1P1CA

Guanidinoacetate methyltransferase with gd ion
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
193
structure length
193
Chain Sequence
RWETPYMHSLAAAAASRGGRVLEVGFGMAIAASRVQQAPIKEHWIIECNDGVFQRLQNWALKQPHKVVPLKGLWEEVAPTLPDGHFDGILYDTYPLSEETWHTHQFNFIKTHAFRLLKPGGILTYCNLTSWGELMKSKYTDITAMFEETQVPALLEAGFQRENICTEVMALVPPADCRYYAFPQMITPLVTKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Monoclinic guanidinoacetate methyltransferase and gadolinium ion-binding characteristics.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords Guanidinoacetate N-methyltransferase
total genus 67
structure length 193
sequence length 193
chains with identical sequence B
ec nomenclature ec 2.1.1.2: Guanidinoacetate N-methyltransferase.
pdb deposition date 2003-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1p1cA00
2PWYA 1M0EA 4C03A 5T67A 3M33A 5HFJA 3GRYA 5D1HA 2VDVE 1JG1A 4RTSA 2ZWVA 4R6WA 2AZTA 1VL5A 3HCAA 5GM2A 2Z6QA 3NWBA 1BOOA 2AOUA 2GB4A 3TR6A 2ZFUA 1XCLA 3CBGA 1WY7A 3TQSA 4KWCA 3SGLA 1EG2A 5HEKA 3DMHA 2EG5A 5LQUA 2ONYA 4M36A 3HCEA 5D1NA 3OE4A 1L3CA 2XYQA 3P2IA 3I64A 2VDUE 2ZBQA 1PJZA 2YXDA 3D2LA 3KPYA 3ELUA 2IIPA 2PWPA 3LCUA 5E2AA 1WXXA 3ER8A 2OYRA 5BXYA 3IHTA 3KR2A 3CC8A 4PYKA 3NVKI 5LQAA 3OU7A 3DUWA 4PYQA 1WXWA 3DULA 4HRAA 3R3HA 4MIKA 5U4XA 4DKJA 3M6UA 3LDUA 3NJRA 4HTFA 8MHTA 1YUBA 3KQWA 3M6XA 1KHHA 3FTDA 5CVUA 4P7GA 3OZRA 1HMYA 2AR0A 2AS0A 1Q0SA 2P1DA 3A4TA 5DSTA 5FCDA 5P8WA 3G5LA 5DXAA 2BR4A 3KQTA 4RVDA 5GIPE 1L3BA 2ZCJA 1XDUA 3K0BA 3UBTA 5E2BA 1QAMA 3R9XB 4KDRA 1IY9A 5DPMA 3HA3A 4PWYA 5CM2Z 3HTXA 3EMBA 2FK8A 3M4XA 3NVMB 3A27A 1JSZA 3AY0A 3THRA 4ATNA 2KW5A 3PS9A 2IPXA 3FPHA 3MQ2A 4P7JA 2AN4A 3DP7A 3P2KA 3UZUA 4G56A 3IYLW 2JHAA 3A7EA 4RTOA 3I53A 4X61A 5K8VA 4QVGA 4BP1A 5EZQA 3Q7EA 2CMGA 1JSXA 4RV9A 2C7RA 2ZULA 1DUSA 2XVAA 4XUCA 3FTFA 3FPJA 3LGAA 2A14A 5GWXA 3HVJA 5CVVA 5E1OA 1JG2A 1RI2A 2ZIFA 2E5WA 2P41A 5ICGA 1IXKA 1R6AA 4IV8A 4C07A 3LSTA 1RJGA 2V7EA 2HNKA 3EVDA 2Y1XA 2P8JA 4PGHA 5KS2A 3BGVA 1ZG3A 5E9QA 4ER0A 2FYTA 2HV9A 3RIEA 2IH4A 3FRIA 1NV9A 3FYCA 2P3QA 4QTUB 4U7TB 1NW5A 4OA5A 2WA2A 3AJDA 4HTFB 5K0EA 4Y2HA 1F38A 2JJQA 4DZRA 3CJTA 3H2BA 3HVIA 3MGGA 5EPEA 3BGDA 2ZIEA 3FTEA 4EQZA 5K05A 1JQDA 3KR0A 4EKGA 2PGXA 3G2MA 2PT9A 2PXXA 4EMSA 4F86A 4KIFA 2AN3A 4PYJA 4F85A 3CGGA 5ERGB 4BP3A 3RW9A 1RJFA 4CTJA 1FPQA 3M6WA 2ZBRA 3NWEA 2O05A 5FHQA 4RTKA 4GBED 1KYWA 3TM5A 4YUXA 4GUAA 2G71A 1G55A 3OFKA 3K6RA 4RWZA 3MB5A 5CVEA 3ER9A 3KQPA 2P3OA 4GEKA 2ZBPA 3OFJA 4C04A 5LQJA 5DSXA 4RTQA 1X1CA 3V97A 5GINE 1NE2A 1UFKA 3HEMA 1O54A 2PX8A 4GQBA 2GPYA 4KIGA 4CXMA 3LDGA 2C7OA 3C6MA 2O0LA 1L3IA 2O06A 3MTIA 5DX1A 4CKEA 5K0GA 2FRXA 1VE3A 3LCVB 4HGYA 3Q87B 5DXJA 5CD1A 1KPGA 2EJUA 3A25A 5DM2A 3E8SA 2OB1A 2FHPA 1BKYA 2B9EA 1QAQA 1ZQ9A 3GRZA 2ZZKA 1XJ5A 1M6YA 1O9HA 2AOXA 2NXNA 4QTTB 3V8VA 4HSGA 5K09A 2UYHA 2IH2A 3JWHA 3KPWA 1ZHFA 5DRYA 1FBNA 1KP9A 3IV6A 1INLA 2PX5A 3FUUA 5G02A 2ZZNA 3TPZA 3L8DA 2GA9A 1R74A 2ZIGA 3JWJA 1KPIA 1RI3A 3LDFA 3LHDA 4X1OA 2FK7A 3B3GA 2YUIA 4ZTBA 2R6ZA 4DF3A 3GNLA 4QDKA 4EKIA 1ZGAA 5GOZA 5JUWA 2EFJA 5EMKA 2HMYB 3O7WA 3A26A 4FSDA 4V0RA 1QYRA 4Y30A 3DR5A 1EIZA 5K0BA 3LKZA 1RI4A 3LL7A 1NKVA 5FUBA 1N7IA 3BXOA 3KU1A 3SSMA 2BM9A 2EX4A 3B89A 4NECA 4KW7A 5CIYA 2XYVA 4OQDA 3SVZA 1AF7A 2UYQA 3GU3A 2VZ9A 5F2KA 4AZVA 3UJAA 3BWMA 5E1BA 1Q0TA 3HA7A 3EVCA 3NDJA 4JXJA 2QYOA 1XDZA 4E2XA 4E2ZA 4YV0A 5HOQA 1PRYA 4C4AA 3EVZA 4PYIA 3TRKA 4RVGA 1VLMA 5LQNA 2BH2A 5EVJA 3VC2A 2AVDA 4AZTA 3I5UA 4KVZA 5DM0A 1D2CA 1R18A 2PV0A 5EHIA 5BP7A 3OE5A 2HTEA 3PFHA 4R8SA 1Z3CA 1SUIA 3FUXA 3EEYA 4F84A 3MERA 3C3PA 5C9ZA 4X63A 3DOUA 4OX9Y 2VDWA 5HIKA 5CCXA 3MCTA 3KR1A 4AX8A 2IP2A 2Z6UA 5EMJA 3ID6C 2B25A 4PINA 5FWDA 3EGEA 1QZZA 5CVDA 1BC5A 4BLWA 1JTEA 2VP3A 3T7TA 3DMGA 5EKUA 2IFTA 1MHTA 5MHTA 3ELDA 3G8BA 1QANA 1I9GA 4RTMA 2PX2A 1EJ6A 1R8XA 4DMGA 4AUKA 3FPGA 2CMHA 3LX6A 2YVLA 3PTAA 3PFGA 1HNNA 2OB2A 3G2PA 5DX0A 1P1BA 1WZNA 2QM3A 1H1DA 4ER5A 5DWQA 3JWGA 3KPJA 1UWVA 1P1CA 3I9FA 4GOMD 2BZGA 4R8RA 3UJ8A 5E9WA 1AV6A 1DL5A 1N2XA 1SUSA 2IBTA 1NW3A 5FWAA 3DLCA 3CJQA 4AZSA 2XBMA 1XTPA 3SX0A 3AWIA 3BKWA 5EG5A 2H00A 3P2EA 2YR0A 3HCBA 5CVJA 3WSTA 5LR6A 3C0KA 4H0NA 2ZWAA 3KKZA 3LECA 2PY6A 5E9JA 4BLUA 4QPNA 4ER7A 3ORHA 4RVHA 1JG4A 4DQ0A 5BW5A 4QDJA 3CVOA 5GIOE 3VSEA 2BM8A 3FUVA 5DTRA 3UJ7A 1JG3A 4E2YA 2UYOA 4MQ4A 9MHTA 5KYGA 5FA5A 2AVNA 2PT6A 2G8NA 2JHPA 3LCCA 5EC8A 3RODA 3AXTA 3C3YA 4M7RA 4HG2A 3ERCA 2CKDA 5DT2A 5GM1A 3BWBA 3HCCA 5H02A 2NXCA 4GOLD 3T7RA 4BLVA 3DMFA 4O29A 2QE6A 2NP7A 3X0DA 5E1DA 2AOTB 4OQEA 4E30A 2BR3A 2G72A 1SQFA 3EVEA 1L9KA 1YZHA 2BR5A 4EK9A 5E8RA 5LQKA 2H1RA 4L7VA 3KPUA 3TKYA 2I9KA 2HR1A 4C06A 5FHRA 3KQMA 3KQVA 4GOOD 4YUYA 5FQNA 2VS1A 3A7DA 2AOVA 5EKXA 5ICFA 4E70A 5IKMA 4WVLA 4PYMA 2ESRA 1SQGA 2CWWA 1RJEA 1U2ZA 2PLWA 3P9KA 4PYNA 5T64A 2LD4A 3CKKA 4KDCA 2O57A 3GO4A 2QY6A 1G38A 4HC4A 3TFWA 3F4KA 4CKCA 1G8AA 4RTJA 3ELYA 3FUWA 2PXCA 4IV0A 4GC5A 3EPPA 2P7HA 4QPPA 5EIWA 3EMDA 5K0JA 2NXEA 2PVCA 3P71T 4P7FA 4Z2YA 5EIFA 5GP1A 3FPEA 3UJCA 7MHTA 2FPOA 3M70A 2GLUA 3OZTA 3P97A 5M5BA 4C08A 4YUVA 1VP3A 1WS6A 2I62A 3BZBA 