4M37A

Crystal structure of trypanosoma brucei protein arginine methyltransferase 7 complex with adohcy
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
337
structure length
337
Chain Sequence
RPPDAFVNRIDRNIPVPARLRHTPVSLIEAVNDFHYAMMNDEERNNFYYEVLKKHVTPETGVLEIGAGSGLLSLMAAKLGAKWVVAVEGSEELAKLARENIRANNMEHQVKVLHMMSTELKSKHLPEPPDVLLSEIFGTMMLGESALDYVVDVRNRLLKPTTKIIPQFGTQYAVPIECDALHRISSVSGWRDLDLKHMMTLQDTVSIVFAKHYGIRMNSVNFRRLSDPIELFRVDFSSSNRNDIPRRKHFDVVAKESGTAHAMLFYWKVTDDEFVMSTDPEDTVNNFPRDMQWGQALQLLDASNGPLPTPVVFTEGKNYNFECNFSGDRVILHMQLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Protein arginine N-methyltransferase 7
publication title Structural Determinants for the Strict Monomethylation Activity by Trypanosoma brucei Protein Arginine Methyltransferase 7
pubmed doi rcsb
source organism Trypanosoma brucei brucei
total genus 106
structure length 337
sequence length 337
ec nomenclature ec 2.1.1.-:
pdb deposition date 2013-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06325 PrmA Ribosomal protein L11 methyltransferase (PrmA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 4m37A02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4m37A01
4O29A 3I64A 5H02A 4ER0A 3BKWA 3CVOA 1M6YA 1KPIA 2BM9A 2YX1A 3G2MA 4FT2A 1F38A 2R3SA 4FT4A 5DX8A 4RVDA 4WVLA 5K0BA 2ERCA 1QANA 2ZWAA 3FPJA 2ZCJA 1JG4A 3UJ6A 1XXLA 4P7FA 3O4FA 2UYOA 3GNLA 2C7OA 2P3OA 1KYZA 2PX4A 4OA8A 2PGXA 1TPYA 3Q87B 2JHAA 3P8ZA 4E2WA 1RJGA 4X60A 3UJBA 4YMHA 3AWIA 1YFLA 2P7HA 2NXEA 4QVGA 3MTEA 3LSTA 4A6EA 4X1OA 4CKCA 3BKXA 3HEMA 3G88A 1N2XA 3PVCA 3S68A 3UJAA 3SSOA 2BR3A 3ERCA 1DL5A 3P97A 2IH2A 3EEYA 3BGDA 2CWWA 3UJCA 2G71A 4DCGA 3GO4A 3FTDA 2GPYA 2YUIA 3HA7A 4M38A 3KPYA 3KHKA 3M6UA 4IV0A 5DM2A 8MHTA 3R6TA 4U7TB 1VQ1A 5GINE 3EPPA 1XDSA 4GC9A 3GRZA 3TOSA 5HFJA 2P7IA 4GOMD 2ZZMA 1UWVA 3A7DA 4RTPA 1D2GA 4PGGA 4PIMA 1YB2A 5LQRA 3JWGA 3ER9A 3TRKA 4PYLA 2IIPA 4R6WA 5E1MA 5EZSA 3LDUA 5E8JA 4MTLA 5CCBA 2DPMA 3B89A 3DULA 3LBYA 4BLUA 1R74A 2PLWA 5IH3A 1G55A 5K0NA 4M37A 1RJFA 4LG1A 2YXEA 3AJDA 5FHRA 2XYQA 4YUYA 3B3JA 4HTFA 2PX5A 2Q41A 2OO3A 3BGVA 3DXXA 5JUWA 4QDJA 4HTFB 5BXYA 4H0NA 2VDUE 3HCDA 2ZULA 3G7UA 4P7KA 1P91A 1Q0SA 2GH1A 5EHGA 1DUSA 2H1RA 4R8RA 1YZ3A 3GU3A 3LBFA 1KXZA 5FHQA 4YUZA 3TKAA 4PYKA 3IYLW 1ORHA 4EQZA 4RTKA 4PYNA 1I1NA 1QAOA 2JHCA 2YVLA 4IV8A 3IEIA 4GOOD 5CVEA 3CJRA 2GA9A 5K0EA 1FJXA 3HTXA 2OZVA 5GOZA 2IGTA 5EQJB 1P1BA 2OB1A 1N7IA 1NW3A 4HG2A 1VP9A 3UWPA 3GCZA 1NW5A 3HCAA 4P7JA 2QY6A 5K09A 5FWAA 1L3BA 2G1PA 1RI1A 2XBMA 2UYQA 5FQNA 4YV1A 3EVCA 3BWCA 2ZW9A 3OU6A 3M6XA 3FUTA 4HRAA 4RTSA 3P9NA 3HNRA 4PYMA 1EJ0A 5EKXA 4PGHA 4C04A 2AS0A 4LWOA 3FRIA 5GM1A 4F84A 4YV2A 1AQIA 5LQJA 2HR1A 5EMKA 3LKDA 2IDKA 3T7SA 5LQCA 4POOA 1EJ6A 4G56A 3C6KA 4OQDA 1G8SA 2ADMA 3AY0A 4PIPA 1Q0TA 4RVHA 1JG3A 1XCLA 2HMYB 10MHA 4R8SA 3UZUA 2PT6A 3C6MA 1B42A 3GGDA 2FK8A 4FSDA 2NP7A 1ZGAA 4GOND 3A27A 5EMMA 2FRXA 1SUSA 2QYOA 1ZGJA 3SVZA 5K0FA 4PNEA 1JR4A 5DWQA 3LGAA 3NDIA 5ICCA 4MHTA 1P39A 3UJ7A 2FCAA 4EVIA 3H2BA 3UJDA 4E32A 1INLA 4PWYA 2ZLBA 3E7PA 5FUBA 2H00A 3KPWA 2GAFA 5CVJA 3I53A 3LL7A 4DCMA 5DXJA 1SQFA 2EJUA 5DLYA 1QYRA 5IKMA 2UYCA 3SSMA 3T7TA 5KVAA 2ZBRA 3LKZA 2O05A 2PT9A 3FUXA 3HCBA 4KW7A 1SUIA 4WXHA 5DRYA 4KDCA 2IPXA 4CWAA 3KPVA 3MTIA 5K0GA 3NMUF 2P35A 5DTMA 5B1SA 4EK9A 3EVGA 3PT9A 3SGLA 3THRA 4CXMA 3TFWA 2A14A 1FPQA 3EMDA 1M6EX 5E9WA 4RVFA 3EVEA 5T64A 2VDVE 5KQRA 2UYHA 4QPNA 3X0DA 1VBFA 3CJTA 2P8JA 2PKWA 4FGZA 1PJZA 2QRVA 4YUWA 5DSTA 1G6Q1 3ME5A 1UFKA 3HA5A 4DKJA 5G02A 2Y1XA 3PFGA 3LHDA 3G8BA 5HIIA 2HV9A 1VIDA 3T7RA 3KQVA 4LECA 3O7WA 3OZTA 5DSXA 2AN5A 5D1HA 4RTOA 3E05A 5HOQA 3DMGA 4OQEA 2NP6A 2YTZA 3ELYA 5DX1A 3V97A 1IY9A 2C7PA 2BZGA 3GRVA 3P2IA 3PX3A 4KIGA 3FTCA 2AR0A 5M5BA 4PYQA 1RJEA 2I62A 2PXCA 3B3FA 4C07A 3OZRA 5E2BA 4YUVA 3FZGA 5E2AA 2AOTA 4RTJA 2ZTHA 1WG8A 3UA3A 2Z6UA 3G8AA 4YUXA 1RI3A 5EIWA 2GLUA 5EZQA 4QQNA 4MWZA 1XDUA 3GRUA 5P8WA 2WA1A 3B7PA 2AVNA 5BW4A 4GC5A 5EOVA 1XJ5A 5CVVA 3P71T 5E9QA 4QTTB 3LCCA 4QTUB 2O06A 3V8VA 1YUBA 2JG3A 2BH2A 2G72A 3R0QA 3TR6A 2ZIFA 3TPZA 1M0EA 3UA4A 1I9GA 3FRHA 5LR6A 3GXOA 2EX4A 3OU2A 3EVFA 2H11A 2ONZA 2XYVA 3GRRA 3U81A 5BP7A 2PXXA 3SMQA 4MQ4A 2ZWVA 1KPGA 5ICGA 1ZKDA 2GS9A 2O57A 4PYOA 2AVDA 4Y30A 3DXYA 4DM3A 4ER7A 3EEOA 3A4TA 1RI2A 4V0QA 5K0CA 1JQ3A 3TLJA 2I7CA 3A7EA 4PCLA 4YV0A 4RV9A 2WA2A 3P2KA 1IM8A 5K0JA 1BOOA 4GUAA 3LDFA 2V7EA 4Y2HA 5HILA 1QZZA 5DM4A 4AZWA 4V0RA 4ISCA 1L3IA 4ZTBA 5JR3A 3FTEA 1KHHA 4RSRA 3FTFA 5EMJA 2P41A 3EMBA 4OBWA 1NW6A 2O07A 3BWYA 2AOUA 5DXAA 1JSZA 5FQOA 3ID6C 3PFHA 1ZQ9A 3I9FA 1KIAA 2AOWA 5CUQA 4R05A 5E1BA 5ICEA 5DTRA 1XDZA 2I6GA 1EG2A 3ANXA 2DULA 4XUCA 1AV6A 2KW5A 4R6XA 4GF5A 4PCAA 3HA3A 4HC4A 1O9HA 4NECA 3DXZA 2B25A 2JHPA 3MCZA 5LSAA 3CGGA 3D2LA 3C3YA 2PY6A 3Q7EA 1X19A 3CC8A 1SQGA 2E5WA 2PSSA 3MCTA 3CBGA 2P40A 1KPHA 2VP3A 3DOUA 1N7JA 1EAMA 4KDRA 4KIFA 4XUEA 3GIWA 2BM8A 3AXSA 5GP1A 4RYLA 1EQAA 2ZBPA 3PB3A 3G2OA 4DQ0A 3C3PA 3SSNA 1ZG3A 2NYUA 2GB4A 3HP7A 2ZFUA 3M33A 5CM2Z 4EMSA 1AF7A 5E9JA 5C1IA 1TW3A 3KKZA 2PVCA 3BWMA 1RI5A 3KPUA 4K6MA 4CKBA 4ER6A 4DA4A 5LQNA 2AZTA 3NDJA 5LQAA 5LQKA 3F4KA 1QAMA 3K6RA 