4M37A

Crystal structure of trypanosoma brucei protein arginine methyltransferase 7 complex with adohcy
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
337
structure length
337
Chain Sequence
RPPDAFVNRIDRNIPVPARLRHTPVSLIEAVNDFHYAMMNDEERNNFYYEVLKKHVTPETGVLEIGAGSGLLSLMAAKLGAKWVVAVEGSEELAKLARENIRANNMEHQVKVLHMMSTELKSKHLPEPPDVLLSEIFGTMMLGESALDYVVDVRNRLLKPTTKIIPQFGTQYAVPIECDALHRISSVSGWRDLDLKHMMTLQDTVSIVFAKHYGIRMNSVNFRRLSDPIELFRVDFSSSNRNDIPRRKHFDVVAKESGTAHAMLFYWKVTDDEFVMSTDPEDTVNNFPRDMQWGQALQLLDASNGPLPTPVVFTEGKNYNFECNFSGDRVILHMQLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein arginine N-methyltransferase 7
publication title Structural Determinants for the Strict Monomethylation Activity by Trypanosoma brucei Protein Arginine Methyltransferase 7
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Transferase
total genus 106
structure length 337
sequence length 337
ec nomenclature ec 2.1.1.-:
pdb deposition date 2013-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06325 PrmA Ribosomal protein L11 methyltransferase (PrmA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 4m37A02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4m37A01
5K0BA 5MHTA 2IPXA 4YUXA 2YVLA 2ESRA 2HTEA 2IIPA 3G2OA 3GU3A 4QVGA 3G8AA 3O4FA 5GM2A 5FQOA 2EJTA 4RTKA 1INLA 4AZSA 3F4KA 3FZGA 1NT2A 3P9IA 2NXJA 2P1DA 3FYCA 1NV9A 2VDWA 4YUWA 1KYWA 2K4MA 2YXLA 3VC1A 2G71A 4YUYA 2PX8A 3OPNA 5LQJA 2Z6QA 5EGSA 3THSA 1KIAA 3KQVA 5EIFA 2PX2A 4XCXA 5FWDA 3BWCA 4PYQA 4PYOA 3R9XB 3LDUA 2CMHA 5DTRA 1EIZA 5HIJA 1UFKA 3ANXA 2IDJA 3V97A 3LBFA 5DRYA 3EVAA 3DR5A 4RVFA 3TLJA 3VC2A 1AQJA 4QPPA 2ZCJA 1X1CA 4KDCA 5DX8A 5EKXA 3IYLW 4PIMA 3C0KA 5HILA 4DA4A 1XCJA 2PWYA 4E33A 2BH2A 4AZWA 2B9EA 4GOLD 3HEMA 4FGZA 4R8SA 5EEHA 3FPHA 4Y30A 2ZVJA 3R0QA 5E9JA 2I6GA 2B25A 5E1OA 3GRVA 3LHDA 1SUSA 5LQCA 1NKVA 4MWZA 5DSXA 3VYWA 1OR8A 1KXZA 1NW5A 3GWZA 5LQRA 4PYJA 4CKCA 4F85A 2QRVA 3I9FA 5HIKA 2EG5A 4EMSA 4XUEA 5DM4A 5DXJA 2UYCA 2HNKA 4DCGA 2B2CA 1ORIA 2G72A 3EGVA 4FT4A 4RSRA 5GIPE 3M6XA 4C04A 1X1AA 3DXYA 5DRTA 1UIRA 1JG4A 3C6MA 4BLWA 3REOA 2PXCA 1TW2A 3QOWA 1EQAA 1SQGA 1D2CA 2AN5A 2NXCA 3FTDA 4ER7A 3E05A 5ICFA 5BXYA 4R8RA 2E5WA 4OX9Y 2UZ4A 3X0DA 1Y8CA 3KHKA 5ICCA 3FUUA 3I53A 5LQUA 3KPYA 4RTNA 1JQDA 5E1DA 1R8YA 1Z3CA 3O7WA 1ZG3A 2VZ9A 3MHTA 3HVKA 3UZUA 1BOOA 1M6EX 4PYKA 3ELUA 4P7JA 5DTQA 5EZSA 2FK8A 2ZZNA 2AVDA 3P9KA 4BY9E 1U2ZA 3UJ7A 2IGTA 3I5UA 2Y1XA 5E8JA 3TKYA 1D2HA 1P39A 3FUWA 1KPHA 3PS9A 5CVUA 3KR9A 1VPTA 2QRVB 3AXSA 3GRUA 2OPBA 3GRZA 3HCCA 2Q41A 3OE5A 3Q87B 1F3LA 1VIDA 3HCDA 3EVGA 3G5LA 3FPEA 4LECA 1T43A 3HA5A 1AF7A 2AZTA 2P3OA 3LDGA 1QAQA 1L1EA 3OU2A 3CJRA 5K0JA 5CD1A 3PFGA 1KR5A 4HH4A 3HCEA 3LBYA 2P8JA 2BM9A 2O0LA 3A4TA 5D1HA 5K0CA 1I1NA 4WXHA 5EMLA 1KPGA 5KYGA 4FZVA 3LGAA 2ZWVA 3LCUA 2DPMA 3ELYA 1KP9A 3KPJA 2P41A 1BKYA 3NTVA 4WVLA 1KHHA 4X41A 2I9KA 4KWCA 7MHTA 2AR0A 3EVBA 2AS0A 4GOMD 4CXMA 1O54A 2R3SA 3S68A 2BR5A 3DULA 3THRA 3KPVA 5E1BA 5EMMA 4RTPA 3HVHA 5LSAA 1QAOA 3R6TA 3PVCA 3M33A 5FUBA 3KPUA 1X19A 3BGVA 5EOVA 3P9NA 1XJ5A 5DWQA 1BC5A 3BKXA 2A14A 4YMHA 3CC8A 3ELWA 1JG1A 2P35A 3U81A 3GIWA 2BM8A 4PWYA 4E2YA 2GLUA 2OBFA 1XDSA 4PYNA 3MB5A 4RTRA 3PLAE 5U4XA 5P8WA 1Q0SA 5C9ZA 2I7CA 5K8VA 1X1DA 4FSDA 3GDHA 3TFWA 2EX4A 4QVKA 1YFLA 9MHTA 2ORED 4PNEA 4ISCA 1SQFA 4OQDA 1FPQA 1QAMA 3CVOA 2AOWA 3BGIA 2GPYA 2ZBPA 4V0QA 1YF3A 4E2WA 1D2GA 4F86A 3LECA 4G56A 3OZTA 4CKEA 2OY0A 2JHCA 1M6YA 1XCLA 4P7KA 2ZBQA 4HTFA 1JR4A 3DXZA 3E23A 3TM4A 3M70A 3UFBA 4FS8A 4HG2A 2YUIA 3LKDA 1VL5A 5JR3A 2ZFUA 3CBGA 3PTAA 3KQYA 5DM1A 5F2KA 1ORHA 4GF5A 4E32A 4M36A 3R3HA 5DLYA 3V8VA 4M38A 2XBMA 1F38A 2O07A 2AOXA 5KQSA 1PRYA 1QYRA 4KDRA 1N7IA 2EFJA 3HP7A 2JG3A 3JWGA 1L3CA 5E1MA 1IY9A 3TPZA 4X60A 4OQEA 1X1BA 1R74A 2H00A 3LSTA 2DULA 2FK7A 3WSTA 1I9GA 3BXOA 3UA3A 1P1CA 3SR4A 2N47A 3DP7A 3P2KA 3MQ2A 3P71T 1QANA 2G8NA 4H0NA 1IXKA 3UJDA 5BP7A 3TRKA 4A6EA 5DX0A 4BP1A 4XUCA 3HM2A 5F2NA 4KRGA 4HTFB 3HTXA 3OZSA 1MJFA 2P3LA 4M37A 3OE4A 4GC5A 2NP6A 5M5BA 3B3FA 4HSGA 2QY6A 3DTNA 3G2MA 3SGLA 3QOXA 4P7GA 5E9QA 3JWIA 4RTJA 5D1NA 5EHIA 3FTEA 2OB2A 1NBIA 4RVHA 2B3TA 3FPFA 3EVDA 3UJ6A 1G38A 3G5TA 1UWVA 1VP9A 3GRRA 2CKDA 2IBSA 1B42A 4DZRA 1ZQ9A 3EPPA 1AQIA 3P2IA 1TW3A 3DLCA 3M6UA 4HGZA 5CVEA 2P3QA 2I62A 3P9CA 1HNNA 1G8AA 1RI1A 4AZVA 3A7EA 2GA9A 1O9HA 3H2BA 3ORHA 2PLWA 4V0RA 3A27A 4EQZA 5EKUA 5H02A 3EVCA 3JWJA 5EQJB 2PBFA 3TM5A 3NWBA 3R24A 4YV2A 1NBHA 3QV2A 3CCFA 3G2PA 3LCVB 2AN3A 3GJYA 2GAFA 5LQNA 2PX5A 2ONZA 4MTLA 4P58A 3PT9A 3EVFA 2CL5A 4CTJA 2ZIEA 2ZULA 1DL5A 3PFHA 3OCJA 1L3IA 2IFTA 3DMFA 3HNRA 3EVEA 1V39A 2PVCA 2OKCA 2JH8A 2IBTA 4B17A 4ATNA 3FUXA 4E70A 2V7EA 4CWAA 4ER5A 3B89A 3OU7A 4GC9A 1XDUA 2XYVA 5GOZA 4IKPA 5FHRA 1JTFA 4KIFA 10MHA 2VP3A 4QQNA 4FT2A 1EJ0A 5GM1A 1P91A 4FP9A 3EVZA 1G60A 1YUBA 5GIOE 3KQWA 3NVKI 1FP2A 5EPEA 2B78A 3BGDA 4RTQA 3BKWA 1RI5A 3HA3A 3FPGA 3G7UA 4E30A 1FJXA 2O05A 5EG5A 3B7PA 5BW4A 5K0EA 5FADA 1IM8A 3FRIA 5T6BA 3BZBA 5DSTA 3DLIA 1KYZA 3M6VA 2XVMA 4X1OA 5E9WA 2OXTA 4YUVA 4DMGA 1JQ3A 2PY6A 1VLMA 2AOVA 3G8BA 3DOUA 3KR0A 1RJFA 4AUKA 3HCAA 5FQNA 3LDFA 2PXAA 1WS6A 2BR3A 2FPOA 2UYOA 3P2EA 