1SJ9A

Crystal structure of the uridine phosphorylase from salmonella typhimurium at 2.5a resolution
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
250
structure length
250
Chain Sequence
SDVFHLGLTKNDLQGAQLAIVPGDPERVEKIAALMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPMEFPAVADFACTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRRFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPNAETMKQTESHAVKIVVEAARRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Preliminary investigation of the three-dimensional structure of Salmonella typhimurium uridine phosphorylase in the crystalline state.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Transferase
molecule keywords Uridine phosphorylase
total genus 65
structure length 250
sequence length 250
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2004-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1sj9A00
4TXHA 2A0XA 1RFGE 2QSUA 3O4VA 3C74A 2AC7A 4WKOA 2GUWA 3UAXA 5B7NA 1M73E 1CB0A 3PHBE 4LNAA 1A9OA 3ENZA 1N3IA 4G89A 3EUEA 4WKCA 4MCIA 3OOHA 1PKEA 2OC4A 1Q1GA 1V3QE 4DA6A 1ULAA 3F8WA 3OZEA 4QATA 4LDNA 4PR3A 4L5AA 4TTAA 1TCUA 3FNQA 1A9PA 2XRFA 1U1DA 2PGAA 1G2OA 4BMZA 5F7ZA 4TXLA 1Z5PA 3PNPA 3UAZA 1PBNA 1RT9A 4EARA 1NC3A 1OU4A 1ODKA 3DDOA 2AI2A 1TD1A 3MB8A 4X24A 5IFKA 3NM6B 1U1CA 1U1FA 5EPUA 3T94A 3P0EA 1JDTA 1LX7A 3GGSA 5F78A 2OXFA 4PNPA 1Z38A 1OTXA 1ZOSA 4FFSA 4F1WA 4M7WA 4NS1A 4QARA 1C3XA 1FXUA 3FB1A 4R2XA 2HN9A 4L5CA 1ODIA 5B7GA 4BN0A 2A8YA 2OC9A 3NBQA 3OF3A 5IU6A 1A9QA 5B7PA 4BMXA 2AI3A 2RJ3A 2QTGA 1QE5A 1ZL2A 3TL6A 4OEHA 4TS9A 1PR1A 1VMKA 1ODJA 5F73A 5CYGA 5KB3A 2P4SA 4DAOA 4MCHA 3DPSA 3O6VA 1Y1TA 4ECEA 4KN5A 4F3KA 2Q7OE 2B94A 1U1GA 1JE0A 3SCZA 1T8WA 4YJKA 1U1EA 3UAVA 1CG6A 1PF7E 1JDUA 3KVYA 4DANA 1Y1RA 4IP0A 1PW7A 3OZBA 3DJFA 4GKAA 4H1TA 4L5YA 1TGYA 4TYMA 1JYSA 4MARA 1RCTE 4D98A 2ON6A 1K3FA 1YRYE 4D8YA 4OJTA 2A0WA 1Y6RA 5K1ZA 4WKNA 3LA8A 1JDSA 4TS3A 3BSFA 3DF9A 3OOEA 4JWTA 3E9ZA 1ECPA 5EUBA 1OUMA 4L6IA 1OVGA 5F7JA 1A9TA 2QTTA 1RXCA 4RJ2A 3FUCA 1RXUA 4QEZA 4TTJA 1JPVA 3K8OE 3FOWA 4D8VA 4DA0A 1SD2A 1V45E 4QFBA 4U2KA 1YBFA 5ETJA 3NM4A 4M3NA 1Y6QA 5CCEA 4OGLA 1B8OA 1PWYE 1TCVA 2ISCA 5B7QA 4TTIA 3KU4A 3MMSA 1YQQA 1Z5OA 3UT6A 1RYZA 3UAYA 4JP5A 4GMHA 3GB9A 4DARA 1LV8A 1PR4A 4F3CA 3U40A 1RXYA 5F77A 1PK7A 1RXSA 4EB8A 5CXQA 5JPCA 4P54A 4NSNA 1SD1A 4GLJA 4JOSA 1LVUA 2H8GA 4WKPA 3KUKA 2OECA 4YMLA 4R31A 3NM5A 4TXNA 4LKRA 1K9SA 1WTAA 3FAZA 4OF4A 4F2PA 1T0UA 3KVVA 1Z34A 1VHWA 1T8RA 4D9HA 3E0QA 3ODGA 4DA8A 3OPVA 4G41A 3PNSA 1RSZA 5F76A 3LBAA 3PHCA 2QPLA 3P0FA 4YNBA 4F2WA 4K6OA 1NC1A 2IQ5A 5F7XA 3IEXA 4LNHA 3K8QA 4E1VA 3BJEA 5F7OA 2BSXA 5CCDA 1JDZA 1VHJA 4I2VA 1VFNA 4YO8A 1JP7A 1Z39A 3DP9A 3BL6A 2I4TA 3IOMA 4UC0A 1SQ6A 1Y1QA 3UAWA 5FAKA 1ULBA 2I8AA 4DABA 1PR2A 5DK6A 1A9RA 4BMYA 3OZCA 1OTYA 4M1EA 3EMVA 1SJ9A 4TXJA 1B8NA 1Z37A 3OCCA 4OGKA 1YR3A 4R2WA 1V2HE 5I3CA 4D8XA 1K27A 2HWUA 1PR6A 1Z36A 4LZWA 3E9RA 3ONVA 2HRDA 1RR6A 1XE3A 3QPBA 1OV6A 4QAQA 1Z35A 1PR5A 1V41E 3KVRA 4WKBA 4DA7A 4DAEA 4G8JA 1PK9A 1Z5NA 3D1VA 1NW4A 5CXSA 1Z33A 5EFOA 1V48A 1Y1SA 3KHSA 1T8SA 4QASA 2AI1A 3EEIA 3INYA 1YQUA 5C80A 1ODLA 2QDKA 4OY3A 3FWPA 3EUFA 4L0MA 4GLFA 3BGSA 2A0YA 1TGVA 3OZDA 1V4NA 1I80A 1A9SA 5CYFA 1PR0A 4NY1A 3LGSA 1T8YA 1JDVA 2HSWA 1A69A 1JE1A 4TXMA
chains in the Genus database with same CATH superfamily
2A0XA 4UNRA 2V4UA 1KDTA 4D43A 3I09A 3Q3EA 4NHOA 3RUAA 4FILA 1OX5A 4BNJA 5I01A 2WV7A 1JEDA 4LF8B 5F98A 2RK3A 4G85A 3T3IA 1N2OA 1CQIB 1PD0A 3EOZA 5H70A 1O0CA 4EPVA 2P9CA 5TQ0B 2J45A 2AXPA 4RACA 2HLHA 2DVMA 3L4BA 1VLLA 1V1MB 2J0EA 3FROA 4A8JA 4WN3A 3O8QA 5EQJB 1NJ8A 3TQTA 4QUGA 3ENZA 5BN4B 2HEGA 3F6PA 4LPSA 1HM5A 4LF9B 4UBIA 3K9FC 4RZXA 3QX3A 5L3RA 2Q5FA 3OJWA 3Q9LA 3WGYA 2EFHB 2NMVA 2G4VA 4MQEA 4BJ5A 1P1IA 1JQJC 4EA6A 4BX9A 3ZWKA 2O54A 5ILGA 2Z1DA 2C0QA 1QUEA 2FWMX 1EXDA 4JUBA 1NLFA 4NOLA 3TE7A 3K0CC 4JI5B 1UPBA 4PIMA 2J33A 1OBCA 3RJMA 3ECAA 4TMKA 3PE6A 5CA0B 1D9ZA 3C0KA 3QMPA 1RQGA 2IU4A 1XEFA 4OHPA 1UPXA 3LCRA 4HDCA 4DUGA 3ZD9A 1FMJA 2QRQA 3A4MA 2H2HA 1SHZA 3O8CA 3ROQA 3EULA 1AN0A 3VMFA 2G0NA 1QH1A 4MLCA 3LIIA 4CM8B 2CLCX 4UTOA 3HWRA 1JTFA 4UE6A 4H6WA 4Z1MD 3ZDYB 5KYYB 2RK6A 3E0XA 4R7TA 4XYMA 3AUXA 3RJ5A 2V7WA 4KNYA 4JC5A 2XDWA 1Y89A 4MWGA 1JFSA 2AA3A 5JXIA 1EMDA 1ZK0A 1IN5A 1KFJB 3N2KB 1HOXA 4IHJA 4ZGGA 3PX7A 1BS9A 1Q0ZA 2LCIA 4UCFA 2W2OA 1QMGA 4AURA 1G8MA 1ISMA 1CIPA 2BDEA 2VDQB 1H2HA 1MX5A 4AG6A 9LDTA 4IZHA 4J3JA 1J0XO 4L16A 1LDBA 1E79D 2VF4X 4UZEA 1XQ9A 2J46A 1Q19A 3IAS1 4QBTA 1RXEA 1SUSA 1ZOSA 3FR7A 3IBFA 4CBVA 4Z2AA 2WVJA 1SIWA 2GHRA 3NR2A 3QJGA 4LDJA 2F3TA 3VH4A 1TNDA 3LNCA 3RYFA 4DQLA 4LOKA 1UAGA 3CE9A 4GPEA 2FG7C 2GTIA 3FZYA 5EMJA 4DBZA 4UQLA 3LUFA 3QLJA 1IJEA 4H7DA 3FCSB 3F2VA 5JADA 4AYTA 5DV9A 1DX6A 3KSDO 4I55B 4B46A 3ZV7A 4AAYA 1LVGA 2PPVA 4AY5A 3RS7A 4PIPA 4OL9A 4OI4A 1QZ3A 4P2BA 4PG6A 1DX9A 1JVNA 1U98A 4HV4A 2FWAA 5ADHA 2GAFA 4EHHA 1TE2A 4TSFD 1Z68A 4Y1GA 3RTCA 5BW4A 5I7EA 1WLSA 1EVYA 1FMTA 4TV9A 4N5DA 4CKXA 4YR7A 1E2KA 5B7PA 1PD1A 1S8OA 3CURA 1T9ZA 3FLEA 3ITKA 4UJ3A 5C4GB 4TUYF 4LYEA 1GVHA 3C6KA 4B7ZA 1JV2B 2R00A 4TMFA 