1VLMA 4BP3A 2HTEA 2NXJA 2VDWA 3AXTA 4U7PB 3NWEA 3ER8A 2G70A 2EG5A 2ZVJA 2YR0A 2HWKA 5CVUA 3FUUA 3NW9A 5D1NA 3KQSA 4DMGA 1R8YA 2IH4A 3DP7A 5T67A 1YZHA 3FPEA 5U4XA 4DZRA 1NV9A 3A25A 4FSXA 3R24A 3E8SA 4PYIA 1EIZA 2G8NA 2FK7A 4AZVA 2AN3A 1FP2A 3EVZA 1O9GA 3HCEA 1PRYA 3NVKI 5F2OA 1JQEA 3QV2A 5F2KA 2EJTA 5HIMA 3O31A 4RTRA 3FPHA 4RX1A 4OBXA 2IP2A 2O0LA 1NBIA 4C06A 4X61A 1NV8A 1VP3A 3DR5A 3ORHA 3SX0A 3TM4A 4B17A 2CKDA 3OFJA 1AQJA 5DTQA 4XUDA 3SXJA 4BLVA 5EPEA 1ORIA 3G2PA 5FADA 1Y8CA 4FR0A 4AZTA 9MHTA 3SR4A 1YFJA 3KQYA 2JH8A 3DUWA 2IH5A 4E30A 2B9EA 3K0BA 3LECA 3M4XA 2PWPA 3P9KA 5FTWA 4E31A 4E2YA 3UBTA 1SKMA 3BT7A 2AOVA 2IDJA 2QRVB 3MHTA 1JSXA 4C4AA 1L3CA 3UFBA 3BZBA 1FBNA 5K03A 3P2EA 1TW2A 2C7QA 3QOXA 4E33A 4EKIA 3I5UA 1RJDA 4OX9Y 1VL5A 1G38A 5F2NA 3KQWA 5K0LA 3HVJA 4KVZA 2AN4A 3OE5A 1X1BA 3WSTA 3LX6A 3PLAE 1NT2A 1I4WA 3HVKA 5KYGA 3TMAA 1X1DA 2B2CA 1WY7A 2V74B 3NJRA 1BHJA 3KQTA 3MERA 2XVAA 1JG1A 1L9KA 2AOTB 1MJFA 3KQPA 3E23A 1DCTA 5EHIA 3DMFA 3T0IA 4AUKA 2IBSA 3OE4A 5GIPE 3R3HA 5ICFA 3RW9A 5EGSA 5FA8A 5C9ZA 2QE6A 3EVDA 4RTNA 4HGYA 2VZ9A 3UJ8A 3BUSA 1R6AA 3C0KA 2ZIEA 3RODA 1X1AA 2HNKA 3BXOA 3G2QA 3ELWA 1F3LA 2NXCA 2OBFA 2YXLA 3G5TA 3KQOA 4ATNA 1R18A 1P1CA 3KR1A 3B3GA 3KQQA 3RIEA 2LD4A 3GWZA 4C03A 1NKVA 4BLWA 4KRGA 3EGEA 1JQDA 5C0OE 1WZNA 4HGZA 1SG9A 4RWZA 5GIOE 2ZZKA 3HVHA 4P58A 2OPBA 5CD1A 4C08A 1FP1D 5FA5A 2P3QA 4QDKA 1WS6A 1KYWA 2P1DA 3CKKA 2FHPA 4FP9A 4QPPA 3DLIA 1RI4A 4YMGA 1H1DA 5EMLA 2XYRA 4OA5A 2JJQA 1NE2A 1R00A 1XCJA 1O54A 7MHTA 3KR9A 4CTKA 4X63A 5EVJA 3SM3A 1UIRA 3JWIA 4GEKA 3DTNA 1MHTA 1NBHA 5KQSA 2ONYA 5EKUA 2B3TA 2OB2A 1JTFA 5FWDA 4IWNA 1YF3A 1G60A 2CL5A 3P9IA 5MHTA 3EGVA 2AOUB 1HNNA 5FCDA 3TKYA 3G89A 5DPMA 1VPTA 2OKCA 2OY0A 3BGIA 3VC1A 4ER5A 5K01A 4M7RA 4AX8A 2F8LA 4UOEA 4P7GA 3A26A 3PX2A 4C05A 1T43A 3DLCA 3L8DA 2Z6QA 3FYCA 1U2ZA 2B78A 4GQBA 2N47A 3EVBA 4E2ZA 1KR5A 5EG5A 4PINA 2ZSUA 3JWJA 2ESRA 2I9KA 3EGIA 3HCFA 4PONA 2IBTA 2WK1A 1QAQA 4GBED 3HVIA 3JWHA 3REOA 5DX0A 2OXTA 3GDHA 3EVAA 5K8VA 5DT2A 2JH9A 3ELDA 2R6ZA 2PX8A 2IFTA 4MIKA 3LCUA 2PXAA 1XTPA 2ZBQA 5EIFA 4PYJA 5GWXA 2CMHA 4RTLA 4IKPA 4DF3A 3IHTA 3FPFA 4XCXA 3KQMA 3THSA 2PV0A 3P9CA 4F85A 4LWPA 1G8AA 5CVDA 4Z2YA 3OCJA 2AOXA 4F86A 5BW5A 2EFJA 4M36A 2PJDA 2NNWB 3PS9A 2ZZNA 4JXJA 5CCXA 5LQUA 1NW7A 1R8XA 3IV6A 2FYTA 5HIJA 3OU7A 5T6BA 3QOWA 1D2CA 4E2XA 2C7RA 5DM1A 5K05A 3MGGA 3CJQA 3ELUA 4QVKA 2PBFA 2ZIGA 3NTVA 5HEKA 4RTMA 5DRTA 4AZSA 1KP9A 1ZHFA 3LCVB 2ORED 3G5LA 3TQSA 3VSEA 4QQKA 4HSGA 3M6WA 3MQ2A 3OZSA 4A6DA 3FUVA 4CTJA 1L1EA 1Z3CA 2NXNA 3OPNA 1BC5A 1SVUA 2VS1A 3BWBA 4RTQA 2BR4A 3NVMB 3VC2A 3R9XB 2QM3A 3KR2A 3M6VA 1OR8A 4BP1A 3KPJA 1JTEA 3HM2A 2CMGA 5EEHA 3TM5A 5E8RA 3LPMA 3LDGA 4E70A 2OYRA 3OFKA 2P3LA 3FUWA 4HH4A 5E1DA 3GRYA 2BR5A 2YQZA 3GJYA 5EC8A 3PTAA 1V39A 1IXKA 1BKYA 1XVAA 4GOLD 3FPGA 5ERGB 4BY9E 3DH0A 4RVGA 1WXWA 5HIKA 2FPOA 3HCCA 4L7VA 3CCFA 1WXXA 3M70A 2PWYA 4FZVA 4X41A 1X1CA 3VYWA 4ER3A 2UZ4A 3MAGA 3MB5A 5GM2A 2Y1WA 5EEGA 4FS8A 4CKEA 3DMHA 4EKGA 1VE3A 1NW8A 5E1OA 2Z6AA 5FULA 1HMYA 2YXDA 5DM0A 1D2HA 2PX2A 4KWCA 3NWBA 3I58A 3KU1A 1JG2A 2XVMA 3B5IA 2K4MA 3UJ9A 3FYDA 5HZMA 5CIYA 5KS2A 3KR0A
chains in the Genus database with same CATH superfamily
2WZDA 3JQDA 5IDWA 1NUQA 2XSZA 4GXNA 3AMVA 1MB2A 3B1JA 4DGSA 1AN0A 3JQ9A 1R0LA 1GUFA 1VECA 3QXGA 3SVLA 2XVXA 2DHEA 4XYBA 5DO9A 4PO8A 4TTTS 3RLIA 3ZOKA 4NESA 3EBPA 4AK9A 5ABPA 5AO9A 5CH5A 4NSNA 5DF1A 4DV1B 3H86A 4EAQA 3H1TA 4B7UA 4ZC8A 3B36A 3VPCA 1RKQA 5AK6A 4B35A 1Y1PA 2H1SA 3BL8A 3TIFA 3VVBA 1TM7E 4FR2A 4QVGA 5LLDA 3OKAA 4BWYA 3W8EA 3MPUA 2GPAA 1J2UA 1L5RA 1Q1EA 3H9QA 3HG7A 4FNGA 5BO5A 3BJMA 1DHTA 3CZRA 1BO6A 2W93A 3BGDA 3PA6A 2WHXA 4O0LA 5FTLA 1G9XA 3ZHRA 2PL3A 4BGUA 5AVXA 3KYDB 3UNXA 1SELA 5B7GA 4IV0A 2C03A 4BUCA 5I45A 3K1ZA 4BQSA 4B33A 3PC8A 1DTSA 5JVDF 2YASA 1N2OA 1AQNA 1N7HA 3ZV7A 4P1ZA 3UW3A 4M60A 4A8PA 1H1LA 3L4EA 4J90A 2PK3A 1EGQA 3PPWA 2AFVA 4FKZA 3CWZA 3WWZA 4ASUD 4UE3S 3EK2A 5T4BA 5ALSA 1EA5A 4D6XA 5LYJA 2V7UA 2GN2A 2W6OA 5LDDC 4ZMBA 4BLUA 2RAPA 2OECA 1PAUA 2REXB 2QLBA 1QE5A 4LDPA 4PAGA 1KE2A 2QQGA 1ZHHA 4ERNA 1A71A 4F97A 4OGLA 3QVKA 2Q41A 2WR8A 4G2NA 5BN5B 4HTFB 4BGDA 3K1TA 1YDWA 4ID9A 4Q4AA 5EGNA 3WAJA 5HRAA 3D8HA 2HQRA 4MI1A 5DWDA 4NEQA 2OVFA 4A0RA 4DT1B 4EHKA 1B0PA 2WIDA 3TMKA 3LBFA 3GU3A 2H06A 1M72A 2QQFA 3H83A 4O4JF 5AXDA 4BVHA 5L4NA 1HRKA 1MFZA 4C7OA 2BMAA 1KSHA 3ZBUA 1Y8AA 5DZSA 4RTKA 4R2LA 1QAOA 1IPEA 4IG4A 1L7DA 2FVYA 2PTGA 3HBMA 4K81B 1ADCA 3VBEA 3ADBA 4EWLA 2DECA 4V0KA 1QDUA 4LK3A 4OFWA 4KQ1A 3SF8B 4LFAB 2V55B 3GCZA 3I12A 2A92A 1L3BA 1M8PA 4FMCF 4KU4A 4ZEWA 4ABYA 4P33A 2J4CA 1ZK0A 4AYTA 3NBZC 2QV7A 3HRIA 4WZAE 5DNDA 5ETJA 1RWQA 5J40A 1RYBA 5E7JA 3RT1A 2GAOA 3W8RA 3M81A 2P9JA 1HDZA 2FZ4A 3H7IA 4BV2A 5AM2A 4DIKA 3E84A 4BLTA 1T2CA 4Q34A 2GR9A 1ZM7A 2PFGA 2YICA 3NGXA 3IDOA 3E2PA 1MV8A 4U2FA 5JSZB 4NBUA 5E6UA 3GL9A 4M1YA 2ADMA 2H57A 1PJCA 3EMKA 1BH2A 3OE7D 3A1SA 4N76A 4WOBA 3LQYA 2FJUA 1MX1A 4RIEA 1GVHA 4MI9A 1C9JA 3NCHA 2O1WA 5ALOA 5FBKA 1D6NA 3IE1A 5AK5A 2DXIA 3EIWA 2DJIA 3AG6A 1GTZA 3M1LA 3BULA 3RYHB 4JGBA 3H9BA 3BSWA 4R69A 4U3JA 5F4BA 1COWD 2DH6A 1MP0A 1RXEA 1XF1A 1ZNWA 2ZLBA 