 1ZK2A 1V16B 3ZY4A 3E8SA 1PNQA 3BN3A 5BN3B 1CZOA 2DTXA 4UUMA 1ZAYA 1J24A 1MOZA 4L3WA 4J0HA 4BV3A 5TJ9A 1K89A 2ATVA 3WTBA 4FGSA 4LF6B 3OD1A 2HJHA 5CA1B 4FINA 4BVGA 4PW0A 5H02A 1G5TA 1TQ6A 2V0GA 2VDRB 4RVCA 1QYCA 2YVUA 3WNQA 4FEAA 3LX8A 1R1DA 1RTKA 4TTAA 2ZU0C 4ZEVA 5HK9A 3R0IA 2FV8A 1DGQA 2OSVA 5GONA 3ZCQA 2UUAB 2JRLA 2M6KA 2CKDA 1MF7A 2OV6A 2W8BB 4LN1A 3JZDA 4KQGA 4PLTA 4NMLA 4KIWA 3ZGLA 1LBHA 2WWGA 3AW9A 4AY3A 1P29A 4IMJB 4MAFA 5AI9A 3I3OA 4DXHA 3P0FA 2DFKB 2YJ5A 3TXYA 1U8UA 3OIVA 4ZVRA 5JADA 1RBQA 5JG7A 4JKIA 2VWGA 3AB8A 3B51X 4QA9A 1EP9A 1XOIA 3UPTA 1NKVA 1E7WA 3L7LA 4FDTA 4EGJA 1EK6A 1FJHA 1T6BY 2QZ9A 2VQ3A 5G3YA 3HJCA 1K7EB 3CBGA 1A9YA 3C70A 2OZEA 1SRQA 3L0PA 3UHFA 4CIBA 1ZN2A 1RD4A 4RIFA 3SLKA 1BKYA 1ZGCA 5TGZA 4RGBA 2O2XA 1Z73A 4B9EA 1YZUA 1DKMA 4WINA 1KMHA 4V0KA 3ZU4A 3ESRA 1XJ5A 2VJBA 3OZTA 4PC1A 4UU7A 5EKSA 1B43A 1TUEA 3A4MA 1IQRA 3LPAA 2E4XA 3M6MD 5TQ2A 2HDNB 3NETA 1RXEA 3OZDA 4P2BA 3SHFA 3WHLA 2PBFA 4CF3A 4ZFNA 4CR6A 3B1VA 1AMUA 1HTBA 1QFXA 1QYRA 1XZAA 1LU9A 3AW8A 3FPHA 4UBOA 4WK0B 3RAGA 3INRA 3PQEA 3ND7A 1PR3A 2RGDA 3N86A 2ACWA 1MB9A 4NK5A 4DZRA 1ZJ6A 3TW0A 3A1FA 4U2KA 3HKEA 1CS0B 1WEKA 3OHPA 4KB5A 5C3MA 4Z4IA 5KNDH 5CXSA 5FBRB 1Z0DA 2MJLA 4AB1A 1DBQA 3CMMA 3SC6A 1XUOA 4QGFA 5DKFA 4LMBA 4ZT3A 3CXUA 3K70D 1KNXA 2GD1O 2NXNA 3QW2A 4ND2A 5JJLA 2BGGA 1QIMA 1UDRA 1WOMA 3JASA 4IRMA 4QARA 2D0DA 2JZOA 4CG0A 4MYRA 4MUFA 1Z5UA 5AW5A 4GQBA 4DY4A 4JLAA 4HWPA 4BLUA 3DLIA 2GF9A 1JQKA 1INLA 3EOBI 3F7OA 3I2JA 5TY0A 4F8YA 3NRJA 1L7QA 1Q7BA 4FCVA 4HGYA 4XYGA 4OBBA 1B42A 4YUAA 4JCCA 4L7QA 5FNVA 1GSHA 4J16A 3DPSA 1VJDA 4C2BA 4OXQA 1R66A 2B61A 1P4SA 4XSHA 2HPHA 4CZ2A 5LN1A 4NBLA 2W11A 4CTMA 5IBCA 3BPSA 3T5AA 2EP5A 2YIVX 4O5AA 2DQKA 4Q3OA 5BN1A 4ALNA 1I7QB 2W2TA 3CEHA 4NCXA 1J7KA 3TTTA 3DVSX 2IYZA 1DHRA 1U9CA 3RFUA 2A9PA 2ZSDA 5BWNA 1ST2A 4MDFA 4EPWA 3A11A 1FW6A 1F2VA 2CXUA 3AUYA 3KUKA 4AS1A 1G6OA 4N7MA 2XCSB 3WGHA 2QDKA 3U17A 4NFHA 1ADYA 3GA7A 4R2MA 4C88A 3OT1A 3LKVA 4WECA 1DC5A 4CMCA 1LSJA 3UB4A 1UKVY 5BN5A 4EIWA 1JE0A 3SQOA 2CLOB 4RTKA 3VDRA 2WKRA 1HE3A 1VKHA 1X87A 1SA0B 1VE5A 4U9IS 1X80A 4D4JA 4F2GA 1KFBB 5E3IA 1Q0PA 1H4VB 4J3NA 3ZWAA 1IOLA 2OE2A 4YDSA 2QL9A 3LC1O 1NU8A 4URYR 4DPLA 2IH2A 4U5XA 3EIHA 5TR9A 1R0XA 4BVBA 5ERYA 1M9NA 1UFOA 1JQEA 2IY8A 2SKEA 2VAVA 1JJFA 4BX8A 4ZAWA 1X86B 4CEJA 3SQWA 3CT4A 5E9WA 4U2GA 5CDYA 4B4WA 4M8LA 4I5IA 2KPOA 3R7BA 4OJKA 2J5RA 3AJAA 3E7FA 4HLCA 4A8PA 4BKQA 2EV9A 2VLIA 1A4IA 3K0AB 4G81A 4JYZA 1AGYA 3NQ41 1NT4A 3INGA 2ORIA 4P3OA 2DPYA 1XCPA 2GCIA 