1SJ9A

Crystal structure of the uridine phosphorylase from salmonella typhimurium at 2.5a resolution
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
250
structure length
250
Chain Sequence
SDVFHLGLTKNDLQGAQLAIVPGDPERVEKIAALMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPMEFPAVADFACTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRRFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPNAETMKQTESHAVKIVVEAARRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uridine phosphorylase
publication title Preliminary investigation of the three-dimensional structure of Salmonella typhimurium uridine phosphorylase in the crystalline state.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Transferase
total genus 65
structure length 250
sequence length 250
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2004-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1sj9A00
4TXNA 4BMYA 1U1FA 3FOWA 3GGSA 1LVUA 1PR5A 1T8YA 3FB1A 1ODJA 3FNQA 4DARA 2I8AA 4WKPA 4MARA 4U2KA 4DA8A 5B7NA 1B8OA 1T8SA 1V2HE 3O4VA 1RR6A 2A8YA 1FXUA 5ETJA 1U1EA 3PNPA 3E0QA 2A0YA 3OOHA 4RJ2A 1XE3A 1CB0A 4OEHA 1V3QE 1LX7A 1ECPA 2OC9A 1Z36A 1Y6QA 1Z5NA 3EMVA 1V48A 3E9RA 5EPUA 1TGVA 3KUKA 5FAKA 5IFKA 2HN9A 1WTAA 1OTYA 4TS9A 4YNBA 4L5CA 4L5AA 1OTXA 5CXQA 2HWUA 1RXSA 1Y1QA 1T0UA 4NS1A 4OGLA 3F8WA 1Z39A 4G41A 4LNAA 4ECEA 4F1WA 4I2VA 2AC7A 4D8XA 3K8OE 3TL6A 3P0EA 5F73A 4M7WA 3LBAA 4BMZA 4R2WA 3KHSA 3FAZA 5CYGA 1JDSA 3U40A 3BL6A 1OV6A 4R2XA 1Z38A 2A0XA 1TD1A 3MB8A 5F7ZA 1Z33A 5JPCA 4F3KA 4TTAA 3KU4A 3ONVA 2B94A 3IEXA 1ZOSA 4OJTA 4TYMA 1YQQA 1RXYA 4OY3A 3T94A 3KVVA 1PR6A 3OCCA 4L6IA 1PW7A 4L0MA 1A69A 1Z34A 4NY1A 4OF4A 1OUMA 3OZBA 4FFSA 4YO8A 4K6OA 4DA0A 4M3NA 2GUWA 3BJEA 5CYFA 1RCTE 4JP5A 4TTIA 3FUCA 1VFNA 4F2WA 4DANA 4LNHA 3LA8A 1A9QA 3O6VA 4TXLA 4EB8A 1NW4A 1B8NA 1A9TA 1ODIA 1M73E 4QATA 4G8JA 3OZEA 4H1TA 4M1EA 1Y6RA 4F2PA 2QDKA 4BN0A 4L5YA 3EUFA 4X24A 3UAWA 4EARA 1PF7E 1RT9A 1T8RA 1ZL2A 1JDZA 3DP9A 1PK7A 3K8QA 5DK6A 4F3CA 1V41E 1RYZA 5I3CA 4DA7A 3MMSA 1YRYE 2Q7OE 4E1VA 1PR4A 3D1VA 1JE0A 4D9HA 5B7PA 4MCHA 5B7QA 5K1ZA 1Q1GA 4D98A 3LGSA 4LDNA 2HRDA 1JDUA 5F78A 4D8YA 1LV8A 1OU4A 2A0WA 3GB9A 4BMXA 1Y1SA 1YR3A 2PGAA 1U1GA 4YMLA 5C80A 1SD2A 4TTJA 4UC0A 4G89A 2OXFA 1VHWA 1ULBA 3E9ZA 3OZDA 2BSXA 3ODGA 3OPVA 3UAVA 1SJ9A 1V45E 3DF9A 3EUEA 5B7GA 2ISCA 1K9SA 1JE1A 3NM5A 1RSZA 2AI3A 3UAZA 1Z5OA 2HSWA 3FWPA 3NBQA 2P4SA 1OVGA 1ODKA 2QSUA 1QE5A 4DA6A 2QPLA 1PR0A 4QARA 3OF3A 4LZWA 3IOMA 1JDVA 4LKRA 5F7XA 5CCEA 1I80A 4WKNA 2AI1A 4QASA 3UAYA 1JYSA 1NC3A 4WKBA 3OZCA 5KB3A 4PNPA 4GKAA 3DPSA 2ON6A 3NM4A 1PR2A 1A9OA 5EUBA 1U1DA 1Y1RA 2OC4A 3BSFA 2I4TA 1VMKA 1G2OA 5CCDA 1K27A 1NC1A 1TCUA 5F7JA 1YBFA 3DJFA 3UT6A 2XRFA 4KN5A 1A9PA 4D8VA 4PR3A 1SD1A 1PBNA 1Z37A 1T8WA 4JOSA 1VHJA 2QTTA 5F7OA 1JPVA 1SQ6A 1U1CA 3EEIA 1RXUA 1Y1TA 5EFOA 3BGSA 4DAOA 1Z5PA 4JWTA 3NM6B 3SCZA 1PWYE 3INYA 5F76A 4TS3A 1K3FA 4DAEA 1TCVA 4WKOA 3KVYA 2RJ3A 1RXCA 4R31A 1ODLA 5IU6A 1PKEA 2H8GA 4QEZA 3C74A 1JDTA 1JP7A 2OECA 1RFGE 1N3IA 4YJKA 2QTGA 1TGYA 1A9RA 3PHBE 2IQ5A 2AI2A 1A9SA 3P0FA 4IP0A 4GLFA 5F77A 4WKCA 3PHCA 1PR1A 4OGKA 1PK9A 4NSNA 4P54A 3DDOA 1CG6A 5CXSA 3KVRA 3OOEA 4MCIA 4QFBA 4DABA 1YQUA 4TXHA 1ULAA 4GMHA 4TXJA 4TXMA 1C3XA 3PNSA 3QPBA 3UAXA 1Z35A 3ENZA 1V4NA 4QAQA 4GLJA
chains in the Genus database with same CATH superfamily
1V5GA 1C9YA 3QKRA 1U11A 1VPLA 1X80A 2A1TS 3R6TA 4PEVA 4OA8A 3GEGA 4L0CA 5JHGB 1VL8A 3EIHA 3M6VA 1KI7A 1JLSA 2H8KA 3N0WA 3K9BA 2Q27A 2PTGA 1RI4A 4QBFA 5L40A 3A0RB 3GGSA 2GEVA 5TVGA 5KQLA 2X0NA 4CF7A 4M9UA 1QG0A 3OBIA 2BGJA 3JSAA 5CLLA 4YECA 4UCQA 4X63A 2FW1A 5CFPA 5EJ5A 2DBQA 3WIBA 4CQMB 3TFOA 7MHTA 3DBVO 1XN1A 5AH0A 5AUNB 2WQ6A 3LCRA 2AD5A 3JYLA 3OU6A 4DLBA 2OXRA 2XTMA 3LT4A 4ZTZB 1U5AA 5A4IS 1HNXB 4DB2A 5FP0A 3KE8A 3WLEA 4B3TB 2SKCA 4ODIA 2WIFA 4Q24A 1UFKA 4JA2A 4DHWA 1TKRA 2GN0A 3CT6A 3ZH2A 3FOCA 4B87A 4AICA 3OQPA 4LYJA 2SICE 3G23A 1VCOA 3B3GA 4XGKA 4QELA 5L4SA 4JSTA 2ZYVX 2FPRA 4HQOA 3BQNB 3L8ZA 1IEVA 1H2YA 2PKXA 5F3DA 3CUKA 1ISJA 4QU0A 3IV9A 5IC4A 4X66B 3QTTA 4JUIA 4X00A 3HDGA 1AGYA 1RRPA 1KMMA 1C1DA 1LX7A 1W49A 4FDAA 3O4JA 1NR5A 4CM6A 3OLWA 1Y6QA 2FJ0A 1NULA 2QTHA 5TT0A 3RC1A 3WLSA 5B58C 5CB8A 5JVDA 4S0XA 3B1KA 5C3UA 2JGMA 2QQ0A 1CLUA 3NBZC 1A96A 1Z16A 8GPBA 1SU7A 2C8LA 3B38A 5IDYA 3O03A 4LECA 4CJXA 1ISGA 1MJFA 2H7VA 4K81B 5GJWC 2B69A 2N1MA 3DDSA 3KUXA 3ZNQA 3QE2A 5CT8A 3RBAA 5CFMA 1TEXA 2ZE7A 1BD3A 1FDOA 2DQZA 3JWGA 4OK3A 4QFBA 3PXXA 5FFFA 4RMJA 3ABIA 2QDXA 4MUFA 1IBCA 2DTDA 4L5CA 1T1EA 3TNDA 4CR8A 4EB0A 3V2HA 5KEIA 2H0RA 3VKGA 1NR1A 1BAPA 3OOWA 3S7ZA 5B6PA 2LDBA 1SPXA 5HBGA 2A5DA 3WGGA 4DYVA 4D96A 5ITWA 2ZRCA 1NXXA 3DTVB 1UBMS 4PYNA 2EF1A 3OFKA 1LX6A 5LPNA 1K5GA 1AV7A 3RJ9A 1R8YA 4EYQA 3Q4GA 5JYEA 1QTNA 1U9IA 2VDWA 3CO5A 3OJXA 4HEHA 2AG0A 4IMIB 1NW3A 3EIQA 4LNAA 5DT2A 5KNBH 4J4TA 1R9MA 4QOGA 3WX0A 3ORSA 1XXHE 1RC1A 5JOQA 3DMPA 3LBAA 2Y9PB 2IW1A 1IRIA 1TCBA 1O2DA 3C8ZA 1FFEA 5K3BA 3KHSA 1N2CA 4YRLA 5HKLA 1T0PA 4YT5A 2BKVA 4R0VA 3B1YA 3NHJA 4N3BA 3ER9A 1IHYA 1DJPA 2IITA 3A28A 4GM1A 3SC2B 1R0CA 3IP8A 2CC2A 3SIXA 4H0CA 4XQEA 5B6IA 