4M37A

Crystal structure of trypanosoma brucei protein arginine methyltransferase 7 complex with adohcy
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
337
structure length
337
Chain Sequence
RPPDAFVNRIDRNIPVPARLRHTPVSLIEAVNDFHYAMMNDEERNNFYYEVLKKHVTPETGVLEIGAGSGLLSLMAAKLGAKWVVAVEGSEELAKLARENIRANNMEHQVKVLHMMSTELKSKHLPEPPDVLLSEIFGTMMLGESALDYVVDVRNRLLKPTTKIIPQFGTQYAVPIECDALHRISSVSGWRDLDLKHMMTLQDTVSIVFAKHYGIRMNSVNFRRLSDPIELFRVDFSSSNRNDIPRRKHFDVVAKESGTAHAMLFYWKVTDDEFVMSTDPEDTVNNFPRDMQWGQALQLLDASNGPLPTPVVFTEGKNYNFECNFSGDRVILHMQLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Determinants for the Strict Monomethylation Activity by Trypanosoma brucei Protein Arginine Methyltransferase 7
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Transferase
molecule keywords Protein arginine N-methyltransferase 7
total genus 106
structure length 337
sequence length 337
ec nomenclature ec 2.1.1.-:
pdb deposition date 2013-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06325 PrmA Ribosomal protein L11 methyltransferase (PrmA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 4m37A02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4m37A01
4KIFA 2FHPA 4X61A 2PKWA 3HCAA 4MIKA 3DUWA 5EIFA 1NW5A 9MHTA 1O54A 5KQSA 3G8BA 1YZ3A 2Z6AA 2PLWA 4EMSA 4RTOA 3A25A 5LQJA 2V7EA 4PYNA 1YFLA 3G7UA 4CTKA 5K0BA 4P7GA 1JG4A 4P7FA 4RTKA 1EIZA 8MHTA 1DCTA 3MTEA 4PYOA 1DUSA 2AOVA 2OY0A 2QRVA 5DX0A 5DRYA 2FYTA 2JH8A 2QE6A 3TR6A 2ZTHA 4PIMA 5KS2A 5K05A 1XXLA 3BKXA 4YUYA 2H1RA 3KR1A 2NP6A 2BM9A 2PXCA 3MERA 3ID6C 4AZTA 3GRVA 3T7TA 2ORED 5GOZA 1D2HA 1VP3A 2ZZKA 1NW3A 3KR0A 3UA3A 3TFWA 3LDFA 2JHAA 1KPGA 3ELYA 3KQTA 3R6TA 3QV2A 4IWNA 1M6EX 1SUIA 4PYIA 2O06A 1UWVA 4EK9A 2AVNA 3R24A 4PYLA 3I58A 3X0DA 3VYWA 1VL5A 3M70A 3KQOA 3LL7A 3RIEA 2IH2A 1JG1A 3HVKA 1KR5A 4YV1A 3B3GA 1BKYA 2PXXA 4HTFB 2AVDA 4DKJA 5K0JA 4OA8A 1N2XA 2P8JA 3AY0A 2EFJA 2XYVA 3IEIA 3TKAA 1D2CA 5EPEA 5K0FA 3O7WA 3VC2A 2HV9A 1P39A 3P9KA 5LQKA 1QANA 3JWIA 4M37A 2AOXA 2OB2A 3OU7A 5DTQA 3ERCA 5CVVA 1SQGA 2AZTA 5K0LA 3TLJA 4MWZA 4CKCA 3HCBA 3R3HA 3SR4A 3PTAA 1SVUA 3DLIA 3OZTA 3HA5A 4L7VA 2LD4A 5K01A 2Z6UA 4HH4A 2I9KA 1B42A 4Z2YA 1VIDA 3GO4A 1XCJA 2VDVE 1O9HA 1AV6A 1R8XA 3G88A 1XTPA 4X60A 3KQWA 3O4FA 2XBMA 4FS8A 2OZVA 2Y1WA 4ER6A 2O57A 4EKIA 2PY6A 4Y30A 3CJRA 3G2OA 3P8ZA 1X1BA 5D1NA 3T0IA 4CKBA 4K6MA 3TQSA 4WXHA 2VDUE 5ERGB 4QQKA 1M0EA 5HIIA 3A4TA 3FYDA 3KHKA 3KPJA 5DX1A 1QAMA 3TM5A 2XVMA 2VS1A 3HVHA 2AR0A 3UJ6A 2ZZNA 1BOOA 4KVZA 2EG5A 2GAFA 1VBFA 5DM1A 4IKPA 5DX8A 3EVBA 4QDJA 4GEKA 1FBNA 1FP1D 2C7PA 2P40A 2OBFA 5CM2Z 4YUZA 3G89A 3CJQA 3ELDA 3AXSA 3TRKA 3G2QA 1QAQA 4AUKA 1N7JA 2PJDA 3SVZA 1R8YA 1F3LA 2ZW9A 3FUTA 4OBWA 3LDGA 3THRA 2ZBQA 2UYCA 2CL5A 4YMHA 2YXLA 5JUWA 2BR4A 3E05A 5ICCA 2HMYB 4C4AA 3I53A 4AX8A 5CVUA 1RI3A 2AN3A 4A6EA 1Q0SA 2R3SA 3TM4A 3FPHA 5DXAA 4O29A 4R05A 3MCTA 1XJ5A 4F86A 3VC1A 4F85A 3B3JA 4R6WA 1G6Q1 4E2XA 4PYKA 2YXDA 3LSTA 5LQNA 1X19A 1WY7A 5ICEA 1IXKA 3T7RA 2ZULA 3G8AA 3IV6A 3SSMA 3CVOA 3EMBA 2C7RA 3FUUA 5BW4A 2OO3A 4C03A 3FTCA 1X1AA 1R6AA 5E8RA 4G56A 2NYUA 3D2LA 3FUWA 1ZGJA 3LHDA 3NTVA 1H1DA 4YV0A 2IH4A 1KPHA 3GRYA 2UYOA 3C0KA 4FSXA 5K03A 1DL5A 3UJDA 5F2NA 5LSAA 2KW5A 4YUWA 3DOUA 2ZBPA 2P3LA 1N7IA 1EJ0A 1L3BA 5FHRA 3V8VA 5FTWA 2GB4A 1XCLA 3NJRA 4KDRA 1V39A 2XVAA 2OKCA 4IV0A 4RTPA 3FYCA 2V74B 4GF5A 2PX8A 2NXNA 4RTJA 2HWKA 4RTNA 1KYWA 3EGIA 4PINA 4YUXA 4XUEA 1G8SA 3KPWA 3LBYA 5EG5A 3LBFA 3P2IA 4Y2HA 3LKZA 1BC5A 3P2KA 1P1BA 3OPNA 1JG3A 4MHTA 1TW2A 4XUCA 5E9WA 10MHA 3GGDA 5EHIA 5DTRA 3A26A 3K0BA 1X1CA 2ONYA 4QTTB 5GP1A 1QYRA 2IIPA 4OBXA 5DM2A 2O05A 5FCDA 2ZBRA 3GDHA 4LECA 4PYJA 3HEMA 3BKWA 3E8SA 5K8VA 3CCFA 3CBGA 4C05A 3RW9A 5K0GA 3LDUA 1AQJA 1PRYA 3KKZA 5T64A 3GRUA 3OCJA 2P7IA 4HGZA 5HFJA 4ER3A 2HR1A 2IH5A 2JG3A 2VZ9A 4LWPA 5EEGA 3PLAE 3DULA 4LG1A 4RVFA 2P41A 4E2YA 1Z3CA 5FADA 2P3QA 4JXJA 3SM3A 4XCXA 4E2ZA 3DTNA 3GU3A 1JR4A 5CVJA 3LCVB 5FWDA 5CIYA 4HGYA 2ONZA 3UJ9A 1KP9A 2CKDA 4C06A 3ANXA 3C6MA 1JQ3A 2B78A 3DLCA 5FULA 3GWZA 5P8WA 4AZSA 4OA5A 2UYHA 1JQEA 3UA4A 1EG2A 4DQ0A 1VE3A 3DMHA 3QOXA 2OPBA 4CXMA 2FPOA 3FRIA 4E33A 3P9IA 3DMFA 5HIKA 3UJ7A 4BLVA 2P3OA 5K0NA 5HZMA 4RX1A 1L3CA 3SX0A 3UJCA 2Y1XA 2K4MA 3DR5A 3LECA 3PVCA 1R74A 2OB1A 4PYMA 5DPMA 3S68A 2JH9A 2CMGA 1WXWA 1WS6A 1G55A 2VP3A 3SMQA 3IYLW 2CWWA 5B1SA 1ZKDA 3KR9A 3THSA 5K0CA 4BP3A 2Q41A 3PX2A 3R9XB 3BGDA 2UZ4A 5DWQA 4R8SA 3FPFA 2B9EA 4RVHA 5EC8A 2ZSUA 4R8RA 1WG8A 2QRVB 3V97A 3KQMA 5M5BA 2Z6QA 3MHTA 3NDJA 3C3PA 5LR6A 2BH2A 5GM2A 4EQZA 4DA4A 3DP7A 3CC8A 3KQSA 3MCZA 5EVJA 4QVKA 4RVDA 4KIGA 2YX1A 3BWYA 3LKDA 3FTEA 2QM3A 3FPEA 4DCGA 5LQRA 3AXTA 4YMGA 3MTIA 4CTJA 4MQ4A 4CKEA 5FQNA 4V0RA 4YUVA 2PT6A 3BWCA 3GRZA 3UBTA 2P35A 3OZRA 2OXTA 1VQ1A 1OR8A 1FPQA 3B7PA 3UZUA 3SSOA 4OX9Y 2GA9A 2IPXA 5C0OE 3GJYA 3FTFA 3BZBA 4X63A 3ME5A 2IDKA 4FZVA 5GIPE 2IFTA 5EZSA 5DM0A 3VSEA 4E31A 3EGEA 2PX5A 3FUVA 4M38A 4ER5A 5KVAA 1T43A 3DXYA 3SSNA 3REOA 5CVEA 4UOEA 1KYZA 2BR5A 2P1DA 3GXOA 5F2OA 1RI4A 3ER9A 1UFKA 2PVCA 4ER7A 3PT9A 1VP9A 1YUBA 4BY9E 4X41A 4FSDA 5FA5A 2YUIA 5DSTA 3JWHA 3EVEA 3LCCA 5E1DA 2B25A 1NW7A 3NDIA 3KPYA 3EVAA 