1SJ9A

Crystal structure of the uridine phosphorylase from salmonella typhimurium at 2.5a resolution
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
250
structure length
250
Chain Sequence
SDVFHLGLTKNDLQGAQLAIVPGDPERVEKIAALMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPMEFPAVADFACTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRRFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPNAETMKQTESHAVKIVVEAARRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Uridine phosphorylase
publication title Preliminary investigation of the three-dimensional structure of Salmonella typhimurium uridine phosphorylase in the crystalline state.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 65
structure length 250
sequence length 250
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2004-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1sj9A00
3PHBE 2H8GA 4MCIA 3FAZA 2OC4A 1SQ6A 1A9QA 4OF4A 4L5YA 1Q1GA 2AI2A 4L0MA 3QPBA 4OGLA 3BL6A 4LKRA 1SD1A 4JWTA 4MARA 1G2OA 4GLFA 2AI1A 1V45E 3E0QA 1A69A 3ODGA 1U1FA 1NC3A 1RXUA 5ETJA 3DDOA 1U1GA 1VFNA 4GKAA 4R2WA 4M7WA 4D8VA 3MB8A 4F2WA 3OOHA 1Z37A 2A0YA 3BSFA 1C3XA 1OTXA 3UAVA 3FNQA 4NS1A 4YNBA 1T8RA 1NC1A 4LDNA 3OOEA 4DAOA 4TS3A 1NW4A 3OF3A 3LA8A 4WKOA 2ISCA 4H1TA 5EPUA 1JDVA 4TTIA 4QARA 1JYSA 1FXUA 4OJTA 1T0UA 4GMHA 4DABA 3TL6A 1PBNA 1TCVA 1PF7E 1JE1A 1RCTE 1YRYE 3DP9A 1B8NA 1Y6RA 1OV6A 4NY1A 4D8YA 1YR3A 4JP5A 1Z5OA 3E9ZA 5F73A 4QEZA 1LVUA 4WKNA 1JE0A 4RJ2A 1V2HE 4F3KA 1ZL2A 4DA7A 2I8AA 3BJEA 4QATA 3NM6B 2A8YA 1N3IA 1PWYE 4TTJA 4DA6A 4F3CA 1ULAA 4DAEA 5F77A 1PR4A 4PR3A 2HSWA 3E9RA 1TGYA 4YJKA 4L6IA 3ENZA 1JDUA 1ECPA 3GB9A 1ODKA 3EUFA 3OCCA 2I4TA 1A9TA 1OU4A 3FUCA 4M3NA 4D98A 4U2KA 1K3FA 4LNAA 1V3QE 5FAKA 1V41E 3IOMA 3FB1A 2B94A 4IP0A 1Y1RA 3KVYA 1RXCA 5CYFA 1VMKA 1SD2A 1T8YA 2QDKA 1RFGE 4TXMA 1B8OA 3O4VA 3C74A 4OY3A 4R2XA 5F7ZA 3OPVA 3UAYA 2HN9A 4LZWA 1PR6A 2Q7OE 3DJFA 2A0WA 1K9SA 3LBAA 3U40A 1V4NA 2XRFA 2PGAA 1A9RA 1A9SA 1Y1QA 1Z35A 5C80A 4UC0A 5CCDA 5EUBA 3EMVA 1U1CA 2OXFA 5K1ZA 4YO8A 1PR5A 5CXSA 3O6VA 1I80A 4TYMA 2QSUA 3KU4A 3PNPA 4WKCA 4I2VA 2AI3A 3OZEA 1RSZA 5EFOA 1T8WA 5IFKA 3PNSA 3SCZA 4F1WA 3P0EA 3UAWA 4BMXA 1RXYA 4D8XA 3OZBA 3GGSA 4WKPA 1PR2A 3UT6A 4ECEA 4TTAA 4TXNA 3K8OE 4TXLA 4QFBA 2IQ5A 1VHJA 4OGKA 4G89A 4YMLA 1OTYA 3OZDA 3T94A 1JDZA 1CB0A 4FFSA 1SJ9A 4NSNA 1TCUA 1ZOSA 3D1VA 5B7QA 3DPSA 1A9OA 1RYZA 2QTGA 5IU6A 1PR1A 1PR0A 3P0FA 1Y1TA 3IEXA 2OECA 1CG6A 4JOSA 3KUKA 1JDSA 1Y6QA 4L5CA 4GLJA 1RXSA 4EARA 4DARA 3NM4A 1PKEA 4DANA 4X24A 1YQUA 4K6OA 1ODLA 1TGVA 1PK7A 4TXJA 2HWUA 1Z34A 5B7NA 2HRDA 4M1EA 4L5AA 3BGSA 1JP7A 1OUMA 4P54A 3UAZA 3EEIA 4LNHA 5I3CA 4BN0A 4QASA 1U1EA 1LX7A 1YBFA 1Z5NA 4F2PA 1RR6A 4MCHA 1T8SA 4WKBA 1M73E 2BSXA 1Y1SA 1PK9A 2ON6A 4TS9A 1WTAA 4G8JA 4DA8A 3KVVA 3OZCA 5F76A 4OEHA 1Z36A 4TXHA 2A0XA 5F7XA 1TD1A 1QE5A 5CCEA 3NBQA 3K8QA 5CYGA 1Z39A 5KB3A 4E1VA 4DA0A 5CXQA 5B7PA 2GUWA 4BMYA 3KVRA 3NM5A 1Z38A 5B7GA 1LV8A 1RT9A 5F7JA 5JPCA 5F7OA 1Z5PA 2P4SA 2QTTA 1Z33A 1ODJA 3PHCA 4R31A 1PW7A 3LGSA 1JDTA 5DK6A 3ONVA 3MMSA 3UAXA 1VHWA 3KHSA 1ULBA 2AC7A 4BMZA 4EB8A 1K27A 3EUEA 1JPVA 4QAQA 1A9PA 1YQQA 3DF9A 1XE3A 4D9HA 2RJ3A 1ODIA 3FOWA 3INYA 4G41A 5F78A 4PNPA 2OC9A 1OVGA 3FWPA 4KN5A 1V48A 1U1DA 2QPLA 3F8WA
chains in the Genus database with same CATH superfamily
1QUFA 3D6FA 1RBMA 2JIZD 3F8SA 4YRLA 3ID6C 3NG1A 2XR1A 3NC1C 4BOYA 4NMXB 3D7RA 1ZOPA 3DOFA 3ES9A 3ZVKA 2XGMA 1WBDA 1RYDA 3R77A 4KYUA 4YTEA 3AR9A 3LT0A 3UT0A 1TEXA 1WY7A 1TO1E 3EVTA 1YI1A 2FH5B 2B2NA 3AEKA 3KZXA 1L7XA 5I8WA 5EMMA 2CW5A 1WA5A 3ZWOA 2NP7A 1EVLA 1VB3A 4OSOA 4L22A 4MS3A 4GI7A 2HLNA 3S5UA 2CEAA 3USES 4EMSA 5LJIA 5A4JA 3NDJA 3TTUA 4R9VA 2JJ2A 4GOND 3NTRA 2A5YB 1TIBA 5C8YA 1SVNA 1W4CA 2ZTMA 2VF2A 2FN4A 2IZ6A 5HDBB 5B1SA 4Z8XA 4JWTA 4CEJA 3OE5A 1ZO8A 4ZQEA 1FYXA 4MARA 4Q3NA 1FQOA 3LSTA 1JX6A 1RMTA 2FOXA 4MEBA 4K7JA 4CE6A 4KWCA 5LN1A 3EDYA 5CM8B 4K28A 4KXYA 1D4FA 1NKSA 1GA4A 1UK8A 1SCUB 2Y0EA 1UFVA 2HO5A 2B98A 4GW3A 2P79A 3SKVA 3BD6A 2QV7A 2I76A 4QXRA 1ABFA 3E0QA 1YDEA 3R6WA 2PUWA 4WZBE 5IH7A 3GVPA 2WF9A 3GEIA 2BGKA 3RYCA 4FN4A 1EFLA 2HLDA 3CX8A 1GYRA 4CIDA 3USZA 3KKNA 1SZPA 3JZFA 5A3VA 1FFDA 4HQFA 4YT2A 1JEEA 4L9WA 2HNAA 2PL3A 2QT1A 2ZCUA 3DSRA 5AUOB 1YSCA 2VDNB 3B1WA 1H8ED 2C3OA 4M2LA 4OP3A 1F12A 2B34A 2CNKA 1OT3A 2DFKB 1UDRA 2VT6A 3F1KA 4UNIA 4OB6A 4CQMD 2B61A 3FTFA 4I4NA 4MA4A 1L8QA 5HW0A 4P3YA 1S8FA 3ZK7A 4O1HA 1E7SA 1Z0ZA 2VRCA 2AG6A 4NDNE 3LKVA 2H00A 3FNQA 4Z1OA 3FWHA 1X7ZB 4LJ6A 2QSZA 3ECSA 1HKUA 3I5UA 4HH0A 2LP4Y 4TROA 1D7OA 3URKA 4B7ZA 2EKZA 4FR0A 2DF8A 4CM4B 1Q7CA 2H7XA 4WKOA 2C9CA 2Z3VA 5IF3A 5KAMA 1AH2A 5DM2A 1AF7A 2IYLD 1VYHA 1NNSA 2ISCA 4P3NA 2CV1A 4YJ2A 1EDZA 4O4HA 4DIKA 3HP7A 3GGCA 4QOSA 5IM5A 5EP2A 4DMHA 5JSKA 3CF2A 3MS2A 3UMFA 2WDPA 4JYBA 2PL9A 4KN6A 5AI6A 1H0KA 3N6XA 1FFYA 2BZ1A 4ZOBA 4JVNA 4LVNA 4LS3A 4F4JA 4ROSA 3TFWA 1RP7A 2GPBA 3CW9A 4YJHB 4DBVO 3TE7A 1ZUIA 1PJSA 1U90A 1K4KA 1S9DA 2CLOB 2XE6A 2XSZA 3OTWA 4L0QA 2YWRA 4C78A 2DXIA 4DR3B 4RA9A 4TYNA 3G1UA 4TMYA 1FNNA 3DDUA 3ICVA 4NE7A 4DJAA 1C14A 3I42A 1VP3A 1C4WA 3O4FA 5AVKA 3Q6IA 