5EGSA 5EEGA 1XVAA 2G1PA 1RI1A 2JH8A 3EGVA 4KRGA 5DM1A 5FADA 1O9GA 5IH3A 1JQEA 3S68A 3PVCA 2DULA 1NV8A 1X1DA 2B3TA 4E31A 5EMLA 3FYDA 5FA8A 2YX1A 3EGIA 4P7KA 2JG3A 3BT7A 4M38A 1T43A 5E1MA 2G70A 1NW7A 1F3LA 3P9CA 3R0QA 3REOA 5HZMA 4BY9E 3BGIA 4QQKA 3B5IA 5C1IA 3BUSA 2P40A 2H11A 3CCFA 2YQZA 2PJDA 1TW3A 2UYCA 10MHA 3UJBA 5K0LA 5K01A 1EQAA 2K4MA 1EAMA 1R8YA 3GDHA 4PCLA 3TM4A 3G89A 1JTFA 3GXOA 1AQJA 2QRVA 3DXZA 3LBFA 5HIJA 2O07A 3OU2A 4ER3A 3GJYA 3JWIA 5JR3A 2OY0A 3TLJA 4K6MA 2OXTA 2B2CA 1ZGJA 3IEIA 4PGGA 5DRTA 3SSNA 1NW8A 3HCFA 3KR9A 2PKWA 2FCAA 2XYRA 4P58A 4QVKA 4C05A 3B3FA 4YV2A 3UA3A 2OZVA 1KR5A 4PNEA 4DCGA 5KQSA 3SSOA 3G7UA 5K03A 3ANXA 1JR4A 2AN5A 5HILA 4CWAA 3SR4A 4YUZA 3FTCA 3OZSA 4RTRA 4GC9A 3ME5A 1SKMA 1YB2A 1Y8CA 3E05A 3HM2A 3MTEA 1IM8A 2PSSA 3GIWA 4XUEA 1KYZA 2P35A 4DCMA 3B7PA 2NNWB 1G6Q1 4FT2A 2OKCA 3G2QA 3PB3A 4WXHA 4PONA 3BWCA 3HVKA 3EVGA 3P9NA 3LKDA 2IDKA 3KQQA 3KQYA 3LPMA 3U81A 2OPBA 3R24A 4FR0A 1FP2A 3CJRA 1VIDA 2I7CA 4B17A 3GGDA 2I6GA 4DM3A 5EMMA 4MTLA 4FSXA 3DLIA 2ORED 2ZVJA 3UA4A 1QAOA 4UOEA 1YFJA 5B1SA 2Y1WA 3UWPA 5BW4A 2AOTA 3PX2A 3DXYA 4LWPA 2IH5A 3DH0A 1NBHA 5EZSA 4ER6A 5LSAA 1I4WA 1TPYA 2B78A 3FUTA 2JH9A 5ICCA 2IBSA 2XVMA 5DX8A 1V39A 2GAFA 5KVAA 5LQCA 2QRVB 2OO3A 1P91A 4RTLA 3OCJA 1I1NA 3I58A 4R05A 1D2HA 2NP6A 3MCZA 5CUQA 3VC1A 1UIRA 3GRRA 3DXXA 1KIAA 4PIPA 1VP9A 3NW9A 4XUDA 5F2OA 4E33A 4RTPA 4POOA 1ORHA 2NXJA 3E23A 4AZWA 3PT9A 3BKXA 2OBFA 4A6EA 1JQ3A 4XCXA 1D2GA 3EVFA 4OBWA 3DTNA 3SM3A 1SG9A 3UJ6A 1VQ1A 3R6TA 3EEOA 2N47A 3LBYA 1BHJA 3HNRA 2WA1A 4YMHA 2P3LA 3VYWA 4IWNA 4E2WA 3PX3A 2JHCA 2EJTA 4FGZA 2PX4A 1DCTA 5ICEA 2YXLA 2ADMA 2IDJA 1XXLA 2CL5A 5T6BA 2Q41A 3KPVA 5DLYA 5HIIA 3TMAA 1NT2A 3ELWA 1KPHA 3OU6A 1OR8A 1RI5A 2ERCA 3GWZA 3M6VA 4FZVA 4GOND 5EQJB 5C0OE 1VBFA 3FRHA 1NW6A 3G5TA 3KQOA 2C7QA 2IGTA 5CCBA 3EVAA 3TOSA 3NDIA 4RVFA 3O4FA 3QV2A 1SVUA 1TW2A 3KQSA 3O31A 1X19A 5DM4A 3QOXA 5FQOA 5K0NA 4PIMA 4ISCA 5DTQA 3UFBA 3B3JA 5LQRA 3HA5A 1YF3A 2V74B 3KHKA 2ZSUA 2NYUA 4FP9A 5EEHA 1R00A 3E7PA 4YV1A 2GH1A 2GS9A 1N7JA 2AOUB 3T7SA 1AQIA 3P9IA 2AOWA 4PYOA 1WG8A 2YXEA 3SMQA 4CKBA 3GRUA 4HGZA 4CTKA 5DTMA 3G2OA 3HCDA 1RJDA 4QQNA 2YTZA 4RSRA 2HWKA 2C7PA 2UZ4A 2ZTHA 3BWYA 4IKPA 1YZ3A 4GF5A 4M37A 1MJFA 4U7PB 4OBXA 4RX1A 5K0CA 1FP1D 4HH4A 3GCZA 3EVBA 1G8SA 4DA4A 2PXAA 1EJ0A 3FPFA 3NTVA 4PYLA 5HIMA 4MHTA 4PCAA 2ZW9A 4X41A 3T0IA 1X1AA 2WK1A 4R6XA 4YMGA 4FS8A 3TKAA 4E32A 2ZLBA 4FT4A 3G8AA 3PLAE 1XCJA 3MAGA 4LWOA 2ONZA 4OA8A 1M6EX 5F2NA 2ZZMA 1YFLA 3QOWA 1L1EA 1NBIA 3AXSA 3HP7A 3HVHA 1FJXA 4RYLA 2Z6AA 5E8JA 5K0FA 3SXJA 3THSA 5KQRA 1XDSA 4LG1A 4X60A 3P8ZA 3OPNA 4MWZA 5EOVA 4LECA 3UJ9A 1VPTA 5FULA 3UJDA 4V0QA 4RTNA 3FZGA 4A6DA 3MHTA 3NMUF 1KXZA 2DPMA 4YUWA 1G60A 1B42A 5FTWA 2P7IA 2R3SA 1X1BA 1ORIA 1P39A 1ZKDA 3C6KA 2F8LA 2PBFA 3GRVA 5EHGA 4EVIA 3G88A
chains in the Genus database with same CATH superfamily
2ZRJA 1PL0A 2NU8B 6PFKA 1K6XA 5T67A 3GDFA 3P9XA 4G23A 3PFKA 3C6ZA 4L27A 2Z6QA 3JQ9C 2NU9A 1CP2A 2XCIA 4P93A 1QUFA 1XRMA 1XTTA 5GGYA 1MA0A 3PL5A 3DMHA 1TQ2A 2FZ4A 2H06A 1A4XA 2QD3A 1AS2A 1R0SA 2VJDA 1XTZA 2XWQA 3QPBA 4OQNA 3TTVA 1ZMXA 1C29B 4QQFA 1A8SA 1Z75A 1EFVB 3LH5A 1CB0A 4BP8A 1K8RA 2FGJA 3MOGA 2ANCA 4JWKA 1TA0A 4MPRA 3W8DA 3KR2A 3U5TA 2TMDA 2OV1A 5E2IA 1I4DD 3KV3O 1FFWA 2HV8A 4BQFA 4CFYA 3SAJA 3S27A 4HRAA 2VP6A 2CFRA 2JZNA 2B5OA 1WE2A 2R44A 1WHSB 1G8JA 1Q0RA 2YIJA 3M6XA 1USUA 3F90A 1ZLYA 2DCMA 5CVUA 1KZHA 4CIDA 4TTAA 2YC2C 3MILA 3AFHA 1E5TA 2PQ6A 4EYEA 5IC4A 5HX7A 3A6FA 3AG5A 5IK2D 5LD2B 3ELBA 1Z0FA 3NQ41 5IS2A 2REOA 3GN2A 4RK6A 2B4RO 1X77A 2O0JA 3NBKA 2FEAA 4NK5A 3E82A 5L51A 3WGIA 4KLAA 3RBAA 3ONFA 4TMFA 1QAMA 4KQXA 4KDRA 5E2BA 1LBEA 2QL6A 4LYGA 3UT5A 3WJ7A 2XT6A 3O8BA 4B46A 1A1VA 3THRA 3LZDA 2Z08A 2IHKA 2X5KO 1E4EB 1Q44A 2YYZA 3P0IA 3EQ9A 4O4IF 3CH5A 2G8LA 1CKEA 2JHAA 4P38A 5K8VA 4TYYA 5EZQA 3NP7A 4TLAA 3ANSA 3PFBA 4NMLA 1HGXA 5D01A 3D3KA 2B8EA 2PUDA 1YR6A 4ZVOA 2RK6A 1W49A 4E15A 1SC1A 2E5WA 2EFEB 3IP5A 3OA2A 2OECA 3SU8A 4IZOA 3TZLA 4K28A 1SN7A 2VPZA 3NC0C 2G7MC 1JIKA 2IU4A 2Q1UA 2HNKA 4L57A 1RYNA 3AKDA 1ZG3A 2X9QA 1FVFA 1WCIB 2O2JA 3C5CA 4I50A 1POWA 1QG4A 7ABPA 3P0HA 1Z2CA 1M72A 5TQ2B 5AM2A 1IB6A 2V3WA 3FOWA 1QK5A 2YW2A 4IDNA 4FR2A 2JJQA 4MVJH 3LVFO 1T5OA 1L7OA 1TU4A 4B81A 1ZH4A 3QE2A 1DAHA 4JI6B 1GNVA 2W71A 4WKPA 1X1EA 3KKQA 4PTYA 4TLDA 2IXTA 4KIFA 3TJMA 4KCGA 5K8UA 5IDXA 1CFZA 4HQ6A 2FW1A 1FFSA 1RJFA 2HSWA 1CUXA 1FPQA 2EC5A 2HMSA 2V7VA 2VRCA 3QLEA 1VKJA 2BH9A 2WC1A 4JL6A 4GMXA 4JMPA 4G0VA 3G8CA 1U0TA 4UVGA 3K0SA 3MB5A 4TM7A 1D2NA 1KSGA 3FROA 1NSTA 4N0MA 4S1OA 1SVIA 2IF2A 1OI3A 2RBKA 2WJJA 4EJ6A 1ESNA 1NXPA 1TKBA 1PZXA 2MHCA 2B83A 3A1TA 2XD4A 3W9UA 1JXAA 4BO1A 1YBMA 1GQFA 1YHNA 3I8OA 3EGOA 3C3BA 2O0LA 4NHOA 2O06A 2PX6A 4QDUA 5BN1A 2XDAA 3Q85A 4K9QA 3WO1A 4G84A 1JH9A 1RRMA 4XB1A 5F9FA 2BP7B 1KS2A 1KZ9A 3GELA 3M8KA 5HUQA 1V9CA 3OPYB 3EA4A 1G20A 4CCWA 1IUNA 2ADOA 3IULA 2YZNA 3H4TA 4D9MA 1GSAA 1E7RA 4AN1A 5FFNA 4QRIA 1WOYA 1ZI9A 4G5QA 5I4CA 3DFUA 3ODPA 3IV6A 3ZLUA 4GX1A 1J8MF 3ZHSA 2P1ZA 1FJXA 4HAYA 3ZZTA 2DQZA 4E7OA 1PX2A 2ZS8A 4BBJA 2GPJA 3EOAI 5LXTF 1YONA 