2VDVE

Structure of trm8, m7g methylation enzyme
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
227
structure length
216
Chain Sequence
NPFSDHQLEYPVSPQDMDWSKLYPYYKNQMTKKVTIADIGCGFGGLMIDLSPAFPEDLILGMEIRVQVTNYVEDRIIALRNNTSKHGFQNINVLRGNAMKFLPNFFEKGQLSKMFFCFPDPHKARIITNTLLSEYAYVLKEGGVVYTITDVKDLHEWMVKHLEEHPLFERLSKEWEENDECVKIMRNATEEGKKVERKKGDKFVACFTRLPTPAIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Yeast tRNA M7G Methylation Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
molecule keywords TRNA (GUANINE-N(7)-)-METHYLTRANSFERASE
total genus 62
structure length 216
sequence length 227
chains with identical sequence F
ec nomenclature ec 2.1.1.33: tRNA (guanine(46)-N(7))-methyltransferase.
pdb deposition date 2007-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02390 Methyltransf_4 Putative methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2vdvE01
2ERCA 1N7JA 4YV0A 2Y1WA 5FA8A 2AOWA 4EMSA 5FWDA 1XDZA 3ORHA 3A27A 1H1DA 3FZGA 1L1EA 2FK7A 3GU3A 4M38A 2OKCA 4POOA 2WK1A 4C4AA 4WXHA 3I53A 3LECA 2PV0A 3GNLA 4PYJA 4FSXA 5EEGA 2FPOA 3O4FA 5BW4A 3O31A 5E1BA 4CTKA 5DXJA 3PB3A 2O07A 4XUEA 2NYUA 4LWPA 4DCMA 1EAMA 3F4KA 3GCZA 1SQGA 2XVAA 4X61A 3IYLW 2C7RA 5DM1A 2IH5A 4YMGA 3TMAA 1YFJA 4BY9E 2PXCA 3DLIA 1UFKA 3NVMB 4DMGA 3KQSA 2JH9A 5LQAA 3FTCA 4RX1A 4O29A 5FADA 3EGIA 2V74B 4AX8A 1FPQA 1M6EX 1G8SA 3BT7A 2FCAA 8MHTA 2E5WA 2NXCA 3DMGA 1KXZA 5K0JA 3M70A 5K0EA 4FT4A 4PYLA 2CMHA 3KHKA 4GF5A 2HV9A 2ZLBA 3CJTA 3KPJA 4RTQA 3UJ9A 4DF3A 1JSXA 1VE3A 3P9KA 4H0NA 1D2CA 5HEKA 3PT9A 1AQJA 1P91A 3GIWA 4PGGA 5DSXA 5E1DA 1P1BA 3LCVB 1X19A 3BGVA 3REOA 4YUXA 2AOXA 2ESRA 3FRIA 3TM4A 3FPJA 2G1PA 2BR5A 4FZVA 2AS0A 1N2XA 4OA8A 3GRUA 3E05A 1N7IA 1I9GA 5K0LA 2AN3A 3BWMA 4C06A 4C07A 3HA3A 