1G1MA 3KYBA 2BGWA 3ZV6A 4BVLA 2HFKA 1M2EA 5K99A 1ZHOA 3TOVA 5JDIC 4O59O 5LMZA 2H1HA 1DKNA 5HM8A 4RVHA 3GX1A 4C87A 3DONA 3I9FA 5TR9A 5IAAA 3ICEA 5IXSA 4GGOA 5JYDA 2IIPA 2QTZA 1WUHS 1ZFNA 3M1LA 4EDFA 2YYAA 1KAOA 2AJBA 4MYTA 1T3ZA 3H5WA 2ZEJA 4OGGA 2JJYA 2W8BA 3DDWA 1GFIA 1M6YA 2C03A 3Q3IA 2BKXA 4FSXA 2O8DB 3WADA 3AV0B 4M9QA 3AVUA 1ZOSA 2HK8A 4BVHA 4M1OA 4WZBE 4CIYA 4BQOA 3VA7A 4QWMA 2WTUA 3EZ6A 1GL6A 1E6WA 3DKRA 5E2AA 3SC6A 4UM5A 1CZUA 1U0GA 3EVFA 3VZSA 3ZZ0A 3KIPA 5CT9A 5TSDA 5JS6A 5A02A 4LCJA 1B0AA 1UINA 1L7XA 4FT4A 1I2AA 4OATA 5E6SB 2XNJA 5FWAA 4RTRA 3RBZA 4U2FA 16PKA 5CEFA 1JSCA 1RWOA 4L8LA 1M2JA 3GJ8A 3OZBA 1R5OA 2JARA 2ZB8A 1ISPA 3B52X 3JQGA 1OFVA 1MHTA 3OWOA 1EGQA 4XWWA 5KYXB 4FUQA 2M6LA 2FH5B 3GJ3A 5KAMA 4R40A 3EDYA 2FZKA 2AJTA 2FSHA 2NSHA 5JAPA 2GRAA 2R8XA 2Y05A 2O8NA 4UMVA 3LM8A 1KKLA 1Z6QA 2KI5A 3SKVA 3FB4A 3MFYA 1WR8A 3G1WA 2CUTA 5I7UA 3FUCA 5J40A 4PZ9A 2Q5FA 1NJ1A 4YCBA 2GLUA 1C7FA 3LP6A 4ZGGA 5EJ4A 2GAJA 3EY4A 4RGQA 3EXFA 4R2KA 2FKAA 2HQ1A 4YCLA 3N8KA 2A1TR 2GHTA 2Z57A 3FPJA 3QPDA 4HB3A 2RD2A 4TWAA 4NAVA 3AKDA 1QP7A 3AW8A 3QFTA 4BASA 4HWPA 3FSJX 3C3JA 3D4PA 1Q0RA 1DV1A 1M83A 2P3SA 1RWPA 2B3DA 2Z5LA 6YASA 1CIPA 2IEAA 1HFEL 2E7ZA 3S99A 4PYOA 1GV1A 1OWMA 3OIDA 3TIGA 3NDBB 4PN7A 1JJAA 1Q20A 2CK3A 4JJ7A 1L4EA 1F2UA 3L6UA 2J67A 2PSDA 1JF8A 5AI9A 3ZHQA 2H9AA 5CW2A 4IWNA 3WO1A 3RWOA 2JLSA 3L6DA 3WIUA 5JZOA 2EJWA 4TL6A 4QT0A 3W4JA 2WSSA 4OFWA 1G9TA 1F06A 3F3YA 3AV3A 4PWYA 1PF7E 4QDOA 1VKHA 4DV2B 4DNOA 1JPNA 2EG9A 3PVCA 4ZANA 5CAEB 1HM5A 3PFNA 2BKAA 2X0KA 3UC5A 1GJRA 1ZOOA 3QOXA 4NMHA 5F21A 1U8XX 2RK6A 2W6JD 3PEUA 5IKMA 4O2BF 4KYTA 1WX1A 2PKYX 2GWHA 1JPJA 2XCUA 3PP8A 2W00A 1RYZA 3MYYA 5KYUB 3D31A 4MVJH 4OUDA 3ASYA 4M46A 4XDHA 1ORRA 5A3RA 3WTCA 4NOKA 1V1MB 4KPUA 2HMSA 4HN2A 2DAPA 3K09A 4IIHA 3STUA 1L7PA 2G80A 2KB0A 4HL6A 4D9HA 3DWFA 2AC4A 3QKRB 2P35A 1B16A 3GAZA 3PQ8A 3FOEC 1CIJA 2IYNA 1U1IA 2LKDA 3HO8A 1NV9A 1TYEB 4Y9SA 4I5GA 5TQ2A 3RIXA 5KNDH 3NVKI 1HTWA 2BT4A 5E6RB 3HZZA 2IHNA 3DZKA 2IU4A 2ZUBA 3HCAA 2YJTD 4DSZA 2FPSA 3C3KA 1FMTA 2JKZA 1YKSA 3H42B 4FUTA 2PZJA 2YY5A 3N0VA 4OQNA 1EWYA 1UANA 3CPHA 1PX2A 3NT2A 2A0WA 2W6QA 3GZTB 2EFYA 1RAIA 4HVTA 4PRKA 4PC2A 2B8JA 3H83A 1KGSA 3RK4A 5IASA 4IGFA 3HDQA 4R83A 3LO5A 5GJBA 1U1GA 5ABPA 4FK8A 4LZJA 1YC5A 5EQFA 5FA6A 4G1CA 2Q29A 1JEEA 3IUNA 4TTJA 2OOSA 2CDRA 1B6TA 1K4MA 4MKRA 1KK3A 3AHFA 1DAHA 1E5XA 2EL9A 3K1ZA 1AQYA 4INOA 4GBJA 1QTIA 4KWEA 1V5IA 3IULA 3V8EA 1AY0A 1CZLA 3E84A 4Y2HA 3IQEA 1YS4A 2GESA 4MV7A 5KSWB 1C1DB 3I5MA 2JLUA 2ETVA 4NARA 2C9BA 1C9DB 2OBFA 3S1AA 5ENZA 5JVDB 1X7GA 3EXHC 2W37A 5TQVA 5H9VA 1WVMA 3O1JC 4S2EA 3R4VA 1LD3A 3GI1A 4KYUA 4HFMA 5D7BA 4CKYA 1M54A 1FUEA 1G5IA 3H4TA 3UW1A 3HEBA 2PSHA 1M75A 1TADA 2QZ4A 4NMLA 2HSGA 3BIJA 2PBZA 4DY6A 3MGGA 3PNBA 5IDWA 3ZX5A 1VQ1A 2A9OA 5EIXA 3FYTA 4PX5A 4UMDA 4Z2YA 5GM1A 1KEVA 1YDEA 3JTMA 5FL7D 5LZ2A 2O19A 2AR0A 4TROA 2IYSA 3F71A 4MVYA 1NU6A 4UOZA 1LSOA 3LRPA 3STXA 1XPUA 1MIHA 2XMSA 1QHFA 2BVNA 3KXDA 2JRLA 4RD2A 4YP1A 2WYVA 2PRJA 4LYGA 3RVMA 3LPAA 4NZPA 3I6YA 5EVCA 3REFA 4ER6A 5KPDA 3I37X 2PQMA 1ZKDA 3DW3X 4IJQA 1DXQA 1OXTA 2PV0A 2P3OA 4AZTA 3FHOA 1N9GB 1E6UA 1Z6AA 1P7ZA 3AL2A 4GRIA 4IIJA 1OILA 4RE6A 4ND3A 4L9SA 3CRZA 5HIAA 3MXTA 4Q3CA 3ZEAA 2NIPA 3B53X 3VU8A 3PQ2A 3G02A 3EDMA 1N2CB 4AULA 5LNK1 3EBLA 2JD2A 3QLVA 4JT9A 1H1DA 3H11A 3OIYA 2QM8A 5GZ1A 1AT1A 1GHTA 3PPWA 4NHEA 4GOOD 1P7CA 2GS9A 3NEJA 3SKXA 1BG6A 3CVXA 4W5TA 4JBLA 4IH4A 4F9EA 5BMOA 3A1FA 2JCBA 1NXWA 1QTRA 3GC6A 3NOXA 1PGJA 3AF1A 3Q6MA 1EGMB 5IAGA 3ESZA 4HWTA 1M2VA 1HDZA 4CRWB 2FW9A 1DAMA 1AM4D 2H9IA 4RM2A 1LV7A 4UUPA 3NM4A 4HXGA 4XKJA 1DBWA 2OT3B 2PRYA 4QDJA 2W8BB 2ZAOA 4G01B 4YHHB 1GCIA 5T8KC 4DMHA 4JB0A 4XDGA 4TMTA 3WGUA 5CBPA 3HB4X 2P9TA 5TX7A 2I2CA 4QGBA 1E7WA 5IN4A 3OJEA 1SUDA 1CY7A 4HYYA 1CTQA 4IG9A 1NX9A 2I1WA 3BORA 1MIOB 4DV6B 1PK8A 4HLUA 4EENA 3DC7A 3NAZA 3I6ZA 4GMGA 2ILTA 3QBEA 1ACMA 3VAAA 5CFRA 4LI0A 1N6LA 1Z6YA 3B5IA 4FW8A 4H6XA 3NFRA 3JQGB 3INTA 2DE0X 5EWJA 4I1SA 3SIPA 5I9SA 3P0JA 3SR4A 4HXYA 4BO7A 1ZS9A 2Q6OA 2FEOA 3WXBA 1ZPDA 4LYAA 1U2ZA 4C4YA 4ID3A 2FDCA 1GN8A 3WFJA 3E15A 4HZIA 2DY0A 3ZDBA 1KC3A 3PX2A 4RTKA 5IDQA 3K96A 3LX5A 4AK9A 3F8SA 3HB0A 4BFYA 4MUJA 4U6QA 5EHZA 4YB8A 2EFEB 3LKZA 4UREA 4PC6A 1SCAA 1EIWA 2GXUA 2IZ7A 2VYQA 1GZDA 2VJYA 2QVLA 2W98A 3EXFB 4GZ3A 4RENA 3UGQA 1OX4A 2QLMA 3FTFA 2YVKA 3JARA 1XD9A 1YGYA 4YV1A 5G53C 1AK9A 1E2LA 1HYQA 4ZAZA 6PFKA 4NKRA 4RF2A 4CIDA 4BE9A 3RFCA 3X1YA 2VKTA 2VSOA 4BJ6A 5F23A 1KH1A 3BHMA 1NATA 1T6ZA 3QKWA 3C8UA 4KPFC 3TNYA 5CYOA 3W2IA 4GC5A 2BELA 3CG4A 5EHIA 5EIWA 4E7PA 1TXGA 1N2BA 4UDNA 2Z8YA 3M3HA 3DV9A 5J59A 3VUFA 3MHPA 1U99A 5BSMA 4D4LA 1N1GA 2JFVA 1M8FA 2ZT5A 1PCXA 3Q3CA 5ALOA 2NUTB 1IBKB 5AM0A 2DJ5A 4ZV4A 2JGNA 2YWFA 4AY3A 4E46A 1DDIA 4KLAA 1E2FA 4LRXA 3GP5A 2J0UB 2GHIA 3FDXA 4U00A 4QDKA 4PG5A 4YQZA 4AZ0A 2GASA 3TRIA 4X9XA 1J2YA 3VPGA 5IH7A 3TRDA 1DBIA 1WOYA 4QEZA 3C74A 1RPTA 3GUYA 3RSLA 4ALNA 5I9IA 1LH0A 1RFGE 3BHJA 1N0VC 3C6BA 4OJYA 4TKUB 3KNZA 3NONA 3KD3A 1GPKA 1O94D 1T4GA 1MU0A 2IZOA 2W6MA 3EZ7A 3QU5A 3KO8A 4OJKA 4PLHA 3KJNA 4BJ1A 1LJLA 2WF9A 4LMPA 4JJGA 1C4XA 2HOQA 