3LCCA 1YFJA 1WY7A 4EKGA 3OZRA 1JTEA 1RJEA 3KQQA 4FR0A 3DUWA 2ZW9A 4FSXA 2PSSA 4NECA 2GS9A 2QE6A 2WA2A 3CGGA 5CVDA 5CIYA 5K03A 2AOUB 1XDZA 4MIKA 2PJDA 2G1PA 5E2AA 1L3BA 4E2ZA 3ER9A 3UJCA 2VDUE 2ZIGA 3K6RA 3O31A 5EIWA 1G55A 2FRXA 4O29A 2FHPA 4BP3A 4RV9A 3SVZA 1JQEA 3RW9A 3TR6A 1RI3A 3ME5A 2PT6A 5EHGA 3VSEA 5BW5A 5IKMA 5GP1A 5GWXA 3B3GA 5GINE 4IV0A 3BUSA 3FRHA 3LPMA 4OBWA 2C7PA 4PYLA 2YX1A 3PX2A 3BWYA 4IWNA 5CCBA 2IDKA 4RTSA 4RWZA 2WA1A 2C7OA 2PT9A 3EEYA 1WXWA 2JHAA 3UJ8A 2YQZA 3SM3A 4DF3A 1DUSA 1L9KA 3IV6A 4U7PB 5HOQA 4RVDA 2YR0A 3SXJA 4X63A 4QTUB 2FYTA 2HMYB 3OU6A 2NYUA 3K0BA 2HV9A 4Z2YA 2AVNA 1SG9A 1XTPA 3ID6C 2HWKA 2VDVE 3GO4A 3MCZA 5ICEA 3TOSA 1R8XA 2F8LA 2IH4A 4C03A 4BLUA 1N7JA 4RTMA 3EGIA 5FA8A 4PYMA 5K05A 5EEGA 2O06A 1P1BA 3OFJA 4GOND 1VP3A 4YUZA 4K6MA 4F84A 1FP1D 5FTWA 4X61A 2ZWAA 4R6WA 1R00A 3DXXA 4R6XA 5DM2A 1KPIA 1AV6A 5E8RA 3GXOA 1H1DA 2ZTHA 5HFJA 3P8ZA 1JG3A 4GBED 4RVGA 4DCMA 4E2XA 4PINA 1DCTA 4UOEA 2ZZKA 3EGEA 1ZGAA 1XXLA 3A26A 2R6ZA 2C7QA 3MAGA 3LKZA 3AXTA 1NW6A 3E7PA 2ONYA 3AJDA 3KR2A 4EVIA 3MTIA 4YV0A 2Z6UA 5LQAA 5KQRA 3GGDA 3UJBA 1JSXA 5KVAA 1ZGJA 3TQSA 5FA5A 1M0EA 3PB3A 4HGYA 5K01A 3C6KA 4HRAA 2BZGA 3BT7A 3KQTA 2WK1A 3IEIA 3GCZA 4XUDA 4EKIA 4DM3A 1YZHA 5ICGA 2IH5A 1BHJA 4ER0A 4QPNA 5T64A 3FTFA 4LWPA 2GB4A 1EG2A 5C1IA 5G02A 4P7FA 3BWMA 4OA5A 5C0OE 1EAMA 2NXEA 2V74B 3JWHA 3MGGA 4GUAA 3HCBA 1JSZA 2PGXA 1ZHFA 3TKAA 1ZKDA 5CM2Z 2IP2A 4CTKA 4OBXA 3UWPA 3MERA 3NDJA 3G2QA 1G6Q1 5HZMA 1XVAA 1NW8A 3BWBA 3NVMB 2C7RA 1RI2A 5DT2A 4YMGA 4M7RA 4PIPA 4PONA 4RTLA 1YZ3A 3LL7A 4LWOA 3L8DA 2PXXA 5CVJA 5EVJA 4ER3A 3Q7EA 2VS1A 3SSOA 4IV8A 1WXXA 3KQPA 5EC8A 5FWAA 2BR4A 5DXAA 1N2XA 2GH1A 3I64A 3NMUF 3RIEA 3B3JA 4POOA 3LX6A 3FPJA 4LG1A 2YXEA 3HA7A 4L7VA 3GRYA 5CVVA 5T67A 3ELDA 2ZLBA 1I4WA 2AOUA 2EJUA 5DTMA 3T7RA 2XYQA 4EK9A 4RTOA 2UYHA 5EMKA 1WZNA 3FUVA 2Z6AA 8MHTA 1PJZA 4MHTA 5IH3A 4C4AA 2YTZA 1WG8A 4AZTA 4PYIA 2ERCA 2Y1WA 1Q0TA 2QM3A 3CJTA 2PKWA 3FUTA 1NW7A 3CJQA 4DKJA 4GQBA 2IH2A 5K0NA 4KW7A 4RX1A 4OA8A 4PCLA 3B5IA 4MQ4A 3FTCA 3HCFA 5K09A 4C07A 5LR6A 4RYLA 1R6AA 5B1SA 4Y2HA 2H11A 4PGGA 4QDKA 4E31A 3TMAA 4BLVA 5HEKA 1R18A 3UBTA 2CWWA 3DMHA 2NNWB 2JH9A 4R05A 5K0FA 2P7HA 3E8SA 5K0GA 1RI4A 2JHPA 3T0IA 2AOTA 3NWEA 1G8SA 3T7SA 4GEKA 3SSNA 3UJAA 4YV1A 2QYOA 3EEOA 4PCAA 1QZZA 5E2BA 3OFKA 4QDJA 4U7TB 4A6DA 3NJRA 4KVZA 3KU1A 4DQ0A 3M6WA 3IHTA 3G89A 4C05A 2OB1A 3EMBA 3GNLA 5CCXA 3NDIA 3G88A 1FBNA 3SSMA 2LD4A 1NW3A 2PWPA 5FCDA 3T7TA 1NE2A 3KQSA 4KIGA 3UA4A 2NP7A 5DM0A 2NXNA 4C08A 3C3PA 5LQKA 2XYRA 1RJGA 2H1RA 2UYQA 3ER8A 2O57A 3PX3A 3RODA 1HMYA 5DPMA 3C3YA 3CKKA 4QQKA 5EMJA 5K0LA 1EJ6A 3KPWA 5F2OA 2KW5A 2ZIFA 3AY0A 2AOTB 4GOOD 2PV0A 2FCAA 4ZTBA 5KS2A 2JJQA 3UJ9A 5EZQA 3NW9A 2G70A 3FYDA 4JXJA 2PX4A 1SKMA 3EMDA 3MTEA 1YB2A 3KQMA 3M4XA 4PGHA 2HR1A 1O9GA 4CKBA 4QTTB 2P40A 2OZVA 3AWIA 3HVJA 4HC4A 1VQ1A 3KR1A 2CMGA 2OO3A 3MCTA 5DX1A 2XVAA 3DMGA 2AN4A 2YXDA 2ZSUA 3KKZA 3A7DA 1VBFA 3SMQA 3D2LA 5HIIA 2P7IA 1SUIA 1SVUA 1RJDA 4C06A 5HIMA 4AX8A 1NV8A 5ERGB 1TPYA 2OYRA 2ZZMA 2ADMA 3DH0A 3P97A 3SX0A 3ERCA 5FHQA 3HVIA 5CUQA 5JUWA 1JG2A 3I58A 5FULA 3KQOA 1MHTA 3A25A 4ER6A 1VE3A 2ZBRA
chains in the Genus database with same CATH superfamily
5KTYA 4N5MA 1AGYA 4TZ0A 4I1OA 1GIAA 1T25A 4XKJA 1Y80A 3NDPA 4G63A 4WFJA 4F4UA 2PYIA 4XWWA 1SKUA 2GJAA 5LP6C 2BDTA 1CUUA 1M66A 3L92A 4AJ2A 1M6WA 2ZIZA 1FSFA 1T1IA 3FM9A 4JA2A 1UDWA 2POQX 4K6FA 1DC8A 4O8CA 1E7RA 4V39A 2O5CA 1CC1S 2GT1A 3D02A 4PYQA 3DTVA 3PWSA 2EDAA 5TR9A 1KO1A 1VYVA 3RNOA 1HE5A 1Z6TA 3ODPA 4H1VA 1B16A 4ESEA 1USKA 3WICA 2ZRKA 1LPAB 1NVUQ 3DR5A 4RVFA 4CMEC 2ZSBA 3EGDA 4XYEA 1RHRA 4I6GA 1Z28A 3JALA 3LWDA 4UULA 3U4MA 2RHDA 1JJFA 4F92B 1KDYA 4A2WA 2H0RA 2P3SA 5FPYA 1Z35A 4I08A 5LYJA 4R1LA 4GYKA 2BH2A 2O2IA 1PNRA 1WTAA 2RH4A 5IARA 4R8SA 1M8PA 8AT1A 1P5ZB 3EZGA 2ZRIA 1VG0B 1WE2A 1V6CA 2I1WA 1O4WA 3H1GA 3KEQA 4CUZA 2R79A 5F1OA 3LXXA 5CTAA 1OW3B 2ZSIA 4M0MA 1USVA 2HBYA 1OR8A 1PS9A 3KWJA 2UZ1A 4HWGA 2BJWA 2BFBB 2DY0A 1YUNA 1F2DA 2RJ3A 2W90A 3HGTA 3IVAA 4B46A 3MRSA 4Q1EA 2OLEA 4CR6A 2X19A 4RFSB 2YW9A 4BX9A 1Z6YA 5JVDF 3FJYA 4GYYA 5ES3A 4TQGA 3U16A 1GPYA 3LQKA 3JRWA 3C6MA 4Q1CA 2PXCA 4JZKA 1JDBC 2E1RA 4Q1AA 3RKUA 2FPKA 2BIFA 4EL5A 2AC7A 1H4QA 5LUBA 5I47A 4WZBB 3F4BA 4YMUA 3AETA 4G4IA 1KO4A 5E7MA 3KRTA 3K96A 2OFXA 1XDWA 3FSEA 1WCXA 1ZUNA 2XMDA 4FU0A 2EBFX 3W06A 4XVUA 2FSPA 3BDAA 4BUZA 1RWMA 1GAXA 4HQ6A 2NO7A 4JLKA 4WN3A 1H85A 2FK8A 4LRSB 1KDRA 1Q50A 4R41A 3TE6A 1PT6A 1IZ8A 5JIBA 1ZJWA 4BL5A 2ZYSA 2RGNA 1KEVA 1G21B 2ZETA 5CVUA 1TYAE 2R11A 2Y1OA 3H04A 5KVCA 3OO0A 2GJKA 2NSYA 4RPKA 2QMQA 1WZUA 1GSHA 4RE6A 5ILOA 3OU2A 1IDOA 2XD9A 2NSHA 4JLBA 4WOPA 4UZSA 3SQDA 1I13A 3K1AA 5DGTA 2IXFA 1SZJG 1A4UA 4YECA 1GOTA 2ZRBA 4B34A 5KNBH 1ZY2A 3BF7A 1MV8A 4QGBA 3BL5A 5ALIA 1A5ZA 1M8JA 1KP3A 4J0CA 1BKYA 3IAS1 2WY2D 3R9IA 3UCXA 1W36B 4K1LA 1RP1A 1ACLA 1SZCA 3V80A 2AR0A 7AT1A 2AS0A 4HDKB 4MUJA 3H9EO 1BFDA 1O54A 4ZOEA 5DEOA 3FTFA 3HGQA 1E2KA 4GM4A 5BR8B 1ZIOA 2K6GA 1Z4QA 2XT9A 3BXPA 3FLEA 3DWFA 3WWZA 3LPLA 2R1UA 4C0SA 3BKXA 3ICVA 1UZAA 4DSUA 3QGMA 3QNWA 2FFAA 1MH9A 4MX8A 5K8UA 3C4QA 3W3AA 3FIJA 4PPGA 5LPNA 5ALWA 1DP4A 