4UBLA 5D7BA 3S44A 4B9EA 1XMXA 5BVHB 4IJQA 5TT1A 3AUTA 4KAJA 3DW3X 2JLUA 1J0XO 1YO6A 3DVRX 3HJNA 5D5PA 5LIRA 4QYTA 3WGZA 1KZ6A 4HQRA 4NDNE 1T8UA 3ISJA 1QIHA 1FW6A 1KK2A 2JFPA 1WDWB 4Y7CA 3HBNA 3DOOA 1W19A 3U4DA 1S3IA 4BX2A 2W2TA 2HDOA 2CLCX 4FCCA 2NUPB 1Q83A 3G9XA 4LJ7A 4BO8A 4E2XA 4F96A 5F3WB 1E2MA 1JNXX 1RQLA 2C0PA 4IMPA 4CIYA 4GI2A 3VZDA 4OU5A 1W2HA 1E4VA 2XCTB 1NIJA 4DA4A 4I8DA 3UEOA 2PUWA 2C7BA 4DG5A 4HAWA 4V0NA 2FUEA 2VHWA 1Z6PA 4YP6A 2CXPA 2YRXA 3QNMA 1Z8NA 2QN8A 4PAGA 3GLIA 1OFTA 3SYNA 3MWEA 1V7PC 3ZCRA 1HYGA 1RR6A 4Y67A 4BWFB 2Q3EA 2VDWA 4XWAA 3HRKA 1X74A 2YJGA 1QUEA 5EKTA 3NUZA 4BO5A 4H2DA 4ZVQA 2A78A 5FWDA 4CG0A 4FFBB 4HXYA 4BNXA 3SVTA 4YRBA 5DHFA 5DYIA 2AMVA 1E1RA 1Z7WA 2EF0A 2Q5EA 1KZYC 1G5QA 4JJ6A 3E7WA 1AHPA 3GZTB 3QG1A 4NBVA 2M32A 4RGYA 1M2WA 5F7ZA 3W6OA 1H9AA 3BHJA 3W3AA 4PX2A 3BXHA 5EJ8A 2B1IA 2CVZA 3LX6A 3KWFA 5IJ9B 3C5EA 3L7LA 2DUNA 3HRHA 3RCBA 5BR8B 2IYYA 1WZNA 2P27A 2QE7A 1KI3A 2WJAA 2QLTA 3H9EO 4NAHA 4WDRA 4YP9A 3D8TA 5JLJA 5EKSA 3U1TA 1E79D 2BZGA 4FJ2A 2CK3D 5H1YA 5B4TA 1TCUA 4Y2UA 3OJWA 1JPNA 2OBBA 5J5AA 5KYXB 4EHDA 3NYQA 1C0LA 1M8PA 3CJQA 4KR0A 4QGGA 4Y2JA 3BKWA 4U8GA 1MAWA 3CGWA 1NX6A 1M1YE 4OP3A 2QW1A 1P2TA 1DT3A 3U19A 2PRJA 2JLQA 1OB2A 1XDBA 1PS9A 2BEJA 2WG0A 3KD2A 3N74A 1DCFA 2ZVQX 2ZYVX 2ZTMA 3K73O 5B1HA 4WINA 3FUVA 3MLEA 1YA8A 2P5YA 1JG3A 2YYYA 4QARA 1B0PA 3TVYA 3HN6A 1DEKA 4OJMX 4BRZA 4X5OA 3PRHA 1V5GA 2AVNA 2NU6A 1L7NA 3L7NA 2EFCB 4WOJA 2PX0A 1X1SA 4JLOA 2I9KA 1AG9A 3CW9A 2ID4A 4DIFA 1NX9A 3OQBA 4CTOA 1RRKA 1U6KA 4M7WA 3WJ1A 4CKWA 1AHNA 1V16B 3GWGA 4OGGA 4PR0A 1D2MA 2BR3A 2Q8QA 4MWCA 2WF7A 3L1KA 2WHXA 3QKUA 1D1TA 3QVGA 3AHEA 4ZAXA 1KO4A 1WMBA 1XN4A 3RKRA 1V3TA 3OKCA 2IYOA 1VLVA 2O5CA 2GTIA 3HXPA 3NKLA 3A58B 4GOOD 1Y9DA 4Z0PA 1BGWA 2ZIXA 1TCCA 2AWOA 2D74A 3KE8A 4FMDF 3CMCO 1GD1O 4I8XA 1IEWA 4OI2A 1N6NA 2BGRA 1C0PA 3M49A 2XZDA 2JCXA 3AHIA 3OLZA 1MC4A 2PEZA 2IHJA 3JQ7A 3E0QA 3MA0A 4NV0A 3NP9A 1GFWA 1D7OA 2G6BA 3ZBQA 1Z3IX 3N2ZB 3COSA 3FUWA 4MR7B 2G0NA 3D64A 4R54A 3OJEA 4WKNA 2J6CA 4YRAA 1KQPA 5JSKA 3RWMB 3LDHA 3W5CA 4RORA 5GP1A 4IDPA 3RM3A 3H9UA 4BXOB 3FX2A 3K32A 5A5VA 7GPBA 2I4NA 4C7MA 1SB8A 3KVOA 1KMQA 3BCRA 5EGSA 1XVAA 3PFCA 4KO4S 2OP0A 2ECKA 3TG8A 1EUCB 3KZKA 1N8KA 3I04M 2ZSEA 2JG3A 3FYDA 4MYHA 1QIKA 3BT7A 3K31A 3QLJA 1A9QA 2G70A 1NW7A 1MJHA 3A4YA 1QFYA 3R6LA 4JYBA 4JUIA 4C22A 2JFUA 4DRZA 3DGFC 4QBKA 2EBHX 3BMCA 2HSEA 2C9CA 3O3MB 1C41A 3CCFA 4ENPA 4D9KA 1EQAA 4HDOB 4OIFA 1NRXA 2XTZA 3T3DA 2D7CA 1JTFA 1TADA 3SBXA 1OZAA 2G25A 3DXZA 5AJUA 1TFUA 1Y42X 3DO6A 3TLJA 4BHTA 3V9PA 3V1YA 2Z6VA 1NP6A 4JN6B 1I2BA 2ZSJA 4V1CB 1Y4SA 1HTWA 1HZZC 3WGLA 2VO1A 1OLOA 4LWZA 1J2RA 5AHRA 4GW3A 5M3BA 1OWLA 1ZXXA 3DCJA 3JD1A 3W6ZA 1D7AA 3G7UA 1H2HA 4CQMB 1FYXA 4ECAA 5C18A 4HDMB 1BX1A 1F0PA 1U4OA 2ZANA 4HDRB 3TE7A 2YVAA 2O0HA 2XB9A 3GLKA 4ND3A 4D8TA 1U98A 3D6FA 1K5GA 4EW3A 1S0UA 2ZUDA 3RYCB 1D04A 3K0CC 1G6Q1 1UFOA 2Q1WA 2VF7A 2RBEA 2ZRFA 3EIFA 2GZ2A 3CIOA 3CNNA 3CZCA 1MGOA 2X4IA 3BWCA 1T6NA 4MUJA 3ZGLA 3R7WA 1RLIA 3PC8A 1R0ZA 1I6WA 4UKDA 5IT4A 1JALA 4MCJA 3T61A 2QQEA 1JQ5A 2B4AA 2NTJA 2FG5A 2R8EA 4EUNA 4ZGWA 3ROTA 1EP2B 3IBSA 1L5HB 4JBNA 2FP3A 4B6SA 4FSXA 2AZXA 1T1JA 3D4LA 5EQTA 3W3AH 2ZGVA 1EXMA 1ADYA 2HA5A 3AEYA 2VF2A 5LYJA 3WICA 4Z99A 2AOTA 5B6IA 5BW4A 2VUHB 3T95A 4N5HX 2JJ1A 4XCQA 3TF5A 3G17A 3FUTA 1U9IC 5LC1A 5TQ0B 1JFRA 3Q9LA 3N7UA 4HDSA 3IBYA 1U90A 4UUAA 5DX8A 2Y1EA 4G0QA 5LQCA 3A6GA 4BQSA 5J1SB 1TM2A 3GPCA 4IFIA 3AG6A 3F74A 4RA9A 4ZVTA 1HM5A 1X0XA 1ZUNA 4LXXA 5TJ9A 3U39A 3Q98A 3KXPA 4ZAVA 4LZLA 1ADCA 3DXXA 3R0VA 3VZRA 4EHJA 2Z83A 1ZD4A 3EDOA 3V1KA 2FW6A 1T1SA 4AZWA 3F46A 4R5MA 4DSOA 1OSNA 2DWPA 4EH1A 4XCXA 5AICA 2H5JA 3VOSA 5BQ3A 2JZOA 1WV1A 1XAIA 2Q8PA 4MVXA 1O89A 2WIJA 1GPUA 1ONBA 3U17A 2CB0A 4AZ3A 4M76B 2G9UA 2PBLA 3TECE 3RQSA 1HSOA 1EK2A 2PZEA 3IBTA 4MA0A 1NLZA 3V80A 4AROA 1NVDA 4NQZA 3TMAA 4Z1MD 1TRKA 1ZGHA 1JG7A 1Y6FA 4N49A 1TX4B 2H2HA 4RKYA 1TMOA 1WXHA 1XZEA 4PYRA 1MAAA 3KQOA 2NSLA 4QFBA 5E6UA 3NBXX 2IEBA 1QORA 4JHXA 3PG5A 4MW7A 3FPSA 4QFDA 4RVFA 2DM6A 5CM8B 3C85A 4LGVA 4TVKA 5CX1A 1R9NA 5DM4A 4E2FA 1JIXA 4OPMA 1NC1A 1Z39A 2B1GA 2XNHA 2O48X 1JHOA 1SIUA 5CYPA 1JDVA 2G5PA 3FKQA 3TFOA 1CR1A 2MMCA 3H97A 5EEHA 2OZLB 4CEJA 3R6DA 1Q84A 2NZ2A 1WEHA 1U7ZA 3BSYA 4S04A 3JQDA 1FC0A 4BV2A 1G19A 4Y3UA 3AT1A 2JJ1D 1EZ4A 1L7QA 5U9CA 2IUYA 1LSUA 4GOKA 3PQ7A 4IIDA 3ND5A 4HQNA 1YOVB 2FFHA 4QQNA 1YB1A 2QOEA 2RI0A 2PHZA 4HO1X 1JKFA 3GCDA 4D4LA 2C7PA 1Y3DE 2VAPA 3P5SA 4AX4A 1MD9A 3DFZA 1E3IA 1LXCA 1OV4A 2BW0A 3H5WA 1R6UA 4XPZA 3HN7A 1Y4AE 1ZMRA 3VZSA 2YOGA 1TGYA 4JK3A 5GJWC 3V8RA 3DFFA 1Z7EA 2PL5A 5JMOA 3DT6A 1BOFA 4UHCA 5LB4A 4RPGA 4PN3A 2ZR7A 2PMBA 2WG1A 3U7IA 2QJOA 4ISBA 3W5IA 5LVAA 5YASA 1E2FA 5ECGC 4BNGA 5IT5A 5ECWA 1VKOA 3R7AA 4HJXA 2V59A 1OFGA 4D96A 5IF9A 3K7EA 1HTTA 4WNAB 1QDEA 3L8YA 5LOVB 4O02B 1UPUA 3P9QA 1XJWA 4RMNA 1ECCA 5AI8A 3UKJA 2CSUA 2JVJA 5G40A 2XRMA 5J4HA 5LDDC 2XCQA 1XPRA 1L8LA 3K9LA 1UP6A 4EKEA 5J2UA 3FOCA 2P2NA 5D2CA 5KYXA 1PT6A 2P67A 1ZM2A 1W85A 2H65A 3LUBA 4GHWA 3DD1A 2P62A 3AHJA 3DB1A 3PC2A 4KJZA 4QAQA 4INOA 3SHTA 3VM6A 3ZV5A 4ID3A 2NN3C 1M2VA 