4KYIB 3JVEA 3WSWA 2E49A 4F5EA 2ZBPA 3B1JA 3GYBA 4UTPA 3EHDA 2GN6A 1QO7A 4RO0A 3RU9A 5AW4A 2SKDA 5SV2A 3MHPA 3CLTD 4GRAA 3CC8A 4YJ3F 4OP1A 1O4WA 3IS3A 1DADA 4OY3A 4FC6A 2C9DA 4C07A 5KYUB 1ECGA 3O4JA 3IUQA 2AEFA 2MR6A 1K98A 3O8LA 1VGVA 3LY7A 3PUHA 3TIXB 3HLTA 1EVKA 5AW0A 3RU3A 2FOXA 4WT7A 5JD3A 3C6YA 3EXHC 5IUNC 4WZBE 5F1YA 4DLKA 2WHPA 1D0IA 1QF6A 4UZEA 2BZ0A 2BKXA 3OKFA 1XPOA 4L51A 5KDLA 1ML4A 1TM4E 2QP9X 4GUDA 2UVPA 2XWPA 3AR8A 1A88A 3LT0A 5T5QA 3SLRA 3T3DA 4CMGA 1O94A 3KTOA 2ZI3A 5G4KA 5JS2A 1FFXB 4H6VA 1KJ8A 1A98A 5BR7A 1HT3A 3TLZA 3SBXA 3IAAA 4A73A 3OOSA 2NAPA 5HZGA 3ZDDA 1O95A 1EDZA 1JA9A 3DLPX 3EXIB 4S1PA 4D2IA 1QPBA 1K97A 1LK7A 4N9QA 3AF5A 1TDJA 3S5UA 2XXAA 3THYB 4W9NA 3TPZA 4UM8B 4D6XA 1EHIA 5REQB 2HC9A 5CNKA 3FMVA 2N1MA 4JXZA 1HDYA 1TX4B 2OK8A 3A7DA 3JY6A 4MA0A 3DVQX 4M2LA 1T34A 3CH7A 3HUFA 3K9GA 4BP8A 2V5AA 4QUIA 2O8EB 5I8PA 3NMUF 1USUA 3I30X 1B8VA 1SUCA 4NYMQ 3K1YA 4HNQA 4AROA 4D5EA 3TTWA 3ML1A 3DZBA 3CRRA 1LPOA 2X7HA 1YFZA 2G70A 3SF0A 4PNEA 1BKDR 5EG5A 4DYHA 1QRSA 1IN6A 3GEIA 3F7NA 4PSDA 2J0QA 3LT1A 4FHGA 3CN9A 5HFAA 1CNEA 4NHEA 3BC1A 2QE6A 4ZQHA 3RI3A 1MW9X 2O0HA 3TW8B 4OI1A 1B8UA 1RR6A 2YJTD 4G56A 3LJKA 4X60A 1BH2A 1JT9A 1RAAA 1ZXBA 5EE5B 3GRVA 1NQAO 3H84A 1JQJC 4UKDA 4CIXA 1GHTA 1N6OA 1ZHHA 4OK5A 3W05A 5AW7A 2RHCA 3ISVA 2QYTA 3NV7A 2DPMA 3IPAA 3WLOA 2O2IA 3DV9A 3ER8A 3KVOA 6GPBA 1V6AA 1EHYA 4CV0A 4XXHA 3S55A 5AJWA 3O8NA 1C2YA 3E1GA 1J0AA 2YFHA 3MUEA 4DA6A 1Q16A 2XOXA 4QYMA 3IR5A 4RMGA 4XUGB 1KI3A 3S2ZA 4ZAFA 3AI3A 4MUNA 4WMLA 5JSQA 5KHOC 3HA7A 4C3OB 4TLDA 4R7ZA 3ZWVA 1H6AA 3EQ7A 3QPUA 1PR0A 4FLMA 1W5SA 4OLJA 4ZO9A 5TQ0B 1MC8A 2A0WA 3P27A 1QOPB 1BHO1 1BEUB 1TQ8A 5AM0A 4YR7A 2PJZA 2EZ4A 1NVKA 5CFLA 2ZJ5A 4MI1A 5EZQA 3UJBA 4X41A 1KWKA 2PBZA 4RSGA 3MVEA 1XTTA 3GO4A 1EU1A 2O8FA 4JI8B 2W48A 3BE8A 3EW7A 2ZI7A 1AKMA 1MAAA 4TVKA 1FP1D 4OP3A 2G9VA 3MRSA 3NEPX 3TNDA 3ZLTA 1KO4A 2XE8A 3NTQA 4KPYA 3T4EA 4AZVA 3G3EA 1E0SA 3TLAA 5JR3A 4DR4B 1OBVA 5IUKC 2C58A 2PH7A 3PC3A 2RBGA 4Q6WA 1R6XA 5EJFA 2IHVA 4OMDA 4HNVA 3TG2A 2GFIA 4WQMA 2DERA 4X8LA 3KSMA 5F76A 4D9GA 1ZKMA 1E89A 2WTMA 2IYAA 1CDEA 4FJ1A 2ZUTA 2PL5A 4OHZA 4JBLA 4R01A 3AKZA 3WJ7A 3U44B 4WESB 2H7VA 2QYOA 1PYOA 2BISA 2R6ZA 4V2UA 1PYGA 3QELA 3VPHA 4LQLA 2FVYA 2P2SA 4WLVA 4KAJA 3WRWA 4D9KA 3IMCA 3AETA 3NDRA 4TWIA 3VC2A 4US2R 1DRJA 1JR3A 3ND5A 3NP7A 4P33A 2YTZA 5KOHB 1TM2A 1C9MA 2AOUA 2G4CA 1R8YA 3C3BA 3DDCA 1CB7A 1SQ5A 3D6NB 2Q29A 4LA4A 2FN9A 4XOIA 2OYRA 3C6MA 4B0PA 5A0VA 3BMXA 1T26A 2ZWVA 3QF4A 4LMPA 3JW8A 1LI7A 3E9MA 1SN7A 