1P1CA

Guanidinoacetate methyltransferase with gd ion
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
193
structure length
193
Chain Sequence
RWETPYMHSLAAAAASRGGRVLEVGFGMAIAASRVQQAPIKEHWIIECNDGVFQRLQNWALKQPHKVVPLKGLWEEVAPTLPDGHFDGILYDTYPLSEETWHTHQFNFIKTHAFRLLKPGGILTYCNLTSWGELMKSKYTDITAMFEETQVPALLEAGFQRENICTEVMALVPPADCRYYAFPQMITPLVTKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Guanidinoacetate N-methyltransferase
publication title Monoclinic guanidinoacetate methyltransferase and gadolinium ion-binding characteristics.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 67
structure length 193
sequence length 193
chains with identical sequence B
ec nomenclature ec 2.1.1.2: Guanidinoacetate N-methyltransferase.
pdb deposition date 2003-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1p1cA00
2K4MA 2ZIEA 2NXEA 2ZZKA 3G5LA 1NE2A 4X1OA 4YMGA 1ZQ9A 2P40A 4QDJA 3OPNA 2C7PA 3MHTA 1SQGA 4GOLD 1NBIA 1YZHA 3LKDA 4V0QA 5DTMA 5GM1A 4C03A 2PBFA 5K0BA 5FCDA 3CBGA 2PWPA 4GEKA 3G89A 3QOXA 2BM9A 4QDKA 3GCZA 5JR3A 2F8LA 3PTAA 3NDIA 2R6ZA 1U2ZA 3EVBA 2Z6AA 4M37A 4PYLA 5EOVA 3TM4A 3UJCA 5K0FA 5LQNA 2FK8A 3LDGA 1JQEA 2ERCA 2XYRA 3EMBA 3GU3A 3LBYA 4FT2A 4PYIA 4ER0A 1D2GA 4RTOA 2IH2A 3VSEA 3O7WA 4ZTBA 5K05A 4EQZA 1VPTA 1WY7A 3EEOA 2UZ4A 1P39A 2VZ9A 5CCBA 3R3HA 2PXAA 5T6BA 4R8RA 3NVMB 5BXYA 2PWYA 2VDVE 1JG3A 1VL5A 3G2MA 3PS9A 1ZG3A 3EGEA 3P9KA 3BXOA 3UJAA 1FJXA 3BKWA 3DUWA 3EVDA 2EJTA 5CVVA 1V39A 3P2EA 2G70A 5FA5A 3R9XB 3PX2A 3X0DA 1N7JA 4KIGA 3BWBA 2OZVA 1G60A 2NXCA 3BWYA 3P9NA 1KR5A 3REOA 4P7KA 2I7CA 3UJDA 3PLAE 3SX0A 3OZTA 4PIPA 4EK9A 2GH1A 4PCLA 3U81A 5LQAA 4C05A 5EIWA 2V7EA 1XJ5A 3UJBA 5JUWA 1P1BA 3HVHA 3B3FA 5FHRA 2PT9A 2ZW9A 1O9GA 3THSA 5GP1A 4ER7A 4YMHA 3SR4A 3AXTA 3LKZA 5E1MA 1NW3A 3H2BA 4IKPA 1Y8CA 5EHGA 3BWCA 3HM2A 3HVIA 4MHTA 5EEHA 1TW2A 3NVKI 3KPJA 4F85A 5HIJA 5EVJA 3OZRA 5EPEA 3OCJA 5DTRA 5ICGA 3Q87B 3M70A 4X41A 4EMSA 3OU2A 1WS6A 5B1SA 3OFJA 4XCXA 2UYOA 4PNEA 1JTEA 1QAMA 4PIMA 5GM2A 4DZRA 3PFHA 5E2AA 2IDJA 1SKMA 4DCMA 4E70A 4EKIA 3MQ2A 1I1NA 3VC1A 2FRXA 4RV9A 2AN3A 4R6XA 4OQDA 4RVFA 1R6AA 2G72A 2PX4A 4FT4A 3UA3A 3B3GA 1HNNA 2AN4A 1VP9A 3GRZA 3PB3A 5LQCA 2XYVA 3BWMA 5K0NA 4POOA 5GINE 5HEKA 3NJRA 3KU1A 1M0EA 3FTFA 3GDHA 2PXCA 5KVAA 4RYLA 1VLMA 1M6EX 3CKKA 2CMHA 4R8SA 3BKXA 3TRKA 1G8SA 3TR6A 4CKBA 3JWHA 3ANXA 3HCEA 1FP1D 5DRYA 1JR4A 3GRRA 3I58A 5EMKA 4Y30A 2VDWA 3EVZA 4QVKA 2JJQA 5DM2A 3EEYA 5FULA 4RX1A 3DLIA 3FUVA 3R6TA 5ERGB 3LDFA 4HTFB 1RI5A 3SSNA 1RI3A 2PSSA 3ELWA 2YX1A 1DCTA 3M6VA 2ZVJA 3UJ6A 3VC2A 5BW4A 1NW6A 9MHTA 1X1BA 4WVLA 5BW5A 2ONZA 4LWPA 1EG2A 3FYDA 2QY6A 2XVMA 3KQQA 3KR9A 2NP7A 1N7IA 2BR3A 1KPHA 2QRVB 3B7PA 2P7HA 2AR0A 2UYQA 3SMQA 2BR4A 1TW3A 3T7RA 2V74B 2P7IA 3OU7A 3F4KA 3M4XA 1Z3CA 1TPYA 4HGYA 2G8NA 2B25A 2OY0A 3QV2A 4IV8A 4RSRA 2I9KA 1ORHA 1JTFA 3TFWA 4HRAA 4DF3A 2PXXA 1N2XA 4L7VA 2PT6A 2P1DA 3FTDA 3R0QA 2AOUA 4PYJA 3A4TA 1RI4A 4RVHA 5LQUA 5K09A 2FYTA 3OZSA 5CUQA 3I53A 2JHAA 3ELDA 4MTLA 4PGGA 2YXLA 4OBXA 4BLWA 1UWVA 1JQ3A 1WXXA 3G2PA 1XDZA 4OA8A 5CVJA 3TMAA 5BP7A 5HIMA 4RTJA 1YB2A 2CL5A 1AV6A 3KPYA 3DULA 2VDUE 3A26A 3HP7A 3IEIA 5LQJA 2UYHA 5FHQA 4GF5A 2VP3A 3FPEA 5CVEA 2YXDA 3RIEA 4BLUA 3AWIA 4FP9A 3ORHA 1H1DA 1F38A 2AOTA 2P3LA 1VE3A 3FUUA 3KQSA 4K6MA 3EMDA 4YUYA 5C9ZA 2C7OA 4M36A 1XXLA 4AZVA 2FCAA 4RTKA 4YV1A 5EQJB 4YUVA 2H00A 2PV0A 2ZTHA 3LDUA 4FR0A 1JSZA 4FGZA 4GOOD 3KQMA 3PT9A 1RJEA 2CMGA 3SVZA 2R3SA 4AZTA 3MAGA 5FQNA 1KXZA 1YUBA 3E8SA 4B17A 3FUWA 3CJQA 4P58A 1ZKDA 4DCGA 5KQSA 5GIOE 1R00A 5GIPE 3BUSA 3TLJA 3A7DA 5T64A 1SUIA 4E32A 4XUEA 3NWEA 3A27A 3HCAA 5DTQA 5E1DA 4RTRA 4GUAA 1XVAA 5DLYA 1NW7A 5E9QA 1L3CA 3GJYA 1OR8A 4QPNA 5DWQA 3DP7A 1FPQA 5CD1A 10MHA 3UA4A 5E9WA 4YV2A 2XYQA 4HGZA 3FUTA 5FA8A 1B42A 4RVDA 5ICCA 1RJDA 4QVGA 3T0IA 4G56A 5GOZA 2Z6QA 2BH2A 5K0GA 1O54A 2JH8A 5DSXA 4E2YA 1NW5A 5EMMA 4E2XA 2OBFA 3BGIA 3CCFA 4C08A 3WSTA 5KQRA 1L3BA 2AVNA 2HV9A 1MHTA 3K6RA 2YVLA 5LQRA 4QTUB 4ER6A 4ISCA 4A6DA 3HNRA 4Z2YA 3ME5A 4R6WA 3GRYA 2JHCA 4H0NA 2O0LA 5C1IA 5DM1A 1INLA 4R05A 2YTZA 3G2OA 3KKZA 2ZBQA 4AZSA 3DH0A 4FZVA 3UZUA 4CXMA 2GPYA 3NTVA 4CKEA 4P7GA 2Y1XA 3CJTA 3UWPA 3FRHA 4QTTB 3B89A 3C6MA 5EMLA 4BY9E 3HCCA 3KQPA 2EJUA 3OE4A 2I62A 4HSGA 1YFLA 1WXWA 2GAFA 4DQ0A 2P35A 2NYUA 3MGGA 5E1OA 1Q0SA 3QOWA 3GO4A 4U7TB 2LD4A 3TM5A 4P7FA 2OXTA 3LBFA 2AOXA 4CWAA 4OQEA 3THRA 5DSTA 4WXHA 2EFJA 3DMFA 2NNWB 1WZNA 2PX5A 5M5BA 1FP2A 5K03A 1I9GA 2O05A 2OYRA 4RTQA 3G5TA 4PYMA 4GC5A 1AQJA 2G1PA 2UYCA 5U4XA 5CIYA 5MHTA 3UJ9A 3KQYA 3BZBA 3BGVA 5EGSA 3GXOA 5CVUA 3GNLA 5EIFA 1SG9A 1T43A 1XCJA 3G88A 3P8ZA 5DT2A 2PY6A 3SSOA 1G6Q1 5DX8A 5CCXA 2IBTA 1UIRA 3LPMA 2QE6A 5IH3A 3FTEA 3UJ7A 4E30A 4F86A 3HEMA 1EAMA 1KPIA 1NW8A 2FPOA 3C6KA 3P9CA 2YXEA 2GLUA 3P2IA 4YUWA 2CKDA 3KHKA 1NV9A 5CM2Z 2P41A 2P8JA 3CC8A 3FYCA 4GQBA 4UOEA 4PYQA 5KYGA 2HR1A 3KR2A 1P1CA 1NKVA 3A25A 3BGDA 4FSXA 1ZGAA 1EIZA 3GRVA 4MWZA 2GS9A 2HTEA 4PINA 3E05A 3CJRA 2ZZNA 1IM8A 2HMYB 3O4FA 1DL5A 1QAOA 1VBFA 5E2BA 3HCDA 2ZULA 4EKGA 1VIDA 1P91A 2A14A 1X1CA 2ZSUA 2BR5A 2GB4A 5HFJA 1O9HA 2FHPA 3P97A 2AOWA 1KYZA 