5K3DA 3HK2A 3P0RA 3V7UA 1Z25A 1ZSVA 4FEEA 2O2HA 3UAVA 3HKBB 5EWJB 4OGKA 5HFJA 3U40A 3ZDEA 5AVUA 3KJXA 4L6CA 4MB0A 3H5RA 3L41A 1QVRA 2FPWA 3HZOA 3WGNA 4RTSA 4BX9A 1JB1A 4G0MA 2R85A 1W0KA 1WOMA 3M3PA 2QTVB 1FVHA 5KYVA 5FH9A 2C3PA 4ZHSA 5IPFA 1TZKA 1E0AA 3H1TA 4U6SA 2MR6A 2QW0X 4I1YA 4IIHA 5C4MA 3SYLA 3OTQA 5MDHA 3L04A 2M6RA 4C4YA 3FLAA 2QJRA 5AMXA 1G6HA 4GZ5A 3FHCB 5DWDA 3ZIAD 4Q4CA 1TE2A 3I64A 2JIDA 1RYHA 5D5QA 4H7EA 5L3SA 3KPYA 5BNTA 5AP9A 3RHSA 3QQPA 1LTHR 2P9HA 1OYYA 4EMTA 2OPHA 3DC2A 3VKFA 3ER8A 1RKXA 2Y1GA 3BQMB 3GLUA 1MHPA 1PN3A 3R6WA 3W05A 1G2PA 2EQAA 4DUPA 2WY2D 3H5IA 2XRYA 4E1BA 4CM1A 3UGTA 1XD2B 3LE8A 2QAGB 1N1GA 1OX4A 3IUBA 3L77A 1VL0A 3INGA 3K35A 3GI1A 2ATEA 5CJPA 2W4QA 2H07A 1XE3A 2B4QA 1VSBA 1B23P 1YUBA 4Y2SA 5AR1A 3Q5DA 2XJ9A 5JT1A 2IYPA 3HBAA 3FPLA 3RK1A 3UN1A 1Q0SA 2VJCA 5ALEA 3SIWA 4MWTA 4R1UA 3NNDA 1AQUA 5F12A 3QU5A 3HQ4O 3KQTA 1TAQA 5BQFA 2JEZA 1RYMA 1YU6A 2F48A 3O75A 4GYKA 1NULA 3BGWA 5E7MA 3RBVA 3TOVA 3UBTA 3ZD9A 5FUVA 3N2GA 2PZKA 4UDNA 1NZDA 5HKOA 3TN7A 3DP7A 2PSJA 3CVVA 1MRZA 4G56A 1R8SA 3OIGA 4X61A 3DJFA 1IAQA 2PRKA 1LDBA 3AHHA 2ZYDA 5IXSA 3Q6MA 3FR8A 4ZHQB 1WU7A 1IWBB 1K6IA 4LYYA 4NQRA 1LW7A 4TS9A 2UYYA 2F62A 4ZJPA 4X85A 5IKXA 1XNGA 4ZICA 3EFOB 3ZTTA 2C2KA 3RC7A 3ODGA 1O3YA 1TQHA 4S0ZA 4JL8A 4FK8A 2OMKA 1G16A 1C7EA 1PEAA 4DCPA 5A6SA 3THYB 4OAQA 1D9XA 1Z34A 1FLNA 2WM3A 1XMJA 4CPDA 1HUQA 4DQXA 2ZI7A 1U4SA 4BQIA 3UK0A 3ZDCA 1EDDA 1M2KA 2ZB7A 2D3TA 3HVIA 2P6UA 1HNZB 4B7UA 4HMPA 3KR0A 2BFOA 1HLDA 4PSUA 1I2CA 4EMSA 3G2MA 3BORA 2ZJYA 3B7WA 3PP8A 1Y6GA 3MWYW 2N1BA 4ZRMA 2BT4A 2YJZA 2QBYB 1L7PA 3LFUA 4MULA 3NBFA 2HF8A 4OQPA 4W5WA 4B6JA 3C6BA 3KEFA 4FJ0A 4RS4A 4DZZA 5A3JA 4B6PA 1E79A 2B92A 1USGA 4XDHA 1GGEA 5HUJA 2RGNA 3O82A 3QLUA 3R76A 3WLRA 1OGJA 4DMKA 4F3CA 1OXSC 1WB9A 4D0LB 2H2IA 3T35A 5I7VA 5LLTA 2P3OA 2W2KA 4CF6A 2J59A 2QVYX 1Z22A 1AKWA 1GEGA 4MCHA 4NE2A 1KO8A 2FHSA 4RV4A 3VH3A 2FSVC 4EW2A 1C7QA 4A7PA 1SXJD 2JDID 1NE2A 3GN1A 3NCHA 4YVFA 3VBEA 2EW1A 1Y9ZA 4JLWA 2RKOA 5CW1A 1XZKA 3LC2O 4M7PA 5BN3B 3EUWA 2VBFA 3ND8A 3IV7A 4ABTA 1NVEA 2PLRA 1HWYA 3D5EA 4ZOLB 1U1DA 1UP4A 3WFIA 2ZYWX 4FMDB 1AUVA 1N78A 4K0RA 5AUPB 1BKYA 3IQGX 1ZQ9A 2ZPTX 2OGUA 1V45E 4EQ6B 1M6YA 4K8RB 2ON6A 1YRBA 1TD9A 6YASA 4C4TA 3KPWA 5GOTA 1ZHFA 3CLUC 1INLA 5G02A 1UKYA 3BIWA 3QPAA 5DFAA 5C7LO 5I4BA 4OBBA 4RMHA 4R3UC 5KVSA 2M6LA 2G9RA 3AM3A 3O2JA 1EUQA 4EKIA 3NIGB 4RH3A 2B1QA 4ZQEA 4OP2A 4GL2A 1PQPA 2EFJA 4EY5A 2XE4A 2QT0A 1WDKA 2YFQA 3BWVA 4V0RA 5AKYA 5K0ZA 5I45A 1XTBA 1MQ8B 1HEYA 4Q3BA 5EQFA 3HR4A 4IMIB 1EGHA 1LEHA 1H5UA 1MLDA 4FFOA 1R0BA 4XLZA 4DA9A 4ZK2A 3U4IA 3OX1A 2QBYA 2HJWA 2ZJ7A 1QYCA 1XLTA 2CNLA 2MOKA 3F78A 3RUIA 2O5VA 4KB5A 5F2KA 3ZCSA 4Y1RB 5A06A 2XWSA 1BIFA 4MVYA 1UC4B 3BGSA 1Q0TA 2WI8A 3ZK8A 3T7JA 4DCNA 4JXJA 1Y81A 2RGRA 2G4CA 1XRPA 4GVLA 2HEGA 4FOLA 1KEZA 5J58A 4XVRA 4A0FA 1ATIA 3PNMA 5E7QA 1AUPA 3BF7A 4IY1A 5AI4A 1PV4A 2XITA 4FFNA 1QGOA 5DM0A 2D6FA 3WQHA 1R18A 1TVCA 4Z8XA 4DG9A 4B48A 3RVDA 3D6JA 1E2JA 5E0OA 3U3ZA 1W5AA 2HB6A 3BG5A 4Z4IA 2AV6A 3EEYA 3ZPXA 3T5CA 4YRQA 3G6KA 4MVJI 3D2CA 2KB0A 5L9AA 4IDBA 4QOSA 1Z82A 3QEMB 1T8TA 2IP2A 2XZPA 4QUGA 1LV7A 5T4FA 2AJBA 3PU6A 3ZLVA 4EO7A 4FHCA 4DIBA 2Z6UA 3KL2A 1VSVA 1KI9A 4G0YA 5T8KA 2IQ5A 4JOQA 3W8RA 1GL3A 1GTSA 4NJMA 4ZYVA 3EDCA 1XXHA 3MB8A 3IESA 4WWHA 5AVKA 5KUTA 1KFJB 2H1LA 4LOLA 1TU0A 3F9IA 1YZFA 2Q50A 3GGSA 4BLRA 5C5CA 1OHHA 1VB3A 2PH3A 4PZLA 1I2ZA 3BAZA 3G2PA 3UMVA 2GZ1A 5JD4A 3UYKA 1H1DA 3MT0A 5IAGA 5FF9A 5F7OA 3JAMA 1C7RA 1WHTB 1BXGA 2RHHA 2GCNA 4MKRA 5J2TF 2GHQA 3S2EA 3WA7A 1QVWA 1CJVC 3ZWAA 4AZSA 1ZEJA 2XGMA 2VA8A 4KQ9A 4YRFA 3WSTA 3EXIA 3P2EA 1V35A 1TM1E 1ZUD1 4Q9JA 4XIGS 3IMEA 4I50F 2Q0SA 1D6JA 1FX1A 3N7AA 3UCXA 4EZBA 2YY7A 4RVUA 1VIYA 2BM8A 2HA4A 3VPDA 1JB9A 4KN6A 1L5GB 5DBEX 2GCGA 1QV7A 3DMNA 2Q6KA 2VI5A 3UMJA 1TQ8A 3NHRA 1TGVA 3DZFA 1PJTA 4LTNA 3BJMA 5CK5A 3RLFA 1HT3A 1LA2A 2O1WA 2BEVA 3EC2A 4F5ZA 2OHXA 2YUTA 1ZCBA 2CKDA 3DKVA 5GM1A 5H02A 5E0KB 3RJTA 4P2BA 1MP0A 1B0UA 1GV0A 1DS6A 1ZCZA 3FYUA 4OOEA 1NVWQ 2OMEA 3V3KA 1L5LA 4HBGA 5M2QA 1R15A 1SURA 1WF3A 3MGCA 3X1XA 4KYTA 1CP3A 3RROA 3PJFA 1F9AA 3T99A 5DHQA 2ZJ6A 2CE7A 4RIGA 4MUAA 1F51E 1ODCA 2BUCA 2PUVA 1AUQA 4C76A 3PPVA 2R97A 4DVGA 4C0BA 4OJQA 2Z04A 3A7DA 5FIUA 2YDYA 2JBWA 5ICFA 4YHHB 2PUGA 1UPFA 4U6QA 1APBA 3GLVA 5JDCA 4FWTA 4DDWA 5CR9A 1FFBA 2NXWA 3AERB 1RJEA 4AJHA 1U9ZA 6LDHA 2NSYA 4GUDA 1HFKA 4KDCA 3MTJA 4XQ9A 1SM4A 2D0OB 2WNIA 1NIPA 2X6QA 1I1OA 4Z54A 3P7MA 3R8FA 1FP6A 1LPPA 2WIFA 2XWJI 1U2QA 2WMYA 3TLKA 2GM4A 2C5GA 4QEZA 1RACA 3UJCA 2XE6A 3QMVA 1ANKA 3D4BA 2I62A 2QDKA 4BZXA 3ZCUA 2EKBA 2CUKA 4M0PA 5K3BA 5B1EA 3NYRA 4Z3KA 2ZJ1A 1QIJA 3PVCA 5MN6A 1X1QA 1GCUA 1S9HA 2H31A 2NAPA 3G2HA 2ERYA 1KYYA 4YQZA 3RABA 5FA8A 3WGHA 5JAOA 1JA1A 2QMQA 2LDBA 1W59A 2YCLA 2D5LA 4FD2A 1O6FA 4GKJB 5HZMA 1E9RA 1MV5A 2CHFA 4BGEA 2VH5R 2F3UA 2XWPA 2IU3A 4K9SA 1M6HA 1NNI1 1C8VB 2NU7A 4F3NA 2YQZA 5K0LA 4IDDA 4ZI5A 4A23A 1E6KA 1N2GA 2CDAA 2VTKA 1N34B 2UXBB 3E58A 3GD7A 1KZ7B 1UAYA 2JFFA 4RV5A 1T9GS 5CB4F 4CQJA 1GT91 1QS0B 1MX1A 2E4VA 1OREA 1ZGJA 2OQ2A 3KCNA 2X8BA 3SSNA 2WZCA 1D8TA 2PKWA 