1WTAA 4Z7JA 4ZHQF 1YJXA 4ZV9A 5LOVF 2IOFK 3HDJA 2AZDA 1WKVA 2DULA 3HY4A 2DWPA 2BEJA 2CJFA 2P35A 3EQ8A 1GRQA 3R5TA 4LXYA 4OMUA 3V4ZA 1EK2A 2FPRA 4CLOB 3EW9A 2FLVA 9ATCA 2CL0X 3U4QA 2DOKA 2P79A 4NG5A 2JFYA 2K2QB 2EZUA 3DEHA 3O74A 3UQZA 4BN0A 1SCIA 2V6GA 3EVNA 4FYYA 1MU0A 3QE9Y 3EDYA 3KK0A 3IVXA 1JR3E 1MQSA 1TJYA 2NACA 2PRSA 4U0KA 3ZR4B 1PDOA 4AJ1A 4E1VA 4YMTA 1DQZA 1GZ4A 2BD0A 3T35A 1T6ZA 3DLBA 4UPVA 1R6BX 4DNOA 4YIKA 5JWOA 1TM7E 2OMEA 3JQFC 4BNMA 2DWCA 1KBQA 4BDSA 3ZKWB 4EI2A 2A0XA 2R7LA 3BHNA 2C4WA 1Y7IA 2PJUA 1KHHA 1T29A 2P4QA 2UZ4A 3DV2A 2YZ2A 3ZD6A 5LKRA 1F3OA 4AZ0B 4FMCF 3ZV5A 3JQ7B 4PPFA 5F2OA 4IHQA 4PFSA 3G9XA 1OAAA 2OKCA 5AVQA 4BX2A 3QK7A 1L1RA 2G07A 2E1RA 2ZB8A 4XYEA 1GFZA 2H7YA 3U4QB 1M0WA 2H1HA 1Y63A 1GUZA 2QAIA 2X1LA 4P2GA 4G97A 1SQSA 2ZSIA 3M1IA 1N8NA 1CV2A 3AUXA 1ENPA 4AQDA 2W6MA 3CLSC 3G5UA 4TT3D 4E33A 4ER7A 1MFZA 5FJJA 3RIGA 5LKAA 5H16A 1UAAA 3PVSA 3ACDA 4M6WB 2F67A 2ZAYA 2R11A 3D2BA 1EKXA 1Z4OA 1D2RA 2AOUB 4FM9A 4FTWA 2GXSA 4HGRA 3FR8A 2ZULA 3V4PB 2J3JA 3SBEA 1EFRD 2D8MA 2IDJA 1GDDA 3N3AC 1PWXA 3OIGA 1Q3TA 3KTDA 1FRQA 3D7KA 4U7PB 1PNTA 4IIDA 4NC9A 1UXJA 2WDZA 4MRVA 4XI9A 4EBBA 1UEIA 2BMJA 1XRSB 2FRDC 2O7NA 2Z09A 3FPKA 1ZIPA 5E95A 2OVFA 3ASZA 3EIEA 3FLBA 3KV1A 1PDVA 1ZMOA 2NNWB 4IO1A 3WBBA 5IULC 3SCZA 3U1BA 1ZH6A 4LI3X 4I3HA 2IUFA 1VOTA 4CN9A 2PUEA 4I66A 1SKYB 2RBKA 5AM5A 3H3XA 4XQGA 4CLDA 1QDLB 3GRCA 4EUEA 3K9NA 4LS3A 4Q3LA 3YASA 3NJ4A 2X4LA 4L3VA 5IDYA 1P1FA 4RD4A 2Q3JA 3T9BA 1GGKA 4TTTS 3WL7A 3SIRA 1AA6A 4JD5A 3RFVA 4QQNA 3EXHA 1O97C 1S3IA 4L4SA 5EA2A 3RREA 3H75A 4F11A 1CUSA 4N0DA 3OLXA 4UASA 1CETA 2XMBA 1U3UA 5EXXA 3BWEA 4MJLA 4L5YA 2P3OA 3I23A 1P7CA 1FOEB 1TA9A 2C1XA 4P8RA 1V7CA 4YP1A 2ZB3A 2HHCA 4WEOA 4L5IA 3KKQA 1QO9A 4J49A 5LXTA 3AR2A 3UV3A 4B85A 1SKUA 5LWHA 1C2TA 1Z8DA 1J39A 2QD4A 3KKEA 1P9WA 3DO6A 3MMNA 1E5TA 1CU1A 4LF9B 1M67A 2PGNA 2I2XB 1TM3E 4KGDA 4ER6A 2MYUA 2ODTX 4PQGA 3NO4A 4ZVVA 1L4YA 2QRVB 4JOQA 2G88A 1R0CA 2J6BA 3ZTTA 1ZFNA 2JLUA 4HMQA 3GLHE 4GMXA 1GR1A 1TMKA 4O4LB 5DGDA 3BMOA 1Q14A 4RTJA 1SZPA 2ST1A 5CFRA 1PTKA 1E8NA 3ABRB 4MLPA 4UVGA 4ECAA 4JH0A 1UKAA 1X7ZB 2XKBA 3CR3C 4N5IX 3J7TA 3MJEA 3WLMA 1GA1A 2EWWA 4D0RA 3OFJA 1DFIA 3ICVA 1WRBA 1P7WA 5LP6C 2OZVA 5A62A 1XJCA 2A9OA 2XTNA 4H4DA 2Y6VA 1KA9H 5EZ6B 5KJEA 2V54A 2O0MA 3GQBA 2UAGA 5EHGA 1WXXA 3C3XA 1UDWA 2YZNA 2ZQZA 3CCBA 4FW9A 3OJEA 3SX2A 2X1MA 3W9BA 4NYIR 3X1XA 3RRYA 2ZSUA 3K9CA 5AT1A 2R7NA 4Y0AA 1T9BA 4NYMR 3VMFA 3WXMA 3F2VA 4ZXFA 3NW9A 3KJQA 5B6IA 1DWUA 1R74A 3G1TA 1VXOA 2E5LB 2AUNA 4XR9A 