1RLMA

Crystal structure of ybiv from escherichia coli k12
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
269
structure length
269
Chain Sequence
AVKVIVTDMDGTFLNDAKTYNQPRFMAQYQELKKRGIKFVVASGNQYYQLISFFPELKDEISFVAENGALVYEHGKQLFHGELTRHESRIVIGELLKDKQLNFVACGLQSAYVSENAPEAFVALMAKHYHRLKPVKDYQEIDDVLFKFSLNLPDEQIPLVIDKLHVALDGIMKPVTSGFGFIDLIIPGLHKANGISRLLKRWDLSPQNVVAIGDSGNDAEMLKMARYSFAMGNAAENIKQIARYATDDNNHEGALNVIQAVLDNTYPFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Phosphatase
publication title Ybiv from Escherichia coli K12 is a HAD phosphatase.
pubmed doi rcsb
source organism Escherichia coli
total genus 96
structure length 269
sequence length 269
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.23: Sugar-phosphatase.
pdb deposition date 2003-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1240.10 Alpha Beta 2-Layer Sandwich Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 1rlmA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1rlmA01
4L57A 4EX6A 3OCZA 4IG4A 3UMBA 3L8GA 3OCUA 1YV9A 3HLTA 3ET4A 2FEAA 1L8OA 2FPRA 4G9BA 5IT0A 3NRJA 3ZX4A 2Q5EA 2FPUA 3KZXA 1T9ZA 2RBKA 1RLMA 4F72A 3N1UA 5AM3A 2AUTA 4OD0A 3QYPA 1XP5A 3ZX5A 3WGUA 5AKZA 2IOHA 5AKLA 1Z4LA 1Z88A 3EF0A 5E0OA 2YY6A 2ZOSA 5AW4A 1U2SA 5ALZA 3B9BA 1WR8A 1X42A 4YH1A 1NF2A 2GFHA 1RQLA 4BEVA 4YCMA 1PW5A 2FDRA 2RAVA 4KNVA 4CNQA 5AI6A 3L8HA 3UM9A 3WKDA 5AVXA 2OBBA 3UMCA 1RKVA 5ALNA 3SHQA 1ZS9A 2HO4A 3QU2A 1SU4A 3ZWDA 2W11A 2IOFK 3B8EA 3ZTWA 2G0AA 3CNHA 4Y2UA 1ZD4A 3W5DA 4XQ0A 2DQSA 2BDEA 1FEZA 4EENA 4UM7A 2WF9A 2HF7A 4KX3A 4OFZA 5ALDA 2FPXA 3U26A 5AESA 1TJ3A 4Y2TA 3QUTA 3KBBA 2MU1A 4KNWA 4NABA 3PGVA 4Y2PA 3L0CA 3L0YA 3K1ZA 1RC8A 4HGRA 3AR7A 1J97A 3FPBA 5ALXA 1YDFA 1ZD2P 5AW6A 2BDUA 3WK9A 4Y2VA 3I1YA 1L6RA 4BKMA 2YMLA 2B1RA 3ZTYA 3QLEA 3OCVA 2YBDA 1ZD3A 1S2OA 2FPSA 1RPZA 1QQ5A 1Y8AA 2B82A 1LTQA 3ZVNA 5AI5A 2B8JA 4HGOA 2PR7A 1VJ5A 3QGMA 5AVYA 4Y2YA 1YMQA 1U7OA 4HGNA 3N28A 1YJ5A 3P96A 4UMFA 5AIAA 4RETA 2OYCA 4NWIA 2D2VA 3UMGA 3IJ5A 4XPZA 1Z5GA 2P69A 1EK2A 2B8EA 2CFSA 3QUQA 2AH5A 4YIKA 5AHXA 2AMYA 4YCLA 3OCWA 4C4RA 2I54A 5AM1A 2I55A 4CF4A 3WKBA 5ALRA 4JDPA 2OA0A 3MPOA 1RKQA 4ZEXA 1ZD5A 5ALLA 4CF3A 3FVVA 5T41A 5AVWA 2HCFA 4UU1A 3NANA 5AVZA 3FGOA 4Y2XA 2ZBEA 4CF5A 5AIBA 5FP0A 3WK6A 5AM4A 1NNLA 3NAMA 1YS9A 4I9FA 2Q4RA 1U02A 1Z4QA 3NASA 3E8MA 2C88A 2YJ6A 3MN1A 1WPGA 4UMDA 1SWVA 5A3SA 3TLMA 5AW1A 5AI9A 3IRUA 4DCCA 5AKIA 5ALQA 3PDWA 2W4MA 3ZVLA 2GHQA 4HGPA 3CZ4A 4KX5A 3R4CA 4DFDA 1O03A 5AICA 3ED5A 3N5KA 2FPWA 1L7MA 3SLRA 1RQNA 2EAUA 1YNSA 1Z4PX 3ZVMA 3AR8A 4XOUA 2JAUA 3GYGA 4EX7A 1XPJA 4L6AA 5AK6A 1F5SA 4UW9A 4EELA 3OCYA 3RFUA 3S6JA 4E88A 2FUEA 4FFDA 3E84A 5AW2A 1RLTA 1T5SA 3A1EA 4AS2A 3U7FB 3OTQA 2G09A 3OCXA 1VFPA 2W43A 3N07A 4I9GA 5AKYA 4UAVA 1IWOA 2GMWA 5ALEA 2JAWA 3M9LA 5ALUA 3R9KA 1WVIA 2WF8A 2WHEA 4J03A 2NYVA 3KD3A 2I6XA 3MC1A 1L8LA 1L7PA 1U2TA 4EZEA 2IA5A 4UMEA 2HI0A 3WGVA 4UAUA 1Z5UA 1CQZA 3HYCA 1ZJJA 2YJ3A 1SWWA 4UU0A 2ZBDA 2HDOA 1RKUA 2P11A 3QXGA 3WKAA 3I76A 2CFRA 4AS3A 3ZU6A 2FI1A 5AK3A 5AKXA 4IFTA 1S8OA 2CFTA 4BX3A 2YJ4A 3ESQA 4HAIA 2GHTA 1Q91A 5AVRA 4BX2A 4FE3A 3DAOA 4QQFA 4NFLA 1NRWA 2P9JA 3EPRA 3MMZA 4HGQA 3SKXA 3QUBA 4NAVA 5AVSA 5AW5A 3M1YA 2C8KA 2G07A 3ET5A 3KOOA 5ALPA 3BWVA 3BA6A 2R8XA 3OPXA 4J2TA 5AVVA 1TJ5A 3L8FA 3KDPA 3NALA 5AKGA 1Z4KA 2MSNA 3NIWA 1RDFA 5AM0A 4O8CA 2R8YA 2O9JA 2NO4A 5ALKA 3E58A 1Z4JA 3L8EA 3ZWKA 2JARA 3A1DA 4AP9A 3ONNA 5AW8A 2G08A 3SD7A 3DNPA 5AKEA 5JJBA 5AW9A 4UMVA 5IT4A 4UATA 3A3YA 2HOQA 3WKCA 1L7NA 1KYTA 5AVTA 2X4DA 5ALGA 3AR4A 2FUCA 4BYGA 1MH9A 4KYTA 2VKQA 3I28A 2C8LA 1VJRA 2CN1A 3PGLA 4G63A 1EK1A 2WM8A 4L6CA 2JAOA 3FZQA 4MUMA 4MWOA 2GO7A 5ALOA 4OHFA 4ZEVA 2C9MA 5ALIA 4YIHA 4JB3A 3AR5A 3L7YA 1RMYA 3AR9A 3SMVA 5ALSA 2ZBGA 4C4SA 1LVHA 2EARA 1U7PA 2P27A 1QQ7A 2PQ0A 1RRCA 2R8ZA 2B1QA 3IB6A 4DWOA 3I6BA 1K1EA 5ALFA 3QX7A 3W5CA 2G06A 1RMTA 3VAYA 3EWIA 1N8NA 2PKEA 3KC2A 3SKYA 4BX0A 4Y2RA 4CE6A 3FM9A 2RB5A 2EATA 4HYTA 1XVIA 2WFAA 4FYPA 4UASA 1TA0A 5AK4A 3AR6A 5ALJA 3WK5A 5AW7A 3L5KA 3U7EB 5IS2A 5AVQA 3NUQA 3L1UA 1ZRNA 3U7GA 1QH9A 4B6JA 4DW8A 4BNDB 2IOFA 2I33A 4C4TA 4BBJA 4RESA 5AVUA 5AI8A 3SF0A 2HF2A 5ALYA 2R8EA 1TJ4A 3QU7A 2Q4TA 3E81A 5ALTA 1Z4NA 4Y2JA 2B0CA 3PCTA 2NO5A 2JGAA 3L1VA 1RMQA 5AM2A 3ZI4A 2YFYA 4Y2SA 3DDHA 1RLOA 5AW3A 4GIBA 2YMPA 4H1WA 5ALWA 3D6JA 2ZXEA 5AK5A 5AKHA 2QYHA 4PNHA 2I34A 1J8DA 4GXTA 3WK8A 2YJ5A 2YMMA 5AKKA 5AM5A 2IYEA 5A3RA 3F9RA 3ESRA 2B30A 5AI4A 2YMQA 5ALMA 1QQ6A 1Z4OA 3A1CA 4BEWA 3WKEA 2AGVA 3N8GA 2ZG6A 1ZOLA 3QU4A 4OCZA 3AR2A 3WK4A 2RARA 2HSZA 2WF5A 2WF7A 3QNMA 3U19A 3EF1A 5AI0A 1QYIA 2G1AA 2QLTA 3U13A 1Z4IA 3U7HB 4ZEWA 2ZBFA 3B9RA 3FPSA 2I7DA 3ZUPA 3ZW7A 5AKJA 3R09A 4EEKA 2OM6A 2G80A 2ODAA 3QU9A 4UARA 4BNDA 3L0BA 2WF6A 1CR6A 2YN4A 4YCNA 1T5TA 3QU5A 1N9KA 4YGYA 1O08A 1WZCA 1TE2A 2HX1A 4Y3UA 1Z4MA 5AW0A 3AR3A 3RF6A 1JUDA 4Y2QA 4NV0A 1ZRMA 5A3QA 2O2XA 1L7OA 3W5BA 4KN8A 5ALVA 3J7TA 3WK7A 2BY4A 5ALHA 2C4NA 2HHLA 4F71A 4QJBA 1AQ6A 3W5AA 3QUCA 4UM5A 2HEGA 1Q92A 4XE5A 3DV9A
chains in the Genus database with same CATH superfamily