3U3OA 3DZHA 3WYBA 4OP2A 2WTUA 2M6SA 1ZAYA 2AHRA 1TQDA 3DKIA 5ER6A 3W3AD 2G09A 5BYKA 1KJQA 1QIHA 1EVQA 4JU9A 3QKUA 1CR2A 1WXIA 1RRMA 1DC3A 1U0SY 3A70A 4Y1FA 5C32A 4QM6A 2W2KB 1DX6A 4WK4B 4UCFA 4NENB 3WQQA 3HNOA 4DL9A 2PMCA 3W5HA 1RXIA 4ODIA 4O4IB 3K8YA 3BJRA 5C5DA 2GNPA 4X91A 5ALVA 3ZLVA 1Y3AA 3HY6A 5KYWA 3FZNA 1CB7A 3UWMA 3WMFA 3DTTA 1BCSA 2WVGA 1J5EB 4EM6A 1P8JA 3ZGYA 1Y5IA 2I4LA 2JK1A 1BRTA 1HL7A 3H9EO 4WNCA 4CM9A 4UQLA 2QW0X 1MAAA 1X1DA 3F2IA 5JFTA 3F3SA 1E2JA 1V2HE 4DT1A 2YINC 1XVUA 4B6RA 2TMYA 4QXMA 4Z4GA 2H4XA 2R1TB 3N1UA 3HDQA 3FLAA 3OFJA 3T9DA 4ZFNA 2VQ6A 1EX9A 1PT9A 1KH3A 4NTZA 4U6QA 2W6QA 3B13B 4EABA 5JMPA 3I9FA 4XM2A 3EH1A 3HP1A 1MT0A 2BBTA 1YQWA 1A5BB 4YCBA 4J0CA 3H4VA 1E2QA 1RTKA 4G09A 4IGEA 4O08A 1PR4A 3M6UA 4WBNA 3PNMA 1A8PA 3OQ6A 1Z7WA 3O8OA 3UB4A 4EPRA 4YJKA 3JSAA 1SBHA 1YQGA 2ZQ5A 3VVBA 4TRMA 3JR3A 4E5VA 5AVXA 2V6IA 5E4TA 5C8ZA 1AY0A 5KOHB 3SY8A 3WIDA 1N1DA 3L7JA 3TM4A 3WQBA 1MZPA 3EUFA 3WDSA 3CIFA 4X85A 4DSZA 1NMYA 3RC9A 4CN9A 3ME5A 3X43A 2GA9A 1AZWA 2NUPA 3OOSA 1TF7A 1N2CB 1QGAA 5IZ4A 4LK2A 4CHTA 5JAUA 4M0MA 2D8MA 3BRQA 2ZR9A 4Y2TA 1FDVA 2O8DA 3CSDA 5TMDA 4IQ0A 3ABRB 1HDOA 2HNKA 1X7DA 2VCEA 1WOYA 2NU7B 4FSHA 1MA3A 1W5FA 1Q2XA 3L4JA 4DUYB 2VJNA 3KV1A 5CVDA 1S7CA 4IDBA 5E1MA 4RTJA 1W5TA 4ZT7A 1GGFA 1B8OA 3EZ9A 4NP6A 4H7PA 4HXGA 4JC5A 4YAOA 1P1CA 3HPQA 3SNKA 4B6OA 1R5JA 4U6SA 3ZIAD 1O97D 1GSIA 5E0KB 2CF6A 4I6GA 4KWTA 4LOIA 1J20A 3D8UA 3E1GA 3GJYA 1NRXA 1VHQA 4IIEA 4TKLA 1VPLA 5BR1A 1WDMA 3U3JA 3OHMA 1CTQA 2R1UA 5FPYA 5JJIA 3BILA 1OX5A 2Z8ZA 3GP3A 3FD8A 3GRFA 3IV9A 1CUHA 3ZHSA 3LBAA 3Q8MA 1NVKA 4MUNA 2XRFA 3K2BA 1T9CA 3G2JA 5JH7B 3DZJA 1KOFA 3NBAA 2VN8A 4BEVA 2DBRA 2GN9A 3NHZA 1CQJA 4H1VA 4EA6A 1JSZA 1TXGA 2GZDA 1A5AB 1JDBB 2OZPA 3KPUA 4KXLA 1XMIA 4UHFA 1AKVA 1K06A 1XWIA 3GMSA 5AW3A 3A6LA 4Y6OA 2PGIA 4JOQA 4WZ6A 1D6MA 3EXHA 1J22A 2NVWA 1WX1A 4TPKA 4E09A 2FPOA 1KY4A 4LF8B 3HA7A 3LK6A 5BSEA 1JYFA 2VHQA 1QX4A 4FUQA 1G4HA 3DBVO 1G8FA 1PS8A 3PRHA 1J07A 4F6CA 1NSFA 1BGXT 3OZTA 4AJEA 3G88A 3WK5A 1JMKC 1UDCA 4OM7A 5JAIA 3KAPA 5ANRB 3GH1A 1USWA 5JZMA 1I80A 4MINA 3FHJA 3NOQA 2IU0A 5I7RA 3LZCA 5CDUA 2JLUA 4G5FA 2QG6A 1S2MA 2V7XA 4TQ9A 3RF6A 4EGFA 4LY0A 1BMTA 3IEMA 1Z22A 2NU6A 2AFRA 1I10A 2BRUA 3NFRA 5L3RA 2FP4B 3HI4A 5CBPB 2Y27A 1DU4A 1PX0A 2UDPA 4V1CA 1WV1A 1DO2A 5DGIA 2FEMA 4C3OB 4PG7A 3I9KA 3MBKA 3NTLA 4FBGA 2I1QA 5JD4A 1JIJA 3MGKA 3N6VA 4M8IA 2J3DA 5DWVA 1K5GA 1HT3A 3VISA 3OCJA 3DBLB 4RTSA 2GPWA 3TW8A 1LI4A 2JASA 2A1IA 3ICCA 3Q0IA 5G1OA 4CMGA 1PGNA 5FTKA 4BJHB 2OWDA 2RK4A 1KDOA 3RLFA 1W36C 4B48A 3SGLA 4N76A 3JQ9C 1ZMRA 1XFAA 3V4LA 2Q0SA 2GMWA 4HDSA 1N6IA 3N76A 3UHJA 5FFFA 2BGLA 2EARA 2O0LA 2Q3EA 4KKVA 2ESRA 5JWHA 3PJRA 3BJIC 1XCBA 4QQFA 2Q9AA 4RS4A 1P44A 3K5IA 3V1TC 4RV5A 1A2BA 3V1KA 1XZIA 2AV6A 3BL5A 4OUDA 4ECEA 1OFTA 3RREA 1I7DA 5AHKA 5KUTA 4YRNA 1WO8A 1DUIA 1O77A 1T2UA 1MB4A 2VPZA 2XUZA 5FTWA 3O74A 4GOLD 2A1TS 2R66A 2Z3WA 3ZY6A 1NMZA 4DV5B 1EFAA 5AM1A 2V4ZA 3LO5A 3HUEA 4W63A 5EIXA 2H1LA 2X14A 2EFCB 2O8FB 2E82A 3IPRA 2B4RO 3JASB 3PXBA 3RARA 3TRHA 5CHEA 3VZBA 2IF2A 3EXFA 3PUWA 3QEOA 1J56A 1XZDA 4HUQA 4JD5A 4Q3DA 2YWJA 1RM4A 1G2PA 2CHVA 3CNBA 4R3UC 4EBFA 3IQWA 4PO9A 4IF6A 2CZCA 5E3HA 3BWVA 3DMGA 1LRLA 4XKJA 4JYPA 4TTRA 4IINA 1GEGA 4RPLA 3F9CA 3I6MA 2HRCA 4HQOA 4MICA 1KAEA 2XF2A 5J43A 5KTKA 3C1OA 2N42A 3DL0A 5BPHA 2G06A 4TRNA 2HREA 1DEAA 2FZWA 3ZJVA 5FOXA 2W90A 5REQA 2FFAA 2WU3A 3CE9A 4US1R 3W3AH 4X1YA 5KVSA 3FFWA 4BNZA 2ZTUA 5JTTA 3FRJA 2HQBA 2NZ8A 3GLKA 1NIPA 4ECAA 5CXQA 1DWPA 3FPCA 1BXRB 1RQLA 2GTHA 4WBXC 3E35A 4YJDA 1ZH8A 3V4FA 4YX9A 3L4SO 1QJ4A 4MI1A 1V47A 2OHFA 1B8VA 2HRRA 1U81A 1A5ZA 1H5QA 1DMRA 1JALA 2ZYVX 3G8YA 6REQA 1XMQB 2ZZNA 2EX1A 4LTNA 3EDMA 3X1JA 4D4IA 2X9GA 2CMKA 2P91A 3G7SA 3A4YA 3QG1A 1SXQA 3VYRB 2AS0A 4G8CA 5EESA 4X61A 3RVKA 1G5TA 1UDAA 4ZI3A 1QQAA 4ON9A 1M75A 1IZ7A 2ZT8A 5F1YA 4AVYA 4CDNA 3OPYA 4XQGA 5MF6A 2BISA 1NATA 2VHYA 3MCUA 1GV0A 4MB0A 2PANA 4W5QA 1CNEA 2LKCA 2IPOA 2PGNA 5FBHA 3LY9A 2X15A 3R3WA 2FEXA 4AROA 3KT0A 4UJ3A 2XCQA 2G82A 4R2LA 1M10A 3PDJA 4ARIA 3Q9SA 2OQRA 4CKEB 3OM8A 1NVWQ 2P1RA 1LUAA 3KQWA 1DG1G 3WP1B 1Z74A 1Q0PA 2R4TA 1U4NA 3NOVA 3UC9A 3FKSA 5CG1A 2P27A 4UEOA 4DR7B 4WK0B 4LYYA 1DJNA 5IZCA 1CRLA 3HCPA 1GYPA 4YO7A 3RU3A 4K9DA 5LB4A 2PKXA 3C1AA 5JWOA 3R3UA 3MD9A 2IHZA 3KVVA 3NVDA 2ERYA 1MJ5A 3EZLA 1GOTA 1GG9A 2I2BA 4C05A 3MINB 3QPCA 4V3CA 4L7VA 5F7XA 4WZBB 3T9BA 5LQJA 5FR1A 1I0LA 5FJJA 4MVJG 1NW5A 2HA3A 1LLCA 1RLTA 1NJFA 1ZD3A 3AEXA 3L1JA 3OPXA 1J0EA 3DO5A 3EDRA 3DCNA 3HP4A 4X1IA 1RABA 4ZOCA 4WCDA 1RI4A 4PZYA 3TPCA 3BULA 1MC4A 3AHFA 3K05A 4WJZA 5KB3A 1YR6A 2MJLA 3K5HA 1JA1A 3AM3A 3RNLA 1DIAA 1QGUA 2OXTA 5H3LA 5E38A 1WKCA 3SIRA 3FOEC 1WR8A 4BZPA 4BPRA 2GN2A 5K8IA 3FSGD 1FRNA 2H54A 1AX9A 1N1MA 3OIUA 1UPXA 4JKOA 1DE0A 2NSLA 2RBEA 1AKRA 4FI3C 3TSAA 5A5VA 2OHHA 4CF4A 1I51A 2C95A 4RMIA 2ZSUA 4MR9A 1KP2A 1HDGO 3JAKA 1G5QA 2XT0A 5DYWA 1C30B 1CNMA 1WMFA 1Z0DA 4KYTA 4CBVA 3JD3A 4DDWA 1U9ZA 4WY8A 4M1OA 1LD3A 2XMBA 1PW7A 3IMFA 3VC3A 4E3ZA 1B3BA 3IP6A 3U2QA 4IKOA 1R18A 3EGDB 3ZHVA 2K6GA 2WM8A 1XZAA 3HFSA 1WD5A 2HJ9A 1HH4A 1K6JA 1YDHA 1TA4A 3EVDA 