3E8SA 4CKEA 3UBTA 1QAQA 3T7RA 5K0GA 5BP7A 1ZG3A 5B1SA 2H00A 3GRVA 2YXEA 1RJFA 2FRXA 3TR6A 1JTEA 1ZGJA 2AOUA 3EPPA 4G56A 4GOMD 4GOOD 4QTTB 4EKGA 3IEIA 4YUZA 5CVDA 1Y8CA 5FUBA 2WA2A 5EIWA 2OY0A 4E30A 3PVCA 1XVAA 2OYRA 4AZVA 1G60A 1SQFA 5DM4A 1D2GA 1X1BA 4NECA 1QAOA 3KQOA 2ZZMA 3GO4A 1KIAA 1NW5A 3H2BA 5DPMA 2BM9A 5FQOA 1OR8A 5E8JA 3UJDA 2G8NA 3FUXA 3JWIA 3IHTA 4QDKA 2VDWA 4MQ4A 2VZ9A 3HCDA 3A25A 3NDJA 2R3SA 4GQBA 4MIKA 3DXZA 1TW3A 1YUBA 4HGZA 2C7PA 5CUQA 3CCFA 3SX0A 5CIYA 2HMYB 3R9XB 2UYQA 3HVJA 3OCJA 2XVMA 1TW2A 2ZBQA 3NJRA 1L3CA 5C9ZA 3OZTA 2XYRA 4RTLA 2ONYA 4IV8A 2PSSA 4ER0A 4U7PB 3FRHA 4GC5A 5LQNA 2ZULA 1SVUA 4LECA 4PYOA 3SSOA 3UA4A 2EFJA 2QRVB 5GOZA 4EKIA 3SSMA 3KQPA 4HTFA 2ZIGA 1NW3A 3BKXA 2ADMA 3CC8A 3LGAA 2K4MA 5E9WA 1WG8A 1KYZA 5DM0A 5GM2A 3EMBA 2IDJA 1JG3A 2ZW9A 3U81A 5K0CA 1IY9A 5EEHA 4C04A 2YVLA 1EQAA 2YXLA 4Y2HA 5DLYA 2CL5A 3BGDA 3MQ2A 1KR5A 1KPIA 2HTEA 3P2KA 4RVFA 3TQSA 1O54A 5ICCA 3BWCA 4P7GA 2IBSA 3UJ8A 2R6ZA 2P35A 3OFKA 1AV6A 5CCBA 3O7WA 1BKYA 1XJ5A 2OB2A 4IKPA 3SR4A 9MHTA 3QV2A 3M33A 3LHDA 3GRYA 3T7TA 4KIFA 2P3QA 1B42A 3HCBA 3G2MA 3G8BA 3Q7EA 4PCAA 5T64A 3SM3A 3TLJA 2XBMA 5EQJB 1G55A 3CKKA 5GIPE 3KQVA 2Y1XA 2G71A 3MCTA 4HRAA 2B78A 3G2QA 4GC9A 5K09A 4GOND 2QE6A 4RTPA 4PINA 4YUYA 2JHPA 1RI4A 4P7FA 5LQKA 1JQ3A 1NKVA 1F3LA 5CVUA 3TPZA 1DCTA 2AOTB 3DP7A 3ID6C 3KPYA 4FP9A 4PWYA 3P97A 4X63A 5LQUA 4ER7A 3KR9A 5HILA 3HVHA 4ER3A 1F38A 2PY6A 3P2IA 4R6WA 3FPFA 4HG2A 3C6MA 1IXKA 3K6RA 4DM3A 1VBFA 2N47A 5JUWA 3G89A 1EIZA 5K05A 4RYLA 1U2ZA 3ME5A 4ATNA 3LBYA 5K01A 1BC5A 3THRA 3DXXA 5DM2A 5ICFA 3TKYA 3GRRA 4P7KA 1P39A 3BWBA 4C03A 5T6BA 2AVNA 3HCEA 3BUSA 1UIRA 2ZWAA 5DTQA 5H02A 5HFJA 3LBFA 3HVKA 4MTLA 3KQTA 5DTMA 4KDRA 3M6WA 3P71T 1RI1A 3CVOA 4RVHA 2AZTA 3B7PA 3KKZA 4CTJA 3AJDA 