1K2VN 4HLUA 3ASVA 4UE2A 4CMAA 1TKRA 4KQHA 3L8GA 3TXXA 1QLJA 4GMGA 4PIVA 4EO7A 2PZKA 1N4DA 5BNTA 5H7XA 3C1UA 4RHXA 5IUJC 3NDBB 3BGIA 1RNLA 4G9BA 4V1CB 3C7TA 3NRJA 2QAGC 4NF2A 5LOVA 2A1UB 5BY2A 1IPFA 1NDUA 1KC3A 4ISCA 4O3FA 1YJ8A 4YFYA 1TW2A 1V1JA 4XW2A 4GP7A 2VSXA 4Q4LA 3DAYA 2IOHA 3PIRA 1Y3IA 1Z88A 3B1KA 1I80A 1M10A 4QOJA 4ARAA 4B75A 4OG2A 3KSRA 5CTAA 1U2SA 2OG1A 1ZN7A 3EXHC 1HE4A 1HZZA 5EP2A 2ONCA 1VLVA 1S6YA 2GFHA 1SXIA 1TVCA 5I6DA 4ARZA 4PPQA 1AKVA 2YVQA 3O92A 1ABFA 2H51A 3TEFA 2B1JA 4J76A 5JY1A 1A50B 2RAVA 3M81A 5CT4A 2X3FA 4CNQA 1GVHA 3EXEB 1MTOA 2NSHA 4RTSA 2IEBA 3NRCA 4J6FA 1C80A 4MP8A 1UIMA 4OXNA 4ADSG 3AVUA 1DT5A 3IJPA 2XE6A 3NP9A 3UMCA 2B4KA 2ZYUX 4YQZA 4IJWA 1DI0A 3MUEA 2PLNA 4JBIA 1F0KA 4MNTA 4M22A 1YZKA 3V6MA 3GV0A 1MPTA 2A8YA 2I78A 4ODIA 3SXPA 4F4DA 2C3PA 1O9BA 2C3MA 3EFOA 5EJMA 5EKDA 1YCDA 1MJNA 1PGNA 3D7SA 3FWHA 3I9MA 3UPDA 2AW3A 3I34X 4URHA 1J49A 3NVDA 3BJEA 3QRWA 3TX6A 1K4MA 3QWFA 5TMEA 5K0FA 1E92A 4MQFA 2WWWA 4RACA 1DRUA 2Q2VA 4OREX 5KYGA 4IFIA 3REGA 1J2TA 4BNNA 1XAGA 4I81A 4LBVA 4V03A 3ER9A 1RZRA 3IB3A 1P0QA 1NIPA 4KAXA 2H7VA 5TT1A 1AHNA 4C7OB 1G60A 4CMHA 1S3SA 1YDFA 9ATCA 1FXWA 1N2ZA 3MA0A 4C08A 2VQ3A 1Y8RB 2PZAA 4WUTA 1BZYA 4YRDA 3FMOB 3DNMA 5KHLB 4LRUA 5DSXA 3X1MA 1QH0A 3NEJA 1WCWA 2H92A 3MYYA 3KQSA 3NLLA 5BNWA 3K8ZA 1YR3A 4PF1A 2DETA 1S2OA 1IVNA 3KTFA 2CZQA 2EIXA 3C3DA 1VFNA 1LTQA 4E13A 3FZEA 2HU8A 4FFMA 3E1SA 4TUYF 3CUYA 5CAEA 1Y5IA 5ECDA 3NC4A 2F8LA 3F5MA 3BRQA 4Y2YA 4P3XA 4S04A 2QTAA 4MPRA 3CF0A 4YJ2F 1XROA 4N6OA 3DVRX 5BRAA 3A10A 1NBMA 3ROGA 1ECBA 4AI6A 2FWBA 5A3JA 3T7IA 3W6OA 2QVXX 1Z18A 2FQ1A 3P96A 5FBLB 1M2OA 3TQTA 2DKNA 4EHHA 3CLRD 4PO3X 2MINB 4F6CA 1IZ0A 4YRGA 4U7JA 2PY6A 1JJBA 4AUEA 4BQRA 2WWYA 1IOLA 2G04A 1P1HA 1U99A 4YMSA 2X2EA 5FA5A 2FR8A 3EK2A 3CMMA 3PA6A 4HDRB 2XAAA 3A31A 2QX6A 3VDXA 2IYRA 3ZG6A 2FN8A 3UJDA 4AURA 3K5IA 1SHKA 3AEQB 4JI2B 2WZCA 3CRMA 1W85A 1WA5A 3CXUA 3ILHA 1HLFA 4MJLA 4PVDA 4Y0AA 1N2BA 1P5HA 5JZ9A 4FFNA 1ZMTA 1GGEA 2JVIA 1BXKA 1E4OA 2XKBA 1SVIA 4OQEA 3N7TA 1NOIA 3GW8A 2QL7A 1CB7A 2PKQO 3ETLA 1JHDA 1GTZA 4KXYA 1UZMA 3NATA 1NXXA 2EWVA 3IQZA 4MPPA 1DIHA 1ACMA 2J3JA 4GM0A 4UDYX 4FSXA 4UU1A 2AC7A 1XF9A 3P9XA 3SPXA 2DWPA 2CUNA 3H13A 1MA0A 4Q1DA 4CKCA 3KETA 4JNCA 1HX7A 2EZ4A 2AJLI 4HL6A 3TAHA 3MTDA 2NUAA 2YQZA 3IE1A 1LU9A 1A9YA 2GPWA 1V26A 1QF9A 2AX4A 3D4LA 1MOSA 3QXXA 1I9CA 5I9NA 1PU2A 5DHUA 2IKQA 4KLCA 5L53A 5HMLA 5CYPA 4RS4A 1I1QB 4H1HA 1RLIA 2X8JA 4KTVE 5AKIA 4RTLA 1VMKA 1PQYA 2W4MA 1XCJA 2BHRA 1E2GA 1WNTA 4PLHA 3A6FA 1FUKA 1M6VA 2C0CA 2YNMA 3BIFA 3F3KA 1C14A 3MSXA 1FUIA 4IHKA 5HJ7A 1TQ2A 2VVTA 1KSJA 1ZD1A 3UFXA 1A2KC 3K6SA 4BB0A 2IY7A 1RYDA 4RMJA 3SLRA 2EX4A 3VR5H 5D8DA 3M89A 3AR8A 4KRFA 1DGQA 2A9OA 2C5EA 2B21A 5HIMA 2PQ2A 1J23A 4N9QA 3UG6A 2P67A 3IDOA 1I1OA 2YHSA 4RABA 5AYVA 4O2RA 1QO7A 1JFFB 3NT2A 1X1TA 1EQ2A 2TS1A 4KW7A 3WRWA 5CB6A 4ZO4A 2IJGX 4DJEC 1EDZA 5MHTA 1SCDA 2HHHB 4X6LA 3E84A 5KOIA 3D8TA 5IXSA 2AQKA 4NU0A 5B57C 3BYZA 1AK1A 4CDMA 4MI1A 2RGNC 4C3ZA 2X3UA 1MRNA 3HFSA 1YFLA 3A6KA 4DNPA 3H3XA 2WTEA 1YS6A 2PSEA 2C7OA 5JI2E 2KBEA 2PJRA 1YUMA 5AJHA 1AO0A 5IVHA 1G6KA 3M9LA 3R9KA 4FYKA 3ZS8A 2WHEA 5GJVC 2C5GA 2C3OA 3I83A 3WGKA 1UK9A 3CKKA 3PX2A 2YRWA 2CBGA 3PXXA 5KTNA 3V1NA 3Q5DA 5JXGA 3RGWS 1JEQA 1F6BA 1JKXA 2AOUB 5HF6A 1Q84A 1SEPA 5TMPA 5TPZA 2VZEA 4KSYA 4WY2A 1VTKA 3G2OA 3A4IA 1Z82A 1JDSA 4QBKA 4MUAA 5EEHA 5F78A 1CVLA 1QCDA 2ZUSA 1H93A 1T26A 2NQ2C 4C88A 5CDTA 1P4GA 3FYCA 1O96B 2QIOA 2NO0A 3L1KA 3VSDA 3CZPA 2O54A 1E2KA 1CUUA 4MV4A 1XZAA 5D84A 1SKBA 1EWKA 1I4LD 1FJHA 2FY8A 3N74A 3RH0A 4ZI7F 1R74A 1VCIA 1VHQA 2BPOA 3ROZA 4G4JA 4N7BA 5D51S 4CGYA 1Z83A 4W1PA 4DCUA 2CF5A 2GA9A 3VMFA 4JVSB 3ZI7A 2V7PA 3BWBA 3AL3A 3MWEA 4E4TA 3DDSA 3ZWWA 1N1MA 4J4HA 1XXLA 2NSLA 4O02B 4ATNA 1XQWA 1E8MA 1SZJG 3O7MA 4F56A 3ST7A 2UAGA 2QM7A 4L78A 3Q0IA 2BM1A 3G6WA 3CEAA 2ETVA 2GAAA 4L73A 4D3YA 3LA6A 4MV9A 1BS1A 1DC8A 3WDMA 1GTRA 1EM8B 3I9FA 2QTNA 4GXQA 2PMEA 4J2TA 1ATIA 3HVUA 3HV0A 4P3KA 4PG4A 4QWWA 4YQYA 1HFJA 1XAJA 3ILYA 5CBPA 2O59A 4UE3S 5I5GA 4QBFA 4X60A 3SS9X 6ADHA 1XZEA 2QVCA 2FSGA 3CU5A 4RHEA 3VZSA 5H68A 1XDGA 3M9XA 2ZSEA 1FQKA 4KGVA 4KO2S 2O9JA 4JVLA 5BN4B 2RGAA 2AJCA 4YVFA 5KTKA 1T3HA 3WAJA 1OFUX 2YDYA 3GG2A 1VL2A 1A88A 3K0CA 1N36B 4R8LA 2Y27A 1JXQA 1K7FB 2X9VA 3F1LA 1IHUA 1AV7A 2C95A 4J94A 1BCSA 1ZL0A 1SRRA 2P9TA 3H9JA 4I1IA 1DBSA 4AP6A 4BZPA 3CVUA 4ZVOA 3KJIA 1EP2B 1DAMA 2W2LA 2YIMA 1PKEA 4K7JA 1L8AA 3U1TA 5H02A 1EIZA 1DKMA 1XV5A 2PRZA 2QLNA 4FDVA 1JIVA 3O93A 1TQ8A 2LRHA 2Y2UA 3VUEA 4IH9A 3K4PA 2MT9A 1NI4B 4GGPA 3ONDA 4PG5A 2G0TA 1ZIXA 5DCLA 1YRHA 4QBGB 3Q98A 1JG6A 4KQXA 2IZ7A 4V2IA 4NAUA 5J23A 4R16A 1NXQA 1PFWA 4DTCA 5I7EA 4GLOA 5T4HA 3KCQA 2BFPA 1E69A 5BNIA 5G0VA 3CRZA 1K8QA 5A5VA 1KZ6A 2RHOA 3GQBB 3FZYA 3NBXX 4MQ5A 2ISQA 1SUFA 1VIAA 1NOJA 2FPIB 5HOEA 2YIVX 1E18A 1QPBA 3TQFA 4EPXA 3LLSA 2GEBA 2NVWA 3KVNA 3MJFA 4HAOA 4RX1A 5GY7A 3ITEA 1EE9A 4OXKA 4PCUA 4MCIA 5KTYA 3C2QA 3P0FA 2R7KA 1GQRA 4B84A 4EWLA 3SM3A 4ZT6A 1ULZA 1V1RA 2LPMA 1KBZA 2QY9A 5DNAA 1WABA 3AM1A 2QMUA 4C4ZA 1EM6A 2FWPA 2H3EA 3S8MA 4BN0A 2WYUA 5F35A 2B8NA 1HC7A 2I6GA 2ZJ4A 3KXIA 3Q9LA 3R0JA 4Q4HB 3ADBA 2A0FA 