3AJDA 4FGZA 4PCAA 4GC9A 4GBED 3SXJA 5FWAA 4ATNA 3GRRA 2H00A 4RTQA 3NWEA 2HTEA 2G72A 2PV0A 5HEKA 4FR0A 2BM8A 1QAOA 5F2KA 2DULA 2YVLA 5DXJA 3OZSA 1JQDA 4P7JA 5T67A 4E30A 2AOWA 5MHTA 3RODA 1G60A 3DXZA 4IV8A 2PX2A 4PONA 3OFJA 3ER8A 4QVGA 1RJDA 2PT9A 1ZQ9A 3FPGA 4HRAA 3NVKI 3BGVA 1TPYA 4HTFA 4AZWA 3G5LA 5EEHA 5H02A 1UIRA 3TKYA 5KQRA 3GNLA 4GOOD 1NBHA 3DH0A 1R00A 5EKUA 3OE4A 3CKKA 1YF3A 3FRHA 5T6BA 3KQQA 3HCFA 2AS0A 3BWBA 3I9FA 2JJQA 4LWOA 2AN4A 3NVMB 5E9QA 4AZVA 3B89A 2AOUA 3FZGA 2ZFUA 5GINE 2ZWAA 1KXZA 2I7CA 1I4WA 1NW8A 3EVCA 5DTMA 5EHGA 4EVIA 3M6VA 2IBSA 1NW6A 5CVDA 3EPPA 3KQPA 3B3FA 3HVJA 5EMKA 4QPNA 3AWIA 4RWZA 4DF3A 2NP7A 5E1MA 1JTFA 1JSXA 2JHPA 3M33A 2DPMA 4NECA 3TOSA 2C7OA 1RI2A 4QTUB 4C04A 1EAMA 1G8AA 4PGGA 1M6YA 1L1EA 5FA8A 1RJFA 5HOQA 4ZTBA 2YQZA 4X1OA 4EKGA 1VLMA 3M6UA 4RVGA 5E1BA 3CGGA 4P58A 2PWPA 4U7TB 3EEYA 1I9GA 2PWYA 4XUDA 4HSGA 3OU2A 1L3IA 3TPZA 2NNWB 4GOLD 3JWGA 3P71T 1RJEA 4FP9A 2PXAA 4M7RA 1MHTA 5C9ZA 1D2GA 2F8LA 4E32A 3A7EA 4BLWA 7MHTA 1QZZA 5DSXA 3I64A 1XDUA 5DRTA 5GWXA 1MJFA 5DT2A 3LPMA 5D1HA 3EVGA 2VDWA 5EMMA 2N47A 2XYRA 4GC5A 3T7SA 2AOTB 2HNKA 1YFJA 3P9NA 5EZQA 2G8NA 3L8DA 2OYRA 3M6WA 3UJAA 3DXXA 3UWPA 4RTMA 3EEOA 2O07A 3MGGA 1FJXA 3E7PA 3HVIA 1ORHA 4F84A 3KPVA 4RSRA 1INLA 2YR0A 2YXEA 4R6XA 1XDZA 3LCUA 1NV8A 3P9CA 1F38A 1P91A 3FTDA 1KHHA 2BR3A 2GH1A 4GQBA 3NW9A 4DMGA 3HA3A 2GPYA 2PX4A 3K6RA 3G2MA 1P1CA 1NT2A 3LX6A 4GUAA 3KPUA 3BUSA 2H11A 2P7HA 3JWJA 4CWAA 3NMUF 1NKVA 3EGVA 3KR2A 4YV2A 2NXEA 3A27A 3G5TA 3BGIA 3PFHA 4BLUA 2QY6A 2IBTA 2ZWVA 4OQEA 5HIMA 4M36A 4DCMA 1EQAA 3G2PA 5U4XA 1XVAA 1PJZA 4FT4A 2AOTA 2YTZA 1NBIA 2GS9A 4U7PB 2XYQA 4V0QA 2C7QA 3PS9A 2GLUA 5BW5A 2WA1A 4P7KA 1G38A 2PGXA 2B2CA 4MTLA 1IY9A 3EVFA 1I1NA 5HILA 3FUXA 3SGLA 1JTEA 1VPTA 2G70A 3O31A 4ISCA 5HIJA 2FRXA 4E2WA 1JG2A 3M4XA 5IKMA 4C07A 5FUBA 1L9KA 3HNRA 4ER0A 3DMGA 2ERCA 2ZLBA 4RV9A 3OE5A 4PGHA 1SG9A 5E2BA 3OFKA 1ZGAA 4RTSA 1SUSA 2NXCA 3HCEA 4DZRA 3KQYA 1NV9A 2CMHA 3MQ2A 4QQNA 4KDCA 4OQDA 4POOA 5BXYA 4GOND 3P2EA 3MAGA 3ORHA 5EOVA 1Q0TA 3CJTA 4PWYA 3PX3A 2G1PA 4C08A 3C6KA 1ORIA 2G71A 1RJGA 2NXJA 2IDJA 3GIWA 2O0LA 5LQUA 5LQCA 1AQIA 3UJ8A 5IH3A 2AOUB 5K09A 3UFBA 5G02A 5CUQA 1O9GA 3P97A 2R6ZA 4KWCA 2EJUA 2ZIFA 2FK7A 5EMLA 1Y8CA 3EMDA 3UJBA 5KYGA 1TW3A 5BP7A 1U2ZA 5GIOE 5EQJB 3NWBA 4FT2A 5ICGA 1YZHA 4HC4A 1KIAA 2ZIGA 2UYQA 4RTLA 2FCAA 3Q7EA 5FHQA 3KU1A 5E1OA 3TMAA 3EVDA 3LGAA 5EMJA 5EIWA 2ZCJA 2A14A 3E23A 4DM3A 2IP2A 5JR3A 1RI1A 4E70A 5ICFA 1HMYA 2ADMA 4BP1A 5CD1A 2WK1A 2ZZMA 5EGSA 4RTRA 3HTXA 1RI5A 1X1DA 1EJ6A 4QDKA 3MB5A 2JHCA 3HA7A 4HG2A 3EVZA 3HP7A 2WA2A 3HM2A 3ELUA 1YB2A 2AN5A 3F4KA 3IHTA 1WZNA 3BT7A 4KW7A 1BHJA 4PIPA 1ZHFA 3HCDA 4PYQA 2PSSA 2PBFA 1XDSA 2FK8A 2ESRA 5FQOA 2E5WA 1HNNA 2I62A 2QYOA 2ZIEA 2EJTA 3BXOA 1FP2A 3M6XA 3PFGA 5GM1A 1JSZA 5CCBA 4KRGA 3OU6A 3H2BA 4B17A 2ZVJA 4WVLA 5CCXA 3PB3A 3C3YA 1AF7A 3I5UA 4H0NA 3FPJA 3R0QA 5DLYA 4PCLA 3WSTA 1ZG3A 3HCCA 1WXXA 5E2AA 5EKXA 5C1IA 5DM4A 2I6GA 3A7DA 3ELWA 5E8JA 1R18A 1SQFA 3KQVA 4GOMD 3QOWA 1SKMA 2EX4A 1IM8A 2BZGA 3GCZA 5K0EA 1KPIA 5LQAA 2IGTA 3B5IA 3U81A 4PNEA 3Q87B 3BWMA 1NE2A 4A6DA 4RYLA 4QPPA 2B3TA 5E9JA
chains in the Genus database with same CATH superfamily
2HCBA 1PGNA 2WF8A 3I5MA 4OLFA 4BP8A 5JHHB 1A9QA 2GD1O 4Q6WA 1RZRD 4YLYA 5EJFA 1OGIA 4YX9A 5KNCH 2F62A 4WVFA 4CIWA 5KQSA 3NGLA 4AO7A 2IBMA 1GAEO 1CQZA 3SF0A 7MDHA 1IWPB 1NL3A 1QJ4A 3R7AA 3RK0A 2X8AA 2C2YA 3G7UA 3SZGA 5A9RA 4P7GA 1QPBA 3RUIA 1WNTA 1L5NA 1I7LA 1EP9A 4DR4B 1Z4IA 2V6IA 1NQ5A 3O2JA 1E2LA 2QMZA 4FLFA 1BEZA 1EMDA 3WIBA 5CG1A 1K8RA 1XCBA 2VQDA 3IPRA 2V7VA 1MRZA 1QIEA 1LPPA 3MT0A 1LC3A 1WUTA 2ZI9A 1N8NA 4FFNA 4MA4A 4DREA 1V3UA 5JECA 5ILOA 3HN6A 5TQ0B 4EGCB 1E4EB 2CK3D 1O95A 4BVBA 3WGJA 4JLBA 3TFOA 2X19A 3DZGA 5AHOA 3V7NA 3I61A 2WUDA 3R24A 4MMXB 1RAIA 1PK8A 2C7VA 2XQIA 3KBBA 3KQOA 2RH8A 1TTHA 4BE7B 1L7PA 1S7CA 2ODEA 3IO3A 1N2ZA 3MK31 4P7BA 1R9JA 4MYCA 4R3UC 521PA 1YRBA 2XITA 3B3AA 5IDVA 5JXHA 4KNYA 2GMWA 5HKBA 4NFSA 3K53A 1W5BA 4LS3A 4COOA 4MKIA 4C0KA 3ZJUA 1BHO1 4GHWA 1KVUA 4UM7A 2AZTA 3BEDA 3AINA 3CR8A 3SD7A 4K26A 4WUTA 4MW0A 1TZ2A 2CNWD 1YIOA 1G5QA 2HXGA 2HJGA 2Y92A 3L8ZA 3T41A 4B71A 3PTAA 2BMJA 1LXCA 3LM8A 1TIPA 2LD4A 4F8EA 4LVOA 1G8HA 1S8OA 4WCFB 3RUFA 1CVLA 3V4OA 3KT6A 3GO4A 3TSZA 3KYJB 2P8SA 5THQA 5CX1B 3CX4A 3O4FA 3QNWA 1Y6JA 3LZCA 1NJGA 4NARA 5LXTB 3TLKA 2OZVA 3G1TA 3QPCA 2QX7A 1VL0A 4ONEA 3MSCA 2PY6A 3HJTA 7GPBA 3EJ6A 5MN6A 1QTNA 1PVDA 3AUKA 3IGFA 3U7JA 1QUEA 4Y9DA 3NQ41 1X13A 3C3DA 4P36A 3RABA 1ZA2A 4B8WA 3KZNA 5TVKA 1HT3A 1IEXA 5EZYA 3N07A 4HATA 1FUIA 5HRUA 1WA5A 2Q4EA 4YRKA 1RZUA 2ZZNA 2BTQA 1YNOA 2HYDA 4KH0A 4OHXA 1M6WA 3AESB 1FP1D 3W9UA 2P40A 5CM2Z 4RAQA 2NZ8A 3DPIA 3OOSA 2PO5A 4FYMA 4QREA 2OXRA 2E5LB 1E9RA 2I3GA 4N7MA 4N9WA 1PJAA 4KG7A 1TKAA 4AWAA 4B3XA 1UT5A 3IESA 3C3EA 3ISTA 3ZLVA 5M7EA 3TDMA 1RPAA 5FBHA 3G79A 5PNTA 3T54A 4HUQB 1F3LA 3M5WA 4HWSA 4OBWA 5DGXA 4CEHA 3RQIA 2ONCA 3EB9A 3BWXA 4GMDA 1AA6A 1BX0A 4C4AA 3OTHA 1II9A 4OSPA 4OHUA 2JK0A 3RVQA 2WSYB 3EFHA 3IAUA 1QR2A 3F6CA 3AEYA 2G76A 1DLIA 1KAEA 2DH5A 4YFYA 3DC2A 4A7PA 2O5RA 4A5SA 3P4XA 5MF6A 1F0NA 3B3JA 1WKCA 2EOAA 3WIDA 5DNCA 