5EL0A 4KE7A 2O20A 1GTVA 2I7CA 2P2GA 3GJRA 3ROEA 2BMEA 3FWZA 5B6JA 3GEDA 4OHUA 3UJ6A 3D7RA 1R0LA 1EFPB 1N0IA 2J4DA 4OQDA 4V0QA 4B4OA 4DQXA 3E9MA 1FW8A 1Q7RA 2OZEA 4WLOA 3BX1A 3DXZA 3WKCA 4DW8A 1DKNA 3OF3A 1EVYA 3H05A 1JVNA 4LXUA 2V6IA 2BJVA 4F3TA 4M8NE 3CBGA 1JZTA 1UPTA 2XUPA 1WABA 4M38A 2DWCA 3TD2A 4I1VA 1JWAB 3OCWA 4ALLA 3ESYA 2A5LA 4ILEA 5CW1A 2IYYA 3HCRA 4QDZA 3V48A 5BSHA 4U7GA 5BORA 3QVGA 5T4HA 4RJKA 2HT6A 2PZLA 1Z4OA 1PQ4A 1ODTC 2OO7A 4BDSA 5ALVA 3ZBPA 5JQWA 2ATIA 1X1BA 4OQEA 4BZZA 3CVXA 1N0VC 1R10A 3BXOA 3NONA 2PKXA 4MS3B 3RIXA 5EJ7A 1TM2A 1C0KA 2GBPA 1CS4C 2XAUA 4QRIA 4G09A 1CP3A 1DXHA 4PS1A 3ZHRA 4G0UA 5GJWC 1PT5A 1RM3A 1UM9B 2G8NA 2QQ5A 2E89A 3AQ4A 3E15A 4HATA 3OCUA 4QXOA 4ALJA 4HY3A 1M1XB 3N2KB 4ARAA 2H5IA 3T9CA 4PAGA 1TRHA 1EVKA 3ZK7A 2EF1A 5H68A 1CIVA 1HSOA 2NM0A 2OM2A 4IMRA 2VJCA 3P96A 4GP7A 3TR0A 3WLMA 5AVXA 4MLCA 4FYXA 2B3DA 4IWXA 3EEFA 2FWIA 4GRDA 3QVXA 4RK5A 3LP5A 3ZV6A 1JHPA 3HUFA 5M2QA 2QLMA 1ISHA 4OATA 2WKWA 2IBSA 4DHWA 1P7ZA 2XGGA 3B1WA 5DHPA 1ZQ9A 2B1QA 5G41A 1KC3A 3ZNNA 2WUFA 5BW8A 3EDMA 3IPXA 2I62A 4MDEA 1A88A 1IJFA 4I50A 5ELXA 5K99A 1B8UA 3QEAZ 2FPGA 1PG5A 3N2NA 4UXJA 1PDVA 1FYFA 1P5JA 3T38A 1GSIA 1PNVA 1JAYA 2N1MA 2OV3A 3O0DA 4R2LA 3T9FA 1QRDA 3AINA 1FYDA 3AUTA 4MVJI 1EFVB 3STTA 4YPOA 1ISIA 4ODIA 3HNRA 4BKOA 3LYAA 1GVNB 3EVEA 1V39A 2ALJA 2ZSEA 4Z8XA 5A1JA 5B7GA 1OT3A 1AHHA 3UK7A 5D6NA 1CY0A 2HK8A 3AMVA 4GH5A 4Q7EA 1A77A 3HSSA 1KC1A 4P83A 4CWAA 1FUIA 2XYVA 3KD3A 4UUPA 5JFGA 2IPOA 1Z37A 1NBWB 2R1TB 1GSOA 2XUDA 3VPCA 4A2QA 2AWNA 1P2BA 4PR0A 1AKVA 3GAAA 5TQ2A 3WL3A 4DBZA 2ZSAA 3EVZA 3K6KA 4JUAA 5ULLA 3NVKI 1GARA 3RO7A 3LZDA 1JLLA 4J1QA 1H8HA 3BKWA 4RTQA 4NL4H 1XIVA 2FPLA 2NZ8A 3FHJA 1IU9A 2ZBDA 3BB3A 3SFZA 2ZU6A 1R2QA 3Q8WA 1GG2A 1L5SA 1YB6A 4B6PA 2FAXA 2XE6A 4D0SA 1QPBA 1MHPA 2C83A 3AB3A 4JR0A 4OQFA 5LLSA 3S3TA 1GN9A 1RJFA 3BD9A 1CHNA 4Q34A 4EM6A 3LC1O 1E3MA 1ORVA 5AJVB 3UG6A 3CLKA 2IHJA 4BWYA 2ADOA 1Z9BA 3JD2A 3KQQA 4QL3A 3GLHE 2IELA 4Z54A 1T5TA 1J0AA 1R6XA 1GGKA 1HT3A 2Q5HA 2VTVA 3K0FA 4U39A 4OH1A 4WADA 1YCGA 3NIGB 2VPXA 1QIDA 4KUGA 5E2AA 5FTLA 4E2ZA 3BTUA 5HZHA 2VDUE 1G6OA 4TXNA 5AUPB 1F2VA 2GCPA 3HKBA 4YAOA 3I8XA 1DWOA 1JQEA 2BI4A 1TTQB 3KHTA 3TG2A 4WKGA 2I1VB 3IELA 1A9XB 5FUXA 2F7SA 2UXDB 4E21A 1UJ5A 1LX7A 1QCDA 1T2DA 2QAGB 3PCRB 4JOQA 2QYTA 2PZMA 2W71A 4ZQBA 5GV7A 1DG3A 1OUMA 4MA5A 3ZE7A 1Z6GA 4XD7D 4V02A 2F8TA 2Q1UA 4PE5B 2JHAA 1UZLA 3G9TA 4O4JB 4KXQA 1A8IA 2JAOA 5DO9A 1E2HA 5JAUA 9GPBA 2QD4A 2FXVA 4K6OA 2WSBA 3W7VA 4PM4A 4A10A 1RZVA 2YUTA 1V2HE 4C03A 4FFWA 4JN6B 4BLUA 2BP7A 4RTMA 2YJTD 5JS2A 3Q2KA 1T1GA 5KCZA 2EOAA 1F7UA 2CV2A 1P17A 5DNYB 1CR1A 4Q39A 5DTJA 5CB6A 5I7WA 1HK7A 3VPHA 3AR8A 2AUMA 2O3TA 5KX5A 3S0JA 4BQRA 3NIBA 1VIAA 4V3CA 5G0SA 1KFKB 1OASA 5BURA 2AGVA 3EG9A 3JWEA 1DFGA 1R8QA 3DZGA 5LWQA 3EC7A 3NHRA 5BNZA 2Y0CA 3H1TA 3GP8A 3MCWA 4I55F 4PINA 3X2FA 3EIQA 4E2XA 1MG5A 1U1IA 2H7YA 2R8RA 1XXLA 2ZZKA 1KMMA 4WOJA 1LJLA 5FRDA 3U39A 5CCXA 1F9AA 2FSVC 5J2UA 1FTYA 2VNIA 2GCOA 4M9SA 4BPBA 1XFDA 2XMGA 3AKEA 4L4XA 1YMVA 1MBZA 3OPYA 3QXXA 3F73A 3IUBA 4ZQEA 2LBPA 1Q0QA 5H4HA 1X2BA 2I8CA 3NRBA 4KYTA 3PLNA 1E20A 4EKDA 1EUZA 1W581 1RWVA 3INRA 5CIWA 5IZ4A 1DPGA 1V7CA 3JAKA 3D6UA 2PS3A 4YJFA 3FOEC 4RIHA 5JCOC 3V2GA 4U4AA 3IKJA 1G8GA 1QB7A 1WCWA 1K0UA 2BBWA 5C1IA 1YK0A 2BMWA 3WGQA 2AEFA 5KDDA 1DEXA 1NP6A 1ULUA 4MVCA 4RAOA 1BFKA 1ENPA 4GEGA 3GN2A 2QTAA 2IP2A 1E9CA 1FNCA 1QSGA 4RAQA 3ENZA 4YC7A 4LC0A 5AKIA 1EWKA 1A4XA 1YS4A 3VBCA 5C46F 3CQ9A 2I6FA 1G6Q1 4EPRA 5EIAA 4Q4CA 3H0CA 1EBBA 1SVNA 2FWBA 1Z4PX 3Q9LA 4ZMRA 4B4UA 2PUGA 1PSDA 4MQEB 1NUHA 3QWHA 2BHNA 1VG8A 2PUHA 3EIHA 4QM7A 4MV5A 2Q62A 4EGJA 4PVCA 2HK6A 3EH1A 4YI5A 3MTDA 5CB8A 5FWAA 4D6YA 1I4OA 1YE3A 3OTWA 5AXDA 1H2FA 3A70A 4F3KA 2EZUA 5AVYA 3PVZA 3OETA 4QWMA 2WWXA 4P80A 2PUVA 3AI2A 3NPAA 5LOVB 2VDMB 5EE0A 5IAGA 3TLYA 2PX3A 1RHJA 2HSZA 1P7PA 2O8BA 1RPNA 3GNSA 1TLFA 1N5DA 3ROMA 3X3HA 3GJ6A 2FWMX 3VPFA 1JXQA 1LPBB 2NW6A 3ENWA 3JD4A 4X7BA 3WP0A 2PKQO 3C6BA 1CQWA 3JU3A 1MUUA 4YDRA 1RJ9B 3UB2A 3H6GA 2TYSB 4JMPA 2XVYA 4NYMR 1KE1A 2Q5FA 3PENA 1YJXA 3U3DA 1NUSA 4YEDA 1JHYA 1U3DA 3SNKA 4B8ZA 4XQCA 5BYKA 3PGA1 3MT0A 1RYHA 5HUHA 1DDOA 1P1KA 3JATA 2O2HA 1RTKA 2H7XA 1ZI6A 1LV8A 4QUHA 3DFIA 2Q5QA 4MQ4A 3SOZA 3IMKA 4L4ZA 2F3UA 4MQMA 3KE8A 3U7HB 1H65A 1TI7A 1XTUA 2XMSA 4TLAA 2PPLA 5FNZA 3RRMA 4E31A 4FN4A 5K0SA 3LOPA 1DADA 3A0UA 1W46A 2UKDA 4BNTA 4CYMA 2OZPA 4RLQA 5CA1F 1K9SA 5JXGA 2WWTA 4DA7A 1E3EA 3IT0A 1TC1A 3FNFA 2V65A 1GPMA 1K27A 5JADA 2YQ4A 2E82A 2Y0EA 4HZGA 4FYIA 3SSNA 1ML4A 1V6SA 5JNWA 4YJ3F 2Z2YA 2Q3JA 3ZZMA 1OLOA 5EQTA 1D3AA 1QKKA 2QTWB 1HA3A 3I76A 3MJ4A 4YCNA 1ZD1A 4M9UA 5SY4A 3IKMB 3IHTA 3T7DA 3MT8A 3PDWA 4M1WA 1N2EA 1BJKA 3VTZA 2VP9A 1XD2B 3VVMA 5U9CA 1U3GA 4JELA 1WSDA 2MSEB 1KA9H 1A9RA 3WIOA 1U1CA 4ND8B 3BTOA 4AMUA 4BCBA 2EGGA 3C3PA 1MPTA 1CUDA 3AFOA 4LDAA 2H1RA 4RXMA 4GGPA 5JDCC 4ENPA 2C07A 2Q28A 3ABRB 4QRDA 5IJXA 2CKMA 3W9SA 3Q5EA 4DSZA 1Y8QA 1JDTA 2FJ0A 3DBRB 3IIMA 3HKDB 4XCVA 3VVCA 3GEEA 4DA9A 5KJCA 5LN1A 3GW8A 3W6UA 3A6HA 4H7HA 1W5TA 3E27A 5B1IA 5JI2E 1YQTA 3ADOA 3E2MA 4L3VA 5KS2A 3F3MA 2P68A 3BCHA 3WP1B 1TM5E 3C39A 5B30A 1YFKA 