3OT1A 5FNVA 4PWYA 4XQEA 3GCDA 4Y6SA 5HKAA 2ZUBA 3D8BA 4L27A 2EGGA 3W5CA 3IVGA 3KC2A 5P8WA 1ZM9A 1YE8A 4HDKB 2AUNA 4ZAZA 1I3LA 2QI9F 3G2QA 1RRPA 1N1EA 4TT3D 1KMIY 3QVSA 1PJRA 3VO8A 3R5XA 1U94A 1GT6A 4LX0A 1VGVA 2I1VB 3PUXA 5ALJA 5K0GA 3KSBC 3DQZA 3OLWA 5FQNA 3NYWA 3W2GA 4P4GA 3KSZO 4E5UA 5TLSA 3G02A 3F6BX 5D3QA 1NU6A 1AUXA 4WOBA 4B6JA 2ZANA 1PFVA 1U1CA 2RHLA 2I33A 3I2JA 3KP1A 1PGOA 3Q5GA 2IUSA 5E6SA 3PC7A 1P33A 4WCFB 2J6CA 4J0IA 3HJNA 3JRXA 4ARSA 2DLDA 1GUFA 2ZBUA 3NNSA 1DNPA 1L1RA 4RMNA 1H65A 1CZOA 2HF2A 4H6WA 1XRQA 2PRJA 1GGFA 4Y6GB 1LQTA 5ALYA 3D6VA 2C4TA 1LDEA 1J0XO 3WJ2A 4ENRA 1G16A 4RNCA 2R8EA 5J4HA 5JMOA 2JJYA 1YBAA 4X8OA 4NI5A 3ZZNA 1QWSA 4Z8YA 2CKMA 1E3QA 2ZIUB 4LGVA 5KYUB 3BZWA 3RSFA 1LK7A 4HZUB 4I2NA 1W73A 4MGYR 4MV3A 1OBHA 3CH7A 1Z2DA 2CLDX 4QHTA 3ZI4A 3C1OA 4Y2SA 5EJ8A 1T8RA 3AHJA 3DDHA 5K3BA 2VN8A 3TQCA 4F6RB 3QNWA 2AKYA 2QX7A 3D8SA 4YO7A 4Q00A 4FMDF 3QWIA 3L7LA 3D6JA 3DDCA 5AK5A 1M6NA 1IQUA 5EHZA 4E5DA 1YMUA 2QYHA 1U1DA 3Q88A 4ZANA 3NIDB 2FWIA 2WA1A 1ZKDA 4AMYA 4DQXA 2V98A 3UWDA 1Z6QA 1E2MA 3DEAA 4CEJA 3TPCA 1P91A 1OOEA 2NAFA 3V00A 1X77A 2P2DA 4NZPA 3ZDAA 1EBFA 3P2IA 3A06A 1NY6A 3HPQA 3LCVB 3T9FA 4PAMA 4MA5A 1KQFA 2I3BA 2Z83A 4W9NC 4YUXA 4J29A 4J9VA 5ILGA 2WU0A 4EJSB 1SBQA 5BOSB 1X70A 2OORC 4MB2A 2FLKA 3SVZA 5IVKA 1NT2A 1UCFA 2DCUA 1BU8A 4FR5A 4QICA 1NP6A 2R5FA 4B0PA 5FPPA 3PU6A 4ZYUA 3FHCB 5FEMA 1Q1AA 2IUFA 1WUTA 1Q0PA 1J8MF 2WF7A 3WK4A 3KQOA 3M70A 4AJ1A 2C2YA 2QF7A 1OB2A 4DCGA 1OAOA 3CN9A 4CL8A 1FTYA 3HB0A 4BMPB 2B5OA 1RQRA 1WUYA 1E1QD 5LB4A 1EGQA 1OPXA 1QIMA 3BQNB 4IRUB 4MGIR 4PS1A 5KCMA 3ZHUA 2P3QA 3PPXA 1MX5A 4Y67A 2H1VA 3HCCA 4REOA 2F8TA 3FOEC 3IV7A 4HH3C 3R5KA 2EGUA 3QU9A 3EE6A 3O4RA 1BW9A 2X7JA 1ZUIA 3KQQA 5LMCA 3O90A 4AY4A 4B3JA 1D9ZA 1RYYA 1G8JA 4HZIA 4HY3A 2HX1A 1O89A 4KN9S 1N0UA 5E4TA 4BQIA 3K70B 3G5MA 3U81A 2FFAA 2RGCA 4TV9B 1J5PA 2W0MA 2DFVA 4BNUA 1ZVJA 3O8QA 3PQ5A 4XVCA 4DRZA 3R8FA 2R1UA 1KXZA 2BEWA 2A33A 4M0FA 5BVGA 1CY4A 5KINB 1L7OA 3HP1A 4IIJB 5TJ9A 3WK7A 1E58A 2H85A 1R9MA 3JAKB 4ZYTA 4CFYA 3USCS 4EQZA 1UT5A 5B7GA 4U00A 5G40A 4EYGA 2WIDA 4RTPA 2OFOA 1I51A 1XN4A 3K2QA 2Q1UA 2VC2B 3DH0A 1Q44A 3GDHA 2PFSA 5BOVA 4DILA 4UM5A 1P1BA 1D03A 1F2UA 3KVVA 5CLQA 4A73A 4F5WA 5BQ3A 1V1MA 1Q92A 1VSTA 2IV2X 4D02A 2VOEA 3Q7IA 4BQNA 3OTOB 3ACBA 1C0KA 5CIWA 2Q5CA 2CNWA 3NT5A 5DHFA 3AO0B 1V7CA 4FIDA 1QVWA 2JDID 1CQXA 1T9AA 1USVA 2JCBA 3GEGA 3NDJA 1J39A 2LKCA 4KK4A 4IICA 2JI7A 4Q9HA 3RYTC 3UMVA 1NDQA 4RFSB 5FKJA 4MKRA 2NTJA 4K0RA 1L8OA 1WZUA 3L5OA 1VZ3A 3E27A 3G13A 4ZV9A 1X1BA 5ITVA 2B1GA 1DOHA 3D7LA 3EYWA 3GOHA 3PQ6A 4D4HA 2PWZA 2QRGA 1MHTA 4WBSA 2QU7A 3AF5A 3DMRA 1K5DA 3S2EA 3OZSA 5DNWA 4A15A 1N2JA 3MJCA 1WMFA 2F9MA 1SXQA 3EEBA 4UTOA 5T3UA 3IOEA 3TQOA 3GLFE 5K7SA 1MUUA 3NC0C 2B34A 1B15A 1DKOA 2AOWA 3A9TA 2R87A 2YJGA 2Z04A 3E0QA 2DHQA 1VJCA 1P2VA 5T4FA 1RIIA 4GOOD 1KGDA 3NWEA 4IS3A 3K4QA 2CF6A 5ALNA 4DGQA 2WM9B 3ZZMA 2P9YA 2GESA 2V3WA 2NOAA 2YZGA 4L8LA 5JD3A 2C78A 1KXJA 2CNOA 4AJEA 4CCWA 2FPGA 5A6SA 1UBOS 1F0YA 1DKNA 2PTHA 4K1XA 3INGA 4M0UA 1ANKA 4M9CA 1TGYA 4ZOAA 4LTDA 4JBWA 1SVKA 2JJ2D 4E4YA 3AFMA 1G2OA 4QUJA 1QAMA 2ZIXB 3MLBA 2F8MA 3BMCB 4Z0HO 4DEXA 2VF4X 3EDCA 2HF7A 3LC0A 3ND7A 3ZI0A 1M2VA 4E70A 4JLUA 2VWHA 2PRSA 2XMSA 4QXMA 2JGIA 4ZVLA 3QKWA 2FG7C 4Y2TA 4UUBA 3O4IA 2HADA 1ZR2A 1P72A 5IH3A 3ONFA 1M1NB 2CHQA 3V7WA 3A6DA 2IYYA 2GCEA 3ZBQA 2V96A 1ZMOA 4MIEA 4DSNA 4B7CA 3T52A 3ZEAA 4AG3A 2A5DA 2EFEB 2KWIA 3GHYA 1JHAA 2BBOA 1OWNA 1Q7BA 2APJA 5J43A 1VPWA 5KWJA 2V6IA 4X5OA 4F7WA 5HHTA 4YUVA 3CH4B 3ZIUA 1FNDA 1T9HA 3GAMA 4G23A 1OW3B 4FYYA 3OJOA 3DZJA 3TUJC 4KPUB 2QUHA 3ND6A 4EI8A 4Q1AA 4Y6OA 1ILEA 5BW8A 1GCUA 2YHIB 3CG4A 3DHWC 4QTTB 5CCXA 4DUYB 2WP0A 4XCVA 1FYWA 1JYEA 2Q3HA 2QLJA 1QGOA 2BM0A 2WNHA 3ETHA 3LQ1A 1GUBA 2E3JA 2PFGA 2NYRA 3NTXA 5DULA 3THXA 4D7AA 5LLSA 2DPLA 1PS8A 2ZWPA 3G9XA 2GM4A 4G5FA 4GOKA 2ZZNA 3UKOA 4G0ZA 3DCJA 4RJLA 4YECA 4CLDA 2ADFA 5K6AA 3T94A 4Z86A 4IHJB 3GRAA 4RELA 3V8VA 2EV9A 3IMFA 1V4BA 4F96A 1VSVA 1N5JA 2FRXA 2Z56A 3WVNA 1A5TA 1XYYA 3MWYW 1WB4A 1OB5A 5ECGC 1WG8A 1BEZA 3JASA 2GNOA 2Z8ZA 3NHFA 4ZMSA 1CU1A 2H2DA 4DE5A 4QYSA 2JFZA 3NHUA 4GT1A 3FCUB 2MSWA 1ABBA 2PJZA 3ZOZA 1CUGA 3F67A 1L4GA 3QXHA 3A4TA 2D8MA 1T4CA 3B2QA 5JMPA 3PUZA 4ZAFA 1IXYA 4KFRA 1ISMA 2FFHA 1L8QA 1ZK3A 4JC8A 1RXCA 3KTOA 1OFIA 2H00A 1XZHA 2VAWA 4WXRA 5FUYA 2IPLA 2OA0A 1VL0A 3VV2A 2QV7A 4WQMA 3FW1A 1RKQA 3EXAA 5ES4B 3OH8A 2H0RA 1N3IA 5FH9A 3D8HA 5ALLA 3D64A 2N0SA 4N5MA 2GI4A 4KB5A 2F64A 4EA7A 1BXGA 2POQX 4N0EA 2OZLA 5DP1A 3AVQA 2EQ5A 2I8LA 2P1DA 4EECA 4S24A 5DN6A 2WILA 1Y5RA 2ZJ3A 4LQLA 3HZRA 1V25A 1EX7A 1FDIA 1U1IA 3K9HA 2PXAA 5JXWA 2GZ3A 3WLPA 3D7RA 2IV3A 4U6QA 2NYAA 3GAZA 2D54A 2GLUA 2ZITA 4IJUA 2FFJA 1R16A 5BQPA 5F2KA 1CS0B 3AOGA 4QBIA 2QPLA 1VL6A 1X8KA 3OX3A 4ZOLF 1QH1B 2FEXA 1BRTA 2OCLA 2QDKA 3FNGA 4IHQA 2AZMA 4K3UA 3A7DA 4HVTA 4LSGA 3JQBC 4HGPA 4RE6A 5FB3A 4NJMB 4MVJM 1WXIA 3FWZA 1BHQ1 1W4AA 3G89A 4UUOA 2PVSA 4M1ZA 1L5GB 1PTJA 3T41A 4DQUA 3TOSA 5IFLA 2C58A 2CMFA 2GK4A 1KSHA 1PR6A 2W6JA 3M6XA 4WA7A 4MUIA 1DG3A 2H9AA 2GZHA 3JYQA 1KJWA 1Q1ZA 3WWPA 1DAPA 5G0WA 2RE8A 1CY0A 1C1DB 