2YWRA 1WCYA 1VL8A 1P7ZA 4M0UA 1O5OA 1XMPA 2VQ3A 5EIFA 5JAQA 5REQB 4AROA 1IXSB 2EX0A 2FNAA 3IBCA 4M37A 1A4IA 2BFDB 2D8AA 3R9XB 3HLTA 3WTBA 4FGZA 1E7MA 4ZT7A 5IX8A 1E8NA 1DEAA 1ORWA 2EFJA 2NU9B 2VPTA 2PT5A 3IPRA 1C0IA 1HZZA 3LF1A 2C00A 4EMSA 4MCHA 1MOSA 2QTRA 4V0KA 5EIWA 1SC3A 3TJMA 5JSKA 2PE5A 4Q00A 1LZLA 1J49A 2JGEA 1O03A 3FPHA 2HK7A 3CZ5A 3QEMB 3AUSA 5LQDA 2DFNA 1U1GA 1HGXA 2VQ6A 4RKEA 3C8HA 1MJFA 4XB6B 1QGUB 1NX6A 4REQA 4NQZA 3U7IA 3G88A 3VR1A 3KXIA 3QY0A 4B2LA 1QNFA 2NGRA 1FJ2A 4TKVA 1PX2A 4ETNA 3I9OA 1J9EA 1NJ6A 4DANA 1SB8A 5HOQA 1WD5A 2GK3A 3ONFA 4DR4B 4ZEWA 2ROQA 4X97A 3CTPA 3MWKA 2P5UA 1JZQA 3CKMA 5GV8A 1SH7A 1GXSA 1JHPA 4YALA 4EQZA 3UMJA 4RVGA 2W6QA 3U13A 3ZHCA 1OB5A 3E82A 4LYDA 2R00C 2PK3A 1E8MA 1KZ7B 5ALRA 3U17A 3NHFA 5BSEA 1Z12A 4EQ6B 5HQTA 4DM7A 1N1DA 4DJFC 1MX9A 2I8CA 4JP8A 1TM2A 2D7JA 3KB1A 4C0SA 5JZOA 2R68A 3IB6A 4CF6A 3PT9A 3DC7A 4ZJUA 3MHTA 5BO5A 3QXCA 3VKHA 4RMHA 1HQYE 1WAMA 1G3UA 3AUKA 3ORRA 3FVRA 1TA0A 1XRSB 4MV7A 4YCNA 4OXQA 1R8QA 5ALIA 1E6EA 3AJRA 3P9NA 5DCUA 1I4LD 3BCUA 4MQ6A 4QULA 5AKXA 1KY5A 5HKKD 4RTRA 3PQ5A 3KKOA 3PVZA 4M0KA 4XX0B 1XCPA 3G8DA 2W98A 1TMKA 2W6ID 5EPEA 4ZYXA 3RBVA 2QX6A 2P5YA 5UKDA 2I87A 4KVZA 1WXEA 1G0OA 2YJNA 3AP2A 2IHUA 2B37A 2GNAA 2WW8A 2P75A 2PS9A 3GBVA 4MQ4A 4L9AA 2FDCA 5E4YA 1EVEA 3NIDB 1DV1A 1GPWB 1B16A 5T3UA 1XTPA 4D80A 1CTQA 4U3JB 3B1FA 3KQWA 2ZT8A 4EO4A 3QTTA 1MIHA 3WLLA 3DE7X 4EY7A 4AL4A 4F2DA 3JAWA 4NE2A 2HJHA 3HL0A 4NECA 4UHKA 2C61A 1KHTA 3EG5A 3NRJA 1Y9EA 1RAEA 5BQ5A 3RS8A 3C2QA 2RHJA 1VKOA 2Y3IA 5E6UA 4QYMA 3RLIA 2Y99A 4LK2A 2LTAA 2GCGA 5DNCA 4HDMB 5K20A 3EZNA 1TTHA 1YDEA 1ZD3A 3K70B 4K9QA 1W36B 4UUPA 2ZR7A 1U3FA 1MV5A 1J5PA 2W6OA 4H2DA 2QX9A 5EJ8A 1TL7C 2OUIA 2X23A 3RU2A 1H3FA 1EEXB 1YULA 4ETIA 1JSZA 5DXAA 1NPTO 1M83A 1AQIA 1YJCA 2ZRCA 1G5TA 2HPZA 5HFJA 2CW5A 4FGSA 2WHXA 1G19A 2RHHA 3CJQA 4GUDA 5FFFA 4Z3OA 1GZ6A 3F6CA 3MRXA 3IS3A 4U6NA 3OEED 3WNBA 4F6RA 5C4IA 4CKZA 4NAUA 5SICE 1QNLA 1XTKA 2GAJA 1XEXA 1YS9A 2V3WA 1O5IA 1ZJZA 2O50A 5AWFC 1W30A 2I4MA 4UOZA 5LIRA 1RYNA 1J2UA 1KH1A 3A6ZA 1CQZA 4LOLA 2O19A 2EFEB 1YVEI 4M9QA 4Z4FA 2C9MA 3L7AA 3OSUA 3W5CA 5AYVA 4LYHA 4P34A 3OT5A 4PZAA 4TYQA 5TX7A 3AOEC 3N0WA 5J2TB 5T57A 4QU8A 1P3Y1 1TW2A 5JANA 1KSJA 1E89A 5AW7A 2IYNA 1XPOA 3LCUA 2UYQA 3LD9A 1MMFB 1K6JA 1DC4A 1XK6A 2AEMA 1YJ5A 2X6QA 3A31A 3OOJA 2FZLA 3PCRB 1VP3A 1EA5A 3QE4A 4HEJA 3UT5B 2OT3B 5E0OA 2IGTA 3L7OA 3T0FA 3GFOA 2XDQA 2C4WA 4JJ6A 1L9KA 4BN4A 1SUEA 1H0HA 2YIDA 3CLSC 2ALJA 3PUKA 2CDCA 1AKEA 2JEOA 1R8XA 2NUBA 3T12A 2R5FA 4O8CA 1QG0A 2EOAA 2R6FA 5TMPA 4QU5A 2Z2XA 2W2VA 1BWPA 3QJYA 4FGWA 3WIBA 5ALLA 4YBRA 3EGIA 3KHTA 3FYTA 4M87A 4NP6A 4M0LA 2CV1A 1L7OA 4NLLA 1WXDA 2YN2A 1B3RA 4GX5A 1Y5LA 1LVUA 4LEIA 5E9QA 1UXOA 2PA3A 4X94A 1ZUIA 2QLTA 2HFJA 3KUKA 4FGLA 4YRTA 5DASA 4I4NA 2W42A 1WPXA 3RS2A 3CEJA 3NM5A 2IEBA 3AB8A 2DRIA 4KGXA 1LTKA 3IDSA 4L4ZA 3QFTA 3PIDA 4FXPA 4YEDA 1EU1A 3JQ6A 5DN9A 4JBYA 4DOMA 1RBZA 1X70A 3X1KA 3UOWA 4ZAVA 1POWA 2WWIA 2XJ4A 4OQLA 1OR8A 4XR4A 5FTNA 1L5LA 3ZWCA 1M6YA 5AQ1A 5KTOA 4CQJA 3ZGYA 3ADKA 5BYBA 5FWXA 5JJ5A 1MABA 3WGQA 5TF4A 3FPJA 3UMYA 2XCSB 4AS3A 3E3NA 2EKDA 3JZFA 1YZNA 1DCMA 1RHQA 3ICPA 4QEKA 1USWA 1V16B 3BL8A 3EAQA 3AHHA 3IKJA 3KXPA 2DQKA 4AUMA 3E0QA 5CURA 4B81A 4RVOA 3EXFA 4MUEA 4LDRA 1JR3E 1KU0A 2Y71A 3P94A 4IRXA 3KBBA 3BKWA 4JLOA 4ERXA 2JLYA 5BYAA 4AZWA 2CV0A 4OXRA 1EDZA 4ZMBA 2ZKIA 3WMFA 1RMTA 3B12A 4HH3C 3WYGA 2HQSA 4GD3Q 3UCEA 1QV7A 221PA 4XFJA 3F71A 3RAEC 4KN9S 1UKBA 3NT5A 4I7EA 1A98A 1LI5A 3QVSA 4PFSA 3IEIA 1XJCA 3BJEA 1NQUA 2C5GA 3OZWA 3Q10A 1N6HA 2WJWA 3CEPB 4IOMA 4NV0A 1WCIA 3ZJVA 3EGXB 1QYWA 2JD0A 3HJCA 1NQTA 3WK8A 1IEWA 4I55F 2IK8A 4D5EA 3QVLA 1IHOA 4D6YA 1DQPA 4OHFA 4KIFA 1JA9A 1NAIA 3RI3A 1JPJA 4IRMA 1MJ5A 3VR6A 3WRYA 2IS1A 3C97A 4CN9A 3FJYA 4F4CA 4UM9B 4KIUA 3WK5A 4F4UA 1JFVA 4HDAA 4LHZA 2B6NA 1K8RA 2N1MA 1SELA 3D3JA 1PS8A 4BO2A 2YNMA 5D6NA 1A72A 4KJXA 1UKZA 3WB0A 4JJ7A 4L8LA 2JJQA 3DEFA 1I10A 2HIGA 4I50A 4BMYA 3SQWA 1HT1E 3SC6A 2WM8A 2PXXA 4N8EA 4IWXA 3PDWA 2NSHA 4PWYA 3UHOA 4H15A 1KJYA 5CCXA 4RY0A 3BTVA 1WDTA 1ACJA 2XZPA 4KDCA 1EP9A 1GG9A 4KSCA 3B9RA 4P3KA 1N4AA 4E08A 1AM4D 2R79A 4WN9B 3QU5A 3MCZA 2LIPA 4RCVA 1H1LB 4R16A 3VTFA 2HWUA 3QKSB 4XI9A 3QWIA 4U9UA 1Z36A 1U80A 2FMKA 3BRWA 4NULA 1J2JA 1SVNA 1OC4A 1OGJA 2UV8A 3C6MA 3E9RA 3Q3HA 3EXEA 4OIFA 3J80A 1O7JA 4PSUA 1BN7A 1RZUA 2MYTA 2QE7A 1KMHA 3C87A 3QUSA 5MF6A 4M49A 2PCJA 2NZUG 2OCPA 3RHTA 3HV0A 1NLMA 2VKTA 4NZYA 4NPAA 3QHAA 3N53A 4D4KA 3HCWA 4MRNA 4NCKA 2NXNA 3F3YA 5H59A 3GK3A 4O02B 3KCQA 1W6UA 4BZQA 1MTZA 2NQ2C 2QQGA 3KVRA 2J7KA 4FN4A 1TB4A 3NUQA 1IBKB 3G8AA 4RL4A 1IEXA 3F49S 4OFWA 1K4MA 2A0FA 2YV5A 3S68A 1QIIA 3H05A 3OKCA 1BMQA 1EUZA 1RE1A 1Y81A 3MSXA 5F12A 4ZAWA 4PO1A 3UAGA 3RBZA 4AKTA 1A7AA 2ATEA 2NO6A 4WACA 5F5NA 3PTAA 3S81A 1FVOA 3GG2A 1OIVA 2GHIA 1K6MA 4A5SA 4JLUA 4IIEA 2QBYA 3F6YA 3V4SA 2YHUA 3R0IA 4YWJA 3R5KA 5CFOA 1RWXA 2P2NA 2YJTD 4L7QA 2PSEA 5G0VA 3OTWA 1YQUA 4B4WA 4F2HA 2YWGA 4WJKB 4UU1A 2JBWA 5DP2A 2Q8NA 1LPNA 3H9CA 4XPZA 3SLGA 3SOPA 3KQLA 3QZUA 1Y1LA 4MLPA 1XO1A 2VC2B 5G40A 1KP3A 2GN4A 5JD5A 1TEHA 2XUZA 1XFDA 3ZWBA 2PT9A 