3GUZA 1UFVA 1VHTA 3BFVA 2Q5JA 4KFSA 4GKJB 3VU9A 1VBNA 4GMDA 4B33A 2YKGA 1OASA 2H4WA 5ALXA 3MIIA 3UMFA 1BXRA 3C4JA 4E08A 1N3LA 2JBWA 4MI9A 1M8KA 1P1RA 2WVHA 2WIJA 3CSSA 5DDIP 3QVXA 4DNPA 3REOA 2N9UA 3CFYA 3IEPA 3S2SA 3L84A 2P9GA 3IVCA 1QKKA 1U6IA 1WR8A 4DLRA 4LHYA 5K7SA 4RAOA 4HDSA 4RK5A 1NC1A 5HQJA 4QGGA 5DI3B 1A04A 3OTQA 4KUEA 5LZ9A 3ROXA 1KPIA 3MPOA 1RXWA 2OXCA 1BIFA 1GZUA 1WP4A 5AUNB 3IV7A 2QMUA 4UDOA 5AI4A 4J1SA 3WYBA 4D0SA 1LD3A 4X64B 3R6GA 4D9EA 3BRCA 1UKBA 4G63A 4J03A 2XD4A 1EQUA 4FCTA 4X8HA 4MPJA 2CMHA 5F35A 3SS7X 3MS2A 1CYDA 3RFTA 3BMOB 4ZZ3A 2WWXA 3GRAA 3KOXA 2ZLBA 3AV0B 1X7WA 5FBHA 2P3QA 1RU3A 3ZCVA 1VSTA 5JJBA 3W5DA 4C2UA 5J5VA 1X74A 1BHQ1 3L5OA 4CKBA 3L6CA 1K8XB 3LUAA 1RHQA 2FZWA 2AF3C 3MBIA 5HHTA 2AA3A 1ZOPA 1K08A 3OICA 2H5IA 1EVYA 3GPCA 1IN4A 1NSTA 1VJCA 3O2JA 4RMIA 5I9SA 2ZRGA 3HU5A 4CMIA 3UKDA 3SWWA 3HPRA 2VPXA 5ELLA 3T7RA 4GX0A 3TAHA 4JBGA 3BREA 2TMDA 2H2AA 1QIDA 4I4TA 4TV8B 1AO3A 3QU2A 4L22A 3TI7A 1IAVA 2W2NA 3IJEB 1FS5A 2W43A 2GLUA 3LP5A 3KXIA 1P74A 1H3NA 2H7CA 1E79A 5CDSA 1OKKD 2EFDB 4GLFA 4PZLA 4MQEA 2O3QA 3A1CA 2XT6A 2EX0A 4MQLA 3V8PA 4AZ3A 5DTMA 1RM0A 4G41A 4XTRA 3EPRA 1GNVA 4KR7A 4DDWA 1L6RA 1AGXA 1VL2A 3L46A 3L7NA 4TQUS 4D6PA 1AXEA 1X7XA 3VO1A 3WSTA 5JU6A 2QRGA 4YQFA 3U13A 3G9TA 3TLXA 1VE1A 2QTBA 3IEIA 2QYSA 1EVJA 4OFWA 2ZPAA 4UM9D 4E14A 5A3RA 1CEYA 2JJ1D 2VNHA 2ZIXB 4BBPA 4CMEA 1QFJA 1MVLA 3CF6R 4NBKA 5CX4A 1OLUA 2CDAA 3KQNA 2V3CC 4HLUA 1F12A 2YV2A 1G6KA 1QS0A 3RSLA 5HK8A 1F17A 3IQXA 2VDPB 2P8SA 3CLRD 4NMHA 4PO3X 3BMNB 1BHSA 2XE6A 4A8JB 4E03A 3U81A 4X93A 4CKWB 5ILQA 3DBRB 3GB9A 4OBEA 3PE6A 3G9UA 1W96A 3PZBA 4Q00A 3A9RA 2DECA 1JLHA 3PSHA 2FPXA 3TX2A 1NW3A 2E18A 1AURA 3IURA 3RH0A 3EGEA 1DVRA 3DXFA 2X5OA 3JQ8B 2CEKA 4YJ3B 2QL5A 4IUDS 2NYVA 3WJAA 1PUIA 3N6RA 1UMBA 1EYZA 3AIOA 2F55A 2NUPB 4QE3A 3T54A 2VOEA 5ALYA 1YB2A 3RM3A 5FHRA 1JB1A 3N2LA 2AN9A 4D6YA 2MT9A 4Z4HA 1AT1A 3JWIA 4IG4A 1A76A 2W22A 5THQA 3MUOA 3UPUA 1ECLA 1OVMA 1W75A 2VDUE 3X0DA 3G7SA 4HVCA 2Z6AA 3OFNA 2AKEA 4H60A 3K2IA 3ZD7A 1H0HA 1V3QE 2AD5A 1BWSA 2Y1WA 1RXUA 2A5LA 2MDTA 3L8MA 1FS4A 3D4BA 4P4SA 1XMSA 2I67A 1TIPA 2NM0A 4R8VA 3RLIA 3A6FA 2QG4A 3F8WA 1U3WA 5HJ5A 4QPCA 2C03A 3LVQE 4OTZA 4YJ2F 1UBHS 1BD3A 1C7EA 3HSSA 1CEQA 3L7JA 4J7AA 4QOGA 1P7VA 4ESHA 2PX5A 2PDAA 1JFSA 4G0QA 3EVTA 3PJEA 1NFRA 4ZTZB 5CB4B 3IMGA 5CPBA 3KZXA 3G2PA 2WF5A 4S2UA 4PNZA 1FVXA 3D6JA 3OQ6A 4W5JA 3W4IA 3WLTA 3ZIUA 2R6AA 3BSWA 1D03A 3CWZA 2GBPA 1DO8A 1K3FA 1PQYA 3KKNA 2NQ2C 1RJWA 1KJIA 4WDQA 3H04A 2Z3ZA 1QIGA 3B1YA 