2JFPA 3UJDA 5KDDA 2DLDA 2C07A 2VPTA 2ZBEA 1O96A 3BB4A 2QN9A 1DSSG 3C14C 3F5MA 5E7MA 2JIBA 3R9IA 2UYGA 3X2EA 4E12A 4IW3B 4ZK2A 4AJ4A 3S81A 5AJYA 4YFYA 2P6MA 4NFHA 2W11A 4OREX 4AVYA 4FDTA 4CMHA 3QYJA 3ZD8A 4RK7A 1A8QA 3STYA 4HAYA 3IQXA 1NBME 5HW0A 1AKNA 3IP7A 4C4ZA 1OXUA 5TDHA 1F8YA 3C7KA 4QUHA 4UBKA 1VHQA 1PQYA 1P4RA 3DTTA 4WKCA 1AKTA 3T7DA 3VU3A 4AJNA 1ORTA 2GBCA 1DAOA 2VPYA 4LXHA 1A97A 1Y82A 4GXQA 3KVRA 1IN4A 3J81k 5KNBA 3KP1A 1JI0A 1KZ6A 1Z2NX 4U8HA 1X8XA 1LDYA 3EARA 3Q1LA 5MFZA 1XUOA 4K9KA 4R1QA 2BUAA 3I01A 3BBLA 3IVXA 5A3VA 3QEJA 4XGIA 1I7QB 4JLBA 1AKQA 3HUEA 4DABA 1ZI6A 2J45A 1NVDA 1BXZA 3KPYA 4J90A 3ZN2A 3TIVA 1F8XA 2C96A 2VHWA 2J30A 1VPTA 1V9LA 2H7YA 3VKVA 4G0ZA 2XWQA 4CIVA 1L9XA 3R9XB 4AJEA 3D2AA 3QVSA 5JXWA 1JA0A 3ZU3A 5GIOE 5LQUA 2VHCA 3S1AB 3TQTA 2YZMA 5AM2A 3JQQA 1LPBB 1TEZA 2FXVA 4MRRA 5D01A 5D85A 1J00A 1BQEA 4QXMA 4CODB 1TT7A 2ZRKA 4B6SA 2QF7A 3VYWA 3U31A 5D84A 5BXQC 4ZT5A 2OCKA 1CDOA 1BHJA 3ORRA 2JL1A 1X3LA 2JCSA 4DTIA 2GEUA 4EUFA 1QO0D 2JLZA 5K8UA 3FSGA 1TLFA 3HXLA 3P9QA 5C5CA 5G0WA 3FCCA 1JR3E 2HO5A 4RCVA 1I5EA 4WXRA 3RE1A 2ID8A 2WTXA 3NORA 1I1NA 4HAIA 2OKCA 3LDGA 2PMFA 3I09A 4IVNA 3RQSA 3TVTA 1PVDA 4II7A 1ESZA 3SE0A 1J0CA 2J6BA 3I9JA 4I1YA 3SSAA 1CEYA 3IAS6 3AR6A 1NA5A 1XTKA 3BZUA 2BGGA 3O4VA 4TLDA 4O33A 4OKNA 2G09A 3TZCA 5FHRA 4H4DA 1N6NA 4FYYA 4IIJB 2BONA 4FFOA 4PO8A 1I1OA 3Q6IA 1HYBA 2FX3A 3JPWA 4W5JA 1SEVA 4XGNA 5DNVA 3R41A 1XE3A 2K7FA 1UMBA 2LPMA 1SIUA 2FX5A 5HTKA 3TSAA 1L5FA 4PVCA 4N6NA 1YONA 2A1UA 3IUYA 3ENKA 5C8YF 1I2BA 2FQQA 3ACDA 4R54A 2OILA 2VBFA 3GFFA 5CNIA 4UOEA 3IDOA 1ISSA 5FR1A 2GD1O 1YZQA 3BWVA 3UIEA 3VAZA 3PGVA 1IG3A 3S8YA 3KPVA 2BZSA 3AXSA 1XK6A 4EVRA 3O0TA 5FAKA 4ISBA 2WE7A 5E8JA 2ZR0A 5ALSA 2GMWA 4BATA 1II8B 3PQ7A 3V4ZA 2XQJA 4BTLA 1Q44A 3CMCO 1U94A 2Q2NA 3LLCA 3RJMA 1KDYA 3VU0A 5I45A 3PUXA 3SFVA 2D1RA 5ICCA 4B6PA 1OMOA 4HN4B 5CCXA 3CR7A 1E1NA 1NZFA 2JIMA 4KIWA 3QSYA 3FHJA 4EMSA 1VLMA 1OIVA 1JA9A 2GA9A 1AGPA 1IHPA 2XV1A 3BGVA 4C21A 3PA6A 1GTJ1 3EQ2A 1GFSA 4LWOA 3TG8A 4PLTA 3KPJA 3K2BA 1ZHHA 4XJXA 1QHGA 2QROA 4CTMA 1S1CA 2C9ZA 4GOXA 1ZIXA 2JCYA 2JK0A 3DBHA 2JC3A 4EVIA 3OURA 4P3OA 2O2YA 3MMPA 2EAUA 1JR4A 2RHHA 3QVGB 1C0KA 4CQMD 3CFYA 3SFZA 5FEUA 4LHZA 1UWKA 2PLFA 3G9UA 3GJSA 3OE5A 4NBVA 1OXKB 3IQWA 3R24A 2O8VA 4URUR 4FOLA 1TK3A 2NU7A 1FRVA 1WCV1 2NXJA 3EAFA 4HZUB 1Z0FA 4R2XA 4YPFA 1JRLA 3OP1A 4B76A 4C0XA 1OX4B 1UZAA 2FUEA 1EM6A 2ISQA 3T5PA 2WDPA 3I39X 4HF7A 2Q1UA 2FMHA 2XBUA 3L0IB 4JKIA 4TTAA 2PYZA 4OHFA 4MIYA 4M2LA 4Y2PA 4EELA 1EFUA 3KJQA 1CDEA 1JFLA 4MINA 3DB2A 1OT5A 4OA5A 2O59A 3IH5A 5ALHA 1F1BA 1THZA 2YINC 4ENUA 3SS7X 3O3NB 3STTA 3JTEA 3ANMA 4FCVA 1A69A 1MCZA 5DHFA 3GBPA 5DHQA 2ZWVA 3WGLA 4FQ8A 4C7BA 1F12A 3CZCA 4DDHA 2VPPA 2WJIA 3OFSA 4AZ0B 5ALGA 3T3PB 3PQCA 4B79A 5DISB 4DRZA 4RXTA 4XLLA 4V1CA 2OGSA 2GUWA 5LYJB 2PYDA 2JIPA 4J3NA 2C4UA 2XMPA 2ZRBA 4BBJA 2W6NA 4MYHA 1UMDB 3A2KA 4OGWA 4UBMA 1FXSA 2HJSA 3HA5A 3QG1A 3AFNA 4M55A 1GA6A 1XLTA 2XJ4A 2YVUA 4TTIA 4UHJA 2SECE 1ZW6A 1A7AA 1O0CA 4RIEA 2PWZA 4Y8VA 3FNEA 4NENB 3IJRA 1BGWA 4Z0TA 3LX8A 2ZUFA 5EZYA 1Y89A 3DTVD 2QR2A 1H1LB 3GT7A 2WAYA 3HZOA 4XUCA 3AM4A 3KQHA 3V1YA 4LNHA 3LA8A 5EIBC 4FJ2A 1OGYA 4J03A 4YXWD 2O06A 4BNDA 5DI3A 4FTWA 1PR9A 3V80A 3SM3A 2IYWA 3IAHA 3I1YA 3PSHA 4R5MA 1GU1A 1JJIA 4RK5A 5A62A 2AKEA 3BHNA 3OHMA 1HQCA 1YUMA 3SXJA 4DCPA 1GA1A 1TEVA 2ACWA 4UBLA 3DHWC 1RRKA 3ACBA 3A11A 3AP3A 5K9ZA 1C2TA 1R1DA 4L4ZA 1O9BA 4B3BA 4OH1A 1MC5A 5FNVA 1CUYA 4PLVA 4EA7A 3U5TA 1E5DA 2GDJA 1TMKA 3X2SA 1MQAA 2P79A 2ZJ7A 1FP7A 1D6JA 3EUFA 4FMCF 4JUFA 4RXMA 1THMA 4B3HA 5BYAA 5ADWA 2R5NA 5KQRA 3OLCX 2VNIA 2RH4A 1MAHA 3VPHA 3Q5GA 3MJRA 3ZXSA 3TF5A 2Q8PA 1BRTA 3AUYA 1RM4A 3MRVA 4R2LA 3LGXA 2G17A 1E5LA 4F3CA 3OT5A 1V41E 5DT9A 5I7RA 2ZUTA 3TOZA 1UAAA 4ZALA 1J8DA 1AU9A 1ZM7A 4UTVA 2LNDA 1WNFA 4WT7A 2CDCA 2O7NA 2VAPA 2W83A 3MMSA 1DKMA 1YS1X 1QHSA 3KQQA 5FUYA 1LPNA 3U0VA 1SG9A 4B44A 3B3JA 4BNXA 1WNTA 3F3MA 4DCOA 3K0EA 3CZQA 2G25A 1L5HA 1NNSA 3U7JA 4ZVQA 3QU4A 1JECA 3R09A 5K1ZA 3FVTA 5A4JA 3OZFA 1GADO 1SN7A 1UF9A 3GJYA 3LHIA 4L50A 2D7JA 1MF7A 5KOHA 3S44A 4RWEA 2Z3WA 4D3YA 3I2KA 4F2DA 5JYBA 5LR6A 4W5WA 4XARA 3IPRA 3L8EA 4N0MA 2BISA 3H8SA 2GF2A 4HUJA 2R7NA 3F5QA 2Z0MA 3URMA 3WDLA 4AKEA 4LI3X 5JSZB 3SG0A 4R05A 5DXFA 2BDTA 1SXJA 3FTQA 1GD1O 4WD3A 5FD8A 3KLBA 4I5IA 5FOWA 1FQWA 1JDJA 1G64A 3IHKA 3L7YA 1G21B 1RQ2A 1RWKA 3CJQA 4A1OA 4B32A 2IPAB 3KC2A 4ISCA 2DEUA 5CVCA 2BFDA 2JB9A 3PGXA 3OIVA 4MWGA 3AVVA 2ZJOA 3I42A 4IFTA 2GEDA 4XPZA 5A3QA 4O2RA 4BKUA 1W87A 4G89A 4MWOA 3H4VA 1G66A 2H5JA 3PF9A 3HNPA 3DVLA 1VHWA 5J4HA 1MAWA 1U28A 5J23A 3AO0B 4MVJA 4GZMA 4V0KA 4C7OA 3NVDA 2WNSA 1ZAKA 3NHKA 3O8BA 4CKCB 1BHQ1 2A59A 2GZMA 3GEBA 3PRJA 4G81A 1KMIY 5LKRA 3L01A 5ENDA 2Q6KA 4OXNA 1YI0A 4S24A 4HTFB 4CT4B 1XTZA 1K7YA 2Z8YM 5EXSA 1AXGA 1ZD4A 1EWKA 2HMWA 4BMPB 4CF6A 5KNDA 4LF5B 1HX7A 1JIIA 4L7VA 1P1HA 1JHZA 3MAGA 5HE9A 5JO0A 4KO3S 4F1JA 4Q1BA 4DC9A 4N7JA 1XNJA 2WIBA 4RHCA 2Q4RA 2CJXA 5HA5A 1KQPA 3G89A 2JAWA 5MHTA 4UAJA 3M5WA 5AQEA 2CVHA 1EG2A 1NWHA 4MR9A 1IJEA 2ANBA 2VQ3A 4PG6A 4QYIB 5BVGB 1OLUB 1YMVA 4ZRNA 2X77A 4P9NA 4BIIA 5FUXA 