1HT2E 3E18A 1Z62A 3LC2O 3K9NA 3O8NA 4K8OA 1O6GA 1U5BB 2A35A 2YHBA 5DXJA 3L1KA 4M53A 4N1AA 4Q9LA 4BAZA 3G0DA 1XDBA 1AN9A 5KVAA 2ZBRA 3A9TA 3LKZA 1BD3A 1XVLA 3AJEA 3KYBA 4HP8A 3RTAA 3T3OA 2Z04A 1E32A 3PJDA 5T57A 3TI7A 1CF9A 1MC8A 1JB1A 1BX3A 1FUKA 1PJBA 1UP7A 3IXQA 3R0XA 2I4LA 2X8LA 4JZKA 5EUCA 1PL6A 4C88A 4E5PA 2R5WA 2QUAA 1P5RA 1UKYA 3HACA 4CXMA 3EULA 3TW0A 2VPPA 1PUIA 4RY9A 5T64A 3KCNA 4A2WA 5T7BA 1R4AA 4REOA 1Y34E 2ETVA 2LPMA 3OC6A 2RK4A 4GGPA 5J43A 1GSOA 1XMVA 2N75A 3STUA 4YUWA 4DUZB 1SAYA 3ME5A 5EAIA 5I51A 3T4UA 4DLKA 3CVUA 3D4OA 3ZXXA 1E7MA 4MKFA 3W5IA 5IXJA 3RKUA 4DJTA 4RTOA 1A27A 3CKLA 2HJGA 3S27A 1PP4A 2O8FA 2WFAA 1QVRA 4MUAA 2HCJB 4Y2TA 3TTWA 5LJIA 1E2QA 2JLXA 1S4MA 1PV2A 2QROA 1X8KA 2CF5A 3ELYA 3WGIA 4E07A 3ZQ4A 2BGWA 4HD8A 1U2EA 3FGZA 3G6WA 1M34B 3TAHA 3UCEA 2OORA 2V0NA 2ZWPA 4B6RA 3QEAZ 2D7CA 3WL8A 1DXOA 1L1FA 4Y9DA 1TJ4A 5JVDA 4R54A 4PBTA 1QO0A 2ZTMA 2JD0A 2SECE 2C2ZA 1WDWB 4HH3C 4L78A 5AHWA 5AJYA 1PG0A 4AQ7A 3DZ8A 2AUNA 5IWCA 2O1EA 2XA2A 2Z98A 3GNTA 1RHMA 5CAEA 3PHBE 3FDJA 2J46A 5ENVA 3LDHA 2C5EA 3VR6D 1IBMB 3ZBQA 4B46A 1ZCAA 1O87A 3ITDA 4FCWA 2XUDA 4OXKA 1U8ZA 4YALA 2HMSA 3KXLA 1E5TA 5JBIA 1I9GA 4L7QA 4PN7A 1TYCA 3T54A 3U81A 3TYXA 3N75A 1I0IA 3QVVA 3TRJA 3LC1O 4B4WA 2GWRA 1GL9B 4PYOA 1M54A 1K4YA 2EZ4A 2F3SA 3IVCA 2WD7A 3A6FA 4MJXA 3AIOA 3GLSA 3IP6A 2WC1A 3MMZA 3ZHZA 3FBGA 3VAZA 3ICEA 4MVJA 5FPKA 2OZPA 5AJTA 4PCLA 1EFRA 4NP6A 1Q16A 4P53A 3TGLA 5K0JA 3VNAA 1L7MA 2AFIE 4L5BA 3HDHA 1YR6A 4JQCA 3VFDA 2WI8A 4EPWA 4F38A 1FRQA 4MV7A 4FMBB 2IJGX 2J3KA 3PFBA 4EQ6B 2WNHA 3ZNNA 1W4CA 4OBWA 5CB4F 3W5BA 1B16A 2GYYA 2UZIR 3ESXA 1SD5A 3HFGA 5DXAA 1AKTA 4QREA 1KRWA 3OZFA 3SQOA 1R4NB 1EJ2A 2F9MA 3O1JC 4B2LA 3LTNC 3CNLA 3R3UA 4YCBA 4MW9A 1BWQA 1GTG1 1U2DC 4XUCA 5G0WA 4A73A 1AS2A 3G2IA 4XB2A 2PGLA 3GVPA 4KSCA 1JBKA 2WSLA 2YNMD 4LKRA 5H0IA 1Z36A 4LYDA 2QX6A 1D1SA 4JB8A 4F6RA 1H3EA 2JDIA 1JALA 3K15A 1KQOA 4KIFA 2I2XB 4RFLA 4W9NA 1EAMA 1Z4JA 2X13A 1F0PA 5FI1B 2H92A 3AF4A 1DKNA 2SKDA 3G1WA 4WADA 2IOFK 3THYA 3LG2A 1ZJWA 4MGEA 2DLCX 1I0ZA 3LWZA 1TW3A 3KKZA 3WWDA 1Z12A 4CLOA 4H4DA 4ES6A 1PYOA 2PWZA 4WZAB 4CYMA 1IDOA 1HYHA 2ZRAA 4L4ZA 2JCGA 3ETJA 3GA5A 2V6FA 3L0OA 4WEOA 1ODLA 1MLDA 4A0QA 2XH8A 4TV9F 2C92A 4WLUA 4X7PA 3GLIA 3JPYA 3AKEA 5AVJA 2HIAA 2OCXA 5EP4A 4BCDA 3JD1A 2HWKA 1VG9B 5D1NA 4ED9A 2X15A 3TGWA 1DAMA 2BCJQ 3K5IA 3STWA 3CF4G 1T1JA 3NRCA 2AG1A 4G23A 4PBRA 3F6CA 5C7IO 1Z8HA 2B34A 1FRNA 3BSSA 4H3VA 2VNAA 1F4LA 3F3MA 4MKIA 5AKIA 1I3CA 4BKRA 1A8IA 1PFQA 2PL5A 3EG9B 4YRDA 4UQPA 4HEJA 1UUFA 4B3JA 1E2NA 3A1NA 3AO0B 4LOIA 4ONEA 1F5NA 5FBQB 5CDGA 1NXOA 2BBTA 3HJRA 3KAJA 4BN5A 4BFWA 3IUJA 4C06A 1DDIA 3QOFA 1ADFA 3R6WA 2AZXA 3U9LA 1PKXA 4IL5A 4R40A 5DTQA 4KUEA 3R76A 1JAIA 2YV3A 2FPGA 3QEMB 4G5HA 4P0QB 1HF3A 3OOEA 5JZMA 2Z30A 1GPJA 4RANA 4D9KA 2JCBA 4YO8A 3S7TA 1K7CA 4K5QA 4AZTA 1PFYA 4J0JA 4FILA 3ZZMA 2D0IA 4EHLA 3M49A 5CA0A 3A14A 2DP4E 3UG6A 2QRMA 3LECA 1KAMA 1PGOA 3H5RA 1N4DA 1OA0A 2FUCA 5A5GA 1EXNA 2JAUA 4Q7QA 5CEFA 1AJEA 2JIOA 2OHXA 3R5FA 5AJWA 3H2JA 1TW2A 3H1AA 4I5DA 5LCXA 2OSBA 2BWJA 1C3XA 1H1TA 2C7QA 5IMBA 1N2CE 2CXHA 5H5JA 2OESA 4F4FA 1I2ZA 2I1WA 1N6KA 4HB0A 4IOMA 1NHWA 3Q85A 4HVAA 2G82A 4JJ6A 3TZHA 3NJ4A 4QTXA 2NZ8A 4IIYA 1BXKA 1MFPA 1A1VA 4QYWA 4D82A 2DWCA 2NVUA 2A9OA 1UDBA 2PEYA 3LYAA 1JG1A 5HMMA 5A5VA 3OTWA 2AOTB 3ZDCA 1MJFA 3ZIUA 1NNEA 2ZRQA 3PEWA 3QNWA 1FUUA 2ZM5A 1GDTA 2O8CA 2XOXA 3V8QA 3LQQA 4J29A 1DJQA 3T7KA 4EITA 4W9MC 2X14A 3E8XA 3C0KA 2YMQA 1E1DA 5DM70 1SCKA 2VP5A 4X1YA 1J5EB 3GVCA 3G2QA 3H7AA 2GXUA 1QGYA 2PKCA 3KQOA 3VR2D 4WDRA 1D8AA 4KG7A 1ONSA 3VMMA 3LZCA 5IABA 1YRLA 4OP2A 1EI9A 4LHEA 1M7GA 4FN5A 5A6SA 4LISA 5KJCA 3HLKA 4O63O 3RAEC 3WLAA 1JLSA 2NYVA 3ADPA 1JQDA 1EIWA 4HGZA 2OWEA 2XDYA 5LZ7A 3DEZA 3TS1A 1E5XA 2BGUA 1DC5A 2B5OA 1PFUA 3ZWWA 1QRRA 5TEVA 4YAKA 4XOUA 3BBPA 3T61A 3UMGA 4Z1OA 2TYSB 2AJDA 4KWEA 4EUKA 3ST7A 1W44A 2CE2X 2VHTA 4G9GA 1FX1A 3GDOA 1KYTA 1R00A 1KL7A 1I1QB 2PT5A 3GVHA 4JT9A 1EDBA 1P2UA 3KSZO 4JLMA 4W63A 4CT0A 2JKYA 3KLOA 3V4VB 1KJNA 4GEKA 4NBRA 3C15C 2R47A 3ZY2A 5EKUA 3CTMA 3M1YA 4X7MA 2V8OA 2AFIB 2W4QA 2OCIA 4WE3A 2VZ8A 1SY7A 3I1JA 1B2RA 1XNGA 3VNBA 4FW8A 1AOXA 1NNSA 1GNRA 5CK5A 3ZZTA 3V4SA 6NULA 2F8LA 2DBRA 3DDCA 2O7QA 2JFZA 1VXRA 5AJHA 1PZXA 1UMDA 3A6ZA 1QQ7A 3NH6A 4GQBA 4L07A 1YZVA 1WXDA 2JFUA 1KMHA 4W9RA 3DZHA 3F7NA 4P3NA 2ZSUA 3F4LA 1NDHA 3NUQA 4LYGA 4NEHB 4US2R 2I9KA 2ZBGA 3FSGD 2Q28A 4TV9A 1T4CB 1G21E 2NOAA 4YX9A 4BZZA 2IHTA 2IYUA 3NBAA 5L53A 5H3CA 2QNBA 5E7MA 1OU0A 3QKSB 1ZZGA 3D7LA 1MENA 1GGNA 4QVIA 3D4NA 2KWIA 4LJYA 3DMYA 1R0XA 4NNJA 4CVNA 1DWPA 3CF2A 3E3LA 1KBZA 4LMPA 2ES4A 3IR7A 4BCCA 1I7DA 2OORC 3K1JA 3I2FA 4O08A 3FOCA 3THSA 4DLVA 1IHPA 2GN1A 3O4GA 3QFSA 1IZ9A 1ULTA 1POXA 4M36A 4RIGA 1O6CA 2FJPA 4N65A 4R1OA 4BWVA 3B53X 5LQUA 5JZVA 1FCJA 1W1IA 3K4HA 2BUBA 4DQKA 5KREA 1Z13A 2A3RA 3QX7A 2V5UA 3TEMA 1U9IA 3VV3A 2CNBA 2G1UA 2PD6A 4L27A 4CCYA 3O4JA 5ALWA 3R3YA 2JIRA 2PZJA 1ZO8A 4KPGA 4LNUA 1W4AA 2QD3A 3Q1LA 2EQAA 4PAOA 5C8VA 4MQ6A 3GLFA 3WMEA 4ZCTA 4L4UA 1QPGA 2I03A 2V5VA 3AVXA 4AKGA 3T9DA 4EGJA 1KJJA 5E3JA 4DLXA 4UZEA 4AKEA 3DNFA 5ICMA 1Q3TA 2YKGA 1J5XA 2P2GA 4C5CA 5B1EA 