4X63A 4YV0A 1R8XA 1KIAA 3AJDA 4X61A 3E7PA 4HC4A 3GRUA 3M6UA 1NV8A 3LGAA 2PGXA 5HILA 2WA1A 3DXXA 5EHIA 3IHTA 4C07A 2QM3A 4DA4A 1G55A 5H02A 1QANA 4CKCA 5HOQA 2YUIA 2O57A 4GBED 1EJ6A 4GOMD 4RTNA 5DRTA 1Q0TA 2ZWAA 3OFKA 3VYWA 3E23A 3TQSA 1HMYA 2EX4A 5K8VA 3K0BA 3G8AA 5D1NA 1XDSA 4LECA 3HCFA 3KQTA 3G2QA 2C7QA 3FUXA 3C3YA 3KR0A 5LQKA 4KVZA 4ER5A 1RJGA 3CGGA 3DMHA 4P7JA 2WA2A 1I4WA 3EVCA 2ZBRA 3JWGA 3PVCA 5DX0A 3TPZA 2ZLBA 2EG5A 3JWJA 5K0JA 5KS2A 3ER8A 4XUCA 2NXJA 5C0OE 2PKWA 4KWCA 1VP3A 4DKJA 4NECA 3UFBA 2OB2A 2IIPA 2BM8A 2OKCA 3MTEA 2ZWVA 4PGHA 1L1EA 4PYNA 5DXAA 3KPUA 5K0LA 1QAQA 1RI1A 3D2LA 3LCCA 5F2NA 5DXJA 4KIFA 1YF3A 2ADMA 5ICFA 4HTFA 3HA5A 1QZZA 3IYLW 2IFTA 4DMGA 4AZWA 5IKMA 3HVJA 4FS8A 1NBHA 4BLVA 5F2KA 1X1AA 2GA9A 4CTKA 3MB5A 2O07A 3M6WA 1BHJA 3FPFA 4E33A 1FBNA 1BC5A 2QRVA 5E8JA 2P3QA 3BT7A 3DMGA 4PYOA 2AOVA 2ZIFA 4QQKA 4Y2HA 5EC8A 2ZZMA 3EPPA 3P9IA 2B9EA 4E2ZA 3MERA 4KW7A 1ZGJA 4OA5A 3EVFA 1DUSA 2OB1A 3DTNA 3RODA 1KHHA 4OX9Y 3MTIA 1IY9A 4RTSA 1PJZA 3EGIA 2DPMA 3DOUA 1XCLA 3AXSA 1R8YA 3TKYA 3FZGA 2XBMA 3IV6A 3AY0A 3LHDA 3EVAA 2H11A 4O29A 2IP2A 5EKXA 4DM3A 3C0KA 3EGVA 2DULA 2IGTA 4BP1A 4LWOA 5ICEA 1G38A 5K0CA 3LCUA 5EZSA 3OE5A 5F2OA 4PYKA 4ATNA 4ER3A 2IH5A 3SGLA 5CVDA 1KYWA 1JG4A 3MCTA 3I64A 1KP9A 3R24A 3P2KA 3HA3A 3RW9A 5T67A 2PX8A 2C7RA 4EVIA 2AS0A 1BKYA 1JSXA 5EZQA 5EMJA 2YQZA 5FUBA 3SXJA 3UBTA 3V8VA 4FSDA 4LG1A 4AX8A 5FWDA 1RI2A 1WG8A 3FRIA 5DX1A 5EEGA 1SVUA 5GWXA 1EJ0A 4C04A 2N47A 3EVEA 2O06A 3HA7A 2PJDA 1XTPA 2IPXA 5DPMA 3KR1A 3KQWA 2AZTA 2ONYA 3ELYA 1EQAA 3FPJA 3I9FA 3PX3A 4F84A 2ZFUA 3NMUF 2NP6A 5HIIA 1IXKA 3S68A 4E2WA 3T7SA 1RJFA 8MHTA 4V0RA 1R74A 4RWZA 2YR0A 2KW5A 4C4AA 5K0EA 4RTLA 4U7PB 3NW9A 5HZMA 4AUKA 3KPVA 2VS1A 1QYRA 4MIKA 5DM0A 3T7TA 5K01A 3LX6A 5E1BA 1VQ1A 2ZBPA 5E9JA 3P71T 1KPGA 1YFJA 4OBWA 4KDCA 4C06A 4M7RA 2B78A 1X1DA 4QQNA 4RVGA 2JHPA 3KQOA 2ESRA 2ORED 1UFKA 3DLCA 3O31A 1M6YA 3A7EA 2IBSA 3HVKA 4RTPA 2AOUB 2ZIGA 3DR5A 3NWBA 4GOND 3NDJA 2BZGA 3G8BA 5EKUA 3ID6C 5FTWA 5LSAA 3C3PA 5FQOA 1L3IA 3M33A 5EG5A 2IH4A 2NXNA 2FK7A 1F3LA 1G8AA 1JG1A 1L9KA 2AN5A 4MQ4A 2PVCA 2CWWA 3V97A 3L8DA 3LL7A 4PWYA 4PCAA 4CTJA 2HWKA 1ZHFA 3CVOA 2AOTB 3G7UA 2PLWA 2JH9A 2G71A 4M38A 4HH4A 4A6EA 1BOOA 5D1HA 3FTCA 3ER9A 7MHTA 3DXZA 3I5UA 1NT2A 4XUDA 2H1RA 5G02A 4X60A 3HTXA 3GIWA 1JG2A 1D2HA 1X19A 2B3TA 2B2CA 5HIKA 1D2CA 1AQIA 3Q7EA 1MJFA 4KRGA 3SM3A 3SSMA 5LR6A 2JG3A 3OU6A 2HNKA 3ERCA 2AVDA 1R18A 3B5IA 1JQDA 2WK1A 3PFGA 2E5WA 4BP3A 3HCBA 3ELUA 3LSTA 4IWNA 3DXYA 3FPGA 3GGDA 3TOSA 1AF7A 4YUXA 2I6GA 4IV0A 3EVGA 4JXJA 5FADA 3M6XA 1ORIA 4HG2A 2OO3A 4QPPA 4RTMA 4GC9A 2OPBA 3MCZA 1XDUA 3GWZA 3UJ8A 3TKAA 3B3JA 3FPHA 2Y1WA 2Z6UA 2Q41A 5FWAA 5DM4A 5P8WA 1SQFA 2P3OA 2QYOA 3JWIA 3KPWA 3LECA 1YZ3A 4PONA 2PX2A 2ZCJA 1PRYA 3LCVB 3KQVA 2XVAA 4E31A 1SUSA 4KDRA 4YUZA 5E8RA 2IDKA
chains in the Genus database with same CATH superfamily
4G0WA 1KVUA 4OGKA 3EGXA 3NBAA 1NRJB 2ZPUA 4WJKB 1XRLA 2QLJA 4LGMA 2XB9A 3IVAA 1X1QA 2FLKA 1L5SA 2YC2C 3EIWA 3LKDA 5H5JA 3JZMA 3TL6A 4YJ3A 1CBUA 3IBYA 4IQFA 2P4QA 4LV8B 4C4SA 3MMPA 5CMLA 1JPVA 4ZCLA 5TQ2A 2E4WA 3BHJA 3E2PA 1GGHA 2E2WA 4PYLA 1SQ0A 5IBRA 5FOQA 1K5DA 3LDGA 2YW9A 5DJ5A 4GR4A 1YXMA 1XD8A 2X5KO 3O0TA 1NYLA 2GR9A 2XKKA 3ZCSA 2VJOA 1PZEA 3IKLA 1EVZA 3L7YA 1XC7A 3H65A 4LDQA 1KKMA 2A5DA 3V7WA 4EELA 1GNSA 3SS8A 4WJLA 1FSFA 1NVTA 2Z30A 1ZIPA 2Z5FA 5E6SA 1TJNA 2H3EA 3UWSA 4UHCA 3BMCB 1QH1B 4UU1A 3UG7A 4EPXA 5B1IA 1UP6A 1G9SA 1GTVA 4G9BA 4RABA 4DCCA 2CLOB 5ALQA 2WT9A 3BXOA 4IDQA 2R96A 4WFIA 3NIFB 3O73A 4O2LA 4CL2A 1JJIA 1O8CA 3BWBA 3VXKA 3NIWA 2IL1A 4UNSA 1FUYB 3S7TA 3QVSA 1GV1A 3CTMA 5H9VA 3DOJA 3KBBA 3BWYA 2YWGA 4HXGA 4O1MA 1J7KA 2QTAA 5T6MA 2LV8A 2QTCA 3JARA 3DPSA 1GG8A 1K7EB 1LS1A 2C0QA 2D62A 1QK5A 2Q3HA 1K5GA 1XSEA 3BHNA 1SQ5A 1N5LA 3IP9A 2H1WA 1FFHA 2AZMA 2WU3A 2AFIB 4S05A 3DV0A 3RJZA 5TGTA 2Z1DA 1HRDA 1P9OA 3F71A 2PJZA 2R6R1 4HB4A 2ZIUB 1XPRA 5CLIA 3RS5A 1U0BB 3PD7A 4DC9A 4GR9A 4TPKA 2Q9CA 1FNDA 1L5WA 1T5SA 1V4NA 2HJ9A 4JROA 5D6NA 3NVKI 1NG1A 5I7EA 3GJ5A 3HN2A 2NO9A 5DTRA 1VSQA 3NT2A 3DFKA 3PUHA 1V1MB 3D8RA 3RSGA 2AG6A 4ZQBA 1DSSG 2ICAA 4PX5A 3ZD7A 3ICQB 1SK8A 1SWVA 1YB7A 1RYNA 2Q0HA 4GNKA 5J58A 3FOBA 4EKIA 3N76A 2NVUA 4OHVA 3HJCA 3GJXC 5F1OA 3LC1O 4KJXA 4OQDA 4DCPA 3F97A 2VF7A 5K2OA 4H2DA 3S99A 1DUIA 3HN6A 5IC6A 3DOFA 3BWMA 1YZNA 3P19A 4HZIA 4LX0A 4QJIA 1LFDB 4WLUA 2D0PB 2KQUA 4XVHA 2J6BA 3TUZC 1SZDA 1AS3A 1T8WA 1MENA 4QOJA 5A06A 2F62A 3HCEA 2HCJB 1TO6A 4X7PA 1G8FA 1JR4A 1W19A 2BFAA 2FOLA 5FIUA 1PEAA 5KINB 3I34X 4AMYA 5LD2B 5JI2E 4RS4A 1U6JA 1THTA 3TW0A 1MXFA 4TMWA 5JNVA 5HBRA 2JI6A 1XWIA 3AKCA 4Q3CA 1JHUA 1YNOA 1GL9B 3GDGA 5FOTA 2ECKA 3QXSA 3W6PA 5DBOA 2YOGA 1XU9A 3VDXA 3G0IA 4BTEA 1Z39A 1UODA 2WWTA 3AZPA 2XVMA 5FFFA 5KQLA 3T9FA 1Q7BA 3GLGA 5TT1A 5EQFA 4FOOA 3E35A 3MUNA 5K8TA 3ILVA 2PGLA 4IFIA 3T5BA 3I61A 3CUKA 4LTDA 2OY0A 4AJJA 2Y93A 4M22A 3FMOB 4AXBA 1ECJA 2PRKA 2PT6A 3WGNA 1IWOA 1E2EA 1A7KA 2E4AA 3MELA 4GBGA 2ANCA 2V6BA 4J0DA 4L02A 5CUQA 1MNQA 1IK6A 2JEOA 3B82A 1B0ZA 2BM0A 2V59A 4ZVSA 5A3SA 4A0GA 1YU9A 4EI7A 2MMGA 1KDOA 3QPAA 4RK5A 1KWGA 1W5AA 1PK8A 