4BBAA 5MN5A 2VYVD 2IQIA 2P2GA 3MT0A 1QS0B 4EYSA 3CZ4A 2C5LA 3O3CA 2IHKA 3UO8B 2YUTA 2ASEA 2V4ZA 3PUJA 4MTCA 2AEEA 2CVHA 2WSBA 4YT2A 3DYIA 4MCIA 2ZVQX 2QW1A 4G9BA 2WI8A 3Q40A 1JT2A 1SBIA 1XI2A 2VF4X 4NICA 2NSJA 2VJCA 3L0CA 4QO7A 5E8RA 1W48A 2XAAA 1TK2A 3EYAA 3HFSA 3SYNA 1KU0A 2XODA 3NJRA 4QYTA 3MGKA 2KW5A 1X7YB 2CLHB 3L2OB 3UGKA 5CD9A 3RC8A 3O73A 2VBIA 2WD8A 4UTZA 1SUDA 4O1IA 1LTQA 4IRUB 1J5EB 1JGTA 3GAAA 3KAJA 3R40A 2CNDA 5IAJA 2I65A 2PMDA 4GXRA 5ALUA 1BN7A 1FYWA 2HHAA 4MV8A 4R41A 1XZIA 1SC6A 2NV2B 3VNBA 3U3ZA 1Y8QB 2KM1A 4F71A 2JCGA 4PLZA 1ZN9A 3NRBA 3T1NA 4JL5A 2A14A 2ATCA 3PGMA 4OOFA 4QEKA 2PD6A 3SLGA 3O4IA 3M6LA 2QW8A 2CZCA 5FNZA 3RRNA 2DC1A 1HETA 2ZU6A 5BURA 3LP8A 1DARA 1DHTA 4BGDA 4G07A 2JFBA 4DLUA 3LUBA 4MUYA 4J0IA 4LFCB 3GA5A 3IP1A 3K0FB 3F67A 4HYTA 1UOOA 2CXXA 4QM7A 2GN0A 1N9GB 1N1GA 1U0NA 2K2WA 3OLVA 5T7BA 5A4KA 4E88A 3MS7A 1ULUA 3MWKA 1C3OA 3W3AH 2ZG6A 1ZU5A 4AWXA 2N3ZA 3LZCA 3WRXC 4D4MA 1RJFA 3IA2A 5K0SA 3TZKA 1L7PA 4J0EA 1F48A 1D4AA 5DSTA 1UODA 1JA1A 1HRKA 2QNBA 4HLDA 4DXAA 4F84A 5DXJA 1ODSA 3O0TA 3D6AA 3Q5GA 2H1VA 1M6EX 4U7FA 4X91A 4F6LA 2FPWA 1KFKB 1LXCA 5K20A 2E5WA 3AERA 1J8QA 3HCAA 1M2JA 1GAWA 4O4HA 4ODIA 3M3PA 3M33A 5EHXA 3R2JA 4KXFB 4P3PA 4J9VA 5BNFA 4LDZA 3KFXA 1V43A 2RGNC 1BDMA 1WY7A 1Q1NA 1C30B 3HYCA 4OGLA 2C3YA 5AHKA 3ANSA 1XEFA 1PGJA 1XKLA 1IN5A 4HPWA 4L1KA 4LOLA 2IELA 5TT0A 4S3MA 5AKGA 2IYRA 2PU5A 2JGEA 2A5FA 2I87A 4QUBA 2CYAA 3OUUA 5EUCA 3SC2B 4D79A 3FMIA 3AVTA 4WVFA 2RHGB 4ADSG 1NVVQ 3QKWA 1J9GA 2DFTA 2SCUA 3CE6A 3OQPA 1K6EA 1WZ2A 3ZX5A 4B74A 1QAMA 3MWDB 2GF2A 4OBXA 4RFSB 3FPEA 1MCZA 5IN4A 4ZN6A 2YYZA 2PUHA 1V96A 5BV7A 2TS1A 3L7IA 1IY1A 1ZGHA 3AIIA 1L4KA 2C4NA 4NCJA 4DIUA 2DFDA 3QPCA 1VHDA 3UBMA 1U7WA 4L27A 4II3A 4II2A 3T61A 5C7IO 5DX1A 3WNDA 1XA4A 4G1VA 4F96A 2EL9A 2RJOA 4UUQA 3CVWA 4UAUA 1SVWA 1DCFA 3Q0IA 3WS7A 3KCNA 3ES9A 3M81A 2FZLA 3WHPA 1WMAA 4TTVA 3DT8A 2X3YA 4JGGA 1X13A 5FAKA 2JCYA 1XEXA 2P5UA 3O6VA 3DEJA 4UNQA 1KDVA 4F9TA 1WUIS 4Q1BA 4GMFA 3FSGD 3DOUA 1FC0A 4PYNA 5ED4A 4UMVA 3RRMA 4FFBA 5J4HA 4K6OA 1HE4A 5DCWA 4E4TA 1T43A 3I39X 1AUOA 4JR0A 2A33A 1OYYA 4FJ2A 1U2DC 3T4PA 3GFFA 3TBHA 1EWVA 4XWOA 1GNLA 1Z08A 4BEVA 3BIXA 3C2QA 4X7RA 5BSWA 3MT8A 3HZZA 4R05A 2R8EA 2J7KA 1RWNA 1T3HA 2AXEA 2FOIA 1PWHA 1S8AA 3HY3A 3WGMA 2O8CA 4I3GA 4Q01A 3FSRA 1V6CA 2BUCA 1LNQA 3EXFA 1IC6A 1DBVO 3KJXA 3QOWA 1EP3B 1D1QA 4BFSA 1II0A 4LJ6A 1IOVA 5I9BA 2Y1LA 1GPNA 4N3BA 4C9BA 1C3JA 5P8WA 3TLEA 4FGJA 2J45A 1E7RA 4RHCA 4H4CA 3KOZA 3GLHA 2G83A 3KYJB 4Y2QA 2PUDA 4KIGA 3WLNA 