2PX4A 3KWFA 2GM5A 3MTEA 2WUDA 4KL8S 4GOJA 1VC2A 4P3NA 2QY9A 621PA 5JJCA 2OGSA 4HD8A 1O9GA 3ZXYA 2AFIB 4CUKA 2CEKA 3I1FA 1NUUA 3V34A 1EK2A 1YZTA 1RHUA 3P1JA 3AWIA 3IT3A 4OKNA 1VQ1A 1TLLA 5EZYF 3PC4A 3VMMA 4ZARA 5EWJB 3WLTA 3CZPA 1BVHA 4FJ1A 1E1RD 3RFVA 5CFLA 3MD9A 4R68A 4YACA 3VOBA 2GEDA 1J2YA 1PS8A 2BZ1A 1JDNA 2X0RA 4R8KA 1U9CA 4F4DA 3LX8A 1KI7A 3PRJA 4DDTA 3ERCA 1H22A 1I3LA 1E1MA 2J48A 2PAAA 4ZZ0A 3JW8A 4PC6A 1GY8A 3WYGA 2QOEA 4M7PA 3ROPA 5CVTA 3P2YA 4C29A 5IASA 3A25A 5JWHA 2O3SA 1ZBQA 1PFYA 1PU2A 1DWUA 3I9V6 4GECA 1GNQA 1K0FA 2VQ6A 3QKUA 4P2GA 4RKFA 3S2UA 2OORA 4UFPA 3K9FC 4BNJA 1ISFA 1R6DA 5FQOA 4WNCA 4TLLB 2Q3DA 3EFOA 3F4KA 3OT1B 2C2OA 1Y3DE 1OWOA 2BFDA 3MWFA 4L1KA 1P2VA 4XVQA 4EB6A 3S7TA 1LGYA 4TTTS 5IX8A 3THXB 3AL3A 1FL9A 1QYWA 4URUR 4LF7B 2OD2A 1BXRB 2I34A 3LDUA 5CA1A 2EFDB 1TVCA 1Z4JA 1ZK1A 4DXAA 3A9WA 4HB3A 3B9PA 7MDHA 5J4KA 1NPYA 3TLJA 5SYNA 1JYEA 1OGIA 1RYFA 4I14A 3VC2A 5MN6A 4KJZA 1F0KA 3CLRC 1FJGB 5JWOA 4IYJA 1C9KA 5JFOA 3IFSA 5JNTA 3HB4X 4TQAA 2XQFA 5AK0A 4C7OB 1LW7A 4N8DA 4DV5B 4ZPXA 1HEUA 3KSRA 3VTAA 2E4VA 1YVEI 5B4VA 3K7EA 4NAVA 2FRDA 4UBLA 3ENKA 3SF8B 2F3SA 4IILA 5G1NA 2ZVJA 2I6GA 2L42A 1A4IA 1O77A 2ZS8A 4LHVA 4UARA 4A2PA 2H9AA 2DC1A 3BIXA 3RUHA 2WHPB 2V98A 3EXEB 1ITZA 4MYCA 2EU8A 3HB0A 2JLCA 5A5EA 4H6VA 3K4PA 3P0FA 1L8XA 2AN9A 2ZS9A 3RSGA 3NS7A 4RSRA 1FVOA 1SELA 3D7MA 2LCIA 2YRXA 2AC2A 3W2GA 2IU6A 4DMLA 4TYYA 3G17A 3T3GA 2D0IA 2QN7A 3DPSA 4I5FA 4RL6A 1BWPA 4UUQA 5KDLA 4DLBA 3FE2A 2BHRA 4EHFA 1NVDA 1R8SA 1K88A 2W2XA 4DBLE 4MUNA 1NM5C 1ZYUA 3KHKA 4N9WA 1UOEA 1ZEMA 4TROA 1QYIA 1DBVO 3FBTA 3KZNA 5HCNA 4OI1A 2VJQA 3FNBA 3KDPA 4CEHB 1A97A 4L85A 4BC0A 4XSGA 1JEDA 2ID8A 3LNCA 3LUGA 2JLYA 2AE2A 5H3CA 2G76A 2ZZNA 1QIKA 4FNMA 1CF9A 2XNDD 1QGUB 2G09A 4GG1A 2Y1XA 4QLOA 4ETNA 2ODBA 1UJMA 1RC8A 1DKMA 3AXSA 5CLIA 5L7WA 2R6HA 4URFA 1QKJA 2VPWA 5EJEA 3I2FA 2F1KA 3GFPA 3ZWKA 4KE9A 4PZLA 4LGVA 2GCNA 2G4CA 1C9MA 2QSJA 3I23A 4JLOA 5E6UA 2G9VA 2QZJA 3VHXB 3QQ5A 4WFIA 3L4KA 4JCOA 3DBHB 1MB2A 2YICA 1I1NA 4LOJA 1AXGA 1KPGA 3L3BA 4FZVA 4QJ3A 1N6NA 3M8KA 2OA0A 1HLFA 4U00A 3QLUC 1C3EA 3THYA 3DPUA 3TLBA 3ZGNA 3ASVA 3T3PB 4BQSA 1BXKA 4JODA 1ZUD1 1UEJA 1DIRA 4IL5A 3K9NA 5EMMA 1O97C 4XYMA 4X1YB 5G1OA 4NCIA 1E7SA 5HA5A 1W44A 4AVYA 2OCPA 3KEFA 1CXZA 2P0EA 2XYPA 4EY4A 3QVKA 2FG7C 3DMTC 1JE1A 3MAJA 1F8UA 4MAMA 4ZAGA 4AY3A 4IOJA 2ZIXA 3AZPA 1HZZC 3IP3A 3MRTA 2JZCA 3OY2A 5A7HA 1TQ8A 1T4CA 1L7MA 1O6CA 2G77B 5FL3A 2HSGA 2GLUA 4PG5A 5DN9A 1PHPA 1XZ8A 3GMDA 4C0QC 1KI6B 2XRFA 4GYJA 4UDXX 5IZCC 3N87A 2X2OA 4FINA 1R15A 5C9ZA 2H06A 3D6VA 2QRGA 3TL6A 3TQQA 2I6SA 4TXMA 3KLMX 4E7OA 2AOWA 4OXYA 1VA5A 3NGXA 3ZV7A 4QHYA 5AVTA 2I2XB 2QPAA 1FTWA 2YASA 3EXHC 3NHWA 5AK5A 4ON9A 2YUIA 4RDIA 1PV4A 1ZD5A 1GUYA 2J9RA 1REQB 2CK3D 3QBEA 4IF4A 4LRTB 2FVYA 3HZRA 3UKOA 3H4TA 3I4CA 4DV3B 3OHMA 4N65A 4YAIA 3ZE8A 3RHTA 1G20A 1FCJA 3C7CB 3ESXA 2CFTA 3PR2B 4V2IA 4IUYA 2O1XA 1DX6A 4O59O 1BSVA 5HCUA 3GCWA 1MORA 2H6EA 2QMEA 1QYRA 1N2CB 1YC5A 2QI9C 4YDQA 5EXTA 3EG5A 4OAPA 2I66A 4JJ4A 3FROA 2AEJA 3LHIA 4HGNA 5AW3A 1G8HA 1N78A 4AKGA 1XRPA 3LYLA 3D0OA 3UA3A 5A3VA 2R1VB 2WTMA 2B37A 2CL7X 3W2TA 4PCUA 4UVHA 1N2BA 2VC2B 3KOMA 3ICPA 2BOVA 3LGSA 3UJDA 1R0SA 2CLIB 5IBCA 4B81A 1EVQA 5IT0A 4B5LA 3O83A 3ZU2A 4RMHA 4ZEVA 5JRJA 1GTMA 4TT3D 2C8KA 4GC5A 1SUFA 3DTNA 4HLQB 1CT9A 1GADO 1RLOA 5DLDA 4FB5A 2JLAA 3TWOA 5TQ0A 1AQ6A 4N5LA 1G5HA 3KKLA 1K6MA 1YBHA 2MDTA 4HUQB 1I36A 2F3QA 4XD7A 3PTZA 1CDZA 1VE1A 3B1YA 3GNQA 3L4BC 3MJVA 3KOYA 4NENB 2BHSA 3QVJA 1XCBA 3ZDEA 1RKXA 4OD0A 4PXAA 5F1YA 1TD1A 3DE1X 4S35A 4YWHA 2OBYA 1HE1C 4PPYA 3EIEA 4A7PA 5BQXA 1TK9A 3EIWA 4MGIR 3Q3JB 3VX3A 2WSYB 2ZR0A 2MTBA 3NG1A 1Q21A 4YAFA 4F7WA 2QN3A 2YV2A 4P8RA 5C8DA 4KYIB 4EX7A 1UC9A 4A91A 5I01A 2YRWA 1GR0A 4Q05A 4BX3A 2NNLD 1YUMA 4LJ8A 4GS5A 3P9ZA 4KNVA 3WQQA 5CD9A 3QX3A 3VPSA 3MTQA 1QHFA 4DIOA 3DW1X 4NDNE 5CX1A 3LF1A 1PO7A 3GG2A 4ZO4A 1D4OA 1OFUA 2NU7A 3PFHA 4ONEA 1YB7A 2PVCA 4JITA 4J7UA 1HL3A 4O63O 4M1KA 4ABTA 2ST1A 4I1YA 4I50F 5JARA 1P9OA 4J7CA 1XTZA 5GV8A 1M8KA 2RSLA 3LT5A 1AD2A 3M9LA 4MIOA 1RKBA 1IATA 3F2IA 1S8AA 3H9CA 1DC3A 3CZ4A 4ITUA 4DJEC 4I9FA 1MX9A 5TT0A 5GIOE 4NBVA 1GQ2A 1PFWA 5CLGA 2ZYUX 2W6PA 3TDKA 4QOSA 1VECA 3I5XA 1ZMBA 4M49A 4B8WA 3LYUA 1IM8A 3OD1A 3PDUA 1BE0A 4YJ2A 1S7GA 3QUTA 5DK4A 4TLEA 3L9WA 4EDFA 3DPIA 1EFDN 1EBUA 2XKAA 2ERXA 3OTIA 3DOUA 3LCMA 3OKCA 4WMLA 2YZMA 1XHFA 2WWGA 3IBTA 4PX2A 3GBSA 3V8PA 1U7XA 3RVLA 2Z04A 2B4YA 3DM5A 1UP4A 1VPDA 2XDQB 4BX0A 4YFYA 1SIWA 5JNRA 3J81A 3VR0A 2CB9A 4W1SA 4AC9A 4EP1A 1XD9A 4RADA 4RL4A 2HDOA 4HYEA 3GFOA 4GPTA 3OSUA 1ZMXA 2O7RA 1OXBB 3LUHA 1QC5A 4ZODA 3L05A 4JL6A 2R6FA 3BE4A 1XMSA 3SEAA 4QT4A 2NN3C 3L2OB 4JJGA 4ZV7A 3ANNA 4RZUA 1RI3A 1ZX1A 4AB1A 2HADA 3EWIA 5G4KA 3DVQX 2H1WA 1G7TA 3AM4A 1AS0A 4HXEB 2QX7A 4D3YA 3HR8A 2V9ZA 4CEJA 2IV2X 2PMFA 3BUSA 4EEZA 3F1KA 1BRTA 3E3OA 4DR5B 1ZQ1A 2BGKA 2QROA 3GT0A 5DGXA 4RD4A 4X3CA 5B37A 3ZE6A 5EP4A 1V16A 1VSUA 3PF9A 4L75A 5FUMA 2O59A 4V2UA 2FMTA 3BFVA 3HCNA 5E4YA 1YAHA 3K6SA 3SXJA 4W5QA 5LNK1 2DQZA 1GPNA 1KL7A 3FETA 4YCDA 4HH0A 2CGEA 2OQ2A 5L7TA 2RGAA 3LLVA 1N1DA 1SOUA 4B43A 2PYZA 3CT6A 1DGQA 3RTAA 1J25A 1M2KA 2CJWA 