1EFTA 4B2YA 2QZ9A 1FVOA 1MMFB 3WYEA 3LDAA 1GQ2A 1NN5A 5GONA 1GL3A 1CQXA 2IU6A 1NXWA 1JHZA 3MT0A 4NCNA 3AF3A 4M0EA 2FDRA 2AJLI 3O82A 4OU5A 5SZIA 1PL8A 4MDFA 1A9PA 3Q85A 2GN1A 5EXXA 4XOIA 4YT8A 3CGGA 3DL7A 4NMMA 5KEIA 3IE1A 4N82A 1ODCA 2ZRJA 2I67A 2ZYHA 2NUAA 2XA2A 4GFDA 3KZOA 1FMJA 5G3ZA 1UPAA 3SIWA 1J39A 1ZJJA 5BW6B 3VRHA 4BP9A 3C39A 3RRBA 1UKCA 2XJ4A 3PTLA 2GD0A 2WZCA 4BN4A 4DV4B 1L5KA 3PYXA 2ST1A 2IE0A 1MEJA 2H9IA 4IHAA 3V1YA 3ZDQA 4IXDA 4TX1A 3PYLA 3CUYA 3OE7D 4RF2A 4YPVA 1RXEA 5DBIA 2OXCA 1HDRA 1Z5GA 1QOPB 1NX6A 2QJFA 2HIHA 2VHEA 3BRCA 1XNHA 3BXHA 2GDJA 1KMCA 2FVXA 3EGIA 4JT2A 1MG0A 4WXYB 4IHJA 3VSAA 5AKZA 4D8WA 3FAZA 3K70D 2QBYB 1IONA 3R44A 2OC4A 5JG7A 2DBVO 2VAMA 4EATA 4LF5B 4LSMA 4QVGA 2EF1A 1WVGA 2OBLA 3ANLA 4L5YA 3C98A 1A50B 4I66A 4OF4A 1P1IA 4QUHA 4ALJA 1HLPA 3CNNA 3N8GA 2OXRA 3M6MD 1GU7A 1FYWA 1FNBA 1NLYA 2HRZA 3GEEA 3QX7A 4HAIA 5JHGB 4WGFA 1YWGO 2JK0A 4NJMB 3KD3A 3KTFA 3TQTA 1GN8A 1X7YA 2HYIC 4IS2A 1DJPA 1CUVA 3QA3E 2PUFA 4G85A 4C4AA 5D5QA 3EXIB 3B89A 5BT9A 3T3NA 2D2FA 4W6ZA 4KN9S 1XAIA 3SHQA 2A9OA 3GRUA 5EL0A 4ZOQI 2VLIA 2EJUA 3ND5A 1I5RA 2HDWA 1A8QA 1XEWX 3GDFA 4GP7A 2MSNA 3ELUA 3ILVA 1VHDA 4R9NA 4ZOLB 4YONB 5C8VA 1BVHA 1IXKA 2Q3LA 4B3SB 4KR9A 3LU1A 5LLSA 1A4RA 4KYVA 1N3YA 1ICIA 1R4AA 4KAFA 3JSXA 4BYMA 4LF9B 2W0MA 2QD5A 1WUYA 2WTEA 4I2NA 4LOLA 4RNCA 4LZZA 4JQCA 3DDOA 4E15A 1BEEA 3H5NA 3IE2A 4YJFA 3VC2A 4F9TA 4LF7B 5D1NA 3FX2A 4W5OA 2PYIA 3DV2A 3F8TA 4KAXA 1FQWA 1NJ5A 3MB8A 1N7IA 4ISBA 4OFWA 2AYXA 2WJJA 4G26A 1J8YF 3EHDA 3G0OA 2RSLA 2JI8A 3FY4A 4H0NA 5B1EA 2GAAA 1ADCA 1Z28A 5CDSA 5KMGB 4I5GA 3DW1X 3EIEA 4P58A 1FX0A 2HB6A 1ISJA 3Q7TA 4QBKA 4QYSA 1NIJA 5EERA 5FB3A 2X0FA 1R9JA 4BVFA 3CLSC 3SXPA 5K3EA 1RRGA 1OZ0A 4Y6LA 1DARA 1L7AA 3KKZA 3NDPA 4AI6A 1E8MA 4I1VA 5F5LA 3M6IA 1RPTA 2FFBA 1Z3CA 4Q9LA 5D3MB 5AM5A 3X1DA 1JA0A 1Q17A 3OOEA 4NAHA 3ZCPA 3DLAA 3RS0A 3S2FA 3V42A 4ZMBA 2RD2A 4XDHA 2OV2A 1RIFA 1Y8QA 3NJ8A 3BMQB 5KYXB 5J2UB 1IY1A 3N75A 1S8AA 4CM7A 2YJ5A 3G5LA 3SZUA 2OSBA 1ODFA 2BEUA 2Z4RA 2AN3A 2GB4A 4X8LA 3WDLA 1QOQB 1U8ZA 5EP1A 2JGMA 1KS9A 5DHRA 2H4FA 4BLOA 2CV2A 3NXSA 4WINA 5DN6A 3UZUA 2IYZA 4UFPA 2A9PA 4RW0A 2FF5A 1WM1A 1PZFA 1R0BA 3D59A 2RIPA 5T6MA 4BNDB 2EZTA 3I2IA 1CE8A 2Q2OA 1MIOA 4UM7A 2DP4E 4L4YA 1NRJB 2J32A 3V8QA 1ULUA 2V7QA 4GQBA 3CR3C 4KZPA 5FV7A 5LU9A 2PUDA 2O2SA 1GG5A 4B4DA 4JX8A 3ZS8A 4EITA 1KYVA 3WGQA 1RCTE 4HLNA 4JJ7A 1FCJA 3RU7A 1EZZA 4B35A 1B8NA 2FX3A 4I4LA 4PLGA 4F11A 1Y6RA 1J33A 1XL0A 2CMDA 3ZDYB 5JY1A 5L3SA 3E7DA 1TMGE 4XSGA 4RJTA 5ITZA 4ESEA 5IDQA 3CSSA 4GPD1 4UHJA 3N2GA 1RYHA 2VCHA 1Q0ZA 1HYQA 5D3QA 1XU4A 1UPCA 4OTZA 5J4HA 1JTVA 1K2WA 1ZOIA 2YRWA 1F9EA 1RWVA 4B40A 1XA4A 4FR5A 1CY6A 3CZ9A 3UV6A 4L85A 4PHGA 4BNYA 1RXWA 2P9TA 2XUIA 4LI0A 5AI4A 5JC8A 3DQQA 3TQQA 3OZSA 2A7XA 3AV0B 3SBXA 2VP0A 1CZLA 3BN3A 2PWPA 4QTTB 4S0XA 4IZOA 3MT8A 1I3MA 1U9IA 5ECWA 2BYTA 3ZCSA 2V98A 2YUIA 1P5JA 3NM6B 3WLRA 1HOTA 2A8YA 4BMDA 2E5WA 4CKWB 4X6XA 4ZQCB 1E1NA 1L9XA 1AMNA 1GRQA 1OYVA 4I46A 2GZAA 2NSJA 1L6IA 3TEFA 3U4HA 4FYXA 5JD3A 3BEDA 5J4VA 2AR0A 1A77A 1KIMA 1C7JA 1TJYA 5F4BA 5YASA 3ZWNA 3H87A 1IYZA 3Q5EA 5T8KA 3PV0A 1LLDA 1R66A 2GCOB 3HV2A 3QOFA 5LJLA 3DZKA 2GJAA 1IB0A 2PT6A 2WF5A 4FFMA 3B9QA 3E4DA 2X5JO 1N2OA 4JYZA 3AU8A 3GEPA 4N54A 2R60A 1NP3A 5EINA 3D1JA 3HB5X 4L5BA 4NCKA 4B3RB 3VJRA 1TEZA 2WNHA 1JVSA 2RFLA 3WDKA 2VWPA 5DNCA 1LU9A 1QKIA 1AO3A 4LSZA 4R8MA 5BSTA 3IT2A 2VUSA 3UUWA 3IURA 1Q50A 3DTVB 3HLTA 1T2DA 2LIVA 4GSLA 3SKYA 3ZZTA 3CVVA 1UWKA 2ZE7A 1WQ4A 3LQ1A 4U2KA 4YCDA 5DDIP 4JL6A 3U9LA 1V3QE 3ODPA 1XQWA 4BQIA 1ENOA 1P91A 2W98A 4BO6A 5EIFA 1VYUA 2FDXA 2H0QA 3B3QA 1M2OB 1D6NA 3LRTA 5BN1A 5LUBA 4B3TB 4W9NA 3ZQ4A 2G36A 2QIOA 2BMDA 2BKXA 2KW5A 3K09A 3L6RA 4IP0A 1CZRA 1QYCA 1Q91A 4DUGA 3DKRA 4TWZA 3OT1A 2VQSA 2PX3A 2IEIA 3AJAA 3R9KA 4J0JA 1QIIA 2DTEA 3S8MA 3T5PA 3PBKA 1OH7A 2Z6AA 1JR3D 4JSRA 2IYQA 2J4DA 1C3VA 3E84A 3VPSA 1R00A 2CB0A 1Q3KA 1VE3A 1QANA 2ZJ8A 3AF0A 3VJKA 4PICA 5A0TA 4FCCA 4ZYUA 3QKTA 1ZVMA 1R4ZA 5KOJB 1OQAA 1II8A 2PKRA 1K9SA 1KYXA 1NRWA 1NXQA 1S9HA 3HR8A 1K98A 4G4GA 4ZYZA 4OJYA 4HB0A 2C82A 1TA9A 4Q7MB 2Y1FA 1US8B 4GO1A 5BUSA 4RGBA 4F38A 2P2YA 4D5GA 1BO6A 5T7BA 1C1HA 2DLNA 3OT5A 2H5JA 1MGPA 3B9PA 4GLOA 1JMYA 3JW8A 2LBPA 2K2WA 5BSHA 3MWGA 3DE4X 1ITZA 4RPJA 2Q29A 5F35A 2FSUA 3FGPA 2I3ZA 2JAOA 5AVSA 3PPVA 3LYAA 1ZSVA 1DXYA 2XYVA 3OBBA 1UJ2A 2GTPA 2H29A 4IJVA 1DIBA 1X80B 4AD8A 4DBLC 2FZLA 1R37A 3M49A 1TRKA 2A30A 1AK1A 4EW2A 2ZUFA 5TRTA 1G7SA 4LYAA 1W5BA 3H19A 3W4KA 4Z51A 5FEUA 3ELDA 4DPMA 4BEWA 5C3UA 5A1TA 5BMOA 4QGGA 2Z57A 3ETJA 4F46A 3WL8A 3RG8A 4IDQA 2MSKA 5P21A 1NF2A 3K92A 4AQDA 4G0XA 1SXGA 2P90A 3IVAA 4QJ5A 2IS4A 3AUAA 3AFNA 5CCBA 2BSQA 2H57A 5JXHA 2UAGA 3KC2A 1YAJA 4MS4B 1QQBA 3QXHA 1WZNA 3FPFA 1IPFA 1VJCA 3KQMA 4QT0A 2ORED 5GWXA 4Q9KA 1R0CA 2H4ZA 4Q6BA 1IZ0A 5DMHA 4X84A 4DWVA 5JZ9A 1VJ1A 2AI3A 4RPHA 3I0ZA 4XA8A 1RI1A 1GPDG 4KUGA 4Y9RA 1P5HA 3AUFA 2YTZA 3GFGA 3K2IA 1EMDA 3PXAA 2YZGA 3DP7A 4RK7A 4ZPXA 5ICFA 3UXMA 2WJIA 4M1YA 4EB6B 3GHHA 4PSAA 5IFLA 5JQGA 1BWQA 2YYSA 2YV2A 4HJRA 3LHSA 4V24A 3UT5A 4IJMA 3TSZA 2VBCA 3R3XA 4FEAA 3ZZMA 4BKQA 5JNRA 2MYPA 