3FSGA 4L6IA 1QU3A 3D8HA 3HP7A 4MV5A 2RBGA 3OX2A 3CE6A 1LQ2A 1J1IA 1OFGA 1L4NA 2XUOA 2YXDA 4IRUB 4OQXA 3SQLA 1CR0A 1CR2A 1F38A 2AOTA 2I6QA 1Z5WA 4HDRB 1AO3A 4OHZA 3KO8A 2OAQ1 3UWMA 4AJOA 5KYNA 1YAHA 3MWJA 4U8HA 1XCPA 4RY0A 4DYHA 4RKEA 4YRTA 1XLVA 1RYEA 2FV8A 3IS3A 5DGCA 2D5IA 2VR1A 1OX6A 1QLWA 3ZVRA 3QKUA 2I4OA 4RLHA 3Q8KA 5FQNA 1YUBA 1E63A 1F1BA 3LC7O 1RYBA 3LP5A 3QVXA 4G1CA 1T9CA 1RADA 2ZXUA 3SAJA 4CW7A 3ZI0A 1IXZA 2O3JA 3D7LA 1N7GA 2YFQA 4MVCA 4MWDA 5AW3A 3U31A 2EL9A 1CVLA 1SUIA 3M1LA 3JQGB 5CEEA 4IRXA 3QRWA 5DOZA 4TSRA 1XB2A 1R3UA 3RVPA 2Y6VA 5E9QA 1N5OX 3D3WB 5C81A 3IV7A 4WAUA 5AQEA 4XFJA 1QOZA 2G6BA 4Y2YA 5ELMA 1XNQB 4FR5A 3WKAA 1EP3B 5EN4A 1I2MA 4OX9B 1NKSA 1Z0DA 2AXPA 4I55A 2RGXA 5L3QB 1LDGA 1CV2A 3STYA 2D2XA 1MJGM 1IXRC 1K0UA 1TM7E 2WIKA 3NTOA 2OUIA 2XE6A 3I5AA 3QPWA 4E2YA 5JALA 2AK3A 4G85A 1OBOA 2J3JA 1JIIA 1W73A 2TECE 4PBSA 1THZA 4D2IA 2P0AA 3EVTA 5EGNA 2H4ZA 1C1DB 4QTUB 4BNZA 4EG7A 4ISCA 3O3OB 1YZLA 1M6VB 2AYXA 1GPMA 5C1IA 2YZGA 3GBSA 4QGGA 5EJAA 3C48A 4CMJA 1RYFA 4DLSA 5EE5B 2BFFA 2C9CA 3LC2O 4BWGA 1KY3A 3CJTA 4IEIA 1B76A 2JIZD 2ZB8A 3DC2A 3DE0X 3KQPA 2I2BA 1WV1A 2QD5A 4KE6A 1SKUA 4XQCA 5AK3A 1DC4A 2VWGA 4LHZA 4U7TB 1AQYA 1M5RA 5JJ5A 4BP8A 1E0JA 1Z38A 5KJEA 1X92A 1TJ4A 3FLAA 2CNNA 1RE0A 4OQEA 1E69A 1VYTA 1CS0B 3WB1A 1DEKA 4J91A 3ASZA 3GNTA 4YFYA 3S7ZA 3G5TA 3M1IA 4OK5A 4X20A 1J9GA 1IJEA 3BX1A 4A0HA 4LE2A 1F6DA 3GEMA 1VL8A 4ZT4A 3V33A 3N8NA 1SPXA 3JQCA 1IB6A 3RGWS 1FFBA 4ZFNA 2YJZA 3IBTA 4IZ6A 3KUKA 3QX3A 4OXRA 2HIMA 4ALNA 5JAHA 1XCJA 2AX3A 2RB4A 1M1YB 5BYJA 3CKMA 3GLIB 3DKVA 5KTPA 1LDMA 4FDVA 2WAXA 2GYUA 4KQEA 3TZ6A 2IBTA 3L4SO 2BRUC 4UFNA 3QF7A 3M9WA 4G3XA 3BRCA 1QTRA 1OWOA 1IBCA 1TYAE 2XWJI 2FSSA 5I4CA 2GXSA 1WA5A 3NWOA 5DHPA 4BMYA 5IM4A 3VNVA 4AMVA 1DKRA 2R8OA 4BFLA 3NORA 5JNSA 4GMGA 2IS2A 1ZCFA 4K9PA 4BQPA 2WKQA 5DTJA 3AY6A 4CF4A 5HX7A 4ROSA 1AK1A 4H1WA 3NAGA 3Q10A 4I19A 1DXHA 4XDGA 1OWLA 2SKEA 1DL5A 4LWQA 1ECBA 5I9SA 3NC0C 4FTWA 3BHIA 1DKOA 2XNCA 1NUTA 3R5XA 4X3OA 4R1PA 3N8IA 3WWOA 1E2DA 3K30A 4KG7A 4YCJA 1Q16A 3AM1A 3BTOA 1UXJA 1GQRA 3QVWA 3AERB 4IDHA 4LXUA 4OYYA 1OB5A 2OBXA 5HKKD 3BIJA 3IJRA 4LJ4A 3C70A 3FCSB 5A4MS 3PC8A 5KVVA 4WASA 3SQWA 1OH8A 2AHOA 2HSGA 1XN1A 3FB1A 1ZMTA 2YUIA 2WLTA 5AKHA 1PR0A 4YO7A 4LDPA 1RIFA 1WNFA 1GCOA 4GXRA 3R6WA 1NXWA 4URVR 4I50F 1HMYA 5F51A 1XDSA 3JYOA 1UKAA 1P4GA 1YKSA 2VXBA 1Z74A 1X7XA 2C2HA 1C0LA 1I3LA 2NNLD 3GLVA 4R1MA 3W0LB 1TEHA 1L6IA 3P0JA 4LYHA 1VCIA 2R47A 3JWGA 4M9QA 4CM5A 1RXWA 2EG5A 4QYXA 2AR9A 4RLSA 4MA4A 1CRZA 4G0MA 4AJHA 1T3GA 3IQXA 1YR3A 1MEEA 2AF4C 3FDXA 4RHCA 4F45A 1ZYUA 3KFXA 3DT8A 4OMCA 4AKSA 1VGRA 3LUDA 4DLXA 1DAGA 2R2AA 1C14A 4H0CA 4Q1AA 5A62A 1SURA 1URPA 1E5XA 2OZEA 2HDHA 2I4RA 4K03A 4RHUA 2NWQA 2R8XA 2FDXA 3SU8A 3I1JA 4BEVA 4FFWA 4B2LA 2PUTA 3LUHA 3MTQA 4RC9A 4UBOA 5GMOA 5AWFC 2W2VA 2PFKA 2HU7A 4MITA 4X64B 5H7XA 4AMUA 3K09A 2IU3A 3CEHA 1C3EA 1Q1QA 3V7YA 4J6EA 5CJ2A 3UB2A 4WNAA 3VH4A 4CM8A 1ULHA 1E9DA 2JIPA 1OXKB 2YY6A 1CT9A 3IQEA 3PKZA 4M0CA 5B1HA 3WIOA 4YALA 5PNTA 3U4AA 1WE2A 4Z49A 5HKAA 3PPVA 4B46A 2CLLB 4KREA 1DCKA 3STHA 5A0FA 2B92A 3FD8A 2WIBA 3WK9A 2J09A 3E4CA 1LJLA 1KQ3A 1U99A 3TGWA 3VVCA 5L51A 4BLWA 5JXGA 3RIYA 3BYZA 2CV2A 2PT5A 3K0FA 3WOHA 3R9IA 1TB4A 1Y5MA 1B4DA 1ZBQA 4E7OA 4NDAA 4OFWA 2IGTA 2J0VA 4OY3A 1K7CA 3AW8A 1BEUB 4I66A 1JEOA 3LCUA 3OM0A 1SFRA 4DBLE 3LT0A 3FLBA 3OE7A 3EQ2A 5LOVA 2WSMA 4RD3A 4XE5A 5CA0A 3TJZA 2O23A 4AJNA 1TZCA 3NRCA 3RPEA 5KNLA 1GR0A 5EZQA 2YQZA 4WX2B 4FEGA 3H8JA 2W2QA 4OQQA 5GJCA 1P44A 4MUGA 1PHPA 3DA8A 3Q1KA 1U2TA 1Y42X 4UNIA 4MA0A 5IYZB 1UBOS 4BGIA 3MPUA 3Q15C 4UZFA 4D3DA 4YBZA 2B4RO 2OBBA 2PLAA 5AW6A 5JSZA 4WN9B 3KYBA 4EI9A 4YDQA 2VL7A 1T2DA 3A2MA 1JDSA 2AG0A 2J3EA 1K9VF 1GPUA 2PUHA 4MQEB 5AKIA 3WLSA 4O3MA 2BKXA 4ZXFA 1OTXA 2XBUA 5HZMA 4B4DA 1XMVA 4MIKA 1HORA 2XCRB 1R37A 3W5IA 3RK1A 1K8YB 3C5EA 5EIBC 1UBGA 1GQSA 4LRSB 4KDCA 4OBWA 3PD1A 4EGFA 2IEDA 3M81A 4XVUA 3RS4A 1OBCA 2OORA 2WVHA 3TTYA 3NTUA 3ADKA 1XQXA 1PU2A 2A7XA 3EC1A 2ETVA 3HVKA 3ZWXA 3NH9A 5AW0A 3B2NA 2HREA 2CCGA 3JD3A 4JR2A 5L3SB 1CUDA 5SY9A 4MS4A 4NOMA 3HU5A 1V95A 5JY6A 5JWHA 2FK7A 5EJGA 1CIJA 2POQX 4ONEA 4P3NA 4OSEA 4U0KA 3AHCA 1KRXA 4J3FA 3AFOA 3Q2KA 4AM8A 1LV8A 2ZIWB 3Q4GA 4OXIA 3RC2A 2A6PA 2NVWA 1VI2A 1DCFA 1ZI8A 4REQB 1Z5UA 1SXJA 1PFUA 4MI9A 1MT0A 3LL7A 4UEQA 2CDRA 4P84A 5CJJA 2C5AA 5D3ZA 3FOWA 1A4RA 2F9LA 3NZEA 2JH9A 5AHKA 3OKAA 4QGBA 4UM5A 2ACEA 1VMDA 1Z4NA 2CVPA 3D0QA 4IOKA 4C5AA 1QGAA 2QWXA 2VHYA 5I45A 1U8UA 2N42A 2JGIA 3DXZA 1JXQA 2WPDA 3TR0A 4YT5A 1A8IA 3U4QA 4UJ5A 4YPFA 4N0MA 3MTBA 1HETA 1TIBA 3IOCA 2B2CA 4NAHA 5LXTB 1O0SA 1JEEA 1VGVA 4LJRA 1BVHA 4ETIA 2R8YA 4YTEA 5IJ9A 4BMZA 1KYYA 2Z8ZA 5KHLB 2XTMA 2FSVC 2HNKA 4N3AA 2WKSA 2AVDA 3ERCA 1K9SA 1MC5A 1R18A 2GEJA 5JSHA 4BJHB 2E5WA 4N12A 2G9RA 3D4PA 4RJKA 2FKAA 5AM3A 2OC9A 3V8QA 3MOIA 3CRVA 1QK4A 3GGDA 2IZOA 3IUJA 4OHFA 3RUDA 1Y4AE 4ENVA 3WRVA 2ZIXA 3N9IA 3KJQA 1A97A 4AKTA 3B13B 4ENWA 1PTJC 1ZM4A 5KWEA 4GZ3A 2ZTUA 3LKVA 3QVMA 4ARIA 1NXXA 4U3JB 4BVLA 3TQTA 3ZWKA 3PDCA 3I30X 3QYPA 4F4CA 1UJNA 5B55A 3C85A 4N65A 3LPAA 3NGLA 2QYOA 3DT6A 1DUVG 3H2GA 