3BB1A 3DUFA 2XR1A 4F1WA 1AZWA 1TQ4A 4ZT5A 3EZLA 3NWPA 4G4JA 3SG0A 1GGVA 5EWMA 3OCCA 4C7MA 4DZTA 1DT3A 3UXYA 4MQLA 3UW3A 4F3YA 4FZRA 1XRSB 4BKUA 1WHSA 3T9DA 2CXOA 4CV3A 1W6RA 1J0EA 2DUWA 3DZCA 1NLUA 4OHRA 5TLSA 1E58A 2C20A 3ZHCA 2IPAB 1LQ2A 3PE6A 4W1RA 3RB8A 3RPEA 3DHNA 1N2OA 4M6WB 2B61A 4O4HA 3IA2A 2FJUA 5HPYB 2C88A 3DWEX 1RRGA 2P5YA 1L5KA 3EGEA 3R7FA 4CCYB 5DIFA 3CLSC 3K70D 3R3SA 1E4EA 4GBJA 5A4AA 4PG4A 1BE1A 3JTMA 4AKSA 4JXZA 5ESRA 4EVIA 1OILA 2CJXA 2B5WA 4CF3A 5EJFA 2C4HA 1BMTA 1JSXA 4K9QA 4QG7A 3PQ7A 1FPMA 2W6JD 1Y7LA 2PBLA 3JTEA 4HRYA 2XXAB 1P81A 4HQ0A 5CT6A 3UH0A 3SHFA 1CQIA 3LSYA 3D4BA 4R9UC 3FTQA 2C54A 1Y34E 4HDNA 3UT5B 3ETDA 5JANA 1OFVA 1FSPA 4GL2A 1FOEB 4UZEA 4NK5A 1ZCZA 4OJQA 5J2UF 1J70A 1VMDA 3UK1A 1KVRA 1H9BA 3ZDAA 1ZM9A 3KCQA 4JKYA 5THXA 3STVA 2XVXA 4NNPA 2BYTA 1EAMA 2GRAA 2QTRA 4X1KB 4C30A 3RQSA 5KQMA 1G3IA 1WSBA 5CCEA 1YQEA 2Q49A 2MSNA 4XEUA 5TB5A 1ZL2A 2VP4A 5AVSA 5FLEX 4OHFA 3BK2A 3JQBC 4BJ3A 4EYOA 3J7AC 4CTKA 1CUYA 4OBXA 5DH9A 2O1SA 1SO8A 4JV5B 4PZEA 4AS3A 2JFPA 4E5SA 1UP7A 4P4GA 1KDZA 3ZDDA 4PX5A 5KAPA 1OTYA 3ROQA 1JRLA 3TLAA 1EUCA 1J21A 4L6CA 4TLMB 3SQXA 2JPDA 2DJIA 2EBHX 1L4MA 1QR6A 2AFHE 2Y71A 5HJEA 1Z4NA 1E1RA 1XELA 2OVFA 4X65B 4ITRC 3AC0A 3HNPA 1OXMA 2Z5VA 3F6PA 1WMSA 2O2JA 2BCJQ 2ZQYA 1HDXA 1B4DA 1WCIA 3OI7A 1NXXA 3O1HB 5I7HA 4EJSC 4RTOA 2OFWA 1W34A 1C4WA 2YIMA 1FSGA 3HL4A 1A2BA 4PIVA 4EG8A 2Z6AA 1JAHA 4YT5A 1Q0ZA 2A84A 1CJBA 3ND8A 2COKA 3WFIA 2YTZA 3R7WB 5EN4A 4ARUA 4UBIA 3WMRA 1JJVA 2IZ1A 2NTJA 3OIGA 4F9EA 2GI4A 2R8EA 4JKOA 3M6AA 4E22A 4Q4JA 3CJQA 2OV8A 4OJKA 3SWWA 1JIUA 2HSWA 2VXCA 3LUFA 3ND6A 4H15A 3TIGA 5IKOA 1A76A 1VLJA 4MUHA 2QZ4A 2QSYA 4OSOA 4X24A 4J0DA 4B7UA 4Q3OA 5K09A 4WA7A 4YJHB 4AUEA 4O4LB 1R6AA 5LR6A 1D6NA 2OWDA 3T3HA 1V71A 4UREA 4DWOA 5AUNB 3MOGA 3TTSA 1BW9B 3OJWA 1KDOA 1XRNA 3BFJA 1SR8A 4LSZA 4M8KA 3TEFA 3AR3A 3GJZA 2NNWB 5A5DA 3DJYA 3UTDA 1OA0A 3CKLA 2NO4A 1U7DA 4N49A 2W37A 3HR7A 1B2RA 1XVUA 2WSMA 4P4UA 4L08A 1R27A 1F2UA 2WFAA 4ZC1A 3CM0A 3S70A 1K92A 3KUXA 2UUPA 1Y33E 3LA8A 4JI1B 4L7QA 4QDJA 4U7HA 1HKHA 2MSDB 5JNSA 2PWZA 4DRXA 2VF7A 1RLMA 1K6XA 1PEDA 1N77A 2PUDA 4IW3B 4ZVRA 1YR2A 3CLRD 4DQUA 1A2KC 3FLMA 3ADBA 1QYCA 3JVVA 3BIWA 1SCBA 3MWEB 4ENVA 1NKSA 4HDSB 3UW1A 3EQZA 3WGHA 4FFRA 4KIGA 5D7BA 5G1PA 2G08A 2NP7A 2ZE6A 5CDSA 4XR4A 2C3MA 1KJWA 3WMWA 4REMA 4FQ5A 2ZTSA 1UOPA 3CTMA 4M0KA 3H2IA 1GAWA 2FQWA 2IHKA 3A6FA 4FBMA 4Q3AA 1IUOA 2JFWA 3HXOA 3FG9A 4RZXA 2NO5A 4UPVA 5IMBA 3VUFA 1SBTA 4H0CA 4Y2XA 1O94C 4B4KA 4B6FA 3N86A 1Y4DE 2QLLA 2C5FA 2OFOA 4LF6B 3F5MA 1NU6A 3DOCA 3M4XA 2H08A 1MFZA 4D9IA 2L82A 5CEEA 1IBKB 2FN7A 1CNMA 3KEOA 4HNQA 1Z56C 1NF3A 2NT4A 3UC5A 3V9AA 5EJ5A 2C5SA 2AN4A 2FQXA 4ZKDA 3PYXA 2HRDA 4IIXA 4C87A 5DBIA 2XNDA 5CT8A 4W5NA 1D6SA 1E2UA 4MRPA 5JMTA 5HIIA 2VHCA 1PR1A 4YROA 5DBEX 3I1IA 1K5PA 1GVHA 2GYWA 5AM5A 4ND1A 1DCKA 3SQOA 2VQFB 3I45A 4FHGA 2A33A 3DAGA 4BO3A 2VATA 3O74A 4WEQA 4DUGD 1TKCA 3EPLA 2QL9A 3F3KA 3TQHA 1UPXA 4KVFA 4Y1GA 1E1KA 1W8IA 2HPAA 2YFYA 3LNTA 4BEVA 2J41A 3K6SB 2J46A 2IPXA 2I3BA 2YC2C 4YUXA 4DUPA 3L7AA 1RM4A 3GR6A 2PH7A 4J0FA 4S0XA 4AJJA 4EWLA 4RTKA 1YNOA 4O2AA 4PSKA 1NT2A 1O5TA 1UBNA 2WINI 2F1OA 4ZCTA 2NSLA 3P9XA 4AQYB 1KZ1A 3PWTA 1B3RA 4J75A 2YXLA 3EEIA 3V7UA 4DYDA 2G9ZA 2DHCA 1SXJD 1U7TA 4F84A 4FR5A 1I3NA 1VJ5A 1ST3A 1F1BA 1KIAA 2OTCA 2I1QA 2VEOA 4KGDA 5BSEA 3U1BA 2F9MA 2Y0DA 1ZIYA 3LLCA 2OMKA 4N7JA 4ZXFA 5I9MA 1YR3A 3DZFA 3OCYA 1E1CB 2QR2A 3A31A 1PW7A 5IABA 5EE3A 4EEKA 3FAKA 1O97D 5K6RA 4DLRA 4OXNA 3B6MA 2LIVA 2NQ2C 4G0ZA 4H7DA 4NVRA 5BN3B 2WB2A 3IOMA 3WLIA 5E6SB 4QSMA 1FXUA 3JD0A 4JX8A 4ZZ1A 3IVMA 3FMOB 4D8XA 4BATA 3QNMA 1LVUA 3RNLA 1VG1A 1M83A 4NJEA 3GJ3A 3NAZA 4Q47A 4A82A 2HZBA 1R0ZA 1TO6A 4N01A 1SN7A 5DP1A 4BIIA 4Q3LA 2YWDA 3FX2A 2E4UA 2PUTA 2PRIA 3H2HA 4LBZA 1YVRA 3LHDA 4W9NC 1NKVA 1W48A 2CK3A 1DAMA 5AXAA 4F85A 2FDCA 3I9FA 1QP4A 1GRQA 1NIJA 3BXEA 2WIGA 3C3DA 3U4AA 4LTNA 2IEGA 3GJSA 3R3VA 2QNIA 5NULA 1IUNA 4I1UA 4ZEWA 2A35A 4KK3A 3RFUA 7YASA 2CZGA 4HDAA 5KVVA 1WPGA 3EF3A 1YS1X 5IH7A 4LFAB 1EQAA 1SHUX 1SQGA 2YWJA 2CHEA 3ED1A 3FTDA 2WJHA 3CTPA 3LE8A 5EPUA 2VXYA 4OTZA 1LBSA 1PX2A 3DC7A 3SQWA 1FU4A 5JVDB 1IM2A 3EQ2A 4GPEA 3VU0A 4QQRA 5CA0F 4MNTA 2I4IA 5DYNA 2IX9A 4ZYTA 1E9BA 5HG0A 1KOFA 3AP1A 3F5DA 5FPQA 4TT3A 2RHHA 1NMYA 5IHXA 1E8DA 4BY9E 2YWRA 4BC1A 2BMDA 1G9TA 1D2HA 3GJ0A 1GPUA 1SC6A 5MGNA 1MEOA 2FLVA 2AZXA 3NI2A 1UUFA 3RRXA 4Q82A 3MLAA 5FHRA 4A8JB 1IRXA 3N7TA 3OIDA 1X7WB 4XX0B 3I9KA 5E3HA 3NALA 1U7OA 3EC1A 3VZSA 3VYTB 3NEAA 1ECBA 1QAQA 1CK4A 2ZPTX 1L1EA 4MKZA 3IP8A 2WMNB 1DHTA 4F8JA 1TZKA 3CJRA 2NPFA 3T5BA 3A6PC 4LJ5A 4JYMA 4UE6A 3VH1A 3LC7O 2J31A 2E5FA 1GN8A 2VXOA 1W36C 3C45A 4WESB 1Y3BE 1VBNA 2QVXX 2VNKA 2XF8A 3EDOA 3HI6A 4MI6A 4I1PA 4KQ6A 2WD7B 3PC2A 3U44A 4G8DA 2DECA 3QJ5A 2VR1A 4W5RA 4EMBA 3G8YA 1XXHA 3IR5A 4WX2B 3RVRA 1OI2A 1CDOA 4P98A 1JN0A 3M33A 1ARZA 1N92A 2Q29A 3AF3A 3BWVA 5FTMA 2JLUA 1YTUA 3V46A 4BNDB 1TCCA 1SCDA 4GZ3A 3FCYA 1EX7A 1KMQA 2QAIA 3OOHA 4CM7A 4PWYA 4NHOA 2V3VA 3MIIA 3I73A 4H31A 4RTRA 3OJFA 3PLAE 4HFMA 4MEAA 4UM9D 1X1DA 4DPKA 4C2UA 1OAOA 4DXDA 2H4XA 1T8UA 2IUSA 1KQNA 3T3DA 4P4LA 4MYDA 1W9MA 4B6EA 1JTVA 