4PRKA 4L3WA 4MIEA 1B6RA 1JR3E 3QKSA 1H0SA 2QTRA 1DB3A 2IZ1A 2XYHA 3PIRA 1PR2A 4OF4A 3ZJ5A 5MFPA 4LMBA 1SXJD 1Z6GA 4F9EA 4LFBB 4JKOA 3PQFA 3U40A 2W2PA 3SQMA 4BQFA 2FMTA 2ZP1A 1J21A 4YJHB 1IJBA 4BXOB 2JI9A 4R16A 1KORA 4DNOA 1DTWA 3GEDA 3HCCA 4ZIRB 1N4AA 2DX7A 2VRCA 2QL9A 3AVPA 4F8YA 1P72A 3AJ8A 3C16C 1Z5OA 1F8FA 2RI0A 3F6RA 4NRDA 4GI1A 3IKJA 2YRFA 1PJ3A 2C2MA 1FSPA 2C94A 1QTIA 4EY8A 4ZCQA 3O2NA 4BNHA 3L4BC 1BEZA 1KH2A 4TUYA 1XI2A 2WTXA 2O8DA 1U8TA 3BAFA 1M0SA 2F2TA 3B3AA 1HURA 2X42A 3CN7A 3EDQA 4C4OA 4BEBA 1F38A 2YJGA 5E3HA 2FUEA 2O2YA 1CUEA 2JA2A 4FYJA 3IIKA 2QIOA 3EVNA 4PX9A 4UEKA 2ZAYA 3WOHA 1ZGZA 3LY7A 3N8GA 3EGDB 4J0QA 1DBIA 3U1TA 1JRLA 2CMFA 3EWAA 5ALMA 2QX7A 2OO5C 2PH7A 4RXMA 5BNFA 4D8VA 4OH1A 1YB5A 3A1DA 3WGQA 2C1XA 1L5OA 2WICA 3NOOA 3SK0A 3JVIA 4IIXA 4LF5B 9LDBA 1WHSB 4UTPA 1VXOA 2H1IA 4OXXA 1EK6A 3I8OA 3O38A 3CLRD 3QYJA 2P2LA 5AVSA 4HB3A 4JJ7A 4OBBA 5DNVA 3W5UA 4D3SA 2PS0A 4QXMA 4UC0A 3U7IA 1PZFA 1ZNZA 1PVDA 2PJZA 2Z95A 5TX7A 2TMGA 3EZ9A 5I7HA 3HJBA 4B6OA 4BTVA 3WK8A 2BGRA 1P7PA 3PUZA 4P4SA 8MHTA 1AKRA 4P2BA 1IXSB 3E03A 3EA5A 2Q0QA 2ZU6A 3R6TA 3QF7A 3I28A 4OK6A 1N0WA 4ZA2A 3W2FA 3ZR4B 4F2HA 3K70B 2DC1A 1DAFA 2HHJA 3L1UA 3PNPA 3TOSA 2ZYAA 3ZHXA 4MVJG 1TYZA 3AFHA 3Q11A 1KARA 1NDQA 2HMAA 2P7IA 1PJ4A 3R77A 1II8A 1T26A 1Y6QA 2WWFA 1DQSA 1GTL1 2C8VA 3K7EA 1U5AA 2ZSAA 3PYXA 4J75A 5ALLA 1KK3A 5KMGB 5GJBA 5B1IA 3TIGA 3WGYA 5AI0A 4ZAYA 1E6MA 4BMPB 2GHTA 3N8HA 3QPWA 1ZN2A 4F93B 1L4HA 1CETA 3SPXA 3LU1A 1PN3A 3DOOA 1HQCA 2I66A 2WVGA 3EPRA 3PFNA 3SXPA 4AJ9A 1CQPA 3DXXA 2YY5A 4EG6A 4PX2A 1IJFA 1WM1A 3OTGA 4IDFA 2WIBA 3AV0B 5AI9A 1DUSA 4UEJA 5DP2A 1AX9A 2PMDA 3G5MA 1CP3A 1SHJA 5EXEA 1FVXA 2HLDA 2A1TR 4FEEA 1FJXA 3T12A 2QB5A 1G21B 2VH5R 3PJGA 3IILA 2WHPA 3NHMA 4MYSA 3L41A 4MW6A 4PGFA 1ISIA 3DW1X 3I6ZA 4H9GA 1LFDB 2EFHB 1YR1A 2I1VB 3QPCA 1KP2A 3JQEA 3RABA 1NW5A 4AG3A 4KWHA 4Z4HA 2RIRA 2X8JA 3M4YA 3IVMA 1WCIA 3LTEA 4HLQB 5CX1A 5L6MB 4MI3A 5DHUA 1PTKA 5LD2C 1DAEA 4ARZB 4CUKA 3FJ1A 4G26A 4IMPA 1G9TA 3VO8A 2CUTA 4FMDF 5AUOB 3RQSA 1YL5A 2GILA 3BMOA 3PC3A 2E85A 4UNSA 4F84A 1DBQA 2VK8A 1X1TA 1MRZA 2A9RA 2RGNC 1P44A 1LSJA 1PZMA 3KKNA 2X0DA 3AI3A 10MHA 1OWLA 3TJZA 2HD4A 1KEWA 1RADA 4PR3A 4Q3EA 1B42A 1U9ZA 3B60A 2D1YA 3CRNA 3T34A 3PHIA 4GOND 3A27A 2FRXA 2IYOA 4KK3A 4M6WA 3QOYA 1W1UA 2I6FA 4I55F 4XE5A 1P39A 4V0MA 3UATA 4NOKA 3SC2A 3UJDA 5CEJA 1M83A 4I3FA 1IZYA 3E9MA 2Y0DA 2X8WA 3WADA 1IXRC 3TFOA 3E35A 5BWBA 3UWSA 1BMQA 4Q93A 4G6ZA 5I5EA 4OH7A 1TU3A 4MV9A 3TW8A 5JDIC 2POCA 5DP1A 1X0XA 3F74A 3KVYA 4WI1A 4BGVA 5IU6A 8ABPA 2PS1A 1JG7A 4ZXFA 3U6BA 3WA6A 4DV7B 1V48A 4PAMA 4X85A 3VR5A 4F3TA 2V7XA 3ABZA 3I3OA 4JT8A 3F73A 3I83A 2ST1A 3MWYW 2P4UA 5AICA 2MSCB 2VDQB 2ZBFA 2FZLA 4K9DA 2VDMB 1YO6A 3COZA 4ZVPA 2X2OA 1O94C 2IWHA 4D7AA 2DT8A 1N2ZA 2FVXA 1U8CB 2P5TB 3CJTA 2TRSB 2PKWA 3HB9A 3PFFA 1TX4B 3DGEC 4FHCA 4IMRA 5JLAA 3ZLUA 5KO2A 3OP4A 5DHAA 4FWTA 3T3GA 3QVGA 1WW3A 3UB2A 3PR1A 2B4RO 4BWFB 1GNLA 1Y9ZA 5DW0A 4W5NA 3ORSA 2W58A 4LYAA 3KQVA 3KTDA 1Z6YA 4QQFA 4YRQA 4RFSB 5AK4A 4LY9A 3WLFA 3MS4A 2XAUA 1FB5A 4EHNA 4H1HA 4JQYA 4B1FA 1UWKA 4LYJA 1XIVA 5LPNA 3X1WA 3QVUA 2JC3A 7REQB 5DX1A 1U3DA 1F2UB 2XB6A 4A6PA 5IX8A 4KQKA 2CWDA 2IZZA 1LJLA 2K5UA 5DB4A 5E2BA 2ODNA 2VEOA 2YHUA 3GT7A 4V38A 1IB6A 3KSMA 5E2AA 2VQEB 3VJRA 1PF7E 4OFXA 4YRZA 1RI3A 1XEXB 1UJ5A 1UJ2A 5KKNB 2ZB2A 4B5LA 1KYXA 2XNDD 4O0MA 2IV2X 2Y27A 3PSHA 1Z75A 5I9BA 4B8WA 2R1ZA 2AVNA 1C80A 5JFOA 1K98A 2WJ4A 2Y4OA 4RJTA 5MN5A 3V8VA 2HBRA 2C3MA 3CYFA 2G72A 1IYZA 2WWTA 4N6NA 4DM4A 3EQ6A 3TLGB 3GXOA 4DPKA 2J9FA 3QBTA 4TVSA 1VE6A 2XX3A 1GCAA 3M9XA 3V2UA 3SMQA 2UAGA 2ZPUA 3HY3A 1L5HB 2BFAA 9LDTA 2PUHA 1YL6A 5DYYA 1E1KA 1KOGA 2FU5C 4L57A 4S12A 4MZXA 1DU4A 1U81A 1P2DA 3QLTA 4D92A 3CX8A 3AR7A 2XQJA 3LF1A 4I8IA 5A0FA 3HKEB 1C3EA 1L7BA 1U6KA 3JQFA 4G24A 4EY7A 1DUVG 5I4CA 4R2XA 4LAFA 4DSNA 3K2IA 1P18A 5KYYA 4NQZA 2QTBA 3BIXA 4YJ2B 5DM4A 5HILA 5IJZA 5JS1A 5IDYA 3Q88A 1DUIA 2Z6QA 1P4GA 1DKMA 4II3A 4ZOQI 1IN4A 4F5DA 1QVWA 3K0AA 4EZEA 5LMNB 1YIDA 2ZVQX 1RRCA 4D5EA 4P82A 2OHOA 4ZALA 4R7TA 2AOUA 4X3PA 2XUPA 5CYOA 5A9SA 2PUGA 2VDNB 1Y3DE 2WP8J 3C8UA 4DDTA 3BXHA 3SHWA 4CN9A 4X66B 2ECKA 1G3MA 3DTYA 2DULA 3D6HA 4R6XA 4G0ZA 4UZFA 4RZIA 4BZQA 3ZDEA 4YLYA 1WF6A 3ILVA 1P9RA 3K0CC 1XP5A 2X8AA 4DFDA 2JHPA 3CG4A 1BVYF 2EKPA 3ED5A 5B2ZA 2RI6A 2VXYA 2VP3A 4RZSA 3ZCPA 2QTWB 3E9ZA 4X9XA 5FWXA 2OXRA 2OQVA 5CA1A 3N0XA 1VHDA 1ZG3A 2WUWE 1Y8RA 2DHCA 3KYJB 3ITEA 3N86A 3A04A 4LY3A 1VIMA 3SZGA 1AF7A 4I55A 5AVQA 1Z0SA 4PG4A 4BRUA 1FUEA 1HQKA 1Y7HA 4ER6A 1V1JA 4B09A 4W5TA 3ABQB 3GDWA 3G2HA 2A9JA 3F4KA 4AROA 5EP3A 1E9RA 2HOQA 3OZGA 2PZFA 4JR1A 4M3NA 4W99A 5A3JA 1MO5A 1Z8NA 1KOLA 2EOAA 5CLFA 1RPAA 2JNWA 1PK9A 2YHIA 3B1WA 3IMKA 3S29A 4IZOA 1YMQA 3RADC 2JF0A 3GH3A 3OHPA 2C3PA 5FUYA 3HVUA 3JD4A 4CLRB 1RXCA 2I6QA 1H23A 3H9UA 3FPEA 3TXAA 1O89A 4O59O 4B44A 2CDBA 1ZOSA 4H1VA 4J7AA 3OF5A 5MN4A 2IYWA 3QY9A 3PC7A 5ICSA 2IE0A 2WUVA 4E5SA 4AJHA 1PTJA 3G59A 5JSHA 1CJSA 1GLVA 3G8DA 2L2QA 3N59A 4JLDA 2O52A 4IVNA 4LDZA 1NP6A 4FCTA 4U2GA 3UV6A 4UHJA 4HV4A 1XMPA 5FUMA 2VXOA 3KOZA 4JUDX 1AQJA 4Q6WA 4CBVA 2HFKA 1CS4C 4M7OA 5HMLA 3SZRA 1DX4A 1E6LA 