1UT8A 3WRVA 3EQ6A 5JYDA 5REQB 3FWNA 3I6IA 3O3OB 4RIFA 3ZU6A 3QIAA 3KIPA 4AWBA 2YKGA 4L72A 3ENKA 3O2NA 5J59A 2FRVA 4QLBA 4KE8A 4LYAA 4O4HF 5T41A 3OTIA 4D3XA 4TQUS 4EG0A 3ZD7A 3BB1A 3QG5A 1CZUA 3GP8A 2PMFA 4K05A 4UM9B 3WWEA 3P4XA 1YULA 4YRSA 2ZSKA 2CNWA 3HUEA 4IEFB 4OV6B 4EO4A 9ABPA 5J23A 3U4QB 1CJKC 3B13B 3LXMA 3PB3A 3HG7A 4IS2A 2C5LA 1AHIA 1NRJB 3PQFA 4B76A 2GJ8A 2NUAA 2DUJA 4YQYA 2QVGA 2O5EA 4FKMA 3RSFA 3VUEA 4R2JA 3UENA 3EC1A 3M82A 3G9QA 2FF7A 1JFTA 3AR8A 4G26A 5EIBC 5ENZA 1EJ2A 1EGAA 5HPYB 1OT5A 1U5BA 2DHDA 2FEXA 1GCGA 5C5EA 3GZNB 4XD7A 1YZVA 2OBMA 2W2LA 2PU7A 5KYKA 1GDHA 3RVJA 4LNUB 1PU2A 1NUQA 2X1HA 1RHUA 2OQIA 1TPYA 2EBFX 4PLVA 3DMPA 3H83A 2FAXA 2ZS7A 1K5DA 1E8DA 2XVXA 2NNLD 2PFKA 4KQJA 3L8EA 3S29A 1NU8A 1KVSA 2VDLB 2AMJA 1JEDA 1QGAA 1II9A 2VLIA 2Z9BA 3MWGA 3NW9A 4R1NA 5JXWA 1Q0LA 4KOAA 2NXJA 1JV2B 4IXWA 2IZ7A 2H5LA 1MZPA 2NO7A 1BEZA 3A1FA 3GH1A 3I0ZA 1NMQA 3TIFA 3WOVA 2I33A 2C99A 1QE5A 2XMRA 4KX5A 3W5AA 1DFHA 4FGZA 2F4NA 2GYWA 3AILA 3VKUA 2IDJA 5BV2P 4OLBA 1GRCA 2CLKB 2Q9AA 3EC7A 2HT1A 5G41A 3TBKA 7ADHA 1UK8A 3A1SA 5C0OE 3MAAC 3PXUA 3VKHA 4TV8B 4CG3A 3GFFA 3DFKA 1DC4A 3H2IA 3N2LA 1WMAA 4EA6A 2KJQA 5K6AC 2JLVA 1JH8A 2WAXA 2GZHA 1YZYA 4LC1A 3WLHA 1SHLA 4Q3CA 3QW2A 1NNLA 2OILA 3AI2A 3D3WB 5K0NA 3UFBA 3W6UA 5T7BA 3RREA 4E5YA 1ZH6A 3PUWA 2UXCB 1YUNA 2OCLA 3LOPA 2WYVA 1Q15A 1RWVA 3KHKA 3PK0A 4FP9A 4ZCPA 5JU6A 4L2IB 3RQIA 2VXYA 3WQBA 1Z4QA 3UJPA 2PH7A 3CLHA 4BU0A 5IFLA 2VT7A 5EJIA 3QMWA 2WIDA 4WUVA 3LP5A 1B8VA 2DEUA 1GFSA 1JKJA 2VSNA 2O2SA 3M34A 2WT8A 4DR6B 3VR5H 1GNRA 2N1MA 1IUPA 1HYHA 1L7VC 5IAOA 2A84A 4IKPA 5JARA 3SQDA 5LLDA 4B0OA 1ZAKA 2IPOA 4GX2A 3GJ0A 2GO7A 3CX4A 4WBXC 3MAJA 3C5WP 2XE7A 1XB2A 4RY2A 5JH7A 4KTTE 5ADUS 1T8YA 4PCAA 3ZDRA 1HKUA 4RMIA 3T15A 3JVEA 3TUZC 3NYWA 3AEZA 3PUIA 1E66A 1F4PA 3T3IA 4INJA 2BUBA 1PL7A 1N4AA 3H8VA 4Y8VA 3BH6A 3K0AA 1ZLXA 4LWOA 3DZBA 3HLTA 4OA8A 3U3JA 3LXUX 5IDQA 3CU5A 3D0OA 3EXHB 1FDIA 4J0DA 1GZVA 1HE3A 2CVPA 13PKA 4H0CA 4A10A 4D02A 1IY0A 4UMVA 5AKIA 1EESA 2AW5A 1FRFS 3DFMA 5CXSA 3ZCVA 4C7VA 1G60A 4W8OA 2HEIA 1B00A 1X1BA 1G5FA 3K0FB 1HLGA 5FYDA 3ET5A 4RYDA 4EUEA 4XVHA 4CHGA 1DBQA 1E2UA 1AZSC 1TVKA 3DOCA 3MD9A 1E7MA 4ZDWA 1NVBA 3B3QA 2SNIE 2YJ5A 5GONB 3WK4A 3OPYA 4X44A 3CNQS 4GKAA 3NTQA 2FEMA 1QE3A 2G77B 1WSWA 1TAHA 3OWOA 2ZFUA 4JNKA 8AT1A 3TX6A 3VTZA 2H5IA 2XCSB 2XGOA 3G8DA 3SHOA 5JHHB 4D8WA 2WMOB 1UH5A 4PZ9A 1DG1G 5F23A 1TZJA 4M1KA 5D1NA 1QR2A 3NDRA 1WD7A 2NSHA 1JXMA 3V55A 2DJIA 4Y7DA 4AQDA 4ASUA 1TO2E 1U3FA 3D6MA 1GU7A 1S02A 1QYXA 1II0A 2YXDA 4BZQA 4E7PA 3UMYA 4HWGA 2OM2A 2WE7A 3LCUA 3SSAA 2OYRA 2FZLA 3VISA 4YRKA 5BXYA 5H80A 5ICMA 1XGKA 4I1SA 4RHXA 4JUFA 3C1OA 3VNUA 2WWXA 4AU1A 1Z5OA 4OU4A 2EKDA 1DBIA 1AOXA 1F06A 1EWKA 4PO8A 2R2GA 2C4TA 4MIKA 5ED0A 1L5RA 2Y27A 3PA8A 3GRFA 3S70A 4F1WA 5GV7A 3D0RA 4QXAA 2JC3A 2BGKA 4G5HA 3AFOA 4GVXA 3OZRA 4W9NA 5IKOA 1PNOA 1YQUA 3N53A 3PQDA 4YRTA 2P4UA 3LOQA 1GTVA 3LRPA 5HQ3B 4D9HA 1VDZA 4B8YA 3AF6A 2D4AA 2XOKD 3QFFA 1EXVA 5AT1A 5C52B 2WVGA 3RSQA 2CXHA 4RPKA 3WBKA 3UWKA 4PWYA 1X0VA 3QA3E 3TLMA 4OGFA 1UMBB 3ETGA 1RYYA 3A27A 3LRXA 4KQKA 1KY5A 2IZ0A 2IPXA 4PBRA 3P2KA 3UMFA 2PKRA 4O8CA 1U7OA 3NAMA 4GPTA 3RJMA 4RTOA 1VJGA 3RI3A 3UMGA 4F4IA 5LMZA 1VTKA 3OLWA 1IN1A 2CMGA 1DXHA 4EJSA 2G6TA 1R9GA 5FBHA 4PLTA 1W48A 1F4VA 2O52A 3QWIA 1N32B 1SFRA 3EAQA 4GXTA 2CF6A 2JI8A 5JSQA 3AESA 4PGHA 1FW8A 2FNAA 1B1AA 5IJZA 1F12A 4ZZ1A 1TEZA 4B4WA 5HA5A 5J2TB 4DDKA 1P1KA 4RCYA 3VPBA 4RGVA 2ODAA 1KE1A 3C7KA 4A27A 2QB5A 4FHZA 3K4PA 2QI9F 1ZJ5A 1U28C 3VR6H 4B43A 3S99A 4X7BA 4EKGA 3CURA 3IIMA 1VIMA 4AF6A 3LZCA 1KVQA 1DZIA 3AEUA 2EJBA 5IU6A 2JIZD 1CY0A 4P6VF 5JLAA 1G3QA 4Q3NA 5H81A 4I36A 4LRSB 2BAGA 1UJBA 1EFRA 4KQMA 5ALXA 1NR1A 5IVKA 1N5JA 1VSTA 2G71A 3RYHB 2EHJA 2AK3A 2HWUA 1EFRD 5BOSA 4H1HA 1IN8A 1NI3A 1FNNA 4L5YA 4YCMA 5LP6B 2FDCA 1H8ED 2BMDA 5KU7A 4N76A 2WE8A 4QM6A 1AGPA 4M1WA 1NVMB 1Z9BA 4CM5A 4KIGA 4REQA 2J3JA 3EQ2A 3C6MA 4JOCA 5I7EA 2C5HA 2HJGA 3F5FA 2CEKA 4BMZA 5JATA 4KWHA 3LCVB 1RW4A 1EKXA 4D45A 1ML4A 1A7AA 3IR6A 2QM7A 2JAUA 3H11A 4UVHA 5CPBA 2F3TA 2FHPA 1CSEE 2VTVA 4FYXA 1IY2A 3BWEA 4B9AA 4HYTA 3UCFA 4AULA 1DAPA 1GITA 3GRZA 1LGYA 1DQZA 3EHDA 2NZXA 3JZIA 4E46A 1ID1A 5A5DA 2UYHA 1GVHA 1RCTE 4WGFA 1OUMA 2X8WA 4YO7A 4JEMA 1Y6RA 3BQ9A 2BRUC 4D74A 4WA8A 2DE0X 4NCHA 3O38A 4RF2A 3I9KA 2HBZA 1I36A 3QX3A 2VPPA 3AQIA 3ED1A 3R75A 2YWJA 4BKRA 4DF3A 2DR2A 3PCXA 1JEEA 2F2TA 1HV8A 3AGPA 5MN5A 3L40A 4YJDA 4PZEA 4D9GA 5KWVA 5JUWA 3EXEB 2P2GA 4A0GA 3OEHD 4WY5A 1QIEA 2XF8A 5JYBA 3C45A 2I1LA 2RFLA 2XTNA 4BBZA 4XRRA 5H9VA 5JCXA 5H8WA 2W6OA 4U2KA 3I34X 2PPLA 1UJ6A 4GPZA 2F9MA 3DE2X 2EX4A 4YB8A 2ZKLA 2V1UA 1DNPA 2CYAA 1EPUA 4YPVA 4XVQA 3AJ9A 1YCDA 3LU1A 1SU7A 4OI1A 1K7FB 1SUDA 2P8SA 3N5KA 4OYLA 1G6OA 1PW7A 5CB4A 1DO2A 2HSDA 4KN8A 1I3MA 2I4RA 1WUHS 1JSRA 2WYUA 2ALJA 3Q3CA 4HL6A 1OH7A 4K3VA 2RHTA 5IBRA 1A2BA 1E3QA 2QYTA 3L05A 4PFJA 3TLBA 1RQNA 2Z56A 3T9CA 1QHFA 1NDQA 2HCRA 1KI7A 2EZUA 2AQHA 2M1XA 3DYBA 3KKEA 4EA9A 1IB0A 5LYJF 5LB2A 1CZRA 2AUMA 3IHLA 4F5WA 5DTIA 4RESA 1U1CA 4PINA 2Q3JA 1B73A 1QDLB 4M60A 4LZOA 1BC5A 1JTEA 2ZSDA 5C2JB 2YIDA 