2ICAA 5DM70 2Z2YA 4GPTA 4N3BA 1U8AA 1IXKA 2ZULA 3G2LA 4M55A 1CVRA 1KOFA 3VKHA 3VPSA 1H22A 2NZJA 3HADA 4LJ4A 4XQ0A 1W59A 1ISPA 2VRCA 1ZK0A 3G2JA 3ZE1B 1BGWA 1I4LD 3U1BA 1J97A 1TFRA 3ILXA 2QUJA 3VAAA 4TRRA 4HYTA 1KETA 4OQXA 3JYQA 6YASA 3GF4A 4MZDA 1MA0A 1Z2OX 3IA7A 3VHRA 1SBCA 1J0BA 1YHZA 5NLLA 3ZHQA 1J8VA 1BXKA 2HIMA 4W1SA 2D3TA 4XUEA 3CSSA 3VR1A 3OICA 3ZWOA 4IQ4A 2CZGA 5L3VA 2WJAA 1P1BA 4H77A 2Q28A 4KN9S 3VKFA 1KJJA 4ZQFA 1S3IA 3SLKA 1JIIA 4JITA 1G0OA 3K0AB 4IJQA 4RFVA 3TKLA 5ALOA 4LECA 1CULC 3LP8A 1M9NA 1MO5A 1PZGA 2I99A 1JSLA 1OXUA 2VHZA 4M0DA 1Y1PA 2BBSA 2W0MA 2XKBA 1U0SY 4G1VA 4CR7A 4D5EA 5T64A 3ZIUA 5CD9A 1B16A 1GEEA 2K7ZA 1K7EB 3C7CB 2WLTA 2B36A 4Q9AA 2ZBDA 1CUAA 4W5HA 1Z3CA 1K7FB 1LPAB 2E1RA 3ICPA 3ITKA 4L9SA 4LE1A 4U0KA 3TZ6A 4E2ZA 5CIYA 3W6ZA 2GCNA 4G1EB 4Q12A 3WMFA 4QOEA 2O8FB 1D3AA 4EECA 5JSZA 1ZN2A 1KP3A 1HFKA 1SUEA 3MINB 1FU8A 3UA4A 1LFDB 1K0UA 1JJ7A 3BDIA 4XJVA 5DISB 4C30A 1OXMA 2FPOA 2Y99A 1JXMA 3K71B 2O8NA 4EPVA 1RMTA 1WMFA 2HJWA 1J1UA 3LECA 2AQKA 3EGDA 3P0RA 5DPMA 4J0GA 1JQKA 4BNZA 4FHGA 4NMLA 2XT0A 2NU7B 2ZBUA 5M5BA 1MQ8B 4GKVA 3B48A 4ZDWA 2CZQA 2FDRA 1BH2A 1QYVA 1GPMA 4H15A 4XGRA 3RYHB 3BGDA 2H0RA 1OY1A 2EZ9A 3E4DA 2FR1A 4HGOA 3HDYA 4FKBA 3F2IA 2QRVB 1EP2B 3KB6A 4G0NA 4MWSA 1P4SA 1N2OA 1E2MA 3K2EA 3LVRE 3QQ5A 4DA4A 1R0KA 2OVBA 3EIOA 2GN2A 4DSAA 1DIGA 1YZVA 1RHRA 1AVTA 1MUUA 3ZXIA 3BWYA 2DFPA 4LXIA 3O73A 2OR3A 3A4IA 5IUJC 3H2SA 3SBEA 1UP6A 4ODIA 4F9FA 2GCPA 3HEBA 3BMOA 2BFDB 4MW9A 3DKVA 5K4HA 3VVLA 3WGUA 3W2GA 3EBPA 1Y7LA 2GO7A 1P72A 2PL1A 1VQ1A 3OTWA 1ZL2A 2X58A 1A77A 1FDTA 3F8WA 4N47A 3NBQA 1TCVA 1F6WA 5C0OE 4O2RA 4XDGA 3TIIA 2VUTA 2E87A 1Y9DA 3HKDA 5CPFA 4BO1A 5I7EA 1JV2B 3VSEA 3O26A 1KYXA 1FQOA 4FHEA 4C2BA 4QGFA 2RHBA 4IICA 1EFKA 3IT2A 2H4HA 3PNOA 3WBJA 1THZA 4XR9A 2WTUA 4GBMA 3GXOA 2V55B 5IP5A 2H54A 3QFFA 3BB1A 4F4IA 4EEKA 3ROXA 1W9MA 3H9GA 4G4GA 3RRFA 2YUIA 2F59A 2Z2IA 4TV9B 3TZQA 5BWOA 4EEZA 1T13A 2P5TB 1WTAA 5AKXA 3B1YA 4JYCA 2GNOA 4AI6A 3EA4A 2JLSA 2RSLA 1NFQA 4YJDA 3FCYA 5D5PA 1K75A 4DIDA 1KARA 2F3PA 2HGZA 1U6KA 2H3EA 3EXIA 4KTTE 4L3WA 1SHZA 2YXPX 4TKMA 3WP1B 1HRKA 3FMGA 4LQDA 5T67A 2X5OA 3QF4B 4GU5A 4C1BA 4MVYA 4D4KA 3WYBA 5B64A 5ICFA 2ANBA 1G60A 3G0HA 2DHDA 2HIAA 3OPXA 2PKCA 3NBKA 1SCUB 5T3YA 4DLYA 1O0BA 1GITA 1ZQ9A 2VDWB 2NADA 1MC8A 3GJSA 2C5FA 4H6PA 3W0LB 1HRDA 3G5LA 5EEHA 3EZ2A 1C4OA 1XVUA 4UQOA 1NY6A 4FFRA 4UMEA 4WK4B 1GV1A 3H8WA 4GXQA 4HB2A 1EWKA 1HL7A 4JMPA 3FFWA 2I6UA 4OFZA 5EE1A 2ATEA 2P6PA 2D2FA 3C3JA 4P82A 3SVLA 3N2IA 4DWVA 4TLLB 2BFCA 1Y1SA 6Q21A 3CO5A 2BFBB 4XIIA 2X4GA 3QG1A 5GINE 2FU5C 2JI6A 5HGXA 4EHNA 2H2AA 2LW7A 2O7QA 1YDFA 4YYEA 2F1RA 3COWA 3JTEA 3F9IA 4M0KA 4OXYA 3S3TA 2ZJ3A 2H48A 1JIJA 3A3OA 2W6PA 3EN0A 2AG6A 1GKIA 5F1PA 1CIJA 1MA3A 2EFCB 2R86A 4OP1A 3TOSA 4AY4A 4DMCA 5BWBA 4JH0A 1DPGA 1E3LA 4EG8A 1XXHE 3K7EA 1YR6A 4HLQB 2PSDA 2OHGA 4TT8A 4DPLA 1F0KA 3NFRA 3OD5A 4G85A 3TAXA 4N18A 2JDID 4PO9A 4D42A 2QUKA 5FR2A 4P58A 4TROA 5AOCA 2QG6A 3N7TA 5AK6A 3E9CA 3AW8A 1QIFA 3M5PA 4MPJA 1GA6A 2J4FA 4P2BA 1GZ6A 2PUDA 5JH7B 2Q5CA 3QFCA 3JVVA 3W4KA 4IGEA 4FFMA 5AXCA 1CYEA 3L9WA 4OK3A 1WU7A 3UW1A 2CXNA 2EV9A 1XDUA 2J67A 5GWXA 1NTRA 1DIRA 3FA2A 3EZ7A 1AHNA 2H1WA 4UAUA 1PW7A 1E61A 3C8DA 1FP6A 3N2GA 4EYEA 2Z5VA 2VPQA 2FLKA 2OYRA 3AHCA 4HT3B 5ELMA 1L7DA 1RKBA 2GM9A 3W9YA 4K88A 4RZQA 5JU6A 5DNEA 4GNRA 4OD0A 2IXDA 2ZRBA 4GS5A 3IAXA 1I6WA 4P4TA 3HWSA 4ZCMA 1FJXA 5JJIA 4GI1A 2R11A 3V4SA 4F6CA 1ODCA 2RGCA 1RE0A 1P91A 3JZMA 3QW2A 5IBPA 2GPYA 2PBLA 3AEQA 3DL0A 4TTPA 1NYLA 4RA6B 4UBMA 3H6KA 4NICA 3SC3A 4U2EA 2JATA 2YRWA 4KE9A 1Q2UA 1CU1A 1CNEA 2NO1A 2CV1A 3K92A 4FB4A 3R8FA 3WJ7A 4J4BA 4EFKA 3EGXB 3CH6A 1Y8RB 3T9FA 1Q0ZA 5HMLA 1AE1A 1E9DA 4BLUA 3U44B 3GFOA 5K45A 1YRAA 2AF3C 1M1YA 3V5NA 2IXGA 4A0GA 3AYXB 3RBXA 2VWGA 3GZNB 5FTNA 1FRFS 4WTOA 4DS3A 4F56A 4AS1A 3I62A 1JQBA 2L19A 3EGXA 3T15A 3ECCA 5HDBB 2B7BA 1GILA 1X7DA 4TMKA 4F2WA 4CE6A 3LYAA 1W1UA 3D4LA 2CLIB 3F7NA 4LZNA 1ZJWA 1NN1A 3ZKAA 5CH3A 3A2LA 3U5TA 4E2WA 1HQDA 2J5BA 3MMXA 4HDRA 4HLUC 4NULA 3KELA 1GCUA 2QTFA 2VJAA 4C6HA 1QG6A 2NUAA 4LY9A 1Q2XA 2Z1NA 4Q16A 4YT4A 5DBOA 1CWUA 4PX2A 2FMIA 2HLNA 2QZJA 3O94A 4NZPA 1BU5A 1LI7A 1HY3A 2QL9A 1YHYA 3A10A 4JC5A 1MO4A 3TL3A 1B0PA 2BDEA 2X0JA 1PSDA 5JS7A 3HXKA 4M9RA 3I2GA 5JD6A 5B3JA 5LZ7A 3RV3A 4AMBA 1V9CA 3T7KA 3UUEA 1E79A 4KHPB 5KREA 3QMWA 3SBOA 2IHTA 1Z34A 4TYYA 2ODQA 2WTBA 2B3DA 2I29A 2B7LA 3L7JA 1QH9A 1X7HA 1R15A 4YRFA 4K28A 3PV0A 5JFTA 1ZXLA 4OP3A 1IZ7A 3BHMA 1QIMA 5CT4A 1MH1A 2O8EB 3AOGA 4QICA 1W8DA 1I7SB 2YIDA 1AY0A 2FPGB 1QE3A 2IY8A 4U8GA 3OIUA 3AR6A 1V1RA 2QGZA 4ZYWA 4D0NA 1UBOS 4JXXA 4RTLA 2HBYA 4JJGA 2OBXA 4M1EA 4PLCA 5E1OA 4UEJA 2Y67A 1DBVO 3SKVA 2YIJA 2RH4A 3D6HA 3H2IA 4FU0A 4G9EA 3RASA 4DM3A 2IP2A 3UATA 3LQ2A 3U0VA 4ND7A 4AXXA 3K1JA 5KNDD 2HD4A 1G3UA 2FW1A 2WVGA 5CDUA 1IOLA 2QZ4A 2WE8A 4YALA 3U4HA 4C4XA 1G5FA 2R1TB 5H83A 3BK7A 3HP7A 3GH1A 4Q9JA 2WT8A 1IE3A 5G4LA 3DOJA 3FPLA 2GOYA 2WJVA 4AF7A 3WA6A 2FWJA 1N6PA 3MMSA 5UKDA 3WC4A 3TG2A 4EPWA 2J59A 3W1VA 4GL4A 3ZK8A 4A0SA 2FR8A 3M6XA 3PFGA 1TA0A 4HPWA 4ZEXA 2C61A 1EDEA 4LC0A 2B98A 4YCMA 3T1TA 4RY8A 1E2IA 1SXPA 3AIMA 3I5UA 1WEHA 