2IXDA 4F85A 5EE1A 1J97A 2QB5A 1CIVA 2XRYA 2ZRAA 4MHOA 2GZ3A 4DKJA 4KCGA 2YJ5A 5FO1A 1RWQA 2WLTA 3Q3JB 1A8PA 2PQ6A 5FWXB 2RHBA 1WS6A 4FEAA 2UZ1A 4WZAE 4KITB 5ALPA 3EGWA 1R8XA 3H9EO 1LRJA 2HHJA 3MD0A 5GZ6A 4RIFA 4TQGA 1EJBA 4CLRB 4QD3A 4OL0A 1ZK3A 5FR2A 1GDDA 1P9NA 2W58A 2PU7A 3OQ6A 1PLKA 1DFGA 1NHWA 2WYUA 1NX6A 1KKUA 1Y6GA 2HJHA 3BWCA 2AKAB 4JXZA 3K6KA 1LA2A 3RTCA 2HJ9A 2WD8A 3ZWQA 3ZHSA 3N0RA 1XCJA 3A1NA 3CUWA 4XZ3A 4JLOA 3A0UA 3C7CB 1CT9A 3WLLA 2GB4A 5FTKA 1DV2A 1GTG1 1NC3A 1UBGA 3T3IA 5M04A 2GPTA 3HO1A 2IHTA 3HCPA 1KMQA 3WQQA 3NMUF 2V5UA 4UNQA 4R51A 2NZWA 4Y2GA 4C89A 5A1JA 4C3OB 2JBAB 2W2NA 4X1KB 5JNLA 3PL1A 3B70A 2O6HA 4JLWA 4KAFA 1E60A 1T26A 2CMKA 4AN0A 5FOQA 7YASA 5TGZA 2MMCA 4YJHB 4CV1A 4OQZA 4XQCA 1I7NA 4DR7B 5TRTA 2PSEA 4RA9B 3E3LA 1Z7WA 1DC4A 2EW2A 3DV0A 1CK4A 2GKOA 2BHRA 4CNBA 3Q41A 4QXRA 2AQHA 3H9CA 1G8KA 2J7PD 4GLLA 1LW7A 3QPWA 4GLBA 4E3ZA 3Q8MA 1YQEA 2AFHB 3H5TA 1P2VA 2XECA 2QA5A 1BFDA 2EX4A 2OAP1 1U7WA 3CH6A 3JATA 4O08A 2RK4A 5DGXA 1MC1A 1ENOA 4IXDA 5TV2A 2J8ZA 5KTOA 4IVRA 2IFTA 3VR3A 1Y8RA 4GQAA 1RRMA 3ZS8A 5DH9A 2Z4RA 4YDHB 1U6IA 3D43A 4FYPA 3HZHA 1DAFA 1QVRA 1PBNA 4HRVA 3HR4A 1SWWA 5F3RA 1HT0A 3K6RA 2AOXA 3D02A 4BIMA 4D9IA 3HVHA 4ETMA 3HACA 3G79A 1GN9A 5K6RA 1MJGA 1WETA 4GSLA 3R0QA 1D2MA 1X7ZA 2BGUA 4CU2A 3MTIA 5COQA 3UV6A 1E9RA 1SHJA 4KJZA 4CKZA 2GN1A 4MS4A 1OXMA 4DXAA 4YA6A 5CVJA 3GUVA 5DI3B 3I6IA 5I8ZA 3TDMA 4EYKA 2VFAA 2WWXA 1RLOA 2AVDA 3A4IA 4KQFA 5AOVA 4EGFA 5KHOC 2VP2A 4IZHA 1RZRA 3ZH9B 4J9VA 3KM0A 1LPOA 2A3NA 2OFFA 1MAUA 3CEMA 1T15A 2VUSA 4A27A 3NHFA 4BBAA 1C1XA 3LBNA 2AMLA 1PFGA 4RULA 2C8KA 2PZMA 1L3BA 4U2BA 2IZ6A 2VLIA 4IV8A 2QS9A 2ZTHA 3O26A 3STWA 4TUYF 1TF7A 1H6BA 4DA4A 5TF0A 3K0CA 2K2WA 1JKFA 1DAPA 1M2HA 3I1JA 1UC8A 2AUNA 4G0XA 4O1HA 4DQUA 3TKAA 4TMXA 4QGFA 1M10A 2OECA 1NAHA 3B13B 5G40A 1D4FA 4QEKA 4J8PA 5L9AA 2I2FA 2I2XB 4KE7A 3EIOA 4IFEA 1M5TA 4CETA 4FONA 3L0BA 2G4LA 2WU3A 2XMCA 1FFSA 1SULA 1U81A 2PFSA 1HI9A 4X3PA 1E2JA 4CMGA 2WR8A 2QAJA 2AB0A 2R48A 3RSZA 4E2ZA 4ZCMA 1DO0A 1QK3A 4FCCA 4NZOA 1DC5A 2E4XA 3SSMA 1YDFA 1O57A 1XVLA 2X23A 4ZTUB 2Y71A 4UTXA 3KS9A 1O97D 1DQYA 3CN9A 3E48A 2ONYA 4GLFA 4JI0B 1UBFA 1JSZA 2VHUA 3W2FA 1W96A 1EFDN 4HBGA 4K9DA 1IUPA 3NHLA 2ZJYA 4FYWA 4Y9DA 3PTZA 1FU4A 1SCIA 5BUZA 2IIQA 2O7QA 5DU2A 1RFLA 2G08A 3LAWA 1YL6A 4NSNA 4Q82A 3L9XA 5LA6B 3IVMA 3QHAA 4JP1A 1SXJB 1GYRA 1VYUA 1S5PA 1UBTS 3B89A 3M82A 1RPNA 1M1ZA 2DKFA 1V1JA 3UMCA 3VMFA 4G0NA 1BKYA 2VVTA 4HX5A 5EWLA 1N8NA 5LCXA 4I8IA 1DLIA 2ENUA 1YRWA 4P93A 3T4EA 1MA3A 5L53A 5DK4A 5E38A 1WHSB 1BE0A 4RZXA 2YDXA 4C4XA 1EFRA 3H5AA 1C8LA 4L9AA 1Z5UA 4O0MA 5KYWA 5FYQA 4NONA 3BGWA 3EQ8A 4JOCA 1TZJA 1H2FA 4C03A 3NGXA 1UQTA 4TPKA 1SMKA 2I7CA 1E9AA 5LJLA 1PWZA 1EWVA 5ALFA 3TEJA 3TJZA 2H1OA 3OTWA 4C7OB 3O31A 3HYTA 3CUTA 4AO8A 2CK3D 3DPUA 3WLIA 4PF1A 3SHVA 2QZ9A 4MVJG 4XB6B 5DHSA 2PUGA 4V0RA 4IVQA 2AE2A 5AW2A 2QKYA 2F6RA 2ZUCA 4GS5A 4EYEA 1YH3A 2BI7A 2WSSD 4U7JA 1XTRA 1QK4A 2BBTA 1CUIA 5JUWA 4BRWA 3FPLA 4ZRMA 2PL1A 4NZNA 4LBWA 4I2NA 6CHYA 1ZI9A 3TB6A 5KOJB 5WRFA 1TQ4A 2WUGA 3LC1O 4MR9B 3K32A 4F8JA 5LU9A 4DARA 4KB5A 2HXSA 5FJIA 3U60B 1Q1QA 1X8JA 3U3OA 4FFDA 4F7DA 3UA3A 3VKHA 4BUJA 2QTCA 3WWZA 5HTOA 3KXIA 4D3ZA 1ZD5A 1SHZA 5CVEA 4Z4EA 1JAIA 1LDNA 3PWZA 1YZTA 2EF0A 1KBZA 4DPKA 5AW5A 2UZ1B 1M1YA 3BIOA 1SBNE 3RRZA 2XCTB 5B30A 4XM1A 4QXPA 5H8WA 1P0CA 3EXEB 2P9FA 2VAMA 3MGAA 1EX9A 2C5FA 1KMNA 3IVGA 3VX3A 2HWXA 4DREA 5IFLA 3Q88A 1MTOA 4QU9A 1Y3FE 2I9PA 3NAQA 1N2GA 2AL7A 2C7QA 4B6RA 4IMPA 5H80A 4CCAA 1YBAA 3CX4A 4D42A 3MWEA 4DLPA 3RJ5A 3O9MA 1B0UA 3QKSA 4FKZA 4GFDA 3FOFC 5DHUA 2YVAA 3R7SA 3WRWA 1KI8A 3GN1A 4XPIA 3ZVKA 1P17A 4G1MB 3V4OA 2Q4DA 4JLSA 3RFXA 4AUNA 4ILKA 5MFPA 5I4BA 5FT9A 1C0EA 1Z0IA 4A92A 4MRSA 4E1BA 3CNQS 1JAYA 2QTVA 1TGVA 3E53A 3M1IA 3N9IA 4GGPA 1L5RA 3S3TA 3HFSA 4NESA 3TJMA 3GD7A 1LGYA 3L82B 4Y2QA 1K0FA 5IUJC 3NT4A 1T0HB 3U16A 1A3CA 2HX1A 2OZLA 3FYUB 1Y7TA 4N5DA 4C30A 1XQVA 4JL6A 1QUEA 3T61A 1HYHA 1WW2A 3V8MA 3TZQA 5F5XA 4CMEA 4M89A 2Q45A 4F4UA 3JYOA 3AOEA 3A9UA 2LIPA 4EMBA 3IILA 2C95A 4HYTA 5TQ0B 3QY9A 3NP7A 2Z83A 3NDIA 3TW0A 2QX8A 3DV0B 4G9BA 3BL8A 5H1YA 3UT0A 3VHXB 4CV2A 1Y8ZA 1E0KA 2BBSA 2XQKA 4NS1A 3ZR4B 1Q0UA 2CE7A 4BFTA 2Q3MA 4YWJA 4PVDA 1I3KA 1QANA 1P4SA 2C9OA 3WIEA 5C1BA 1HDOA 3JATB 5EHNA 2CB0A 3RODA 3GEPA 2IZ1A 4BGUA 1BZYA 2VDQB 2Q1WA 3UWSA 4NXMB 1AA9A 4M86A 4ROTA 3TH5A 1A2QA 4JXJA 2XVZA 1X9HA 2IWHA 1Y8RB 4KG7A 3G0CA 1L4NA 3WMEA 1KERA 2I4NA 4XWKA 4HGZA 3L6RA 1CZRA 1W0KA 2FB9A 1NQ5A 4ZT4A 2ANCA 5BQ3A 1F38A 1PJZA 1KSGA 1YQDA 4XUDA 1FX0A 5KNLA 1DOZA 5C8ZA 1DPGA 1MQSA 2V5AA 2OGUA 2V7QD 2ZUSA 3LHKA 4UU1A 4B7UA 3HP1A 2IYQA 3RARA 1JIQA 1RQRA 2YHBA 5LQMA 4R9VA 4A0FA 3OQNA 4L3VA 5FTMA 4IIJF 3O4GA 4MS4B 1ZUWA 3HVJA 4P38A 2YNMA 3RS0A 1C9MA 4RPGA 4EGJA 1JQ3A 2MTBA 3X1KA 1H0HA 2AHRA 4JEUA 4ZOLA 4EFLA 5ALTA 1CZNA 3HLTA 3LZCA 3NFYA 3AUXA 4FYJA 5FWYB 1SU8A 1VIYA 3IV6A 4R69A 2OZEA 3O73A 3WB1A 1DC6A 4OHKA 3CJRA 3LRXA 1C1XB 1JQLB 2IUUA 1ZO8A 2BH2A 5K3EA 4KBYA 1MTZA 1I8TA 4F6CA 2QAGC 1ZJ4A 4L6IA 3SLRA 2B5WA 2NQTA 1J8FA 2R87A 5AXDA 3O74A 4IZIA 4YAUA 4R1NA 1UK7A 2O8EA 2QMQA 2O8BB 1ZIOA 2GNPA 2V58A 