1XNHA 4AAYA 3PQEA 3LFTA 1LWNA 4BKMA 4OL0A 4FR0A 1HDXA 4ZCSA 4QGBA 1D8TA 2D13A 2ZT8A 1SKMA 4ZANA 4NWIA 3WLIA 3MHTA 1SWWA 1C1XA 1GA4A 5KWSA 4PC2A 1Z6ZA 3IBSA 1P6XA 1O0BA 2H51A 4NZ9A 2B7BA 3QOXA 4KUGA 3TLBA 4A0FA 4CZ2A 4D9CA 3D1VA 3NP7A 2XIQA 3SNHA 4U1RA 1T3LA 2NWQA 1PDVA 4GIBA 1IN7A 2C20A 2HPVA 4LWZA 2WRZA 3CO0S 4Y98A 4DJAA 4HJXA 2IF0A 2JZCA 4WGFA 1FRZA 4PLPA 1RQ7A 1BHJA 2H7CA 3UC5A 1BZYA 3KQTA 4ECAA 5HR5A 5C4GB 2FEMA 2YY6A 2YJ5A 3GQBA 3VSDA 2D0DA 3E23A 5BOVA 1MX9A 5ER6A 3X1MA 3AG5A 2IBSA 1N8SA 1P1IA 4W6ZA 1SVKA 4D26A 2ODWA 1QBGA 4MP8A 4LJLA 5KNLA 2ET6A 1NUSA 4L0DA 1RM0A 2XYPA 4YT5A 2UUAB 4K6HA 4IGFA 3GAAA 4UARA 3NLLA 3WMWA 1A82A 2ORVA 3BS4A 3RU2A 3OFSA 1WMSA 1KDOA 3VOSA 5HZHA 1T0HB 3D4LA 3QQ5A 1ZI8A 2DH5A 2GZMA 1A4UA 2GHRA 3HKDA 4GFDA 4NEGA 2P2CA 3CV3A 5IT0A 1GRQA 4RWZA 1U1DA 2ZYTX 3RIYA 1OAKA 1QGUA 4Z1MA 4P58A 5IVDA 3TQHA 5FKJA 4C08A 3DVAB 3ITKA 4ZP1A 4UQLA 2ABWA 3AUKA 4D56A 3SS8A 2P1DA 4OHRA 3HI4A 5LWHA 4H08A 1D7OA 2UUPA 4MW2A 2XTNA 1VFPA 2ZYGA 2ATIA 1S5PA 2DFTA 4BX8A 1NRIA 4PQFA 1XX6A 3T7AA 4MUEA 1JXQA 1SB8A 1L4UA 1UIRA 4TLBA 5JT1A 3JWIA 2PKQP 4G8DA 4DL9A 3HXOA 4DA9A 5HRCA 3I05A 3AKDA 5K3DA 2D5CA 2B3TA 1WUJS 2FPLA 1WV0A 2WFLA 2VTDA 3MMPA 4L3OA 4D9HA 3G0BA 5MGNA 3UW1A 2O3SA 1IQUA 1C7FA 2Y77A 1FFCA 4LRXA 3S1AB 1RRGA 4F91B 2NUBA 5BVGA 1MJHA 2PS3A 4MV3A 4PQRA 4ZRDA 4XGRA 1TZJA 2EKZA 2O5RA 3GHYA 4IIFA 3K5WA 4PONA 5CM9C 2QR5A 3ZK9A 4B74A 4QYTA 4N8EA 2ADOA 4R84A 1PV1A 5DX0A 1JFFB 3IVRA 1WW8A 1JBEA 4H31A 1OFGA 3LY9A 3AUFA 2R6ZA 4IIUA 4JYBA 5JEEA 1QH8B 5FUXA 1JJFA 1QWOA 2VJPA 3A9RA 5G0VA 5JV5A 1CR6A 3CY6A 3E22B 3L02A 5KSPA 3EQ8A 3FPFA 4HN9A 4E4TA 1E2BA 4F86A 4HWTA 3F8WA 3A9CA 2YV2A 2H5JA 2WNIA 1ONNA 4JJAA 3ZI7A 1KFKB 1DAOA 3B9PA 4OHKA 1ZW6A 3ZGOA 5CCXA 1YOVB 3OCYA 4IXMA 4AG5A 3C48A 5JARA 3ONNA 4Q1FA 3ADKA 2ZBEA 2C7RA 5J23A 4KIJA 2EQ5A 3HWRA 1ZOIA 4PPGA 5A4FS 3ASZA 1DRJA 4HGQA 3NTVA 4PPYA 1KU0A 1P2SA 3EW7A 2XB9A 2ORED 1PQPA 3KV1A 3NUZA 4GEGA 3DHWC 1GSHA 4FTWA 3WMFA 3KX2A 2R4QA 3ROQA 1JLRA 2YZMA 4MICA 5IM4F 1GCGA 1DIBA 3FNBA 1L1EA 1Y8QB 4OXYA 1E2IA 4BNYA 1WNTA 3FMPB 3IO5A 1O8BA 4XDYA 2EL7A 1E6CA 3GP8A 3DHVA 3H5OA 1W2HA 1XQ1A 2CVZA 5J63A 2C4MA 1X7XB 2XCIA 5EIBC 4Y0AA 2C9BA 2X7JA 4C6HA 2HF7A 5TDHA 5A4DA 3PFKA 2V9PA 4TPKA 3P32A 3T1HB 4G0WA 3KTOA 2X41A 1IZ7A 1PWXA 1YS6A 3CEJA 3ABRB 4D74A 2P3LA 1YCDA 3E3AA 3OO0A 2ENUA 4PO3X 4D3YA 4P32A 1HE4A 1V39A 4O4LB 1R37A 2I29A 2DUJA 2R00C 3LWDA 2WHQA 5ERGB 4F6CA 2BYTA 1WUYA 4QODA 2QUZA 1Z0ZA 2CV0A 1UL1X 4HDNA 3W5HA 3SDBA 2VZEA 5KHLB 4M7PA 3T0FA 4EJSB 3KB6A 1FF9A 1I4DD 1LQUA 5JO0A 3VTKA 1BAPA 2FPMA 2ZE8A 1CF4A 3QE3A 4OQQA 2R7LA 3PUIA 1UMCB 2CXRA 4MKXA 3PXAA 4CKEB 3JQAB 1TECE 4PSDA 3S99A 3STHA 3RC3A 5AI4A 5FPYA 4LJ8A 5JAZA 1JU4A 3V1KA 1MVLA 4RPCA 3B5EA 3AB7A 4WVFA 1CUDA 2HSZA 2R7KA 3AHFA 2DETA 3FLAA 1A9QA 2WTEA 4IM7A 4WINA 1AE1A 3P0JA 3PRHA 3ZOZA 4TTVA 1FUIA 4BVAA 4CM4A 2H1VA 5M29A 1YRWA 5K0BA 3FAZA 4D9MA 4EVQA 1KO8A 2B7LA 4FIDA 4HQRA 5DIZA 1JG4A 1QH1B 4YCLA 3O1IC 3QBEA 3UJ6A 4P7FA 3QEBZ 3O4FA 4KSBA 1OYOA 1BMDA 4G4SO 4YI3A 3UV7A 4Q9NA 2HRCA 1SU7A 3Q1KA 3PQ7A 4IR7A 4LI3X 4UASA 4PSAA 4Z7OB 3CRW1 1XO1A 3DA8A 3O8RA 4B8ZA 5I8PA 1I0LA 3L93A 3JQBC 1QRTA 2BEVB 2XEXA 1KH3A 4LF4B 1A8PA 3PVCA 1YZTA 4OHFA 4YRIA 1A5TA 3IALA 4C1BA 1DP4A 3I4LA 4TSFA 4BO4A 4TQUS 1W5TA 3BB3A 4N9QA 2G71A 1N5MA 4QJBA 3O8QA 4HAOA 3TNDA 3UJCA 2GM3A 1A2BA 2A0WA 2AG5A 1ULBA 5G0SA 1HNXB 4ON9A 5C2JB 1SCAA 3D4IA 1OKKA 5JCZA 1CB0A 3DFUA 1DBVO 2RONA 3CUVA 4FYKA 4P2GA 4KQJA 1F2TB 1THTA 2EZ9A 5HFJA 1BA3A 1NQ5A 4PG7A 3R8FA 5JMPA 1V43A 2YRXA 3U9TA 1QQBA 2PUTA 1P5JA 5FB3A 4R6WA 5E1MA 2WE8A 4YI5A 4KXQA 4BX3A 4AL4A 1T8UA 3MVEA 1U0OC 1SPXA 5IH3A 1N3BA 1BWSA 1NLZA 3LP8A 4JVSB 2FPIA 1QE3A 4LXUA 1Z7BA 4N03A 3WQHA 1V1MB 2FMKA 4QYIB 1FS6A 3FRJA 1LV8A 1R6BX 1VG0B 3WA7A 3KK0A 1VRVA 4U7DA 5CR9A 3H75A 5FNZA 3BMCA 2IT1A 2ISQA 2V6BA 3JQCA 5LQMA 3D6FA 4BBPA 1KXJA 2Y4NA 3TKLA 2QPOA 3KXKA 1J2RA 4GI5A 3R0VA 3WRYA 4BB5A 5DGDA 3H2HA 3QF4B 1JYEA 4NE7A 5CPBA 3IYLW 5ALNA 3U4AA 2CDAA 4Q3OA 4GOOD 4ESEA 2VCHA 5FI3A 3GD5A 1KZ6A 2R4UA 1W75A 4GGMX 6YASA 2WM2A 3ON5A 4LBYA 1P1BA 1Z74A 3ES9A 2OB1A 2EJCA 4MRNA 4WXYB 1VP9A 4Z3KA 1WNFA 3EXFB 4UOQA 2M6KA 2P91A 3AW9A 3U19A 4OOEA 2PD3A 1S8NA 2QZ9A 2XZLA 5K8CA 2ASVA 3DE7X 4I1YA 4CM5A 2Q3HA 3GFRA 1S1MA 2XWQA 2XBLA 5B58C 4ND4A 4Q9KA 1PIWA 3DMTC 2IYVA 2XITA 4PGHA 3WTBA 4Q1AA 4BX2A 4DOMA 5KYUB 3EW9A 2HR1A 4QOJA 2ZI5A 3AW8A 4KE8A 4IF6A 1VCNA 2DG2A 4CMCA 3JPWA 1NR7A 2I9PA 3H2SA 2FEAA 2W2KB 3OM1A 2JEOA 5L8VA 1HYGA 2FK8A 3HHPA 1ZGAA 1WXGA 4PO1A 4UNPA 5AKKA 1U0BB 3WL7A 1EWRA 3N9IA 2C9DA 4DY6A 3VU9B 4L4RA 1DVRA 4Z86A 2OBNA 1R4MA 3EZ6A 1AZTA 3KVVA 2XQKA 3MOIA 5FUBA 5FR2A 2H00A 4NBNA 4UTRA 2Q4RA 4DVGA 2RB4A 3OHSX 2C1ZA 4DCMA 3NHAA 4DJ5X 1A8UA 1K5DA 3TZ6A 2AXPA 3S40A 4KGVA 4MA4A 4EJ2A 1G5IA 4KW7A 4KDCA 2P78A 3RFUA 5M34A 2HCBA 3GBPA 3CUEF 4XSGA 6LDHA 1UBKS 2AG0A 3NIFB 2TMYA 1G2QA 1PW5A 3EVGA 4B3RB 3ZNOA 1WAMA 2X9VA 5M7EA 1Y6FA 3ZS8A 4F1WA 4R1TA 4PNPA 1RZVA 2FSVC 4MWTA 3WY9A 2CUZA 4HFMA 3VTAA 4Q05A 1PJZA 2J3LA 1L5MA 1HG0A 2RHBA 4PTLA 7GPBA 3HA5A 5HKBA 3B78A 4FX5A 4Q0MA 1NATA 1O57A 3EF0A 2RKWA 1EP1B 5HF5A 3NAQA 1KBOA 3FR8A 2ZUFA 2I2AA 