1JXMA 2SCUA 1JWLA 1B2LA 2C2XA 3EMKA 3QA9A 1SU8A 4XEUA 1HURA 5C31A 1TMYA 4GOND 4I9HA 2R86A 1O7JA 4YT5A 4UW9A 3ZEIA 3ZXUB 3HY3A 5JSFA 2EU8A 3OCYA 4LJ6A 3QYFA 5HF5A 1Q0TA 1DV1A 1J4AA 2HNAA 3BA1A 3DXXA 3FTEA 3VR5D 1CWUA 2IYOA 4EY4A 1WWKA 3DKPA 1WEHA 3D3WB 3ZD7A 1XZLA 1TD1A 3T5BA 1EFVA 2JCVA 3BSYA 3PQFA 3GVPA 3EA4A 8AT1A 5CR9A 2FSHA 1NR5A 1RQPA 2NZXA 1H22A 2CYCA 3N39C 4FD2A 2ZJ7A 4YBZA 3MINB 3WLNA 1O94A 3LZ6A 2EWWA 1THTA 4K46A 1F0NA 4XTCS 3PVCA 1WTAA 3KD3A 4AKSA 4D9CA 2ILVA 3O82A 1T3GA 3GMTA 3RYIA 1DT3A 1RYMA 4D74A 4EAAA 2DC1A 1BA2A 5MGBA 3LQRA 5AK0A 1HNWB 4MEBA 4YJKA 1KPHA 2O4CA 4AU1A 4Z4QA 1PNQA 3AK4A 4BNJA 3CZ9A 4DNOA 1T1GA 1SAYA 2PS1A 3FFBA 1YIDA 3PDIB 4PPFA 3RUFA 3T1OA 5DTRA 4MYRA 4DUZB 4A03A 2ZE6A 5F4BA 4B87A 5TXGA 1CZHA 2QSJA 3MRTA 2I80A 5LCXA 1GEEA 1GYPA 3IAXA 4HUJA 1KFBB 4P4TA 1YQWA 2CFRA 4I1YA 3TFWA 4FEYA 1X86B 2B2NA 2GGSA 3RSQA 2FRDA 2GZ1A 4WV3A 3CCFA 5AK3A 1KAEA 4HLQB 4X41A 3UWKA 2HWUA 3RGGA 1XFDA 5K9ZA 3GP5A 4MEJA 4R1UA 4DADA 1QP7A 3OX2A 2BFCB 4K9SA 5EZ6B 1W1UA 2B2CA 3LGAA 2JKZA 1T1RA 4EJ2A 3JD3A 3ONVA 1ZJZA 3T5AA 3NJ4A 2J3KA 4BP8A 1I7QB 2ZUDA 3LC1O 4F4UA 5CEJA 5FOXA 1DOZA 1R1DA 1UEXC 3KXLA 3QE3A 3EQ8A 2QGZA 3OF5A 1HL7A 4AMBA 1T6NA 1FZQA 1TM7E 1YBFA 2V6MA 1A2QA 2ZT6A 5TS2A 3DE5X 4ZARA 3B48A 5HKKD 3L4BA 1V47A 3GCGA 1BH6A 5TR9A 1O8CA 4RLFA 3M1YA 1P1IA 2IOQA 4CM8B 3L7BA 3A9UA 2VQSA 1LBHA 1X3LA 2N9UA 1QZXA 4HEQA 2PMKA 2MSNA 4JLJA 4C89A 2HN9A 5HRCA 2PO5A 4B46A 2WHXA 5TVKA 2ZJBA 4EKYA 3ORQA 2Z3WA 4PC6A 2D1SA 1J9ZA 4D26A 1TF2A 1NW8A 1YRLA 4S1WA 2YQ4A 2WIAA 4TMKA 3CSUA 3NPAA 3RSGA 3WICA 4IR7A 3R3YA 2VRNA 3KUDA 3NH6A 1CBUA 1IZZA 1BXZA 3FKSD 4HS9A 4WZ6A 5TEVA 2WA2A 2IXBA 2VFAA 4U3JA 2ZREA 5F9FA 5AW8A 4GQBA 1P9OA 2FGJA 3H5AA 3PNPA 4LWZA 1LF5A 4F4JA 2CL5A 5LIPA 1LK0A 3JSAA 4WINA 1M5TA 3QITA 1NMXA 3ZNQA 1MRSA 3AKEA 4RF3A 1EUDB 1L0BA 1K9VF 2QR5A 1Y5MA 3VKGA 3FETA 4PC3A 2W2PA 1HEIA 1RWMA 2HQOA 2L82A 3LHFA 2FSUA 3T99A 4Q12A 1ZINA 4G4SP 2GEJA 3GL9A 3CEHA 5C81A 7ADHA 2HMUA 4LHYA 1DLIA 5BSGA 3NKLA 2PZBA 5CIYA 5GADl 4PEVA 4JI8B 2ZXUA 4L5IA 3OSZA 1BGWA 1XO1A 3SEFA 3UMYA 2CLMB 3OMWA 4X1KB 2ZTUA 2OO7A 3G1UA 4XASA 3V4RA 2IBMA 2WVAA 3DLHA 3H9UA 1IYZA 1DXYA 1JDPA 1GA1A 1JT9A 2D8AA 2WM8A 3D5QA 3ITKA 3LC2O 4IJQA 4TS4A 4OI2A 4RZSA 4YT4A 1WLSA 4G8DA 4IJVA 1VMIA 4DM3A 3B52X 3FZQA 2PS0A 4IX9A 4MW0A 4L8FA 1PFKA 3OWXA 4OHYA 2IY9A 2AD5A 1OHHA 3PEYA 3MT9A 4WNAB 4BCBA 3IIMA 2BZSA 4LDAA 5B1HA 3TTWA 1R6XA 4WKBA 2OCPA 2VATA 4K8OA 2IZ5A 3RBVA 3GJXC 4NEHB 4CPDA 1T2DA 4IIXA 1KU0A 4RJJA 1LVHA 2VSQA 3HPRA 1OZ0A 1U7PA 3QA3E 4IINA 4NMXB 1VYUA 2KLBA 1RRCA 3I9OA 3H3JA 4BO4A 4WIAA 5DWVA 2UU9B 3P26A 2DTDA 4QX6A 4TYPA 1DFGA 1IG3A 3HXMA 3EWNA 4DCMA 3JQGA 3UPTA 1RP7A 4KXNA 5DI9A 5IU6A 3E9EA 3K15A 3MJRA 3ZCUA 4YV1A 4U7HA 4BKOA 1GTJ1 2Z08A 3UGQA 3MGCA 3Q0TA 4QTYA 3AUJB 3FYSA 4EKEA 1P75A 4OIFA 2IS2A 2REQB 2VWQA 2FWRA 2PT9A 1E63A 2WQZA 3GLHA 2QRJA 2DT8A 3E7DA 4FZJA 4EM6A 2AQ8A 2QY6A 4KFCA 3LBHA 3LO8A 2NQ8A 4X84A 2DBVO 4NPAA 1DIBA 2NVOA 2JLWA 3A36A 4DLVA 5IJWA 4KPEC 2IOFA 4IWXA 4M60A 1FK8A 2ID7A 5FBZA 1KVRA 1SG0A 4FOTA 2IEIA 3LUCA 5E7MA 5L7YA 2R1TA 3WHKA 1G6Q1 1KTVA 4OXXA 5BN1A 3PDCA 5FAKA 4NY1A 5CTJA 4L4UA 5KYUA 1UJMA 3LP6A 2ZLBA 4WCFC 5DHAA 3A6EA 3H2GA 3TMKA 1IIRA 3ADOA 2CLCX 2Z6AA 5AJZA 4JI0B 1DZ3A 4AJIA 1TEHA 2ZULA 1TKBA 4FMCB 1RJGA 5DTMA 5A2QA 1XI2A 1E3WA 4IVQA 4MZXA 3TL2A 5LU8A 4HYYA 1RQ2A 3ZHTA 2R6GA 4C4AA 3JAWA 1DO8A 4OIMA 4QPDA 1BDJA 3L1VA 4AJNA 2BMJA 3HBAA 1NM5A 4M0MA 2O1SA 1DAKA 3DMTC 4Q03A 5KQPA 1ZESA 4OH1A 5CJPA 4TOIA 4BWGA 5IZ4A 4YJDA 4YB8A 5D3MB 5MFPA 1REQA 3NOXA 4NBTA 2O8FB 1AC5A 1W0KD 3L93A 4QSHA 3RI3A 3Q8LA 2QA5A 1TYZA 1EFKA 5A06A 2E85A 4RPLA 5H70A 1QP0A 5LKRA 2H7YA 2PHZA 1W2WB 4HUQB 3L4JA 4M54A 5H81A 3EZ9A 3WLRA 2F43A 4D0RA 1Y98A 4XCQA 2QG4A 2W42A 2OCIA 5AM5A 3PQDA 1Q11A 3K8YA 2OO5C 4IMRA 4LJLA 1C30A 5CNMA 5FLEX 1A27A 1LPMA 5A7HA 4CIVA 3JTEA 1A4IA 2EVWX 2PMBA 2YBEA 1RWQA 3D4BA 1NNSA 2VT6A 1SVWA 3CUVA 4IILA 4FYHA 3BGWA 4HB0A 5F76A 1W7AA 4QG3A 5E4YA 1ST3A 1OFHA 1FJGB 1YDMA 4EJSC 5F1PA 4NC9A 4YWHA 1TEVA 3K6JA 4HPXB 4IXDA 3JQFA 2G63A 1MA3A 5FTWA 1NURA 2Z2YA 3O4FA 1T15A 2QLTA 1EVYA 3SE7A 3WWEA 1E0SA 3COVA 4L1KA 5EHQA 3LPMA 3AF1A 3VOTA 4F92B 1RIFA 3B9RA 3LUFA 3FPSA 5DNVA 3RS5A 1A5SB 4XD7D 3UT5A 2C9OA 2H11A 2O3TA 4D9KA 4F3CA 1U3VA 1H3FA 2I22A 1BMQA 4KMRA 5F33A 4X00A 5IBQA 4IYJA 4UD2A 4F3KA 3R0VA 2CWDA 3VKFA 3CEMA 3TAXA 1LQUA 3EQ2A 2O2CA 1OBOA 4KKVA 1HFEL 3PFGA 5SYAA 1W94A 2M6LA 3C8MA 5JAIA 1NBIA 3ER8A 2PUWA 1O58A 4CQMB 3TW0A 3PDJA 2C4HA 4B34A 5KDDA 4BMCA 1TVEA 3V4LA 2QLFA 1Y37A 1ZPDA 4KXUA 1FZTA 1M1XB 3TNFA 1XHFA 3K70C 4I50A 4B3SB 3ESZA 3BULA 2C2WA 1BDIA 4UNPA 4O2BB 3QEMB 1D0SA 3RSHA 1GPUA 3WFZA 4CG0A 2YZMA 3STTA 5JADA 2H9YA 2JFYA 1YHNA 1SUDA 3FOCA 5GM2A 1DV2A 3NHBA 1TF5A 1XEAA 3DV9A 1TA9A 2IQ5A 4JP5A 4AG5A 1WXDA 2E7ZA 4TSRA 2W6CX 4HPJB 4Q4AA 5BXYA 2R3SA 1X15A 4O25A 3RUIA 2NTNA 4RKWA 5CA1B 2OEPA 5DBGA 3W0LB 4IOJA 3DPSA 4LVOA 2ZU6A 1NVWQ 5EZYA 2I8AA 3KR9A 1ISIA 5BPFA 1VBKA 2G7MC 3E2IA 2GD0A 2ADMA 5BQ5A 5BP7A 3WMXA 1W36C 5KJCA 1ODTC 2I2XB 1Y4UA 1R3UA 4KXQA 2VNKA 5JAUA 3DFFA 4V2UA 4TYNA 1UWCA 3D6MA 2W6PA 2CXTA 4XDZA 