1UKZA 2IFTA 3R7NA 3FI9A 4RO0A 3CO0S 1PT5A 3W4JA 3KC2A 1YS1X 1XBTA 2PX2A 4WCFC 1KAGA 2BFAA 4ESEA 1KC3A 2HAEA 3FPGA 3U44A 4L5CA 3GNSA 1C3OB 4Z0NA 2E18A 4G0OA 2WW8A 2KX7A 1JQLB 5ESXA 3OFVA 3QLUC 4UCXA 1KQNA 4CV0A 3L8GA 4DLPA 5KNBA 4RK1A 4AY6A 1GYQA 2YZ7A 1TLFA 1ZOSA 4PIVA 4EYKA 2C0QA 4Z7NB 1RMQA 2NADA 4LXTA 4N5NA 4TROA 3H16A 4ND7A 4C0KA 1PBNA 2I6TA 3BAFA 1CNEA 1VE5A 4HUTA 2XBMA 2WHPB 4H6PA 2FR8A 1F60A 2UV8A 5EG5A 4H7HA 3HCBA 2YV5A 4CMAA 4B4VA 1OJ7A 3KKZA 3F9RA 2PMEA 2PMWB 4F97A 4LBVA 3S6JA 1VBKA 3FZQA 1Z29A 3GH3A 4CZ2A 2IXDA 2NQ8A 1F17A 3KT3A 3G6WA 4UNPA 5KOJA 5L4LA 3K5HA 1GADO 3MD0A 3EJWA 3M5PA 4OM8A 1OBFO 4L0MA 1RAAA 1ZAYA 2HMVA 1H6DA 1QV6A 1P4AA 2R8BA 3U9SA 2NWQA 3LCCA 1GILA 1E61A 3R3JA 5BRNA 3AXTA 1G8FA 3IT1A 5AHXA 4LGMA 1SMKA 3E2IA 1CJTC 4KXNA 2DMRA 1UOQA 1DTWB 1FP4A 1P19A 1X9HA 3OPMA 2EOAA 4PQYA 4NCKA 2I7TA 4YMSA 4CI0B 3EBLA 5CDYA 5HZKA 4OHZA 1HT1E 1WF6A 1XFDA 3TNYA 3ER6A 1W7AA 4ZN6A 1EZZA 2NUTB 1NFRA 2GN6A 3N2YA 1X86B 5DTJA 4ENTA 5BT8A 1YZHA 1PJSA 1LQ2A 2QNRA 2ZJ5A 4MRSA 4KVFA 3ZEIA 3KPUA 4NOKA 2C78A 1ITZA 3KQMA 3QJGA 5FHRA 1MJ5A 4QATA 2NMVA 3K9GA 1LI4A 4LW8A 3NH9A 3EF1A 2AF4C 2I2XB 2JBAB 3P26A 4Y9RA 3GUVA 3PC4A 1NQUA 2B82A 4FC6A 4LYHA 5B58T 4BU1A 4QYMA 1G8HA 1Z2DA 3JQAB 4XCVA 3MJSA 4L2IA 3RG8A 3Q15C 1SUEA 1UM9B 5HKKA 1WP4A 2HCTA 3COPA 2O57A 4EENA 2ST1A 3CR7A 2B9VA 4NU0A 1B6GA 1SOUA 3AIMA 4K6CA 3WNDA 4CL2A 3OBBA 2XKAA 3G0BA 1FUYB 1II8A 4H6XA 4L9SA 2NSDA 3UWMA 4J3NA 3E9MA 3GLHB 4IGIA 2ZT8A 2QYSA 3AKYA 4MW2A 5JC8A 3F49S 2EFYA 3AP1A 2CYCA 4RMJA 1TJNA 4EY4A 3O8QB 4OFBA 2WWHA 1BU8A 1DT5A 3M70A 2QJTA 1KE2A 3KP1A 3TDKA 3KLMX 4BWGA 3CSUA 1Z4MA 3AWDA 3M0EA 1G7SA 1GG5A 1VL2A 4RHEA 2ZRCA 3BQNB 4LCEA 1BKSB 4FUTA 3VC7A 4WTOA 1F6WA 4YP0A 3PVSA 2P9JA 1IZ9A 2JLAA 2WFLA 3SJCA 2NM0A 4CLDA 5BYAA 4ZRDA 1N4DA 5E1MA 3VTAA 4IQ0A 1F3LA 3CINA 3C6XA 3L8MA 4BY9E 4BMVA 2XKBA 4XSVA 4AJOA 3EX7C 4IPTA 2E37A 4Q1DA 2Z2YA 4JLKA 5I4IA 5K8JB 4J4HA 2RKWA 3H5AA 1NI4B 5K01A 5C5IA 1MB0A 4DKXA 1LFDB 1QV9A 2RGXA 1EWRA 2GMWA 4MEAA 3DZIA 5F3RA 5ES3A 2Q4OA 3JWIA 3A0UA 1QMGA 3ONDA 4IIGA 1SVMA 1PR9A 1Q7CA 3ORSA 3PJGA 4JBXA 5EJ9A 1NW8A 3WZ2A 3PFWO 3RH0A 2LWIA 2XYRA 3N5CA 4LI3X 4U1RA 4CL0A 4OQYA 2ETXA 3A1WA 1A71A 2Z5VA 3B3FA 3UA3A 5HWSA 3UHOA 3AUXA 4FW9A 4GH5A 3UHFA 3W1VA 3GT4A 3LC7O 4KBYA 4YQFA 3S1LA 1E6LA 4OXXA 1XA3A 3FTCA 4V1CA 4QNNA 4NMMA 3M1YA 6CHYA 1F1JA 4LMRA 1VSQA 4TWZA 3DF9A 3SS9X 4MS1B 3I2KA 5ERYA 3VH2A 3O8RA 4BJ3A 2FSSA 3DOJA 4CG1A 3VC3A 2VQSA 2CV0A 1JKJB 3SI7A 2GEDA 2I7DA 2V8OA 3SZLA 4AF7A 3FCAA 1HF3A 2OKCA 4L4YA 4NULA 4YACA 1K4YA 4K1LA 1RVV1 1ZMOA 1TYBE 2CLLB 3ETCA 3CIFA 4OI0A 4IOKA 2O8CB 2OK7A 3STTA 1OX5A 3R24A 2QAGA 4R83A 1IIBA 5ALQA 5J5VA 4KKXB 1K7EB 1DTSA 4DR3B 1P1JA 3DLIA 3EDMA 4NH0A 2JGEA 3RRBA 5KWEA 3HDJA 1QP0A 1OF1A 3E2PA 1BWSA 1HC7A 3N8KA 3QPWA 1EZ1A 3LWNA 5BSWA 1P75A 5I9LA 2HJRA 4LDNA 2A0FA 5IXYA 1B16A 3LGXA 4CG2A 4UVEA 4WDQA 2IYXA 3KKNA 4UPDA 2QUKA 1JN0A 2PU5A 4FYPA 4RF5A 4YCBA 3GRRA 5FI1B 4BNLA 3OH8A 4BMPB 4FYHA 3TQQA 4POOA 2O6HA 2OBFA 4E21A 2JJ2A 1I9CA 4TMKA 2C2HA 3DTNA 2F17A 1DDOA 1HSZA 2VHCA 3JD2A 2H29A 2EWWA 4KOEC 1PDWA 1BHJA 3NIDB 1TFRA 3E9QA 4KI0A 1GOTA 3ROEA 3L7KA 3TLCA 4J16A 5IANA 3WRXC 1AF4A 1PR1A 1UJNA 2CJWB 2WPDA 2O0MA 5LMUB 3GDGA 1ECBA 4QUHA 2L69A 2YWDA 3U4MA 4B71A 2ERCA 3AF2A 2QK4A 2VTDA 4UCFA 4CKEB 4DQKA 4NKRA 1GAWA 5BVGA 2ZRMA 4MYUA 2R8XA 4KGZA 5EE9A 3WZMA 2F1IA 3OZ7A 5LOVA 1NQVA 3SS8A 5FQOA 3O31A 5TQVA 4ITVA 4WT7A 2CCGA 4DR2B 2FSIA 3CEAA 2QNIA 3HA5A 3SOPA 4JJKA 4UTXA 4EPRA 2P6PA 2R8RA 3LT2A 2PL1A 4HQLA 1H4SA 3E7PA 2PZ8A 3HE3A 3MELA 4F72A 3U3DA 3I4CA 4HADA 3SYRA 5EKDA 5IM5A 2AOUB 4BO6A 3ZX5A 3JQ8B 3VV3A 4JP3A 1O97D 4NYJR 4IO0A 4HGZA 3OKPA 5A5FA 4OKIA 4QEDA 5CHYA 4QFMA 1ISMA 2UYGA 2ZRNA 1ZD8A 3LXXA 4BNFA 2IYNA 2PANA 3AESB 3U16A 4UCWA 3H2JA 5B3LA 5DW0A 3S8EA 4NBTA 1UBNA 2QS9A 1R4NB 3C8UA 3MMXA 4GF5A 3K30A 1JMYA 4U7PB 1R3DA 4J91A 1X38A 1E6CA 1TMGE 2I2BA 1NN1A 2Q62A 3ZQJA 3WRYA 4A0SA 5EHZA 1A4UA 3OICA 5BWLA 3U7FB 3G49A 3L2OB 4OH7A 3ZGXA 4MO2A 3LW7A 1D5CA 3TG2A 2W11A 2C8LA 1V6CA 3I76A 3PFFA 4W99A 4AURA 4FWIB 5IJ9A 2FN3A 1L5WA 4NBKA 1EVIA 1JEYB 5T8KC 4EHLA 3D43A 4UOQA 3HGTA 1NE7A 3WYBA 621PA 4PV7A 3WWPA 4MPTA 4DIMA 3ZY6A 4ANFA 2LKCA 1LTQA 1L1EA 3DBIA 1ZRSA 3K0CA 2A3NA 3GQVA 2HRCA 1EU1A 1DADA 1L1RA 1Z0UA 2PGAA 3L01A 5K0FA 1J0EA 1EFPB 3P8ZA 3SDBA 2QY9A 3TZQA 1LU9A 1V95A 4NATA 5AH0A 4ND8A 2WOOA 4ZT4A 2CUTA 3DQZA 1LDNA 4KPUB 1XALA 3M6FA 1DX9A 1N92A 5J9FA 1F2UB 4YALA 1DGQA 1ORTA 3NIBA 4DJAA 4KQ1A 3I92A 5ESRA 2PBFA 3RC8A 4LV8B 5IJ0B 2HM7A 4C03A 1XEWX 2DBZA 4GIBA 5CLQA 3NUGA 3GRYA 3JVDA 4J3FA 3THXB 2CDNA 3SNHA 4ZEMA 1YR7A 1VL5A 5KTNA 3ZNNA 3BTUA 2HWXA 2REQA 3GMTA 4JYZA 2GPNA 2AOUA 3F3MA 3PI7A 5AM0A 2OHOA 3CBGA 1UQUA 1C1DB 4I8IA 4OUDA 1MIHA 4CNBA 3IDQA 3KXLA 5JVDB 5F35A 3WO0A 4MV8A 3AP3A 2BSAA 2QP3A 3DF7A 5AJVB 3TSAA 3TEJA 5I8PA 2FV8A 1J0AA 4RAOA 5KX5B 4P4SB 2QZ9A 2IXGA 4O4JF 5ER6A 1J4AA 5LQMA 1IY8A 1L5FA 1VHLA 2JKZA 4JXZA 1NP3A 3UOWA 4J4TA 4F93B 3SPXA 2HN9A 5KJ6A 1Z47A 4ZO6A 1XP5A 1QTRA 1FJ2A 3M6UA 3D6UA 1RCFA 1KXJA 3OT4A 4N4AA 1H69A 4I4CA 1KHHA 3QVJA 3WE7A 5KQLA 3SC2B 1A4IA 3M5CA 