3CZ5A 1KARA 4GI1A 2GVDC 3DC7A 4B6RA 5C1PA 5M7EA 3UKJA 4EL0A 4FHZA 4MB2A 3GVHA 3E9ZA 4UHCA 2DH5A 2ZIGA 1Z4IA 3B12A 4ZPXA 4AW9A 3Q1LA 4ZC1A 1ONNA 4HQKA 1EGHA 4BB0A 2BGMA 2HN9A 4QATA 2D2XA 1OE0A 3EGOA 4LSMA 1O2DA 3AR7A 2H54A 2AG0A 5IC6A 5KQRA 4GBED 4NS4A 3OIDA 3ER6A 5BV8A 4MA4A 5C5EA 3E5MA 1KXZA 1LFDB 1GZ6A 1Z2OX 1DBRA 3KSDO 2PSDA 3ESXA 4Z0TA 5SZIA 2EW8A 3JAWB 3OCUA 4B2YA 3LUGA 2E4AA 2NNLD 4LMRA 2HO5A 3NC0C 2VHJA 3OQHA 3UFXA 1FFWA 5CJPA 1IN8A 3QH4A 3HR7A 1FDVA 1W36C 2C5HA 1GNRA 3PRKE 3F6CA 4KWHA 2P4HX 4W9RA 1NXOA 4BX9A 1VBKA 3D54D 2GO1A 3EXEB 3GJYA 3S99A 2BAGA 2QQ5A 3LV8A 5JAIA 5EUMA 3ZH2A 5FPYA 2FYTA 1K92A 2R1ZA 3BDVA 3NHPA 4B4DA 3QBVA 3ABOB 1XAGA 5K09A 1VMDA 3KB2A 4X6LA 3S5JA 4KV7A 1A27A 2ZT5A 3J80A 3KB6A 3HXQA 2KMLA 3D59A 1QU2A 2WE8A 2Q4OA 4RVGA 3LXMA 1K75A 3WI7A 2WU4A 2WYHA 2QYHA 1XZJA 1I32A 2I71A 2IEBA 4JVOA 2PKQO 1UPCA 1FUEA 3G0DA 3P20A 5I4KA 4JSYA 3A4YA 3WLKX 3N7TA 1Z0IA 2R8XA 3KEFA 4MW4A 4QOEA 4YXWD 3U5ZB 2B7BA 2IYWA 2DWQA 2FRVA 3HWWA 5D5QA 4AUKA 2YIDA 8ATCA 1YBVA 3OZBA 1GUBA 3WK8A 2BFEA 4IP0A 1ADJA 4WXPA 3TNLA 2EJWA 2GD2A 3WBFA 2Z5VA 3ZOKA 3GL9A 1V1RB 1BSVA 1S1MA 1CW2B 3W8FA 1N2CE 3HFGA 4KH1A 1U3TA 5EVJA 3A4LA 1THZA 3O91A 3HM9A 1UOPA 4RVSA 5KDDA 2GHQA 3G7NA 1AN0A 2C2OA 1XAHA 3B6IA 3EG9B 3GP5A 4RDIA 3VR5H 4LF8B 4KDFA 3LCCA 1W85A 2HJRA 1EG2A 3ZS9A 4BJ3A 1SEPA 4BNFA 4ZJYA 3FOZA 1BYUA 2O07A 3R0JA 1V4NA 4PCVA 1RPZA 1TZKA 1V9LA 4UULA 4ZOEA 4EY4A 4RTLA 3AY3A 1RCTE 4M0DA 4KI7A 4MARA 4DSNA 3ABZA 4UZSA 1V1RA 2CDBA 3N2GA 4L8WB 1R0LA 1SQ6A 2XCUA 1E5LA 2XUQA 4B6GA 1E2NA 3W1EA 3NBFA 1RYZA 4Q9JA 2R1UA 1I1OA 2WWRA 1OI2A 4HZUA 4NK4A 2VSOA 3BHIA 3T9FA 1A8UA 4QBFA 1M1YA 3RVDA 3ENNA 1D09A 2V7EA 4KKXB 2LIPA 4KJZA 4X92A 3NAQA 2JFVA 3FI0A 4I3FA 4K8RB 2I66A 3PC8A 4NV0A 3V4LA 4YY3B 1DAMA 2AN1A 3PT9A 1UBKS 4QVGA 1E1QD 3ZU6A 1EA7A 4JLSA 1H69A 3FYTA 1AQIA 5DSXA 3TSOA 5JH7B 1KIFA 3E2IA 1FFEA 1UBFA 1OQAA 4R9RA 4DQVA 2W6JD 4C2TA 1T0PA 4GP6A 2L82A 2YVKA 4IIJA 1WQ3A 2X9GA 2QQEA 1L5HA 2W4QA 1HSOA 3KS9A 2G3YA 1XMJA 1NVUQ 5CX1A 1Z7GA 1JDBB 3VYTB 3PHJA 5E7QA 2YUIA 4FYWA 2NT4A 1RHRA 3TVDA 1IRIA 1FFDA 1ORHA 2AK2A 1GLGA 2PQ2A 2H4XA 2ZIZA 2VQFB 3GLFE 4N5LA 2YBDA 1GYQA 4AG3A 2XWBF 4B7AA 4MHTA 1CVLA 2AJBA 2J5BA 1XWFA 4IVQA 3TR5A 1CY4A 1KQNA 5B55A 1L5HB 1RLUA 2ZTHA 1UBRS 3ESDA 3HHEA 1K1EA 2FH5B 3P19A 3Q0EA 4FYXA 2QLTA 4OP2A 5JTTA 5L4LA 4N48A 3V48A 4FXPA 3STHA 4Q37A 3ROKA 4D97A 3PP8A 4RZ3A 4OHKA 4B73A 3LE8A 5HDQA 3MWEA 2NO9A 4K1XA 4YHBA 4M99A 2BEWB 1EGMB 4UFOA 2C7VA 3VC3A 2HXYA 1E3TA 1E2MA 3GRUA 2FXIA 1T0JB 3TN7A 