3TPZA 5AW4A 3KZCA 2NGRA 4RKEA 5IVIA 3PT5A 2H2FA 1X42A 1TZBA 2HA2A 1N7GA 2IT1A 3LRTA 4QGHA 4YH1A 1QRUA 3OZFA 2HEIA 4G67A 1ETHA 4PHTA 3HJHA 4TLLB 1SIWA 1P9NA 2GPYA 2MSEB 4R2WA 4X63A 3WYAA 4ZVMA 1Z8HA 5A4DA 1SCUB 1HYQA 3E1GA 1JJVA 1FVFA 2GSWA 2PX5A 4GD3Q 5AI6A 3GLGE 3O84A 3RKUA 1RYZA 3ZGNA 5AVXA 4H7EA 3T4XA 4AMUA 1TK3A 3VU0A 3KYDB 2HO4A 3FPFA 3VJRA 3VTKA 1GTL1 1ZH0A 4DV3B 2QTHA 1FJ2A 4ITUA 1BGXT 4OB6A 4ZI5A 3O8LA 2G1PA 2ZR9A 2PGXA 2RAUA 3OQJA 4OHVA 5DHTA 2P9FA 2WAAA 1RZRD 4NXNB 1SUWA 5JT1A 5BW6B 1FUEA 1JR3E 1B8UA 1H2YA 1NDHA 1OTXA 2IDZA 2GETA 2ZKIA 5F51A 4X20B 5LDGA 3AZQA 5EXXA 2ZU0C 1JE0A 4HDQB 5F77A 2HTFA 3WB2A 1GAJA 3OCJA 1JU3A 1P6XA 3SMQA 3TLEA 4FD3A 4BO1A 3W2IA 3VR0A 3PT9A 4F1WA 4XRGA 1QF7A 2Y1KA 4LOAA 1F0PA 1X9IA 2FA9A 2PGJA 3G49A 5A71A 5C5EA 2NZJA 1ELOA 3KSAC 3L4KA 4D0NA 1WB6A 5ELLA 1J97A 2Q62A 4HQNA 1DRKA 2N47A 3R2JA 1U9IA 4BNVA 1IY9A 2XNDD 4DAOA 3HWSA 1YO6A 1I01A 3LYAA 4KXXA 4FB4A 2OYSA 3QOFA 4KR7A 4BGEA 3ZJ5A 1NBMD 3CJRA 4J49A 5EP3A 3GA5A 5IAGA 1FP2A 1TAUA 1Q15A 4MVJA 2H5LA 4IAOA 2WAYA 2YBDA 4JU8A 4XWAA 4YRCA 3C3MA 4R51A 1HYEA 4HWPA 3KPYA 2BFDA 4FR0A 2WDZA 3DUFA 3GGOA 4NFHA 3EDMA 5AXAA 3T8YA 1IBMB 3SS7X 4TZKA 4HMQA 4IJ5A 1Y1KE 4W6ZA 3AESB 1OGIA 5HJEA 3ITNA 5LQUA 4UHJA 5ENDA 1OFGA 1YQ9A 3ZC3A 2RGUA 1J2UA 3PFWO 4N5HX 1G18A 3CVWA 2ENWA 2GBFA 1J21A 2WUFA 2IPOA 2JLAA 3JARA 4OQXA 2Y1WA 3P0RA 1S4MA 3G0IA 3I09A 2HXSA 3RRMA 2VDQB 2XUDA 3LWZA 4TZ6A 3WIVA 1N2XA 1D8TA 2NVUA 2BHSA 1UZAA 5CLFA 3KE9A 4C76A 2CDNA 5E6RA 3X1DA 5FULA 1GG2A 3U3KA 3GJYA 1EK2A 2OGWA 3DYIA 4HFJA 5IAJA 3VR6A 4MRVA 3ESYA 4Z54A 5JVDF 4LWPA 2W8BA 5AM1A 3N2LA 4KNYA 4QUEA 1M0SA 4G24A 3NOOA 9LDTA 5DGHA 2L19A 1SBHA 4FNAA 3FA2A 4ND8B 3W5UA 4JI4B 1E1DA 5HDQA 1PWXA 4IEFB 1YR7A 4QJIA 3ITDA 3UB3A 2AVNA 5LU9A 3A28A 4BAGA 5IYZA 1U8FO 2DUJA 1XVUA 2WIKA 4J4BA 2X58A 1EJ6A 1B4DA 4D82A 1NVTA 1M5UA 3FUCA 4RZHA 3B12A 2HPVA 2X5KO 1A7AA 1B7GO 2I67A 2WP8J 1UDBA 2YUTA 2YNMD 3DB1A 1EHIA 2O0MA 3I9V1 3MMNA 2BT4A 4U5QA 5IKMA 5C4MA 4CMGA 2HQBA 4I5DA 1YS9A 3USES 1Z4QA 3N53A 1XALA 2DPXA 2B8WA 3KSMA 5EI5A 2R96A 1DP4A 4UEKA 1Q83A 2VPYA 4XQCA 1U8XX 2BFMA 3RROA 3JZFA 4JMLA 4ML3A 4QULA 4B1FA 3II6X 1KQ3A 2ZSBA 3OQOA 3VYRB 3O3CA 1DEAA 1NXTA 2IHVA 4HQKA 5KDOA 4ZOEA 1GPBA 1NC1A 1BDHA 1CNFA 2VDJA 1J70A 3C98A 3CZ4A 3ZBPA 3R44A 5DRYA 3WO0A 3R4CA 3AEUA 1X6VA 2G3YA 4GPAA 1FTQA 4ZVVA 2FPWA 1JEJA 4NNPA 3SR0A 3VVBA 4EPTA 4BLUA 3LKBA 3ZVMA 2O05A 1TPZA 1XQXA 1ZO8A 2WMNB 3B89A 3ENVA 3GYGA 3VNAA 2A88A 2P4SA 2RHBA 3KOXA 4RA6A 2HU7A 2VJOA 4EW3A 4X0EA 1FU7A 1IZ7A 3AONB 5IANA 2J3MA 3CHYA 3AINA 4RM2A 3H11A 5DLEA 4BTVA 1EDEA 2XE4A 2V5VA 4ZC8A 5JD6A 5AUNB 1RLTA 3OM1A 4FDLA 3GP8A 3HDHA 3K30A 5LA6A 4DR7B 3ZH9B 1XMOB 4JX9A 4F5EA 4XA8A 1GR0A 4OM8A 4J16A 5J2UF 3OJ0A 3DE0X 1K5HA 1XFAA 5DU2A 2J4FA 1BKSB 2GMWA 2J5BA 3EDYA 1NX6A 3WG9A 5C7LO 5B30A 2B94A 3OG9A 1YI1A 2WTXA 5CFRA 3H8WA 3OTHA 3ZDEA 5CM2Z 4J03A 5LL6P 1HQKA 1EA5A 4J8PA 4MUHA 3D3QA 3TAUA 3L01A 1KE2A 2GVNA 3X1KA 3OUTA 3K35A 1K92A 2ZYRA 5LB2A 3V2IA 5F1KA 1Z5UA 3A9RA 4M1QA 5TS3A 1ZJJA 2YKGA 4R5HA 2H08A 3FNIA 3KHSA 1M2HA 1Q3HA 3T3DA 4Z6KA 4NCNA 2IHYA 3PGJA 1ZNYA 2IYFA 3U60B 1M1YA 1RKUA 1TU3A 3M6IA 3P19A 1EFPB 1EVJA 3DE2X 4OF4A 4XX0A 3LCJA 3M3DA 3WKAA 4D42A 1ZVVA 3VX4A 2QTCA 2QRKA 2HV8A 2O8VA 4JAVC 1X7XB 2PGLA 3IQEA 2VYNA 4PCVA 1NVVR 1XZGA 2WWIA 4PZLA 5AKXA 4AN4A 5LWQA 2ROQA 2WJIA 3BFXA 1FFWA 1YK1A 3D6TB 1EUCB 4MW9A 2QP4A 2LIPA 1KC1A 4LQDA 2NU7B 4WN3A 1XSEA 1XU7A 5CA0F 1U8CB 3TJMA 5JNRA 2GHTA 2OBLA 2OOSA 3UMRA 3L02A 4FLEA 4FHCA 2Q5FA 5CH5A 3HN2A 2PRIA 2EGHA 2DQYA 4LXHA 3RNOA 4ND7A 2ZUCA 2JAHA 5ERYA 3QPWA 4FVTA 2FMUA 5DPMA 1PF7E 5B3KA 2O7QA 4HGQA 1NVVQ 4G8JA 5DM2A 2LIVA 2E82A 3KOOA 4GMHA 5D7BA 2YFKA 3TGLA 2EHDA 2ZJZA 1HYHA 1ESMA 3R7LA 1T10A 2RIRA 1MPXA 3RG2A 2P0AA 3HYRA 1QS0B 2WJYA 3IP1A 5ABPA 2VIIA 1T1IA 1FUUA 1W8IA 2PGDA 3IOBA 5KMGA 5F1YA 3C6KA 1HDYA 1JIUA 2W2LD 3NIBA 1Z5PA 1U28C 1OX4B 3EVAA 4US1R 1D2GA 3VISA 1YI0A 2DWQA 1J99A 4O2LA 6CHYA 1NN5A 4YDRA 4A2QA 2PBLA 5G4KB 3RVJA 4BE7B 2FV8A 3PCXA 5CX1B 2AK3A 2XYVA 4CR7A 4KV7A 3A3YA 5B3JA 2OM2A 2VOJA 3RUAA 2ZRQA 3X1JA 2ZSFA 2I6FA 3PUWA 3TL6A 1X9GA 3NWBA 4JODA 4DBLE 1QHHB 1G63A 4H6VA 1U5AA 2J6HA 1VDZA 2XMZA 3MQFA 3RLIA 4X62B 3JYHA 4ZP1A 1ISGA 1ABEA 4R1SA 3TWOA 5A4JA 4MVJI 1U5CA 3AUTA 2WYVA 4TUYB 2FUKA 3KR1A 4CCYB 3I1FA 1ZICA 2AZTA 2PUEA 1J1ZA 2Y68A 2E18A 3BORA 4WJLA 5JFOA 4YQEA 1D7AA 5FBHA 4YJ2B 4CV2A 1E1RA 3CLUC 4TLDA 5K8CA 4ZDIA 3OWHA 1DIOB 1YUNA 4JVNA 4QUGA 2QG9A 2ZQ5A 3K6KA 4INZA 9GPBA 3E05A 1HWYA 1IBSA 3BKWA 3LCRA 1Z6ZA 4D45A 1PIWA 3MAAC 3L05A 3VNBA 4C7OA 5HCUA 2HSGA 3ESAA 1Y8RA 1ZUD1 2JB9A 3EVTA 1YR9A 2QK4A 3K1AA 4WMLA 4X97A 1NR1A 1BN7A 4OHFA 4Z51A 1S2IA 2G76A 3OP4A 3AFNA 4EBFA 3N6XA 4XKJA 3HSKA 2ZJOA 5A0TA 2A9VA 1S2GA 2QJWA 3C3PA 3DBIA 3CCBA 5DEOA 3H6KA 4AJLA 4RAQA 1LDMA 3OZDA 4KWHA 3RT9A 1SOUA 4TKLA 1IC6A 1SUPA 1JBKA 1QQ7A 2LZ0A 2PQ0A 1H8HA 3G0DA 4PHCA 4RXMA 1XTSA 2C2GA 3CMCO 1GPKA 2PUHA 1BRMA 4XX1A 2QTVB 1E6KA 2OCKA 1D1PA 4R7TA 4TMYA 1S3GA 2H57A 5ALFA 4IGAA 3EGCA 4FFSA 5L6MB 1WUKS 1RPTA 2LV8A 1T8WA 1U11A 1L4YA 1M75A 4CE6A 3MCVA 3E9NA 4DG5A 1JVBA 3O8DA 2MINA 2BI8A 2QYOA 