1Z13A 2QWXA 3CLTC 2OHVA 4ZQCB 3FPJA 3TNFA 5KDDA 1XSEA 2ORWA 2ZSEA 4NOKA 4OMDA 5HTOA 1PJCA 3WSWA 2VSFA 3VYVA 2PEZA 2OZPA 5BQXA 2ECQA 3P27A 4BNYA 2JFXA 2BSXA 4II2A 3TZCA 3NHJA 4YP9A 3EZFA 4UDYX 4ZO8A 3C98A 3BDAA 2ZUDA 3QPVA 4KMMA 2BUAA 1XWWA 1ZJ6A 3BWMA 5TQJA 4B3HA 2NPOA 1UDBA 3OJ0A 2XLBA 2B5WA 1Z6QA 4NCNA 4EITA 3COJA 1YFZA 3I32A 2PMEA 2AJBA 1RQLA 3R6GA 3HCAA 4XE5A 5J59A 4MGIR 5EIFA 4RKFA 3R8XA 1FQKA 2AN9A 4N5LA 4X8OA 4XH9B 3EXHB 1SULA 2DH6A 5C3MA 3MYYA 4NNOA 4I55B 2V7EA 3A70A 2IEYA 4HN2A 3OPQA 3VNQA 3LT1A 4URWR 1E2EA 2OHJA 3PNBA 3R6LA 4I81A 1JEAA 1Z5GA 3OLVA 2FPKA 3F5MA 5B1EA 2WYHA 1RHUA 1KMIY 1L7QA 2AG8A 3CS3A 1UMBA 2ISCA 1WUKS 1YRWA 2ZOSA 3RC3A 4QLBA 2X3FA 4ND8A 3SJBA 1N92A 4KLZA 3IL2A 5CM8B 3ROFA 1PTJA 2EWWA 1G291 1WKVA 3W2HA 5GOZA 3FPBA 4HUTA 3WBBA 3KWMA 4D26A 4L75A 3GEHA 5LUBA 3PE6A 4V02A 3DQPA 2D0IA 3EUFA 1C0IA 1Z4QA 4CCWA 4KVGA 1UBSB 1PEKE 2X3UA 3BL5A 1R8SA 3A6KA 1V41E 2B8TA 1Z2DA 3N6XA 2ZWPA 3FGNA 1NP7A 3KJHA 3OKCA 4JSTA 4L7QA 4J03A 3G0GA 1G6HA 1YIAA 4PQGA 4FMCF 2XXBA 1EI9A 4QWMA 4YP0A 3I72A 4YI5A 1SCNE 1G7TA 1AUOA 1C9JA 1KR5A 1M6HA 1N2GA 1SO8A 1JP7A 3MTQA 3EDQA 4BNDA 5IF9A 4OYHA 4FTWA 4QXPA 1YS6A 4JELA 4M22A 2P2DA 4PZYA 1KSFX 1QRAA 5HX7A 2CBZA 4YRAA 5IH7A 2HSZA 5F9FA 4M37A 4IZIA 1O6GA 2MHCA 3PGKA 1E3MA 1DT5A 1XCGB 4GGOA 8OHMA 3UCFA 5HUJA 1PQ4A 4ND4A 5JD5A 3LWNA 1YO6A 4P33A 3DLIA 3OZTA 4NEGA 3UXYA 1DG3A 4GI7A 3R9WA 4L7VA 4BX8A 3K31A 1W5AA 3U40A 4HH4A 1KJIA 3O1JC 2RDMA 5TJHA 4FYXA 4G8JA 2J0UA 3VR6A 3HN2A 1PZMA 4FB5A 1UT8A 5BUCA 1NP6A 4CL0A 2WD7A 1X7YB 2ATIA 4HCJA 1ZMBA 4JBIA 4ASUD 3B1WA 3FSGA 2JASA 3CJRA 4KR0A 4W5JA 5D1NA 1PZHA 5IVHA 1FTNA 1H2YA 3QH4A 2DQSA 3K09A 5DE3A 3CRNA 5GONB 1N3BA 3WK7A 2IYTA 4PZAA 3OIYA 4L5IA 3SQOA 1FA9A 2IP1A 2Q4OA 5HIIA 3REQB 1ADYA 2DWOA 2OQRA 1SBTA 5C1PA 5IXSA 3E22A 5FLKA 1T3TA 4YI3A 1RRVA 1IG3A 1ULHA 4TKLA 1U3UA 1EVQA 3P9XA 4XCQA 5K20A 4NBUA 4MICA 4P80A 2E82A 3AVQA 5CXUA 5DX8A 4X1IA 3OX1A 1ENZA 4I8DA 3TTSA 3KHTA 1N77A 1ZIXA 3NUGA 2WMYA 3QVMA 3TRFA 1V4NA 2P6NA 3AXSA 2W5UA 2HMVA 5JTTA 1NI4A 3ZHRA 2G5PA 3LP5A 3JD4A 5JASA 2PJDA 1HK7A 4CT5A 1SKYB 1DOZA 2NNLD 4MW2A 3NTRA 5HCUA 1WXQA 4GVLA 1N5DA 4LN1A 3HXOA 2HWXA 3F6EX 2BR4A 2HYIC 3T4UA 5IN4A 2RCNA 2TSYB 2XZPA 3E05A 4KAJA 5AW1A 2IL1A 621PA 1DJPA 2QDXA 1QTRA 1VE1A 3STTA 2Z1DA 3F71A 3GAMA 3HCPA 5F4BA 4A0QA 4C5AA 1UEIA 2D8AA 2FJUA 3FMVA 4MWEA 2FH5B 3RUCA 3O8CA 3BMNA 3G85A 2F48A 1CIPA 1B2LA 4QGBA 1MGPA 1GTJ1 3RYCA 2G9QA 3BQNB 1OX4B 2GAOA 3SLGA 1U7ZA 3AGPA 1U3TA 3PEFA 4PSCA 5EXTA 5DLDA 4D4JA 3BXXA 3CVOA 4RA9A 1JI0A 2VRBA 5HDQA 1ZGJA 5CTAA 4CMIA 3V8NA 2IH4A 4Z4FA 4LHZA 2CYBA 1M6VB 4AZ0B 4BMXA 4P0PB 1EJ0A 1I14A 1WX1A 1KAHA 2HF2A 1PR2A 3BC1A 5TXGA 1XLUA 1OBOA 3DDWA 5KSYA 4CM9A 2LKCA 1NBMA 1TK2A 1KFEB 1RPTA 3RVBA 5BRAA 3P2IA 4XYEA 1BNCA 4A0FA 1IQPA 5J2UF 10MHA 1V8FA 1EWYA 4R5MA 1LX6A 2VATA 5ALZA 4AS3A 1ND6A 1TUBA 1FFGA 2CDNA 3NBMA 4ZVRA 2X0RA 3UTCA 1VKNA 2D2IA 2IEGA 3JAMA 5HK8A 3WL4A 2XGMA 4K86A 5H80A 4B4UA 3KQNA 1QDUA 3ZD6A 1NY5A 2QX9A 4LWZA 5B7QA 3NBUA 4TKUB 4PQEA 4LWPA 2RGUA 5AOVA 4N65A 1LDYA 4YXWD 5A03A 3H4TA 4AN0A 2YWFA 3ESCA 4H7IA 1N5RA 2H7YA 3A0UA 4OBEA 1YJ5A 1VJRA 2B30A 1LWNA 4R1PA 4XD2A 1BWRA 4QYWA 2HHHB 1U9YA 2NZUG 5IJXA 1AUXA 1YE5A 1JQ3A 1K3TA 4OGLA 1HDZA 1JQEA 2BHRA 3EQZA 1R0LA 1Y3AA 4GLOA 1JEJA 4WASA 4A5OA 4E33A 1J22A 5I9SA 5HIKA 4BGIA 3EEQA 3U49A 4JLVA 4B74A 1WB4A 3ONFA 3H2HA 4RX1A 3UJCA 1BCSB 1TIBA 1YJBA 3DR5A 1QH8B 2JH9A 2EKPA 3I9LA 1JF8A 4JVNA 5LZ8A 2I8AA 3FPCA 2Y6UA 3IYLW 3U3JA 4B75A 2BL4A 2CWWA 1T8TA 2ZSKA 3QLTA 4L4YA 1GU0A 1V7QA 3HYTA 5T57A 1QG2A 2WMOB 4FCCA 5IDQA 1EFRA 1WDTA 1V95A 1ZH4A 1WIWA 4ETMA 1AKEA 1WG8A 5EQFA 4QSHA 2ES4A 1M0TA 3S4YA 3AUYA 4KXYA 3SQMA 3VH3A 1YR2A 4URXR 4G0VA 3DP7A 5EP2A 1IZ0A 1LVUA 1G5TA 3EVNA 1ZNYA 1RHKA 3NHLA 5HF9A 1OASA 4FGWA 3PC7A 2OGTA 2PH5A 3GG9A 1N7HA 4KFTA 1XNHA 5T4BA 5EP4A 3G2IA 1ZK1A 4G5HA 1ZISA 2XD9A 3R0IA 3U17A 1GSHA 1Q3HA 3QITA 4NNJA 4CPDA 4R0VA 1B0UA 4G0XA 4Q15A 1H85A 3KC2A 4FOTA 1K8QA 3X1WA 4TRNA 4PSDA 1LI5A 4ESEA 1N1MA 4JX9A 5C7YA 1ID8A 3BWVA 4F9TA 5JSHA 4JV5B 2PR2A 2NTJA 1PK7A 4I4NA 2RK3A 4XOIA 2ANCA 1G4UR 2G25A 5AOAA 4AYXA 5A3JA 3OD1A 4Q9DA 5A4AA 5BN4A 3AVOA 1XMPA 3D6JA 3MC1A 2BGJA 2DQ4A 4UPEA 4NXNB 2X9GA 3FWHA 3V2UA 1VLZA 3RIMA 5KKNB 1WW2A 5HP4A 2HIHA 1NLFA 2OO5A 1U8FO 4JJKA 4RFSB 5KVAA 3REOA 1CEXA 1DDOA 1W88B 2VH1A 5DHUA 2CVHA 3RTBA 3MTGA 4M9XA 4D9GA 4MWDA 5IYZA 1FSFA 3KQUA 1IRIA 1YUBA 2PKQP 4P35A 1DRVA 5FPQA 2H6EA 3EFOA 4FSDA 3DHEA 1NLYA 5A71A 3RC7A 5DSTA 2P9JA 4TL8A 5K0ZA 2BKAA 2FFBA 2PV7A 4FCVA 4E5VA 2HA4A 3FOAA 3GUYA 3QLUC 2B8WA 4BV8A 2HA2A 4TZ0A 1RAGA 1U2PA 1L5VA 2J31A 2QI9C 2QXTA 3AG5A 4JAVC 1RC8A 1C0PA 3SHOA 1UFQA 2W8BA 1JA1A 2G72A 4KE7A 1TQ6A 1HT2E 2J46A 2VPPA 3L0BA 5DYWA 3TSCA 1E5QA 3KDAA 3CO0S 5F2KA 3F4LA 4P7JA 1GRNA 1KC1A 1P7CA 2A9RA 2H17A 2F90A 3CWCA 4FNGA 1DAKA 2K2WA 3RODA 3UIEA 4POAA 4BNLA 4DVGA 2QE7A 3DXZA 1DEAA 4XVHA 1QSGA 1ZJ4A 3L18A 4HR7A 2C29D 4R41A 1HDXA 3RTAA 3DNMA 3WLNA 2G9ZA 4L72A 4BNHA 3CINA 2D54A 4N4AA 4C0XA 2ZCUA 2BFCB 3GARA 1UIRA 3KZOA 4O4IA 3GNLA 1K9SA 4E4YA 2Q5LA 3ZDDA 3TIGA 3CKKA 1NZJA 4LYHA 5CA0A 4D4IA 1BMFD 3H2JA 4ZHQA 1GGKA 2ZYAA 4CLOA 