2AS0A 1RP1A 2O1SA 4TWBA 4EW1A 5IKPA 3CPJB 5CT9A 1UL1X 2PH5A 2BR4A 3HLYA 2IIBA 1NQTA 2Q9CA 1OAAA 2WUVA 4YT8A 3H4MA 4O1MA 4TT8A 1H05A 1T36A 3RUAA 4BFUA 5I3CA 3P0JA 3PRJA 4XZ3A 3FSJX 4XB2A 2OC9A 1YACA 3W04A 1UPBA 4E6EA 4YPOA 1ZC4A 2ZPAA 3ITKA 3SP1A 1ZVQA 3WAGA 3I5AA 2GCOB 5LL6P 4CQNA 4R2IA 3QYPA 3EXHA 1E9AA 3N2EA 4L02A 1JIIA 3EH2A 3JAKB 2QLMA 4AIRA 5K4HA 3TGPA 4CR6A 3HACA 2BGNA 5HQTA 1WWKA 1KIMA 2VZEA 3BXGA 1RI2A 3T3NA 3DHEA 1K4MA 1JDNA 4LVUA 2O8VA 1R6AA 3GUYA 5EI5A 3H86A 2FDXA 1HL3A 2BLNA 4V3BA 3R5JA 4ZO9A 1LKZA 3MXTA 5AK6A 3NAGA 2LCQA 2E6UX 1VHJA 3KHTA 2IHNA 1KBOA 4FPXA 4BMXA 2CZGA 1MAVA 1TF5A 3FI0A 3FRIA 2IH4A 5JJLA 1GKUB 3IO5A 3ESAA 2PR7A 3DL7A 1Y8RB 5CD9A 1F38A 2NZ8A 1KKUA 1CJMA 1M76A 3TLGA 5FNZA 3MQFA 3G0GA 4QJIA 1ODSA 1FXWA 3MQ4A 1ISPA 1ZK1A 2FF5A 3IP1A 2HQOA 1FFGA 3KEQA 4EY8A 1DSSG 1V7CA 1UBCA 3QVXA 4L15A 3TLGB 1PTKA 2NUTA 2FP4A 4PYJA 1KZ1A 1R8QA 1N5IA 2JAPA 2X8JB 4P82A 5DNUA 2WJIA 4I3GA 5KJ1A 1NLYA 1XWFA 5HW0A 3KD3A 1NSYA 2ZBRA 4OJYA 1U0HC 3PDHA 4XASA 2R25B 2PPVA 3T4EA 1T0BA 1E1DA 4JVSB 1WDTA 2ZUTA 5K3FB 1J2YA 4BE9A 2Y93A 4F3RA 4RWZA 3GCWA 1DIRA 4IGAA 4KRYA 4RHCA 2X86A 3B9RA 4PZUA 5TS3A 1V2GA 5LQJA 4KXUA 4YC7A 2IP4A 5GINE 2AK2A 4JA2A 1QRDA 4W5OA 4FN4A 3QFCA 1FTYA 4HJRA 1ZGGA 4R81A 3JQEA 4XGQA 2QE7D 4AICA 3GLFB 4OSOA 4V3CA 5JSUA 2L42A 1NPDA 5GY7A 2QN9A 3D7LA 3AEKA 1OYWA 2I3GA 4TMTA 3Q87B 1GPKA 1K97A 3KOYA 3WG9A 2XNKA 1BE0A 3H3JA 4QASA 4W9RA 2FB9A 3RTCA 5MFPA 3CLTD 3H7AA 2FEKA 1CX9B 3UXYA 1O8CA 3A3KA 3Q3JB 1Z74A 1P7VA 2J08A 3D02A 3MJFA 4WZBE 5JBNA 2MSCB 4MP3A 4EHKA 4R7GA 4HSGA 5GQSA 1X7ZA 2QI9C 5K09A 1BH6A 1I4EB 3JWHA 1FSSA 1J42A 3Q8XB 3Q6IA 3A3OA 1KP9A 5I9TA 1GM5A 2CCKA 1GLNA 1MTZA 3IBFA 3TPZA 1YRLA 1ABFA 1R74A 3DE7X 3MPOA 2QUAA 4R8KA 4N6OA 2AJ8A 2Q2WA 3MINB 4CKCA 4DBVO 2O8FB 4LY6A 1MB3A 2V0CA 4KXVA 5DGTA 4LXGA 4EIWA 3PR2B 1TUBB 1L5NA 1F6BA 2AWNA 3INRA 3ZJTA 1A8UA 1KU0A 3CRNA 1TF2A 3ZV4A 4DHEA 1L9XA 4IG9A 4YV7A 4TZTA 5A2GA 2ZWOA 3R6GA 2V4UA 4ZV9A 2FVYA 4LNUA 3DBHB 4MS4B 2QNBA 2XVYA 4QODA 3ICWA 5ITWA 3FBGA 3D6AA 3IEPA 1NQOA 3K09A 4UXJA 2J85A 2WTXA 3AFIA 2GZAA 2QTNA 4O1HA 3SJ7A 2PS9A 3GT7A 4JP8A 1K92A 4X1IB 1JQAA 1XWIA 3G68A 3MCUA 1FYVA 1XDZA 2LTAA 4YJKA 4QIHA 2XH8A 5IC5A 2JFOA 4Z8YA 3EVZA 4B73A 7YASA 1H4QA 3CEHA 4CBVA 2WZQA 1QTIA 3LCRA 4Q03A 4BFLA 1C8LA 4O4HB 1I33A 4OJNA 3U0VA 2OSBA 2IBMA 3KLPX 3S2ZA 4JV5B 1QO0D 3GLGA 3VH1A 4G09A 1NJ8A 1UT6A 2EZ8A 3GFVA 4CETA 5CFMA 2W4MA 2X0JA 4LN1A 2VTEA 1UBKS 3IR7A 1Z4NA 2VUIB 3JAWA 3ZZMA 4NP6A 4KPUA 3PXAA 3NANA 3MF4A 2B25A 1M9NA 3OOEA 4U7JA 4BPBA 2BFFA 1RD4A 1QWSA 1W96A 4L8LA 3PJRA 3VO9A 3IDFA 4W5QA 1PK8A 4MR9B 4BUZA 1L7XA 4ZT5A 5B7GA 1EJ6A 3AJ8A 4LDPA 3PICA 2RHDA 1ZSNA 4M46A 4YPFA 3EXG2 3UUFA 3IKVA 3K96A 4HYQA 3PTAA 3AKEA 1AK1A 4G1EB 2GERA 4C0LA 4MV0A 2ZI9A 4F4UA 1FRZA 1E0JA 1MFPA 3LTEA 2PDAA 2DQ4A 1D4FA 1TZMA 1U7XA 1G7CA 1THGA 2RHGB 1M2NA 3KV1A 2H59A 5K6AA 1V43A 2LKDA 3V2IA 4EGJA 5EL0A 2AEEA 1UWKA 3T7AA 1VCOA 4GXNA 4HRXA 1QVAA 3UATA 1HYBA 1XCGB 2QPOA 4BB0A 3OQIB 1G2IA 1QR6A 4JDUA 5EXSA 4AXXA 4EL5A 2QTHA 2FWAA 4YYZA 5IN4A 2FZCA 1WZUA 4FEAA 1E98A 3LX5A 2FUNB 3HWX1 1OFUA 3DBVO 1VKHA 3JALB 1OHHD 4JJIA 4MZDA 4CKBB 1S2OA 3DKRA 2W6CX 4MQ4A 4X1KA 4MYCA 5DWVA 2LP4Y 1VI6A 2HO4A 4IGKA 1O1YA 1NMYA 5CDGA 3GY0A 4WMLA 3EW7A 3BRQA 2PSDA 1Z15A 2EX1A 2UVPA 4TYWA 3T7RA 2NXCA 4PQFA 4P3YA 4R68A 5DI9A 2M2IA 3HHEA 4OQEA 4IIBA 4EF5A 1NYLA 1P5HA 2QLNA 2XMCA 4B7ZA 1K7CA 5LQKA 4RA6A 4C06A 2LUOA 2OLJA 4II7A 3N3BC 4A2CA 2FG7C 2F3SA 5D7NA 3UPTA 5IKMA 4JDPA 1RXUA 1LDEA 1T34A 1VHQA 4G0XA 4LDRA 1JIQA 4WVLA 1BH2A 1QP8A 1XU4A 4OLFA 4UCQA 4HSEA 3STXA 1SQGA 3JRWA 2K7ZA 2CVQA 1M1YA 4Q05A 3S1AA 4EKDA 1J9GA 5T64A 4DM7A 4TVSA 1QF6A 4CU5A 1G9SA 3IAHA 1JWLA 1GL7A 5LKRA 4GD3Q 3TFWA 1RPAA 1FQOA 1XD8A 4C4ZA 2PXCA 2D62A 4NE9A 4TMZA 4B3DA 4HRYA 3ICCA 2NW6A 4C7OB 3A3NA 1E94E 3TOXA 3DMRA 3GFBA 5K0JA 3P71T 5I9BA 3LQQA 1T3ZA 3AV0B 4DMUB 1JNYA 4J0JA 3FPEA 3L6RA 3MIZA 3EAFA 2GLUA 3QTTA 4LJYA 4RFSB 1DDGA 5KX5A 2BE7A 4Q93A 1T9HA 1PHRA 4RS3A 4G97A 4V39A 3BVPA 4MQ6A 2O59A 4ML3A 4QA9A 4XPIB 5IH3A 2DULA 1X2EA 4RWEA 3PC8C 2W7TA 2JGNA 2B20A 1E0KA 2XMSA 3CSSA 3I6QA 3I9OA 1JI3A 1PGJA 2ADFA 4Q1CA 3EAGA 3TVTA 1EX7A 1DP4A 2GK3A 4JB8A 2W6ID 1B3BA 1QJ4A 3THWB 1FXSA 2DBVO 3BD6A 4W6ZA 3VX3A 3PEYA 3GRAA 1TC1A 2OO5A 1NVKA 2BFDA 3E5MA 4I4TB 1PD0A 2XGSA 5AVJA 4R84A 4UBMA 4Q7QA 4ZGBA 2Y8EA 1QHGA 4QKQA 4D7AA 4D8YA 1R8YA 1ZUNB 2QD5A 4ON9A 1OAOC 2CB9A 4HLUC 3WGUA 1P2SA 4C7KA 1BDHA 4E08A 2CNDA 4LFBB 4KK3A 2GJSA 1T0JB 4AYTA 1P6UA 1Q1NA 1P2GA 4YT5A 4QT0A 1QLWA 4CDRA 4R8LA 3EPRA 4KAXA 1XKLA 1SXJE 4EGQA 3W5DA 1F7UA 2GCIA 2JI9A 2MSDB 4Y0NA 5G1OA 1QGZA 4S1WA 3KB6A 1IN4A 1WUYA 3V6LA 1ZRMA 4LVNA 3VUFA 3CMMA 3TINA 1HORA 2OCGA 1S2MA 4QXPA 4J2HA 1GQYA 1VLLA 4I14A 4KUHA 3W90A 4TOIA 3KKKA 1X1RA 1OAKA 4OQQA 5B53A 1NBME 3BMQB 1JR4A 3GNQA 3NOQA 4UPVA 5F1KA 4MUYA 2YOFA 1J24A 3KXIA 5D5HA 4WJLA 4U39A 1OXUA 2GJKA 2NZYA 3BZWA 1W36C 2XUDA 3CZAA 3M5DA 4KXLA 2A1TS 2XJ4A 3RIXA 3WLMA 4AKGA 3GLFA 1T8SA 2EWMA 5A02A 3G2QA 3JQBC 4PONA 4GFDA 3MWDA 4ZCSA 3HVKA 2OVBA 3EVGA 2FH5B 1GN9A 2PL3A 3CBQA 3Q5GA 4UEKA 3IQZA 5ENVA 2GBCA 2OBNA 