2ZE6A 3OE7D 1ZIDA 4XOIA 5K20A 4IMRA 3JY6A 5AKYA 4J6FA 3D8SA 3KKNA 5DM2A 5LZ7A 3V4VB 3ZLBA 2QEQA 1CNMA 5K8TA 3M2TA 4DJFC 1EINA 1RLJA 2XUFA 4FSHA 2EDCA 3UZUA 3ABQB 1J9GA 1N6HA 3IAFA 5LBIA 3D6NB 1CETA 4KIUA 3GFPA 4UHHA 4N41A 3I62A 2CLHB 3CNBA 4JUDX 4XD7A 3OQMA 1Y7IA 2V6JA 3DR3A 3U1VA 1C3LA 5HOQA 5T4FA 4GKVA 4E5PA 3MB5A 3AG6A 1UWVA 5L3SA 4O4LA 1SQSA 2C97A 1QJCA 3I2FA 4LOIA 4QNNA 1ZZEA 4BPBA 1VJDA 1IZZA 4QXAA 6NULA 1H9BA 3MGBA 1FDTA 2A5LA 3G8BA 1GNLA 2FFHA 2D4HA 2HV9A 1YMQA 2X6RA 3NLLA 1VI6A 1A9TA 1QOZA 1YZUA 3D9QX 4PIPA 5FORA 4D9EA 3CF2A 3TBFA 1NW8A 2GN9A 1U0JA 4AZSA 3LMKA 1R6AA 2GFQA 1JHOA 2A9QA 2W7TA 3ELBA 3GCXA 3H5RA 3PEVA 2H07A 3VNBA 3BAZA 4CCYA 1DJMA 5EJ7A 2NQ2C 2HF7A 3L84A 3IUJA 2EBWA 1EGAA 3EIXA 3TXXA 2PWYA 1PEKE 2VDOB 2VZEA 1M6WA 2PCLA 2Y6VA 3H6KA 3JR3A 4HN9A 3VPXA 4Z4IA 2WKQA 4QX6A 4KXWA 2CUNA 4RF4A 3NW9A 3SYKA 5KYWB 1KR2A 4RZHA 4FP9A 4H1VA 4HXEB 4UEWA 4WWHA 4Q4HB 3WYAA 2HSDA 2WWHA 3DZDA 1UT8A 4KAAA 3VXKA 3EZYA 3LLMA 1UXJA 3MSCA 3R3YA 2LDXA 3LT5A 2P77A 2Q07A 3IO5A 4C14A 3HSKA 5HEKA 3CEJA 1PP4A 5AW9A 5H4HA 3I0MA 4C4OA 2X8LA 4G36A 5EFZA 1Z82A 4GYWA 2G9ZA 5FUVA 5A71A 3G5LA 2XCSB 1XAGA 4H4CA 5JS2A 5KSPA 4UAUA 2KJQA 3R4CA 5KWEA 3KTFA 1Y4AE 4DUGA 4BO1A 1JKMA 3ZQKA 2K5UA 4XX0B 5F3WB 4EHDA 4WGGA 1XHFA 3HYCA 3ADKA 5CVUA 5IVDA 4CMIA 3AVTA 3TWOA 3H5IA 5IBRA 3L8YA 3WK8A 4JSRA 4XFDA 5C7YA 1JILA 3FMPB 4LV8B 3LVRE 3LYHA 1CUGA 1U0LA 2HNAA 2N3ZA 3WTBA 4CGYA 4EWLA 1DBVO 3I73A 3F7OA 4OGFA 4ZHQF 2AFIA 1U3UA 3NASA 3FLAA 1YZGA 4OYLA 2XADA 1E3MA 3A4VA 2I6QA 2H2IA 3D6JA 4DM7A 3GA0A 2FEWB 2G71A 4DWJA 5C80A 4I1UA 3HCRA 3RSOA 3ECSA 4ZYXA 1GZSA 5I5EA 2YICA 3A1TA 4F3RA 3W2TA 1I2MA 3KTAA 4Y67A 3EMBA 4V02A 3AU9A 3CZMA 1VSBA 1ZCZA 2V7UA 1ACLA 5DF1A 1YZKA 3KQWA 1UAGA 5FF9A 4QVKA 3T95A 3ZNPA 2VJOA 4ARAA 3ET4A 3PA8A 3BGOS 3NHAA 2WSYB 5A3JA 1B93A 2J09A 4LVUA 1Z8HA 2UVPA 4MV4A 3S2SA 2P11A 4XPIB 3O8CA 1QK5A 4PBTA 3K70B 3ZOKA 1NJGA 2FW8A 1II9A 4I1OA 1XMPA 2HMUA 2Q1TA 1UM9B 4DJTA 5KWJA 1IWPB 3EG9A 3NOOA 1E8MA 5KNBD 4O3MA 1YU9A 2PZGA 4RLSA 3OEYA 1JAXA 2ORIA 4OLBA 5HZGA 2R6FA 3BE5A 3IESA 4W1QA 3JALA 1FFHA 1W4ZA 3H5OA 3HEMA 3JQPA 5CRIA 1Y6JA 3MXOA 4G0OA 3GFQA 2H5EA 4B2YA 3PWTA 1FUUA 3BD8A 4ZI7A 2ZIUB 1NP3A 3F6EX 4N0PA 2I3AA 3H65A 4F4CA 3OO1A 4O29A 1JG1A 1ESCA 4GZ5A 3CUYA 4YUXA 1OLSA 4G9EA 3PFIA 1BMFD 2GJ4A 3CH7A 4D0NA 2FR8C 4DA6A 3RV4A 3GF4A 5AKIA 2NU9B 1MBZA 3B78A 5NLLA 2F9FA 4QARA 4LXQA 1BQ4A 1BWPA 3BSWA 4Y2SA 1QGZA 1RE0A 1WUJS 4IS2A 2BZ1A 2PA3A 2XMDA 5IRCD 4OMCA 3W1VA 1G0NA 2BFFA 3O90A 2ZLBA 2IHZA 1I80A 1ISIA 4M49A 5AVQA 4S2UA 3AERA 3NRCA 2IV7A 3V5NA 5SYAA 1T36A 2OENG 3UAYA 1G5QA 1XMXA 3ZDRA 5D87A 4IBOA 3RC3A 5B57C 1PL0A 1XZFA 3JWIA 1K6JA 1VB3A 1RKUA 3FFWA 4OMDA 3BK2A 4GKAA 1UOQA 2GSDA 2RHMA 2FZVA 2GXQA 2JW5A 4HPJB 2GBLA 5KDOA 3ESYA 3F74A 1M0SA 3EPKA 3AJEA 4BO9A 2FDXA 2HF8A 4LQDA 3BL5A 1KVUA 2AEMA 3VMMA 4R41A 4ZOLB 4ITRC 2ZYWX 5KREA 5EP1A 3KAKA 3KQKA 1Y33E 4IGAA 3DOOA 4BFUA 1TJYA 3DO6A 4NK4A 2W70A 1P7PA 3GQBA 3MBKA 2NUBA 1TTTA 5FI5A 2VP9A 1BXKA 5REQA 2CMGA 1CUEA 3FFXA 1K27A 2V6GA 4ZDIA 1X39A 1YOVA 2QE7A 4MWCA 4UTRA 3E9YA 1TKBA 3K4PA 2OPBA 3E7DA 1ZISA 2GBGA 4U2EA 4R1UA 2G9QA 1SWVA 1UAYA 1SXHA 4JBWA 4EUSA 3L4BC 5CDGA 1YBFA 1JMKC 3BGIA 1IDOA 5FPSA 4LK3A 3WLPA 4YDQA 4ZAFA 3OX3A 4RU1A 2OHVA 1Z63A 2PANA 5DLPA 4Q3OA 1K1EA 1LWNA 4E4RA 2CKMA 5FLYA 4YCCA 5IANA 4QO8A 3CKMA 4N5MA 2LUOA 4EKNB 2QTWB 1RYEA 1XLVA 4MUXA 3G5TA 2QTTA 3IR6A 4U8GA 5GQSA 5TJ9A 3ZU5A 1UWCA 5HUHA 2I6SA 1R6TA 1ZRNA 3LF2A 4A5OA 4YMVA 5AW6A 1WUKS 3LKVA 3D5TA 3K6SB 3R3HA 3LRTA 4Q3LA 3PHGA 2ZIFA 4M1TA 4ZOEA 1T5SA 3GRPA 1QRTA 3HKEB 3AP2A 1E3IA 1KE2A 2PWBA 1Y4DE 2A92A 1Q6YA 3BGSA 1U2TA 2XUAA 2J9FA 1I2DA 1DJLA 1RPJA 1VM6A 3HJCA 2D0PB 2OB1A 3OEHA 4QYSA 4RE5A 3CMMA 1IN7A 3NDRA 5CB4B 4G3XA 1F4PA 2NNLD 4WNAA 3WIVA 4IIGA 4K0KB 2MDTA 3HJUA 2H3HA 4M7PA 2EL7A 1L7DA 1ZD9A 2XCIA 2ONKA 3GH3A 2H54A 5AJWA 1RS0A 5FB3A 1CJTC 1T4CA 1Z4PX 2JCXA 3KYCB 5CA0A 1E5TA 1VDMA 4HGOA 4CCYB 1OH7A 4JI8B 4D0SA 1W5BA 3SE7A 2G6BA 4KWHA 1H2HA 1WP9A 4D79A 3S6JA 3P9NA 1HGXA 1ODLA 3GY0A 3YASA 4F3YA 3FDFA 2O54A 2OV1A 4IGEA 5FWNA 4XWTA 3OCWA 1N2OA 1PKEA 4Q4CA 5AVOA 2WVJA 2WOJA 1YDWA 3ENNA 1J21A 1VC2A 2P2CA 1QQ6A 3AINA 4HRYA 4QHTA 4B9AA 1U8CB 5K3DA 1RRFA 2WAXA 3EH2A 4MQ6A 4H77A 3TIFA 1JIKA 4P84A 4LRYA 1ZESA 1JFFA 5LUAA 3WK7A 4M1ZA 3MTAA 4N54A 4ZQCB 3UH0A 5CLFA 5JAIA 4BQIA 2Z04A 4Y2UA 1KI3A 4BHTA 1XD8A 3S70A 1TVEA 4ZGBA 4C07A 3UMSA 5I7OA 4MWSA 4QPZA 3GA7A 2ZS8A 1P4AA 4KUHA 3W7VA 3K8ZA 3GJ7A 3RVSA 2XA9A 4BMCA 2NYRA 2JGRA 3DM5A 5SY4A 3ZE2B 1ZMRA 3A3YA 3IKVA 3A6FA 4RVUA 1I3CA 4Q7JB 1D4AA 4IWXA 4US1R 2O3SA 1ZJJA 4BNVA 3JQBA 4OQXA 1O3YA 1W59A 4C0BA 5IVPA 4CMIB 3L7JA 4RHFA 1VIVA 2ZWMA 3L0YA 3LZDA 3PHCA 4J16C 1EESA 1UJBA 4OGKA 3VH2A 3F3SA 2RAFA 4K46A 1SUSA 1ZG3A 4P54A 1TRHA 1P6XA 3OY2A 3Q98A 1RTKA 4UVEA 5KI6A 4BFSA 4CDGA 1J8QA 1C7RA 4PGHA 1ZD3A 4L16A 5ALMA 2V65A 3QHPA 1G2QA 3F9RA 5EZYF 5BV1A 1XJWA 3VR4H 1RW4A 1C7EA 2IUSA 4XASA 1A5ZA 3Q10A 5DTJA 2IH2A 1M66A 2E2WA 4MR7B 4K86A 2P9CA 3IDSA 4CF5A 2VJAA 3KTAB 3TGPA 4EW3A 2XCRB 4FMDB 3DAGA 4NCJA 2DSTA 1V71A 4ZZ3A 5LD2C 2BWJA 2NXNA 3LT1A 1KBOA 5A6SA 1W5SA 4YP5A 2ZQZA 