1OC2A 1XLVA 2EJVA 5JEDA 4NZPA 3FTQA 3IV9A 2YDYA 1A9XB 1WUHS 3TLCA 3KKEA 1N2EA 3G0BA 4B79A 1C0PA 3DWIA 5JS7A 3FHJA 5IM4F 1IN1A 3S5UA 3LVQE 2ZE6A 3MBOA 4AJLA 1SVUA 4BJ3A 1ADBA 1N2XA 1KI7A 2C2BA 4KWCA 1GPDG 3GO4A 3GCXA 1Y42X 1F1BA 3M0EA 4YCDA 5KC9A 2QRHA 3WL4A 1JDVA 4HAWA 1KYZA 1SCQA 4K81B 5CVCA 3IERA 4DLKA 1R0ZA 4DKJA 1IDN1 3MWEB 4WZBE 3L7KA 5J4VA 2MYNA 5JJBA 4CM9D 1MB9A 1PZMA 5HKLA 4F97A 5BRJA 3GEPA 5JAOA 1WEHA 2ISSD 1YQ9A 4RL6A 4E5NA 5LYJA 3R74A 1FYVA 1YL7A 3PE4A 1Q50A 2O3JA 3LVRE 4HRVA 1GRRA 4DEXA 4EVSA 1GGJA 1T3SA 1RYHA 2PGJA 3WA6A 1EWVA 3CEAA 1CJCA 1UDRA 3FETA 1RCFA 1NNSA 3IPAA 4KSYA 2ONZA 4RJLA 2V6IA 4KQKA 4BE9A 5GVSA 1DE0A 2B4RO 2PZLA 4BO1A 4LZPA 4NBWA 1CY6A 3MJTA 2EWMA 3K96A 3RU7A 3CS3A 2QAGA 3EXIB 1Y5MA 2ZYVX 4X91A 1FFHA 4RM2A 2NYUA 4YJGA 3WHPA 4GPAA 3QQ5A 3ZEIA 1N3IA 3DYBA 4CMGA 5B4UA 4I1RA 4P3XA 3SHFA 3DUWA 1A95A 5AJXA 8ATCA 3VTKA 5JXGA 2VDPB 5FF9A 5CDYA 4N1AA 1GG2A 5KSPA 4JI0B 5KOHA 4EEKA 3WY9A 2NTYC 2ZFUA 1Z16A 3JRWA 3NHWA 2H5EA 3N87A 3JALB 2C29D 2R1TA 3UMGA 3IQHX 2NO4A 4FKMA 2GNPA 3W7AA 3KUCA 3O8BA 3NH9A 4LF6B 5AI6A 3T9BA 2WIFA 3X3HA 2CNLA 4Q0MA 1S6YA 2PX4A 2QTCA 5EJ4A 4QKQA 1U28C 2W4QA 2WUFA 5IBPA 3STXA 4BMZA 1KO1A 1Z2AA 2FRVA 3G7SA 4HAZA 1CB7A 3ONEA 5JSHA 3L8FA 1KJNA 1NMXA 4H1VA 4PNEA 3PEWA 1NYQA 4TZ0A 4FE4A 4GWLA 5C7OO 3L8YA 5CVJA 4ZU6X 4B2IA 1XZKA 4N7RA 2IZ1A 3W05A 4C4XA 5C1OA 4D0NA 3L6EA 4DDVA 1UKCA 5KKCA 3GYGA 4W5TA 1MBZA 3AUFA 2QUAA 1EXNA 3OLZA 4DDUA 3U3MA 2QZ4A 4R7GA 1ZH4A 5DOZA 3WO1A 2Y6UA 1IATA 4HF7A 5GONB 4YJHB 4OMDA 1T3LA 1U0EA 3RFFA 3GGPA 4C6SA 4RF4A 2RHBA 1XMJA 2PXAA 4XYGA 4C14A 1QFYA 3L1JA 4LJ6A 5FQNA 2X2FA 2XXAA 2GKSA 1JQKA 1UK7A 4Q19A 5A0FA 1BXRB 3DE5X 5LZ5A 2OVFA 5K51A 3W5BA 1NJFA 3QUQA 5DN6D 5JT1A 3BD9A 3EPRA 4P92A 5MN5A 1V8PA 4H4CA 4N8SA 1QUFA 2QQEA 3PSAA 3KU1A 1YJ8A 4YV1A 5BMVF 5IVKA 4EI7A 3WE7A 3QM1A 4FFSA 3GFRA 4W1QA 4TLCA 1D5CA 2Y9PB 2YJZA 3G0GA 5FBRB 2F90A 1Z13A 2RGNA 4KI0A 1C3XA 3ROKA 3VHXB 2YQ4A 4FE7A 1KRWA 1L5RA 1QS0B 1Y6FA 1LGYA 3JD3A 2IUFA 3ZHRA 3KUUA 1KBZA 1IY0A 3QVTA 4GWKA 5HCIA 5THXA 3RE1A 4NNJA 1Q16A 2M6SA 3WOVA 2WDZA 3P9KA 1HF3A 5EWJA 1B2LA 3JD1A 2A5JA 3MTDA 3HYSA 3KHKA 3IQEA 1DOAA 3JQAA 3IP9A 4NEHB 4OP1A 2IOYA 1X19A 2IW3A 5DSXA 5K2MA 4CG0A 4WDRA 1A9QA 1M6NA 4YLGA 4ZANA 5AIBA 3ZY5A 3THYB 1EGQA 2OQRA 3JQCA 2BV3A 4Q9DA 4XZ3A 1MDFA 2IH5A 2PA0A 1GCIA 1KFEB 1Z6GA 3AF1A 5KJCA 1Y8CA 2WTBA 4P22A 3MTAA 2F59A 5DE3A 3L3BA 2ZULA 1NXVA 3COVA 2VJYA 1I9GA 2QJTA 2GRAA 4DZTA 1O94C 2HZBA 2GN0A 5C34B 4DCGA 2ETVA 3E81A 3TL6A 4NWIA 1KAMA 3VDRA 2Q49A 2VATA 4I4LA 3NKLA 1VMKA 2CJPA 4RGVA 1L6RA 1D4OA 5CYGA 5BW5A 2ZXFA 2O8CB 4O33A 5HFNA 5LA6F 3AHFA 5K4GA 4MVJG 4X63A 4Q7LA 2VQEB 1YUBA 1LY1A 3FPCA 1Z6AA 3WIDA 2QYSA 1HFWA 1XZMA 2PO7A 2DJ5A 1ZO8A 3CXRA 1G6HA 3B1ZA 4RHCA 2Q7OE 1BMFD 2JAPA 2IWRA 1Q7TA 1Z45A 2I54A 1AGRA 1YB5A 1YQDA 4LTMA 5EIHA 4TYWA 4NZNA 3MXTA 3NIBA 4RV5A 3AR7A 2ZJ3A 3RUHA 3F67A 4MUGA 5JBNA 4QM7A 2ZATA 3D3NA 3RKRA 2AK2A 1SAYA 4EEXA 3QBTA 1QCZA 4RVSA 2VXBA 3SP1A 4DCVA 3JWJA 4D3YA 1NBMD 1WX1A 4CFYA 4PAOA 1WO8A 2HI0A 1KI4A 1LK0A 1B73A 1LLUA 1YI0A 2XW6A 4ETMA 1L5OA 4DMKA 1JJBA 2P8SA 4JU9A 2Q9BA 2RBEA 1V6CA 4F46A 4POAA 4HWPA 1YACA 1AGYA 1AS2A 3FCUB 4DC9A 4XUGB 2COUA 3WNDA 1P44A 4ND2A 2FMUA 1USIA 3JYHA 1FX0B 4OM7A 2X2PA 1Y9DA 3AG6A 5TVKA 3R7WB 5A62A 4KNVA 1RCTE 1L5MA 1PO7A 3AF4A 2DBZA 4Y6QA 3GPDG 2B4YA 3GJTA 4BBZA 3HEBA 1KI3A 3B3QA 2WPNA 2ZT6A 2JGLA 3T9AA 3WYCA 3Q3JB 3KKNA 1L8XA 2A5YB 3NATA 3ICOA 4ZU3A 2BH2A 1M6HA 2CYAA 4N12A 1TQDA 4Q12A 3M89A 4GSKA 4ENPA 2G7MC 1C1DA 1R8JA 2J48A 2GHTA 4HB2A 3F46A 3VR4A 5BR8B 2ZYSA 1P80A 2OA0A 1C7EA 3VSCA 2AZDA 2CHFA 4P7GA 2JD2A 2CMKA 2FTKE 1IXYA 5EA2A 3FTPA 4I0WB 4TWZA 3ZXXA 1W88B 4FOLA 5ELLA 1Q0PA 3ACCA 4Y6SA 4JA2A 2MDTA 1ENOA 2XWPA 4MQEB 2DPHA 1XL0A 4IOJA 1V1RB 3EQ2A 2QSZA 4DG9A 1ECPA 1TEVA 3ESCA 1NP6A 2YBEA 1QP0A 1QKKA 3HUDA 3H9EO 2JKZA 4LMAA 2CNKA 3NJ4A 3TW8B 2KBEA 3ADOA 4PZEA 5CB4A 4XDYA 4CMJA 2A35A 2QMYA 2QMQA 5TQ2B 3TD9A 3SDZA 1QZUA 4RKQA 1EXVA 2XHZA 2K2WA 1NN0A 4V1CB 5BVGB 1UBRS 1COWD 1GDHA 4N0QA 1JECA 3QFRA 1FEZA 3GFBA 1Z26A 3HFRA 3IODA 1QV6A 1JPUA 3O2JA 2VZ8A 4EFDA 5ALVA 5EI5A 1MH1A 4PHTA 4DLNA 3U39A 2NQTA 5EN4A 4JT9A 1JSRA 3F7OA 4NZ9A 3E7PA 2AQ8A 2OYRA 3ENVA 4OJMX 3TINA 3BDVA 4E2XA 3PXDA 4ER5A 5PGMA 3SE7A 1JJIA 2ZYUX 3ZXYA 1AE1A 2IZ7A 3PJEA 3PWSA 3NAMA 1Y3CE 3C41J 1CJMA 3LK6A 2Z30A 3ANNA 5A6SB 1N9KA 2CHEA 1FFGA 1BS2A 1KDVA 1OYOA 4BNKA 1UKYA 2VUUA 5E3HA 3ZV6A 2JFGA 2XUJA 2UXBB 5TT1A 1Y8RB 1M2VA 2QTVA 1CUVA 3PRHA 4I9UA 3ADBA 5F3DA 1Y37A 5KYKA 2EW8A 3DDCA 1TK2A 2I4RA 3FF4A 3GGOA 3GU3A 1HDRA 1TECE 3G9UA 5B4TA 1TU4A 4LWQA 2ATVA 2CCGA 2ONJA 1RDFA 3WBFA 3F6SA 1Q5PA 2MIIA 3HJFA 3JXEA 2A0UA 5JY1A 1EH5A 3NBUA 3GJ4A 3A1DA 1E1LA 2O1XA 2OGWA 1FRVA 3JATB 3LY8A 3FCEA 3AEUA 2CD7A 5KNDA 3FSGA 1RI1A 1WUTA 1GY8A 5ALQA 5IZCC 5BYKA 1Q21A 5CT8A 5KAMA 4KN8A 3PKIA 5FRDA 3VJLA 4C4ZA 3S2IA 3K0BA 1Z62A 3RGWS 1EZ1A 1U0SY 3BILA 4TLMB 2V8BA 2QUIA 3DCYA 3A3NA 2PANA 4OOEA 4WCFC 3T5GA 4TUYB 3EEOA 3I76A 1U0BB 4NMHA 1TIKA 2IXAA 3M81A 2EL9A 2KSQA 1BGXT 3H1AA 1H6CA 4EM6A 1PWXA 2A3RA 1XHEA 1XA3A 4IQFA 2E1PA 4AS2A 2GCOA 2R86A 2Q3FA 2Q3JA 5LKRA 