2EQAA 2VWQA 3IR6A 5FNZA 2NO5A 1KXZA 5BV2P 2O1WA 4MAAA 1EXWA 1P74A 1H1LB 2H65A 5BYBA 1EUCA 3PZBA 4Z8XA 1KMHA 4DQLA 2VBGA 1E3WB 2OV4A 4KNVA 1CDEA 1Z06A 2C1ZA 2GUGA 2VN8A 4QPZA 4RWZA 4B82A 2HUNA 2H2FA 2GK4A 2IX9A 3QVLA 4KSBA 5L3QB 4DGSA 2E5FA 1G8AA 4QJ5A 1NVBA 5EIXA 3A4NA 4V3BA 4BKMA 1T1JA 3L02A 1D03A 1HDCA 1U2RA 1YZUA 4G97A 3NIBA 1X7ZA 2QAGB 5JRJA 3LJKA 3OIWA 3OP4A 4WLUA 3CN7A 2X76A 3O8NA 4OKNA 4ALLA 3FVWA 4N8SA 4J0JA 2XXJA 2IV2X 2G04A 3OU2A 4IG4A 1BN7A 1I30A 1PFVA 4KMSA 3PSAA 4B6PA 4HXGA 2CJYA 3ROMA 1SCQA 2W2NA 5EFOA 3C87A 3B6KA 3W5BA 3GWGA 5JDCA 5C9ZA 1OI3A 1XHLA 3GYGA 3IP9A 1U2GC 4C7VA 4FW8A 1ACLA 2H63A 4O4IB 3LXUX 1KK0A 4NK4A 5KYXA 1JDBB 3D4OA 1J5XA 4H7DA 4EKDA 4ZGWA 1EUDA 3CEAA 1XKXA 3HGQA 3ADPA 1SEVA 3TTTA 3KJFA 4HXYA 1VE6A 3CRZA 3K6KA 1YRYE 3CLKA 3IDAA 4GGMX 3NWOA 1VMKA 3CW2A 4N49A 3PZRA 3V00A 3IE1A 1INLA 1IONA 1XDZA 1YZYA 3K9LA 3NHSA 2QVYX 1ZVMA 5DHFA 4ZVTA 2XADA 1JRLA 5DXFA 4JQYA 1ZRHA 3EF3A 1PQYA 2J6IA 3HG7A 3WV4A 2GQ0A 2JHGA 3DE7X 3OEHD 4HDKA 2E4WA 2Y1KA 1VPVA 1K8XB 1X42A 2RBGA 4JHLA 2H11A 2BZ0A 3IMKA 1O95D 1OXSC 2ZYUX 3DMYA 3DKKA 3G1WA 3S0JA 4D3DA 4ZAGA 2HLHA 2CLDX 3BD9A 3E6AA 1YU9A 5C2JB 5KTYA 4LCJA 3UB3A 1U7OA 1QRDA 2IXEA 1QQ6A 4HNUA 3LUJA 1BXGA 4M88A 1RWVA 2NACA 1NHGA 2QLNA 1DJLA 2QTRA 4EI2A 1Z26A 1NU8A 1QYWA 3MJTA 3IAHA 3NAMA 1Z8NA 5A5GA 4U39A 1GDDA 3FVQA 1YBFA 4PLTA 1E2NA 3L92A 4MVJP 2QTMA 2NVOA 1OJ7A 4BX3A 5C5IA 1JTEA 1SU8A 1VLVA 2Q3CA 2V98A 3O31A 3WGNA 4UU0A 4RPLA 4CTMA 4OU4A 4C5CA 1H2ZA 1T3LA 1F8UA 1UJBA 4P4GA 4EOGA 3UKDA 4TLMB 5E2BA 5AVSA 4GSYA 4P0TA 2H06A 4CT0A 5KSOA 1NR7A 1BXRB 1UK6A 4OQDA 4JSRA 4PW0A 4X7BA 2X8BA 4PC7A 2DUUA 4BQFA 4E5KA 2X23A 4FW9A 1SKAA 2WHXA 3OSUA 1J6UA 4TV8A 3RUEA 1TUGA 3C3WA 4C08A 3AUJB 4S0ZA 1WBDA 5AQ1A 3WNVA 2PL9A 1I3CA 2QT0A 1RJGA 1WVIA 3O9ZA 1K0FA 4NJOA 5KZMB 1AMNA 1CQJA 4XX0B 4NJMB 4O4LB 4RIEA 2WTMA 4JJIA 5HCNA 2FFJA 2O7VA 2V96A 2IITA 3CMCO 4UMDA 3UMGA 1TKBA 1H93A 1AN0A 2OO5C 3TEMA 4EYQA 1V5WA 3P97A 4NAHA 3FF4A 2QD2A 1DFHA 4EPYA 5HZHA 2FQXA 3DVAA 2FN9A 2C57A 2BGRA 3SZRA 1Z9BA 3DZ8A 3O74A 3K9BA 1Y8RA 1CUYA 1DBQA 2G5CA 1TLLA 4UHFA 1CY2A 3MYRA 2Q1SA 4B76A 3ZGNA 1I6LA 2DUMA 1UT6A 2BRUC 3N3BC 5CYGA 2ZCJA 4XFKA 3F1KA 3WKEA 5EMNA 3CHYA 4HXEB 2Y1CA 4KQHA 4QQ8A 3P0EA 1S96A 3OQIB 1GQSA 4PYRA 3JAWA 1PWZA 2X6RA 3CRRA 4YCDA 1XTZA 1XMXA 1EK5A 2WIDA 4IFBA 3S28A 3VR4D 4DDVA 4QDKA 5T41A 3NTLA 1YC2A 2GTHA 4N6OA 1MVLA 3IHTA 4D25A 3VPAA 1IBCA 2HQSA 2VWPA 2NOAA 3F1LA 1U9IA 3IFSA 2FMUA 3O21A 4AUEA 4YAUA 2XCSB 4ALJA 3Q2IA 4HFJA 3DV2A 3ZUGA 4BGEA 1DIAA 1RFLA 1HNNA 3AF5A 1L4EA 1ESMA 4JVLA 4S2EA 1CR0A 1F2UB 1TO6A 3VVBA 2HEIA 3IQGX 5AW4A 1AF7A 4NKRA 3UJHA 1WB6A 3VPDA 3LT0A 1UJ5A 3ECAA 4PE5B 4CMHA 1FFAA 5E2AA 3NCTA 5C1IA 3UM9A 2OHXA 1TX4B 2Q3FA 5HF5A 2IWHA 4BECA 2AJLI 1P9OA 2J0EA 1NURA 1SMKA 4EM6A 3KYBA 1JDSA 3RVRA 2PS0A 3GCZA 1EGHA 1C0KA 1S5PA 5K0EA 4ZQHA 1EK0A 4I2NA 4B3IA 3DA8A 4FM9A 2RCYA 4NCKA 4ZU6X 3GT4A 5K3SA 2VDLB 5JQGF 1ZAYA 1H9AA 2FRDC 5E9JA 2CYCA 3WR5A 3MXOA 1VHQA 2CLHB 1XG5A 4MOWA 1DC8A 2YOFA 4IDCA 4IIJF 2PKWA 3BCUA 4O4LA 2VP4A 4TS9A 1YI8A 4DCUA 2N9UA 5LBIA 5TB5A 3U3MA 4L5YA 1WHTA 2PZJA 4AULA 2JVIA 3DO5A 1GQFA 4UXJA 5F5LA 5IM5A 1AO0A 2QAGA 3OZXA 3QPWA 4PYNA 3K6SA 4MCAA 3LHKA 5LXTA 4P7FA 2VQFB 8MHTA 2GF0A 3Q4GA 1E96A 1S1CA 3Q8XB 5FPHA 3HUFA 3C45A 3CH5A 2DQKA 3HI4A 2JA2A 2QE6A 3I9V6 2E1PA 1X2EA 5KS2A 3RVMA 3M9WA 4FFBB 1O3YA 3HPQA 3H42B 3K3PA 3KR1A 1UJCA 5AJYA 1T5BA 2PXCA 2FWMX 1JQJC 5EINA 5KTRA 1DARA 3FOFC 1TM3E 2D4AA 2XDQB 5LBUA 4EELA 4DL9A 4BNWA 2W2OA 3CNOA 1BFDA 1M8FA 1OTYA 1U8YA 2F9MA 2JHAA 2Z2ZA 2ZR7A 3ELYA 1UZUA 4XQCA 3N58A 1M6EX 4Q21A 4NV1A 1PT8A 3DAPA 3G7SA 2W6JA 1DWUA 5B2ZA 2F55A 2WOOA 4PYLA 4IDAA 3UK1A 1DQPA 1VL5A 5TDHA 4BO5A 2O5EA 3ZI0A 2ECPA 4DA0A 4JZYA 3B3GA 5IBQA 4HTFB 3PCTA 2J08A 4YCSA 1E0AA 3VU9B 4DYHA 1ESZA 4QRIA 1QFSA 3QOYA 3BMQB 4CF3A 2C7OA 4OLHA 2ZJ5A 3I2FA 4U2KA 2HV9A 2VYND 1S4MA 2QPLA 4PNHA 4RADA 2NQ8A 4QULA 3P9ZA 4ITVA 2CVZA 2NZYA 3D8NA 1VYHA 3GN1A 4EZBA 1IUOA 1KEZA 4RCZA 2FUKA 3OSZA 5LMZA 1KJQA 4QELA 1NVAA 4FLMA 4WFIA 2W8BB 4MRAA 2J0UB 4EFLA 1IJKA 4G84A 4DC9A 2NTYC 2Q2QA 1IEWA 4O5OA 1XTSA 3FDJA 5TEVA 4QAQA 4D8XA 4MH0R 3UG7A 3TFQA 3DHYA 1VIDA 3UGJA 4MDHA 4QHYA 1KEVA 2GKSA 4N0PA 4WXEA 2EBFX 2JI9A 3G88A 4DDTA 5LLTA 1YGYA 5G1NA 4LJAA 2WTXA 4MYDA 4X90A 2DHEA 1SR8A 4GW3A 1OT3A 4V03A 4MQ5A 1DWOA 2DHRA 3U4QA 1SBHA 3ETNA 4PFSA 4N03A 3SHTA 3DGFC 3TLGB 3WLMA 3QQPA 4KMRA 1QHXA 3V34A 1YDMA 1KEKA 1II8B 1G98A 4YONB 4OI2A 1Y4UA 3ABZA 4E14A 1M6VA 2EKZA 3BFXA 3PFFA 3FX2A 4KACA 3ZTTA 4DMUB 1OAOC 5TMPA 2BVNA 5T8KA 1TA4A 2FPWA 1U0JA 1N2IA 4C01A 4R1UA 2PAAA 3A1FA 2XE6A 4JLSA 2BWJA 3S40A 1E1MA 1G42A 1QLHA 3WIVA 1JWLA 5A0VA 1MJGM 1R16A 3KKOA 1FP4B 4PBTA 2DKNA 1FTYA 4Z4GA 4X94A 1YFLA 4Z99A 1MTZA 1PX2A 1PV2A 2FOXA 3D6MA 1QX3A 2RC6A 3MT8A 3PDIA 3U56A 1L7RA 3P4YA 2QXYA 1CE8A 3T94A 2GTIA 2XBLA 4DM7A 4ZWNA 4E1AA 4RM3A 5FUQA 1TUEA 5J9FA 2X0IA 2WF5A 1L0BA 4LCEA 1QRRA 2BMVA 1XEFA 3PQ6A 4BWGA 2EJBA 2IT1A 1MNAA 3MRXA 4EF6A 5BW5A 3AC0A 2QYHA 4BGDA 3JYOA 4AIIA 4TMYA 3TSYA 1IPHA 2RHRA 2XKAA 1OFGA 1Z16A 4YP1A 3U7HB 1THGA 7ABPA 3KOYA 4KPUA 1ZOIA 3IAM1 3ADOA 3DOUA 4BFVA 3THWB 1RLMA 4WW0A 5GZ3A 