1H5NA 1TZJA 1YE3A 4FW9A 3VSBA 1WKBA 3WMWA 1AY0A 2B1RA 1K08A 2HQBA 2HK8A 1YJBA 4JOCA 4DJFC 2RC6A 1YBMA 4GS5A 4DDUA 2TMYA 3AETB 2NXEA 5CITA 1U3DA 3BD9A 4O4LA 2QLLA 3OJOA 2FMHA 4LJSA 3PSHA 5DTMA 3WICA 1BS2A 3ODGA 4C03A 3KKQA 2ZBEA 1II8A 3AGQA 1YQGA 4LF5B 4G25A 2RHRA 3L7LA 5TPZD 2AYYA 3U39A 4Y98A 3W5UA 3R5FA 3S2EA 4IX9A 3EVBA 1J6UA 2V54A 2XQGA 3DZDA 3STXA 4FSHA 2JCXA 3ECAA 2ATXA 4UQOA 1H2RS 1F0PA 2FK8A 3PHLA 1QONA 5I9BA 2P2DA 4YAIA 1T25A 3C1OA 4KN9S 3R3XA 5L4SA 4RTOA 1WHSB 2G77B 3HCPA 4NIMA 3VSEA 1F2TA 4CLRB 4CI0B 2EWWA 1VPTA 1ZPDA 4OV6B 5KKNB 5KTSA 3UBMA 3S4YA 1W5BA 2YMLA 4RF5A 5A7FA 5BO5A 5CXQA 4GE3A 3R3ZA 1G2OA 2GPSA 3NUZA 2Q0XA 3SCZA 4MLDA 2HEIA 4HEA1 1HLDA 5BXYA 1MJGA 5ITZA 4Y9UA 1JG3A 5K3EA 1J7JA 4P5DA 4N82A 3ONWA 1WUTA 2CCJA 2H0QA 4MGYR 1WDLA 2P1RA 2ZAYA 5LYYA 4HZUB 2H7CA 3X0DA 1RHJA 4R41A 2PBLA 3WOVA 2TMDA 4XQEA 1XKTA 2WWGA 1R4MB 4GX1A 4CKZA 4KO2S 3TQCA 3QXJA 3M9XA 3PQ4A 1Y3AA 2CY0A 1TK3A 1O57A 2V7PA 4ND3A 3SX0A 3BCUA 3NJ4A 2IUEA 1OX4B 2GH1A 3TW4A 1W52X 3CT6A 3LH5A 3PK0A 5JU6A 4MEJA 5BNTA 1AHPA 3Q8LA 4UVHA 2CXUA 5EIWA 3OM8A 2QZSA 2B2NA 3HVHA 1XVIA 1JU4A 3IPRA 4L57A 4DG8A 3O5AA 3F7MA 1UBJS 1R10A 1J8YF 1JIUA 2IE8A 4BNKA 5K4HA 1CZHA 4TS1A 3AXTA 2Y27A 1DDIA 3VVMA 3LYLA 1BXRA 1Z6YA 3BWCA 3R7AA 3WWYA 3PXUA 2R6JA 1B0AA 3C3DA 1E2KA 2FPRA 3KPJA 5FPSA 2IDMA 5LB4A 4ZKDA 2DJ5A 1H94A 1O6ZA 4M0UA 4BFWA 5EZYF 4M1SA 3TCNA 3MUFA 1TKRA 3OFJA 2RHWA 3I12A 1N1DA 2DPHA 3GZTB 2B20A 4HNVA 2B35A 4CQMB 1FTSA 2WWYA 2GDZA 3A1CA 4ZOLF 3BFKA 3Q8XB 1WKCA 4R0NA 3RVNA 3E1SA 5AKZA 4CCWA 3LBAA 4OXXA 4CR7A 4YRSA 4O4JA 5SYMA 4BNGA 5HJ7A 5A7GA 2IX9A 1USGA 4EEZA 5KYUB 4QXRA 1Y1KE 1ZSYA 1CC1S 2R6HA 2QU7A 1A8HA 2YV3A 2AMJA 1G8GA 1L7XA 1W1IA 1YZGA 2AC2A 2R60A 3TSOA 9LDTA 5JVDA 2CMHA 2BOVA 3T7AA 2GKGA 221PA 2ZGVA 3G6WA 5TNXA 3TTSA 2CLFB 2ZJ2A 1QCDA 3OSUA 5JQGB 3H4MA 2QGFA 3SLRA 1E94E 3ULKA 1XJ0A 3BWDD 3WO1A 4MI3A 3FLEA 1AUXA 1D2RA 5M04A 2WDZA 1BMFD 2VQ3A 2P27A 3OTWA 4PGFA 2F9MA 3LDFA 4TV9B 4D4JA 3LLCA 2B8WA 3ELWA 2YX1A 1DAIA 1ZZEA 4I6EA 4JENA 3ZV5A 1NMXA 5K5EA 3JQDA 1H6BA 2D4HA 5HZKA 4Z4HA 5IXJA 2JK1A 3PQ2A 4IAOA 1NASA 1EG2A 4DAEA 5F35A 1IWPB 5HCUA 4P7BA 5J2TB 2LVBA 4TROA 1BG6A 4BBPA 2P7HA 4X85A 5F7JA 3ILHA 1TW3A 3MWDB 4U8GA 1E1RD 4ENRA 3U4HA 1Z0ZA 3HJFA 4NS4A 4AYXA 3PQFA 1BQ3A 4FC7A 2V9ZA 4HB0A 3ZH9B 2MYTA 5K99A 2Q9UA 1C2TA 5LLDA 1QRUA 1TI7A 3HNPA 1AZWA 2P5YA 2VOJA 5EUMA 4WKBA 3WYBA 4U7FA 4C3VA 4ZTUB 2UVQA 4J0IA 3G5AA 3FNBA 3K0EA 5ADVA 3KTFA 4C7MA 3PZBA 1B6RA 4MMXB 4MGKR 1E3WB 1UWVA 2HV8A 3OD1A 3LGXA 2DQZA 2ZSDA 4DQKA 5AJTA 5BNIA 3PGKA 3IHWA 2OXRA 2GM3A 1YB2A 3MBIA 3EODA 3MSCA 1TA0A 1OAOA 3IEIA 5AXAA 4YK7A 3SHWA 3ZCRA 4B47A 3GP5A 3Q3HA 4PSKA 2WHXA 4I6JA 3UK0A 2R6GA 4DMLA 5ECYA 5GOTA 1H9AA 1JYFA 3AZQA 4PX9A 3L4JA 1XKLA 5AVYA 1NDHA 4PR0A 7MDHA 4CNQA 1RMYA 1TADA 2YJ6A 3E3OA 4L4YA 5IZCA 1ORRA 1QORA 3OETA 4HATA 1HWYA 3PGMA 1GV0A 2FPSA 2PJRA 4J7AA 4H3SA 3VKWA 2AIRA 2EP7A 1HG0A 4DJAA 4TM7A 2I33A 2K2WA 1A5ZA 4B7CA 4I99A 4E32A 4Z99A 3GVPA 3GJTA 4GUAA 1S01A 2I55A 1AC5A 4CQNA 1YMUA 2JLXA 3AR3A 2HA5A 4WZ6A 5TDHA 4BFTA 3RVQA 2FN8A 4J76A 3PPYA 3DZJA 2XYQA 3NYIA 3SDZA 4HGZA 4B3JA 3DB2A 3WK7A 1VE5A 2BMFA 2F8MA 1BA3A 4R9RA 3GF4A 3B1XA 4N6NA 4Z4CA 1X7WA 2G5GX 2VKQA 3GFVA 4QEKA 4BX3A 1EEHA 2QNRA 1E0AA 4NYMQ 1H8EA 4JBLA 4IIDA 1V4BA 3MBKA 4ZCIA 1T3ZA 5T7BA 4U00A 5A9TA 4FHGA 2DCUA 1FJHA 5LQRA 4Q7KA 5JS8A 5CEFA 3FOEC 2VJYA 2CVHA 3T3DA 4TUYF 2P2CA 1E2IA 5TY0A 2MSDB 4HLDA 4JSRA 4G0XA 2M6LA 2HA7A 5ALEA 2ZAMA 2JFBA 2JW5A 1JE1A 3RTDA 4C5BA 1SCUB 5AI4A 2CHEA 1SQ6A 4FE7A 1N9GB 1XEAA 2JCGA 3NIDB 1PT5A 1EVEA 1QF7A 3L4EA 3QOWA 1E9RA 1CY8A 4IJUA 2X1HA 2PYDA 4G01B 1VKRA 2Y4OA 4QBFA 3G79A 2PX5A 4GZ6A 3GAFA 5HF8A 3TTXA 2VUSA 1Z37A 5K03A 4YAGA 1Q0RA 3ENKA 3BQMB 1D8AA 1L7QA 3PDHA 5AO9A 1LBSA 2P9QA 1T2NA 2YUTA 2CUZA 3BCHA 4G5QA 4Q4LA 3NU1A 4YRNA 2QR5A 4RK7A 2I4IA 5CT4A 3ZHUA 3OOEA 1EFTA 2VJLA 2RGNA 2JFOA 4DQUA 2O48X 2QVXX 2W6MA 2GBCA 1PGOA 2EX1A 3IQGX 3QZUA 1RC0A 1IUOA 1ATIA 3H1BA 4LXHA 3UG6A 2GZDA 5IH3A 2QE6A 3RT9A 1T2EA 3LWZA 4DRXA 2EFYA 4RVUA 2A1TS 2GZHA 1JHYA 2G08A 4FEAA 1L7VC 7REQA 2OV1A 4QFBA 4BKQA 1W5TA 3N3AC 1T8YA 3FYCA 1SOWA 2BHNA 1BQ4A 2WF8A 4UZSA 4F71A 5B53A 1NKVA 1XI2A 5HYVA 3N2YA 1KOLA 3MCWA 5CB8A 1HSZA 1MT3A 4CM3A 4IRMA 3AJRA 3K2BA 2NW6A 4IMPA 4JELA 4M7WA 2JFXA 2HMYB 4WY2A 4MMZB 3VR3A 1ADJA 1BU5A 1VBFA 4Z4EA 1I32A 5CJPA 1UBLS 1X6VA 1QWOA 1UFVA 1TXGA 1QGZA 3IALA 5D01A 5IWAB 2RIPA 1O9HA 1SIWA 2XMZA 2FHPA 3CN9A 3QEJA 4X1YA 1T2CA 3RG8A 2PUVA 4HRVA 3SQMA 3NB0A 4JVSB 4X44A 1KYQA 1NW4A 2D1YA 4MVJF 4URFA 3OFNA 4HAOA 4XLZA 2FUG6 5HGXA 3SD7A 5IVPA 4CG0A 1GN9A 4MYUA 2GEUA 1ULBA 5DHFA 4EZIA 1DT5A 4PFKA 3EGDB 1N9KA 1CRWG 3M82A 2W2LD 3D0RA 1WP9A 5CK5A 3ZE9A 2ZJ1A 3HU3A 3SBXA 3OE1A 5D1NA 3RSSA 1M66A 1WLSA 1HDOA 3BXHA 4HHEA 3C3YA 2XMCA 2R8ZA 3SJAA 1JFFB 3ZCPA 1T4CA 3JQ9C 1PZHA 1Q95A 1DXQA 4ER5A 3HDHA 4HAVA 4HI0E 4P7JA 1N7HA 1IB0A 1GOTA 3ZQKA 2GM9A 2NAPA 2HQ1A 3V7UA 3VR5A 2Q0SA 3G5UA 5HCIA 3WLTA 1GO2A 2ZUEA 3A1WA 3UFBA 4Z9FA 4BKMA 4BO4A 4HDSA 4CT0A 5CG2A 1F51E 2WIAA 1JI3A 2HT6A 3IP6A 1RI1A 3UHOA 3JYQA 3UICA 2XYPA 3QWBA 4DIOA 1V43A 1W0JA 3EXIA 