3KM0A 2VP5A 1PWZA 3FWNA 3LO5A 3LOPA 3OJXA 2JGKA 1U8ZA 4UD2A 4F4IA 1OSNA 3JZDA 1XHFA 1ND5A 1H9AA 2FK7A 2QLFA 2IYFA 2X77A 3DKIA 3BTSA 3MHPA 4NSNA 4LXYA 3EZ2A 4C21A 5IYZB 1XZDA 3JQ9A 2I8LA 1V37A 5EE1A 3W8FA 1T0HB 3INTA 1N0VC 3BGOS 3QXXA 3CGWA 4ARAA 2VPYA 3GFSA 3ISJA 4D4HA 1J07A 3OQJA 4IXMA 5H80A 2ZCJA 3EY4A 4LKRA 2IHJA 2MSEB 3K9HA 3IXLA 4UBLA 4XWWA 3HKBB 1PEAA 2H1IA 2O1WA 1AXGA 3KQOA 3O92A 4X61A 3L93A 3PBKA 3IVAA 2JJ1D 5GJVC 3TUJC 1B8VA 4CL2A 4YGXB 4OLJA 5KYVA 3ZU5A 5EJ5A 3NC4A 3PUXA 2XXJA 3B3FA 1E2LA 1EVLA 4I14A 3DZKA 1ZNQO 3IKVA 3IQXA 3GARA 4MUJA 4CUZA 3R20A 4DSTA 4QXRA 2PZJA 5HIAA 2DCUA 3ZI7A 1HG0A 1XPRA 4TT3A 2BDTA 3E5NA 1PJQA 1OX4A 1QHSA 4INOA 4RDHA 3WISA 2BFCB 4FLEA 4RPJA 5HK9A 4IV5A 2BFEB 1FX1A 1WCIB 3PJGA 4ZPJA 5CB6A 4M0EA 4EQ6A 3HZZA 2Y1FA 4ROTA 3RAGA 4BU0A 3NYRA 4P0TA 1T36B 5KUTA 4EYGA 3IR5A 3A14A 4PPQA 1R2QA 3ZJTA 1Q7GA 1ZUNA 4F3TA 3I9LA 1Y3FE 2I91A 2AKEA 4K2AA 3L4KA 1GT6A 2VBGA 3IP1A 4J2TA 3WB2A 3Q15C 3BK1A 4IWNA 3RHZA 1MP0A 4AJNA 4AM8A 5CBKA 4PHCA 4BXOA 2YBDA 3WNZA 1VL1A 3FUXA 3NT4A 3QFHA 4LRSB 2IUUA 5ITSA 4BATA 4YO8A 3DWEX 2JA2A 4BMCA 4RHTA 4K6KA 1AURA 5THQA 2AGVA 3OUZA 2KHZA 4CW7A 3VGJA 1OLXB 4Y2UA 2ZR8A 1NURA 1G9SA 4ON9A 1UBHS 4BLRA 1MIOB 1BE0A 2O07A 4RMJA 4FT4A 3WL3A 3MM4A 4HGRA 3AVOA 3NTXA 3AU8A 4QTYA 1DBIA 1P19A 5CA0F 2FEWB 2VOEA 1R6AA 3F3KA 4EG7A 5DHRA 1VC2A 2VOJA 3NORA 1CD5A 1P72A 1RJ9A 1ZWLA 5DMHA 3URMA 5CB0A 1E2EA 5ABPA 5DN6A 4B87A 2OOKA 4ZMSA 1SULA 1Z37A 3O8DA 4EA7A 1EPUA 1NVWQ 2D5AA 3GJ3A 4QC2A 1PLJA 2NXJA 3ZHBA 1JAHA 3DBOB 2QJRA 4R8KA 4EJ0A 3WGUA 2FVYA 1JBQA 1QKJA 1MPXA 2CC2A 3R44A 4C2TA 1R4MB 1HDZA 3K53A 3BSSA 1XZNA 1PV1A 1YMUA 3KVNA 3Q1LA 1TYDE 3GLKA 4J75A 4HZGA 4UXIA 1L3BA 5CXUA 3IVCA 1YIDA 1GG8A 4LZWA 3E5HA 5EMKA 2IBTA 1X7YB 1ORRA 1XAGA 2PWYA 4EPXA 1FSZA 2PR7A 1P31A 1WVMA 2CDRA 3R3ZA 4Z0HO 4ER6A 1E6MA 1B14A 5FORA 1NVTA 1KNXA 3K9WA 4J43A 4YQEA 3OQBA 5J5AA 5TPZA 2N9UA 4R1QA 3ZE8A 2OD9A 4PZ0A 2XBLA 1H4TA 3UUFA 3RIMA 3U4MA 1LPAB 2QJOA 3A70A 4YHHB 3AVUA 3WAJA 3R0ZA 2B4AA 1SRQA 1ADYA 3MWLA 4J49A 3I8OA 3E22A 3WLQA 5GZ3A 1RFLA 3KEMA 3Q12A 2IYSA 4GQBA 1NF9A 1QVAA 2V55B 4GNKA 1QQAA 2NG1A 3B3GA 3ANSA 3HJTA 1C9KA 4J0HA 5IUKC 3VYUB 5JCZA 2ZJ2A 2Q9CA 2XKKA 4BMPB 2AOUB 4ZIRB 3D1VA 1WETA 1UCFA 2I62A 2IYEA 3KFVA 5JCPA 2J3DA 2E87A 1F8FA 5LP1A 3I9KA 2DB3A 2VHCA 1QYCA 5ES3A 2YFYA 1AXEA 2TS1A 4QBHA 4EBBA 3GEDA 4XLTA 4UNSA 4IUYA 4MQFB 2ZRHA 4TLAA 1TO2E 2AI1A 1ZK4A 1ZYUA 4HAIA 4OHCA 4D46A 4DT1A 2HU7A 2HF7A 4WFIA 4YXFA 3I2JA 1QONA 4D4MA 3ZWAA 5T67A 1WP4A 1YXMA 2W7TA 3CVWA 4AWBA 1HT3A 3MB5A 4QWMA 1E2BA 1I5OA 5EXXA 2YHIA 3CX6A 3T61A 1S7CA 1O97D 2CLEB 4MA5A 4CFZA 4ANFA 3Q87B 2LIVA 3H8VA 1BYUA 1M54A 2XSZA 3CLTD 3ONDA 4ACBA 4IDNA 1UDXA 2E6KA 2E0IA 2GYVA 4F60A 9ABPA 4UD6A 1CY8A 2TMGA 4KN6A 1ULSA 4HO1X 4BIIA 1BEEA 1DFGA 3TQOA 4MB6A 4ZXFA 1F9EA 4IJKA 1F2DA 1X9HA 2G5PA 2QD4A 2H9AA 2YUIA 1O6FA 1USVA 3AEZA 5CP8A 5E2BA 5EXSA 3I73A 5CYFA 1ZI8A 5B1HA 4DIMA 3MLBA 4HSEA 2WI8A 4JYAB 5TV2A 3KP1A 3D4PA 1IY9A 3KZMA 3TR6A 1A8QA 2XGMA 3CFYA 5HWSA 5KYWA 4JZKA 2L82A 4NAVA 4BQEA 3RDPA 1XPJA 4PLTA 1OI3A 2V7QA 4MW0A 4P8RA 1KS9A 5FOXA 4PV7A 3QE9Y 4KREA 4GBGA 4L51A 2IF0A 4KDRA 3ZW7A 4RTOA 2QSUA 3FSJX 4V39A 4GX2A 3H5TA 5LDGA 3TLJA 3AY7A 3B53X 3S44A 1WXQA 4BGEA 3A26A 3W2HA 3ZK9A 1N25A 4KPYA 4PVDA 4RFSA 4RK4A 4EUKA 2XNDA 4IFEA 8OHMA 2E7ZA 4YWHA 3DZJA 5DJ5A 4LISA 5KOHB 1I4DD 4C0XA 2NTEA 1I2DA 3ORYA 5K0LA 3X1ZA 1O9HA 2I6SA 3ZQ6A 5DOVA 5KNCH 2PFSA 4LZNA 5DXFA 3RGGA 3CINA 3ZX4A 4ZMRA 2DUUA 2RGYA 5IZ4A 2QRVB 4YAWA 1HRKA 1PKEA 1Z8DA 3JAMA 5E7IA 1WV0A 2FPGB 4EH1A 3PUJA 3NNNA 4UNPA 1V9SA 4LDNA 2B9VA 5FPSA 5GIOE 1SXJC 2WOJA 5EZYB 2Z1NA 3W77A 1AKRA 3IKLA 2DC1A 5FCDA 4PC3A 4AG3A 1S96A 3GY0A 3KV3O 4K2HA 1EFRA 3B85A 4ZO4A 3L43A 1JRLA 1T5HX 4YRJA 3U4QB 2AFHE 3KLMX 3O2SB 3P9ZA 4H3VA 2AFIB 4C1NA 4ZC1A 3WGHA 4Q7EA 2UZ3A 1QV9A 2PMBA 4FYVA 3PA6A 3ZU3A 2C9BA 2GD1O 3WMXA 2EBFX 4DBLC 2ABWA 3L04A 5DRYA 2CXHA 2VHTA 1AHIA 3U44B 2PUFA 3ER9A 1JG1A 2WHYA 1WKVA 2HCTA 2JIQA 3I23A 3NJ8A 1DIAA 1M2EA 3ZWPA 4A2CA 3KPVA 4CIAA 1RRCA 3OD5A 3QWFA 2OD7A 1CJSA 2B1IA 2DCMA 1Q0QA 4QECA 2QP4A 4HNAB 1MPTA 4X24A 1TZ2A 4PLWA 2A5GA 3E7DA 1KI8A 3QWHA 4YJ3B 1ULUA 3M6VA 1Q83A 2XQJA 2PSJA 2HDWA 3EXEB 4WZAA 4CIVA 4KXMA 4EJ2A 4GLBA 1JFTA 5T6MA 5KINB 1I14A 4E46A 4OIMA 1NWHA 5CLLA 2IELA 2WIGA 2Y0CA 2AG1A 3SX0A 1CW2B 2ZRGA 5KS2A 1KZGB 2H5JA 4WLOA 4AJKA 4LGCA 3FOEC 1W35A 3N58A 3DXXA 1AQJA 3CR3C 2BJWA 4X71A 1PLLA 10MHA 4G0OA 5IG2A 3FB1A 1XZFA 3WK9A 3U9LA 3UK7A 4H1HA 4UTPA 4YQFA 3JYPA 5FH9A 1JN0A 1V5GA 3SC2B 4HC4A 4ZVOA 4EA9A 2DKNA 2PV0A 1FYEA 5EY5B 5KQGA 5AVXA 1ND6A 3PC8C 4L78A 5HK8A 3LKBA 1FJXA 2QX8A 2H07A 2RHRA 4BNLA 2BC9A 5ICEA 1M2WA 1HQKA 3OUTA 1T5BA 4HOYA 3H1PA 4Z0PA 5FA5A 4F93B 1WU7A 1ESEA 2NP7A 2QR3A 3TFQA 3G0OA 3Q6NA 1Z7YA 3D2BA 3OIGA 1C3OA 3FDXA 4RPIA 3RSHA 2X2OA 2WJAA 5FBLB 1ZK1A 1GL6A 1P9LA 4JB2A 1TAQA 3F8SA 5BNTA 3CUVA 3DEIA 4OB7A 1V8FA 3AP3A 3BWXA 4P81A 4DT1B 4AXBA 2P4SA 5G0SA 4B2PA 4R8VA 2JJ8A 4QXOA 4CETA 3L07A 1RRKA 4QVKA 3RABA 2ZIWB 5TR9A 4B3DA 3OPQA 1JKMA 1N2CA 2O5VA 3MJHA 4PLPA 3REOA 3MT0A 2WJGA 4LHWA 3I5UA 1WMSA 3K8ZA 4I8DA 2B94A 4BIMA 1JH8A 2XMDA 