3UATA 3BD9A 2JH3A 3VVLA 1KRXA 3HKCB 1ND5A 2C2OA 2ZIVB 2L19A 2BKLA 4RD4A 5FNVF 2G82A 4D5EA 3OX1A 1Z5ZA 5THXA 4DZRA 4YRNA 3ZZMA 3NDJA 3GRFA 3BSSA 3TPCA 4S05A 3KXKA 1YE3A 4LY0A 3NV9A 1CV2A 3HDTA 4GOND 4HB4A 3PNVA 4WN3A 1K8YB 5AJZA 1Q91A 2WMYA 3ANSA 4ALKA 4B0OA 2WHXA 5EQTA 1R6VA 1GCAA 5C31A 1DX9A 1EFKA 2A9KA 2NO7A 4RW0A 1MNQA 2W2QA 2Q3CA 2HSJA 2HHAA 2XT0A 2ZRFA 2Q4EA 4NJMA 4JB3A 4YVFA 3JALB 3RIHA 5KS2A 5ALUA 4YR9A 4JIGA 2VHEA 3FPSA 2VYVA 3FNQA 3VOSA 4LYFA 3VPDA 2Q0XA 2BTEA 1MFPA 4PSDA 1PFUA 4LOAA 2FZEA 5JSHA 4I4TA 3E3MA 2R1VB 4F4HA 3FF1A 3H16A 4WFQA 1VG1A 4CTKA 1H4SA 2O3RA 1JG3A 3R7WA 4AX4A 3C43A 1ULHA 4EY6A 3Q3HA 2XXAB 5GOZA 1LBTA 3D0QA 1QGUB 3JQRA 3N59A 2FDRA 4KI7A 1NONA 4MW4A 1KO5A 3G2OA 2XMQA 3G2LA 3LPLA 2H08A 4AIIA 3NCTA 4BQRA 1YZNA 4WKGA 3BT7A 5K3AA 2ODWA 1T9KA 5CNMA 3MJFA 4LS3A 2AJ8A 3AY6A 3VDXA 1C81A 4RJ2A 1BS2A 2QVBA 4FVTA 4DSTA 1YTUA 3HCOA 2JVKA 4YQYA 3SXPA 4ERNA 1NJFA 1TTPB 2J5XA 3DBRB 3U1TA 3BM5A 2D2VA 3AERB 3ITDA 4PO1A 4LJ8A 3EPRA 3E3OA 3PGLA 3RBVA 3KB8A 1B00A 4TV9B 5EE0A 1DQSA 3E9RA 5A5FA 1U0RA 4UMFA 5K8LA 5FI3A 1SXJD 1SXPA 1GGMA 1IXSB 3PD7A 1P5RA 4DLRA 5EJ8A 1QHXA 5K0BA 1CS4C 2SKDA 4CKXA 2WVHA 3C8MA 3S28A 3UJPA 5IFKA 1L5QA 1CE8A 1M2WA 3BERA 2CJFA 4PZPA 1L8QA 2HDHA 3K1YA 3GZ4A 4JT8A 4N3CA 3ZTTA 4YAEA 4GKBA 5EWMA 1UP7A 5JNVA 4MVJF 3DJYA 3DCJA 2XHEA 4Q9DA 4C6HA 1OTXA 2PV7A 1CRQA 5JW6A 1G20A 4RK1A 3T5AA 4RH1A 1IN6A 2NU6B 3GQBB 2J3DA 2PKQO 2P1DA 3OWHA 1T4BA 4M22A 4YMHA 3J80A 2A33A 1JH8A 2ZRPA 3H9QA 4B4VA 1JGTA 1JW9B 3KKOA 3LUBA 1ONNA 1IM5A 1YOVB 2P6PA 3DOJA 4UBJA 4G0PA 3CXUA 5G3YA 1E9FA 1JDBC 4QQRA 1YQXA 2E1RA 4OO3A 1SQGA 1UDXA 1XX6A 1VHDA 2YMPA 5CM8B 3ZY4A 4DDMA 5KNDD 2HUNA 1IOVA 4CM9A 1YBVA 2ATCA 3LCUA 1TK9A 3PDWA 4OV6B 1L4UA 3QEMB 3FWYA 1M34A 4BMZA 5A5GA 3B8EA 3B9QA 4E30A 2W42A 1O94C 2NN3C 4ZO9A 5D00A 2DUNA 2FR0A 5HCUA 4J0JA 1CUBA 2C0CA 1YASA 2XOXA 2YUTA 4L3WA 5M5BA 5LQRA 4FCTA 2J41A 3V48A 5CYGA 4FOSA 3PUJA 3FKSA 1W25A 1KNXA 1E4EB 1S0UA 4CQLB 3TDNA 4R8KA 1Y8QA 2CLMB 8ADHA 5A7GA 2VRBA 2C7RA 1YZYA 1ZNQO 3F2VA 5ERXA 3VSEA 3RHFA 2W2TA 2R7LA 3COZA 1EYZA 2IU6A 1DWPA 1GQ2A 2PO5A 5E1OA 2FCRA 4HPXB 1RI2A 2Y1KA 1U2RA 3OLYA 4AS2A 4C29A 2YCLA 1HURA 5AP9A 1DEKA 2D5CA 2H00A 1V4VA 1DKPA 1AB5A 4YMSA 2ZBDA 1G4HA 1G8FA 2QGZA 3GT3A 4L8VA 3RRNA 4DMUB 1WF6A 2I0FA 4B7AA 2X6QA 1MB4A 1T2NA 3BB1A 3W3AA 1PR6A 4JGBA 5LUBA 4QNRA 1FTGA 2CXTA 5JYCA 4EJSA 3GJ0A 1Q0TA 3F6BX 1BJTA 4ITVA 1U8EA 2ZAYA 3IEIA 4RTSA 5IJAA 5ES4B 1B73A 4Y7DA 3HO6A 1Y1LA 3RU2A 1X7WA 1OBFO 2IUFA 4J0HA 2J7KA 4WNCA 1PE0A 1VTKA 2ZDQA 4S0ZA 3SVZA 2EBFX 2RIRA 3E7PA 3I9MA 4IIBA 4ZAWA 1QP8A 4X20B 5CNKA 2XWBF 2NM0A 1HMYA 1G3UA 4AP9A 3B8HA 5K0FA 2FFQA 1EK6A 3SU8A 4W5RA 1A95A 4OQFA 4MRVA 4WGFA 3JPYA 4HTAA 4KKVA 1N92A 1Y9ZA 3IO3A 3V2UA 5LQDA 1VPDA 2GLTA 4B3GA 2Q99A 3FVWA 2TSYB 2GPSA 1P5JA 5KJCA 3ZWWA 3LA6A 1L3CA 5JEEA 5JRDS 1CRWG 4JN6B 3LC7O 1GFWA 2P9JA 1CDZA 2Q3FA 3O6VA 1WB5A 5JCOA 1KDZA 3VZRA 3QPCA 4EMUA 3CURA 4AF8A 4J1TA 5EZQA 4WY2A 2Q5OA 4RQTA 4YUZA 3UOWA 4G0VA 2J0QA 3C1TA 3KDAA 5HOEA 2RH9B 1CEXA 1NE2A 2KLHA 3VM6A 1U8YA 4LPSA 1VLVA 3VR3D 3QPAA 2HM7A 1VLJA 3T06B 1GSAA 4FS8A 4H1TA 2OK7A 4M1EA 5ULLA 3TK1A 4C4RA 2DERA 2Q9UA 3U13A 2PUVA 1SVIA 3ZCUA 4ZEXA 1GEGA 1N8KA 2PUEA 3BUSA 5T4EA 3QY0A 1SA0A 4H7PA 4HC4A 5ALNA 2P40A 5E4YA 3VDQA 4PLYA 1ZQ1A 2XUIA 4D26A 4HDAA 4L4XA 2ACVA 4WW0A 3V7WA 2GM4A 1ID8A 4EHFA 5EIOA 2QTFA 1IQPA 1J7KA 2AC2A 1QFJA 1TZKA 1W76A 5CP8A 4EO9A 2LBPA 1JG4A 3F1KA 4IIVA 4XYBA 3IALA 1VLZA 2YWHA 3AR4A 1SKBA 1XCGB 3ZUGA 2I1VB 2J9YB 4LWQA 3HXOA 4OBWA 1PS8A 4BLSA 2OAEA 3HKBB 3TE7A 4W5OA 3R7BA 1SHLA 2QN6A 1ULTA 2GK6A 3GCZA 3ETLA 3GJ5A 5IYZA 8OHMA 1YJBA 1P19A 3VR2A 5HR5A 1Z0ZA 3N8GA 4CM7A 4YH1A 3U2QA 1H6DA 2JI4A 3MT7A 3ESRA 3CBQA 4G1EB 4OK5A 3BD6A 4KFTA 3V42A 1EK1A 4IEFB 5KNCH 2RHGB 3EZLA 1SKAA 1GTMA 1DVRA 3I32A 3TZ6A 1F0YA 4P5EA 1U9JA 2XYGA 4QUIA 4BMXA 2IS1A 1NF3A 1P5HA 1FBTA 1T29A 2X9NA 4ZYVA 4EHLA 2O8CB 3OD1A 1E4OA 2JJ1D 4FKMA 4I1IA 4JBHA 3R7WB 4ES6A 3HS3A 4QSHA 1P72A 2PVPA 4JU8A 3CTPA 1FSSA 2VEDA 3ZJTA 3PE3A 2P69A 1RHMA 4W9RA 4X1OA 2OM2A 4KE8A 2OTCA 1DINA 1MORA 5AM1A 2XB2A 1VHTA 1U7ZA 1TT5A 2Q1YA 4IDPA 4IJWA 1EUYA 2F3SA 10MHA 3OZDA 2WJ6A 4I9FA 2BSXA 3B9RA 4TTVA 3N6VA 2RGYA 2O57A 3ZE0B 1HDCA 1RDFA 4J76A 4A0GA 1SVUA 5M29A 1JWBB 1PT9A 2V4MA 5LP6F 4Q93A 2BI8A 2E49A 2VDKB 4G4JA 4NBSA 3FRHA 4EKEA 2P4EA 2OQ2A 1L7BA 1QFMA 3O9ZA 1QVAA 3ONEA 2FZ5A 1LFDB 1DX4A 1QYDA 1AVTA 1TX4B 2RHTA 3SZMA 3T54A 5JNTA 5J1SB 4O0LA 4KO1S 3MWYW 4MDEA 1CE8B 1OI4A 5B55A 3C5HA 2OYSA 1N8SA 3D6UA 4EGAA 3K4HA 3NM5A 1DL5A 1J0AA 1EFRD 1PZMA 2C00A 2UUBB 1GPYA 2COEA 3UAZA 2TMDA 1K3TA 4ZT2A 3F6CA 4ESEA 1MW8X 4D44A 1MPXA 2FQYA 1RLMA 1WCYA 3CU5A 3A4YA 3I30X 2Y9MB 3NBYC 2A9VA 4IJKA 2YXPX 4OBXA 5KTPA 4EZEA 2X5KO 1KZYC 5EYPA 3RI3A 4C6TA 5KTKA 2HV8A 3MTDA 4FYHA 3QEOA 3LBHA 4KV7A 4WXPA 1YB4A 4Q1EA 1G3MA 2ATEA 3HC7A 3LK7A 5LMUB 3LTNC 3K5HA 3OWXA 4KFRA 1T1RA 3DLAA 1XZQA 4JT4A 5F64A 5HMMA 3PS9A 1AO3A 4EHNA 4ETNA 1QZ3A 3O3MB 1M34B 2BE7A 2AXQA 3PQEA 2VQDA 3S40A 2GNAA 1NXVA 2QX6A 4H7HA 3KT3A 5EE5B 4XM2A 3PDIB 2XDWA 3GLIA 2GO1A 1G9SA 1BTOA 1SQ0A 2BW0A 3BBPA 4F5EA 3BVPA 3OZCA 5CGQB 