1XKLA 1TEZA 1MMFB 3KKEA 3AVTA 3A6DA 2CXUA 4PR0A 4WCDA 1MOPA 1WR8A 4BEJA 4BIMA 5CEEA 1PWZA 2NO0A 1OBFO 3D0QA 3PF8A 4JLPA 4K3VA 3TL3A 2PH1A 4WH0A 3GOQA 1FNCA 4WFKA 4CDNA 1NASA 2BN4A 3PIIA 4HDKA 1RWMA 5GGYA 4G36A 2PAFA 1YS4A 2HM7A 2PQMA 4WUVA 3S5UA 3V5NA 1XZBA 4N6OA 3GUYA 3B1FA 1YZKA 1RYNA 4IDGA 4JLWA 2V7WA 4PPNA 4QUDA 2VJMA 1H2AS 1Q14A 4WL0A 1KZHA 2R60A 5SV2A 3B7PA 1QIIA 1V8BA 1QYIA 2PEZA 3OLWA 2PRJA 3ZVMA 3NWJA 3RS7A 3GDGA 5K8UA 2FA9A 1U0FA 3FNIA 3ROZA 4PLZA 1W4BA 4RA9B 4YQYA 4EG4A 1UFRA 3J81k 3KWJA 3SLRA 2DWOA 4PC1A 5M04A 1R6VA 2ID7A 2ZJ3A 3LI2A 1FU7A 4I6GA 3G5AA 4ZPXA 3LGXA 3RG8A 1H1LB 1M1XB 1SM4A 2W6NA 3PEFA 4MVJE 5K9ZA 2HMWA 3B20A 3OZAA 4KYTA 3KT3A 4DABA 3CM0A 1BYIA 4NXNB 1PNOA 2GKSA 3A4TA 3C5HA 1OLSA 1RI2A 3CKMA 3GPDG 1SH7A 2PQ2A 3IUYA 4V0QA 4ZMRA 5LYJB 1U8EA 3RRMA 1T0BA 4YJ3F 4C3VA 4UHFA 5HDQA 1M2EA 4TZKA 3VI4B 4EHFA 3RSQA 3VGPA 4OHZA 4FEAA 4ESOA 2XI4A 5EE3A 4DMHA 2VA8A 3ED1A 2LRHA 4JOBA 4Q4AB 4V0RA 3GMDA 4PZ0A 3RRYA 3C2QA 5A5DA 2VH2A 3INTA 2C95A 1G5TA 3PR2B 2O07A 3CLUD 4FWBA 1SBHA 3QWAA 3NM6B 1VPEA 4TTPA 1QMGA 2P9HA 3OCCA 4WNAA 4C7OB 2Z4RA 3ID6C 3PCRB 3IPLA 4Y6PA 1KIAA 3EFOA 2Z2IA 3ZI4A 2PIDA 4LGYA 2RGUA 3K35A 3VR1A 4A16A 5IJ9A 4GF5A 2A9FA 2N3ZA 4BBJA 4BEVA 3LW8A 3HI6A 3IDSA 5LN1A 4N12A 4TKVA 2Q6OA 4TVKA 1X19A 1ZUHA 2P40A 3ND8A 3F2IA 1MD9A 1N7JA 3A1EA 4R01A 2OAEA 4MV0A 1WL8A 3AXSA 3QU4A 4RJIA 4WXEA 2Y6VA 3DKPA 3TO5A 1M5RA 1Z7EA 2IZ7A 2G83A 4KR7A 3GLIE 2GCIA 3OPMA 3W5AA 2KX7A 1ORRA 3WXMA 4NAUA 3P19A 4HNUA 1OX4A 1NN5A 1DRKA 1EINA 2AEEA 2HPHA 3S4YA 3TSWA 3EXAA 3IQWA 3VHXA 3MCVA 4E88A 3AEUA 3VX4A 1N92A 2EG5A 2WYIA 1VKOA 3ZYZA 2PSJA 3H18A 4BZPA 3BIJA 1Z5ZA 3UEOA 1LQTA 1VBNA 4BOYA 4B31A 4U3JB 4A0GA 4QBTA 4KCGA 4BQQA 1XQ6A 4MJ3A 3LSYA 4DIDA 3KCQA 2RGCA 1QHYA 3HCEA 1EVJA 4MUFA 1N0UA 5HJ2A 2Q2VA 2WFMA 1XQ9A 1AK9A 4NS1A 3N28A 1LA2A 5B36A 3ZJVA 3VPFA 2ZSBA 2IQ5A 1KGDA 1V6AA 3KXDA 4UM5A 1NOIA 1NV8A 4BUJA 1C9DB 1FQWA 1RRKA 4ZT6A 1CJTC 4DAEA 1GAWA 4YRGA 3U5TA 2RCNA 4M99A 1Z16A 4KYIB 4S24A 4D0SA 1ZN7A 3T3PB 3WDKA 5G0TA 1PJSA 1UBCA 3PFCA 4OHYA 1E5DA 2P0YA 4LRUA 2QD2A 2Z43A 1ZCBA 2B9EA 3HBJA 4FFOA 1MKYA 3EN0A 3EF1A 1RMTA 3D1LA 3HJUA 1XTIA 4A2QA 2H54A 3D8NA 1P2GA 4HMOA 3IH5A 5JANA 2H6EA 4B76A 2ATXA 4KPEC 1X7HA 2O23A 5EJ2A 5KDLA 1UBNA 4LSWA 3GAMA 3AINA 4OQYA 3ZGYA 2HH9A 2F1RA 4CFSA 4A03A 3HVRA 3KOWA 2D54A 1NT2A 3LYHA 3MQFA 2R0QC 1X1DA 4D6PA 1VJ1A 3Q41A 1JSRA 4JC8A 4EZBA 1EX1A 1PEKE 1QJCA 1Z56C 3QX9A 4DQDA 3N39C 2PHZA 4WAUA 4XX0A 4XD7D 5FFMA 5JVDB 1GZ7A 2DT5A 2RHMA 4HQ6A 4E5NA 4ZMSA 3BVPA 4MCAA 3D3JA 2ZYVX 5A02A 1CIJA 1M2HA 1K3UB 2WZCA 5ICFA 1NF2A 2B4TO 1AHIA 5C7OO 4KFCA 3PNOA 1PL8A 1YZFA 4FZ5A 5CAEB 4JY7A 3DAYA 3DDNA 4JQSA 1SCQA 2AIRA 1YB6A 2FWIA 3AQ4A 1CQIA 2HNKA 1CJBA 2C42A 3F3SA 3I1FA 3O3CA 4IO1A 4OGGA 4YJ3A 4JIGA 2NQ8A 4BFXA 1T3TA 2JKZA 1P0PA 4KWIA 4HXYA 3WDSA 4EG1A 3ELBA 3K9WA 4ENWA 2E4XA 4HDQB 1O4WA 4NBLA 1AIPA 1U0NA 3BDVA 4BZWA 2WG0A 4M1OA 2OFWA 4WWHA 1Q3HA 2Z3WA 4BLWA 3RK1A 1ZD3A 3HXMA 2WDPA 2NVOA 4KBFA 3NS7A 1RNLA 4IINA 4N18A 2QRLA 1EVEA 1DKLA 5DYIA 3RUCA 4YRKA 3WNQA 2KM1A 3C5WP 1DRUA 4TS3A 4Z0TA 7YASA 1RI4A 4JV5B 1XTSA 4NZOA 2ZDHA 4PLWA 1OJ7A 2BH9A 2XYRA 3OZDA 1XXHA 3ZQJA 3B8HA 2WU3A 1K6IA 3DAPA 3LCJA 3R4CA 2BF7A 1PQUA 5TGTA 3UM9A 2PUEA 5IPFA 1QCYA 1KAGA 4KGXA 3RUEA 3G02A 3BFVA 2QZPA 2P11A 2ZJ2A 4JWTA 2HSDA 5KBYA 1GKKA 2YV4A 4YAFA 1OXVA 4LWQA 1YF3A 1MB3A 4MYHA 4R8VA 2WF7A 2D0OB 2FR0A 5D87A 4D9FA 1QC5A 3JTMA 4X7BA 4U7GA 3DLCA 4KI0A 1KAHA 1FXWF 4KVGA 3WQSB 4CR6A 1GTRA 1RWWA 2CNLA 5ESXA 5ALZA 2FX2A 1P3DA 2A30A 3EFBA 2DRIA 5GMOA 5LMZA 1XZDA 4RLHA 2HT6A 3JWJA 3RSOA 2D1FA 2FFHA 3HDVA 4PHGA 3ZNPA 3JQPA 3OTHA 1EB8A 2W6CX 4F6RB 1QAQA 2F62A 1T5OA 4B3IA 3Q2KA 1ISSA 5IULC 3RWMB 1Z7WA 3DDSA 5EIFA 4ZHQF 2QR2A 3LCUA 3Q7TA 4IQGA 3AR8A 3K5PA 3THYB 1L8OA 2FKAA 3OTIA 4M0EA 5K0SA 3CZ5A 2H8KA 1AGNA 2B8TA 1P9OA 4CLOB 3B85A 3KJXA 5TVKA 1G7RA 1E4YA 2EERA 2P2SA 4HNAA 3AI1A 3A6LA 1WEHA 4FYXA 4IIHA 4NLLA 4PW0A 1IK4A 1GU7A 1TC2A 1CJKC 4Z2YA 4KPUA 1EYZA 1FDUA 3E15A 5DI9A 5HBGA 4C0KA 3LVQE 3GLIB 3LH5A 1NW7A 1SKYE 4DRZA 1CUBA 4FJ2A 1PZGA 4C2TA 4JP1A 4E6PA 3COJA 3ZDXB 3BC1A 3GLFE 2R1VA 1RQGA 2GBLC 1AKEA 3ZPXA 1V96A 2BFPA 1R0YA 2ZIGA 2HNBA 2H85A 4LX0A 5A3QA 2VSNA 1ZRHA 4EB3A 1HV8A 1KP9A 2WG1A 2WJVA 2ZROA 1CTQA 3IPYA 4Z0NA 4C87A 4Z4GA 4TWRA 5A1JA 1P6QA 5IZ4A 1MAVA 5GV8A 3HXKA 1VGVA 1ONPA 4NE9A 4O1IA 2ZS8A 4UUBA 1S3SA 3CUKA 2NV6A 3I6YA 2JI8A 4MVYA 1NJGA 1CDEA 4E1AA 1ZSYA 2RC5A 3I0MA 3KR2A 3UOWA 5TF0A 1R0KA 1XD9A 3V6LA 4D9JA 3IQEA 4ZV7A 1NM5C 2FPGB 3QSGA 5IYZA 1ZY2A 3OFVA 1FFXA 2QK4A 2WIGA 1RAFA 3KJIA 1WUIS 4YAUA 3HUTA 3MW8A 5EC8A 3MT0A 4TM7A 5CA0B 5E9AA 3RI3A 4HGPA 3FPGA 1YJQA 3THOA 3NYWA 4D1YA 4JBLA 1K27A 2ZR8A 4AF7A 4TMFA 1LS6A 2CY0A 4E3WA 1WXXA 3IAS6 3BD6A 1Z4KA 3OQHA 4NICA 3OWHA 5CW1A 1SCDA 3NGMA 3QGMA 5AYVA 3SZMA 3LO5A 3HB1A 3FTQA 4KR9A 1W4ZA 1RJWA 1HLPA 4JLUA 5L3SA 1XTKA 5C3UA 3SX4A 4MQEB 2J0UA 2Q2WA 2IEIA 4MTCA 1XQYA 3KWLA 2H4JA 5BNZA 1NTOA 4KQHA 1AS3A 1UK9A 2J8ZA 3QVWA 3HO1A 1X3LA 3AUJB 2NVUB 4BHTA 1DOAA 2IYPA 2IOHA 4RMHA 1P29A 2JAPA 1H5UA 2C4KA 4KXVA 3STYA 1XGKA 5KTRA 2HHAA 4MHSA 4BPBA 4UVDA 4ER0A 2E1PA 1AXEA 4OX9B 4YV7A 2NQTA 