4JLMA 4Z9AA 1XSEA 1EE2A 3ZW9A 4DYDA 4HXFB 1FA9A 4O2LA 1CRWG 4PNZA 4HXGA 3IVMA 3L79A 4ESEA 4KFCA 3C5WP 3N8DA 3FI0A 2L19A 2YN0A 4K6MA 4YN3A 1JIIA 3HM9A 4EKEA 1H69A 1JDUA 1L4FA 4ZK6A 3A6KA 3FMGA 1EDOA 3RYTC 4EHJA 4IP0A 5BR7A 1J0DA 3NDPA 3NWOA 4M0MA 3PGLA 1EESA 4OK3A 4I8IA 2HSJA 4MCAA 2XTNA 1PR3A 4K9SA 4P6VF 3ZHQA 1TXGA 1KEUA 1PL0A 3MD9A 4BC0A 4E7OA 5K8UA 1VIDA 4MYUA 2IEYA 5JD3A 3UMFA 2E49A 5B53A 2FPIA 3CLKA 2AOXA 3JD4A 1VE5A 3AR4A 4X54A 1XMXA 1GLGA 3ITEA 5FD8A 3OT1A 4E5VA 2D74A 1MXHA 2JBHA 2R2AA 4LOHA 1KDPA 4XJSA 1M34E 1C9NA 2QU8A 4UVGA 5HR5A 1NN1A 4Q93A 1FU7A 4NBLA 4OJTA 4XCQA 4YP0A 4F6CA 3EDMA 3PDIB 2Z5FA 2D1SA 3BC1A 3MS7A 1N75A 3T9FA 1KEZA 4G01B 5AKJA 4ABTA 3IGFA 3U7QA 1E98A 2BUAA 5LKAA 2QENA 3KAJA 1JEOA 3T6KA 5FUMA 1RAHA 3I2HA 2I29A 2XWJI 2FQWA 2DE0X 4HNVA 4KBYA 4CMCA 3QYFA 5A3QA 1L7EA 4WQMA 3ICCA 1IVYA 2QMUA 4W8OA 3UBMA 4A8JC 4C2BA 3ZDZB 3WIUA 3DR3A 4L73A 5C3UA 5L7YA 5IDYA 3MBKA 1RZ3A 1HDCA 2CMHA 3OLYA 1JTEA 1NUAA 1SBNE 2I78A 4ZVUA 4D9KA 2MSKA 2A94A 2Q5QA 2W2KB 3HTXA 1GSHA 4V0MA 2C96A 2IS4A 1UZNA 3R5JA 1HDXA 1T4DA 2OCLA 4S35A 2B8WA 2FE4A 1HLDA 3QMWA 4XWGA 3U7EB 1RP7A 3Q72A 3GX1A 3QEBZ 4RVHA 4L85A 1FYXA 3TGPA 3IBGA 2Q0QA 1WSAA 2OV3A 2FX2A 4LNUB 4HDKA 2QE6A 1H8HA 4KTTE 1OI2A 3AY6A 5EHXA 3LJKA 5CT9A 1GA4A 1V3TA 4Q48A 1ISFA 3JVVA 5FAXA 4C4RA 1ZGAA 5K3FA 2XODA 5BWNA 3MQ2A 1NVMB 4TMYA 3AL3A 1KBOA 4F85A 1R4NB 1NVAA 4YQYA 4YAEA 1IQ0A 5FI5A 2FWPA 2XQIA 2J4CA 1B74A 1GL7A 3IULA 1ZFNA 1SCAA 3X1XA 2XA1A 3FOCA 2ISCA 4RDCA 4BFVA 1CDOA 1A2BA 3H1FA 4MWBA 5KSZA 2EGGA 3B2QA 4O4LA 4TTIA 2HPAA 2V7XA 2JIZD 4J0DA 3WGTA 2OAP1 3M1YA 1QH0A 1GPLA 1DKNA 3R3SA 5ARDA 4TVKA 1K98A 2OO5C 4EPTA 1RYZA 4XWOA 2UZ1B 1HYQA 2C9DA 2P6MA 3EAGA 1LVHA 3FI9A 4A9AA 2PGDA 3NALA 4IQ4A 4QNRA 3CN9A 3N7UA 1DRUA 1DTWA 4XDGA 2C3UA 2CVHA 3MTQA 1D5WA 1XJQA 4O2BF 2ZJ6A 2CXXA 3GQBB 4YDSA 3EPJA 5DYTA 4F3CA 1CRZA 1YVDA 2JNWA 1U2ZA 4ZKDA 4QM6A 2PZFA 1R74A 3QXJA 3GEMA 5T3YA 2YV1A 5T5QA 3C7DB 4HPJB 2FY8A 2ZJ0A 2WR8A 4MWEA 3TMAA 1U90A 1R5OA 3E5RA 1FSGA 1OY1A 2PZBA 2QYOA 2VYND 3EJ6A 1Y4UA 3MTBA 1FSFA 2Z56A 4D4JA 4LVUA 1ZD2P 1V9LA 2EF1A 2NUPA 2BEWB 3EVDA 2D1TA 3MTGA 3I12A 5FV4A 4NCHA 4P83A 2FLKA 1A27A 3GWGA 4G1UC 4MVJD 2PR2A 4EECA 4MRSA 5TJHA 1V7CA 1Y6ZA 1JEJA 2DPXA 3EVTA 3H42B 4JOSA 3GUCA 5DTJA 5IJXA 2AOUA 4ZIRA 3AM3A 5JAMA 3ZBTA 4R31A 3AEQB 4P5DA 1YGYA 4PX3A 3TI7A 4PRLA 3T7AA 1MLDA 4GS5A 2PAAA 5JYEA 4ZZ3A 4LJ7A 1Y82A 3HS3A 3ZKWB 4PS0A 5EXPA 4Q4JB 3K20A 4MVWA 4KO4S 2FP3A 3CF2A 2XNDD 4F2PA 1IXRC 3OCXA 5B5SA 4RE6A 3UGJA 1Z7BA 1F8GA 1AKVA 4W9MC 2C94A 3G5UA 3T4EA 4ZAYA 3V4ZA 2ZJ5A 4ZRMA 1PFQA 5GGYA 1FB5A 1KGDA 2EZ4A 4I4TB 2IIPA 1VTKA 2QRNA 3EDCA 3HXOA 3D6MA 4OHVA 1AQ6A 3NRCA 1G18A 1YB7A 4OYHA 4DA8A 1D7AA 1GQ2A 2HXYA 4FD2A 3I8XA 3MAJA 3R0XA 4G41A 6YASA 5LQJA 1WUJS 1AMUA 4CKWB 3T52A 4QDUA 1VZ2A 2EHDA 4KV7A 1RABA 4Q4AA 3GELA 5BV1A 2IQ5A 1WSDA 4O4IF 3IEXA 1XL1A 4P53A 3QXSA 1FL9A 1N9GB 2BEVA 4NABA 4BEVA 3UN1A 2P6RA 2ZTLA 3KLOA 2GBGA 5FNVB 4AZTA 4RQTA 2A92A 3U9SA 4CDNA 13PKA 1TQ8A 1N5RA 2IX9A 3N74A 1G8AA 1TCAA 1RI2A 4RIIA 3FGPA 4X20B 5ALHA 5A3SA 3UHAA 1JDZA 2PH1A 5K5EA 1FFEA 4I2VA 4DV1B 1VMAA 5I4CA 3AVPA 5C3MA 3I8SA 5A0VA 3GFFA 4XAQA 4GPZA 3BL6A 1HG1A 5C7YA 2YJ6A 3FD8A 1R0BA 1RZVA 1GR1A 2W2PA 4DCOA 5JZSA 1QRUA 5H1YA 1SCUB 1VBFA 3C85A 2OM6A 3HDHA 1HLPA 2YWDA 1ZG3A 3CW8X 3R7FA 3HYCA 3BFVA 2OFFA 4NCXA 4B3FX 4LY9A 5LMNB 4LV5B 1T6NA 3RVMA 5M3BA 1KVRA 4W5NA 2M6KA 3GLFE 2H9IA 5JPDA 2ZRQA 3EZYA 1PSWA 3EGDA 1L7NA 4B2YA 3EMVA 5FI3A 3QK7A 1SJ9A 3OHSX 4HH0A 3IUYA 5CRIA 5CDUA 1VSBA 4R83A 1T5LA 1L4HA 4LC9A 4LYAA 4MLZA 5J4HA 1UC5B 4KQEA 4IEIA 1VPLA 3G9TA 3JVDA 4JUCA 4K9NA 4H1WA 3IE0A 1UEXC 2G08A 3THWA 1G8GA 1TRKA 2PU7A 4X41A 4ENUA 3LQFA 1WW2A 3CYFA 3R6WA 2ID8A 4H4EA 5B6PA 1CUDA 3D4NA 3VI3B 5BPFA 5C8VA 2RD2A 1XMSA 3CE6A 3MYYA 4WGGA 4CEHA 1F60A 2E89A 4EKYA 4UXJA 2HBRA 3U4QA 4LSGA 1GR0A 4MAAA 3C7AA 4F7DA 1A50B 2PLRA 2ZIUB 1R4NA 3OHPA 4S0ZA 3T1OA 2B1JA 1IWPB 1XE3A 4EP1A 2OGSA 3GJSA 5KWEA 1VIYA 2CL0X 1HT0A 5E6RB 2PTHA 3SXJA 3ENWA 3JQ9C 1Z9BA 2RCNA 5CD9A 2DTDA 3CRW1 5DM2A 1CERA 2IQIA 2ERYA 4GPBA 3IUNA 2PUCA 4OI1A 1W52X 1GAXA 3VR2A 3PXXA 1W6RA 2Q3CA 4C01A 2X9GA 3RS9A 1FS6A 2Q2VA 3KHUA 1QIJA 3JZAA 2CVOA 3GWZA 1BU8A 3T7KA 3RKUA 1OT5A 1UKAA 1DTWB 1MG0A 2VJOA 3I4LA 5ULLA 3WFIA 4HYEA 1ZISA 2H7XA 1E9EA 1K0UA 1AT1A 4NV1A 3A05A 4CF5A 4EFMA 5CFPA 4ZQCB 2FPPA 3ZU6A 9ATCA 4H3SA 1Q0TA 1ZMOA 1QTNA 2BMVA 1O96A 2IY8A 3HFSA 1BD3A 4TUYA 2C4HA 4UAUA 5DGHA 4N3AA 4QTXA 4BMSA 2IOQA 2WILA 2Q4EA 4DA9A 3A4TA 2WG0A 4RAQA 4ZOLB 4X60A 1P1KA 2CJWB 1GKIA 4DRXA 3KTAB 4R3NA 1Q0LA 2NSYA 2V4ZA 4UU7A 4IR7A 4WVLA 4KACA 4QRHA 5LQRA 4IV0A 3Q3CA 4U2BA 2VNAA 5F9FA 3L0OA 5BT9A 4OQPA 4L74A 1FFAA 5SZKB 3MJ4A 2A0YA 2BFPA 4P2GA 3VHLB 1YI1A 2X5XA 1FRFS 1L8OA 1GOTA 1DUSA 1ZWKA 3DVRX 4XARA 5KYUB 1KEKA 2VQFB 5CITA 2E5WA 3ZWVA 1DO0A 2EJWA 4KGDA 1V4BA 4J6FA 3I45A 1UIRA 3CLUC 4JWKA 4BVGA 1DBSA 3LGSA 2OZKA 1PBTA 1NKVA 3UHFA 4U4AA 1A69A 5JR3A 2TECE 4LXUA 1GCAA 2F9LA 4FB5A 1USGA 4BFUA 1IHYA 2OCYC 2WICA 4G2TA 5J58A 1IBCA 3W8EA 2PMWB 4KIGA 1YRLA 2Q29A 2UVQA 3DMNA 1LLCA 4D0SA 2OAQ1 5ELXA 4S2UA 3SSAA 5FPKA 3PFNA 2VLIA 3O7MA 4XWAA 