4F4FA 3BH7A 4ZI7A 3GEEA 4TLMB 4C30A 3TG8A 1GUAA 2ZJOA 4AY2A 4LJKA 2EP7A 1QE5A 1M2EA 2RGGA 5L3QA 1NATA 3GG9A 1N2CA 4AN0A 2I5PO 3ME5A 4KDRA 5LOVA 1IEWA 3AOEC 4M4SA 4TKZA 3M6FA 1PR2A 2GN2A 3ICPA 3QQPA 3H86A 5ALPA 5C0OE 5A1TA 2GETA 1KH3A 1EM6A 2GB4A 4UJ5A 1EE9A 2FVXA 2OR3A 3JYPA 1RP1A 3TW6A 3E1SA 2AX3A 1D7AA 4OQXA 5FUVA 1KXJA 2IEZA 3D3JA 2Q1WA 1E3QA 4WE3A 4YNBA 4AQ7A 2ODWA 4AO6A 2A67A 3TDKA 1JRLA 2B83A 2YWHA 2YICA 4P80A 1S4QA 4WCFC 3UV6A 3W9YA 5IHPA 3T1OA 5SY9A 1UR5A 5KX5B 1N5RA 1Z06A 1R9JA 5BWLA 4RVHA 4OUDB 1C3VA 2G06A 3SYMA 3PVCA 3T38A 2X6QA 1K7XB 3KT6A 1BMFA 3HE3A 2E3JA 3F6SA 2VQDA 2PUBA 3B85A 4CL0A 1J0EA 5ARBA 2BFEB 1TCCA 3FZQA 1UMCB 3RF6A 1H0KA 2QJOA 2XRMA 3WV5A 1G8JA 4PS1A 4QUAA 3HA5A 4QFCA 4I55F 4YB8A 3FOCA 5E0OA 4BQQA 7REQB 2IKQA 3COWA 4IQ4A 1GD1O 1N9KA 4J94A 3BFJA 1XGKA 3WJ1A 1L7AA 1SMKA 1NQWA 2R6GA 3JAKA 5JXHA 4KQEA 3ZW7A 2Q50A 3W5HA 4QRIA 4ZO7A 5P21A 2J5QA 2WAXA 3H9BA 1E3DA 4C43A 5AW3A 3BZUA 3LL7A 4HGQA 5JSZA 3HXMA 2G0TA 4B8WA 2BCGY 1L5ZA 4RORA 2XDYA 5G3ZA 2Z6VA 2C29D 4DSZA 1NBAA 1NY6A 1E5QA 2UYOA 4L15A 3U16A 4NFYA 4RFSA 1UBUS 1U2GC 1NN5A 4P36A 2QN8A 1ZD2P 2NU7B 4WXEA 1PD1A 2BN4A 2NN3C 4EZBA 1AK9A 2VDWB 5BSRA 2BTEA 4C89A 3JWEA 3RUIA 3BIJA 4FBLA 4HMOA 5FHQA 1PJBA 5EKTA 3ZY2A 6CHYA 3STUA 1MEOA 3BJZA 4RD3A 1GTL1 4U4AA 4C0HA 1IEVA 2XGJA 4K9RA 2QPLA 1AB5A 4FVTA 2BP7B 4YUYA 1U0EA 4C4XA 1C0EA 2FN4A 2IEDA 2YWCA 1IY0A 4C0JA 4HVAA 1A8PA 2DKOA 4QBIA 5EUBA 3NLLA 1MORA 4MLCA 3RSGA 3K09C 1QYIA 4AF6A 1HQDA 1QH1B 4DNXA 3D7NA 3AVUA 2G1JA 3DQQA 3HUEA 4MRMA 5CXUA 1RRMA 4KKVA 4NH4A 2AS0A 2PLFA 4R3NA 2BYTA 3OQOA 5AUQA 2XVZA 3WK6A 2JLQA 3W06A 2FDCA 3FVTA 4KODA 1SIBE 2Q1XA 4M60A 4RXMA 1U28C 3O4HA 3OPXA 2B5OA 4N5MA 5KSPA 3GGJA 3P9PA 3QU7A 4A27A 2BLNA 2VJOA 3AC0A 1OWPA 1QCCA 2JVJA 3LRTA 4JOBA 2KQUA 1J06A 1EFVA 1VKZA 2F9FA 1KYZA 2GTIA 2QTRA 4MRMB 5AXDA 1THMA 4AIIA 5FOXA 2X58A 5LZ5A 2PE5A 4X20B 1Q12A 1YBAA 3JVUA 4F3YA 5CIYA 1G21E 2FSHA 3DBLA 2OV1A 2PAFA 1I3NA 2JLBA 3QVUA 2CFOA 4HUQA 1G59A 1A72A 3UYKA 2AG1A 5GV8A 2R44A 4AJEA 5DYNA 4CMHA 3EEFA 4PHCA 2H92A 3OC0A 1P0QA 1KEZA 3K7EA 1GZ7A 4RJ2A 2EJBA 3LECA 5CLLA 4AICA 2REXB 3LDGA 3WHKA 2OV4A 2Q4RA 3LY9A 2HPZA 3EF1A 4TMWA 2J4DA 5C1OA 2DHQA 3N28A 3FDJA 3QPVA 3TSYA 2VQ6A 1K8YB 2IITA 4KO8A 3D4OA 4B09A 1JIVA 3QU9A 1GNQA 1IK6A 1SELA 5HUHA 1P45A 3DD5A 2FDRA 3IXLA 2EFEB 4JYBA 2LXNA 2ENUA 2CMKA 4JT9A 3PHLA 4Y2HA 4ENVA 5KC8A 2XUDA 2XMSA 2B21A 2E37A 4O5OA 2FUG1 3SZ3A 3B5IA 1H6CA 3UOGA 3RJMA 2N47A 3QJ5A 3LFHA 3GHHA 2XMPA 3B70A 3QUSA 4URHA 1WDKA 2CMDA 5IAKA 