3M6LA 3EXEB 3LM8A 3ZLUA 1EM8A 2GZRA 3NHMA 5ICFA 1TCCA 2O4CA 1F7UA 2I54A 5LP6F 5B4UA 3V6MA 4IYJA 2R4UA 3DVAB 3HVJA 4FM9A 1FA9A 5BN4B 1Y5NA 3T0GA 4DZZA 3MB5A 1E98A 4MWEA 1BXGA 4E33A 3S28A 4RNCA 4J6FA 5FNVF 3QNWA 2V7VA 2Q5EA 3NUGA 1IHUA 1P9WA 1EWTA 1TC1A 1VLLA 2WHYA 2QI9F 3CNLA 1CUSA 1DRWA 1M0SA 1QHHA 3CEPB 3DMGA 3KVNA 4P4GA 4QJBA 4F8YA 3EOZA 3L49A 2PPVA 3PEVA 4FYHA 1IBSA 4OA5A 1YS6A 2O3UA 3HG7A 1RRPA 1C1YA 3L0BA 3PYXA 2PZKA 2UUAB 3R5HA 1NU8A 1UXOA 2W2MA 2HMAA 1I7QB 2VTBA 3KDPA 1RZRA 1NI4A 3TCXB 3OC6A 3OPVA 2NTVA 3GEDA 1X8LA 1E6LA 3NAQA 3PKJA 3OIGA 1YDMA 3IVXA 4JJGA 3W6OA 1QQTA 4K05A 3PNBA 5BOVA 4U5XA 4LYGA 4D3ZA 2E85A 1OXSC 3WGGA 1K4YA 2WD7A 4RM2A 4QUHA 2RGCA 3OY7A 1S2NA 1JB1A 3VR4H 1FYWA 4Y2RA 4L8FA 3KZCA 4HPWA 4HAWA 4RK1A 2C7RA 2FWMX 3FSEA 5FUBA 2I1WA 4K86A 3CVWA 3UBTA 3AVXA 2YV1A 3TVYA 3K1YA 4LG1A 4Q4DA 3IX7A 4TVBA 1XAJA 3ITKA 2LGJA 1PZGA 3WP0A 2JASA 1XTPA 2IPXA 3R7BA 3BSFA 3KR1A 3I5YA 1D6MA 1II9A 4W5NA 5HCNA 4KGZA 1H9BA 2YFKA 2F2TA 4LYEA 5JE8A 1HL3A 5FNZA 2XV1A 1H65A 1U4NA 4NJMB 4P3XA 4C30A 3THXB 4R8KA 4HUTA 4L9WA 3IXLA 1JHPA 3C39A 5BVHB 1LTQA 1YL6A 2Q4DA 3NW9A 4MCAA 4PZZA 2ZR9A 2H4YA 4R69A 2J1LA 4UEJA 5IJ0A 5K01A 2RAFA 1G9TA 3WJ2A 5IF9A 1YFJA 3U5ZB 1HO3A 1U1IA 2DSNA 2PRIA 3OQ1A 4QJ5A 1BWRA 4ZREA 3HRHA 1CJVC 1X38A 3N0WA 5LIPA 1H0KA 1NX9A 2CXSA 5T4FA 4EY4A 1M6YA 4F04A 1GGFA 4JBYA 4YMLA 2ZIGA 2OD2A 3DR5A 3PEFA 1GAXA 4MS1A 2G17A 1W76A 3OZXA 4IVRA 3C3PA 2XTNA 1JQ5A 1L3IA 2FHSA 2HF7A 4OLHA 3K5PA 2ERXA 2JLZA 5IT4A 3QMMA 1J70A 2NO0A 3A6ZA 4R9UC 4D92A 4EFNA 1YZKA 4XB1A 4F92B 2VK8A 5JSUA 1MAUA 2I99A 2W6QA 3B2QA 4RCYA 2CL7X 2SKCA 3VNRA 4UPEA 4WZBB 5ER9A 3QPVA 2C4HA 5I9NA 2CWWA 4XSHA 5MN5A 3G9ZA 1UOQA 1XFAA 3PHCA 3NBZC 1K8QA 4PE5B 3VR0A 5I3CA 1J00A 4NBNA 3SIXA 2OM6A 3MWLA 3T99A 3G0OA 4M38A 2OHOA 3VRHA 4PW0A 4JAVC 3RQIA 4BNXA 1N78A 3QVOA 5ALSA 5D1HA 2H4HA 1S5PA 2Y67A 1XLTA 1MZPA 2GD1O 2TSYB 3MLBA 5IBCA 4L9AA 1C9NA 2LXNA 5FOVA 2GBFA 3CFYA 1NGSA 1Y5RA 4KRGA 4KN6A 4RW0A 4YREA 2PR7A 3D1LA 1DEAA 3WO0A 3CVJA 5FOXA 4HVAA 4OXKA 3ILYA 2JATA 2O8EB 3T0FA 4L27A 2OE2A 4W9MC 3BRSA 1XE3A 1MJ5A 1QSGA 1U4SA 3H75A 1NTOA 3T8YA 4LF4B 2QTBA 1Z16A 1S4MA 1IN1A 2FAXA 4OIMA 3EVGA 2BGJA 1SUDA 1ORIA 2Z3VA 2NSHA 2IPOA 2FEXA 2OO5C 2FUNB 4RMGA 3I1FA 4KMMA 1UBEA 2XA2A 3GCXA 3GWZA 5A0VA 4IGEA 4J0JA 1ZMOA 3HXOA 1U8FO 4IVNA 4YMTA 2Q7OE 2AJDA 1XRJA 4N3NA 2OEPA 2EIHA 2JFZA 2CWDA 4PS0A 4GMHA 1JN0A 2EZUA 2XUGA 3P2YA 5C4IA 1JEQB 2C9OA 2ONCA 3AX6A 2VAPA 3CWZA 4G1FA 2MYPA 4I9UA 5JD4A 1PWHA 4ZANA 2I91A 2FPLA 4DBVO 4YUZA 3B3AA 3K8YA 2O8CB 4F4DA 5BR7A 4BFCA 5EIBD 2ZZKA 4OJTA 5BR8B 1XKQA 1Z5PA 2EF1A 3IT1A 3QWAA 1PJAA 3IBCA 3JVVA 3C3AA 3MFYA 5GY7A 3DDCA 1JHRA 1KMCA 1K98A 1VFPA 2DE0X 2UZAA 3CMCO 4DSZA 1XK7A 1VMEA 2B8EA 1V6SA 5KNBH 2I5PO 3PLRA 1QYVA 1I7PA 2B2XA 2GASA 1VKJA 4FPXA 4BQIA 3H9BA 3GJ4A 4N3CA 3DHVA 1PLLA 1W6UA 3PQCA 2GJKA 3HJTA 2NV0A 2WF7A 4LZLA 3KJEA 1XVLA 3ZWMA 4FT2A 4ER0A 2JLVA 4ED9A 2GPAA 4P3YA 1Y4SA 1YRWA 2QEQA 3ZWWA 3MZ0A 4WRRA 3NNDA 5AOCA 5GONF 3P2OA 5THKA 2AI2A 1ZN8A 3TRFA 4N41A 3C8HA 4ND6A 3LXXA 3AR9A 2X7HA 5T6BA 4URWR 4YIHA 5CGQB 1OWNA 2XTJA 3JAWB 5GGYA 5GADl 4JIMA 4RXUA 4LJ6A 3WWDA 3EH1A 3OJLA 4J4TA 2QSJA 3UGQA 4R84A 1UK9A 2GGSA 3CTPA 3L8MA 5AQ1A 5KWSA 3KP1A 2VJMB 2YN2A 3JD2A 4JQCA 2XZOA 3PEYA 4FOPA 1WX1A 2G70A 5EJ4A 3VPXA 1A7JA 1HYEA 1UDBA 4KIWA 4DPKA 5CFNA 3DLBA 4IGAA 5D87A 4LCJA 4FVTA 4YROA 1GFIA 2ZJOA 5JNTA 2IU4A 3ETLA 2DWOA 4AS3A 3KEMA 3DP9A 5CH3A 1WCV1 1M2OB 4FFRA 3HRIA 3MPOA 4I50B 1S8OA 3F6RA 1M2VB 4UM8B 2VBFA 4BN0A 1AKVA 3VC7A 4ZPJA 2AN9A 3ZHBA 3C45A 4EK9A 3UK7A 3EQ7A 3OZVA 3V4VB 1XJ5A 2MR5A 3I45A 3VO8A 1M8KA 2QRQA 1E64A 2ILVA 1KMNA 1K3TA 1PR3A 3EN0A 3Q9LA 4JITA 4RGYA 4MLPA 1JDTA 1QRSA 4YMHA 3SHVA 5HUHA 4HLNA 2UZ0A 1XZHA 3ZU5A 4L85A 4PZYA 1NULA 1J33A 1U28A 2LBPA 2PZ8A 3FTQA 3RYFB 1JQBA 5CA0F 3P2JA 2O0MA 1LD3A 3UNXA 4AN4A 1PDWA 2YIJA 1RM4A 3Q0TA 1L5YA 4XXHA 1UZLA 1D09A 2B4KA 4W5RA 1Z62A 1Z4LA 3F7TA 1Z7EA 1MH1A 1R0LA 3C43A 3WB9A 5KTMA 1KJ9A 4FYIA 3VC1A 2GM4A 3IT3A 1XZCA 1TU3A 1XNGA 2WHEA 3DVQX 1Y9AA 1YK1A 2H4WA 2J41A 2RAUA 3KZXA 3UA3A 4B8WA 3ZIUA 5KB3A 3TQHA 1E92A 2CEKA 2WSLA 4BU1A 2KWIA 4MKGA 4UHDA 2BP7A 1QH9A 1RDFA 2VEDA 3C97A 3AVYA 3PUIA 3C7TA 4RFSB 2P90A 4CN9A 2P68A 1D4OA 2H7VA 1HC7A 1EGAA 2UKDA 2QTVB 2FPIA 3MSXA 1YRHA 2B5VA 2W6JA 5DRYA 2WQ7A 1AJEA 4YRJA 5HK9A 3L43A 3OECA 3FDIA 1AS0A 5MN6A 4OHCA 5DK4A 3ZBTA 1H6CA 3CB4A 3FUVA 3G8DA 3A10A 1DCTA 1C8KA 3Q98A 4XQ9A 2O19A 2B9VA 3RUFA 1SN7A 3PNVA 2HRQA 4G8BA 4OFBA 3INRA 1YONA 3DTVA 3C5CA 3ISVA 3KKLA 3KU4A 4FR2A 4FUTA 4MUIA 3KR9A 4W1RA 4EHJA 3HYLA 1OZAA 2B6HA 2G9ZA 3AI2A 1PEYA 3MILA 2EU8A 3AV3A 2BEUB 3ZCXA 3ZXUB 4CF6A 4R1NA 2O2JA 1KQFA 5KU7A 4O6VA 4X1KA 3YASA 2FZGA 5FOUA 1CLEA 1MO3A 7YASA 4F5DA 4HRAA 4JB3A 3OZIA 5REQB 3H4VA 1N2CA 4UBMA 1P19A 4GZ5A 2ZUSA 5EE3A 4CMIB 1EQUA 1LDBA 3KXDA 1SXIA 4OHKA 4DT1A 4EMTA 3GAAA 4DCNA 3H0CA 1ID8A 4M3NA 1CKEA 1AQUA 1IN8A 4KN8A 2VHWA 4JHLA 2VJKA 2Q2NA 3VU1A 5TQ0B 5ARBA 2RAPA 3T1YB 1SKQA 4PRLA 6LDHA 2R00A 4V3BA 2Z5LA 1YDFA 2AJCA 2RK4A 5BQFA 3OWHA 4JJ6A 3RFVA 4BX9A 1YJQA 3FMFA 4V38A 4TXHA 4GVXA 4AJ9A 2MSKA 4J16A 1U7XA 4PX2A 