5J2TF 3BCSA 3VU8A 2UZ0A 4A0RA 1FTGA 5BMVA 3N6XA 5J2UF 4XOIA 4XW2A 2RIRA 2QDXA 3SXPA 2OBNA 1Z4KA 1WUIS 4KU4A 1O4WA 4HPXB 2OCKA 4XTCS 5KCMA 2ACVA 2ZJZA 3KJHA 4UMFA 3BH0A 2N3ZA 5FR1A 5FBHA 1T36A 1KAOA 1IMOA 3AZOA 3D7KA 4L50A 3EVBA 1M73E 5D3ZA 1SIUA 2DX7A 1LW7A 1Q84A 4LAFA 3PFHA 2XMCA 3I61A 1JPNA 4JUAA 2UYHA 3CF4G 1T34A 3TL3A 3G79A 1DQNA 1NNLA 2QTLA 1Z8HA 3WHLA 1KYTA 1TU0A 2QX4A 1OWOA 2BHRA 1V26A 4C0WA 4YMVA 4LJAA 3QOWA 3PT5A 1A9YA 3ZCRA 2CDNA 2ZSBA 2XEDA 3FLMA 5CH8A 3EVNA 4AQYB 3GPCA 4C4SA 1RJGA 2A9QA 2Q50A 3LCMA 4KV9A 3R7SA 1SB9A 5BN4A 5JC8A 3U44A 4HNTA 1C9MA 5GM1A 2P0EA 2DWUA 1OLXA 5H7XA 3UGKA 4DLRA 1SR8A 2WJJA 1KJWA 1KS2A 3UXHA 1E58A 2P8JA 3EWSA 2Y2VA 4D57A 3H6KA 3HUEA 3EZGA 1K68A 1BFDA 1T2NA 1UZUA 4DM4A 4PLVA 4PYOA 5ALWA 1GNQA 1QQTA 5FXMA 2AJBA 2B6HA 3NHPA 2LWIA 3OE5A 4GR4A 3QFFA 3V7FA 1N8SA 3A1SA 4FJ2A 3OLXA 4MCJA 2XYVA 2WKQA 2EXXA 2I6XA 1I6MA 5DCWA 2E55A 1U7XA 4L8FA 3C4QA 2B69A 1EWTA 3HGTA 3U5TA 3OESA 3FZNA 1P5JA 1KSGA 1HSOA 5H9WA 3I1IA 4Q3KA 5KHOC 3AVVA 1SQ5A 4J07A 1X7HA 2W93A 4MS3B 2VNJA 4PCUA 2BKXA 3W79A 2OWDA 4LQDA 4Y9DA 5GMOA 3SLKA 2POCA 4G4GA 4PXYA 2C99A 4CMHA 1T43A 2BFOA 1I2BA 2VAXA 2OXFA 2QRKA 3GRZA 2EW1A 5KQSA 5EJ7A 2H1VA 1SVIA 3NFRA 5JSZA 2ZZMA 2Z4SA 3TQIA 3OFND 1OX6A 1UPUA 4MV8A 4FUQA 4P3YA 1DT5A 1JEQA 1N5LA 1Z4OA 1NXPA 4UUMA 1E3QA 3BK7A 5BQ3A 3BPSA 1EK0A 2PTGA 2EVWX 1FXUA 1ZSVA 2AXQA 1U94A 1V47A 1IXKA 2C7BA 2CYBA 3DXZA 4O0LA 5IF9A 2IS6A 4QGHA 5FI0B 2R66A 4E2FA 5JRZA 2WPDA 4K7JA 2PJRA 3F4KA 4KG7A 1T35A 2P27A 2BMAA 4RV9A 1QPGA 1O4VA 4RXTA 2YINC 2F3RA 2HNBA 3DULA 3Q8LA 3CNEA 1X9GA 3LHKA 1ZM2A 2IGBA 2R6CA 4HWGA 1XQ6A 3ETGA 4LHSA 4V2IA 2RGBA 3TH5A 1IQRA 1I4WA 4B1FA 4EYSA 2F64A 1SN7A 4ZC8A 3EUAA 1NVEA 1N8NA 3IBSA 3N9IA 3L7YA 4ZICA 5KNCA 2CNNA 1JHDA 4MPDA 2RJ3A 4O2AA 3QVWA 1ZGHA 3B6EA 4XSVA 2HWWA 2OZLB 3PHJA 4KFUA 4R6XA 5ERYA 3GAMA 1ZN8A 3CNOA 3H2SA 5JNUA 3OIDA 3H1GA 3LUKA 3T8YA 1L4NA 1PDVA 1E1QA 3PNLA 1FQOA 2WAMA 5CDHA 4AMVA 3H0CA 3H2BA 5AP9A 1H2BA 1HE4A 1KDZA 3TDKA 2PLAA 1BCRA 1EZ4A 2WQ6A 1YIAA 1OHHA 3DE0X 3W1EA 2XE4A 4YRKA 1U7TA 2A9FA 3PI7A 2HCFA 1QHXA 1PT5A 2R8ZA 3C3JA 3ZCXA 4PSCA 3UWKA 4MR9A 1S3FA 3K0FA 4DMFA 3TBKA 1FTQA 2C58A 2FN9A 2O3QA 2ZPUA 3A1CA 3NHZA 4OBEA 3DEHA 4ZVVA 3RTBA 4YRBA 5EIBD 4WZBA 2PKWA 2Z6AA 4CLRA 3BMXA 2P69A 5BR4A 1X3LA 3CLTC 1YRQA 5F1KA 1HBJA 1CG6A 4YAJA 4BNFA 1PF7E 5F33A 1EP3B 4B80A 4RPGA 2IEAA 4FWBA 4GW3A 4Z4IA 1FBNA 1PJ2A 2J3QA 5LU9A 1EVQA 1MC8A 3MPOA 3PPVA 4JEIA 5EINA 3SSNA 1NBOA 1I4OA 2DWCA 2JEZA 4YA6A 3AT1A 1NYLA 3Q2IA 4UBKA 3TCNA 2FUEA 3DJFA 4PGFA 5BNWA 3F1LA 2VTVA 3ME5A 1M6WA 5FBQB 1TGYA 4IHAA 3PNBA 4LJ8A 4YI3A 5FOWA 3U3KA 3ZHYA 1RHMA 1JYSA 4JI4B 3VC3A 3G5AA 4UFOA 3WB1A 2PZ8A 1PRYA 2VJPA 4IYJA 4II7A 2ECQA 3VQTA 3ZK7A 4Q4JA 1XZ8A 3TSWA 3TF5A 2H65A 1B26A 1TUGA 2ON6A 1W1IA 4LC0A 1T10A 2AN4A 2ZBVA 3UV3A 4BAGA 4JBHA 5EKUA 4RA6A 1GRNA 2BBWA 1RWBA 2QWXA 3ROGA 4ENQA 5MGBA 1OOEA 3KYIB 1PTJC 4HX5A 4UMVA 3HDQA 1DXYA 1JS1X 3H5NA 3UPDA 5HP4A 2D59A 5D5PA 5EP2A 2P9BA 3GXOA 2QM7A 4W6ZA 1PJZA 4TS3A 3T3EA 5KVAA 5L3SB 4QLAA 3ULKA 1PQYA 1M1YB 1SKYB 2GF0A 4EF4A 3V1UA 1WOYA 2GNOA 3L0PA 4KXUA 4LYJA 3TPZA 2NXWA 5E3IA 1N7JA 4AKHA 2H18A 3E9ZA 3U1BA 1QORA 2EKPA 5HQJA 1BSVA 5EUBA 4DCTA 4ZJPA 1JR2A 1OUMA 5HRUA 5BOSA 4FSHA 4EG8A 4BJ6A 3ZIDA 1OLSB 3TIXB 2NU8A 4NARA 3WB9A 1ECGA 3UK2A 3CUKA 5D7NA 1MVLA 2IHKA 1ZIOA 4OLFA 3TTXA 4DWVA 4XVHA 2C4KA 2GX6A 2Z4TA 1RXCA 3O26A 3TBFA 5J23A 5FUYA 4X1OA 4BCDA 3A4LA 3ZE2B 2YL2A 4MVJE 5AKYA 4BJ1A 4I1IA 2E5LB 3IEMA 4IGIA 5LQCA 3F73A 1WHSB 5G1OA 3T0IA 1ZOIA 2E4YA 2PHZA 2IA5A 3HZOA 4IDFA 1BW9A 2Q0XA 1GAJA 3L40A 3DEYX 4GXNA 4QFBA 1J21A 2G36A 5E4JA 2DT5A 1WIWA 3AWIA 4HQOA 4U02A 5LCXA 3CG4A 3X1YA 3QG1A 3NM4A 3CJRA 2BUBA 3HLKA 3PUIA 4JDUA 3IVRA 4TN5A 4MR8A 3D3KA 4E5UA 1FQWA 1SXJA 3LCJA 4M38A 5H9VA 3IXQA 2HLPA 1O3YA 2H52A 3E3AA 3PYXA 4IIYA 4R1NA 3RC9A 3JQRA 3RROA 3SJ7A 1ABFA 2FE1A 1UPAA 2C2ZA 1A4XA 2QMHA 1EUCB 2WT4A 3LIPA 3PC6A 4N4AA 4ZZ2A 2DLCX 3SQNA 1GYPA 1W36D 1M5TA 2NZ8A 3MILA 4KR6A 1KQOA 2XIQA 2ZM6B 4DIKA 1FNMA 5CFRA 5LZ4A 2JAHA 3G0HA 2Q3BA 1FXSA 4TRNA 3DXYA 2WA2A 4KXXA 4M22A 4V03A 3OFVA 1Z56C 4S0XA 3UT6A 1VCIA 3FTNA 3A6FA 1U3VA 1W4ZA 4C76A 5AM3A 2PNJA 4V0RA 3WP0A 1NOIA 4CKBB 2JH3A 1Q7CA 2FETA 4XH9B 3FJ1A 5JTUA 4FDTA 1FJHA 4AS1A 5AO9A 1NULA 2YQ5A 4XB2A 3URKA 1ABBA 4LBYA 4WVFA 5T6BA 3DB2A 3B7GA 1GTG1 1U8EA 1YC5A 3VO9A 4PRKA 2C9CA 1LV8A 1VMIA 1PR4A 2FOIA 5IKEA 3HPRA 3RRYA 5KTNA 1DQRA 3ELUA 4OHXA 5IARA 4QO7A 4B8YA 1YV9A 3V7UA 1ZGJA 2YZNA 1XQVA 5IT0A 1JQAA 2VDVE 3GUHA 3ZDBA 2BFAA 1A3CA 2HMYB 2PJZA 1R0XA 3A8TA 4M46A 4JI7B 3B70A 4MK4A 2E82A 3GRPA 4P86A 3DLCA 4UUQA 3UTCA 5KCZA 1Z0SA 2IY7A 3UH1A 1X42A 1E59A 4NHEA 3VR5H 2JFZA 2QS9A 3GNTA 1MRNA 3DEJA 2IYXA 3J7TA 2JAOA 1L8QA 1MJGA 3HO1A 2CVZA 1QRAA 3KPYA 3PENA 3DT9A 3VYSB 2Z2JA 1JLHA 1KO8A 5AM1A 2QD3A 3TECE 4LBZA 1RRVA 5BURA 2E4AA 1KL7A 2ZXEA 1K7CA 4M7RA 5ALGA 5IH3A 3RU9A 3HG7A 2O8EB 3QQPA 4U7HA 2HTFA 1ID1A 1L1QA 4Q7JB 4X8MA 3SI7A 1W0KD 5AQEA 4TTTS 4M89A 3RRFA 2KWIA 4CG3A 1G63A 2Q07A 4IDOA 3BXGA 4LRQA 2X8LA 2I76A 3DTVD 2XMPA 2DHQA 3IALA 3KJXA 4B3BA 2I1LA 2NAFA 3AL2A 3HB0A 3B3AA 4TV8A 4Y2HA 4KAXA 