1F48A 1JR3E 4KN5A 4LY0A 3IQDB 2Q3HA 3PA6A 3F6BX 3H18A 2JGMA 4EDHA 1XMPA 3B6JA 3WL8A 3OBIA 1D1QA 1K75A 1SVKA 1VMKA 1WP9A 2IW3A 2X5XA 4BQPA 2XMQA 3IERA 4RDIA 2W2QA 2WFLB 1L2TA 5H7XA 4ZREA 5FWYA 2V7UA 1PSDA 3AHGA 4JX8A 3VHXB 1NKSA 3OECA 3MJEA 1S2DA 4LYDA 2GPWA 3FFXA 5K8TA 1L5SA 1VRCA 4G81A 1LC0A 1A7KA 3CTMA 5H16A 4DUGA 1U28A 3C87A 2E3JA 5TPZD 5BR7A 5A3RA 3AIKA 1I1NA 3I58A 1LF5A 3O4RA 2BHSA 4R05A 4HGNA 3UG6A 4CIXA 4DBLE 4V0OA 3P0FA 2AMYA 3LTNC 3P94A 4E33A 1VP9A 2RIRA 2YFKA 1GLGA 5LZ7A 4QTZA 5K20A 1ORHA 3PRYA 1JFSA 2VYNA 4J4BA 1SVNA 3GD5A 3ROFA 5CLFA 3QWBA 5SZHB 2QPLA 3B9BA 4DDVA 3C3MA 1O6BA 2HSZA 2OTCA 3C8DA 1ZVJA 3QBEA 1CUZA 1ZN7A 3ZY4A 5B1YA 2XUJA 2APJA 5AHWA 1R12A 3LVBA 4LF8B 1PI3A 1DCTA 3TD2A 4OHXA 5P21A 1Z5VA 1T8RA 2OL4A 3PC7A 1H2ZA 2VYVD 2JBAA 1ZWKA 3JPWA 4LUCA 3RU3A 4CU2A 2IS6A 3GWZA 4Q3EA 4KR9A 1NW4A 4IDEA 2ZUSA 3HRIA 1AKEA 4HZUA 1AV7A 1JDJA 4ZTZB 1UUFA 5FXMA 3TTSA 2L82A 4R8VA 4OK3A 1GYRA 4DYVA 2V7XA 2XNCA 4IJKA 3QV2A 4MWGA 3D1JA 2C96A 1TK2A 1RDFA 5B1DA 4MZXA 4PNHA 2GRAA 4RZIA 4YI5A 3G0IA 4CLOA 4TZ6A 4MHSA 3UIEA 2YN0A 5A71A 1Z5WA 4IH1A 4S1TA 4DV5B 1SH7A 3GJSA 4J49A 3SMQA 2GEBA 2OP1A 1FFDA 2QX6A 3D4PA 2D2FA 5K9ZA 4JI0B 2XB2A 5FYQA 3AV3A 1G9TA 4RH1A 4CJXA 5CLGA 3OE1A 5TPZA 2E85A 4UUMA 3NGXA 5TMEA 4Y2TA 4XGNA 4ZGGA 3DL2A 4LF4B 1KEUA 3BWYA 1SKUA 6ABPA 1YZ3A 1JHZA 3TAHA 3OI7A 2EW2A 1BO6A 1NR7A 1G8SA 2WTEA 4OF4A 4F4CA 3SC3A 3WGTA 5JAZA 3RTEA 2BWJA 1QC5A 3AHDA 4RKFA 4FQ7A 3OE7A 3NM4A 5LMCA 1QH8A 3PGVA 4Y1GA 4PLFA 4E1AA 1H8HA 3CEPB 4MR8A 3IQXA 4H60A 4QHSA 4DNXA 3FM9A 4FEYA 3SXUA 4FE4A 2ZLBA 2PK3A 4KK4A 3SCZA 4GP6A 1WVIA 2C61A 4PY2A 3DE5X 1GRRA 4X6LA 5CTJA 1M6EX 4MGZR 5C34B 3T94A 5F2NA 5EJFA 4L8WB 4R9NA 5K45A 3NHKA 2QV7A 3OPVA 1S8AA 4RYLA 4PPQA 4EB0A 1IBCA 3SXJA 3THSA 4BCBA 1YE5A 5H82A 2GHRA 1EXNA 3IMKA 2OXIA 3K3PA 3H04A 2XUOA 2NUAB 4A6DA 5F9MA 1W44A 1UC5B 4H7DA 5KHAA 1FUUA 2EWVA 1B42A 2FZWA 1P74A 1SKBA 4IJWA 4DV7B 3TWOA 4Z3OA 3I1FA 3L4EA 1P33A 2VDRB 3H4VA 1D6MA 3RYFB 4UM7A 4FHEA 3OPXA 2LV8A 3F7MA 4CR7A 4G5YA 3RT7A 1T4CA 2WG2A 1CIVA 2JVIA 1DOAA 4WK4B 1T4BA 4YMTA 1U1GA 3N6RA 3R20A 5GMOA 1DIOB 1U7DA 3VKWA 2EG5A 4BVAA 3TIGA 2W37A 3OZFA 3DAHA 3GQBB 3F8WA 3KSDO 1L4UA 1N9ZA 1Z06A 1HDOA 2XYQA 1RZUA 3OP4A 1VJRA 3TQTA 3U5ZB 1P6QA 4E5MA 4BNHA 5HDQA 4CM6A 1W0CA 2VYCA 3BRWD 4G25A 1QLHA 4E94A 2WICA 4YRMA 1T9AA 3S8YA 3I61A 3E7FA 4FDUA 3ZXXA 4PCVA 4EFDA 2W2KB 3HKBA 3ZHUA 5KSWB 2CXTA 4EJSC 3RYFA 4J0HA 5LQAA 4EFKA 2BL4A 2QM0A 3U7RA 2Z57A 3TDMA 1TZBA 1UC8A 1TVMA 1SHKA 2PWAA 3BTOA 3DXFA 3NJRA 1IATA 2WBLC 3OHSX 1KTVA 3UV3A 4CIVA 5IX8A 3H11B 2V6JA 1Q3TA 1FY2A 4FMBB 1KR2A 1LQUA 1GG8A 4MRAA 1K7XB 2VR1A 3KM0A 2YMLA 2B36A 2TMYA 2VFAA 2VT2A 4EGAA 3U3OA 3GLIE 1AO0A 2GD2A 4ZVKA 2AMFA 3EGCA 4EUHA 5CM2Z 1H2AS 2BFEA 3GLQA 3NNSA 5IH7A 3EMBA 2FK8A 4ZQFA 3R7BA 3LKBA 1JSZA 4RJ2A 4AVYA 1MEJA 3CH6A 4LOIA 3RWOA 1HRKA 3EWNA 1A72A 4D8XA 5A3SA 4F11A 1X9IA 3K9NA 2VH1A 4OLJA 2ZULA 5ALTA 2VDJA 2HSJA 1U99A 1Q74A 1E7WA 1NUSA 2A14A 3HVJA 2WUGA 3VI4B 5C8YF 3FFTA 3H2KA 2RHBA 2OSVA 3E0XA 2VOEA 1Z16A 4YRCA 3UK1A 2WFZA 2OCPA 3Q6NA 4RM2A 3WL3A 2HRBA 2QRZA 4FUQA 4G9BA 1N9GA 1YHYA 3QFRA 3BGVA 2VAWA 2XY4A 2V03A 2VH2A 2ZQYA 4ZODA 2PQ0A 1DKLA 1VE9A 3G2JA 2ZB8A 1XLUA 2BFEB 2XA2A 3C7TA 4BQOA 5FPKA 1ODIA 2B1JA 3I4FA 4EG5A 5K0EA 3D5TA 4P36A 4G37A 4W5RA 3H2BA 3M83A 3MGGA 4M1TA 1V11A 4NOJA 3OZDA 5EIBD 3FYSA 4CM4B 5J4VA 5BNWA 3WB2A 4K88A 1A2OA 1VBNA 3ZJVA 1Z0KA 1CG6A 1N8TA 2FEOA 3CGGA 1ODJA 2J7PD 4OIMA 1ESDA 1NXXA 2IE8A 5IULC 3RU2A 4YTEA 3REQA 2EP8A 5BR4A 4NX2A 2PUFA 2R11A 3OX3A 4OMUA 3U7QA 1BA2A 1L0BA 5CB0A 3NALA 3WBJA 2MYPA 3ZZ0A 2JAWA 2VRCD 2XLCA 3HXQA 1E99A 3KDPA 3QF7A 5DSXA 5JG7A 5E7IA 2R6CA 4KO1S 4AJ4A 3RSOA 4EAQA 4OYHA 3MLBA 4HWKA 3B8EA 3EQ7A 5DE3A 3G7SA 5CA0A 1MRSA 1QBKC 3W7AA 5KPJA 3VR4H 4LMBA 1IOLA 2Y66A 1G2QA 3EXIB 3PQCA 3A25A 1WZIA 3EEQA 2N46A 5F9HA 3CN7A 3CA8A 4Y6LA 2G5CA 3A2NA 3LX4A 3O90A 5TMDA 1BVYF 2P9TA 1BMFD 3BSSA 2B5VA 1IE3A 1RKQA 2H1CA 2OGWA 2Q4RA 4GEGA 4QFCA 4WNIA 4F8JA 1C7ZA 3WISA 1JDTA 4K87A 3SFZA 3DC7A 3J81k 4Q37A 3K53A 4JX9A 3IP7A 4WXRA 3DO5A 1CR0A 3AFGA 1Q7BA 2JIRA 1JBEA 5AW2A 1CUUA 3DBLB 3G79A 4GP7A 2X3YA 1JDZA 3GEHA 1Y1KE 1TECE 1M73E 1Z38A 2FW8A 3JWJA 2W22A 3LHDA 5LBUA 4TWIA 3BCHA 4OFXA 4ZHQF 3JAKA 2JA2A 1Q1AA 1RQRA 1UK9A 2DKFA 3NTRA 4TV9B 5JPDA 1XZBA 1WB6A 4OFZA 5ARBA 3TYXA 3AP2A 1TIPA 4RIIA 5A0VA 5EMKA 2GN4A 2VJBA 1FTGA 1XNRB 1QYRA 2XV1A 3FNGA 3MYRA 4KP7A 3DPSA 4IAOA 3OMLA 4H0FA 4N41A 1ADBA 3M2PA 4WN9B 4DV6B 2BGMA 4AS2A 3MWDB 1J5XA 5KMGB 1M1NA 5TXGA 1J2TA 1R5OA 3HUDA 4KVAA 2ATCA 4OB6A 5AXCA 5TSDA 4AO8A 3PYXA 2QN2A 4CODB 1AF7A 1C2TA 2VZ9A 4E07A 1ULHA 3CB2A 4I9HA 1HE4A 4I08A 4Q9DA 4BAGA 1VPWA 1I3LA 5BYKA 5CDTA 4C4AA 1LDMA 2QVZX 4XYMA 2H4ZA 4TRJA 1SUPA 4GM4A 1CQZA 1NBWB 4NFLA 5A0FA 1KO1A 4UQOA 1GR0A 1PE0A 4KVZA 3RC2A 1HQCA 2DQSA 1BW9B 1BHSA 1VCHA 3OQ1A 4IXMA 5BP7A 1I7DA 3KSBC 4NXNB 1NXSA 1WUTA 3FUXA 3R40A 3OJFA 1IBRA 1M2EA 4G4JA 2GPBA 1ISFA 3B78A 4N01A 3QFTA 4EVRA 5EMJA 1LUAA 4MCIA 2H6EA 3QXJA 2N75A 1BTOA 3CX8A 2XT0A 2WQ7A 2PUHA 3GZNA 2I6XA 2XAUA 1YGPA 3NU1A 4MP6A 3ZU5A 5BT9A 3DMGA 4AN4A 1SRRA 1SHTX 1XL1A