5DX8A 3VDNB 3BE4A 2HU2A 4QJ5A 1O08A 4ND2A 3CVWA 6CHYA 2AX3A 2ON6A 3NDPA 4E1VA 3PITA 1UK7A 3TIXB 3LLSA 3E61A 3BXFA 1CE8B 4X1YB 1UMBB 1Q2UA 2EFGA 2Q7XA 2ZAIA 3LCMA 3OQJA 4IJUA 5CLJA 1JPJA 3WLMA 4WXRA 2CK3A 5K7SA 1X6VA 1VSTA 1I5EA 1OFTA 1EBFA 1UKEA 1X1EA 2CL6X 2OQ2A 4W82A 4ZAWA 1GAXA 5A6SB 1E0JA 1FDTA 1PEAA 1SUEA 4E12A 1N2XA 2GM9A 2H1HA 3K96A 4ZZ1A 4WZBA 1Z6TA 3P97A 3F78A 5K2OA 2F8SA 1QOPB 1SQ5A 2NSYA 1JTVA 3IE2A 5BT9A 5HP4A 3UK6A 4OQXA 4U7TB 1L7EA 3KKMA 2GF0A 4B3SB 1ZH2A 1FXWA 1GTJ1 2DFDA 1MIOB 3CWCA 2VP2A 3EIUA 2O2XA 3G7NA 5LBTA 1Q15A 3UG7A 3BN3A 4E0BA 3H9EO 3HYCA 4IS2A 4KQGA 4R1SA 2X2FA 1W0JA 4V2IA 4KHZA 2XOKD 3JYQA 3LUDA 2IIPA 3DJFA 4GH5A 3TTUA 1E7SA 3TOCA 2OILA 3PYMA 2I80A 3O73A 4MWCA 5JCOA 4X97A 4U6SA 4M37A 5BSWA 4YT8A 3ZZ1A 1TT5A 4RENA 2PX5A 2DR3A 2OO3A 2PG3A 2YBEA 3DOIA 5ALUA 1O7JA 1UMDB 4RVCA 1IBCA 3C87A 4G5OA 3BGSA 1KMHB 3H87A 4D79A 2GH1A 3BDIA 2XMDA 2H1RA 1A9TA 2NZJA 2OMKA 2Q8NA 2ZI4A 4R8RA 1KXZA 4QDUA 4BO6A 4EIWA 2AQ8A 1YVEI 1UH5A 2JHGA 4QATA 2Q5HA 1N2IA 3A0UA 4QX6A 2AI1A 5JHHB 4FW9A 5CVEA 2QW8A 2Q21A 3JW8A 4RLFA 3L9WA 5HE9A 1K06A 3GR6A 1E60A 1C7EA 1LKZA 2NTJA 3E1GA 4US0R 4FB4A 1RAHA 4FBLA 4I4CA 4XYEA 1UDWA 1X2EA 4MO2A 4DKXA 1I4TD 3W3AD 2DHRA 5FWAA 4QD3A 1FFSA 4YRNA 4YT4A 1EFHA 1KZ4A 4HNRA 4W5HA 5A4MS 4DR6B 1ZP6A 2H4YA 2VHQA 3FYUA 4UPEA 1PNRA 4QXAA 4HRAA 3AERB 3W2HA 4CCYB 4Y6LA 3QG1A 1SKYB 2REOA 3UMBA 4AN0A 1XTZA 4LNUB 1BXGB 4N4AA 3FPSA 4K40A 4WZ6A 5KOHA 3ZE8A 3GLFB 4FEGA 1P1RA 2NW6A 1G8SA 1H2YA 4WV3A 3U44A 1ZUNA 1N32B 3OESA 2ANBA 1XA3A 3IOEA 4U7FA 2C61A 3KT6A 3MWEA 2MCFA 1BE1A 5HF8A 3CNNA 2HJVA 1H8EA 4TL9A 4G0QA 3JWEA 3T5PA 2NU7A 1OU4A 1C30B 1JHRA 2F4NA 3F47A 4V39A 3OCUA 4DUGD 2P69A 2IW1A 1BXZA 1K8YB 2REBA 1U9YA 2F3UA 2RH5A 2B1QA 2ZIZA 3LK7A 1M6NA 3KDSE 1SVOA 3RYIA 3UJ7A 4E5DA 1SVSA 1EX6A 3HMKA 4EJ6A 1ZBDA 4IFEA 1APBA 2W9XA 3RNLA 3C3EA 3L0SA 5DLYA 1VMDA 4K26A 2CJYA 3S44A 1UM8A 5FUWA 1KKMA 1I14A 3IAXA 1XK7A 1HA3A 3HCBA 1DTWB 4M9ZA 3TK1A 5DGXA 4Z0HO 3EXEB 5INTA 4C29A 4OHVA 5K0GA 4P92A 2JLCA 1MZPA 2XWPA 2W2QA 5DN6A 3RBAA 3OT4A 3DE0X 2WT4A 3E0QA 4X1KA 3ZHOA 4YAEA 2FSFA 1QV7A 3GLVA 4BN0A 3F9IA 1ZPDA 1P7ZA 2IP1A 3QNUA 3V7FA 3GHHA 2DOKA 3EVEA 4I50F 2J4FA 4QPNA 5AXBA 3P4XA 3P5SA 3P4YA 4TUYB 1ZJYA 2QRVA 3AJAA 2O8DB 1U0GA 2ACEA 2FN9A 4AZ0B 1J8VA 2OSVA 1G9SA 2VUUA 3OIDA 4HFJA 4KSYA 4H0CA 4DLWA 2HDHA 3ADOA 5DSXA 4KRYA 3GUUA 5JWHA 1S89A 3LO8A 2OOKA 5DHRA 3FWPA 4PTYA 4MDHA 2BOVA 2GRAA 3FNQA 1ZM9A 2H2FA 4ZCRA 3VNSA 1YZNA 2GZRA 4OV6B 4H27A 1XLTC 5EVCA 2QLTA 4YUVA 4D80A 1TTTA 3QWBA 4OI2A 1V5WA 2FZGA 2FPPA 3F49S 2XUIA 4RTJA 1WG8A 2C4HA 3K1YA 3M9LA 5EXPA 4O25A 3HCOA 3KSBC 3WP1B 2E49A 2COEA 3M6LA 1J33A 2HI0A 2HLPA 4LKOA 3OTQA 4ESHA 4Q18A 3UHOA 1QGAA 2BGLA 2AZDA 3WHPA 2IZ5A 5U4QA 4ZGWA 1UPCA 3NHFA 5EOVA 3VU3A 3NBUA 2R97A 1TB4A 3BH6A 4BNFA 3H8WA 5D85A 1A2KC 1Q1QA 2O06A 3CZPA 5IMSA 4PC3A 4P4SB 2JG3A 2BH2A 2EL9A 3BB4A 3SG0A 4Y2RA 1GGKA 3TR6A 4B83A 2QPAA 1XNQB 1E6KA 5LR6A 3PGJA 1H4VB 9GPBA 1J23A 3EZ2A 5EPOA 1NONA 5BR8B 2VH1A 3IJ5A 4U0KA 1ZKDA 1II8B 1J09A 5BMOA 2ORYA 3L5OA 1NZFA 1OAOC 3L0DA 3R9KA 3JZMA 1X7YA 4XYMA 4PZZA 4NPCA 3A6PC 4IVRA 4DXHA 5IWAB 5J5CA 1V3UA 1JL3A 2W11A 3EMVA 3KDAA 5L4LA 1A7JA 4LTMA 1G5QA 1WSAA 1M10A 1UDAA 2ZBVA 3NWOA 4QU5A 3ZW7A 5GZ3A 3CVVA 3LLMA 3DEJA 4Z4IA 1V5GA 2PZAA 1UBMS 3QTBA 4A8JA 3DLHA 1DMSA 4L5JA 3W78A 3L6CA 5THKA 1VLLA 3PWTA 4IMJB 2GCGA 3PQ3A 3LA8A 4DNFA 2JLSA 3ROFA 1JSZA 3NEYA 2QT9A 4BAUA 1H9CA 1D2RA 4GS5A 1Q6ZA 1ZGBA 821PA 2Q1SA 2C5AA 2G17A 4QUGA 2AR7A 3A0RB 5DTRA 1DIOB 1K2WA 5IDVA 3KEQA 2WHPB 1EGVB 2X5KO 1AV6A 3AGPA 3DHNA 2WE7A 4G86A 4HC4A 5KYVA 2PLRA 3I2IA 4M9SA 2OQIA 4NI5A 1HFWA 4NCNA 4EUHA 5CFZA 3VNVA 1KO4A 3C3YA 2X8JB 3OE7A 1YSCA 5F78A 1KJYA 3SZLA 2DEUA 3JD0A 1WDLA 1Y80A 2VDPB 5F9MA 3LUCA 1E1LA 4UBLA 1QRSA 1XA4A 1HI9A 3Q12A 4AN4A 1BOFA 1EQAA 2HIHA 2P75A 2R68A 3PUYA 2H2IA 5DNEA 3RIXA 3EAQA 3U4GA 4WLVA 1VLQA 1U1IA 1YE5A 4DJFC 3IBTA 1CEYA 3BMOB 2J5XA 1A1SA 3MWDA 1H2BA 5C1IA 3OEED 1QP7A 2PVCA 4MDEA 1N78A 1X9HA 2V4MA 1YJ8A 5CLGA 5LQNA 2Y71A 3GF4A 1NBMD 5LZ2A 3UWKA 3QQPA 1IVYA 4R9UC 4YNBA 4J0EA 3WNVA 4CIXA 5L40A 5EWLA 4MZDA 1F3OA 1AURA 1QZUA 4XM0A 3Q8MA 2B1JA 4JITA 4DYDA 1IUNA 4GP7A 4M6WB 2OP1A 3ZGVA 1N2HA 3O84A 4WACA 3TRDA 3SC2B 5L3QA 4EPVA 2VHZA 4KAFA 3ZIAD 1CRLA 4EYOA 4MB6A 4GR9A 5JQGA 2VWHA 4HVTA 2CHQA 3NHJA 1Q1BA 4I50A 2GT1A 1E9BA 1BKDR 3BEDA 5EJEA 3QV2A 4CV2A 1CRWG 3QZUA 1JFVA 1E3TA 5LP6F 4JI4B 5IHPA 5F98A 4ID3A 3Q40A 4XJTA 3O92A 2DLDA 3SX0A 2FWAA 4B48A 3JYLA 1NUPA 1YZGA 4UDNA 4QTZA 3T99A 2DHQA 1HLFA 3FJOA 3HABA 4ZU3A 1ORIA 2CC2A 2VYVD 1CR0A 3UTCA 3P7MA 2HK6A 4IXNA 4DLPA 3AP3A 5I9LA 3GRCA 4G1EB 4I4TF 1DBWA 5JJKA 4UPDA 2GPSA 4E31A 1KZ7B 2OO7A 1ITZA 4F3NA 1FFAA 1Q0HA 1JSXA 4MRMA 3TR0A 3TVYA 4YDQA 1CUAA 1N5OX 3QVGB 3GJQA 4KFUA 1UKBA 1SOVA 1UT8A 3JS5A 4JOCA 5CFQA 4MKHA 1P2VA 4G81A 3LLVA 3I5UA 1VL5A 4XIYA 4Y7CA 4Z49A 1CHDA 4QJIA 4MPJA 3WSTA 1MOZA 1ECJA 4FE7A 4XDZA 4C3ZA 3BRSA 4GZMA 4DV2B 4BYGA 4TLMB 4FYHA 4MROA 3RVRA 3W5VA 3HEAA 3O1HB 4FHGA 4QKQA 3OVMA 2IU4A 4JB3A 4LHYA 4M1TA 5B3AA 2I8CA 3N0WA 3A4LA 1KO1A 2ZSFA 5DBGA 2A33A 5BMVA 2R48A 5FV4A 1ZVJA 4JL8A 4UJ3A 3DP9A 3K05A 4R2WA 2I76A 