1Q7TA 1BMTA 3JRXA 1XCLA 3B1ZA 1V39A 2XV1A 3OLQA 2IV7A 2B9VA 1P31A 3N0TA 5LA6A 3ITNA 5CT8A 4PINA 4YCBA 2H1FA 2XOKD 4Z54A 1I5OA 2PYZA 3DOIA 3W1WA 5CB0A 4Y2HA 1B00A 1NG1A 3M82A 3P2KA 4M9QA 4W8GA 5AXDA 3UMFA 1AQNA 4MHTA 1YTUA 4LMRA 4J8PA 3A26A 4TM8A 5DTIA 1X1CA 4TVOA 3TLGA 4Y98A 1R6TA 3I45A 3WGMA 1D4ZA 4HNRA 1H6CA 4UW9A 2AKAB 2C8VA 3RTDA 5JSFA 4QA9A 2HSJA 2A4KA 3PEEA 4U2BA 5EKTA 4KX5A 1GNLA 3DKRA 4M87A 1KBQA 2Y1FA 2GAAA 2BFNA 3DT6A 2PUVA 3B2NA 3OWXA 4BVLA 5KX5A 3ICWA 2M1ZA 1ONPA 4ZCLA 1T9GR 5CNMA 1EKXA 1H4VB 1QGAA 2DKFA 4HJXA 4XWGA 3PRJA 1P18A 3VTZA 3DTNA 4L0DA 2QV0A 4NYIR 5TQVA 5LN1A 1RQ7A 3DLCA 3L40A 4TMTA 1JG7A 5IKXA 4RHUA 2J3DA 2REQA 3BMOB 3HCRA 4JB0A 4RKWA 1RLTA 3H65A 2PUBA 1VPDA 1GZ5A 2VPIA 3A8TA 3FRIA 2EFGA 4D8VA 1A8IA 3I4FA 1NJSA 2IWRA 3J7AC 5JS8A 4H16A 3UJ7A 2C88A 3AEKB 3INRA 3KEQA 3CVYA 1EM6A 2HDOA 4LJ6A 4IJ6A 4TV9F 2ZJBA 4JLPA 2BEJA 2VP3A 2B8JA 3HDQA 4AP5A 4DG8A 3AQIA 5JNRA 4Y2VA 5LWQA 5LM3A 1DKUA 1B6SA 1N9GB 5K0CA 4LYEA 2ZRPA 5KUTA 1ISHA 5WRFA 2OCAA 6PFKA 1YQTA 2MJLA 4CG2A 1FBTA 1P1IA 1VRVA 1Y3CE 4R8SA 5BR4A 4OYLA 4YJ2F 1N9KA 2WKWA 4D5GA 1XMSA 3EUAA 1V3VA 2QZZA 4ILEA 1GCGA 1VLJA 3TVYA 1RM0A 2H16A 5DF1A 3OPYA 3FSJX 1RRMA 4EQZA 1S3SA 5JAPA 5K8JB 3M4JA 3IXMA 1X94A 4FHCA 5F23A 3USZA 5KHAA 2RHLA 2V9ZA 4MS4A 3IVAA 4J07A 2E6UX 4AX4A 5IKOA 1SCAA 5AW5A 5BYAA 4AKHA 3SKXA 1H5QA 2HF7A 9ATCA 1M2OA 3HB5X 5AVOA 1J25A 1E98A 3KCNA 3H2KA 4PZZA 4ASUA 1RVV1 2GA9A 5CDYA 1R27A 3FTFA 4J0KA 4FZVA 1CUXA 4KFUA 1XEWX 3I92A 4PC1A 5LCXA 1H0KA 1HZZA 3PBKA 2IU0A 3OZUA 4ZV9A 4AG6A 4R2KA 3DDNA 4FMPA 1XTTA 5EE0A 1KYYA 1TUIA 3BJEA 2QN6A 5LD2B 1KFJB 2EERA 4X8MA 5F2OA 3TQCA 4KQJA 1CCWA 1WBJB 2HDWA 1G64A 4TLEA 3UN1A 4B87A 3KOZA 3A58B 4US2R 1I9CA 4X41A 2XCOA 1XYVA 4OLJA 2GN4A 5LIPA 1DJOA 4PRLA 5EXDA 3FWYA 3HYSA 5E1DA 2DQYA 2PSFA 1NF8A 2XW6A 1AV7A 4NBVA 1NW7A 1Z74A 3T3DA 3KPYA 3FAKA 4PCAA 2IV3A 4IIEA 4PFQA 1NVFA 4M6WA 3RE1A 4ZCTA 2GN9A 1O5OA 1RSZA 4RTQA 2AEMA 5CK5A 1A4RA 2XMCA 2I54A 1LI4A 3OT1B 1D7OA 5KAMA 5D01A 2EL9A 2ZR9A 3RLIA 3JYPA 1HYHA 4REOA 5JXWA 1CR2A 1SU4A 1I24A 1YVPA 8GPBA 4UTZA 1H66A 2GFHA 2WJZB 3L7MA 5H7XA 1CY0A 2WAXA 4Y6OA 1WPXA 1JJFA 1GRVA 3GLHE 2FWAA 1TTPB 2G36A 3QOFA 1G41A 4P9NA 2VAXA 5COQA 1FDVA 3NV7A 5AESA 1TU3A 1WO8A 2MOKA 1E1LA 2FXVA 4MRSA 4HRXA 4WY8A 3CCBA 5AVJA 3VX4A 4M0LA 1FYEA 2WU1A 3ZCSA 2GDZA 3FRHA 2Z5GA 1JU4A 3DZIA 1FVHA 1JALA 3L6UA 4GD3Q 3TLCA 4BN4A 2YC2C 5C46F 3KWJA 1XA0A 2XTJA 3EZ9A 3H86A 4UAJA 5EE9A 4YJFB 4ZAWA 3WLOA 5F1KA 1G4AE 2CXOA 2UXBB 3ABIA 1QHSA 3JQBA 4WFQA 1CRPA 3SAJA 4Z9FA 3OQHA 1SIBE 3SR0A 1NQTA 4HUQA 2WVJA 4KWEA 5EA2A 4ENTA 2C9MA 2ZRLA 3HVJA 4LNHA 1VJTA 5ETJA 2X40A 2RONA 5E1MA 4D4LA 3L0ZA 1JSXA 4OHFA 1NVGA 4AMZA 2H4JA 1Y98A 4N3AA 2WJPA 5GJCA 3QX8A 3EBOA 3T06B 4B40A 1N75A 1HX7A 3MWDB 1ZD8A 1VLQA 1GVNB 1I13A 1TAGA 4JB8A 1A9RA 4ZTBA 1TXGA 4ALNA 5JVDA 4DV1B 2HDNB 1DQYA 1O97C 3M6UA 5H4HA 4U02A 1Q14A 5A62A 2A1UA 2R84A 4IYJA 3U1VA 4ARSA 3H19A 1QFMA 1C3OA 1LK5A 3RGWS 3QSGA 4MRNA 2AWNA 4EKNB 3U6BA 4LIPD 1OFIA 2NO4A 3JYLA 4OB6A 5FTKA 2GDJA 4Q1EA 5G53C 3RFCA 3WGKA 4G24A 4BFLA 3DC7A 1B0AA 2FSVA 2WSBA 3AFIA 4FGJA 2P9EA 3D2AA 3EGWA 3MA0A 4N3CA 4Z2AA 1XFAA 3I1YA 3K9CA 1RDFA 5JO9A 4F60A 3CVWA 1T5DX 1AURA 1JAHA 1U0LA 3DL2A 3L8DA 2BP7A 1MGOA 4YQZA 3ZJ5A 4NJEA 4I4TB 1Z63A 5EKSA 4NOMA 3BFPA 1QH1B 2CB0A 4MQMA 1M1NB 1G7SA 3OEEA 1O7JA 3E35A 3VAZA 1SVOA 2W6NA 3LLSA 4C20A 2QR3A 2A4MA 1HDRA 4Z1MD 2VJLA 4B4KA 3SEQA 1L2TA 5JIBA 1NV8A 3KZ1E 1KEUA 1R2QA 1A98A 1Y3IA 3C7AA 4GQBA 2A5GA 3DF7A 1PD0A 2Q1XA 3KYCA 4X1YB 1IBSA 3ROKA 2Q46A 2BGKA 4BQOA 5KOHA 2Z9CA 4K0KB 3MMPA 2H1CA 4OHRA 3T0GA 5AHRA 5C8YA 4UBNA 4IFTA 3CEMA 4DGQA 1UQUA 3FCOA 1ILWA 1ZD1A 1NWHA 2C77A 4UUPA 4Y0AA 3MCUA 4ZMBA 5GJBA 1X1SA 2FF5A 2J3HA 3K4HA 1QCZA 5IVIA 3WE7A 4CODB 1Z18A 4EKYA 1P4JA 1GO2A 3CZMA 3JASA 2AWOA 4IQFA 2FX3A 1FK8A 4WAUA 4J90A 5U4XA 1Q84A 2G88A 1NUSA 3ZWBA 3MTAA 1O94C 1AKWA 1QK3A 3GBVA 4JQCA 4R3WA 5ES4B 3RJTA 5CJPA 2FKNA 3DV9A 4GSLA 3E7DA 2BI4A 2V58A 4IWXA 3SC2B 3ZGXA 4DLNA 5HZGA 3P5BA 1RADA 3CH7A 4WJLA 3HO1A 3Q40A 2FPIA 3DPSA 4RV4A 3RF6A 4EA9A 2WJYA 1QB7A 1F3OA 1LRJA 5CG2A 1JBKA 2X5JO 3HNRA 3S8EA 2C5AA 3KZMA 3WDSA 3COZA 3C70A 2RC5A 3WSVA 2XNKA 3FJ1A 4N0QA 4DRZA 5HZKA 4MI1A 3QLEA 4Z9BA 4POOA 1C4WA 2WNHA 3U3RA 5EOVA 2Q2NA 3OCWA 1REQA 2Z2XA 3D43A 1L1RA 1XX6A 3CA8A 4H08A 3FNHA 1JHQA 1IEVA 3O38A 4FNOA 3SXUB 2VAWA 3C6KA 2BBOA 4JMLA 5KYTA 4L4XA 1LCIA 1QS0A 2QVGA 3IV7A 2Z4SA 3GZTB 4G6ZA 4PR3A 1C29B 2AOUB 1Y80A 1VCMA 4M9SA 5K09A 5G02A 3O4GA 3KLMX 4JUCA 1ZMXA 1P6QA 4LDNA 5KWIA 4Y1FA 1RWBA 4MO9A 1YS1X 3CV3A 1CUZA 1HE1C 3R9KA 4JLKA 1BDMA 2BCGY 2IS2A 3TB4A 1ZFNA 2R97A 5T3UA 1CETA 4NMWA 3I2JA 5DHPA 1EZ4A 2HK8A 2HJ9A 2MU1A 3LSYA 4HLNA 1OU4A 1L1QA 2YW9A 4HC4A 2WUEA 5LD2C 2Z57A 3GUHA 1F1JA 4QARA 1KQNA 2XUAA 3HLTA 3NI2A 5ALJA 1ARZA 3TMAA 1W4AA 3U44A 3U16A 4Q3AA 4MEAA 1X80A 2Q45A 1X7ZB 3MBIA 4QXQA 4Q1VA 3RHZA 3SHWA 5BSWA 2B1JA 1DWPA 4ENUA 3DBRA 3TOCA 3HTXA 1KRXA 1Q1ZA 3LZ6A 4BNGA 1RI5A 2CMFA 3NBFA 2Z04A 3RU2A 1CT9A 4GLBA 1HFEL 4ZIRB 2MSEB 4MWBA 3K09C 2X1VA 4WZBE 4ZQEA 1SH7A 4RKEA 4JI5B 1U6JA 1Z2NX 4TV9A 3H1AA 2BGUA 1RAHA 2XWJI 1A9XB 3ZCTA 3ND7A 1K63A 1SUFA 4TYNA 