3A3PA 3LUJA 1NDHA 4YJGB 5CA0F 3MCTA 1IN5A 2ZW9A 4N0PA 3MB5A 1XRNA 3B6KA 4CMEA 3BBPA 3KLPX 4LXGA 2DSNA 3DMFA 3UT6A 3KYDA 5AXCA 4QPZA 3A1EA 1X77A 3N2EA 4JNCA 5EE5B 5BQPA 2QNRA 1F0NA 2VWHA 3CY6A 3QBDA 5DMXA 4MHSA 1ZNXA 4IL5A 2QRNA 3LT5A 2W48A 2ZRFA 1NUPA 5K09A 3IDQA 1UMDB 3LCUA 1YDWA 4MYCA 3EGXA 5HA5A 5A03A 4O1MA 2IFTA 1YCHA 2HW8A 1YJ5A 1W87A 2IPNA 2HRBA 3HRKA 1WHSB 2B1IA 2OFOA 4K9KA 1AZTA 4MVXA 1CF4A 2L0XA 4K46A 3B78A 5KTNA 1SJ9A 4RV4A 4KQCA 7YASA 4LG1A 4GPAA 4OHOA 2Q3DA 3BWBA 1SOAA 5GJVC 2J3MA 1LQTA 4MR7A 1MFPA 5ILGA 3UG6A 4F9FA 4JXZA 2Y76A 4S12A 4YXWD 5JS2A 4BQQA 1GPNA 3GNTA 3H4IA 4R8LA 1HQCA 1DG9A 1WPRA 1USKA 1W76A 3FR7A 3EEFA 4LRUA 4AG5A 2C2BA 3RU2A 5I45A 3L6OO 4HTFB 4A9AA 4KRFA 3LGAA 3E15A 3P0FA 1Y1TA 1AUOA 1J8VA 4I1YA 5DTMA 5CUQA 3OHPA 4KO4S 3WMGA 4AMGA 2VP4A 4GECA 5ALTA 1RXSA 1W7AA 1EFCA 2XUGA 3FMVA 3G2KA 4ND8B 4ASUD 2G70A 4BAGA 3SD7A 1NXXA 3G9QA 2QX8A 3AR6A 3ITNA 2P6RA 2PD6A 3I5MA 1FUEA 2FRXA 3GY0A 4FI3F 2B8WA 1U7DA 2B21A 2PSDA 3BX1A 1RFLA 3DMTA 5F1KA 1NPYA 5CVJA 3UW1A 3WOHA 4AMYA 5HK9A 2DETA 3N7TA 1DIGA 1UXIA 2WMDA 3ROXA 4NWIA 1C3JA 4DM7A 1LCIA 3ESDA 1FRVA 5C7LO 5I8PA 2HMVA 2IQIA 3D43A 4O0LA 5JECA 3PWZA 1OJ7A 1OKKA 1KJNA 2GZRA 2WINI 1QH1B 1RJGA 1DTWA 3HB7A 2P5UA 3VOSA 1M0WA 2WTXA 2ETVA 4QJBA 3T1QA 8GPBA 1TDJA 4KH1A 4Q7EA 4U8HA 3IBTA 4XLLA 1YXMA 4YEDA 4DIBA 1M1XB 1P72A 3IUMA 3CZ4A 3VR5A 1UPUA 5CA0A 3KDSE 4RNDB 1QAMA 2R6JA 4IRXA 5HXAA 5I7OA 1M2NA 1ZA2A 1RM5A 3AFHA 2IZOA 4LCJA 1LX7A 3CJQA 2C83A 4IDNA 1ZVQA 1JF8A 1Z5NA 3M5WA 4GKBA 2W6JD 1TVEA 3OBIA 2F48A 1KNQA 1YHZA 3O0DA 5ELLA 1E0DA 2WAYA 3WV5A 1R4MB 2G71A 3ISVA 1MJGM 3OD5A 1C2YA 4ZRMA 3CX3A 1M73E 1ZAKA 1Y1SA 2XUDA 2I4IA 1D4OA 2VYCA 4EY6A 1PUIA 5D85A 1NSTA 2WPDA 3ZV6A 2OZLB 3OZCA 4D25A 5FUQA 5I51A 3KB1A 2IBTA 4IFEA 2JRLA 3A1TA 4O29A 4KR6A 3P1JA 1XXHE 2RHTA 3U4MA 1BVUA 1Q1AA 2H1CA 2IHJA 2QTLA 3E53A 2JIDA 1L7MA 1VGQA 4XWYA 3GA5A 3SHVA 3LPMA 2XMSA 3FA2A 2RGNA 4E5KA 1A9YA 4C7OB 2UXCB 2KPOA 2XZPA 2FF7A 3Q5DA 4YWJA 3VPXA 5FOSA 1OA0A 3NTUA 1H85A 3GGOA 4WGGA 1KYZA 2BMJA 1IWPB 4BVLA 2PL1A 3EF0A 2PZFA 3NP9A 1XCGB 2AVNA 4W7SA 3FDIA 1Q0RA 1CQIA 3F6BX 4HH3C 4RGVA 4M1MA 1IXYA 1I6KA 3B7GA 1SELA 1XD9A 2GAFA 1M2VB 3O8NA 1XD2A 2DJ5A 4V03A 1KZ1A 4LZLA 1LKZA 2I99A 4PNZA 5JADA 3JWGA 4L74A 2TSYB 3ANYB 1PL6A 3IC5A 4JMLA 3DUFB 1MKYA 5ULLA 4LVOA 3IEKA 3FVVA 3K5WA 4HWPA 4GI2A 2GYWA 4EQZA 1VMDA 4OATA 1U98A 4ACAA 3F97A 1QXSA 1W85A 3FI0A 4KVZA 2QRPA 4HY3A 2IOHA 1UXKA 1ND5A 4LRTB 4KO1S 3EIQA 3S3TA 4K9NA 1Y8AA 5FA6A 3RFUA 2J46A 3FGNA 2YRFA 1XG5A 2P2SA 3T5CA 1XZGA 2HKIA 2YXNA 3U09A 1UL1X 2AN1A 1Z47A 1VLQA 3PC7A 1QR6A 2Z2JA 1OBCA 3B20A 3QUTA 1NVVQ 3VHXA 3GRKA 4Q1CA 3JVEA 4QAQA 3A9VA 3UMCA 5A3JA 1P8AA 3FIUA 1U3GA 4MVWA 1HG1A 3OU7A 5EI5A 3WGHA 2PX2A 8ATCA 1MU0A 2FG7C 4R3WA 3WMEA 4EWLA 5BW4A 1LH0A 3T7KA 4YAJA 2JJ8A 3UUGA 2GK3A 1EG2A 1GUZA 1Z0KA 1H94A 1D0IA 2P77A 2BFBA 3I04M 4JFAA 3OEWA 1HDYA 4GIBA 5F78A 3G8AA 2D3TA 1OVGA 2X6QA 1RTTA 1E9FA 1ULHA 2ZM5A 1LJUA 2QPLA 5GY7A 4RTLA 3S70A 3KLMX 5A5DA 4FFLA 3Q3CA 1V6AA 3FCXA 4WLNA 5C5CA 1U5BA 3VR1A 3UAOA 2GO1A 5BYAA 2X9VA 3LLVA 3PUIA 1QQ6A 4JEIA 2R8RA 1AUVA 4NR0A 3FOAA 4P84A 3VDMA 4C76A 2XMZA 4U7FA 1V9SA 2FZGA 4G67A 4YYEA 2RBKA 4R0NA 1D1PA 4WZZA 2OCBA 1BVYF 2FN9A 3PC8C 4WK6A 3BYZA 4MI3A 5AHOA 1WDKA 1JBKA 5FHRA 1JVNA 3KJIA 3Q2OA 3G89A 3KB6A 3T34A 1E0AA 4MB6A 3JTEA 3MERA 2BFEB 1TM5E 2SECE 4H7DA 3AY0A 4P82A 3QPBA 2OBBA 4KMSA 1ECFA 2C9OA 2MYUA 1H2RS 3H8JA 1WZ2A 3S2YA 2BBWA 1QONA 2YZKA 4LKRA 2YIMA 5C81A 1O3YA 1ZD4A 1WXEA 1K97A 2ZETA 1P1FA 3R5XA 4RVDA 5JFOA 5K3OA 1IJEA 1G291 1X0VA 1Y42X 4QJIA 3V46A 1VE1A 4ENUA 5K6RA 3C16C 3ZDCA 3FYTA 2VHWA 1BXKA 1SHJA 2WHRA 1J0XO 3CUWA 4HNTA 5FWNA 4RVHA 3W90A 1YHNA 2I6XA 2QJOA 4K0KB 4AZVA 1QMPA 3VMMA 5FNZA 1QIJA 1FPMA 1A71A 3FYSA 4ITVA 3BOSA 3ODGA 3B52X 1E0SA 2BPOA 3UW3A 2C5LA 4A0GA 5CK4A 1MC1A 2BEWB 3HM9A 1DB3A 1F3OA 1TMOA 2AZXA 1YQTA 3BBLA 2DM6A 3A4LA 4GI1A 4RQUA 3RS7A 5LYJF 3A0RB 3LNCA 3AQIA 4R2WA 4D8VA 4FMCB 9LDBA 3H8SA 2J31A 4ND6A 4HNQA 4AMUA 1R6UA 1CR1A 4UOZA 4UEKA 2UZ1B 1WCWA 3SLGA 5HRAA 1TI7A 1TUBA 4H0CA 4U7HA 3ZQUA 3I6QA 3RSQA 3B60A 2FLVA 3UPDA 1O6GA 2D5BA 4ZAXA 1GDTA 4X94A 1ZJ6A 4ZJUA 1E5VA 4OQQA 3X1ZA 1JIQA 5IHPA 1GQSA 1B00A 2OV3A 3C0KA 3Q7IA 1QB7A 1LZKA 1KJ8A 3GLFA 1GV1A 3E1KA 4UBJA 2A0KA 3MWYW 3QVTA 1ACJA 1N0WA 1R3DA 2ZRGA 3F67A 1UZAA 4UXJA 1R0KA 3S99A 2V9CA 3CVOA 5C51B 2FUG1 3AVWA 2ZSJA 1LSSA 1W19A 5K8LA 1G20E 2V0NA 2WT9A 4XPIB 1O95C 2VYVA 2BHTA 4PPGA 2JNWA 3ZGLA 3Q15C 4BRUA 2IPAB 4LHEA 4EELA 5AIAA 4OJTA 3IPYA 2PSEA 3DMRA 4Q4LA 3EX7C 1UKYA 4GMHA 3PEYA 4IUDS 1DQRA 3N0VA 3ZHYA 2NXJA 3TH5A 1XKLA 4LF4B 5U1PA 4ZI7B 3PE3A 4RM3A 4KL8S 4C43A 4OLAA 4DTIA 4TKMA 1E7YA 3RWOA 2P6MA 1SZCA 1PT5A 4IIJA 121PA 5EY5B 2JHGA 2WKPA 1I4DD 2B1QA 1NBEA 1VJ5A 2O7NA 2QRMA 4FQ5A 4OOFA 5A4AA 3UMVA 3X3HA 2ORIA 4FGSA 3U3ZA 1SBQA 4CFSA 5K7SA 5GVSA 2SCUA 4P93A 5JYBA 1Z3IX 1I2CA 3OESA 4F1KA 2DBZA 1TM1E 3T3DA 3THSA 2DULA 5G0UA 2J7PD 3PQ6A 3P0IA 4Q12A 3TLXA 1OI2A 1PHRA 2P6PA 4W5WA 3VU8A 1JEOA 1M7BA 1II9A 4WT7A 1IHPA 2F3SA 3OCYA 3PUJA 2VF4X 2R751 1XKQA 1TOAA 2QTFA 2W6IA 3RG2A 5DCLA 4AMZA 1PEKE 2W2QA 4RJ2A 1GSAA 