2ONZA 1XTPA 1O9GA 1M0EA 2CKDA 4FS8A 1IM8A 1RJEA 2B3TA 4FSDA 1JG1A 3KPVA 2ZBPA 1MJFA 3EVCA 1KYWA 2BR3A 2B9EA 4CXMA 4RTMA 5LR6A 1XCLA 3G8AA 3VC1A 2PX5A 1JQDA 3C3YA 2P1DA 3P9NA 3NTVA 5E8RA 3UJAA 2ORED 3A7EA 4R6XA 4RSRA 3T7SA 3RW9A 1VLMA 4C05A 2OZVA 1T43A 2P3OA 3OE4A 1JG2A 3SXJA 1SUIA 2I6GA 3EMDA 2CMGA 4M37A 3B5IA 3DLCA 4L7VA 4AZTA 3FTDA 2GB4A 1ZQ9A 3KPWA 4QTUB 4ER6A 4DA4A 1WXWA 4P7JA 3M6VA 2JJQA 4OBWA 2AN4A 2YUIA 3HA5A 3M4XA 2PX2A 4OBXA 2VP3A 1DUSA 2WA1A 2YR0A 2PJDA 1G38A 5EOVA 4CKCA 5LSAA 4OX9Y 5P8WA 1PRYA 3CBGA 3FTEA 2PGXA 4HSGA 2NP6A 4QDJA 3C6KA 1JR4A 2FK8A 4KIGA 5BW5A 5M5BA 4CWAA 3SVZA 2PT9A 4EK9A 2IH2A 3KQMA 7MHTA 1NW8A 3OE5A 3OPNA 2O05A 5KQRA 2LD4A 3PX3A 4IV0A 3DH0A 4QPPA 3KR0A 5FWAA 2ZSUA 1QZZA 2DPMA 2HNKA 3NVKI 3EGEA 4E2XA 2G70A 5F2NA 3ER8A 1SG9A 2AOUB 4M7RA 5U4XA 4DCGA 4E2YA 5HZMA 5C1IA 5KVAA 2I9KA 4CKBA 4GBED 4E2WA 1SUSA 2BH2A 4RTNA 3AXTA 1BHJA 1X1AA 1ZGAA 3GWZA 2QRVA 2YQZA 3OZSA 4YV2A 4KDCA 5GIOE 3P2EA 1NBIA 3KQQA 2IBTA 2Z6AA 3GGDA 3TKAA 3FUUA 3GJYA 3OFJA 4OA5A 3PS9A 5CCXA 3B3GA 2GH1A 1RI5A 3KR2A 3HTXA 3PX2A 4QQKA 3EVDA 4QPNA 5FULA 3P9IA 3HCAA 1L3IA 3MCZA 5GP1A 1QYRA 3V97A 5E2AA 2IIPA 4C08A 1R18A 4WVLA 2GA9A 2ZZNA 4XUCA 2G72A 5FHRA 3OU7A 5EPEA 2EX4A 3HCFA 1FJXA 2PT6A 3WSTA 1D2HA 2GPYA 3ELWA 5DXAA 5HIJA 10MHA 3NMUF 4MWZA 1L3BA 4UOEA 4PYNA 3JWJA 5DX8A 1EJ6A 1R00A 3EVGA 3G5TA 1INLA 4PCLA 3LCCA 4E70A 1WS6A 3A26A 4K6MA 4PYKA 1NE2A 3FUWA 4HTFB 2ZIFA 4BLVA 4Z2YA 5GM1A 2I62A 5CM2Z 1I1NA 3DTNA 3UWPA 2ZCJA 2QY6A 2IPXA 4F85A 2NXEA 1KP9A 2UYOA 3BWYA 4YUVA 2P3LA 2PXXA 3HCCA 3HVIA 4FT2A 4QVKA 4R8RA 2UYCA 1XCJA 1P1CA 2P7IA 3ELUA 3AY0A 1YFLA 2UZ4A 1MHTA 3FUTA 5E1MA 4XUDA 1XDUA 4GOLD 3KQWA 3B3FA 3R0QA 5CVJA 5EMMA 3G5LA 3VC2A 1NV9A 1QANA 1WZNA 1V39A 3DMHA 3EVAA 1NW6A 3A7DA 5DRYA 