2OBYA 3FDZB 4MUXA 4F4JA 1IPFA 3GEPA 1AJEA 3HB4X 4C4PA 1ZOSA 4LBVA 4B85A 4B6SA 2ZVJA 2J6HA 3KIPA 1NNUA 1L4FA 3OLZA 4Y7CA 2BEKA 4XWKA 2WJ3A 3SC2A 3UXHA 3WSTA 1GPYA 3HCCA 3HKDB 5DM4A 3ZIAA 3LP6A 4BV2A 4GYJA 1OGYA 1U9ZA 5IRCD 1OF1A 1XZHA 2LR0A 2Q07A 3CRQA 5K51A 3UB4A 4DLLA 2B35A 2O1XA 3KKMA 1YBMA 3KXPA 1O89A 4PYIA 3U09A 3S81A 1T34A 4GOKA 1CB7A 1YZTA 2YWXA 1E4YA 4FHDA 2ZSIA 4TX1A 4YQYA 3KV3O 1CFJA 4EARA 3TE6A 4GZMA 2YJGA 4K6KA 2WFMA 2QZ9A 1MORA 3E3NA 5DB4A 3IQZA 1DC3A 1XAGA 1QYIA 1BN6A 2PQ2A 1RZ3A 1QM5A 2BFAA 4W99A 2BF7A 4C9BA 4WFJA 2YINC 3DFIA 5IAGA 1YCDA 1M76A 2X13A 1LS6A 1RYHA 3G8YA 3FLEA 5DM60 1XPUA 1GPKA 1Y1TA 4PYOA 3KKKA 2QAGC 2RB5A 2HRQA 2QRVA 5DX0A 4UPDA 4YJGB 3S8MA 2Q3BA 1EUDB 2JH8A 2JB9A 3E3LA 1Y3DE 3L5KA 4BJ6A 4E51A 5I45A 2DWCA 1ZHHA 3H9QA 3OFVA 3TQFA 1C14A 2QS9A 3ZHYA 2CVQA 1FNSA 2P2ZA 5F64A 3T7TA 4A1OA 1VP3A 3GLGB 4JS0A 4BB6A 2APJA 3PC6A 3C14C 1N2CB 1XUOA 2VEOA 3CR7A 3KQHA 4XB2A 1XKTA 3DWIA 1U1CA 1PEYA 3L7DA 1MX9A 4RQBA 1MX1A 3U4IA 4TVBA 2MMGA 2JLCA 3BF7A 4W5QA 2DBZA 3EPRA 2A3NA 4R1NA 2Q5JA 4EK9A 4REQA 3DO8A 1NG9A 1ES9A 2O19A 1IVYA 1DXHA 3I58A 5AM4A 5F78A 3ZCRA 3LL7A 2C7PA 1CV2A 2IH2A 3I37X 2GI4A 1UBLS 2CY0A 3P0HA 1P8AA 3HB1A 3WAJA 1QBGA 4M7WA 2AVDA 4OKIA 4XARA 1UBFA 1M54A 2WWWA 2GN0A 2P8JA 4IP0A 4X3CA 4PN3A 5BWLA 2JLUA 4L57A 2IZ5A 5L3SA 3SPXA 3QWIA 5DV9A 2E6KA 3ZBPA 1ICEA 4EW6A 1W93A 1ZSNA 4TTTS 3FPKA 5TY0A 3L8HA 4HFMA 4CCYB 3X1DA 3WB2A 3WZLA 2ZAMA 1ZWKA 3WK5A 4WGGA 4CV3A 2W83A 4D3XA 5IPFA 1Z12A 4CG1A 1BMFA 1I3NA 1KXJA 1RXSA 2HFKA 2WG0A 3A3KA 3CQ9A 3E9QA 1XF9A 1D0SA 2J9RA 2OD2A 3K35A 3KKLA 4Q37A 1UBCA 3ZQ4A 4CGYA 3WLRA 2EIXA 1UL1X 1JIUA 1R8XA 2C78A 5F9HA 2WSMA 1CUWA 5BVGB 3OMLA 4ETWA 3GJTA 4G5XA 4WKNA 1JZTA 1V5GA 4W6QA 3RFFA 5CB4F 2B6NA 5CT5A 1S8FA 2W6ZA 4K6MA 2XMRA 2H52A 3O2NA 4WXHA 5DBIA 2ON6A 1FS4A 4X85A 3AUTA 3MIZA 2J5RA 3HLYA 3HJFA 1RP7A 4RQAA 4M1YA 3M1YA 4RIHA 5T8KC 3VZBA 3HVHA 1KS2A 3UENA 3V3KA 3VSDA 4F4HA 5CU7A 5I8PA 2ZB3A 2ODWA 4MLPA 3HKEB 4QDJA 1GPAA 3NH9A 4WZBB 1RWNA 1SQ0A 5JSYA 3TRIA 3KETA 1BIFA 1YR3A 5AW2A 3O0TA 4E11A 3VZQA 1CDOA 1IZZA 4QM6A 1ZD4A 3CZAA 4XVUA 2H18A 1N7JA 6REQB 4D8WA 1SURA 3E9ZA 3DQZA 1J70A 4EWLA 2ZBQA 4XASA 3TEFA 3GLGA 4GGPA 1WPRA 5H9VA 1T9AA 2QJOA 5IHPA 3LQKA 4J2TA 3O8OB 4FEYA 1FRQA 1J06A 2CUNA 4V0OA 4DV0B 2CB9A 4U5XA 2FRDA 5SYNA 3RT7A 1DE0A 1C8BA 2Y8EA 1TQDA 2FW0A 4O29A 2QM0A 5K5EA 2I78A 4UKDA 2QTGA 1YSCA 4KYVA 1RHQA 1Q0PA 2D4HA 2OGZA 2ZRKA 1UJ4A 4RZSA 3MPUA 2IYZA 3OLYA 2PAFA 4ZI2A 1T29A 2FN3A 2RAVA 2DHCA 2XX3A 4EHJA 2XEXA 5KNBA 2KX7A 2RIRA 2X9NA 3TUZC 2VHUA 4FI3C 4C03A 2PT5A 1ZO8A 3D2LA 3L3BA 3B5EA 3PA8A 4GPAA 2HH9A 4DCJA 4XGIA 3NTVA 2V97A 1QX4A 4DEXA 5MGBA 1IBKB 1NSTA 1E3SA 1AUQA 3HJGA 3MJSA 5C8YF 3R23A 4MW4A 2IUTA 5ADUS 1T8WA 1GCIA 3I8SA 3PCXA 4IDGA 2ATXA 1NX9A 4XM0A 4W5TA 2E48A 3M5CA 5JDCC 4TXMA 4X6LA 4ENPA 1DIOB 2QIPA 4L73A 4UQPA 3BSFA 4B6GA 4LOJA 1XD9A 3X1YA 3KZXA 3BMNB 3HY3A 2VCHA 2BEUA 3QM1A 1YOVA 3OUZA 3RKSA 1T9BA 1JG3A 3LBAA 3OPNA 4MHSA 3RRBA 2XF8A 1Q19A 4YRBA 3CH4B 3T9DA 2I7XA 2CL0X 4HQFA 4INZA 1OC4A 4MRMA 1DQRA 4CM3A 4OXKA 4MVJE 3VOSA 2V7TA 2BI8A 3NEPX 4PPGA 3WRYC 2WUGA 5HCIA 3D31A 3R7WA 1J33A 3K70C 3PQ8A 4XX1A 2O8DB 1O6FA 3E8SA 1WUJS 2O48X 1RQ2A 3CCFA 4EH1A 5GZ1A 5K0GA 3I0ZA 4RPCA 4PCUA 2FEOA 4CM5A 1BCSA 2WU3A 2ZU0C 3F46A 4XWWA 2C98A 5FBLB 3ROTA 4MPDA 4N40A 1ZCBA 2XGGA 5LBTA 3ABRB 3E48A 3F7MA 4UMVA 2PH7A 3WYNA 1AKNA 3STYA 1WB5A 2ZJ1A 1EFRD 4Q01A 2AFHB 1KAOA 1T0UA 3L1IA 1RPJA 1LPNA 3ANXA 3KM0A 1LTHR 3NKFA 4CU5A 2FQWA 3WZMA 1Z7WA 5D5HA 4WHMA 3SJZA 3QOXA 1EFDN 1IWBB 2I6TA 2OPBA 3IODA 5DN6D 3NBAA 4BTEA 2Y3IA 3DMFA 5IMBA 2VQ6A 1WTCA 4BLVA 5KWSA 1UMDB 5CJ2A 5GVRA 3WYDA 2BT4A 2I4OA 2Q3DA 5AI9A 1XGKA 6GPBA 2VNSA 5KVVA 3T5BA 3FETA 4QBKA 1TYBE 5EVCA 4G0UA 3RJMA 2C07A 3SMQA 1ZUD1 3QU2A 4XA8A 4JGGA 3THSA 1L7VC 4FFSA 4MV8A 4OEHA 3U4QB 4PM4A 3R9XB 1PT9A 3FPFA 4I1SA 1BJTA 4IXTA 4ZP1A 1J8QA 3CKLA 2DLNA 4DTIA 3C3PA 4L4ZA 1DG1G 4LSGA 4MV1A 2KM1A 3LCRA 1KBOA 3A9VA 4IIVA 2VZEA 3AKDA 1J9ZA 3RARA 5FBZA 4AB1A 1KA9H 2OGSA 2OM6A 1UMBB 2QW8A 5EVJA 1QO0A 2ZM5A 1W88A 5SZIA 1IUKA 1ULSA 3TOXA 3QVKA 4G9BA 5ED0A 4YMGA 3ADCA 1HPLA 1WOMA 4Z4CA 1YB5A 2G6TA 2P35A 1JIVA 4X3OA 3B6IA 3RT9A 5K9ZA 3MJFA 4OJTA 1IHDA 1BYUA 3L4BA 2GBGA 5ITSA 3QMVA 1MV5A 1O8CA 2OWDA 3IUEA 5DI9A 1NMYA 4HLDA 3A6EA 2QW1A 4MROA 5DP1A 1EBUA 4F71A 3IT3A 4O3FA 5BSMA 1M34E 4X00A 2RJ3A 3LX8A 3DLTA 4ZZ2A 1P33A 4CKWA 5HHTA 1JR3E 1ESNA 3IVGA 4YP5A 2A3RA 3LT4A 1KJ8A 3W3AD 2LIVA 1KYZA 2Q6IA 3DTVD 3QE3A 3BD8A 4TMVA 1N2JA 3RSGA 1FRVA 4MUEA 4E5NA 5INTA 3O8QB 1Q22A 1B8UA 2A5FA 2R79A 1VZ2A 3HSYA 1KI4A 2IYUA 1FNDA 3C7TA 1H05A 5IT4A 2DECA 1TZCA 1MP0A 2H4WA 5C51B 1E0JA 1TO1E 3MLAA 1F51E 4YAFA 4D6YA 1AUPA 4OUKX 5E4TA 3KD2A 3M2PA 3EVAA 4XWTA 4RVNA 4TYWA 1Q3KA 2HTEA 1U1DA 3UWDA 2Y76A 4UM8B 4AROA 4MHOA 3OZSA 4NOLA 1SOVA 2JANA 1XTBA 5BSKA 4Z4IA 4NCAA 1C7RA 5MHTA 3OC0A 4TTVA 4DBZA 2AE1A 5AK0A 1TM7E 1U98A 3IRUA 4IV8A 4RZHA 2JCBA 2K6GA 1YB4A 1RJDA 1MC5A 2PT9A 3HBLA 1WWKA 4IGIA 4QVGA 4EJ6A 1HXHA 3QFTA 1CW2B 1J90A 1E32A 3AL2A 3VPGA 1T8SA 4ZHQB 2E7ZA 1JQ5A 4OFBA 2JIBA 4XGNA 4U7FA 1YASA 2AXNA 5T6BA 5KVQA 3O7MA 3V32A 2AS0A 4GYWA 4MR7A 4YQFA 