2Q2VA 3NTVA 3MVEA 3UH0A 1IVYA 4M9SA 5GOZA 3TNFA 4PCVA 1U0RA 4BKPA 5JSUA 3USCS 1NBAA 4GZ5A 2I7XA 1HZZC 1YZ3A 4OK6A 3LP5A 1N6KA 2FPIA 3V7UA 4WLUA 4PSDA 4C22A 1QCDA 1U7WA 3L6UA 3QI7A 2GSDA 1HSZA 2A9RA 3JZDA 4YRCA 4M87A 3AR4A 4DXAA 4U6NA 3ANTA 1DX4A 4FILA 4KXMA 5KYGA 5HKBA 2ZEJA 5FPTA 4AY2A 2R7AA 4U2GA 1ZOLA 1OYYA 2QZPA 3QKSB 3I9JA 4IUBS 4X8OA 3QWHA 1ZJ5A 1HE3A 5A6VA 5HVNA 1KY3A 2YJNA 1N2ZA 3AI2A 3CUTA 3JPWA 4RELA 4WLVA 3CH6A 1B6TA 3KEGA 3Q72A 3RBVA 3WJ1A 1ECPA 4MR8B 1NTOA 3F7MA 4H7FA 2ZPTX 2OZKA 1WBJB 3D6MA 5IK2A 1E5DA 1P1HA 2UUAB 2F43A 5I7SA 4D9FA 4DR5B 2XYRA 1WCXA 1SXJB 1H4QA 1XZKA 2I4TA 1U8AA 4ZEVA 5HDQA 4DBLE 1FLNA 2XOXA 1OU4A 4I4TF 3WR5A 3GVIA 1P2SA 1QV7A 1VSQA 2FZEA 2Z9BA 3DXYA 4IDHA 4OFZA 1C1XB 4OQYA 3PUYA 3KQUA 1XA0A 3HGMA 3EBLA 1M72A 4UQOA 2C94A 3AEKB 2X2FA 3PQ5A 5A4KA 2PEZA 3DJYA 4Z7OB 4G25A 3CLTD 4KUEA 4ZJYA 4IGKA 1F38A 2D1QA 2NTNA 4F3TA 1Y80A 1WXGA 4C6TB 1FNSA 1YO6A 1O2DA 3EH2A 4P32A 5IW8A 1SD2A 2FZKA 1P61B 2WSSA 5DU2A 4E31A 1Y5RA 4EH1A 1OLXA 2G1KA 4DLAA 2H1OA 2OFXA 5FBWB 2PHZA 4B33A 3NHPA 3PC3A 2JS7A 2O2CA 3K1JA 1P6XA 1UEIA 4H3VA 5DGTA 5FFNA 3O38A 3DQZA 1U0EA 1JEYA 4E46A 5JT1A 1YAHA 1YL7A 2ZROA 2EFYA 3PFWO 2KS6A 3EGOA 1EDEA 3AM4A 4D92A 1KTVA 3M4ZA 1IWBB 3TLCA 2ODAA 1FEZA 1YGPA 4OAPA 3HBMA 3NLLA 2IK8A 2Q7OE 2ZJAA 3DJFA 4KXNA 4GRIA 5L8VA 4QYIA 3KYCB 5DHUA 3EGVA 4LXXA 4GSYA 3U40A 3MA0A 3Q98A 2OY0A 3DG9A 2AG8A 4TV9F 1IUKA 1NOJA 4IZ6A 4Q47A 3K5PA 5ALUA 5LXTF 2HV8A 2XF8A 5HCUA 2XYGA 4HZIA 5ERYA 2OZVA 7MDHA 5AI5A 1JHUA 4FYKA 4GWLA 4HH1A 1DHTA 3FM9A 1CQPA 5H59A 4JZKA 3OEHD 4BNUA 5JO0A 4L0DA 2P7HA 1NF3A 4HPXB 2I1LA 4X6LA 1VIVA 3L49A 1DQYA 3IP5A 4UMVA 1TM4E 1ISRA 1PT6A 3UK6A 1KU0A 1QCZA 1U1CA 3DULA 2WNIA 3K4HA 4FFVA 1HLFA 4V3BA 5KYKA 3BWYA 5B3JA 1CRPA 5C1BA 3EDOA 4C2UA 2W8BA 1EB8A 1GQFA 1WS6A 2FFJA 3LW8A 2Q27A 1K92A 2HXYA 1BS2A 4QBGB 1XDWA 3HSKA 3I2FA 1XUOA 4IVQA 4KJZA 5CX4A 4BBPA 4RULA 3HYTA 4ZV4A 4PX9A 1UFKA 2QUKA 3B53X 3E5RA 3VV3A 1Z06A 2QR3A 4PPFA 4Q48A 4CVNA 2CVZA 3WQRA 2VDRB 2ZU6A 4UPEA 4YUWA 1XNQB 3C15C 4BDTA 2HYDA 1V1JA 2Q49A 2P9EA 4OGGA 3FYDA 1QMGA 2I33A 3DV0B 4P6VF 5JPIA 4A2WA 3UKJA 3G7UA 1DRVA 4U2FA 1ID8A 1HA3A 2JZCA 3BE5A 1OVMA 1TKBA 4M8NE 5DXJA 3A2LA 1VYVA 2A1TR 3RNOA 2Z8YA 3IBCA 3TR0A 2H5EA 2IV3A 5CT5A 1ZI6A 4UU0A 1IZZA 1M83A 1OBOA 1X7WA 4BCDA 3NQ41 3PDWA 3J7AC 4D3DA 1YV9A 3ZTYA 5FYQA 3RVBA 4YK7A 5H70A 2R5WA 3OMWA 1Z13A 4F1WA 1BKYA 1YFLA 2QZSA 2WG1A 1GZ7A 3ANNA 3MUNA 1ISMA 3AKYA 1DC8A 3LK7A 4DTCA 2YHUA 4JB2A 4RJLA 4ZA2A 3K31A 1SD5A 3R41A 1JZTA 2XHZA 3RYTC 4BMXA 4EDFA 5IJXA 3QX3A 1BU5A 1EXMA 2R2AA 3W05A 1PVOA 4XARA 5IT0A 4F93B 4JITA 4G1VA 3OFSA 3T12A 2XOKA 1CUFA 1N0VC 5KIAA 1N32B 5BQOA 5CHYA 1PR2A 1P9LA 4MQFA 2Y71A 2Y6VA 4IYRA 2H08A 3PXEA 5FA5A 1JI0A 3CCFA 1ZY2A 1UOQA 2V59A 3CZ5A 2AHOA 3QF7A 2FEAA 3HJGA 3LPDA 4ZAFA 5G4LA 2JLRA 3OCXA 3RE1A 4NOMA 4C04A 4QBHA 2C7PA 1PX2A 1RWMA 2AXEA 3LBNA 5COBA 1FU8A 4QDXA 3BMNA 4J16A 4V0SA 1EBFA 1H2ZA 4XFJA 5AXDA 3RTEA 4W8HA 4ZAWA 4Q16A 3PFGA 4Z0TA 2C98A 2FWJA 2IW1A 2IYNA 3SHWA 4ZK2A 3ZE8A 4TMWA 1PYOA 3B1ZA 3BIJA 4XGRA 3ROPA 5BNTA 2EW2A 5TB5A 2KI5A 1Z0AA 4TSFD 4KIJA 4QPJC 1U3WA 4MUIA 1PIWA 2XBMA 2HMUA 1H42A 4PBSA 1W88A 1T9DA 2B4TO 4YWHA 4AJHA 4AYXA 3A2NA 4PC3A 4FSXA 2EWWA 2PXXA 1BKSB 4BE7B 1JG7A 1ZOSA 3H8VA 4Q1BA 4B4UA 1ZEJA 3FZEA 1F60A 1RI5A 1SKMA 2IXAA 1RDFA 3UK7A 5DTEA 2CLHB 3RAPR 1WV0A 3WO0A 2KX7A 1RZRA 4CPDA 2J6BA 5IYZB 1XU9A 4TV8F 4QJ4A 2P3SA 3Q88A 1S7GA 5FXMA 2EFJA 1CG6A 5FAXA 3HKBA 3TLEA 4EEKA 4HP8A 3VXKA 1R0RE 3DHYA 3H9BA 3MTAA 1O9GA 3PUVA 4WBNB 4ZYWA 1NYTA 3O8OB 1XYVA 2WB2A 1I3LA 3IA2A 3P2IA 3WGOA 4ENWA 1D6JA 1M1ZA 5TGZA 2X0EA 4KMOA 4M9ZA 4TZ6A 3L7OA 3KUUA 5EYPB 1S3FA 1N6LA 1JG6A 3ZD9A 5LP1A 3RADC 5TIIA 3U31A 2Z2YA 4K2HA 1AMUA 1TGVA 1PK7A 4YCAA 2OG2A 5EXPA 5B7NA 1K68A 2MSEB 1OGIA 3T7EA 3KBBA 4BWFB 4AJOA 2O8CA 1K7SN 4DDTA 3ZNNA 2F8MA 4EB3A 5IBCA 4DJDC 4YIHA 2FN7A 2XE8A 4NV3A 5LQSA 5K2OA 2AL7A 4RK0A 5I9NA 1D04A 5LLDA 4P54A 1XQ9A 4K3VA 3AZPA 1PG0A 2QN2A 4LNHA 5IKOA 1Z6XA 4U8GA 3LL7A 1XCLA 3RYFA 4EYSA 1N5LA 5TARA 2P68A 1OFUX 3MELA 4PV7A 3FNEA 1T3SA 1DQPA 4LHWA 4P08A 1ICEA 1N6HA 2GD1O 1Y6FA 5AW1A 2PRIA 1GU1A 1UAAA 5BWLA 5E7MA 3DMDA 4HNAA 3DHWC 4WXEA 3UENA 1FMFA 1T8SA 1KI2A 4TUYB 4IGIA 1EQAA 3EXEB 3PRJA 4I9NA 1GR1A 2H11A 3VR3A 4MYRA 1R0ZA 3OLVA 4C6RA 3A9WA 1MORA 3GJ7A 4Y1GA 1WP4A 1XHLA 2C54A 2MINA 3FNRA 5I7AA 4DA8A 5D5HA 4UCWA 3TLYA 1UJNA 1C9YA 1W4LA 3AB3A 2XZDA 1MABB 1UAGA 1TD1A 2ZPUA 2QLBA 2XA9A 1C1DB 1QE5A 1E63A 1XXHA 3H75A 2WIGA 3HPRA 1SK8A 5FQNA 5GPBA 4D7AA 2MTBA 3A04A 5CA1F 3K8QA 1AKEA 4UAJA 4UTPA 2DQZA 3WJ2A 3E6AA 4N0QA 1G8YA 1Z83A 3C4VA 1OI3A 1BYUA 1EFVA 2ES4A 3IELA 1VG8A 1CR4A 3IQHX 4WY2A 4FEYA 2ZI6A 5BNFA 4YRMA 4Q0MA 4YAIA 4QLOA 1BJKA 4KNYA 1U94A 4BX0A 1N34B 1N4AA 1DL5A 2YL2A 3WL4A 1Z38A 3ND7A 1CSEE 2VF8A 4K40A 5GV7A 4HLUC 1YI8A 4WQMA 1PJBA 3VAYA 1N2EA 4IJQA 3NVMB 4TMZA 1T29A 2R9VA 4D6XA 2ICAA 4BFLA 2VP2A 4UEWA 3RRMA 1W0KD 1WPGA 4RTRA 1IJFA 3EY4A 1SURA 4UNQA 4NCBA 4NNJA 3OU6A 3CB2A 5H02A 1HMYA 3PHCA 4RAOA 2NU6B 4OXNA 1SXJD 3QFHA 3RYHB 2I3AA 5F51A 5JW6A 4NAUA 2O8EB 2QTMA 1PEDA 3CBGA 1DQSA 3KP1A 2WT8A 3NXKA 4Q19A 2TECE 