1SQFA 2W2KA 1FPQA 1U98A 4QASA 1L4NA 1MQAA 3FY4A 3UHOA 4DB2A 4KGZA 4A0HA 4FYMA 4CKEA 2OY0A 3KZVA 1NBAA 2C1ZA 5FOXA 5JNLA 1IONA 5DMXA 3GLIB 1JXAA 4BBAA 3KXDA 2RC6A 3TEJA 4JJAA 4V38A 3BRSA 2NO1A 4WLVA 4PPFA 4MW9A 4S2EA 1UJNA 4D3FA 3BVPA 2A8YA 2W4QA 4FFVA 5BMVA 3EZFA 2NGRA 5KKNB 1M74A 3TRHA 2ZATA 1CUGA 3WVNA 4AJHA 1P2GA 2FETA 3FYHA 5KQSA 4LCBA 1NR1A 3QRWA 3LK6A 4MP6A 4NDAA 1SXPA 1YZUA 4S1NA 1KY3A 4TYPA 5COAA 4US2R 1EE2A 4YRJA 2V7TA 3JZAA 3K94A 5JCOA 4CTOA 2H0AA 4AURA 1Z8NA 2FK7A 3DBIA 1L6IA 2GZHA 3KTAA 1XVLA 4PLYA 4PLVA 4RZSA 4G5GA 1A98A 3WB9A 4CL0A 2N47A 1U65A 2H17A 2Y6VA 2YIJA 4BVJA 4I3GA 3U4IA 5EWLB 1MZVA 2VCYA 2NSDA 1S96A 3L4SO 1CYDA 3JVEA 1IXKA 1PR5A 1D09A 4H0NA 4KGVA 4XEHA 1JL3A 3S27A 4MQFA 5I51A 3ZKWB 1N2ZA 1P3JA 5FV7A 3UAXA 5JAHA 4QFCA 2Z4SA 3OPXA 1OFGA 2WZBA 4DJAA 1K97A 1XALA 4F9GA 3FTEA 1OZGA 1CUAA 3M9XA 3O8OA 4BLOA 1X0VA 1CJUC 3FUCA 3UCEA 3E1SA 1FW6A 1E1DA 1ICIA 2VK8A 3B9BA 3A2KA 1PTJC 1GYRA 1CS0A 3QMWA 3LX4A 2C57A 2R68A 3F8WA 4BFWA 4RM3A 1VP9A 2DFVA 5A5GA 3ORSA 3TAXA 2ZSKA 5BOSA 1AOXA 3KKMA 1RI1A 1G8AA 4E4YA 5T8KC 421PA 1CIJA 4XR9A 3PA8A 2EFHB 2DU8A 2I4RA 2OCBA 4KRXA 5AJZA 3U4CA 3JWJA 1DARA 3RRFA 3C3AA 4YV2A 4EELA 3Q98A 1J5PA 1U2QA 4IEEA 2YL2A 1X80A 4G0NA 2H2WA 1UXHA 3DW3X 2GAFA 5DHTA 3TOZA 3U7EB 2V3CC 2BI7A 4D3XA 1RXIA 2GD0A 5L51A 2ZJ8A 3BD6A 3EVTA 5E6RA 3QSYA 2DWUA 4QRHA 2Y1GA 5BQPA 1PLLA 1LDNA 5BSMA 3H4MA 4ATNA 4WOCA 4E70A 1NOIA 4DLSA 5U1PA 2C4UA 1AURA 3U0VA 4ER5A 3X1DA 1RHMA 2I4NA 2LXNA 2OO5C 2JK1A 1O3YA 1RFGE 5GOZA 2RAUA 4IKPA 4C0BA 5K1ZA 3GVIA 4E51A 1JR2A 4P3KA 5LP1A 4NBLA 4BV3A 1ORTA 2GARA 3S6JA 3LK7A 5GONF 2W6JA 3DLTA 3WYDA 1WD5A 3BGDA 5A62A 4BUJA 3CLSD 3GFFA 2JA2A 3PNVA 3D6FA 1K68A 2DTEA 4LI3X 5DF1A 5T6BA 4TVBA 2ILVA 4FCTA 4R98A 4MLDA 4F38A 4DV7B 1BNCA 4XIGS 5JE8A 3ZU4A 2LVBA 5AESA 3G8BA 3NAMA 1G8YA 1SB8A 2YV1A 5DHUA 2Q07A 1D2EA 1WS6A 3ZQ6A 3B2EA 2AT1A 1YZKA 2B8TA 1JXOA 2UYOA 4LQDA 2YINC 3G79A 3OZRA 5CK4A 3SX2A 2X77A 1X6VA 1I3MA 4XARA 4Z7OB 3CGGA 4JWKA 4W7IA 3GPDG 5ITSA 1JV2B 4AD8A 4R0MA 1VPWA 1C3LA 1QYVA 3L0BA 3OM0A 1OXSC 3OAAD 4YJ2F 2WG1A 4LZWA 1V1RA 4BP3A 1HTWA 3SDZA 2GBCA 3NHJA 4HGOA 1YO6A 2QS9A 1E6WA 4UHKA 3OLYA 3OX1A 3C7KA 2XADA 2ZRHA 4HS9A 2JGAA 3GLGE 1IBRA 1TZMA 2H2GA 2PTGA 2IQ5A 1I2MA 4UQLA 4AQ7A 3V55A 4PYLA 5FR2A 2IXTA 2C0QA 3I8SA 1A8QA 3BWYA 3ET5A 4J0GA 2AH5A 3A1UA 3BTSA 4XFDA 4HEHA 3QOYA 2I22A 2E48A 1XD8A 1SFRA 2WWIA 4UVDA 2IGBA 4TXJA 2C1EA 1EYZA 1QFXA 4TRMA 3ZPXA 3KUDA 5JMWA 2ACEA 2BSXA 2XDAA 3OZFA 1G8MA 2VDVE 3GO4A 3NT2A 1JHZA 3AKZA 2JASA 2BGRA 2EAUA 1YJAA 4AX4A 1L7VC 2JAWA 3HZHA 1E7WA 2YC4C 1IPEA 2WWHA 2D1QA 4HVCA 4IX1A 3NM6B 4OQXA 4FIZA 4RF3A 2C2MA 4C5CA 3LYHA 4RSGA 4L78A 2XOKD 1JU4A 3Q5DA 3U3OA 4DDUA 4DV2B 1GKUB 4GVXA 4FGUA 4A26A 2VT6A 1FFXA 1CUWA 2AF3C 2XXJA 3L8FA 3ZD6A 1SBZA 3TI7A 1HQDA 2B4TO 4G0QA 1TTTA 4URZR 1K63A 2YV4A 3HYRA 3MELA 1W8DA 2QM8A 4BXOB 3H83A 4F5WA 1YB1A 5C81A 1DZIA 1LRKA 5JC1A 3MAGA 1R16A 3P4YA 1NW6A 4YWJA 3PGKA 1JHRA 2EJWA 3A06A 3HV2A 2Q2OA 1C8VB 2ZBEA 3M5PA 3W7BA 4Y7DA 4IP0A 3EA0A 2ACKA 4PBSA 4AM8A 4NNOA 5BV7A 3BAFA 1DRUA 1QDLB 1Q6ZA 5KVAA 3L4EA 3E8MA 4I55B 3OFND 5TGZA 2H2FA 3TPFA 5CFMA 2D3WA 4JQCA 4YQYA 2Q3EA 2I8AA 4JC8A 2X5OA 1LPNA 5FLYA 2V7XA 3ONWA 1J7KA 1IY8A 3PHLA 4NCXA 2H65A 4QDTA 1HYHA 2YV3A 3SJBA 2WFLA 1NVAA 3FVQA 2FZGA 5K4GA 2QN2A 4HNRA 1YDHA 4PFSA 4FGWA 3IL2A 1WDMA 4J0KA 4PO9A 3QITA 4ARZA 4BBPA 1CEXA 4OLAA 1IIBA 4IZHA 3C3CA 2PJRA 4B7CA 3JYQA 1M1YA 1FA9A 1NY5A 1Q5PA 2HCJB 2IQIA 4HDMA 5IU6A 1AKEA 1W4BA 3WSWA 3MERA 1ZN8A 2HYDA 1DKLA 2HOQA 2PU5A 3DOFA 5DYGA 3LFTA 4Z7JA 3SXUB 4M86A 1GNSA 3MLEA 2WV7A 1O94D 2PXXA 2QGZA 5FOUA 4GICA 4K6GA 1JNYA 1U3VA 1P2TA 2ZTUA 3EW7A 1V6AA 4M89A 1T9DA 5DXAA 2AXEA 4KRFA 1F2TA 1NM5A 1PG2A 1M6VA 3W8EA 4LRYA 3DDOA 4Q9HA 5JI3E 3K32A 4L5CA 3FPCA 1CJMA 2NXWA 4U2DA 1BWSA 2X5KO 4JR2A 5IK2D 4EHAA 1G4AE 2DUMA 2EJUA 3ES9A 4DUGA 4LZOA 5HRUA 4Q9DA 5BSKA 8MHTA 3IKVA 1Q11A 2VHUA 4F4IA 1OCEA 5T3YA 1KDTA 1EVJA 3B52X 4HKTA 3CRMA 4FBGA 3TBFA 5KTTA 3CR3C 2QP4A 4RCYA 1GZDA 1V1MB 1A5BB 4IZ6A 4MV3A 1R5NA 2PCJA 2QMHA 4ZXPA 3AF6A 2BTEA 2WAOA 4X84A 4RENA 1OH7A 2F1RA 3KJFA 5KOHA 5JJIA 3ANYB 4N6GA 1SXJA 3Q8MA 2KJQA 4AO8A 2JGJA 2VTEA 1UC5B 3KT8A 4G5SA 4HNHA 2Y68A 4NR0A 5F9MA 5K3CA 5KWJA 3HUEA 4R7GA 1Y6GA 3R3JA 1ZOOA 3IODA 2VPYA 3QPDA 3HO6A 4OPMA 5SV2A 3NOVA 4TTVA 3W6OA 4AJLA 1GD1O 1R0RE 5K0FA 3IE1A 2EERA 1V8FA 3AEYA 1S1CA 1U3TA 1VDZA 2OV6A 1XA3A 2VLIA 4XDHA 4YR7A 5C4MA 4RULA 3O2QB 1ESDA 4EUKA 4PAQA 3BQNB 3P9RA 1QZZA 2QVYX 3T95A 2AXPA 4CQMD 4UNSA 2NO9A 1NI5A 3D4IA 1UBRS 5BPFA 3QEMA 3G88A 1CBUA 1Z25A 3SSMA 1ULHA 4A6PA 1V3TA 4INJA 5K51A 1UPUA 4AT1A 4CRWB 1G5RA 3DEHA 4UW9A 4X45A 4PICA 3VI4B 3E3LA 1T2UA 1V48A 2IYWA 2IU3A 3RWBA 5AW8A 1XX6A 1Z0DA 1E60A 3LL4A 5AKYA 1FFHA 2NU8A 4KR7A 1M73E 1ZRSA 2GAOA 4TKLA 2ZJ6A 1WF3A 2H54A 4OUDB 3F5SA 2RG1A 1O57A 2ZR9A 1R5OA 4Q1BA 3EPKA 1QWOA 3T3MB 5A06A 3GCGA 1LBQA 2ORWA 1DIOB 2Z6VA 1M2VA 4F04A 2PV0A 1G4HA 3P0HA 4ZD6A 1PVVA 2O2CA 3IAM6 4PO8A 2NWQA 1EUYA 2OAEA 3TVTA 1YB2A 3ZV5A 2Q3FA 4HWOA 3EW9A 4Q1DA 3RC1A 3FCOA 5J4VA 1DIAA 4CV1A 4TMTA 1OH5A 4RIFA 3CT4A 3QW2A 4B74A 3QW4B 3FZEA 3MILA 1OROA 1ZR4A 3BMQA 4JK3A 3KXKA 1A8SA 