1XE3A 3FYCA 3INTA 2RD2A 5COQA 1B6RA 4J6EA 2J0EA 2A94A 3IAM1 4DAOA 4NNOA 4H3SA 4NE7A 2XWJI 4GW3A 3ZHCA 4D9JA 4MVWA 4AX8A 4AJJA 2GPJA 3LP6A 4C4SA 3GJ8A 4G1MB 4MKFA 1TA0A 2EKBA 1JWAB 1XTZA 3Q98A 5ARCA 3S70A 4AKTA 2DM6A 1HGXA 2HQBA 1IVSA 3ONVA 1RLMA 1T5OA 2ZPTX 3CX4A 3DWFA 5EQJB 5BSGA 1U9JA 3PHBE 5KWIA 1X1AA 4YYZA 2LDXA 1W4LA 5FD8A 1P5JA 5AW6A 5JISA 3H87A 1Z12A 2F62A 1Q74A 1G3RA 5HBRA 3V1LA 4AZWA 4OHUA 2ORWA 1J2UA 1XU7A 2WSIA 1OI3A 2Z98A 4L7VA 3VJLA 5DHFA 2B1RA 2XF2A 4FZVA 1MJGA 2ZIAA 1FZQA 1AY0A 1P33A 2EJTA 4KWTA 1FP7A 1WUHS 2YX1A 2IEIA 4ZK6A 3JVIA 1F06A 1RAFA 1CT9A 2IEAA 3PEVA 1HFEL 3QBDA 5KYUA 4M1TA 3JASB 2B4TO 5K8JB 1IXYA 3WK7A 1I94B 5FR1A 1HO3A 3NHZA 1GZ3A 2CXOA 4MV9A 4DNQA 1I4WA 3OZUA 1QH0A 3ZX4A 4EW2A 3PXGA 3HRIA 4OU4A 1AQ6A 1ZH4A 3WADA 1NF9A 4ABTA 5LQAA 3MGCA 4PSVA 2OBXA 3CSDA 3HU1A 4JOSA 3E84A 3RRJA 1Q7CA 2G28A 3QSGA 2AHOA 2I7TA 1Q1AA 3B60A 1DQSA 1Y9EA 4XM2A 3UMCA 3GFTA 5A02A 5A4AA 1ZUWA 4K3VA 2H8KA 3P5SA 4M0UA 2O2JA 1JF8A 3G59A 3Q6IA 3KEQA 4PRYA 5ALZA 4Y9SA 5FUYA 1VB5A 3UG6A 5FI5A 4D3DA 1NBWB 1SVNA 1NYQA 2HBRA 1JEAA 2HX1A 4CDRA 3KZKA 5F21A 4B3IA 2H5EA 1K7FB 3JQ8A 2DUJA 5EZYB 7MDHA 3VC7A 3U3KA 2Q3CA 3OM1A 1UK6A 4AWAA 1JU9A 4N12A 1Y81A 1ULTA 4EI9A 5HKBA 2Z2IA 2EWMA 1ZJ4A 4BFWA 2JI9A 3ROMA 3V7WA 1UZUA 3BJRA 2OAEA 5EJ9A 3BEOA 4XIJA 4Q19A 2ATXA 5KYVA 2QA5A 5KWJA 2EHJA 2QF7A 2Y93A 3R9KA 3U9LA 1QVWA 1W93A 1SXJC 1LBQA 1SK9A 1YI0A 4M6WA 4XRRA 5D84A 4IDFA 4R2KA 3TOXA 3Q8MA 1NQTA 3ANLA 3TSCA 3U9SA 1QZZA 2AFVA 5FWYA 4DLBA 4O8CA 3RVOA 4MIYA 2Y9MB 3IBFA 1FDRA 3QVMA 1FSSA 4LXIA 2FMUA 4XWTA 4K2AA 4INAA 4RH3A 1P6QA 1LPAB 4FR2A 1VE3A 1E2KA 5JC8A 1XKXA 2VQEB 2QTTA 4IL5A 4NBVA 1QHGA 2N42A 1IQUA 1N6RA 2FN8A 1TADA 3QE3A 1Z5NA 4JJIA 1OH6A 2KE5A 5K3FB 3DHYA 2VS1A 2CL7X 3LDFA 2X13A 1M5RA 3UUEA 1N2BA 3HWRA 4ALLA 2IYOA 4UM7A 1Z38A 4BHTA 1IN7A 2V4UA 1P1HA 3BG5A 3R74A 3D0QA 4A0RA 1FXWF 3DBIA 1DRWA 3UAXA 2ATEA 3Q2OA 2ZYAA 2D2IA 2GK3A 3RU7A 4AF8A 4E5YA 3NBYC 4V0ME 1OD6A 2DKNA 2QN3A 4WXMA 3D43A 5IYZF 3WA7A 4DT1A 5HYVA 2O8VA 2B8TA 1SIUA 2H11A 4HHEA 2QJWA 3G5LA 3LGAA 3RK1A 3U40A 3VC1A 3ZK9A 5CDUA 2F8SA 1VC2A 3HXPA 2Y1OA 2DFNA 3DT9A 3Q3GE 5JSFA 1C0PA 2CC2A 2P6PA 2R7AA 3BCRA 3LBHA 4JJZA 1XQVA 4L78A 4M7PA 5G1NA 1UDXA 3IJPA 1QV7A 2BLLA 3K30A 3P96A 1L5MA 1X7WB 2MCFA 5FV4A 3SICE 4QELA 3ANTA 3C6KA 3I34X 3LY8A 1YHYA 3DHVA 4CKXA 2Y27A 4WKOA 3CJTA 2AIRA 4NU5A 1K6MA 1WUYA 4W4TA 3SFZA 2PXAA 3FE2A 1QORA 2ZAMA 3JQ9A 3OMXA 3T1QA 3GT7A 2ZB7A 2WSSA 4J0FA 3OZSA 4Q3DA 2J0UB 3FKJA 5ICEA 5DBIA 1OW3B 4BE7B 1TZJA 4BVFA 3G5TA