4YJ3A 2VUIB 4Z9BA 3OA0A 1Y8QB 1P3DA 3BTSA 3BWYA 4R9SA 1XZLA 2DLNA 4KXFB 2HBRA 2PD3A 3IMGA 2QMEA 2OWEA 3W2EA 9LDBA 5LOVB 1DARA 1SOAA 5JWOA 5BWOA 3HBFA 2O05A 3QUAA 2Y1GA 1SBYA 4B3FX 3X1JA 1XA0A 2J32A 5L8VA 3VR5H 4BLVA 3IX7A 1J1IA 2I4TA 2WPNA 2W0SA 1MXFA 1JNXX 3KV1A 4GPEA 4JYBA 2C57A 3EMDA 1NLUA 5BSVA 1OF1A 3BMOA 3TX2A 3ZY2A 1VJGA 4ETWA 1XZNA 2CWDA 2HHCA 3E7FA 4F4IA 4GI5A 4HZGA 4X95A 5H82A 3DHEA 3IURA 4RK4A 2C1XA 4X44A 5D5QA 4J94A 3KZCA 1V16A 1AKVA 5IX8A 4UM8B 3AH8A 5BW5A 1IPEA 3GBSA 1FSFA 5JWHA 1YBHA 1WD5A 3HM9A 1TB4A 4MSUA 1GKIA 2TMGA 2V55B 1H8HA 1FZQA 1GU0A 4E32A 2EYUA 3KX2A 3ROFA 2NXCA 3THOA 4NBLA 1A9PA 1NASA 2GLXA 2PAAA 1KK0A 2BGKA 3EVEA 4OU5A 4HNRA 4PR3A 4CM1A 3DAHA 3I28A 1A9YA 5BVHB 1WXGA 4KEAA 3NIWA 3IDFA 4I50A 2Q4OA 3K30A 2AZXA 2WYHA 4AX8A 4XI9A 4KVGA 1JPVA 3DDNA 1I5RA 4JNCA 2ABWA 4QTUB 4HSEA 5ARBA 1H2RS 3OI7A 4RQUA 1WTCA 2G0AA 3DE1X 1XFDA 4D5GA 5JZMA 4GI7A 3V32A 1Y1TA 1RM5A 2PPLA 3DDCA 1USUA 2ONZA 3OD5A 5CVVA 1M7BA 1WULS 2Q4TA 2QUKA 4M37A 4YRFA 5KQPA 4JK3A 3EK2A 4R1SA 5CK5A 3TRFA 4DG8A 2XBMA 4W8GA 4I81A 4OAPA 4WFIA 4XTCS 5EZSA 2J3HA 3DWEX 1EIZA 2I6XA 1OTHA 4I55F 3JAKB 4GBGA 3HNRA 3TCXB 3T5CA 1QIFA 4DYDA 1VLLA 5DCYA 2BHSA 3ANLA 1PUJA 1T8PA 3L4JA 3AVWA 4URYR 1NW9B 2UUOA 2Q6VA 3DBOB 2YJGA 3UO8B 1TJ3A 3ZQ4A 5LQAA 2GD2A 4OQEA 1UK9A 3O75A 2Q0HA 2V6FA 4QE3A 1HETA 1SA0B 1W7AA 3K9HA 2PGIA 3KBBA 1SG6A 3CZ5A 1DEAA 1JHMA 4X84A 4XR4A 1I6KA 4LJKA 4RVFA 1OKKD 1NI3A 1ZH6A 3KB2A 2VDRB 4ZOLF 1DXYA 4MULA 5HDBB 3V34A 3DUFA 3EGXA 2YNMD 3GN2A 4R6WA 1TYCA 1MV8A 2I2DA 2QX7A 3UA4A 5CVTA 2H57A 4EQ6B 4JQCA 3VYRB 3GIWA 1V2GA 1DBPA 1RPAA 1P81A 2O1EA 5B37A 2CZGA 2OUKA 2COKA 5LWHA 1B74A 2EFJA 2XMBA 1LLFA 1J7JA 2YRWA 3MJCA 3TE6A 4DWWA 3K9LA 1AQ6A 1JT9A 2VJKA 1H85A 3UCXA 1D4ZA 3I9KA 2PJRA 2JANA 5DVZA 3ROPA 1G7RA 4IGIA 3W8FA 2R751 3LCMA 4D97A 2PNJA 4DRXB 4MR8B 4II2A 4FE7A 3ZWCA 2R1ZA 3NTLA 4IIDA 3WBKA 2BLLA 4WOKA 5CW1A 4QM6A 1ZRSA 1F7UA 2JPDA 1QWOA 4MTLA 4M0EA 3LVFO 1LZKA 4RD6A 2EJVA 1RLIA 2GZ2A 1JR2A 3FWHA 3JQDA 4J1NA 3SHWA 2PKWA 3CCCA 3N6RA 3CE6A 3NVAA 2G1JA 3PKZA 4FFWA 4HNAB 4KK4A 4MWDA 2QVZX 2C92A 3C3XA 3E70C 3SBOA 2GZ1A 5ELMA 1QS0A 4PLZA 4BNYA 3GLFA 2WWIA 3HL0A 1QHHA 1A1SA 3HXPA 3ORFA 4Z9XA 1L7VC 1OLOA 4O4LF 5JSYA 2GARA 3HXTA 1ZH8A 1JKXA 4N4AA 1A8UA 1MVOA 2BE9A 4M1MA 5THQA 2VN8A 1QNFA 1RWNA 2CN1A 3ONDA 2L0XA 3H8VA 3HJHA 4J7CA 1E59A 1T1GA 3LT2A 2ZR8A 5MGBA 4E5NA 3GK3A 5BMVF 1TT5B 3V1LA 3RAGA 4FLFA 3LY8A 3WK6A 1VG9B 1CP3A 2R9VA 5F1OA 3EZ2A 3OUZA 1RKVA 1P29A 4C7KA 3UAXA 2VQFB 4BQSA 1NL3A 2WZCA 3JS5A 4JP8A 2IXTA 1KO4A 4HH1A 2PTHA 3VVCA 4EFNA 1N5IA 2I7VA 1P1IA 3SYRA 1FQJA 4DDUA 4TXNA 3CY6A 3HP4A 2BMVA 1NSFA 3LUJA 4XIIA 5TJHA 3U4HA 1FFDA 3KZNA 1WO8A 4QRDA 5CM2Z 4HQ6A 4WA8A 4YDSA 1LK7A 1JLLA 4CMAA 1CEEA 4BNMA 1X1SA 1OAAA 1LVUA 1Z07A 2YTZA 2MYPA 1QONA 4MUNA 4AB1A 1XT6A 4JBXA 4LV5B 3T9FA 1X70A 3BXXA 1HRDA 3GRYA 1C3OA 2XYPA 4MW9A 1X1CA 4R7ZA 4RUKA 2CNNA 4TKZA 4QKQA 5IJWA 3FMIA 4ED9A 1ZGZA 4P4TA 2X3FA 1W5TA 3L7LA 4RKYA 2P2NA 3P4YA 1DTWA 1T1JA 1XCPA 4OQYA 4UPVA 4XB1A 2QM7A 3M3PA 1AQUA 5EHQA 4H15A 4IDOA 3HA3A 1PJ8A 3K15A 4U6SA 4WESA 2BL4A 2FK8A 3E1SA 4L3OA 4Q9KA 3HLYA 1NXQA 3WGYA 4C6TB 3IJPA 3KLPX 1E96A 5KJ6A 1N5OX 3QIVA 3MWGA 5JD5A 4FHZA 3MILA 3DL0A 1QVZA 3QOFA 4XFJA 2KBEA 4WXMA 2JBHA 5IM4A 4AZVA 2YC2C 2PUTA 3P8ZA 4P4LA 4MQMA 1MO4A 1X19A 1WZIA 3HRHA 3OOHA 4M53A 4BP8A 4DUGD 4DXHA 1M1NB 2PL9A 4YUVA 3P2EA 3SZGA 3TLBA 4ILEA 1L3IA 1XCOA 2QD4A 4I1VA 4LF9B 2WM8A 4F3TA 4N5HX 3SJ7A 1WXEA 2X76A 4P4SA 3T1OA 3HWRA 1LK5A 3G8AA 2C3PA 3Q7RA 2MSLA 1UXHA 1LBSA 3OPYB 4WBNA 4IDNA 4QSMA 1WXQA 4ZOAA 2HW8A 4DVJA 1U9IC 2PUAA 3SF8B 2BM0A 2C59A 2O0JA 3C5EA 4HWGA 4KFSA 1DQZA 4JYZA 1VSQA 1YVRA 3V6MA 1IULA 5BSKA 1DO2A 1LEHA 4BZQA 2FEKA 3VR1A 3IQIX 3CONA 1NG1A 5U4XA 4WFKA 1E2DA 2FWJA 3I23A 4I9NA 4F4JA 1BVUA 1AN9A 2ECFA 1S4MA 3VDRA 5HF8A 3Q7PA 3F90A 2CXHA 3O21A 4MA0A 3P7MA 3Q8XB 5SZHB 1Z3CA 4JLDA 1Z28A 4MAMA 2P5SA 1BIFA 2VHJA 5G3ZA 3WAGA 1T5LA 5ALXA 2GYYA 3B7PA 3C98A 2EWVA 1QF7A 2L2QA 3FWZA 4LHXA 4ND1A 1BEUB 5F73A 3TOXA 4BTEA 3FTEA 4W7HA 2CL0X 3F9CA 1DKLA 5A5EA 3GNSA 2AWOA 1ENPA 4OHBA 4XD2A 5EXTA 4LW8A 5JSFA 2ETXA 2WTAA 3OIGA 5YASA 2NU8A 1O8CA 1F2VA 5CA1B 1M74A 4ZI7F 1JDSA 3LQKA 3LIIA 4GH5A 2JHCA 1QCYA 1CQXA 4I50B 3GJXC 3TLYA 3WYDA 2VA9A 1GNRA 1FNSA 2ZIEA 4NDNE 3X43A 4DL9A 5KZMB 2NYAA 4L74A 5C5IA 2WFLA 5K3OA 4L7QA 4LSMA 3C3MA 3CNHA 1ZN9A 1WMSA 3HGQA 1L4FA 1IK6A 1JL3A 1O97C 4MS1A 5CH5A 4EB6A 2VT7A 2E4YA 2EP5A 1IFXA 2GNOA 1STOA 1L4HA 4EPRA 3C41J 3RSCA 1T6NA 3ONVA 2WD7B 4UNIA 4LWPA 3GFGA 4GHWA 1XAHA 1IH8A 1NFQA 1FZTA 2VDMB 1F7VA 3DE5X 3WWPA 2TYSB 4Z1OA 4DJJA 3S2ZA 3FKQA 3BKXA 4IYRA 1OREA 1YQQA 2H1VA 3EISA 3F49S 4JI1B 4B0PA 1NVFA 4LSGA 3AB8A 5BN3B 3L8DA 1NBIA 3PBKA 1KJZA 1QIDA 4Y9TA 4UTOA 3DMHA 3KSDO 4MWTA 721PA 1PW7A 3WLHA 2VSYA 3L77A 3KLOA 2Q9AA 3SQLA 1AS2A 1OY1A 4IVPA 3PUVA 1WDLA 4G1VA 4WLNA 5HFJA 2H1LA 4JQOA 4LVNA 4YAGA 2QLJA 1TCCA 2GRJA 2QL7A 4KRXA 4FI3C 2QRNA 4UARA 2FE4A 3AY0A 5KC9A 5FOUA 4C2AA 2B4RO 1QCCA 3FNFA 2FPLA 4QUBA 1VBMA 3JYQA 1RXEA 2GZDA 4UUOA 1NW7A 3PCTA 4MP6A 2O07A 4PTLA 2R2GA 5ESRA 1L6RA 5FHQA 1JBEA 3VNAA 1WA5A 2PJDA 1T91A 1RJ9B 