3EIUA 2GZRA 1PV2A 1SUCA 3A7DA 4HQOA 4ZCSA 2P7IA 1SUIA 2UV8A 1E3LA 3KTOA 2IITA 3MS2A 4URWR 2PUWA 3R74A 2EP8A 3PE4A 2OYRA 3ETHA 5EJGA 1IK6A 1O58A 1PK9A 1Y81A 4FUTA 2AG8A 3SX0A 3HKEB 3V7WA 4MYSA 1NN3A 1GNRA 2FZ5A 3BMNB 4ZQIA 3WTCA 1B0PA 1SXIA 4FYYA 4EBFA 2PQMA 2CNWD 1U8YA 1R3DA 2X4GA 1M76A 4F97A 1V95A 1ZVJA 2XWQA 2C04A 3INGA 3OY7A 1PJ4A 1Z12A 4OHOA 2NUAA 4TMKA 3D64A 1YD7A 4G9GA 2G9UA 2IYOA 2G5TA 3L4BA 3EFEA 4XWAA 4CG2A 3RIHA 2HGZA 3L1HA 4CKBB 4DJ5X 2P9FA 2NXJA 1XN1A 4MUAA 4ZZ2A 3T7EA 3CH7A 2X0FA 2HIAA 2WM3A 4LE1A 4RGVA 4AMZA 3OA0A 1NQAO 3K73O 2V9PA 1N3BA 3P19A 5DBFA 3CVUA 4JNCA 2H3EA 1EFCA 3NBFA 3VRHA 2RD2A 3MXTA 3EZ6A 3QKSB 3HA2A 4XA8A 2M32A 4L2IB 3I72A 4WE3A 5LB2A 4XYBA 3H16A 3RSZA 1NJ8A 2QN1A 4NZMA 1GPDG 3IXMA 5JLJA 1UPFA 3C8MA 1UT8A 2V4MA 4X6YA 2Q9UA 4ETWA 1XP8A 3AF5A 4YAEA 5TGDA 3OQIB 3JSXA 2V0GA 3MM4A 1S8NA 4HAXA 4W9RA 3PGMA 1ZWKA 2IUYA 2ASEA 5KSZA 1NZJA 4PIMA 4JJ6A 5I3CA 3FR8A 4IOMA 3TRFA 4E88A 3BHNA 1WKCA 3AU8A 4W8GA 3RAJA 4A23A 3AHEA 2D1RA 3PXUA 2D0OB 3LVFO 4HQFA 4D3DA 5CJ2A 121PA 5J5VA 3LC0A 1HDZA 2QV7A 4Y9TA 5J43A 3PI6A 3Q9UA 1ZJ4A 4XOIA 1YOBA 4B3TB 2I76A 3G9UA 4CJXA 1KXZA 3W05A 4YK7A 4Z9AA 3WYFA 4OI0A 2EQAA 2AR7A 1VCIA 2EG5A 3DE0X 1Q7CA 3DTVB 3ZTYA 4LMBA 5IUNC 4U63A 4JI8B 4XRRA 3PZRA 5JSKA 5GPBA 1JEEA 3VDNB 3DBOB 1JIXA 4C04A 3DXYA 1CQJA 4JD5A 5JROA 3EGDB 1WCV1 1YL6A 3KO8A 1X15A 2J6CA 2KYRA 3JALB 3KYIB 3NAGA 3NYWA 4BWGA 5K8IA 4NXMB 4MJ3A 4GDFA 1I51A 3NHBA 5E0OA 3LM8A 2OZLA 1N34B 3X0DA 1YI1A 4OO3A 1VFNA 1YR8A 3P2JA 5LYJB 1TEHA 4JKIA 4HV4A 2IWHA 5HVNA 3Q8LA 1D03A 1JFSA 3O7WA 3ZCPA 4F5ZA 2NIPA 4BMSA 1H4SA 3GVPA 3L0OA 2QJWA 3R3XA 3EQ8A 3GJ4A 3BF8A 2QM7A 1B6TA 3SQMA 1XR3A 3DB2A 4N1AA 3G3EA 3MYYA 2B83A 4ND4A 1LWOA 1DEKA 2BFFA 2J08A 3FUWA 2VF5X 5EQDA 1NX6A 2R2AA 2R751 5A9TA 5IM5A 2UZ1B 1K7CA 13PKA 1E7QA 4MWSA 4LV6A 3MTBA 5E3IA 5LQSA 4RY9A 3GBPA 3FOAA 4ENSA 3LDGA 4ZK2A 3LXMA 2IHUA 4D9CA 4EHHA 1IQ0A 2QMYA 3ESRA 4MV4A 2C03A 2H1FA 1UKCA 1IN4A 1YDWA 3FJ1A 4WXHA 4AI6A 4YVFA 3TTWA 4HEJA 4BQOA 3PIIA 3CPHA 5DE3A 3ADKA 3CNOA 2G06A 2G67A 4MWCA 4B32A 2ISQA 1ODFA 1YT5A 3AETB 4KWCA 4PRKA 4W5OA 1K86A 3PEYA 4L50A 4LTDA 4MCIA 3BJIC 1ZUNB 5IYZA 1X8JA 5E1BA 4RFLA 2GCEA 3WJAA 5ALFA 3IUMA 4IM7A 4GX5A 3W8FA 4JXXA 4QDUA 2GN8A 3QU7A 3ELWA 5TMBA 1JHDA 1PDOA 1V9SA 4EVQA 4CVNA 1HE3A 3RYFA 1SIBE 2QDXA 1XRQA 2XBLA 1G20E 4R0NA 5H16A 3PHHA 1YIAA 4N0EA 1B6RA 1VZ3A 1DJLA 4S3MA 5D84A 3K1AB 4S2UA 1EFKA 3BXGA 5I9TA 2ORED 2D4HA 4GU5A 3ZQUA 1QQ6A 4WLFA 2JGEA 4HQKA 2E0IA 2QORA 1D2GA 2ANCA 2M1ZA 4FNOA 4FX2A 2A1TS 3F1LA 2P1RA 2YBEA 1DQRA 2BGUA 3TM4A 3C97A 1H1LA 4IIJB 1KK2A 1KZ7B 1P9WA 1S8FA 2ZUSA 1N6PA 1US8A 1RWOA 2D1YA 2HRZA 2Z08A 3HFSA 1C8BA 3T9AA 2DPXA 1F3OA 1G0OA 3NEPX 3L7JA 5LZ5A 2HHCA 2M6SA 1DRVA 3LQYA 4I1IA 4K1XA 4M21A 4XGNA 1CDEA 1YJ5A 4G85A 1LWNA 1GAEO 3QU9A 2INGX 1QOPB 3V4SA 4Z3OA 4TL6A 4ZVVA 4PLCA 1I2DA 2XWJI 1P80A 221PA 4FMDB 1CRPA 3TW4A 4IQ0A 4YCMA 1AHNA 1FU7A 2B34A 2DKNA 4KQ2A 2J0QA 3I01M 2QQEA 4EABA 3OAAA 4CLDA 3VZCA 5C1PA 4CMBA 2IH5A 4RQAA 3KBOA 5ECGC 5BSRA 4EI8A 5BMVF 1QANA 1OZ0A 3GPIA 5JD5A 2QYHA 3TRKA 4A6EA 1E1QD 1YQXA 1PWEA 2H7VA 2SCUA 2WWYA 3FDFA 1DFIA 3HDVA 2W2MA 1MX3A 3R1IA 4M37A 1ZL0A 3PGVA 1YRLA 1KSJA 2QY6A 4B83A 4F4FA 2FOLA 3D2CA 3DR3A 2DQ4A 5ILGA 3LKVA 4Y0VA 2XCRB 3C5VA 4AULA 3I0NA 3CISA 1K9VF 3NP9A 3U7RA 1UFOA 2QMZA 4QSHA 2QN9A 4RE5A 3L40A 4J91A 4KDFA 3W6NA 1O2DA 2ZXUA 3QVGB 1UBOS 3ZBQA 1KY4A 4B5KA 2WSIA 2Q4EA 1KVTA 1W4CA 4ECEA 3ZGZA 1RZ3A 2O5VA 3S8EA 4Y6PA 2DWPA 2HRCA 5FAKA 4MVJH 1TFUA 2IHTA 4CE6A 2H1HA 3VR5D 4ZA2A 5CURA 2F62A 4EJSA 2JVJA 4X90A 3WO0A 4KQKA 5BSUA 1IJKA 5I5EA 4RY2A 4G8BA 1GL3A 4X62B 2XOKA 3IP6A 3LT1A 2VJMA 1PR0A 3OPQA 2R86A 3S99A 1PV1A 1I5OA 4HNVA 4BOYA 1HDCA 3LT2A 2X4IA 3BXHA 2NAPA 4G4GA 4H17A 5AVKA 4LDQA 3OIVA 3V8NA 3GRCA 1LSUA 2ZULA 4M76B 4ZRMA 2EL9A 4EG4A 2HHHB 1L3IA 5HQJA 4IG4A 4Z9XA 4I6EA 1KARA 2CXHA 3IDFA 3TDMA 5G3ZA 4MW0A 2O3UA 3TIFA 5B36A 1PLJA 1WXHA 5F98A 4Y1RA 3WGOA 4QC2A 4XDZA 3PHCA 1GTSA 4GFDA 1C4KA 1Y8ZA 4XB1A 3F9CA 1SULA 4FI3C 2VUTA 2XCLA 1IUKA 5HJ7A 4JEUA 4EG7A 5HK8A 1JDUA 3OFNA 3C5CA 1FP2A 2YXNA 5GADl 2WTUA 4U9UA 3H2JA 2AZMA 1YS2X 3DEAA 3MYRA 4TL8A 2NYAA 2QRPA 4D9NA 3H5OA 3IOYA 1XUOA 2FPGB 2CLSA 4WK0B 1DKQA 1GZVA 1W5AA 1ZJYA 2MMGA 2NG1A 3CNBA 5H81A 4AMYA 5A6SA 1XPRA 3ZR4B 3AQIA 3V4LA 4A0QA 3T7AA 1VMEA 5EJ6A 2WSLA 3JYLA 4Y9UA 3C5EA 1DBIA 3N2GB 5HKKA 2XGSA 2ZSHA 1DCFA 3BSWA 1TQDA 4D3ZA 4YNBA 3QX9A 1F8YA 3WMFA 3BC1A 4LYAA 1ULTA 4OGKA 3OTOB 2PFKA 2XWSA 1IN1A 2B94A 4BRWA 1Y1LA 3QYPA 1FFEA 2PJDA 4ID3A 3RAEC 2N42A 2A5GA 3CO0S 2EIXA 2VLBA 2YOFA 1VJ1A 3O31A 4MGZR 4LXGA 2CLLB 5TQ2B 2C82A 5HTOA 1O94A 1OAAA 4H3SA 3E70C 1JLLB 1Y1RA 1JI3A 2YZNA 3LBAA 4Y2YA 1L4UA 4ZC8A 3FIUA 4G24A 1YHYA 4BCDA 1ZGGA 4IXNA 3K2EA 4YDHB 4AKEA 5BVHA 2RFLA 5IRCD 2A5JA 3VSEA 2HCBA 2YHIA 2IYPA 5GWXA 3QIAA 4YX9A 4WKNA 2YS6A 1D2MA 3C5HA 4UEKA 3UQYS 1QQAA 1DJMA 5CB4A 2PMWB 2FH5B 3M5CA 1NWHA 1ZN2A 5IK2A 5M3BA 5T57A 5CCBA 2WU8A 1WXWA 4BE9A 3HJHA 3SM3A 4HPWA 3D81A 2VUUA 1FTSA 5JAPA 2PGOA 1W88A 1KJJA 1USUA 2VHXA 4NATA 4DARA 2ZYIA 5K3EA 1WVGA 1SGWA 5CYFA 1AV7A 3CKMA 5BWNA 1Z18A 2AKYA 2IVFA 4BB5A 1CZLA 4F9TA 5CIQA 4ZGBA 4D8VA 