4KVZA 3AR6A 1U0NA 2WHPB 2NU9B 4Z1MA 5TNXA 3L5KA 4TL6A 5C0OE 2BD0A 5EIXA 2I2BA 4R1OA 2CT8A 5KC9A 3L1UA 4MGEA 1XMXA 2JLXA 1QIEA 3ECCA 2WJJA 5G1PA 3AEQA 4YT2A 5EMNA 1NKSA 5JSQA 4C4TA 1L5NA 3IBTA 3WJ1A 5IVPA 4RESA 5AVUA 5FLYA 3PR2B 2Y0CA 1IBRA 4UBMA 3IXLA 2OFWA 1XRPA 1UM8A 2H63A 3BHMA 2HWXA 3QKTA 4C0HA 4EHJA 2OFPA 2QE6A 4HNVA 1BHJA 5JLJA 1FYXA 2KS6A 1A9PA 1SHZA 3C3WA 3KTAA 4V0KA 1ZCAA 2AZDA 5TC4A 4ENWA 1Y34E 2E4AA 4RVCA 4UFOA 1TB4A 4W7IA 1XHLA 1CUVA 4NECA 4YCSA 1E2QA 4HXGA 1B3RA 4UAGA 5I7AA 1FYEA 4IKEA 3F5QA 3FVRA 4OK3A 4MW4A 2A67A 4I4TF 2CJFA 4CUKA 1VYTA 1JAXA 2YFYA 1M34E 4ZRMA 5KNBH 3KUUA 3KUKA 3VPAA 1CUZA 2R0QC 3LUKA 3ICVA 4Y30A 5HJ2A 1SUSA 1LD3A 4XGKA 4IM7A 3B3AA 5DWQA 4BV2A 4PXSA 4CCAA 5HZKA 3HKDA 2GF2A 1RAGA 1LSUA 3W6PA 3TTTA 3AJEA 4HNAA 4QECA 3WC4A 4DV7B 1GAEO 4NBKA 3KUCA 1LX7A 3G8BA 4B3BA 2PRYA 2B30A 3JWJA 4RFVA 2FZVA 4K9QA 5KYYB 1DRWA 1TO6A 1EVEA 2YMQA 2DFKB 3IDAA 4OQNA 1GA6A 5HS6A 4TMFA 3B20A 2PV7A 1E2DA 2IXGA 1JFFA 2H48A 4YJHB 1F2DA 3IMEA 2ZYSA 5FA6A 1P4HA 1K3TA 2YOHA 3R7DA 4MLCA 4L3OA 3W2HA 1Z28A 1QM5A 2VYFA 2RARA 1V11B 2DULA 3HUDA 1UK7A 3FD8A 4LZAA 3U19A 1NXPA 5BV8A 3GLFB 1WDWB 4UQOA 3LXXA 3H19A 1Z0KA 5IDWA 1COWD 1AXRA 3H5WA 4HBGA 1UC8A 4KOAA 4UZSA 4X95A 3TIGA 5BSTA 2ZUTA 1VB5A 4FBMA 2BAGA 2ANCA 3PR3A 2MSKA 1FX1A 3KL2A 4JL5A 3SAJA 2LR0A 3W90A 4JT8A 3USZA 1WQ3A 3KEQA 4ZI7B 3D2BA 2WJVA 4ZO6A 3Q7EA 4DL9A 4EYEA 1A7UA 3QU5A 4BXOB 2FG5A 3K2EA 3ABQB 1YDEA 4Z0PA 2P4HX 4D80A 4CODB 1IUNA 1DMSA 2Q6KA 3L6UA 1RYFA 2MR6A 5I4BA 4KQIA 1UQTA 1JQJC 2GJKA 3Q9UA 1E9CA 3OQIB 1Z25A 2R5NA 4BGUA 1PCXA 3GN2A 3O3NB 4GSYA 5DNEA 4YYEA 4LFBB 4A6PA 1BVUA 2LXNA 1D2CA 4EF4A 4S1TA 2A9KA 5SY4A 4DR1B 4GI3A 3HDTA 4NDZA 1Z5NA 3IVAA 2HK7A 5C5CA 1O96A 2NPIA 5BQOA 2PS3A 3BCSA 3C43A 2FDCA 3MTIA 4EA6A 4GKVA 1Z0IA 2CJXA 4KG7A 4DN6A 1UPTA 3CE9A 3IBCA 1JMYA 4OQDA 2ZJAA 3QUCA 4D5EA 2V7WA 4R4JA 4AKTA 4XE5A 3O3MB 4GLLA 4OMUA 3BCRA 5LP6A 1ORIA 5ARBA 5DHSA 2WAXA 1J2RA 4WZAE 5T6MA 3UMBA 2ISCA 4EUNA 1BKYA 5A7FA 3T1VA 3OCUA 4BLOA 3UB4A 4GVXA 4L02A 2P4EA 3ET4A 4UEWA 4U8GA 4X1YA 1TC1A 2XUIA 4II7A 1WUHS 2NUBA 1S9DA 3TG2A 3A7EA 3C7KA 1T9ZA 2QD4A 1QHYA 3CKYA 4IMPA 2DSTA 4KP7A 1R0CA 1JQLB 3U9SA 3NHRA 3L04A 2R25B 2QAJA 4REQB 4TLMB 3RKSA 3TD2A 3WWZA 3U44B 2BLLA 2H9IA 5FBRB 4FCWA 1QGUB 3B82A 1L5HA 3CW2A 2YY6A 3R74A 5E9AA 2BYTA 1GZUA 5CP8A 2W2OA 5ALZA 4NFYA 4A8HA 3TLAA 3O4HA 4AROA 2VYVA 1PJSA 3FUWA 3ZXYA 1QTRA 1NW9B 3IDQA 4OKSA 4PYMA 5SZHB 1UEIA 2AEEA 2QJRA 3N76A 3DLPX 4BEVA 1UPUA 2BFAA 2UYQA 1NPYA 2CLIB 2G28A 3P5BA 3TRIA 1CUDA 2CXPA 3W3ZB 2HJVA 2HIMA 3ZDRA 1G9TA 1HMPA 1UJCA 4IRMA 4R8MA 4C14A 4CVNA 2CCKA 1KYYA 4MB6A 4P84A 4TTPA 3ZH2A 5DGTA 1K6EA 3PXCX 4F6LA 9MHTA 2XH8A 2PM8A 3QU2A 3IEUA 4N41A 2J8ZA 2JBAB 2QVZX 3C3BA 4JOSA 1L5MA 2GXSA 3HXQA 3E70C 2ZJ1A 3RVDA 3PVSA 2KW5A 2FP4B 2H4YA 4TXNA 2A2ZA 1PFQA 4DUGA 2IPAB 1UP7A 1UMDA 1XLWA 2HGSA 4MVJH 1YZGA 4ABYA 2VJCA 4R1TA 1D2HA 1R0KA 2BHTA 1JXAA 1NI4A 3G3EA 4XAQA 4KE8A 3I39X 4W5QA 3IUBA 1VMDA 2P75A 4FN4A 1T2CA 2ZCJA 4JZYA 1FEZA 2O19A 1KMCA 1LLQA 1URPA 2W37A 3S2FA 3PG5A 5EQFA 2GAOA 2MIIA 2XGGA 3ADKA 1OI4A 5LXTF 5JZOA 2D5BA 3EPKA 1RM0A 1OXTA 3G6KA 3KBBA 3FYHA 4LWQA 3TW6A 3AWIA 3OBIA 4BKRA 4M87A 1E5VA 1KHTA 2FPIA 2YJTD 3NT4A 4B74A 4O5AA 1V8DA 2IZZA 2WKWA 4PYQA 1CUHA 5AXDA 4F04A 5ILOA 2DLCX 4P93A 1GP2A 3ZBTA 4EPRA 4BC0A 1ZFNA 3PWTA 4F3RA 4C0BA 1CHDA 3KZMA 3RT7A 2YMLA 1C3OB 4NBRA 4QREA 3ZTYA 3VR6H 5DX1A 4LHXA 1I2MA 2CEAA 2R66A 2NZVG 4FWIB 2D4HA 2MR5A 4F84A 3NXSA 1MIOB 2YXDA 4KUGA 5A4AA 3WNBA 1LRLA 5KTMA 3AVVA 5BR4A 4QBHA 5KPDA 3OQMA 4HDKA 4H6XA 3EIHA 1G1MA 4KL8S 2WJ3A 4H7JA 3R75A 4YV0A 5JAZA 4G0WA 3AKCA 5B37A 1CD5A 1JPUA 1KVTA 3PUYA 3RS8A 1M2FA 4EW2A 5FD8A 3ZHCA 2QLMA 4H18A 3VJMA 3QKSB 5F23A 3DC7A 3SF8B 3GRYA 3CY6A 3NPMA 3WLIA 3X1WA 5K3SA 4MV7A 3B7GA 3DEYX 3F74A 2IZ6A 2GN4A 3L1IA 4QQKA 4ER6A 1FTWA 1YGYA 1BCRB 2ZWAA 3VKVA 3IJ5A 1XR3A 2G5CA 1ONBA 1X39A 2C59A 4R6WA 3MCAA 3NCHA 2BBTA 1OROA 4FMDB 4WCFA 5HBRA 4DKXA 5JANA 2AFIE 3I30X 2OVFA 1LDBA 3C8ZA 1UDRA 4X61A 1SZPA 4OP2A 1HMYA 3KEMA 8ATCA 4JC5A 5JMWA 4C22A 4C4RA 4CKEB 5DN6D 3LVRE 2XVZA 3LUBA 2QW0X 1SC1A 1U2GA 5JZVA 4HGZA 1OV6A 2O0KA 2REOA 5DM70 2Z6QA 1WBJB 3WGZA 2W4IA 3BK1A 3OKCA 2X4GA 2HD4A 1FSZA 1YDHA 3FKQA 2IU3A 1IL0A 1RLJA 4LJ9A 4TS9A 2W93A 5H3CA 4X64B 5HQTA 1XNHA 3QVVA 4U1RA 2BLNA 1ZD5A 5FO1A 3QYAA 5JCOC 1QHFA 3F6PA 1UJ5A 2SICE 3OTWA 1YDGA 2I4NA 4PQGA 3S8EA 2Z3VA 2GJ8A 4B48A 3AM3A 4QT0A 2BTQA 4BKQA 4F6RA 2QZPA 4JC0A 2XOKA 3QPVA 5AIBA 2MOKA 3FHTA 1C7QA 2OP0A 4BVLA 3CUTA 2W6JD 3LX8A 2Q4RA 3COWA 5FFMA 1U65A 5K0JA 4C43A 3OHPA 3E8MA 1RU3A 2O7NA 3QSYA 1I0IA 4BVHA 5EJ9A 1J0CA 1IUKA 5B7QA 1WY7A 3GEBA 3GZTB 2C98A 3MF4A 3N0RA 3OU7A 4YYZA 4ZGGA 1CZUA 3LOQA 5ER9A 2P6PA 4E51A 1Y6ZA 1JA0A 3JWHA 4DWVA 2JFVA 3F98A 3JD2A 3RBXA 5BOSA 3WQQA 4DJTA 2QENA 3A37A 3W8NA 3TKYA 1H6BA 3WBKA 1S3IA 5C53B 2ZRJA 2H4WA 5JOQA 3ZK9A 4Q5IA 4DNQA 4BPRA 2FE4A 3O1LA 3RWMB 3UT6A 1OYYA 4ZCIA 2ODEA 2JIBA 3LHIA 5K0ZA 4B83A 3M3PA 3O94A 4CLOA 3MT0A 3UOWA 5AUOB 3TFOA 3Q12A 1GD1O 4MA4A 3SC4A 1O94D 1FFSA 2DKFA 3B1FA 4JNKA 2CB0A 3BIOA 4QYTA 1LS6A 1ONOA 1Z68A 2GDZA 5FTMA 3PPYA 4JKOA 4DIFA 3DKVA 