1RI2A 1KPGA 1RJDA 2OB1A 2HR1A 3LDFA 1NBHA 3LKZA 4YMHA 3KPUA 4E33A 2PX4A 1VP9A 1WY7A 3NW9A 4A6DA 3E23A 4JXJA 3JWHA 4PONA 3BKWA 3UFBA 5K03A 2UYHA 5EMJA 2FHPA 3MHTA 3EVBA 3LL7A 3A4TA 5GINE 2EG5A 4QVGA 3ELDA 4RVDA 3QOWA 2FYTA 4DZRA 2ZTHA 5LQRA 5DTRA 4PYQA 3V8VA 5ICGA 1YF3A 5HIIA 1HNNA 2YXDA 3CJQA 2PXAA 4F84A 5JR3A 3DOUA 5BXYA 3HA7A 3VYWA 5DRTA 3PLAE 2GLUA 3LDUA 3MTIA 3B89A 1I4WA 5ICEA 4EVIA 4PNEA 3I58A 2IGTA 3IV6A 1RJGA 2EJTA 2VS1A 3ELYA 2PWYA 4GUAA 5E9JA 4QQNA 2AOVA 1ORIA 1YZ3A 3B3JA 4KW7A 5IH3A 2P7HA 3KR1A 5CVEA 2HWKA 3VSEA 2PKWA 1ZKDA 5EKUA 2P8JA 3I5UA 4YV1A 2NP7A 3T0IA 5DSTA 2V7EA 3ERCA 5EG5A 1VQ1A 5FQNA 3SMQA 2PLWA 5E2BA 4FGZA 2IFTA 4OQEA 4PIPA 5FCDA 2ZZKA 2PX8A 2NXNA 2BM8A 3PTAA 5HOQA 3TFWA 2EJUA 1X1CA 2IDKA 2Q41A 3FPEA 3KQYA 3D2LA 3R24A 4X60A 5EZQA 2VDUE 2JHCA 3HM2A 3DUWA 2VDVE 4F86A 2AOTA 1O9HA 4X41A 4AZSA 4HH4A 4PYIA 3OU2A 4E32A 2PWPA 4V0RA 4MHTA 4ISCA 2NNWB 1FP1D 1AF7A 4RVGA 3HNRA 4BP1A 5FHQA 2C7OA 3DULA 3K0BA 2IP2A 3LSTA 1JQEA 3G2OA 4X1OA 1RI3A 3M6XA 3TOSA 5HIKA 1ORHA 1QAMA 3OU6A 1DL5A 4R8SA 1BOOA 3GXOA 4ZTBA 2Z6UA 4BP3A 1AQIA 2P41A 2O57A 1R6AA 4RTOA 3BGIA 3C0KA 2YX1A 2ZVJA 4EQZA 4P58A 1R74A 3P8ZA 3ER9A 2BR4A 3DR5A 3MGGA 3EEOA 3LDGA 5D1HA 1NT2A 2KW5A 2PVCA 2ZWVA 1VL5A 3RODA 5KYGA 5G02A 1ZHFA 1R8XA 5EZSA 4AZWA 1FP2A 4RTRA 3UJ6A 1VP3A 3LPMA 5HIMA 3UJCA 1YB2A 4RV9A 4BLWA 5EHGA 5FTWA 3SSNA 3THSA 5D1NA 2B2CA 3I64A 3MERA 4KVZA 4RTJA 4A6EA 1EG2A 2NXJA 5C0OE 4E2ZA 2AVDA 5MHTA 1HMYA 4M36A 4RTSA 3TRKA 3TM5A 4E31A 3QOXA 3BZBA 4HGYA 5EHIA 2XYQA 1JSZA 5E9QA 1JG4A 4V0QA 4FR0A 4DQ0A 3EGVA 1X1DA 4OQDA 3UZUA 5IKMA 1M6YA 5DX1A 2O06A 1NV8A 2H1RA 3EVFA 4PYMA 2BZGA 5T67A 5K0NA 4RTKA 3G2PA 5LQJA 5DT2A 5K0BA 3MAGA 5CD1A 1EJ0A 3RIEA 3DXYA 3FYDA 3I9FA 3FPGA 3KU1A 3FTFA 2C7QA 2B25A 3MB5A 3HEMA 