2MCFA 3TOVA 1PWZA 4HNHA 5H68A 1TF2A 4CQLB 1IONA 3GLHA 3LVQE 1GSHA 1KETA 2C58A 4BZWA 1QP4A 1OI2A 3IUQA 3O38A 3HGMA 4WKNA 3IA2A 1L4YA 3KETA 3VR6H 4B3SB 2YV2A 2I0FA 1ZKDA 2IF2A 5BYAA 3TAUA 2GOYA 4P22A 1AF4A 3GG9A 3D4LA 1C4KA 1MAVA 3MS4A 3UK2A 1NVVQ 1SKAA 5F33A 1KEUA 2O8DA 1SH7A 1XVAA 4JUCA 4QPNA 2VATA 4IOLA 4HLUC 3RADC 2BJVA 4CCYB 3CW2A 2MOKA 3C8DA 3CGWA 2VP5A 2H9YA 4R8MA 2X8WA 2RGYA 3MN1A 3MUOA 3IDAA 5LZ8A 2Q2VA 2W83A 3BREA 2H5IA 2QXYA 1K2VN 3MD9A 4G1UC 4PVDA 1SB9A 3V2IA 2VAVA 3JASA 4J2TA 1ISMA 1JZSA 1SBYA 2IEZA 2HSWA 3FR7A 4ALLA 3NNSA 4PLPA 4D8WA 1RHMA 4C88A 3TKLA 4HX2A 4DG5A 4R6WA 1XTTA 4FZRA 2O0LA 1T1GA 2YTZA 2RONA 1DBQA 1RMQA 1XEXB 4FZVA 3WRXC 2Z08A 3FPKA 4DNXA 2QTNA 2I67A 1ILWA 1RXVA 3VAAA 5C31A 5IEJA 1WZEA 1HOTA 1RTTA 2I62A 2AD5A 5KNDD 2HB6A 2NYUA 1W4ZA 4TYYA 1QYWA 2EX0A 2SCUA 4P7FA 2WUDA 2VYFA 1NONA 3WLPA 4B6OA 2N1BA 5JANA 2QQ5A 2JANA 2MINA 3KCNA 5CDFA 1UPUA 1O77A 3KT0A 3Q7IA 3VOAA 5M2QA 1WBBA 5DM70 3JQ7A 1Q77A 2WVJA 2CSXA 4C7BA 1UJCA 4M55A 6YASA 1Q44A 2CF5A 2NU6A 3I04M 4XTCS 2FPWA 4AKEA 3PDIB 4S1OA 4FI3F 4EHBA 2WHQA 2XZLA 2FZWA 2AL7A 1CE8A 1TM4E 2I2FA 3LTEA 3G1UA 1HFKA 3OC0A 4NF2A 1AKTA 3HK2A 1AE1A 1S1MA 2HLDD 1L5HB 4PXYA 2NYRA 3ZZNA 3S8EA 4HL6A 3A32A 4K6HA 3CX3A 3HYSA 4IFEA 1UIRA 1UZMA 3H16A 5C7LO 4QULA 2QJTA 3BMQA 1GQFA 1EFKA 3E5MA 3HBFA 5F64A 3E8XA 4B44A 1QUFA 5AKGA 3QFFA 3KHUA 4MYCA 2ANBA 3KAPA 2FN7A 2FLWA 3DBVO 4CE6A 4LRTB 3W8EA 3EXG1 5TGZA 1LZKA 4A27A 3SE7A 5JAUA 1ZGAA 1EIZA 2BI4A 4J0KA 3GRVA 1M67A 2XHZA 3CJRA 4ZVOA 1BWSA 3EXFB 1J0AA 5JCOA 3FCEA 1J56A 2OCDA 2J9FB 1C50A 3GDOA 1G21E 3DFMA 3JR7A 4N7JA 2GZ3A 1M8PA 2GB4A 1EK6A 1PJRA 2FW7A 3PQEA 3NPMA 4HVCA 1KYZA 5JLAA 1D0VA 5AOVA 3OX4A 5CNIA 1YTUA 5CIQA 1ZVMA 2IHJA 3CVYA 1X3SA 4XYLA 3I39X 3OEEA 3OCWA 1T3LA 3MXTA 3OQHA 4XWOA 2H2IA 4IWYA 3PVZA 2UYYA 2IIVA 2ZSKA 5HOQA 4X0EA 4I4NA 2EKZA 3P1JA 4FHCA 2Y05A 3BCRA 1Y1QA 3NO4A 4HCJA 1LPBB 2EEPA 3BXEA 4J7UA 1LUAA 2CXTA 1VPEA 1NVBA 1XQ1A 1O87A 2EFHB 1SOMA 1MABA 2IK8A 2Q8PA 2R7LA 3GJ3A 1Z2OX 3K6KA 5J23A 4I14A 2WJHA 1E2BA 4IF4A 1E0DA 3II6X 1YU6A 3B3QA 5AJVB 1H3EA 1A1SA 1EGHA 1HDGO 2VJPA 4DMFA 2NXJA 5ALNA 2PKWA 4WERA 5MFPA 1ISIA 4KX5A 2HDNB 2JJ2A 4PFJA 3WGUA 4A23A 3I9JA 3LY7A 4RTLA 1FP4A 2MMCA 1L1EA 3U13A 2WU0A 3KUXA 5ALOA 4Z7JA 5EZYB 1UM9B 2IKSA 5H81A 1WW3A 2REXB 2H2AA 1TU4A 2PQ0A 4UUBA 5IM5A 3M8KA 5E6RA 1YV9A 1VXOA 2QF7A 3BWEA 1Z6PA 5FUXA 1V71A 5KJFA 4OBBA 2QV7A 3UAZA 2GEVA 3DEAA 3G0CA 4ZOLB 1FTNA 2VCYA 3OIVA 4LSZA 3S29A 8AT1A 1IPHA 3MRVA 1Q50A 1XELA 2OOSA 4LRWA 4EGAA 3CEAA 1E2FA 4YAEA 3FVWA 3BAFA 4C0JA 4MPJA 1OFHA 1DARA 1WMDA 3OQNA 2P3QA 4XI9A 5FUVA 2WTBA 5EHZA 1P2BA 2DHCA 3HDTA 4F46A 2XUKA 1G5QA 1BS9A 1DUSA 4AWBA 1DTWB 4MV0A 5JCPA 5G41A 3UQYS 2XWBF 4HGRA 2Q5HA 5EFOA 3E9CA 3TKYA 4Y0AA 5JHHB 1IK4A 3IV6A 3WLAA 1E4EA 3HL4A 2CNWA 5DW0A 4M8IA 2ZRBA 1QUEA 4HWRA 3KC2A 5CAEA 5COAA 1FTGA 2F1RA 1QK3A 3A6GA 3ZXIA 5KMGA 2W2OA 1WCXA 1ZGCA 3EQ9A 4KFUA 4BEJA 1M34B 2J9YB 1NG9A 2HI0A 4WXYB 5K0CA 4D6YA 2VHQA 3VPCA 4GR5A 1B8NA 2QT9A 3CLUC 3TX6A 4FBGA 2IZ7A 2QTWB 1FVOA 3P0EA 1JG4A 2XUPA 4MO2A 3ZCQA 5GZ3A 2QY9A 3CNBA 5T67A 1EXVA 1XQ9A 3PZRA 2AS0A 3HXLA 3DMPA 2FMUA 4J1NA 3OLXA 5IH7A 3KJGA 1JHVA 5DX1A 4G36A 2GKOA 3TZLA 4GRDA 3ZDAA 5HZHA 1JIJA 1V5FA 1XTUA 2CLEB 5DPMA 1KXJA 3HABA 1E0SA 2KX7A 1SOUA 3EZGA 1NHGA 1O1YA 1GZVA 2XKJE 2K5UA 4JZKA 3RYIB 3CUWA 2WZCA 2HSEA 1DGQA 4RV4A 1RJFA 1NXPA 1OXBB 3A4NA 3QVGB 2AFIE 1QFYA 3F1KA 5AK4A 3H9GA 4W63A 1ZH0A 4KPUB 4KTVE 2DH6A 3KPVA 3V48A 1LTHR 4B7XA 4OF4A 3R3YA 4X00A 1Q3TA 2J33A 4BL5A 4RK6A 1MOSA 2X2EA 5ILQA 3RYCB 3C3BA 1ZQ1A 4L8LA 4C9BA 3P9RA 2C3MA 3A7EA 4M9ZA 4RORA 4D9BA 5HQ3A 1RPZA 4Y6LA 1T3HA 3SC2A 5KJCA 2G5PA 1ECGA 4M0LA 2BGIA 3NDJA 1ZRHA 3QU4A 2BZGA 4N0QA 1W2HA 4GX5A 4N49A 3K1JA 2QW8A 3TBFA 4MJ3A 3DLAA 3MUEA 3UW3A 4DA7A 3FZQA 3KTDA 5DNUA 4XPZA 3BB3A 3JAKA 2ZVQX 3EIEA 3DOEA 4G41A 4WT7A 4KR6A 2AE2A 3O8NA 4R2MA 4YHBA 2VSFA 3N7UA 3EGXB 1SVKA 3D6JA 3L8DA 3UAXA 4NWIA 1HZZC 2HWKA 1CUWA 4GWKA 4BZZA 1OAKA 2GCNA 1ZLYA 4QOFA 4WLVA 4I46A 4DUGD 2TRSB 4MQLA 3NAMA 4HWOA 3I5UA 3HHPA 3CN7A 1FFDA 2H1RA 2VPYA 5H16A 1MW8X 3VYRB 3IV9A 3OFVA 3JCZA 1VB5A 2OCXA 2HU5A 2ZSFA 3GUHA 3MT8A 5T4HA 3S0JA 4CR8A 3D54D 4RA9B 4BMDA 4DABA 2HHHB 2JGMA 4QBIA 4TUYB 4FFLA 4XW2A 2D1QA 1IQUA 4MDHA 1PUIA 1TYBE 3FPGA 3O2NA 4QHTA 4M76B 3WLEA 1RBYA 2DWUA 4N9QA 3PNOA 1U3CA 4KQJA 2NU8A 4CMKA 1ZOPA 2ZJ6A 2VFAA 3CUYA 3EASA 1XTIA 2X7JA 1ODTC 3IAM1 4IQGA 4A16A 3OTQA 4XX1A 3DMTA 2ODQA 3GWGA 1N6RA 3MB8A 1EK0A 3EDRA 3GBPA 5JMPA 4C4RA 4UEWA 3G0GA 4J3JA 5J1TB 3TLEA 2XD9A 1TT5B 4CL8A 3FYTA 2J3DA 1NOJA 3QFRA 3W3AA 1U90A 3B5EA 5TJHA 1QJ4A 4HNRA 3BXGA 2E82A 4EVRA 1UIMA 1XXHE 2PX2A 4GPBA 1VG9B 3ZWPA 2C5EA 5JQWA 1YC5A 5ALKA 3JARB 4RKWA 3IVCA 5E8RA 2PWAA 4MW4A 3WGKA 4D5GA 3N8KA 1U1EA 1D2AA 1R4NB 4QTXA 3CY6A 2IE0A 3IVRA 4A82A 1MW9X 3AFMA 3IVGA 4HLCA 5B1DA 4MWBA 4GOLD 1NBIA 3UJNA 1SUAA 1AHIA 1SVWA 1P31A 1LBHA 1DMRA 2GBIA 3GMDA 3CRW1 1RWQA 2CD7A 4WA8A 3I9V1 2HJSA 4BVKA 1Q14A 2OQ2A 3HJRA 4AP9A 3TF5A 1W4BA 4S2EA 3IDFA 2Y1EA 2RBKA 3Q9NA 1W5SA 4IG4A 1RWXA 5JYCA 4OJNA 2W6IA 4PYIA 4ZCQA 3HL0A 3SZ3A 4K0KB 2EG9A 4E6EA 1WSBA 