1L1FA 4KAAA 4NYIR 1QQTA 3D0RA 3CZCA 4NOLA 3PA8A 4W99A 4YRRA 3GJZA 1E9FA 1GUZA 4G01B 1DBRA 2Q6LA 4U7PB 4WESA 3C74A 4IZ6A 1E8DA 5EWLB 3JPYA 3V8EA 3DF9A 4PC7A 1IWBB 2P6UA 2EL9A 4B3FX 3HCOA 2WD7A 1CUEA 4ZKEA 3U7JA 4PSUA 5TQ2A 4C4XA 4Y1FA 4WBNA 1MB2A 1YQXA 3R9XB 4TV9A 4AMVA 4NARA 3K8QA 3SDZA 2LVBA 5I7UA 4LJRA 1ZH8A 2EP5A 2O2GA 1KKMA 1L8LA 2D1TA 3UAVA 4NYIQ 5K8UA 4UMEA 4UHCA 3AERA 1AXGA 1NQWA 2HI0A 2NTEA 2J5KA 4DDHA 4IIJA 3DE3X 1Y7LA 3EZFA 3JAKA 3CBGA 3WGVA 3B6ZA 4P8RA 1NPTO 3BD6A 4L3VA 5COBA 7MHTA 3H2BA 4AO7A 2YJ3A 3I8XA 2JIQA 1OXSC 4YAIA 1K6MA 5IK2A 4CGZA 2R6R1 1VLHA 4L50A 4PZAA 3GGSA 5HOQA 4CTOA 4PZEA 4OATA 4EDFA 2ONKA 4EATA 1SQFA 5A4FS 4MV6A 3BPSA 3WXMA 2ZJ6A 4RFSA 2FPPB 4QQRA 5LZ7A 3C45A 3EC7A 4WUVA 3SJ7A 2P8SA 1KY2A 3ZLTA 5AFSA 1RRGA 1LRJA 5GAJA 4A1FA 2PQMA 4ARUA 4HAIA 1LV7A 3AF3A 3Q11A 3ZWYA 1K4YA 2VBIA 3ANYB 3VZPA 1MQ9A 1Q0UA 1QRAA 1JFVA 1RI3A 2P5SA 3KS9A 3WLTA 2XVYA 4M0CA 3ZGOA 2P5TB 3QVLA 2UZ0A 4JUDX 1XD9A 4DDMA 4KYIB 1G5TA 4IJMA 2BV3A 7ABPA 2GCOA 3NM6B 3R9WA 1KH2A 5B58C 4W1SA 3TSZA 2B7LA 1U0HC 3PC8A 3NALA 4K6MA 1VLQA 1RYBA 2SKDA 4BS9A 3KWLA 4LY6A 2PX2A 2CE7A 1YCGA 1RWVA 4I55B 2HCJB 2ACVA 2WIBA 3DVSX 1FVOA 2XSZD 5HJ5A 1NUUA 3V46A 1KFJB 2X40A 2QLBA 2F1JA 3WWYA 2OTCA 3EYAA 2G4LA 1GN8A 5CDFE 3ZHZA 2VG8A 2Q8QA 2JARA 1ODIA 4Q6BA 4JIMA 2CDBA 3C6MA 4LY3A 1ZYUA 1TUBB 4A8JB 4M8SA 1JYSA 4FHFA 2RKWA 1FP4B 5BO5A 2Q6OA 5G0UA 1T1SA 1AKYA 1LY1A 1M3SA 2AF4C 2HPZA 3KYCB 4MLZA 3GDFA 3R6LA 1IN4A 1EJBA 1IDOA 3SNHA 2VA9A 4YUYA 3JQ8A 1KMHA 4LYGA 5EXTA 4YS6A 3T9BA 3LM8A 3WMGA 1XQ9A 3FPKA 1KYTA 4DJFC 4L07A 2R7NA 1NVXQ 1MAAA 2IEAA 2WJWA 5ANRB 2Q29A 3FCXA 4Q4CA 2FUCA 4BWVA 2VQ6A 3MTQA 2QPTA 4P92A 3R5SA 1Q20A 2NACA 3CTMA 1M1NA 2GKGA 4GGOA 3I3SR 1EWYA 2V65A 1S02A 4B3RB 3MUNA 2FEWB 5LBTA 3TJZA 1E59A 3DAHA 4MDFA 3AJAA 4X71A 4DLZA 1IRXA 5AUPB 3IT0A 1SKAA 4GUDA 5DSZA 4C6RA 3N8IA 1X14A 3A4NA 5T3YA 1VYHA 1YJAA 1H5UA 1U3FA 1JG4A 1J2JA 2WTMA 2A30A 1L1EA 2ZDGA 1YRAA 1FDWA 3JALA 3DOFA 2C9MA 5ALIA 2CDCA 3SYTA 1Y9ZA 2CXUA 1BO6A 2HSWA 2MHCA 2REXB 2ZRKA 4KPUA 3EVZA 3UQZA 2HR1A 2POCA 2XNHA 4IOKA 4I3HA 1Q74A 1P81A 4K9KA 1MC5A 5HQ3B 5TIIA 3DDOA 1EA7A 1DBWA 3IX7A 3NFYA 4C0JA 3R77A 2GPNA 2D0OB 5JRDS 3KZ1E 2H8KA 1MENA 1TOAA 4X94A 1G41A 2HRRA 2XNKA 4CMEC 3FNRA 4ER0A 4I1PA 1SGWA 2G06A 2BGGA 2CDRA 3EJWA 2GCIA 4PO1A 1SB8A 1K5GA 1UWKA 4QPZA 3AVOA 2RB5A 2C2HA 1DBPA 1GU7A 3UAGA 4OUKX 2N75A 2EF0A 4QG7A 2WFAA 2X4IA 4PNEA 5B12A 4UASA 1AN0A 1EESA 1MFPA 1QK5A 1IQPA 1MLDA 2DVMA 1B93A 3BVPA 3AEKA 5GVRA 3GI1A 4KQ9A 4RPGA 1CRQA 4C7MA 4F3TA 2P0YA 3C3JA 1Y7IA 2JFWA 3K0AA 1OGYA 4PQYA 3EIXA 4B76A 5C7IO 3R3HA 3H0CA 4MUXA 2HCRA 1VPEA 3LT0A 3VPDA 3KKLA 1DIRA 1MB9A 4LN1A 2YV5A 4EO9A 2QBYB 1QFYA 2VK8A 3FDZA 4IF4A 4J1TC 3UJ6A 3BBLA 3VI3B 4J0CA 3ADPA 1R88A 3BB1A 1NVGA 2D0IA 3PXEA 4HDSB 1PSDA 2J7PA 1J33A 4BJ1A 1N78A 3TEJA 4ND3A 3UOGA 4MWEA 1UKBA 1PJ3A 1XCOA 3BXHA 5BPHA 1XP8A 3UWMA 1Z4NA 1EBBA 4I8DA 1SUEA 1B41A 3P2JA 2Q7DA 3RVSA 3EW7A 3KSDO 1NP3A 3DNFA 3GLTA 3WLAA 4LZWA 3A3NA 5BYKA 4DRXA 1U63A 5FUBA 1NUQA 4UTNA 1RBQA 4DG9A 2XYRA 2VDLB 4BZXA 4HSEA 1PW7A 1T2EA 4HRVA 1CS0A 1HLPA 5AVOA 2ZAIA 4K26A 4PR3A 4EJ0A 4OLBA 1GNVA 5JHHB 1KY5A 1QH1A 4KODA 3ASYA 2F1OA 3OY2A 1C29B 4UEQA 3FNEA 4KIUA 4PNHA 3AP2A 2R5WA 4JBLA 3A11A 1E2HA 3OPMA 4M6WB 3V80A 2F55A 4HTAA 5I9SA 3DTVA 2OFFA 1W35A 1JHUA 3IBYA 2FYTA 4OGGA 4BBAA 1P0MA 1XT6A 1FTSA 1QHSA 4YNBA 3A1FA 5ADVA 1G8AA 1ISRA 2IYEA 1K86A 5KQRA 3RCBA 2IWHA 1QZTA 5AI4A 3D4NA 1F7VA 1GNPA 1E1NA 1QMPA 4F11A 3AKZA 1XHEA 3M1AA 3Q8XB 1NBHA 1C7RA 1AGXA 3P9CA 3A1CA 4EZEA 2HBQA 2PJDA 3LDAA 4AXBA 1IAQA 2AGVA 4H16A 3ZQ6A 2ZG6A 3CGWA 3DCIA 1N57A 3TRKA 3ZV7A 2MSLA 5ICEA 3EJ6A 1Z5WA 1P7WA 1Z35A 2D1YA 2HSZA 3PUKA 4RO0A 1B00A 4IXTA 3D3WA 1SVMA 3E48A 3FJ1A 3VR1A 2PE5A 1Z4IA 2VRCA 5GIOE 1P1RA 5I7RA 3W78A 2JAQA 1RZ3A 4ZEWA 1KJJA 2AD1A 4EYSA 1GZ7A 3GT3A 2DTEA 3GLGB 3PXBA 3MINA 4L15A 1A82A 1ZSNA 1UH5A 3BUSA 2ABWA 2IE8A 1DC3A 1M8JA 3EOZA 4G5YA 1N8TA 4HVAA 4JCCA 4ZQCB 3S70A 1QAQA 3SICE 3IQWA 3COYA 1GHTA 4D8VA 2GM9A 1IEQA 4ZAGA 4MGZR 4XXHA 4YGYA 3QUAA 3DMNA 4BLQA 1IY0A 4H7FA 4LC0A 2GEUA 2Y0DA 3WIUA 1CCWA 4HR7A 3ECAA 3QFCA 3EDOA 4JUAA 4KVGA 3TGWA 4FHEA 3HKEA 1YBVA 1NL3A 3LQYA 3IR5A 4N0DA 2QD3A 4J43A 3LW8A 4Q3CA 3H4VA 4UTZA 4HZGA 3T7EA 3NG1A 4NMHA 1U3UA 1DO0A 1ONSA 1C7ZA 1PRYA 3F6YA 5AMXA 1KO4A 2XWQA 4MDEA 5LDDC 2VK2A 5ALHA 2TMDA 4U7TB 5KTRA 3MQ2A 1SY7A 4ESVA 2OD9A 4OO3A 1UF9A 2NZ8A 1NQTA 4NHEA 3HWRA 4DWJA 4BQOA 4DDTA 3HA3A 2DFLA 3GOQA 3H4TA 2ORVA 2ZRHA 3MXOA 1EUQA 4HWOA 5EMKA 2BFCA 5FYDA 4UCQA 4G5HA 4IV5A 3DXZA 1SC6A 3Q4GA 3V8RA 5I8WA 1L7BA 3RFXA 3ZWOA 4LKRA 1O5TA 4B7ZA 1JHOA 1K7CA 4LFAB 1L5OA 2JAXA 2QR3A 1CYEA 4MHTA 3IUPA 4P7GA 5KKCA 4BV9A 1N2CA 5GV8A 1WBBA 2ZR8A 1RJ9B 2FPRA 2QUJA 3CH6A 3GT4A 3TH5A 3UXYA 1M2EA 1IEVA 4P86A 3KE8A 4WJZA 5GJCA 2RBKA 1RLMA 4EG4A 4FKBA 3TZQA 5E7IA 3VX3A 4MVJG 5JAPA 4AN0A 2ACKA 3E7PA 3QIVA 3D0KA 4RL6A 3PQ8A 1INLA 1Q5PA 5AKLA 4FXOA 2DB3A 4WZBE 3FHJA 5IBCA 5EJ7A 3H1FA 2GS9A 3IAM1 4JB2A 3HP7A 2Z1DA 4MO9A 2GZAA 3PGMA 1E1MA 2OBMA 3DXYA 2ATXA 4RF4A 4J4TA 1MGOA 4EEXA 1QF6A 2HREA 3BE6A 1PFYA 4FGZA 1BNCA 5FOTA 2A0WA 1WKCA 3RW9A 