1GLVA 1TDJA 1MQ8B 1ZH2A 2WT4A 1STOA 3ABSB 3ABOB 4BS9A 4AJPA 5DN6D 3R3ZA 2O06A 1P1BA 1NWCA 2RHRA 3DVAA 1XZKA 4DLXA 3RG2A 4OHKA 1OKKD 3Q85A 2QW8A 1NNSA 4W7SA 4CBVA 5B55A 3D31A 5FTWA 5UKDA 2AE1A 2CDBA 2QSZA 1N5MA 2X1MA 4JEHA 4R6XA 3RARA 3ZH2A 2EJCA 3BHMA 1KEWA 5IULC 4K28A 5FPSA 1YQQA 3COSA 2ZTHA 3GAMA 1TMOA 4Z53A 4Z2AA 4CFZA 3UTCA 2QLNA 4AN4A 1LJ8A 1WP9A 1ZIXA 4BFTA 1JEJA 1O0BA 5CDUA 1ZICA 3WR5A 4ND2A 4QDXA 3IOBA 2C7QA 3H19A 4Y2QA 4LYJA 1ULSA 2EQ5A 2O4UX 2ZI7A 4KTTE 4NPHA 3UBMA 4CQMA 1CR2A 1SVMA 4O6VA 3IP5A 2ORIA 3EXG2 3ZY2A 1SHLA 2DR0A 2DFLA 2ZUDA 1B6GA 2XUAA 1UM8A 3HYLA 3M1AA 2BP7B 3NXSA 2HJ9A 4MXDA 4TMZA 4UZFA 4YDSA 4HVLA 2H1SA 4L51A 2WI8A 3VU8A 1YBVA 1NXPA 2ROQA 2G0TA 2CUKA 3M4JA 3PWZA 4ZVTA 1HQYE 4MB0A 2RK6A 1YHZA 3VUEA 3HSKA 5KX5B 2IX3A 4I2NA 1OAKA 1MAWA 1Y3CE 2I1LA 5G02A 1S02A 1J5EB 1JLHA 4FDLA 3QJYA 3WISA 3MWDA 3L8EA 2TMGA 4P08A 3QUQA 3PXEA 4UD6A 4R1MA 1E3TA 3F5FA 3BJZA 1CZHA 1VIMA 4I0WB 4LYDA 5LA6A 5J2UB 3AUJB 3BRCA 3DHWC 4OJNA 2GCOB 2QUBA 2NZXA 3G2QA 3LLSA 3B3QA 3G59A 3GDOA 1U4OA 4WY8A 1RI2A 2SBTA 4XJXA 2R44A 1Z7BA 1LB1B 4M7RA 1ZNXA 2R87A 3OPYB 4X6XA 1OOEA 3RWOA 1ISSA 1FSSA 3NOXA 1MJNA 4ENTA 1OYOA 1P4JA 2B7CA 2VS1A 4I5EA 2FMIA 3R7NA 4PLWA 3KQPA 5CDTA 2HFJA 3O8DA 4Q7KA 4C2BA 4LOKA 2FJPA 3NMUF 4ZI5A 2R8OA 3JAKB 1BD3A 2R4QA 3B2QA 3PC8A 1YVDA 4RGBA 4YJFB 3TLGA 3SN6A 4EKNB 1T8YA 4ZDWA 1J8QA 4A92A 5T67A 4ZTZB 3H3JA 4JC0A 2NX2A 2B9VA 5B1DA 2CNWA 2DF8A 2O8FA 1KGSA 3MCAA 1Y9JA 1JG7A 5IH3A 3T4UA 3W5UA 1GCAA 3U26A 3EN0A 2O2SA 2JL1A 4LY9A 1KERA 3B36A 2D5CA 4S1WA 4BJ5A 1E77A 1WB6A 1R4MA 3LOUA 1U81A 2PIDA 3T5TA 3ZHBA 4UUOA 4ZI3A 1O96A 2ZRDA 4A1FA 2JI4A 1L5ZA 2DBQA 4RF4A 4C07A 3ESAA 4DCOA 3OICA 2IYNA 4HI0E 3BJEA 3ETEA 4M1TA 5ALYA 4B80A 2CV1A 4HEA6 4PGGA 2ZI3A 5L3QA 2AK3A 3S1LA 5HEKA 1Z5GA 1NOJA 2B20A 1EWYA 2HA3A 3H1PA 3K1TA 2LR0A 4J43A 4KWTA 2EKZA 1C14A 2ZANA 5KYYA 4R05A 1UAAA 2JCBA 1RZUA 2JHPA 1SCIA 2O8BB 1TMGE 2BFEA 1N2SA 3N0VA 1T2EA 4WUTA 5CM9C 1HNZB 1YDMA 3KC2A 3TNJA 3HZZA 4L0QA 3UUWA 2XKKA 4MR7A 4IH9A 1K3TA 4QT0A 4JI3B 3G1WA 4AG6A 1GG9A 1PFVA 3TB4A 1ZMOA 3WKBA 3EMBA 2IIBA 4I2VA 1NW9B 3UXEA 5HDQA 5IW8A 3S8MA 1XOIA 1KFEB 3KQKA 2FA9A 3NXKA 3CLHA 4IDQA 2VHWA 5TS3A 5AVQA 3SZMA 5BWMA 4X6UA 3UA4A 1SUEA 3N2IA 5CLLA 1CRQA 4QAJA 2FLWA 1VFPA 1RJGA 2BFOA 4WBSA 1L4HA 5FBRB 3SS7X 2ZKIA 3RYCA 1HOTA 2CVZA 5DPMA 3S1AA 3CKKA 2RKBA 3COWA 5EMJA 2FN8A 5IDQA 4JJEA 1TT5A 2WF6A 4DV0B 3Q88A 4Z0NA 4UAGA 3E18A 1LA2A 2A7QA 2PN1A 4G1VA 2JJQA 3FYDA 1MVNA 1UXKA 2QZ9A 4LJSA 2JGMA 3SIXA 4EYQA 4L8FA 2FWPA 1S2MA 1LK5A 2W42A 1Z4IA 4IDNA 4KXFB 3AFNA 2PUAA 2OZVA 3RVKA 4D6XA 1UPBA 1UBHS 3T5CA 1CZUA 2DHDA 2FMXA 2PS1A 2LCFA 4GLBA 1JI0A 5CBPA 3C3BA 3HB1A 3RU3A 4A0GA 5EXXA 1IXRC 4H4CA 1AKYA 4H27A 4DC0A 5DLPA 3PGXA 4U6QA 3ZDXB 4QYIA 4KPYA 4C06A 2I7DA 1PZXA 3BE5A 3DKVA 1U0NA 3L07A 1CUZA 3CSUA 2KMLA 4HH3C 4IIBA 2OXIA 1FMJA 3SYLA 4J1SA 3ZIUA 4TKVA 4YAUA 1E99A 1ZO8A 5EJIA 2YY6A 4D0NA 1Y42X 4FDMA 5IJZA 2CHFA 1MHTA 1YFZA 2Y1CA 2FSFA 2XDWA 3EBLA 3EYWA 1VE3A 3ZHOA 2Y93A 4OI4A 5IVHA 1FFAA 1KO7A 2YWHA 2OXEA 3KYJB 3WLEA 3G2OA 1JLMA 3GT4A 4K86A 3RC2A 1VYUA 2W2LD 3DEYX 3O4FA 5HE8A 4J4TA 2DSTA 3W3ZB 1QVAA 4DT1A 5L53A 3VNAA 4CMHA 3HUUA 3WNQA 4XIYA 3HYNA 3OM8A 1A9TA 1H2ZA 4Q3KA 4ND3A 1R6VA 2R00C 3TLEA 5KYTA 4HNAA 3W5DA 2HLNA 1QGAA 1C0PA 2ZSFA 1SKBA 3OPMA 3DV2A 5LQJA 3HJFA 1FDWA 1I5EA 5EIFA 2ZJ2A 2IYZA 2RIRA 2WHQA 2IZ5A 4S1TA 5JCXA 1PT8A 2AW3A 5T8KA 5IM4A 1KO8A 2P4HX 3E5MA 4US0R 4LI0A 2QPLA 1KEEA 2XECA 3ZQ4A 1YCDA 1YQGA 2DBYA 1JQ5A 4O4IA 5DOZA 1AQJA 1QVZA 2AJCA 5KTPA 3OT4A 1W4ZA 1UZUA 3RDPA 3H6HA 2VJPA 3F7NA 4NFSA 4J1TA 1X0XA 2WIKA 3K8QA 3AM5A 1T1JA 1EJBA 2J1LA 3FHLA 2FPSA 3RBXA 1T5HX 1ZK0A 1H0HA 4QAQA 1VKJA 3W8DA 4B0PA 4EGFA 1YU9A 1J90A 4U7DA 3UMYA 2OO5A 3CF4A 3R0QA 3ORRA 3AYZB 2CMKA 3MN1A 2RI1A 2JLXA 5FDFA 1HUQA 2HRRA 2Q2WA 4L57A 1DXOA 4XSHA 5DOVA 3SBXA 1EM8A 1BIFA 1WQ3A 3STYA 3WO1A 4BO4A 4R2HA 5CNMA 5CA1B 2XCTB 1ACMA 1GITA 2G72A 5CRIA 1IJBA 2R6AA 3U7GA 3PCTA 4RESA 2GK6A 5EKSA 4WT7A 3C6YA 3OQ6A 2GASA 5B12A 3GFVA 5FO0A 3HQ4O 1Q17A 3I9NA 2VL7A 3NWJA 4ZI7A 5ICMA 3UAGA 2W8ZA 1RPAA 3S81A 1J49A 2M6RA 2NZ2A 1RFLA 2FFBA 4RPHA 2QM0A 1XK6A 4IZIA 4QYTA 4B44A 4KXVA 1GG8A 3QBVA 5B6IA 4YJGA 5ICCA 3RV4A 4FHEA 9ABPA 5M04A 1W9HA 2CD7A 1ECPA 2D62A 4QEDA 2V8OA 3IQFA 3TVYA 1R8YA 2C2HA 2K5UA 4NJMA 4RWEA 1E1QA 1JHXA 4EHDA 3MHTA 3JZDA 3QFHA 4R84A 5B2EA 3FR7A 4GLJA 1VIVA 2RHLA 2A88A 3I6ZA 5EZSA 2IRWA 3STHA 3TTTA 4A8JC 3UJ7A 1Z62A 3D59A 3K4HA 1XZMA 5CGQB 1EK1A 2IE0A 1HZJA 3BMOA 1PD0A 3ET4A 3RRZA 3ZJYA 1XXHE 3OZUA 3UAVA 2OT3B 1DUIA 1G7CA 3KYBA 3OG9A 1DELA 1FLAA 3C48A 4RGQA 1H6BA 5HS6A 5A7GA 5KHLB 2P30A 2Q6LA 4L4YA 4PSCA 1LFDB 1OLXA 3LBYA 1BTOA 1OLSA 1BAPA 3KWLA 2OQVA 1ZAYA 3E2PA 2O0LA 2Z8XA 5KYGA 5DJ5A 5FA6A 1AO3A 3IOCA 3VR5A 3COYA 1L5MA 4LXQA 4WK2B 4BCCA 3CWZA 3H13A 3WRWA 5IUJC 5IT9A 1NLYA 1TM4E 5AWFC 4HLDA 3OMWA 3NBMA 1YIDA 1C3OA 2QBYA 1TKRA 3BH7A 1E6UA 1HFWA 2AKEA 3P2MA 4MKIA 1P45A 3H65A 3TPCA 1N2JA 2RHOA 3X43A 1C3JA 1XJ5A 2RJOA 3FKSD 4G2NA 1NKTA 4X0EA 2CYCA 2LW7A 2PZJA 1FYVA 3H1BA 3NNSA 4CT0A 3QA9A 2PGNA 2BUBA 5CX4A 3EXG1 4JI2B 1FZTA 3A1NA 3BN3A 1P7YA 2ZTLA 4BWVA 1MC8A 1N1EA 4P84A 5IYZF