1LX6A 2AC7A 1DIHA 3G5TA 1Z2DA 3TPFA 2CJWA 3ZBQA 2H2AA 4ZN6A 1PJCA 2ZFUA 3Q6MA 4B1FA 3VQTA 2HWWA 3OWHA 1G64A 1WCYA 3K8ZA 4K6FA 3G0HA 1X9GA 4OYHA 4QBFA 4KB5A 4HDCA 1G66A 3A4MA 3OE1A 3PHLA 4Q6WA 2ZXEA 4BLRA 2XEDA 3VR4A 2GN4A 3WLMA 1V7PC 3QTBA 2PYZA 4C2BA 2HXSA 2I1WA 2JJ2D 4JXKA 4OJMX 4QGAA 3H1GA 2WKSA 1W96A 4JI6B 3FF4A 1EI9A 1WVMA 3OTGA 2CFSA 1J21A 2W0SA 3CM0A 4W7IA 4X3OA 2ZJ4A 1P19A 2OK8A 1R2QA 1S02A 3FWPA 1DNPA 2ZWAA 4ZO4A 1XRMA 3GRYA 4L4RA 3ZLUA 3TVYA 1EJ6A 1ZJWA 2FWBA 4HDRA 1ONOA 2OFWA 3HDYA 2C9BA 5EIHA 3KKQA 3RS8A 1OTHA 1BA2A 1PP4A 3FG9A 3NZEA 4AW9A 2ZG6A 2HJGA 4H27A 4RD4A 2VC2B 1Q92A 3UN1A 3IXQA 5JBQA 3Q12A 4MQMA 4CMBA 1XHFA 2HLDD 2VKQA 1OHHA 5T5QA 3KUXA 3UGJA 1X7XB 3SDBA 1TUIA 4CM3A 1YFJA 4CM5A 3EXFB 3L7AA 2MSWA 3DOEA 3EEYA 3GARA 2CDAA 5JSFA 5K5EA 1ARZA 3U44B 1TW2A 2BFDA 5C8XA 3K9FC 3NGLA 3ESAA 4DMLA 3ETLA 1VSVA 1Y9ZA 2BBOA 4P35A 4PS1A 3U3XA 1FFEA 3QIAA 4M53A 3EAFA 3GJ6A 3TTWA 1H2YA 2VRCD 2WAXA 1L4UA 4MHOA 2G77B 2PTHA 1EM6A 1S0UA 2OORA 2GPTA 1NVUQ 2Q5HA 2HQOA 1AMOA 2WIFA 4RHUA 3SXJA 1MQSA 1WZCA 5IKMA 5JAMA 2PFKA 5DT9A 1K5DA 1JAHA 2QN1A 3GUHA 3OC6A 3PZRA 3T6KA 1P7VA 2P9QA 1RS0A 4LVCA 5GM1A 3A4TA 4PYOA 3QKIA 2VPIA 2VPWA 1NG1A 2YHAA 2JA2A 5C1IA 4KXQA 3STTA 5E6UB 2FI1A 3LKBA 2V4UA 1X1RA 4IIDA 3FCAA 3IVGA 1ZQ1A 5HNKA 4BWYA 3ROTA 2DSTA 4AN0A 1K9VF 2EYQA 1NDQA 3QLUA 1JS1X 3QP9A 4Q1FA 4TMFA 3CX6A 1A9ZA 1WRBA 2XSZD 1D6SA 2RHCA 4XUDA 3VJLA 3TG8A 2NO7A 4N12A 4EJFA 3CZQA 3TOSA 1PSWA 4EVSA 4HOYA 4GPTA 4R1UA 4HWTA 1MO5A 1UMBA 4PSVA 5BQ5A 3HK2A 3UAVA 4RL4A 2QY6A 1MX5A 3BRWA 4M7OA 3ZV5A 4QHYA 2B5OA 1N6PA 1XVVA 5LYJA 3RJ5A 5AW8A 1H4VB 5F2NA 2I80A 4YP1A 5EHZA 5L40A 1KFCB 1UEXC 4D4LA 1QLHA 1MPXA 1BWSA 4B47A 2M2IA 2ONYA 4TS3A 2QUZA 3IP3A 5FH9A 2OHJA 1OWNA 2J4CA 3DZFA 2O20A 3O75A 2V9ZA 2R8XA 2XNJA 1XDBA 1CY7A 3PWSA 2N47A 3VC1A 1H2HA 3QEBZ 2I65A 1UM9B 1SVKA 2GK6A 5JYEA 3CG4A 3OETA 2E49A 2I2AA 3AINA 3GLTA 3QOYA 1G20A 2QGFA 3I39X 2FUEA 2XWSA 4L5JA 2FEKA 2XTAA 1FS5A 3ICPA 4IV8A 1E2GA 1HPLA 1FXUA 4IVNA 4WEQA 3GLIB 4XYEA 1Q19A 2BFFB 5H81A 3VZRA 3WSVA 2UUCB 1XRLA 4G5HA 3QUBA 3RIYA 4DZTA 1DJOA 3ZDEA 1S8NA 2XDWA 1R6BX 3PGXA 4I50F 5EXDA 4CM9D 1L8OA 4XQCA 3COWA 5L6LB 1JHYA 1H3FA 1JQEA 1RQ7A 3IAUA 1SUPA 2EWVA 4M0PA 5LDHA 4H59A 3ZD7A 1CXZA 3PU6A 1RZUA 2QQEA 1J5XA 2XDQB 3UNXA 1A1VA 3H2ZA 4EA8A 4WVLA 3SFVA 4YJ3A 4IKEA 1XJCA 2PRZA 4NCIA 5EJ6A 5BV8A 3BKWA 3PQ4A 1E3SA 3MJCA 1B43A 4TV9B 4ZTUB 2JBAA 2BWJA 2EGGA 2WU1A 1C3EA 3E5NA 3MTEA 4GWKA 4LSWA 2PN1A 1M9NA 3DDHA 1VOTA 2GJSA 5LSAA 5EPOA 2NMVA 1QC5B 3EE6A 1TC2A 2AG1A 3IUSA 4P8RA 5F1PA 4PNEA 4LOJA 2O6LA 1T4MA 4AG6A 4ZQHA 2ZYDA 5LBUA 2IXDA 2XWJI 2DWOA 1RHUA 5A06A 3DHEA 1WG8A 2QW1A 4O4LF 4OYYA 3MXOA 4WADA 2HA6A 1E6WA 4ZAYA 3MMNA 4MQ5A 4TTSA 5LP6B 4OX9B 3A9TA 2WAOA 2OCKA 3IO5A 1KARA 9GPBA 4D5EA 1YRHA 1BOFA 3AW9A 4JIGA 3B6IA 2HFKA 1N36B 1SA0B 2C4NA 2PXCA 3IJEB 5FLYA 5GONB 2E7ZA 2JFZA 2Y1GA 5B37A 1SVUA 3AEYA 1OBVA 5BN4B 3T5DA 3W1VA 3WMRA 3ZYZA 2BUCA 3AI1A 3IP9A 1C29B 1MB9A 3CZCA 1SOWA 4WCFC 3P9NA 3RRXA 5JZSA 3O8RA 3H3FA 3L8ZA 4OHXA 4CT0A 3E9CA 4PFQA 3K96A 1WAMA 3WNDA 3T54A 5ADHA 3OF2A 5CURA 1CZHA 1HETA 2RH8A 4UE2A 1BQ3A 2XLCA 3M70A 5ALSA 1X15A 3N53A 3B8HA 4MAAA 5DP2A 5UKDA 4Z4QA 3V3TA 4XCQA 1QRDA 1X2EA 1XTRA 3ZNQA 5HJEA 1C3OB 4NE2A 1G3QA 1L1EA 3ZE1B 1W30A 2X5KO 4N8EA 2NYRA 5AVJA 2J0UA 1T1GA 2B8TA 3HJAA 4PC6A 3GNSA 2G9ZA 1U8FO 3OLYA 2WWVD 3TJRA 3LQRA 5ECYA 4DSOA 1R10A 3HM2A 1R16A 3KE9A 4IJ6A 2GK4A 5C46F 3FHTA 3FDXA 4NPCA 1YRLA 4LNAA 4BB5A 5T4FA 4JQOA 2CFCA 2X6RA 4URHA 5IMSA 3VPGA 3AY3A 4QGSA 1A2OA 3A58B 3FMFA 4EPTA 4IQ4A 2AA3A 3QLVA 3N74A 3MWKA 1RJ9A 3COYA 1Y1RA 1JHQA 1BU8A 1RQPA 1UCFA 4FCWA 3ZX5A 1ACLA 1KMNA 4WECA 2W2LA 4I4TA 3WTCA 1GAQA 3G9ZA 5CT8A 1TQHA 5HS6A 3E5HA 4KO2S 3OOWA 3ILXA 2LUOA 4MUHA 3HE3A 1UBEA 2QD2A 3OQIB 2C4HA 2MDTA 4OY3A 4IAOA 3IX7A 4WMLA 1NMSA 2CCGA 4K6HA 1IIBA 3IAFA 4OSPA 2XB4A 4Q00A 3V33A 5JQWA 1JILA 3UAYA 3GLGE 4LZWA 1W52X 3LY5A 3W5VA 4Z53A 2MWMA 1V16A 1PNQA 2QORA 3Q3VA 4RACA 2EFHB 3STHA 3UMGA 3HYLA 4M9QA 3JD4A 4DUPA 4R69A 4POAA 5DTRA 3OPQA 1H1LA 2V7TA 4MVCA 1V4NA 3I9OA 3KZMA 1N5KA 1U0OC 3NU1A 4D26A 3H5LA 4BJ3A 4A2QA 3CNQS 4HPJB 5DW0A 3E03A 1Y1QA 1BG6A 4EG1A 1ZICA 1BQ4A 4OSEA 2ZBGA 3RHZA 4WOCA 3E8MA 3T15A 3GJRA 1G19A 1O08A 2E9SA 4TWIA 1KO1A 2HLPA 2QAGB 3WB2A 1QV6A 3HCBA 3L6BA 1FX0B 2ID7A 3EODA 4AJPA 1PV4A 3FIJA 2GR9A 2ANBA 1BHSA 3KD2A 2DEUA 1Y89A 3GGGA 3PF9A 1MDFA 2ZI3A 2B0JA 1U2EA 4Y1EA 5CPBA 3OZIA 3HCEA 1JG3A 1HTTA 3UJNA 3MMZA 5JASA 1H05A 1ZHOA 1X74A 2A58A 1SH7A 4E7PA 3NBXX 1Y8QB 1EVYA 4AT1A 2XCLA 3G2PA 1Z08A 2Z3ZA 2ZWIA 3GLSA 3M1IA 4XR4A 3R8CA 5CFPA 3ZXUB 4ZDJA 2GFQA 1BE0A 2BEUB 4MLZA 5LC1A 1VPEA 4BVJA 1AUXA 1SBIA 1P0QA 1E98A 1TQ2A 1ZGHA 4PZEA 1VZ2A 1O0SA 1BW9B 2CFIA 3UJBA 3GNQA 3C6KA 4G5SA 3SDZA 4O2BA 5AOCA 2EP8A 2IUSA 5FLXA 1KGSA 3W9BA 4BQPA 3BPSA 4FD3A 2WV9A 3P0EA 2WJGA 3QM1A 2LE0A 2KM1A 4BNIA 4Q4HA 5E2IA 5EOVA 3G5MA 3W04A 2WD9A 4ALLA 3FRIA 3ONDA 2A94A 4R2KA 3WYDA 1UKZA 4LJ7A 4B34A 2E4AA 4DIUA 2DBYA 1FA9A 1RVV1 1Z82A 2NZ2A 3OZBA 4BO0A 4ZIRA 4GZ6A 2QF7A 4Q4AB 3DCYA 5I9LA 2RHHA 4OU4A 4HDQB 4NLLA 1E64A 1QCCA 2ZDHA 2ZTSA 3INGA 3MLAA 3LTEA 4PFJA 