4CT5A 3AUUA 4ALKA 4ZAGA 4MWZA 3FLBA 3QTLA 3R9KA 3NBXX 3RADC 1FRQA 3TXYA 2Q6OA 4IWYA 2RGAA 1NASA 3KT0A 4HDNA 3USCS 1T0UA 2TMKA 4MGZR 4RIFA 4NDAA 4UNQA 3TX2A 2VXOA 3LQ4A 3MJDA 4MUNA 4X6LA 1YKGA 1ZK2A 3KOWA 1TC1A 4UUAA 4TYPA 3FBGA 3FFAA 1X1DA 3AHEA 1SY7A 1AKTA 2H4WA 2ODNA 2D1FA 3CB4A 3HJHA 3KAQA 1U0JA 1LB1B 2QM0A 3OPVA 2ZRDA 2ID4A 4KK3A 1HA3A 2MINB 3P0FA 1UK8A 1O89A 3PNKA 4I5EA 4J2HA 2H1LA 4KC0A 3WO0A 4EJMA 4A03A 1M6VB 1D2GA 1GCGA 1O58A 3ZGVA 1QCYA 4OGGA 3VUEA 3L0IB 4LNHA 1R6BX 3U4DA 4ZVTA 2RDMA 2D62A 1SWWA 1YRBA 4MRRA 4YT2A 4DVJA 2IPMA 5BSRA 5K4AA 1ODTC 3IJRA 1N0UA 3FDIA 4HAUA 3FOBA 1QK5A 1RMYA 4K3UA 4A0SA 2J9YB 5L4NA 3DE4X 3OM0A 3QF7A 2M6RA 4Y98A 5CX4A 1XAIA 4O4HF 1PWHA 4G1FA 4RLSA 1U3DA 1LRLA 1E2PA 4LWZA 1QIDA 2G04A 5FWYB 3PCXA 4YC7A 4DQVA 4M0FA 4UC0A 1LNSA 4OU5A 3A7DA 3VOAA 3W5IA 4A36A 3HSYA 2C5HA 3A06A 1T9BA 4QDXA 4MW9A 5FAKA 2FSFA 4PXAA 4YJ2A 2H2DA 2QRPA 4HHEA 3WWZA 5HHTA 1XCOA 1IU9A 1PR2A 3FMPB 4M6WA 2N47A 4GG1A 5IRCD 1FSSA 1V71A 2P7HA 1EDBA 1QFJA 2WJ6A 3GA5A 3IFSA 4Q1CA 2NM0A 5ELMA 3KT6A 1ONBA 3I6ZA 1FIUA 1Z0JA 1ZEJA 3QLUC 2ISQA 3KOMA 2ZYRA 1CFZA 2IPOA 3A9SA 5AHWA 2O7RA 4Y2SA 1X1BA 1KQPA 1MC5A 2ZYWX 2I3ZA 2ZYHA 3AOEA 3EZFA 3P2KA 4G8CA 4KP7A 3VH1A 1FP7A 3CG0A 1KVQA 2CLKB 2QUKA 2R7LA 3QVOA 4S24A 3STWA 4L0QA 4DV2B 1RKBA 1UMDA 2XNKA 5IXYA 1AQLA 3OM9A 2G9NA 4Q1AA 5CH5A 2PU5A 3H16A 4YJHA 5I3CA 3B60A 3DWGA 2Z5LA 3SHOA 4X0EA 2IUSA 4PRYA 4QOHA 1U5CA 4XIFA 1V8DA 4OXXA 4QUDA 2W2LA 1FFDA 3M6MD 2Q0HA 2R1UA 2JCGA 3VI4B 5DLYA 2CLSA 1LSJA 1O6BA 2KLBA 5E0KB 3HYNA 4Q1DA 2XRMA 3ILXA 3U3RA 4QHSA 5GINE 4JLAA 4M54A 2M2IA 4PGGA 3ZH9B 4NMMA 3A3YA 1IJBA 1WA5A 1XTBA 2NO9A 2NZVG 3JQ8A 1SOUA 3LQRA 3GDGA 1SBZA 1W4AA 2DHRA 4G0NA 4C9BA 4ZV4A 3S29A 3C45A 2RK4A 4KE7A 3ZY6A 4UREA 3JARA 5AOVA 2R9VA 2HA7A 4FS8A 2O2IA 4IW3B 1EFRD 1SWVA 4PYRA 3VAYA 1H5UA 4Y30A 3LXMA 2G9QA 4DA7A 4KLRA 4DAEA 1Q3TA 3OU2A 5KNLA 4NJMB 3OJLA 5FUWA 3UJDA 4RA9A 1AHPA 2WHPB 2RG1A 1ORTA 1Z29A 1I33A 1WZCA 1JIJA 2R1VA 1LBIA 3MCAA 3SDSA 4BRUA 1PK9A 1BRMA 2R97A 4G4JA 4F4DA 3KX2A 2JA1A 3THYA 4E5SA 3EPHA 1RLUA 3EIUA 4UEOA 4FNMA 1Q7BA 3LYHA 2ZUSA 1S0UA 5EFOA 1FSPA 4RPLA 4EF5A 5C53B 1QRSA 3G2QA 1G8HA 3HXMA 3N0VA 4JT4A 3VSAA 1DJMA 2GB4A 4N5IX 4LRTB 3IP5A 4YB8A 4I9HA 1CUAA 4AZ0A 4Q3NA 2VEDA 4WASA 4YAIA 2XT0A 1C4WA 4JB3A 4TVOA 3DMYA 3EUFA 4R7ZA 4M9XA 1M2NA 2BKAA 1SOMA 2FG6C 2H1SA 3SFZA 1Z5VA 1GILA 3QX7A 2Q6VA 1OA0A 3B36A 1P2SA 1PZXA 5BRNA 1TM1E 3SQOA 4JY7A 2W8ZA 3M6FA 1EBUA 1NYRA 2P2SA 4B74A 5DISB 1YR1A 2Y05A 3CLRC 2BKEA 3LX4A 4AY3A 2Q21A 3R7LA 4Z8XA 1KK1A 3P2MA 4IJVA 2ZUFA 1YCHA 2JPDA 2PRKA 1W48A 4C4TA 2ACWA 3G3EA 2X5JO 6REQB 5KX5B 1I32A 1U8TA 1ZSYA 3FDJA 4WUVA 4Z4GA 3PPIA 3DLHA 3EIEA 2QD2A 1SO8A 1J00A 2PD3A 2RH8A 1IRXA 4YYEA 5BSKA 2FSUA 4Y9SA 5F3RA 3QHPA 2GXAA 2RGDA 1OFUA 3WRYC 1II8A 4Q37A 4H08A 2BPOA 5IBQA 3I62A 2PJUA 3OE7A 2QOEA 2J3IA 1NE7A 2ODAA 2AC4A 3B1KA 3WRXA 2EEPA 4AMYA 2HMAA 1CUHA 3ABZA 2V54A 1YL6A 2GDJA 3RS5A 1WMAA 1CWUA 1ICEA 2NTVA 2XWSA 5IEJA 4BFLA 2EARA 3ELDA 5I5EA 4ND4A 2O7VA 3NVDA 4HEQA 3WQQA 3EH1A 3TRIA 2F8LA 3BHIA 4DLPA 1Z6YA 4B6SA 1FMLA 4DV7B 2HIMA 5CG1A 4AY2A 4PQRA 1PG0A 2SKEA 3ESBA 4R01A 1H8EA 4BMOB 5K99A 1SXPA 2XTMA 3V8EA 3EUEA 1XN1A 3BA6A 5AUQA 1CZOA 1XD2A 3LBHA 3KXLA 3F8WA 4ZWNA 1VHDA 5HJ2A 3ZCPA 4IY1A 2C84A 4FQ7A 1ECCA 1Z4QA 1BHSA 1MN6A 3C3PA 3LSTA 4D1YA 3GAFA 2GQ0A 1GT91 3G2LA 4A1FA 1OJ7A 3F5QA 1DT3A 5B2EA 2A58A 2R62A 4FFLA 4LN1A 5EQFA 5HF9A 4DPMA 4ZEXA 4ENVA 4Z2YA 1NTOA 1PLKA 2RHMA 1T2CA 1NUPA 1W581 3I2GA 1NVBA 5TQVA 1ZOOA 3RTGA 2V3VA 3VU1A 1QQBA 1EIWA 1F4VA 1QPBA 3AJEA 1QWSA 4KWHA 4AU1A 3GNLA 3CHYA 5HF6A 5MN6A 2PGAA 2YCBA 4DPKA 2C7OA 3CVJA 3VJRA 1VE3A 4W99A 1I3OA 5C8DA 2OMEA 4Z54A 3LW8A 1AF7A 4JIGA 4B9EA 4MX8A 3PITA 1KJQA 4UZSA 3PZBA 4ESOA 2CT8A 1FDRA 2JI4A 2JHAA 3CJTA 4XYBA 4AF8A 1OU4A 2HF8A 4GOJA 3NAGA 5BW8A 5FL7D 4K8RB 3SU8A 3KYDA 3ZIAD 4CODB 5IS2A 4C0AC 5SY4A 2J1LA 1Y3HA 2AEFA 3I2IA 2X3FA 4KH0A 4FDMA 2ZIGA 1U1FA 1YKFA 4Z53A 3JD2A 2A9RA 2GT1A 2R6AA 4D4IA 5AFSA 1MZPA 1WKCA 3BX1A 2Y8EA 3HHPA 3HCOA 3USES 4D3XA 2H7CA 4G25A 3DAPA 1V7QA 4QOEA 4IMRA 5JU6A 2AX3A 3GLHE 2Q5LA 1KOLA 2QN1A 5A3JA 5K6AA 5A2QA 2VT2A 5HUJA 2BMEA 2G9UA 1EEHA 4U6SA 2EBHX 1BW9B 3H3JA 2DG2A 4OB8A 3EJWA 4RVNA 1B76A 4GXRA 4V0SA 1X80A 5IDVA 2PRZA 2EGUA 2X1LA 4C88A 2FP4B 3DHNA 2E2WA 1MNAA 2JLBA 2WP8J 1B41A 3O47A 4BDTA 3DGEC 1ONPA 3BD6A 2Y6VA 4FC7A 2JJYA 4XVCA 2YIVX 3OOWA 3NBQA 2G3YA 2PWBA 4XVUA 3O3NB 3FYDA 3DWFA 1FC0A 3VZRA 2EGHA 2X4IA 3IAHA 4NMXB 4P5PA 3LX8A 3LOQA 2GZRA 4G6ZA 1KK2A 1QLWA 3G17A 4BMXA 4E11A 1ZH8A 1L5ZA 3AGQA 2CDBA 2I65A 3PDUA 2CMGA 2PKEA 2YFKA 4J0JA 1NATA 2EP5A 5IT9A 1ZL2A 4R9NA 3U4GA 2P40A 3D8UA 4CEIB 3ORHA 1WZNA 2P9GA 5SYNA 4BNUA 4ZOLA 3KALA 3KTOA 4FLMA 2D2VA 1ICIA 3WK6A 1U5BA 4YCMA 5AW5A 3M6LA 3PFBA 3K16A 5BV8A 3NHLA 4G0WA 5DM4A 1ZM9A 3OX1A 4YLYA 5BUSA 1RRGA 4UVDA 2BFMA 2W2MA 4MKZA 3RD5A 1MHPA 2ZS8A 1Y5RA 3G2MA 3EEQA 2CMFA 4YJFA 4Z9XA 3ANYB 2HRCA 5JRJA 3BIOA 4DQKA 3HKBA 3CZAA 4NDNE 5J9FA 4FYIA 1XIVA 3TRFA 3GD5A 4ZEMA 4H6XA 2CZGA 5CLFA 4F5EA 3DOJA 2IZOA 4ENSA 2GEKA 1MO3A 1T5SA 1NJSA 3WL8A 3TO5A 1GQFA 5TVGA 3S40A 2JI8A 4HEA6 3DMRA 2B1QA 1D4FA 