3L6RA 2Q3BA 3CW8X 1C4WA 2X0DA 3ZD8A 2NU9A 3FB4A 4I2VA 3LIIA 1K86A 3LJKA 1CDOA 4UD2A 2BEVA 1FW6A 2NQ8A 3PXCX 3U6KA 1FU4A 5AJUA 3QEBZ 1GM5A 4ZC1A 4KR7A 1N2SA 1SHLA 1D6JA 2PLRA 1F8XA 1L5FA 3QKRB 2FQ1A 4QBHA 3EVDA 3TIIA 4DWOA 4BNDA 5AW1A 1V39A 4NXMB 3DFFA 2QTRA 3TGPA 1ESEA 1E2GA 1XRPA 4JNKA 1Y80A 1EK1A 3HZZA 2FPXA 3N0RA 3SG0A 2YFYA 4TMZA 2W4QA 3I0ZA 4ZZIA 1LEHA 1XD2A 1ZOIA 3UB3A 2XOKA 2YZ7A 4ZEVA 3UIEA 2J3QA 4KKVA 4WXRA 2W00A 4MINA 3HKCB 3CH4B 1MO4A 4BN4A 1FYDA 2KLHA 4BNIA 1TGVA 3WGIA 1CULC 2LNDA 1N9ZA 4LMPA 3QBDA 4RD0A 3VX3A 3HFJA 4RQAA 4ER7A 5ALHA 3GGGA 1KEVA 3PR3A 1MQAA 1NF8A 2B7LA 2ZYVX 5ULLA 1WQ4A 3HWWA 1NW3A 2OSVA 1HEUA 3DMNA 3TECE 1HG1A 5EHGA 3CM0A 3LCJA 4CEJA 5FRDA 1E2NA 1ADGA 3BIOA 4Q16A 1H2FA 3WP1B 3I04A 3BSWA 3F9CA 1U3VA 4QUEA 2H16A 2AFVA 3ASUA 3SEAA 3RBZA 1NFQA 3DDHA 4GPIB 3ONEA 3KOXA 1LBTA 2BFNA 4M86A 3G68A 1OLXA 3LUGA 5LP6B 4JNCA 4J9VA 3OZEA 4KR3A 2YQ5A 1IVYA 1ONNA 2EEZA 2W98A 3FVRA 4XQGA 3VU9B 1GU0A 3VZRA 3E18A 1OYOA 2XGGA 4NPHA 1QB7A 2ZANA 3DHYA 3ND9A 2NVBA 4NENA 4LGYA 1L1RA 1ZAKA 4A2QA 3ZQJA 2WZDA 5FNVB 3MLEA 1TAGA 1ZR4A 4RF2A 5K0NA 2A35A 3VKFA 2H2GA 2AWOA 5TMPA 3K9BA 4RHYA 4NEHB 3D5EA 4Q4AA 2G7MC 5KVAA 1M1YE 1P5HA 4O8ZA 2VYNA 1EJ2A 2IEGA 2GD6A 3ILXA 5LNK1 2AKEA 4ZCPA 3BMNA 4FNOA 3FOZA 1G7RA 2X86A 3A9UA 4CJXA 4OQLA 3DS8A 3V4FA 3F96A 2Q50A 2P6RA 1C4OA 1CEYA 2DWCA 1XQWA 1IIRA 2XNDA 3C4QA 3LOPA 5T8KC 1HI9A 1XJQA 1KKUA 5ERGB 1KI3A 2O6HA 2II6A 3TE6A 2DZDA 2GFQA 4MWSA 2GSDA 3W4JA 2V7QA 1WJGA 1UMBB 3AY7A 5BW5A 4MW6A 4AN1A 3SR0A 5HE9A 3RE1A 1JJVA 3RF6A 4E5KA 4U1RA 5L45A 1N8TA 2PGIA 2CXNA 2G09A 2JIOA 2QVGA 5JNRA 4CDNA 3LTNC 3ZW9A 1R0BA 5KYXA 4XEUA 3EDQA 1IPEA 2XOEA 2A3RA 4JMPA 4ZP1A 4XJVA 4MVJP 4MROA 3LU1A 4AX4A 1DQPA 4K28A 3WFZA 2OQVA 3VZBA 3ITDA 2QG4A 5IAJA 2PXXA 4UM9D 4HKTA 1P6XA 2BHRA 4YCDA 1IHPA 2LR0A 1V8ZA 2X4DA 3M5PA 3ZJYA 4RPHA 1VPDA 1QQAA 3L2OB 4G5SA 4YRBA 1NU6A 3L0IB 2W8BA 2XUHA 3NVDA 2VJBA 1J8VA 1MFPA 4GXQA 4Z9AA 1WSAA 4CRWB 5IKPA 4D25A 1OJ7A 2Q4OA 2CL5A 3TZKA 1ILEA 1AV6A 1ZMRA 5HNKA 1KYIA 1U9YA 3MLAA 4H77A 1OYYA 5SYNA 2Q3CA 2DM6A 3HBJA 2PRYA 1WETA 2BFFB 1MKYA 1TTQB 2PIDA 4WFQA 3WG9A 1KKLA 1RQXA 4MUAA 2P3LA 3T3IA 1CK4A 3VAYA 5B36A 1V6CA 1C0EA 1Z4IA 2GCIA 1HXHA 2P9BA 3AHEA 2JAXA 5GZ1A 2NQ2C 5I7SA 4CEHA 2V98A 1W6RA 4RTKA 4QHSA 4QOEA 4YASA 1SKBA 2ZRPA 2QL5A 4EHHA 4Q9DA 2VJNA 4I5DA 3UJPA 1KVRA 1ESDA 2QAGA 4JFRA 4K81B 4BXOA 1YVPA 2RE8A 4C7OA 1HM5A 1M8FA 1M1ZA 5KKAA 2MSCB 4M83A 4BNVA 3CJQA 4X20B 4IXDA 5K2MA 4DCGA 1YH3A 5GIOE 4YWHA 2DXIA 1TMKA 8ATCA 3RRBA 2FW0A 1B6SA 5EWLA 1HV8A 1ONPA 3VPGA 4TWZA 3NQ41 1AS2A 4IIJF 1NW7A 2QMHA 4HDMB 1JL3A 3K0CA 3AF1A 1KZYC 4L6CA 3FNGA 1N2GA 4RGBA 3ZXYA 2JZOA 4GGOA 2XY4A 5FTLA 1JDPA 3L1JA 1SXHA 4DEVA 5B6JA 5CD1A 4PICA 4BCBA 1B8PA 1KORA 5HSGA 1MV5A 1XLWA 4N8DA 4HFNA 4NNJA 3RIXA 5KCZA 2Z6QA 3M5CA 1I3CA 3T52A 3WLQA 3B6ZA 1NVWQ 3OT1A 4NI5A 1CQIB 4OH1A 1GPJA 1BCSA 3GCGA 1RAGA 4TQAA 1IJKA 4DHWA 4GPD1 1L3BA 2ID9A 1UXGA 2ZRMA 3EPKA 2IJGX 2PKCA 3GL9A 2OLJA 4DA8A 1J39A 3GUCA 4LCBA 1REQA 1TVKA 4KRXA 4QUBA 1ZM9A 3C87A 3I37X 1US8B 4AZ3B 4ZOQI 1G8MA 2ZBQA 2W4IA 4LJ9A 2FVXA 4YJGB 3TTVA 3LQ2A 2DFKB 1AGYA 2FZEA 2PSDA 1TAQA 1RZ3A 4HSEA 1CSEE 2C95A 4BO9A 5MDHA 1Z6GA 4JJFA 1GTRA 2WNIA 1E7MA 5JAZA 3ZY2A 1BQEA 3KOZA 2ATVA 2FX3A 1KJIA 2PZGA 1CUHA 3GJ7A 3ONVA 4QU8A 4X93A 5A4AA 3LCMA 5DSTA 5B4TA 1CFZA 1R6TA 1YJXA 1PR4A 2G6TA 3OQOA 4DKXA 4CMGA 1NBWB 2O05A 1CETA 2HOQA 1R6BX 3OESA 4KV7A 2AXEA 1Q74A 1A72A 3DDOA 2CE2X 3IR5A 1M54A 4O4HA 2ID8A 5ENDA 5EP2A 2YS6A 2YMMA 4JI3B 2G1PA 4TSKA 3QI7A 2Y0DA 4TOIA 3AKYA 4OJMX 1A5SB 3O75A 5GVRA 4CLHA 5FWXB 2C4MA 3PDWA 2UVPA 2ODAA 3H1TA 2Z2YA 4IS2A 4ZO6A 1BKSB 5ALTA 2OA0A 4MKHA 4KO3S 5BSFA 2UUOA 2ID4A 1FSZA 1I1OA 4TL8A 3TUIC 4OGLA 1OREA 4F4FA 4U02A 1W46A 3A3PA 2XMGA 2AYZA 3D7RA 3FX2A 4HNSA 4RDIA 2HDWA 5CNJA 2ZUDA 3HYCA 5ECGC 3WI7A 4MHSA 4B0PA 5IDWA 4IYRA 4N4AA 4C4PA 3KHKA 1KMHB 2CLIB 4MIYA 3AF3A 2H9IA 1PBNA 3IRUA 4K1LA 3WK8A 4AN0A 2G3YA 2JL1A 5KJ1A 2IXGA 1YASA 1HDXA 2DUUA 4MYDA 1SBCA 1DPGA 2DQKA 1S3GA 2GS9A 5GONB 1MC8A 4JZYA 4KMOA 1LX7A 1PEKE 1ZL0A 1XZFA 4UPVA 1Y0BA 3M2PA 5E2BA 1E1QD 1NNUA 2A14A 3E48A 3RV3A 4B3HA 4B5KA 3OCYA 3E81A 5KYYA 1KI6A 4EEXA 1DKNA 4E15A 1PL7A 4ZQHA 2YDXA 5F3WB 3PR1A 4QO7A 3SHOA 3M6UA 1RQRA 3M4NA 4PRKA 5D7BA 3S44A 3HB9A 5IP5A 1E2HA 3QOFA 1EFPA 5DN6A 3V2HA 3MINA 5GPBA 3SZRA 3GG2A 1U2SA 1E9VA 3KDSE 4WLNA 3U49A 2XTZA 3QK7A 1VA5A 3QMVA 3UC9A 4TV8A 1DRKA 3TPCA 2VT7A 3DVRX 1CZNA 1ZRSA 2OQRA 2Y4NA 3BD6A 3OOYA 2WPNA 1DINA 1IAQA 4NFLA 3TLYA 4BO3A 2Y0CA 4BVAA 1EEXB 1Z33A 3TGLA 4JYPA 5FTNA 2GI4A 3KR0A 2FSGA 1MPXA 3O8LA 1KJQA 3BDAA 1Q6YA 3EPRA 4BKOA 4WV3A 4QASA 1U63A 1P33A 1EZZA 2CK3D 1AU9A 1K0FA 1VP3A 1VJ0A 2BF7A 3OIYA 3GPLA 4IH1A 4Z54A 1T9HA 5I8WA 5CA0B 2H63A 2PH7A 3DLTA 1V9LA 2D1FA 1LDEA 5JBQA 2NUAA 4JBWA 1GTG1 1RRCA 2FE1A 5TSDA 1DG3A 1USVA 1WD5A 2DQYA 3IIMA 5FI5A 1ZIDA 2HEGA 2I80A 5F2NA 3B1FA 3K7EA 2ZR7A 1Y3DE 3D3JA 2BFEB 3ZGVA 1I5OA 1RZRD 3INTA 3R1IA 3HBNA 3HO8A 5FBKA 2Y2VA 4HEA6 2E9SA 3W1EA 2OD9A 4LHVA 1EDEA 1I3NA 1QHSA 1Z4JA 1IL0A 2YOHA 2J30A 3DL7A 4KVGA 5AJYA 3B1WA 3VX4A 1JA0A 1ZVVA 3KOYA 3QE2A 3WYDA 