4PRLA 5FTNA 2JFNA 5I7WA 1ETHA 2RGUA 1E1YA 2DUJA 4YVFA 3UGTA 1VG1A 2CFRA 2OILA 3QFCA 3RTBA 3VH3A 3QE4A 3LF1A 1CP2A 3AR2A 5KTPA 1DX9A 1EM8B 2YVKA 1IK6A 3H2BA 5FWDA 5HIJA 1QO9A 4MO9A 3LXXA 5D84A 4ATNA 2DPGA 3WRWA 3THXA 4YRIA 5DM70 4Y0NA 2XBUA 3ELYA 2BZ0A 3Q40A 4GS5A 4XX0A 4WKGA 4PIPA 5DYGA 3WC4A 1OTYA 1GRRA 1Z4KA 2ZREA 5C7OO 4GD3Q 4LEIA 4OP1A 2QXUA 1G8GA 1L7OA 1QVVA 3MPOA 1RAGA 2A5JA 4DVGA 1ZG3A 3RFFA 1NNLA 1Q1BA 4MMZB 2ATIA 2INGX 3EFHA 1LS6A 4IGAA 5AKHA 5E4YA 3E8SA 2H4YA 3DZDA 3MWLA 4LJ5A 1XCPA 2HT6A 3SE0A 5IUJC 2EX0A 5EE1A 3TS1A 4E4TA 1F9AA 1T25A 5MFZA 2NPIA 3VZCA 1E66A 3CKKA 1WXWA 3Q5GA 3W6PA 3SS9X 3GELA 3IMKA 4WX2B 1JSLA 2DH6A 1JJAA 2B20A 4M76B 2IL1A 3FJYA 3FZGA 3IBYA 1XZCA 3TI7A 1YB2A 1U02A 2NZJA 3FKSD 3CR7A 3MBOA 2JIMA 3NYWA 4MI6A 1KDYA 2H18A 5KO2A 2JLCA 3FLEA 4ALKA 2CZQA 2B69A 3CIOA 2GM4A 3SG0A 1NVBA 1N8NA 1YQUA 2G40A 3L0PA 4TV8A 2WIBA 5KQMA 3GBSA 5E9WA 3IMCA 1KWGA 3I2JA 3IMEA 1R6DA 3PEEA 4R7TA 3UMYA 4DLZA 1N6RA 4OHUA 3AVOA 2PQ6A 1ZK3A 3CT6A 3I01M 3SR0A 2C2WA 3H16A 4M1EA 4R1MA 3WMXA 2EVWX 3KXKA 3TQSA 3AIMA 4IFTA 4M22A 4CLDA 1GPYA 2I9PA 4OA5A 4DIDA 1L5MA 4ZO6A 4C01A 3U39A 3LVFO 3REQA 1OXUA 3AU9A 4G81A 4BXOA 3F9RA 3R7DA 3TGPA 1XALA 1H0SA 4CYMA 3MMPA 1B93A 2QN3A 4N41A 1WMDA 2M6LA 1EDBA 3UVEA 2PT5A 3M6VA 4AO8A 2Q50A 2XUPA 3AP3A 3BF8A 3QVGA 4CLOB 5HWSA 4JFRA 2QRZA 4JLKA 4WA7A 4MRMB 3DAOA 1ADJA 3D6AA 1H2FA 2D54A 1YBFA 3EGWA 1LZLA 3KO8A 5AKJA 4F2HA 3L07A 2VRNA 3VO8A 4FIZA 2OYSA 2W22A 1D2RA 1QS0A 1R9NA 1TVKB 3FJOA 2BI4A 3L6EA 4Q21A 5FP0A 1QSGA 2NAFA 4EO4A 4MJLA 5GMOA 3O4GA 2QE7A 2VDLB 4FHDA 3W34A 2HPHA 2C3UA 3A10A 4N3AA 2KHZA 5K0FA 2HHCA 4GDFA 2HZ7A 5AW4A 4FLMA 2ZULA 1TK9A 4E5UA 2C03A 1VMIA 3QJYA 3BHNA 2IC5A 3SBOA 4P22A 1T0IA 1PGPA 1LDYA 2VL7A 5AI9A 3TOVA 2F1JA 1XIVA 2WABA 3NTOA 4J1TC 4LXTA 3HJUA 1TKCA 3OA2A 3OFKA 3P2YA 3SJUA 3IP8A 3QXXA 2Q4BA 3RYIA 4RZ2A 2A3NA 3C8MA 4U1RA 5BNZA 1D4ZA 1ZUHA 2AEMA 3GYBA 3OJLA 4HNRA 2XMGA 4WNAB 4B32A 3D3NA 1Z4LA 3P27A 1CHDA 3PNLA 2HMYB 1K66A 3EZFA 4PGGA 5FBQB 3ZK8A 1EFDN 4JVSB 5AVTA 2QUAA 1U5AA 3DQPA 3UK0A 2ZM6B 1HURA 4P86A 4YI5A 1Y6ZA 2X7HA 2YN2A 4XEUA 1JHRA 3Q4GA 3KKEA 4LOAA 2H06A 3AHJA 4MLDA 5CA1A 3IKJA 5HPYB 3HB0A 5JPCA 2ZOSA 4HG2A 2YZNA 3ZQ6A 4D97A 3IV6A 2GASA 3RAJA 1OROA 4HVCA 4A73A 2R79A 1QF9A 1QX3A 1P0MA 5ABPA 5D01A 1FQKA 2WJ6A 2YQ4A 3K1YA 4GP9A 4NEHB 4DDVA 5BN3A 3KB8A 4JI0B 1Z7BA 1DBIA 5K20A 3UWSA 5TMPA 2BM0A 3FTCA 4FOLA 4L6AA 3FE2A 4MPTA 2WD7B 3K6JA 2FUCA 2YFYA 1V0JA 4RZUA 2D1FA 2PLNA 4U00A 2CJXA 3QMMA 3KHSA 5CXUA 1V37A 3KIPA 3DKVA 4V0OA 4H4EA 4NS4A 1OAKA 5HSGA 3ROGA 4YMGA 3K16A 2XUJA 4AYWA 4FP9A 2GBLC 4IEIA 5EWMA 4A82A 4CQLA 3I23A 5JQGB 4EY5A 4IDEA 1E1RA 1EBBA 2RAVA 5HBGA 3AR3A 4TLCA 3UV3A 1ZR2A 3UT5B 5J5CA 3IEUA 2P2DA 3GHYA 1E2FA 2EBHX 2PZEA 3PQ3A 4N1AA 1B76A 4LYFA 3U3DA 1KMMA 4WJLA 3QFFA 5JI3E 2CY0A 2A9KA 5J5AA 3HRIA 3MIIA 4I50B 3C3AA 2OUKA 4I36A 4K81B 4JASB 3UUFA 1SCJA 2HBRA 2OC9A 4GYKA 1DBRA 2NADA 4RSMA 4ARZB 1YIOA 1QK5A 1GGNA 3MWDB 4TRRA 4U2DA 4N9WA 4C6HA 2FR0A 3RK0A 1JQ5A 1NVTA 1W5EA 1GRCA 2ZT6A 2HIGA 4PYMA 1U80A 1E7WA 2N1MA 3GEGA 3K72B 3KR1A 5HILA 1YDFA 2EX4A 4NFLA 3U3RA 5HIIA 4QDJA 5JNWA 1ZSNA 2ECQA 3TLZA 5JVDA 2ZXUA 4E22A 4RKQA 2HA0A 1YVPA 1V35A 3RC7A 4YQYA 1JIKA 2CJYA 5KTMA 2W6ZA 1W25A 2E48A 1H6CA 3NORA 4ZT2A 3X2EA 3UPUA 1XWFA 5TPZA 3Q0EA 3G9TA 4HZUB 2DPHA 1ESZA 3O8BA 2O7RA 4K9LA 4PLFA 2BLLA 1YB7A 4AKEA 4BB9A 3QQPA 2W4MA 4XCVA 4MI9A 3BKXA 3QWIA 3GXOA 4AJ4A 1HNXB 1C7IA 4YC7A 2FJPA 1XAGA 1KYQA 4JR0A 2YOHA 2NU9A 3TTYA 2ASEA 2HNBA 3VYUB 1O95A 2ZAMA 4MKXA 1IBKB 1NLFA 1NE7A 1VZ3A 2VS1A 3FCSB 4QD3A 3WNCA 5GJWC 4BZXA 4BJ1A 2BFAA 1SC1A 1WETA 3NEJA 1PKXA 1YVEI 5C8DA 3DFZA 3I2KA 4MQ6A 2FFHA 1QIDA 3ZTWA 4HGYA 4ND1A 1WXXA 3VNUA 3SYTA 2IP4A 4GZ3A 1U1FA 3GRPA 1KKUA 2B1RA 4YP9A 3GT0A 1QDEA 4CMKA 1X3LA 2JI6A 3EVEA 3PQ8A 1I8TA 1RPJA 4GOXA 4XCXA 3KOZA 2D1YA 3KHTA 5EZQA 3TSCA 3WAKA 1G3MA 1L4HA 3F96A 1DC4A 2DR3A 3B5IA 2CFOA 5HKLA 5DN6D 4ID9A 4IMRA 4PZCA 3BREA 2EJTA 3TRKA 4ALMA 3L02A 1O7JA 3TK1A 3VVLA 5JC1A 2ZSBA 3AFMA 4RXTA 5C1DA 2IWHA 2V7QD 4JI8B 4DNQA 1MAWA 4QEKA 5D3KA 3ZJYA 1F0PA 4DKJA 2VK4A 4Z99A 4ZVVA 2VYQA 1PT7A 2A9VA 3HSSA 1QH8A 1NF9A 3LIIA 3PB3A 4D9GA 1XR3A 1U28A 3KQVA 2NLOA 3DDZX 2H1SA 4D3YA 4EY8A 1L1RA 3SVZA 4OHBA 2GZ1A 5KNBA 1RWWA 521PA 3F2VA 4M0UA 3I1YA 1M34B 4FOSA 2WAAA 3GW8A 2V5AA 3KJHA 2WU8A 1T4BA 4GGPA 4S1NA 3WE7A 4NU8X 1XTKA 4GOKA 1AE1A 3QRWA 4L27A 3VA7A 2BMFA 4X1KA 1HZZA 4FYIA 1DBSA 4GL4A 2CLEB 4LVUA 3WRYA 2FJ0A 4GX1A 5JO9A 5IVPA 5EWLB 1LRJA 2AOTB 3FH0A 4ARCA 1I0IA 1WCV1 4L0CA 1PN3A 1SHTX 4M9XA 1G5RA 1GUBA 3LOUA 5F2EA 5B2EA 2C0QA 5D6OA 3OEYA 4YP6A 3K6SA 3A6FA 1T36A 5DHTA 4U7WA 2Q9CA 2V65A 1NQXA 1GKLA 1W1IA 5BW5A 1D5CA 2VJMA 3ED1A 1PQYA 1ZITA 4W82A 4BQNA 2QTZA 3HCDA 2D2XA 1KEVA 4JGGA 1JLLA 2QMHA 3BUSA 4PSUA 5T41A 4BLPA 2EJVA 5LQCA 3G17A 2FAXA 3GJZA 4HQRA 1MXFA 1H9BA 2I91A 1CUJA 2WZDA 2BKVA 4FC6A 1TMYA 5TQJA 4QOGA 1I2BA 4XQEA 1CFZA 5HZGA 3VC7A 1GUDA 4IMIB 3P0HA 4CKXA 2FSGA 1AQUA 1T5HX 3GLQA 4MW9A 3EB9A 4URUR 2JVKA 5DNVA 3VNRA 3W5BA 3VU3A 2IHTA 5DHQA 5AWFC 3CUUA 5FWYA 3LC2O 2EFDB 2CD7A 3N8KA 4RGQA 2XTJA 3QPUA 4GHWA 4O4JA 2X9QA 3IVMA 4ZTZB 