2VZ9A 1K2VN 2O3JA 4LA4A 4XVHA 3VPSA 4Q48A 3QNUA 2XR1A 5DW0A 4KMMA 4EO4A 3M4YA 1KDPA 1AG9A 1H2BA 3WSWA 2EZ8A 2QE7D 1KR5A 1NF9A 5BW6B 1OXBB 3QMVA 3UG7A 4TYNA 3OQOA 4J4BA 1Y3AA 4JODA 4PX9A 5DBFA 4EB8A 1F6DA 2WUWE 4OYHA 3VUEA 3WLOA 4D9KA 1B8NA 2MINB 2QW0X 1Q57A 1RCUA 2F1OA 4HWKA 4RMNA 5IWAB 3DLHA 3JQFC 1AQNA 1XCLA 3GPDG 3TR5A 3ZD9A 3BB3A 4B73A 1FTQA 4AY5A 3A1DA 2QN8A 2B7BA 2WFAA 2E4UA 1FK8A 2WD9A 2ZWIA 5ALDA 3BDAA 4CTJA 3EPHA 1O7JA 1SCUA 3EC1A 5D5HA 2XUZA 3WRYA 3M0EA 5IEJA 2A4MA 2OK8A 3DHNA 3K09C 2BKUA 1PJQA 5J2UB 3W34A 4BQQA 4AKGA 2FP4A 3ZVNA 2VATA 1RT9A 3JD4A 1U4NA 3BWDD 4Z99A 2J5BA 3ZHZA 4P0QB 2H4XA 3F3KA 4YLYA 2WW8A 1WHTA 2ZI7A 2PX5A 4PX3A 4QJ5A 1H22A 1X6VA 2DWQA 5DTQA 1Y3HA 4KPYA 4DLYA 3EEBA 3MCAA 1RLUA 2F1JA 3R3UA 1JXOA 4ZMBA 3CX6A 3GJ6A 1NVWQ 2QQEA 2MR5A 5JHHB 5JMPA 1MZPA 4KX3A 4HX9A 1BCRA 2IXFA 2HA0A 1X74A 3JQ8A 3K9GA 5CA0F 4JI2B 3NYRA 4R4JA 4IUBS 3D1VA 3NVMB 2P2DA 4WFJA 2QU8A 5T41A 1JE0A 1NUAA 5SYMA 3FDZA 3GG9A 2H1SA 2JLQA 2EERA 3ID6C 3KJFA 1DC3A 2M1ZA 5CCBA 1A0OA 1JA1A 1XKTA 2NSLA 3QUBA 2JBWA 3V4SA 1TYAE 1Q1GA 1JLLB 2G77B 1Y1PA 1IY2A 3GCDA 1A5BB 1XMJA 4KN9S 4X6YA 2OWDA 2P7HA 3M4JA 4W5NA 3CVUA 1GL3A 2HA4A 1HQYE 1QO9A 1N78A 2RKBA 2WV7A 3VU9B 1FLDA 4IXMA 4F06A 4RZUA 2QRVA 1LV8A 2VBIA 4DBZA 2J5RA 4V3CA 1J5EB 3UWPA 3EVAA 3DP7A 3FVVA 1FRQA 4N1AA 4Z8XA 4Z3KA 5KU7A 1YR3A 13PKA 2FN7A 2G8LA 2SHKA 3C45A 4ND7A 4P3YA 3ZHTA 2JG3A 2B9VA 3EPLA 1THTA 4OB6A 3QVKA 1IEQA 1W36D 1SRQA 4XQGA 3HA7A 1RHQA 4J49A 4BX9A 3GRRA 3OC6A 4M76B 3N7TA 4TX1A 4QBHA 3IUQA 1OX5A 2FTKE 1RM0A 2FPGA 2XCOA 3IA2A 4HGPA 1AQLA 3CLUD 1UDRA 1MW9X 1VL2A 4CIAA 2BUBA 4IEEA 2JLVA 2QNRA 2XYRA 1ULBA 2ZFUA 3ORHA 3HDYA 5BW8A 4F84A 2AG8A 1R64A 2B1IA 3F5FA 3NBAA 3WB2A 4CMJA 1YS6A 4B6GA 4K6HA 4G24A 1KNQA 4U7DA 2XITA 2PGJA 3NR2A 3R23A 2NZVG 3L07A 2PFKA 5EKXA 1ZR4A 1IRXA 2VP3A 3GRKA 4YT8A 2B8NA 2O50A 1V45E 3ZDZB 2HPZA 4QM7A 3M6XA 3TNFA 4WBNB 4QZVA 2GPYA 3A9TA 3MS4A 4IFBA 3FPKA 1HT1E 3COWA 1YR9A 5KNCA 1CUSA 1PV2A 3TM5A 2DP4E 2VL7A 4J1SA 3NEYA 3SHQA 5K2OA 2INGX 2JAXA 4OCZA 4PCVA 5CPFA 4BE7B 3C5VA 2R8EA 3QLVC 3ETNA 4R3UC 2Y0CA 1JIVA 2PKCA 1Q3TA 2ORVA 1D7OA 2NO5A 2P4SA 3IVRA 4JH0A 1UWLA 5DYYA 1XIVA 5KCMA 1N6OA 1N2CE 1IQRA 2P90A 4GD3Q 1ODKA 1WMBA 4WCFA 5JG7A 2H31A 4A5SA 2QIOA 5C53B 3CNLA 5E2BA 4F5ZA 5GV8A 1I14A 1D6SA 3MIZA 2CYCA 2VO1A 3WLAA 4FR2A 2VP4A 4WPGA 2BFEB 1HE8B 1WQ4A 3QV2A 1RC0A 3IJ5A 3CX3A 3V8BA 5FBKA 5BUQA 1Q11A 4KLCA 4XCVA 4RF3A 4RBNA 4UCXA 4QGSA 5F7XA 4MB2A 3SNHA 5LDDC 1L4YA 1KPGA 3OKCA 2XQVA 4NBNA 1WZNA 1XEWY 4I4TF 3JQ7B 3HXQA 4CGZA 2ZXEA 1FCJA 3O93A 3S27A 3RVJA 1CJCA 4JQSA 1JYSA 4R9NA 1M2OA 1XPOA 1F2TA 3LK6A 4Q4AA 3UY4A 2IPLA 2QYHA 3SS8A 4ADSG 1NN3A 1XEFA 2E6UX 3IDZA 4M99A 4HLUC 3I1FA 3FNIA 4O1IA 4FNAA 4FSDA 4TWIA 4EB6B 4XUGB 2IXEA 3PR1A 4GNKA 4HJXA 4EZBA 3VKWA 2L69A 4Q0MA 4QJIA 3ZWMA 1LTHR 1QC5A 2YJ4A 3ZCRA 1O8BA 4RORA 1N1MA 2REQA 3BSFA 4JENA 1FYDA 3PL5A 5F4BA 3VFDA 4AQDA 5AXAA 1J70A 1W5EA 2OAQ1 2VSQA 4M7OA 1TDJA 2OVBA 3UF0A 2WJGA 2Y1DA 4ARCA 2XUPA 5LZ8A 4UFPA 1SUEA 5AJXA 4LGCA 1P3JA 2FPUA 1J6UA 3NAGA 1PVVA 4JGGA 4KMOA 4YRPA 1RMYA 1QDLB 1UPUA 1HE4A 2AR9A 2XB8A 3B5EA 3I3SR 4KW7A 1K89A 4BP9A 5IZCA 1DDOA 3QE4A 4KVFA 3R40A 3R2JA 4IXWA 4HHEA 4JQZA 3HYNA 3PXCX 2B20A 5INTA 5AK6A 3K20A 1WDTA 3DJFA 3PFHA 4KREA 1ARZA 1IUKA 1D5WA 1OWNA 2FUCA 3WLQA 4PPYA 1OYWA 1QFYA 1IHUA 2PGDA 3QBDA 4TTQA 2ID9A 2JFQA 3MT8A 4WIAA 4X41A 2QZJA 2HCJB 2FG7C 2N42A 7AT1A 2P78A 4X1IA 2L42A 4YCJA 1TZBA 2NNWB 3V33A 5JPIA 4L15A 1Z37A 3GLHB 2ZB7A 1QCDA 3ELYA 4A8HA 4W5QA 1O1YA 2WC1A 4FBLA 1G38A 1RJGA 1P61B 1ODTC 1GKYA 1Q16A 1GCGA 1JB9A 1R5JA 3U5ZB 2HO4A 2M32A 4RKQA 3WLRA 4OHZA 3AETA 3O2JA 1EAYA 3AQIA 5DIFA 2K7ZA 5HRAA 5D1NA 1USWA 3PK0A 2O2SA 1ATIA 1OH8A 1X7DA 3CUSA 3ZJYA 1RRCA 4EEZA 3VR5A 3EW7A 4ZVMA 1O6GA 4TKVA 1ESMA 2Z95A 1C30B 3K1AB 4CM9D 1GVHA 2RIPA 4LJAA 4UULA 5CD9A 1M6VA 3ICVA 3AJ8A 4LG1A 3P32A 4DWVA 2KLBA 1DBRA 2FN9A 4XLTA 2D5BA 3E22A 2DB3A 1A7KA 2QJOA 2NPFA 3I61A 1AZWA 2XNDA 1XQYA 5A0FA 4FILA 3FD8A 4O5OA 1IXYA 1FS4A 1TCVA 2X1VA 5TC4A 4WKOA 4RY2A 1E77A 1HO3A 3AYZB 3W9YA 3V9PA 3KQUA 4KHPB 2TECE 5DDIP 1WCIB 5KTYA 2FP4B 4R31A 1B8UA 3U4QA 1RKXA 4NBTA 4RLQA 4AZ3A 1RI1A 2O5CA 2HL6A 1JKJA 1WHTB 2OORA 4TVOA 3SS9X 2ZJ4A 4HDRB 3EA0A 2VDVE 1CF9A 3MWJA 5BR7A 1QVVA 3PX3A 3CRRA 3GFSA 4MPTA 3VO1A 5ALQA 4GOJA 1KYVA 1EFAA 1RZVA 3EVGA 2HZBA 4MIKA 4INAA 5EMLA 5KJEA 4ND5A 5JRJA 5CTJA 1N2ZA 2OG1A 1SK8A 2K87A 1G2PA 2Q2OA 3O84A 4KO4S 4PNZA 2AFVA 2NO0A 2WLSA 3CCBA 2WIAA 3R44A 4O4JA 4RACA 2Q5HA 5IJXA 1LUAA 3CJTA 1ISHA 5DOVA 2OEPA 5DHRA 5J1TB 3W3AD 3O47A 1A9SA 1HKHA 1NVMB 4G0MA 4ME6A 5DRTA 3JASA 5G1PA 4R68A 3KTOA 2AN1A 3KWJA 2PFGA 1WXXA 3CR8A 3LL4A 5LVAA 5GTDA 1J20A 3N6XA 1MR3F 2QLNA 3DEZA 2GHQA 2BBOA 4B7CA 3A6DA 3WQHA 5B4TA 4H0NA 3QEKA 4KX5A 1KQOA 2ODNA 1YJ5A 2O3QA 3IKLA 1E1CA 1V5WA 1YIOA 5JD3A 4R0MA 2CXNA 2R96A 4RVDA 3DDOA 1CG6A 2WJAA 4TTTS 4BKRA 5IUNC 4XFKA 3ZHCA 2NO9A 5LN1A 3BH7A 2QMHA 3KZ1E 1R4AA 2M9MA 2OXEA 4NZYA 4WECA 3CEHA 3W5BA 2WA1A 1KF0A 5SZIA 1RHRA 2AUMA 2IBMA 5TPWB 2MT9A 3CSDA 1YK0A 3BXFA 1ZGHA 3MJ4A 1NBWB 1Q7RA 2X40A 4OLAA 3RCBA 2R84A 3NH9A 4MH0R 5IJ0A 3C7AA 2YV3A 3AY7A