1UWKA 4QYWA 5CA1F 2AMLA 1VG8A 3V34A 3O91A 2J46A 2UDPA 2I8CA 3VPFA 1C80A 2O1WA 5KNCH 3JALB 2GTHA 1XBTA 4DGQA 1PR9A 3VBEA 5F52A 1FDTA 2O9JA 1FE8A 3RRYA 2I3ZA 1PG0A 1Y9EA 4DA6A 1PJZA 1XZBA 2I6UA 3EGIA 1EVLA 2ZI3A 3ZY6A 1R8YA 4RTSA 3UMCA 4BQNA 4LF9B 4Q05A 5D3KA 3AY0A 3U9SA 4H18A 1CY2A 1KERA 1DBWA 2JAUA 3OURA 1O08A 1SEVA 2GILA 3IEVA 5JT1A 1GIAA 2C97A 3ZEIA 2YCLA 4EUKA 3ZK9A 4Y1EA 4OG2A 2DECA 5EZSA 3VVBA 3IE1A 3HPRA 3KYIB 1G5RA 1I2ZA 2OENG 4KO4S 4GMDA 1RC8A 3AB8A 3P26A 2PLNA 1NLYA 1RWVA 2PX8A 1P4AA 1MFZA 2WQZA 1JSXA 1BEEA 2OBMA 5AKJA 2EKLA 5DBHX 5BSMA 2O3RA 3RKRA 1G20B 1I7LA 4IQ8A 5EEGA 3GEGA 2XAAA 4WMLA 4RZ2A 3M6IA 4D57A 2BKAA 2QT1A 5K8IA 2JGKA 2OXEA 1SM4A 3IXQA 4KYIB 4MKXA 1ZUWA 4X7MA 3X1ZA 5GV8A 3WAJA 1HTWA 3M5WA 1GCIA 5H83A 2ONJA 5HIIA 4BIMA 1DMSA 3S8MA 3EPJA 3OY2A 3GRFA 4WOBA 2F4VB 2KW5A 2QLBA 3OHSX 4FYKA 4KRYA 4PPQA 4Q4JB 4J1TC 3PJDA 4IL5A 4L2IA 1KR2A 2RCYA 4NBKA 3AI7A 4U7PB 3U7IA 2IBMA 2GF2A 1CUYA 3AR7A 1L7OA 1VQ1A 2ZBPA 5FKJA 1E6CA 1RP7A 4RZ3A 4M0KA 4IIYA 4MRMB 1KY4A 5ENVA 1ND5A 1Q84A 2A0FA 1NXSA 3D7KA 3FFAA 3N1UA 4KE8A 3LOUA 3NBFA 1JEDA 1DO8A 4KQ2A 4EP1A 1W88A 4MJXA 4AECA 1E9FA 1NPDA 2X22A 3OCCA 3PL1A 4TMVA 3ZY3A 2C5FA 4ZJUA 1MV8A 3JRNA 4GOXA 3SICE 2QD3A 1B3RA 3QPUA 3QW2A 4REMA 4NAUA 1I4DD 2YNMC 4ASUA 3CSUA 3K70C 1G6OA 4HDNA 4O8CA 5LDDC 4YR9A 1RHKA 1QNFA 2HMTA 5L9AA 4F9EA 1A2OA 1UH5A 4NNPA 4Q9NA 2VNKA 2I2WA 3DOOA 1EFRD 1H1LA 1XCBA 3LVBA 3WJ1A 3ZDRA 2JIRA 3RUIA 3A4VA 5E3JA 1LBEA 4RMHA 1IM5A 1ZHFA 3GT0A 3ROTA 1FU7A 5AM2A 1GPDG 3ZBUA 3C14C 1QTIA 1WUHS 2IXEA 3RJMA 2RK6A 1BFUA 2JIZA 4HNQA 4Q7JB 2VNAA 4BKPA 2W70A 5ADUS 1E1CA 1D8TA 3KIPA 4NYIQ 4JJZA 4XIIA 5EXDA 2QENA 2RARA 4UARA 1OF1A 1NF9A 1D2CA 3PA8A 821PA 1X14A 1LRJA 4NJEA 4QNMA 2VG8A 3NOOA 5A3JA 3HJUA 2BC9A 1DI0A 3C41J 3ADPA 3CLUD 4PZCA 3AL0C 4H3VA 3WYAA 3K1AA 3BA1A 4B85A 4BP3A 4D02A 3ELUA 3LSTA 4PZLA 4KQ6A 2BSAA 4CVNA 5K45A 3MYYA 4PY2A 2X3FA 2G4CA 1AF7A 2O2DA 3EW7A 4GIBA 4RD1A 5C1BA 3QBVA 4D97A 5HQ3B 1DTSA 1P74A 2JD2A 3NOVA 1MDBA 3WQRA 2DH5A 5EHQA 3K5WA 1ZD9A 1CJTC 3L1KA 1KK3A 2WG0A 3NM6B 3TIVA 3VI4B 3W78A 3I92A 2BMDA 2N75A 4NFYA 1D1PA 5CDHA 3TKAA 1XTQA 1C5KA 3ANYB 2GD2A 3HJBA 4NS1A 2PFGA 2DTXA 5KSPA 5KREA 3OOJA 2ETXA 3A9SA 1N1MA 2ZCJA 1EESA 1S8NA 4KZPA 3EF0A 1ULTA 3EISA 4E31A 5FH9A 5LYJA 2SBTA 2AUNA 4LOIA 4JUBA 5IKOA 1Z75A 1Y1LA 1ESCA 2PWZA 4I4TA 4ARBA 1EP2B 1W0KA 1X15A 4ZV9A 1K2WA 1NE2A 3B1VA 2Q3LA 4H15A 1ZIXA 5HF6A 4H1VA 4BP9A 1EA5A 5TQJA 4IEFB 4KPGA 1NN1A 2XMQA 4HWGA 2P9HA 3I9MA 3FAZA 1JS1X 1OWMA 1QP8A 2QK4A 1U3UA 2QXTA 4C5CA 4E12A 1DX6A 2P69A 2M1ZA 3GR6A 4WNCA 2B8NA 4M37A 1E6KA 3DCYA 2WU8A 1NR1A 2NUTB 4GYJA 5C52B 4KGVA 2P9JA 3JSXA 4KWHA 1M73E 4WESB 1UADA 4MUYA 2H52A 2BFCB 4D43A 2DUNA 1K7XB 4N6GA 5K05A 2V9PA 1KFBB 1WY7A 5EXTA 3ZV7A 4B7AA 5H59A 3TLBA 2CMDA 4A2PA 3HA2A 3A9VA 4HP8A 1P39A 2PXAA 4DVGA 5ADHA 4IIXA 4INAA 1T29A 3HLKA 1EU1A 5UKDA 1L7PA 4D9IA 4US1R 2KYRA 5E7IA 1OH6A 4GPTA 4PVCA 1CY7A 1P1HA 4Y6GB 2CXQA 3RBXA 4D6PA 4EJ0A 3TD9A 3ETNA 1B15A 3SXUB 1MA0A 4CFSA 1FXSA 4GVPA 1GT91 5FBHA 3EFOB 4X6LA 3T3GA 4XDZA 4DA9A 3D02A 2BEWB 1K3FA 3GVCA 2NZJA 2NXCA 4Y1RB 3GJ8A 4Z3KA 1J20A 3T5CA 1GRQA 1W581 2I29A 2YY7A 3QTLA 3QLVC 3W2IA 4MRSA 1CJCA 4YQEA 5KQMA 4KUGA 3TW8B 5A3QA 2FZVA 3GRPA 3OEHD 1J0EA 5K20A 1XN4A 5C18A 2HUPA 4ARAA 3BHMA 4HADA 1RQLA 3H2HA 2OVBA 5DNEA 1XLUA 3UUFA 2R6DA 3E03A 2WSIA 3NRBA 5AVVA 1AMUA 3MFQA 4C6TA 1KZ4A 1RYHA 1T1EA 3H2BA 3L82B 3PL5A 4ZI7A 1IZYA 3U4MA 1WB9A 1VZ2A 1DJNA 5AM5A 2RKBA 1DC7A 4JLNA 5A5EA 2VPPA 2XHEA 3EAQA 4RZUA 3U1VA 4CQMD 1ETUA 4DV5B 3EYAA 1JU9A 4HS4A 5B1SA 4BY9E 1NBEA 3CLTC 2IDJA 2DWQA 4G26A 4J7CA 5KEIA 4KQCA 3P27A 3B85A 1A2BA 2BFOA 1DX4A 3BDVA 3BK2A 3H19A 3LA6A 4FJ2A 2PX4A 3B70A 3U0BA 5FWYA 3H6HA 1J2YA 1L5OA 2OCBA 3C8MA 6AT1A 2IY8A 1EXWA 1O6BA 2MT9A 2VKTA 4RUKA 3JD4A 1H2BA 5JZMA 1JH9A 4GGMX 5BRAA 2W37A 5LMUB 4YN3A 3NJ8A 2JJYA 2BLLA 3KB1A 3KYDA 3QEMA 2PR2A 2V3VA 3MD0A 3SVTA 3TRKA 3IDSA 2QMEA 1BZYA 2V1UA 1SHTX 3QUCA 4V1CA 3TIGA 4ZYZA 3W05A 3FZYA 3CYFA 5AHRA 2IW3A 4DC1A 2BFBB 2QJOA 4QUJA 1ZXXA 2C4TA 3HYRA 3HGQA 4DREA 1RPAA 2ZQZA 4DY6A 2XQIA 2YC4C 2B99A 3A04A 3AEQB 5BW4A 1LCIA 1H2HA 4R2LA 5B58T 1B0PA 1V3QE 2YMPA 3CXUA 3EIFA 2PKQO 4YJFA 4PCUA 4GRAA 1I36A 3FFTA 3IBGA 4RF4A 5E7MA 3AIKA 3OQVA 4Q19A 4DV6B 5TEWA 5TMDA 1QIIA 2WFAA 3H9CA 4BPBA 1Y8RB 4QSMA 2WG1A 3TQOA 5JJIA 1Z4MA 2D00A 4QARA 3OJCA 3RASA 1BRTA 2X3UA 5A0TA 2AOUA 1JEYA 3BFXA 5ED4A 2QQGA 2FZLA 3LW7A 3LNTA 3ONNA 4F6RB 5ALFA 2JHAA 2ZB4A 1H05A 4ETNA 3HUDA 5IANA 1QVRA 2PRZA 2XZPA 3CCBA 4L3OA 5C3MA 2GCPA 1BJKA 4CETA 1M3SA 1NUQA 3HKDB 5BP7A 1KGSA 3FPCA 2VTDA 3FZEA 4BTVA 1NQWA 2GRUA 4Y2JA 3MMZA 3RVKA 2YQ4A 3GQBB 1KU6A 3I52A 3HBAA 2FTKE 1BH6A 1TO2E 2ZT8A 2HD4A 3HBMA 4XTRA 3RB8A 3AWIA 5KZMB 5U9CA 3CVXA 2XPCA 2QTLA 4TMFA 4AQYB 3W5VA 3ZVMA 4ZHQA 4ZYLA 3AFNA 4YUYA 4QM7A 2AMFA 3ZNNA 3EHEA 1VSBA 4N0DA 4YV1A 4FYWA 2PV0A 4CG3A 1V47A 3U17A 1RJEA 2CF6A 2VNHA 1GPLA 5P21A 3OLWA 4FGUA 1SU4A 1QU2A 1O89A 4NR0A 3ESQA 4M87A 3A58B 5FTKA 1Z3IX 5LDGA 2BHTA 5KQSA 2R85A 1ULZA 1WHTB 1EKXA 4F3YA 1FNMA 2VRWA 3CZPA 3U09A 4OQMA 1OR8A 1TJYA 2XLBA 4UNPA 3CPJB 3QQ5A 1FPQA