2AZDA 3PNYA 3HBMA 1NZFA 3I9JA 3HMKA 2YFKA 3IBCA 1K6IA 1RYDA 1Z4MA 5D3KA 5EHGA 2RGAA 1ETUA 2BKLA 2MSLA 3L6BA 3R0VA 4LYAA 4U7WA 2ILTA 5F5NA 4E5MA 2AE2A 2JKVA 3W06A 5BSEA 4WWHA 1REQB 1YCHA 4HX9A 3IKLA 3BFJA 2Q1TA 3DFUA 3EGCA 2WJJA 4WINA 1IEQA 3RO7A 4B6EA 3M33A 4JP5A 3IDZA 4LYYA 1PWHA 3ZVNA 1P77A 4ZVOA 2JFWA 4DRYA 4EGJA 2HY7A 5E1BA 1DP4A 1VXOA 1XD2B 1XRLA 3WBFA 5AW0A 3EEYA 3EIWA 3KOXA 4NU6A 4R8LA 2DR2A 3P52A 4QHSA 1JB9A 2PZEA 1Z7BA 2Y6VA 1E60A 3JRNA 4MR9A 8ABPA 4XZ3A 5AI4A 4V39A 1GN8A 3W9BA 3H8JA 3IJEB 2B5VA 1YFKA 2ZU6A 4M7RA 4BDSA 2UVPA 2J3LA 2W4QA 3HKCB 3UK7A 4EQ6A 4RXTA 1U8XX 2DSTA 2SCUB 2E85A 3EXG2 3QLUA 4LDRA 5DLEA 4LMAA 3RRMA 2N47A 3GJZA 3STUA 3T7SA 3C7DB 1A7JA 1N0IA 2XXAB 4BATA 3LUCA 2XDQA 4FDTA 4NZNA 3T9CA 2CLFB 4NMMA 1A9TA 1I0ZA 4WLNA 2G7MC 3BSWA 3D3JA 1BX3A 2JI4A 2PVPA 1E3IA 3EMVA 3H5RA 2YN4A 2GJ4A 1O4WA 3E7PA 4X1YA 4EATA 4NJMA 2OLEA 3C4JA 3CIOA 4RSRA 4BMZA 2R66A 3N5CA 4INJA 4CQLA 1KIFA 2HW8A 2J0QA 1FSPA 2A88A 3RI3A 3P9CA 5BQ3A 1DOHA 5EUQB 2VJBA 2Z30A 2ZBVA 5KHOC 1IVSA 4W1PA 4RZIA 4GUAA 5D8DA 5AVXA 4BNKA 1YD7A 2WKQA 4G37A 1ABEA 1QMGA 4KQ2A 3LHIA 3WHPA 4CEJA 3CT6A 4KLAA 4MGEA 1U2QA 4Q1AA 4QC2A 2EEZA 2AMVA 3LKBA 4AZ3A 1FFHA 1OVMA 5ALFA 3UKOA 1A88A 2IHZA 5J4LA 4FMDF 5CDSA 1RT9A 5ENZA 4FGUA 2ID8A 3GD7A 4WNIA 3B1KA 2ZRAA 5FDFA 4UAGA 3FWPA 4PANA 5J63A 1A8QA 2P75A 5J3JA 2ZCVA 2YCLA 1FLVA 2ZRNA 5CPBA 2XYQA 4HWGA 3PS9A 3RAJA 2JLWA 4P7KA 4JJ7A 3WIOA 2RHHA 1O57A 2R87A 3AF3A 5HILA 4F4DA 4DV4B 1NNI1 4NS1A 1ONSA 1VPTA 3SG0A 4YN3A 3H0EA 2RE8A 5FUBA 4GXRA 2R96A 4MGHA 1D1TA 4ER0A 4BS9A 1I6KA 4A8TA 2LCQA 2H5LA 1N3LA 1OFVA 4DR6B 3GLKA 2WOJA 5B58T 1YUMA 2C7BA 1NC1A 1NV9A 1Y9JA 2CMHA 2PO7A 4ARAA 4XYMA 3ZS9A 1UFOA 1Q0TA 2CD7A 1JPVA 2ETVA 3HKBB 5DNUA 1AA9A 1SVKA 3L4SO 2ZTMA 2OV1A 2PIAA 4LBZA 1N2BA 1V48A 3RHTA 4GMFA 2IDJA 4WE3A 2Y0EA 4ZCRA 2B61A 4PAMA 2VO1A 1AQIA 1MT0A 1SU6A 4G65A 3OMXA 1S89A 2C84A 3TSOA 2SCUA 2QHXA 5IFKA 2QK4A 5EWJA 1E66A 4BB0A 4P3PA 1FEZA 1ID1A 4MVJI 1T6BY 1ZSVA 1RTTA 4NZ9A 5EMLA 4YRCA 3UFXA 3WK8A 2EF1A 2R6HA 4FDVA 4RJKA 5EQJB 3U80A 2RBEA 3OZEA 2RKWA 3CPJB 2O8BA 3TW4A 3UMVA 2FMHA 1PR1A 4CIAA 3MGAA 1H2RS 3IQEA 3LT5A 1EB9A 3F3KA 3NDPA 4RH3A 3K8ZA 3AR3A 2Z3ZA 2GYVA 4MX8A 2ZETA 4BP1A 3NPMA 2ZZMA 2WK1A 3VQTA 2R6CA 4UHCA 5ALHA 1XQ1A 1TCAA 4MLDA 4OQYA 4NCXA 3OQIA 2BD0A 2XMDA 5DIFA 4BFUA 4BCBA 1XLTC 1NZDA 2XEDA 4IWYA 1WQ4A 2C9OA 4OHKA 3TOVA 3PRYA 2C0QA 2ECKA 5T7BA 3RSSA 3OPVA 2PBFA 5KNCD 4QNMA 1H2BA 2QYOA 4B47A 2QMHA 4FYPA 3A2MA 4G4IA 4KWHA 3CUVA 1EFCA 3H2BA 3UW3A 5CNIA 5CCXA 3C43A 1SVMA 1CG6A 4E5DA 1EUCB 2BFFA 4JEHA 1J99A 1E7RA 1ZG3A 4AJEA 1DKOA 1M5UA 2I6GA 3T9AA 2YNMC 3ECSA 1Z33A 2ZVDA 3IPLA 5EE5B 2PRSA 1G4HA 2FFAA 3AVVA 5AHWA 3AF4A 4G36A 1U28A 1Z0IA 2ENWA 1SC1A 1RW4A 2Q4BA 1TEXA 3PUZA 2LUOA 4HFNA 4HGNA 4JODA 4LF4B 5ITZA 4B46A 3MUEA 1YS2X 4HVTA 5JARA 5KC9A 4C88A 3C5VA 3ZDCA 3H11B 2O3TA 3AU9A 2V7BA 3M4ZA 4D9BA 5L40A 3OHPA 2C5HA 1TVKB 4FE7A 5DGIA 4RTOA 1N9ZA 1BJRE 2VLBA 2Q29A 4EF5A 1G5RA 3LOPA 4CTKA 1YV9A 4Y6GB 1T4MA 2F1JA 2DM6A 4YRRA 3SS9X 1BMDA 2FN8A 1QK5A 3PQDA 5DRYA 4QFMA 1R5OA 2H4FA 3TR6A 1Y0BA 4QUGA 4YACA 5A3SA 5JYEA 3Q7IA 1I3KA 3NS7A 2QSUA 4B3CA 3VMFA 2YKGA 4P0QB 4GKKB 2NP6A 5K6AC 3GVPA 3JWPA 5CVTA 3ID6C 3HRKA 1QC5A 2FX5A 4M1MA 3CXRA 4AXBA 5JZOA 1QIJA 3WQSB 4JT4A 1M2FA 3FFAA 3EUWA 3KUDA 4QUDA 3L4BC 1USWA 3UG6A 4WY2A 4B9AA 2WWVD 5FO1A 3R9XA 5A6SA 1CZNA 1YNSA 3PYLA 4FE3A 3SQWA 1J0CA 4WESA 5HFAA 1MC1A 2PGNA 5KYUB 3T5AA 1DAFA 4ZI5A 4OOEA 2J6BA 4BZQA 1ZVKA 2VTKA 2G40A 3FVRA 1GT91 3TR5A 3VZDA 1IJBA 4FBLA 4H7EA 5DIZA 3TMKA 1V4BA 1DTSA 2IKQA 2RGBA 1UZNA 3NWJA 3Q9NA 2ORVA 5PGMA 7AT1A 1OPRA 4N0EA 1YS4A 1AO3A 1K3UB 3CSDA 3Q85A 3R4CA 4X44A 1V1JA 3I1JA 1AN9A 3R0ZA 1A8PA 4FMBB 4TWRA 3IP5A 5DFAA 1OZFA 4B4VA 2XTZA 2FP3A 2XCTB 1DQNA 5KO2A 3IB6A 2HL6A 1RBQA 3CTMA 3GYBA 4FOLA 4JUIA 5EZYF 5BW6B 4AECA 5LMUB 2XB2A 4X1KA 3T5DA 3QUAA 3FSGD 4TVSA 1C7ZA 4P32A 5HUQA 3PPIA 3BBLA 5A6VA 2X9LA 3IHKA 3LPDA 9GPBA 1EWTA 4GEGA 5J1SB 2QJTA 1PS8A 3DMRA 3ELBA 5HG0A 2WZDA 1HGXA 1DKQA 3KQWA 1XTPA 2G06A 4CQMB 3EK2A 3ZBUA 2RG1A 3I2YX 2GCOB 2X1MA 1GZVA 2GILA 3FYTA 4GP9A 4LNAA 4MVJM 1T4BA 3URMA 3Q0TA 4DCSA 3EQ8A 1D4FA 1TM5E 4P6VF 4C4ZA 3TQSA 1S01A 2CL6X 3Q8MA 3DLBA 2IOHA 5F7OA 3GI1A 3WGYA 3I9MA 2GPSA 5ALEA 4QBHA 5CLFA 1FS6A 4MIOA 1D2EA 3LUGA 3D6FA 3RIXA 2GAFA 3QG5A 2WYIA 1NP3A 1HOTA 3PXXA 3K8QA 4HX5A 5FI1B 4GQIA 4LHEA 2PNJA 1X2BA 3CJQA 4AG3A 3PXDA 4B2IA 4H0CA 1RRKA 2OP0A 1LFAA 2RHMA 4P22A 5H3HA 1R3UA 2IU3A 2HBZA 2ZVPX 1LBTA 4Q3OA 4YROA 3RSCA 1FFXA 1XP5A 1D2AA 3ESBA 1XKQA 2ZW9A 4MI9A 2Q3JA 5EJAA 3LWBA 2EYQA 1UMKA 2C8LA 1TIKA 1V5EA 2ZI6A 2Q9UA 2V7WA 5B3KA 1NRWA 1L5LA 2OSVA 3H97A 2IPNA 4HB3A 1PJQA 1X1TA 2O1EA 2PGOA 1RMYA 2A7QA 2PVSA 4CQJA 2WAOA 1J07A 2TS1A 1RC0A 4MYTA 4R6WA 1ZICA 2A9OA 5DEOA 3OF5A 4F6LA 2AW5A 2VT2A 4GMKA 3RWOA 1QLJA 3BGOS 2CV2A 1C0EA 5CRIA 5A1TA 1L7NA 1L4KA 1JPJA 5JADA 4O2LA 4OSOA 1PBTA 4OFWA 4BMOB 1W9HA 3VH2A 3H16A 1R6AA 4KQWA 4BNUA 4KB5A 4Q7LA 2NU6B 4LZLA 1FNBA 3N74A 1ODKA 4ZVSA 3HCWA 3UJDA 4Q9LA 4IDHA 4DXDA 2P6OA 1LJUA 3SZ3A 3A6LA 3NIFB 2HPZA 2O2XA 3KJQA 3PJDA 4IZOA 1WSBA 1PZFA 4IEIA 5BN4B 3ZY2A 2PUGA 4K6GA 1NMXA 2XVAA 1MDFA 4KN8A