2PRJA 4F3YA 5IDXA 4J7AA 5AKIA 4PRKA 2P0EA 5M3BA 1MX1A 3LBFA 3H1BA 3A4VA 4CG1A 4GI5A 3VMFA 1T0BA 1WUKS 3B51X 4A4DA 3M34A 3FWYA 1PDOA 2I8AA 2VLBA 4J03A 1NTRA 4QG3A 3NR2A 3E7XA 3GROA 1U8TA 5BN5A 1K4YA 2P75A 3EW9A 3JQAB 4JDUA 4F72A 4B2IA 2OD9A 1HSOA 4M1SA 1TX4B 1V3UA 4HADA 4JODA 3VHXB 3X2FA 4O4LA 4DA6A 3H04A 3ZJ4A 2J0VA 4LV8B 1V39A 4DUGD 5EIOA 2V6GA 2NSHA 1U3VA 4D6YA 3RUEA 2H65A 3FTNA 3L43A 4WACA 1NT4A 1E7RA 5KYTA 4D44A 3LBYA 2Z43A 2GWHA 2YASA 3HBNA 3MCZA 1O0CA 3N9IA 1P0FA 2BFBB 3BSSA 2J67A 3UHPA 1K8ZB 5EHQA 4A0QA 1TKAA 4DRZA 2OLJA 2WHQA 3GB9A 4YQZA 4LK3A 3MGGA 3S8EA 5DI3B 1NFFA 1SN7A 3CLUD 4OGFA 4WZAB 1U5BB 2RE8A 1N77A 1TT5B 3HXQA 2HMWA 3VHLB 1C0LA 4UVHA 4XVRA 2L42A 3L0OA 2ZJYA 1Y1KE 4H1WA 4FWTA 5KVCA 3A27A 1E3EA 2G04A 4F56A 1J90A 1GG8A 2DY1A 5ICMA 4F7WA 4OQDA 4WH0A 2YWHA 4MNTA 5BUQA 3S1AB 4OAQA 1A82A 3WIBA 3EF3A 1QIFA 1KOLA 2MCFA 1NWHA 1WB5A 1FTGA 2Z30A 1J1UA 3MJDA 3HJHA 4CIWA 1H65A 5KSWB 1B6RA 1QZZA 4AL4A 2A0UA 1T8YA 3GGJA 4PF1A 3G0DA 5ENDA 2NU8A 3RRNA 1IHXA 4TXMA 3AOEC 4GRDA 1N2HA 1IU9A 4KE8A 3JQFA 4ERNA 1HGXA 1HY3A 2WQ7A 1L2TA 5J3JA 3VDXA 1DC7A 4UZFA 2RGCA 4E7OA 2OGSA 2IDMA 2REQB 1M2FA 2A33A 3GLGA 1ZGGA 3UJ3X 3H0CA 1QZUA 2QR2A 1KK2A 2YWBA 4FYMA 4KBFA 5I5EA 4RU1A 2FWMX 4P0QB 5EZ6B 1LW7A 4PHTA 2E3JA 2JCVA 5HFJA 1EWRA 6NULA 1YIAA 3PIIA 3B3JA 1GTL1 3JQDA 3KQPA 4Y6RA 3KKLA 2J45A 4N8SA 3PUXA 4N3BA 5JRDS 3E61A 1MOSA 4EB0A 1YCDA 1B8UA 5BYJA 2WP8J 3GFBA 4KIUA 4TYPA 5AD1A 1CY2A 5GIOE 5HCIA 1JBQA 1E3IA 4QXAA 3UJAA 3VR2D 4L2IB 2NQ2C 2OHVA 1RLUA 2Z5FA 3N0XA 1V11B 2XDAA 3CWCA 3DT8A 5D3ZA 4OHYA 3ZCVA 4QDTA 4TM8A 1AKUA 1OAOC 5A4IS 2GX6A 3R3JA 5JU6A 4Z9AA 4XWGA 4LDQA 4BNWA 3GLFB 4EPWA 1TLTA 1B1CA 2F1IA 3RVQA 6PFKA 3BXOA 2ZSEA 3BTUA 2UV8A 3GJXC 5DBHX 2AJBA 1ENZA 1Z7GA 1AOXA 2NVOA 2Z6UA 3X1WA 5EC8A 1XVLA 3Q1KA 3TUZC 3DKKA 4O5OA 3AEZA 1F51E 2IHBA 2WJPA 4II2A 3EQ8A 4JB0A 4ZARA 4MV6A 4PC2A 5LM3A 4HWOA 1AS0A 4HRYA 4AZ0A 1SG9A 2AW5A 4IXWA 2XRZA 3EFEA 3RABA 3D4IA 1SKYE 3L46A 4MV4A 3QUSA 3SCZA 2AOUA 4UUQA 4C0WA 2O3JA 4AWXA 2V0GA 5AQ1A 3G02A 2YNMC 3BJZA 3OZRA 3UAWA 4HYTA 1QFSA 4N5MA 3CRZA 4JLNA 4KU4A 5A04A 3I2YX 2Q3HA 3GGPA 2RHWA 2Z58A 1L1QA 4MW7A 1C9JA 4R8RA 5CFLA 4G0VA 3ZV3A 4D8XA 2UUOA 3DMPA 3NWPA 2PUAA 4NCHA 2PTGA 1J0AA 2QJRA 1ADBA 5A02A 4FC7A 4EUEA 1XEXA 4J3FA 4X7BA 4LX8A 4ZEMA 5TR9A 3W9SA 3WWOA 5CDTA 1A4XA 2P2ZA 5B4UA 4OLHA 1M1UA 1UJ6A 3A25A 4XTRA 4B71A 4CKYA 4FN5A 4W8OA 2X0RA 3ZGNA 2JAWA 2OWEA 1QG0A 2EHDA 3DLCA 1NM5A 2HUPA 5CITA 2PR2A 1E3WA 1GQOA 2IOFK 2NOAA 2WI8A 3GPCA 3H6HA 4NBTA 5JCJA 3QYJA 2ZKLA 4MRAA 5BP7A 3FBTA 2Q7DA 3PR3A 2Q1SA 2QHXA 2KE5A 1NBHA 4IJ5A 1OKKD 3DE2X 5U4QA 3KL4A 4IDDA 4DR1B 3DV9A 2ZRKA 3DNMA 3HKCA 2DFDA 2IHKA 1GPJA 1U2ZA 2IHNA 4O63O 2UXDB 1EHIA 1QR2A 2UYYA 3I58A 3T1YB 5F2OA 3PKJA 4P5DA 4UKDA 1PJTA 1X1QA 4OO3A 3SYKA 3BB3A 3VR5D 1Z5WA 2V3VA 3RV3A 3U4IA 5FX2A 4MV8A 4JLJA 1CNFA 1PR1A 3FROA 3MRTA 4BV3A 1X13A 1E92A 3BXEA 2PKCA 4MW1A 2PX4A 2IKSA 1KPIA 4M88A 1MW9X 1GCOA 5ED0A 5IWAB 4F45A 1MB0A 4PIVA 4ZCQA 1R1DA 4BBJA 3WB1A 1U31A 2PO7A 1IFXA 3UTDA 1L4NA 5AKKA 3BFPA 2VNKA 4RLHA 3G5UA 5EIBD 4BO1A 1MV5A 1EFKA 2ID4A 2FXVA 4FFRA 4OXQA 2F43B 2YYYA 2Q2WA 3FGOA 3NAQA 3QU9A 3QELB 4E2FA 4TOIA 2EL7A 2QPAA 3H1TA 3CB4A 5AK0A 1P39A 1YL6A 2VDPB 4P4SA 4I5DA 2WPDD 4YGXB 2XI4A 3NHFA 1KO8A 2R65A 4LJSA 4C5CA 4R8VA 2C4VA 3AF2A 4TYYA 1E32A 4WDRA 4XYLA 1PLKA 1KJ9A 3QKRA 3V7FA 4B81A 3M1AA 1RKXA 4FKMA 1RBQA 3NP7A 2UU9B 4I9UA 4FBMA 4IF4A 5IJAA 1EWTA 1KWKA 4I9HA 1MVLA 3SYMA 1I6LA 4JR2A 4D9BA 3NWBA 3T4EA 1ST3A 2FR8C 4WN3A 5KHLB 1JXAA 2C2MA 3TINA 1LTQA 1ZEMA 1I13A 4A5OA 1AXRA 1W73A 4F2PA 1B8PA 1OT5A 2FU5C 3JQ7B 4MS1B 4J1QA 1VKZA 4W7HA 1G5PA 1Z68A 3M6XA 3MRXA 4NJEA 2RGBA 3IO3A 1D1QA 1GKYA 2I55A 2VUTA 1I7LA 1AQLA 1Z45A 3TL3A 4AJLA 3O92A 1C3LA 2BJVA 2BSXA 1UBFA 1ULZA 3NYIA 2UUPA 3V3KA 3IVCA 5KNCD 2UZ0A 1LK7A 4I6JA 1ORTA 2QY9A 2CEKA 3B1VA 3D4PA 4KVAA 1UR5A 4MV7A 5E6SB 5ESDA 5LNK1 3QVVA 3UWOA 3GJ3A 1LEHA 2WJZB 3JXEA 1FP6A 2BGUA 1Y8RB 4JP3A 5C2JB 1UK9A 1P5FA 2MSLA 5LXTB 1B3RA 1U5CA 1UJ5A 4ESHA 4MV0A 4QYTA 3NS7A 4XWKA 1BFDA 1TTHA 1WSWA 2XCUA 2XKAA 5SZHB 3R6LA 5ALKA 1ZWLA 2FSVA 3T5BA 1FYDA 1PTJC 1ZNQO 3IUEA 4J75A 4OMUA 3DAFA 3SX4A 2F4NA 2AOVA 2JHFA 3GFOA 3OFVA 4GOMD 4LOKA 3TR6A 5LUAA 4DB4A 5EP3A 1T35A 1VLVA 1WB6A 4W99A 3PDCA 3N6RA 1JIUA 2EERA 4C6SA 4TM7A 3KVRA 3LLMA 4Q5IA 4AF6A 4XVCA 5EKDA 3F0TA 1X14A 2J41A 2TMGA 4UCXA 5TNXA 4CTMA 1EFRA 3NT4A 4PSKA 3VTZA 1JQLB 4OLJA 4KGVA 2EQ5A 4OVKA 3AILA 2VTKA 2AOWA 1J49A 2MIIA 4LV5B 1Z33A 2FK8A 3QBEA 1Z12A 1Q84A 1XRJA 1KK0A 5AOVA 4D57A 4F7DA 4KFTA 4ZRDA 3GZNB 4PYRA 3O3MB 2VI5A 1Y34E 4J9UE 1U8XX 5B1IA 4KW7A 5DO9A 4DLBA 4MKGA 5B58T 2WSLA 4OBXA 4QXQA 3T7JA 1BMQA 2HV9A 4AZ3A 4EG5A 4G3XA 5HRUA 4C1BA 4GMXA 4AM8A 4EKIA 3QVKA 2W2TA 2Q5QA 1X7WB 1N0HA 2FPMA 3B9BA 2OENG 3FPKA 2PXHA 4WCFB 3MQFA 1Q12A 1M2EA 4R84A 5NULA 2C7VA 1E4OA 4AJNA 1SVIA 2BGJA 2DHCA 2R8EA 3ZHUA 4ZGWA 1N4DA 4V0RA 2C04A 2MMCA 4DCTA 1O97C 1C9NA 4IDFA 3UM9A 1DAOA 4AG3A 1YQQA 3QW2A 3QXSA 4MVJM 4PLZA 1RPZA 2Q1TA 1LNSA 2O5EA 2YJ6A 1MC5A 4YCSA 1QB8A 5ITWA 3IRVA 1PUJA 3E9QA 1QQTA 2JH3A 2IW3A 3BGIA 1NX9A 4UHBA 3UMRA 4AK9A 3SC3A 1G8AA