1OIWA 2OHOA 1R0RE 4X44A 4JENA 3FRIA 4JNCA 4W5OA 1RWVA 3JASA 4ECAA 3TEMA 3VJKA 1A2QA 4RANA 2RARA 1PV2A 4JJKA 3O4FA 5L4SA 3KOXA 2AHRA 4DS3A 3HBNA 2I7TA 2PGXA 4RZSA 3QELB 5AM5A 2FSHA 3K70D 2TRSB 1YNSA 3F3MA 1QC5A 1UJCA 1IM2A 1VSQA 2VT7A 1PSDA 2XMGA 4CF4A 1WB4A 5LNK6 1C1YA 1HPLA 1PKXA 2R1TB 3HI4A 3BAFA 3NBKA 1WV1A 1CT9A 2IJGX 2PQ2A 2I2AA 3B1JA 1YRYE 3JU3A 3WDSA 1JMYA 1I6KA 2ODTX 4AJ1A 1RC1A 2I80A 4KE6A 2QT9A 4HDNB 3HCEA 5GOZA 2FZKA 4DIOA 4IHKA 3IHLA 1C3LA 1R00A 2XRZA 2AMJA 3QNMA 3TOXA 4ETWA 2W6PA 4PCLA 5EZSA 3I1JA 3K0SA 2DY1A 4RNDB 4DDWA 1IHDA 2LPMA 2QIOA 4F6LA 1R6TA 1NFRA 1G21B 2O0KA 2IC5A 1J90A 1G20A 2QRLA 3PGA1 4LZLA 2BKVA 4MUBA 4EABA 1LBQA 4CN8A 4UUOA 4CKEA 1EE1A 1VBMA 2IVFA 4GI5A 1C4KA 3ZQUA 1ZVJA 3G85A 5KMGB 5L3QA 1YBVA 2VDWB 3M3PA 3ZR4B 4D6PA 1DDGA 3NP7A 4RSHA 1NW3A 1P9OA 2F3UA 5DBFA 2QNRA 2NU7A 4OGFA 3SHVA 4ITVA 1P9NA 4EAAA 4EITA 5EIBC 2FSVA 2JDIA 4BO4A 4MHSA 4Z5XA 1Y48E 4FVTA 3A2NA 2YOFA 3A11A 4CT4B 3UOAB 1P4SA 2NVUA 3AESB 2IDJA 3BZWA 3IQDB 1M0WA 1BAPA 5DX8A 3EVCA 1SXJB 4H0NA 4RK1A 3SN6A 1DXQA 1RQNA 3NNSA 3BH6A 4QEZA 3HWWA 3AM1A 1XEWX 4ATNA 3TW8A 3F8TA 1H1TA 1NYTA 3OFKA 5HS6A 3ZZUA 4LDZA 1SOVA 4DJAA 2O52A 1WMBA 3KDPA 3IJEB 3FHLA 1YBFA 2I2XB 2N1BA 2O6LA 1B6SA 1RKUA 3P27A 3GLIA 1FTSA 2D6FA 1YHNA 4DPLA 2CB0A 2PRIA 4BNZA 1SQFA 2B1GA 2ZEJA 4MVJM 2HHHB 2PJDA 4CMEA 2YS7A 4QJBA 2IIQA 3K4HA 3L1HA 4BVHA 3LXRA 3G1WA 3R3UA 3W90A 3SZOA 3GNQA 3LLSA 2PZMA 3ZHTA 2VHWA 3EDOA 3LV8A 1WY7A 1XTJA 2BTOA 2IYYA 2D0PB 3FGNA 3A2MA 4WW0A 3ZK8A 1AKUA 5B36A 5IN4A 2Z43A 2OZVA 3EPPA 3OPYI 4WFJA 3BL5A 2C77A 3OH8A 3F97A 3LL7A 5E8JA 1JKJB 4CG1A 2I9KA 1Q15A 1A7UA 4NU8X 2H5IA 1LSSA 3KKMA 3O8LA 4IGAA 1KE1A 3C1TA 1SHUX 5HZMA 4B7XA 2GYYA 5ECDA 1VM6A 4BLVA 2HIHA 3JYNA 3VDXA 3UC9A 4KO8A 5E1BA 1YE5A 4F06A 3MMNA 3CBGA 3GB9A 1KFBB 4CVNA 3AFNA 4XR9A 3NIWA 4HGOA 3KZCA 5B37A 1XNQB 1XJWA 1PUIA 3GD7A 3MPUA 2JFWA 1UINA 1VXRA 3O21A 1XBTA 2HLDA 3R5HA 4HBZA 4NQRA 4Q9HA 3TCKA 5E9JA 1XZJA 1ZD4A 4Y6PA 4FPXA 1GUYA 2Z8YA 1XU9A 3H83A 4R1MA 1D1PA 1P6QA 3H4VA 2CVFA 4J0IA 5BQFA 1JSXA 2HWXA 1D6JA 4MV4A 2O2EA 1TAHA 3FCCA 4DJTA 4CLXA 2NN3C 2B4QA 2Q5CA 2IYQA 4PYKA 4WOPA 5EXEA 1Q95A 1K7SN 1SUPA 4RFLA 4EGFA 5DWQA 2ZITA 3ZOZA 2B78A 2UUAB 1W4BA 1TO1E 5ADUS 1RLIA 2E6UX 2W4MA 3F96A 3IEUA 1SD1A 3F98A 3LHDA 3T5DA 3DFUA 1IWBB 4CEIA 4CQLB 2VF7A 3CWCA 5C35A 1P0QA 1ZP6A 2RBKA 4G4SO 3N6RA 4UHFA 5LLSA 2IU6A 4UNIA 1LQ2A 4TXNA 2E21A 3K0FB 3LP8A 2PFGA 3GRFA 4I5DA 3I6QA 3RFTA 4C06A 3KEFA 4EW3A 4OLBA 3P0JA 3IAS6 1RD4A 1YSCA 4MH0R 1CEYA 3LECA 2O2SA 2ZE7A 1I2MA 3KVOA 2IDZA 2JLQA 1VYHA 1CNMA 2BISA 3TPFA 1X15A 1FDOA 1FK8A 2I6TA 2UVPA 3WTCA 2PKRA 3DO5A 2G40A 3QSYA 3WK4A 4XPIA 2HW8A 5LXTA 4L3WA 3W2FA 3RARA 4BCCA 4DY4A 2Q41A 3U61B 3BHNA 4TMZA 2BFBB 3B3JA 3WGJA 3I0MA 3V32A 3EWNA 1CE8A 3NOVA 2BCEA 1ZA1A 3AB7A 5U4XA 4QPNA 4DJDC 4KQXA 1HE8B 1OXUA 1RAGA 3I5XA 1YBAA 2H2AA 4Q7MB 3N0XA 3KQQA 3ZV4A 4MQLA 2QPLA 4BNTA 3GLUA 4M0PA 3R3VA 4GPD1 4IJWA 4PINA 1IBMB 2V5UA 1W59A 1WW8A 5BXQC 4PLGA 1WBBA 1M2GA 1UT6A 2X40A 2OCIA 4DLBA 2YOGA 4CU2A 3CH6A 1YS2X 1GQQA 2JW5A 3MCUA 3UWPA 3ZS9A 1FP6A 4CLRB 4H7KA 3TE6A 3K8QA 3PEEA 5FWYA 4GKKB 3EUWA 3NW9A 5ANRB 4E1VA 2EFGA 4R2MA 1ATZA 4AECA 4U7WA 1Z0FA 1DAFA 1NUSA 3CX8A 3DMGA 3LY7A 1V39A 4LIPD 2EU8A 1AMOA 1VSUA 1IOLA 5A3RA 4JQOA 4JP3A 3BTUA 1UPFA 4X1IB 2ZDQA 1P6XA 4RY8A 3VVBA 2AN9A 3QIAA 1EIZA 4FGJA 5LLDA 2MSDB 2Z6VA 3DFKA 2EZ8A 2BBOA 4N6OA 4FFWA 2FG5A 3PXEA 2FOXA 4IMIB 4X1KA 4CM4A 4ZI7A 4OHWA 2AUMA 2IPXA 1Q2UA 3H4IA 2AVNA 3AKYA 2VDWA 3HN6A 4G0UA 3G1UA 1RWKA 1A9RA 1M2VB 1USKA 2QTVB 1BJKA 4EAQA 3K1YA 2GYUA 1SFRA 4IDGA 2D2IA 1J22A 1NUTA 1R0KA 1VB5A 4KCGA 4YPVA 5C1PA 4NYIR 5JAIA 4YY3B 3HYRA 2F1JA 3OURA 4IIFA 4ZT6A 3STUA 1HTTA 4Z0NA 4C7JA 4ZZIA 3NHJA 3AY3A 4GGOA 1TUEA 3OEHA 2A88A 3KL2A 3G7NA 1HFKA 1M34B 2JGAA 3AI3A 4JKYA 4LWOA 5SZHB 4A5OA 4DC0A 1NJ1A 1OW3B 4DWWA 4PM4A 1SUIA 4O63O 1L2TA 3DZ8A 4WGFA 4AP6A 5JD6A 4NK5A 5JQGB 4W8HA 4C87A 3RASA 2DOKA 2XH8A 3E53A 5CA0A 1CULC 1DJPA 3I30X 4DB2A 1Q1EA 1QZXA 3N86A 1W46A 3ANMA 2HRDA 4WZAB 3PHIA 4Q1VA 5IKOA 4UTNA 1T2FA 4OXKA 5BOVA 5JJIA 2EFYA 2WU4A 3BWBA 3PFIA 2OSBA 1GNTA 3PB3A 4MB2A 1FXWA 4NNPA 3T3PB 4MKIA 1K9VF 3ZTYA 4XRGA 2AH5A 1A4UA 2WZDA 2WJIA 4IIGA 1Z35A 4XXHA 4FZRA 1QCDA 1Y1KE 3QTBA 3PGXA 3I2YX 5IJAA 3VO2A 2WK1A 5HZGA 4UM9D 1VFPA 4G8JA 4RQAA 4R9VA 3QMMA 5DO9A 3SC2A 1CUXA 1BX3A 3H5VA 1NXXA 2V7EA 4R05A 1QP8A 4ITRC 4B84A 4ZHQB 2E4VA 2F00A 4KMMA 2D7CA 4KEAA 4D8TA 1EVZA 3GJ7A 3RG2A 2DFKB 4Q4HB 4YP7A 2ZAMA 1QDEA 3EFOA 3MLAA 4LDQA 1JALA 4NMWA 1V1JA 4QOSA 4YLEA 1SXHA 3UTDA 5AW1A 4ZCMA 5JI2E 1X8KA 5K09A 1GARA 1E1CB 4DG8A 2DECA 3S2EA 2HHAA 1Q6ZA 2FPUA 2D0IA 3ND5A 1YZLA 2DBVO 2A9VA 4TQGA 5BWOA 1T26A 5LZ9A 3PI6A 1NRXA 4GYWA 4L0MA 5M34A 4Y1RA 1ZMRA 3G6WA 3R7NA 3LH5A 1FFYA 4AG5A 3OFNA 4R41A 5EZ6B 1NDUA 1TM5E 1X1RA 3BWDD 1J2RA 1L8LA 3BGSA 4FW8A 4B83A 1AMNA 1LPOA 3V48A 5M04A 2AQKA 1TUBB 5AJVB 3VSDA 3RANA 4KBGA 2PS0A 4EOGA 3TJZA 1DG9A 3D5EA 3F1KA 1X7WB 2QZZA 5C52B 2PUEA 2I99A 3CX3A 2C4VA 2H00A 3BGWA 3IESA 1KZ4A 4G1EB 3WC4A 2VP9A 4ZVQA 5LD2C 3BYZA 1VE6A 4W63A 5M2QA 4QT4A 2VVTA 2BM1A 1T9KA 2NZ2A 3C3CA 3EGWA 2VSFA 3KXDA 4Q66C