2YWDA 4OL9A 13PKA 3W6PA 2XKKA 1DCTA 2QU7A 4WK6A 1BA2A 2HK8A 2G6BA 2H2DA 2ZUWA 4C7JA 1PFWA 3OPYB 1UEXC 4C0WA 1EDEA 3FPBA 4S0XA 3E7WA 4YQEA 4DARA 3DVRX 2ZIEA 2EYUA 3HDYA 3KXPA 1IL0A 3U4MA 3LBAA 1M8KA 4BO5A 3HJAA 4KMMA 3H2KA 4ATNA 4BS9A 3LUGA 1QIFA 1PNQA 4KR0A 1OGYA 1L7XA 1ORVA 3DPUA 4B34A 2J9FB 1RWBA 2GK6A 2AC2A 4M83A 4JSRA 1GLGA 4R31A 4HXEB 1DSSG 1B3BA 2XUGA 1ZI6A 3S70A 2MSNA 3R7NA 2OGTA 1PR1A 1UXHA 1ODJA 2VPQA 2OPBA 2QAGC 3HSKA 3PUHA 4MSUA 2A1TS 4EA9A 4Q7MB 3C5VA 3EWSA 3K1AA 2JLWA 3CH4B 5BNWA 1CVIA 4QWMA 1POWA 1TYBE 3FHJA 4HK4A 2D5IA 1MH9A 3KJFA 3R5KA 4E14A 1XCJA 1Z5WA 1YVUA 1YI8A 5CLHA 4B3CA 1Z25A 4BFTA 4EUFA 2OLKA 2YNMA 4X63A 1HO3A 1QO0D 3PNBA 4MR7A 3DTNA 2E55A 2ECOA 1NBHA 2AC7A 2EBFX 4LJ7A 4RL4A 2AN1A 5KQSA 1U99A 3MQ4A 3WNZA 1QZXA 3K0AB 1AUQA 4IWNA 5GAJA 1RP7A 3N2LA 4YQZA 2AOUB 1PQWA 5CH3A 2YJNA 3GGCA 4WX2B 2OY0A 3LPCA 1TCUA 3QPUA 4J1TA 1F0KA 4MI6A 2UU9B 3D4PA 4L0MA 2XW6A 2B36A 3A26A 1OTYA 2GCNA 3PX2A 2IIQA 3QKWA 3TW4A 5HSGA 1QQ6A 1A72A 3RVPA 4E2ZA 1ZRMA 4JWKA 4Y2QA 4M0FA 4PINA 3RLFA 2PKEA 3D6TB 5G53C 3WGJA 4BMNA 3CH7A 2IHJA 4RW0A 5CDSA 5BPHA 1H2XA 1FSGA 3B82A 4YYZA 4AJLA 3OWXA 2IEGA 3MJTA 1VIAA 3MRTA 4LY6A 5BN3A 1H5NA 3OM8A 1V35A 5DT2A 4W6QA 2GJ4A 5FWXB 3GMSA 3GLKA 5H3HA 1DKRA 1CZUA 5CA1B 2H3EA 2C7BA 1Y8RB 2Q5OA 3UAZA 5C35A 2GF9A 3GFVA 4MVXA 1HPLA 1OWMA 3E7XA 1G5FA 4I55B 4C4ZA 1EFRD 3QHQA 4CM8A 2CHGA 4GVLA 3GLGA 1MPXA 2G06A 3BEOA 2YY7A 2QWXA 3ZXYA 1SQ0A 1XZMA 2MWMA 1L5QA 2X3FA 3HV0A 4OQFA 4V0OA 1K7EB 4EX6A 4KHPB 4XLZA 2BFOA 1RTKA 1TO2E 2YFHA 3HR8A 3OIWA 4U00A 6GPBA 1K0FA 3WRXA 4CM1A 3GWGA 2YHIB 2E18A 1GVNB 3GW8A 3MT7A 3S2YA 1WPGA 2B3DA 2LUOA 4NY1A 5AUNB 2ZSHA 4IRMA 5BQ5A 4ZCIA 1QYDA 4R5HA 1GG8A 1FMJA 3GLHA 2OOSA 5FO1A 1CUVA 2QTMA 3P2MA 3JZIA 1KZ1A 3M6WA 3LFUA 4FKBA 2YW9A 3SDSA 5MN6A 2P77A 721PA 4DY4A 2B61A 3R7WA 2DUUA 3SX2A 4BE7B 3C98A 5CFOA 3BWBA 3EUFA 5K4HA 3C1OA 3ZWPA 1EVLA 4URHA 1XRRA 4ZVOA 2CLMB 4BX0A 4NKRA 1Q7TA 1F6WA 3KPJA 2Z1DA 3RRNA 4HNTA 1N2JA 3CX4A 2FQYA 2VNHA 5JBQA 2CZGA 2FWMX 5KC8A 2CZQA 3QVMA 2I2CA 3BE5A 3FGOA 3KB8A 2RHCA 1JLLA 3PLNA 5KAMA 1QLHA 4DYVA 3GRYA 2BR5A 5SZKB 3TQIA 3EXG1 1RXVA 1TAHA 1K5GA 4ERXA 4AB1A 2PKYX 2ZCVA 1SZJG 5EJ8A 3FWYA 2X5XA 2CCJA 5IUNC 1DIRA 4EZIA 1C1XB 4GKJB 1YVRA 3A1WA 3ONFA 1XNJA 3LBIA 3PL5A 3QA9A 2WG2A 3C1UA 4ZT5A 2VAXA 5H7XA 4URUR 3UQZA 3WIEA 4I1RA 3EH2A 5ALVA 1R9GA 1E2JA 5AJZA 1LSUA 2QSJA 4OXRA 1CD5A 3DUFA 1CNMA 5E1OA 5GPBA 1N0IA 2E5LB 3F5DA 3C5EA 1C5KA 2P67A 3AF2A 4JBHA 3VTZA 3CXUA 3HA2A 5U9CA 2K87A 4RA6A 1P1HA 1JIKA 4N8DA 3VR2A 1U7DA 2XMGA 2RGAA 4OFBA 1UM9A 1AKYA 2HF2A 3PICA 4LQCA 2CYBA 5H02A 2CCKA 1MQ8B 4KX3A 1OLUB 1QZ3A 1HFJA 1SB9A 2OV6A 3P0FA 1JFLA 1WP9A 4KVAA 4LMAA 2ERCA 1NFQA 2VF8A 1G7TA 3O8OB 5D6NA 2NUPA 1C8KA 3OKFA 2I7XA 1CS0A 1NPTO 2XUAA 3O91A 3SFVA 1I01A 3RG2A 1JG6A 5AVOA 3DAOA 2ZT5A 3MTBA 4DDKA 3TWOA 4QA9A 2QLMA 4FOSA 5H1YA 4E2WA 1CK4A 2PSFA 3K3PA 1SU6A 1R10A 3BQNB 4PS1A 1P5HA 2IZ6A 1PWHA 2ZI9A 3MAAC 4QFMA 2PN1A 3DZKA 5FWYB 3LSTA 1A4XA 2LDXA 4RSGA 5BWCA 2V4UA 1PDOA 3BKXA 3HKDB 3ESBA 3MFYA 1JB9A 4R1UA 4XFDA 5D8DA 5FYQA 5I9MA 5LA6F 4DA0A 5EMHA 3OF3A 1VKRA 3OUUA 3N8IA 2GI4A 3EEYA 4KKVA 4OGKA 4EHHA 1K97A 2H2WA 3WGLA 1GXSA 1ZEJA 2QMQA 3Q5GA 4YRCA 3VI3B 1V9CA 2QTFA 1HZJA 3GD7A 3K8OE 1XB2A 3R5HA 4HQKA 4RGYA 4AJ1A 4NMXB 1VQ1A 3TIVA 1WW2A 4JLVA 1U2GA 1E2UA 1I6MA 4LE0A 5FPSA 1CUZA 5G2OA 1GARA 3RVOA 1M7BA 1D7AA 1I1HA 1Z2NX 1WWKA 3L46A 3NR2A 3FSGA 4RABA 2A9PA 3CLTC 4CG3A 1T3GA 3ZD7A 2QGZA 1Z06A 1RXYA 1P9WA 1RLTA 1XCMA 5KU7A 1LW6E 1H3NA 1AGRA 4S05A 4FE3A 4GBJA 2PLWA 5JYCA 3AHEA 3ZJUA 1XCGB 1IZZA 1GQQA 3RVLA 2WWYA 2IITA 1XZAA 5IAEA 4EAAA 2WNSA 1VI5A 3AV3A 2YMMA 4G37A 1WSDA 3VUEA 5JUWA 1ZH4A 5BVGB 4XB6B 4WECA 5SZJA 3T4EA 2HRBA 4MUGA 5KHOC 3U16A 3G7UA 1RHQA 2UVDA 2AF3C 4DDUA 5BR1A 3KUUA 2HO5A 1L4YA 2FQWA 2VUHB 3ISTA 2JB9A 3GZJA 3NKFA 1IBSA 4HH0A 3NNDA 5EJIA 3USCS 2N46A 3KLPX 4XM2A 3SBXA 3UYLA 2OM6A 3GAZA 1CJCA 4YS6A 1VIYA 2GA9A 3U7QA 3AJ9A 1XRPA 3QELA 4M8LA 4Q19A 3ZH2A 5KWVA 1UBRS 3LVBA 3AF5A 3H2GA 4MUXA 2W2LD 4DG5A 4LHWA 4DG9A 1KI7A 1UJ6A 3TSOA 3JQRA 1UKZA 4ARAA 4DR1B 3CT6A 4LXHA 3Q98A 5K09A 3THXA 1U63A 5F33A 1G5HA 2PD4A 1NU8A 1OWOA 1XEWY 2OV3A 3AWDA 1GFSA 3OAAA 2QZJA 2W4IA 3J7AC 5DHFA 2Q3EA 5EKXA 1NMZA 5JPDA 4UU0A 1L4MA 2ADFA 3MIIA 4P31A 4G01B 5K3BA 4NMMA 4M54A 4P86A 3UN1A 1E6UA 2W2OA 3WGNA 3HU5A 2EW8A 3I5XA 3U13A 3BRQA 3RU9A 3ZVRA 3P94A 3CVYA 1GPBA 3IQDB 4CCWA 1P62B 5ITZB 3PUVA 4JGIA 3W0LB 4Q3AA 3TBKA 1AV7A 1FY2A 2XRMA 3LOQA 4NV1A 1NHGA 1ISJA 3UOGA 2NU8B 2Q2NA 4JX9A 2Z8YM 4EENA 5F9HA 2JIQA 3ETEA 4DLTA 3SC6A 1NQOA 2PBLA 4MS3A 3O75A 4POAA 3FY4A 4JYMA 4QBHA 2QQ0A 3L05A 2CNDA 1JEQA 2W48A 4XWYA 4RJKA 1L7NA 3UUFA 4KRFA 4OHPA 4R1QA 2BP7A 3AT1A 3I8SA 5E4FA 3K8ZA 2R8PA 2VATA 4OFZA 2WQ6A 4F21A 4M2LA 1NBOA 8GPBA 1Z2PX 2X1LA 4H4EA 1IBRA 4JMPA 4N9WA 1TM3E 4ZT7A 1YFZA 4Z7NB 2PT9A 3N2IA 1K7FB 4X8HA 3RRJA 4HDNB 2G07A 2XKJE 2RH4A 1RQRA 5B7PA 1QCZA 4DW8A 1X7DA 5DTMA 4BJ5A 4J3JA 5BT8A 1T8WA 1MDBA 1P0MA 1YR3A 5FNVB 4AY6A 1PZHA 1M8FA 2ILTA 1Q22A 4PE5B 1W8DA 2HEIA 1GV0A 2Q3BA 2XY4A 2FRVA 1VCIA 5B58T 4YMVA 4HMQA 2ZE6A 4TQGA 4F4JA 2QZZA 3CX6A 4X3CA 4FYPA 2G09A 1EE2A 2YHSA 1V8OA 1S2LA