4PXYA 4G3XA 4UREA 2ADOA 1TZKA 1QHEA 2C00A 2YYAA 4KNVA 4DLSA 3A9WA 3PQEA 3L8HA 4RWZA 1M33A 3LCUA 4NCHA 1WDMA 5BYAA 1CF4A 4Q9NA 3P9SA 1RKVA 3BFKA 4WKCA 5E1MA 1DEKA 1EUDA 2AB0A 4UM9D 3TLXA 1RWPA 5CFZA 5ADHA 1VKJA 1V6SA 3CLKA 4S0XA 4HAUA 4INAA 4NLLA 4Q18A 4YROA 3TK1A 3Q3HA 2QAIA 1VGRA 2NV2B 4GFDA 2J3EA 3ZDBA 2YV2A 3UH0A 4GBGA 4QODA 2RHGB 2CHFA 3B8EA 3F47A 3GDOA 4YALA 3ZTWA 1LBQA 3ZQ4A 4AJPA 4CMCA 3V4ZA 4X1KA 3ZGVA 4Y2UA 1FE8A 5TGDA 1RXIA 2MYPA 4ALLA 3OESA 3I9KA 4P4SA 4BP3A 3BRWA 4INJA 2CMHA 1PZHA 4BE4A 5FNZA 2OXTA 5I7WA 4LF4B 2FPXA 3V8MA 1JFRA 2HMWA 2IYLD 4RYLA 2RI6A 2PUCA 1PWYE 1CJBA 1N2HA 3G2JA 5K3AA 5IHPA 1UC4B 1Z0AA 1F06A 3GIDA 2MU1A 4OOEA 2FJPA 4WADA 4WNAA 3OP1A 1Z62A 2F3RA 2ZBVA 1R10A 4RMIA 4IXMA 3JRNA 4Y2PA 2CNKA 2G71A 4MW1A 1Q2XA 4QVGA 2JJMA 1GKKA 3KV1A 4XB1A 1MCZA 1PWEA 3KWMA 5HWSA 2QI9C 3LQKA 3TE7A 1N1DA 1E3JA 1M83A 3KOWA 3CRVA 1VGQA 3MB8A 5SICE 5T5QA 2CE2X 2OK8A 2IYZA 3QVGB 5FLKA 3G9UA 4M8LA 1FYFA 2H6EA 1DZIA 5IH7A 5FJJA 2G25A 4HXEB 3Q3GE 4G1CA 2W6MA 3ORRA 1YIOA 5JSZA 4KRYA 4Z9BA 1VMAA 1R0WA 2FG6C 3M7IA 4XYEA 4CV0A 5ITZB 5JC8A 1C8LA 1JLLB 3E9YA 4L5YA 4HXFB 4QPJC 2YN0A 8ADHA 4D3ZA 4GR9A 5J63A 5L9AA 4O4IA 1CPYA 5BUQA 1HZJA 5K0TA 1IM5A 4IQ0A 3VR6D 4R9UC 4E3ZA 2EKZA 4G1BA 1FFDA 4ECEA 1K8ZB 1QO9A 2GRAA 2O7VA 4HGNA 1C50A 4PY2A 4J0FA 2CMKA 2HPAA 2IYTA 4FOSA 2C92A 5CD9A 2AMLA 1KDYA 3TNJA 2ERCA 3E5MA 2WFZA 3HDGA 4GWGA 2HU5A 1T43A 2EHJA 3GAFA 4IEIA 1HE5A 4QNRA 2XJ4A 4JLAA 1UOOA 3P9QA 1Z5GA 2XMBA 5JDIC 4UCWA 1GRRA 1VKOA 1CY1A 3CNOA 1CB0A 4L0MA 4O33A 2FJ0A 4HQLA 1H2RS 1YS4A 5FQOA 2D62A 1EI9A 1P44A 3DAFA 5H82A 2V4UA 1GRCA 4UQLA 3EIOA 2BEUB 4OL0A 4F9EA 4G5XA 4MVCA 1ORRA 1XWWA 4PX5A 5ALRA 3ENZA 2M6RA 2NAPA 4U2FA 3MOIA 4XJXA 3TIFA 1JKIA 1M67A 3CNQS 4RK1A 3FCOA 1PEAA 4LWOA 5F2EA 1KJIA 1TJPB 4J9UE 5FTJA 1XZQA 4D8XA 2I4MA 2DP4E 3RQSA 2UYGA 2LDBA 3O2SB 4UDOA 3WNDA 1YCFA 5K0LA 2PZFA 5D3MA 3L9WA 3FGOA 1USIA 5KVAA 2H5IA 2Z8XA 3I8OA 4UUNA 5AM4A 1SOMA 2RAPA 1D1QA 1TU0A 5D3KA 3VVMA 2Q3LA 2XGOA 5HKBA 4MWGA 1WPGA 1ONNA 2E89A 4BMSA 1A8UA 3AUAA 2HTEA 1OJ7A 3KFVA 5K3DA 5EE5B 4DA9A 5IFKA 1BFKA 1U31A 3DM9B 1E1KA 2JFXA 3SYNA 1USKA 3U7IA 2P91A 1JTVA 3ABSB 3LWBA 4M7WA 4URFA 3AM5A 4BWYA 3OX4A 3KOYA 4TWJA 1OVGA 2IYPA 2OV8A 4Z9FA 3A32A 1E3IA 3DBHB 1L7MA 3JR7A 4RVUA 5B4VA 3T54A 3CRRA 2FX2A 2AWOA 1KZ1A 2WJPA 3C41J 5U4XA 4JGIA 1ZJ5A 4EB8A 2HA6A 2O8CB 3INRA 3M2TA 2C7VA 1PI3A 1RRFA 1XTJA 5JXIA 3OTGA 4J3NA 1XB2A 2D5LA 4EG8A 1C3LA 4RVNA 3UFBA 1ZGHA 1N6IA 4LMRA 1GQSA 3CPSA 1GPLA 3ZS9A 1W52X 2PSFA 5F7ZA 2MCFA 3MRVA 3RFUA 3OURA 3IT1A 4Q9LA 1GG5A 4DYDA 1TMOA 1TZ2A 1T5SA 1BWPA 1QJCA 2Z9BA 3K0SA 3EY9A 4ARVA 1US8B 2GASA 5FWXA 1Z22A 5B1EA 5JHGB 1J00A 2A86A 2GH1A 1FQOA 2HK8A 4W5JA 1GAXA 1AUQA 1NAIA 3QVXA 2WNIA 5ALUA 1N0HA 3UK6A 4CT5A 3WGQA 4E12A 2D5CA 5LOVF 1RXSA 4F93B 2DECA 4RS3A 4MV1A 1TIBA 1IQRA 1YZVA 3DP9A 2RJ3A 1DBQA 4H4CA 4WN9B 1YC2A 1C3VA 1DCMA 1U2TA 1PJ8A 2RIPA 3FVQA 2ZYAA 1THMA 2VYND 3DDUA 3L7IA 4GECA 4FZRA 4KEAA 4O1IA 4RTRA 3MMXA 4R2IA 3TW8A 4U5XA 1IJBA 2VWPA 4FQ8A 1NW7A 1K97A 1G1AA 3QEMA 2ODNA 4RGQA 4Z0NA 2R7LA 4N65A 3ZY2A 4B45A 3I53A 3O74A 1X7YB 1W93A 4KN5A 2P79A 3VTZA 3N2KA 3RK0A 4BLTA 4PX2A 1IVSA 4IMJB 3LY8A 4H7DA 4OV6B 3JATB 2PWYA 2VZ9A 3UMJA 3FYUB 4X8HA 4ENTA 4R0MA 1PGPA 4UAJA 3SXUB 4DBZA 4F06A 2G1UA 2CXRA 2RHJA 4L7QA 1QFXA 2DUWA 4XI9A 5CVJA 1AO3A 3VU9B 5H4GA 1EX1A 3A2LA 1O77A 1SUAA 3M82A 4PFSA 3W1VA 3HZZA 2JFPA 3WLSA 1KEKA 4CFSA 5C37A 3P2EA 2IF2A 4ETIA 5K5EA 4RY8A 4HLDA 5DHRA 1KPIA 2PSDA 4XJSA 4JQOA 3VO2A 2FW6A 3DHNA 3EG9B 2PIDA 2EC5A 2J6IA 4NCAA 1TO1E 2AZ4A 1HDZA 3SFVA 2HQRA 1LQ2A 1Z0ZA 3DZCA 3WBFA 5CXXA 4A6XA 3QE4A 3L0DA 2A35A 1VXRA 3C6YA 4YO8A 1QIFA 3HVIA 3F0TA 4ZYWA 1O97D 3MWDB 3OD1A 3OLZA 2A3NA 5EUCA 1W48A 1IY2A 2XGSA 3BA6A 3CLSD 3ESXA 2O5EA 4CKWB 3O4GA 4QU8A 1DC6A 1S8NA 3PRKE 3NIWA 1D2RA 2IUTA 4MDHA 3BK7A 3B8HA 1JMVA 4ZGWA 2YHAA 3VU8A 4OK6A 4INPA 1TECE 1G21E 4BFTA 1QO0A 3ICEA 1C4OA 2X41A 3C70A 1XLTC 3MERA 2ZQYA 1SBTA 3L4EA 3NIFB 4MGKR 3WNVA 2A0UA 1FXWF 3SHVA 1AKQA 1UMBB 1HBJA 4MYUA 2BC9A 4AF6A 1U7DA 4YJFB 3WHIA 4RKRA 1RI1A 3PUVA 1T9GR 1TM2A 1Z3CA 1A7JA 2DBQA 3IV6A 3OKPA 2DBZA 4ZQIA 1QG0A 1DEXA 2VAPA 5FTLA 1CP3A 1E1RD 5DXAA 5DM0A 3TDNA 1L5YA 1QOQB 2I03A 3DBRA 4NX2A 4RGBA 3TLGB 5I51A 3FI0A 3W2FA 4A8JC 3Q7TA 4N47A 5E3IA 4BLVA 1AUOA 3QPAA 1UC5B 3AKYA 1GL7A 2V7TA 3HA7A 4ZVRA 3Q9SA 4GPIB 2O6LA 2OCAA 3UXHA 3BM5A 1YZYA 2GK7A 4UUPA 1J42A 3K20A 1MQ8B 1IXRC 1JECA 3FSGA 3NKFA 1DXOA 1GFZA 5DYYA 1OQAA 4HN2A 1EDDA 1VJRA 1MO3A 2CN1A 2F1KA 1PQ4A 5CBKA 4LKOA 2G7ZA 1ZEMA 4PFJA 4RTOA 1GZVA 1E98A 1H8HD 2HO5A 1M34B 3ETJA 2VQFB 3ZV3A 1R6BX 1NMSA 2Z1MA 4BMXA 4GNRA 1D3AA 1KO5A 4BFZA 4CQLB 4D46A 4EVRA 3AV3A 2IGTA 3P5SA 5KQMA 1IN6A 4IDEA 4ERXA 2X13A 2JH9A 3BS4A 3LI2A 2B1IA 4MDYA 2E5WA 1KQOA 3E82A 3GFGA 4JJEA 4J1NA 1P0IA 4KSBA 3MBIA 3LIPA 4PGGA 1SXJA 4X6YA 5FUQA 2PJUA 1IUPA 2VJPA 1JU9A 1T8UA 3H3FA 3TQRA 5JVDB 4AJOA 4YJ3A 3GRUA 3LPAA 1PYOA 1GLNA 2UZ3A 3C97A 4E2ZA 5AJYA 3UT0A 3KKMA 1KOLA 4Z1MD 2YZ2A 1JPNA 3NWJA 5CRIA 4EG6A 3HM9A 3AESA 3PXUA 3MJSA 1AKEA 1Y8QB 4M1MA 4XSHA 4KQJA 3H2IA 4J7AA 1YKFA 2DHRA 2PCJA 2VTBB 5K4HA 2JK1A 4HTFB