3UJ7A 3UJBA 3G7UA 1NW7A 3GDHA 5LQCA 5EIFA 1XDSA 3FPHA 1JTFA 2OBFA 1WXXA 3EVEA 2DULA 2H11A 2ZIEA 2OPBA 5GWXA 5K0FA 2O0LA 4LG1A 3HP7A 4KWCA 1VIDA 1Z3CA 4PGHA 3NDIA 1FBNA 3C3PA 3R6TA 4RWZA 2PBFA 5ERGB 1KHHA 3SGLA 2QYOA 3LX6A 1G6Q1 3JWGA 5EGSA 3MTEA 3AXSA 3CGGA 5EVJA 2Z6QA 4Y30A 2JG3A 3EEYA 5CVVA 2QM3A 4LWOA 5EMKA 3CJRA 4IWNA 1Q0SA 2YTZA 2ZBRA 3Q87B 2IH4A 1PJZA 4ER5A 1VPTA 4DKJA 3FUVA 4GEKA 2OO3A 4B17A 3E7PA 1R8YA 3GRZA 3M6UA 4U7TB 1Q0TA 3PFGA 3PFHA 3P9CA 4HC4A 1G8AA 1KPHA 1L9KA 2A14A 2GS9A 3BXOA 3L8DA 2JH8A 1TPYA 3R3HA 5F2OA 2P40A 2I7CA 3EVZA 2JHAA 2ZFUA 3LCUA 3OZRA 2OXTA 4BLUA 1YZHA 4KRGA 5DWQA 5EKXA 5KS2A 2CWWA 4XCXA 3DMFA 5K8VA 2AN5A 5EMLA 2AR0A 3AWIA 4R05A 5E1OA 4AUKA 3NWBA 1XXLA 2GAFA 5FA5A 2XYVA 3S68A 1UWVA 5KQSA 4YUWA 5DX0A 3G88A 5EC8A 4PIMA 3X0DA 1SKMA 3UA3A 3LKDA 2F8LA 5F2KA 3ANXA 3FYCA 3NWEA
chains in the Genus database with same CATH superfamily
3BJIC 1Q84A 4DLVA 1J39A 1FXWA 3R3XA 3I9JA 4JS0A 1K6MA 1NKTA 2Y92A 4OVKA 3UJNA 4PWZA 3NUGA 4S04A 5L7WA 3MF4A 5HE9A 3TAXA 1QJCA 3KJNA 2JFNA 4TLAA 5HKKD 3TXYA 1UMDB 3SXPA 4LE0A 4M38A 5IKXA 3EGCA 1PTJA 1KH3A 3VOAA 3BXGA 4EUFA 4BHTA 4YT8A 5BUCA 5KVCA 4ZVLA 1Q1NA 1B2RA 4DWOA 4ZP1A 5H70A 3GEGA 1FU4A 2EJVA 3H87A 3OZIA 4OF4A 4EA6A 1FDRA 2EBHX 3AEQB 2F1JA 4X1IA 3HC7A 3EGOA 2Z2IA 3WLHA 4B40A 1E5QA 3KVVA 2A2ZA 4MDEA 1KHTA 1L6IA 4O4HA 2C7RA 1QZUA 2HUNA 2EQAA 3H0KA 4DCOA 2W2XA 3AFGA 3WC4A 2W37A 3JYNA 2D0DA 2C57A 4IDAA 4NPCA 3B2EA 2YNMA 3I04M 2AFIE 1ZYUA 1JAZA 4GM0A 4L6CA 2ZDQA 2ZS7A 2VZ0A 2XDAA 3C6ZA 2XXAB 4WADA 4KH0A 4E5KA 2C9ZA 1UMCB 1ZINA 1TOAA 3B51X 3C7AA 1GV1A 2JIDA 3VNVA 4EVSA 3BMNA 3D7RA 4XTCS 5U9CA 3FNQA 4BCDA 2Q6VA 2VNSA 5H3LA 2IJGX 1G8JA 2RGGA 1TM5E 4JOSA 1AV7A 1DBPA 2HJGA 5LC1A 1K4MA 4QO7A 1JFLA 1Z7WA 3V00A 5C8YF 2YHUA 4C3ZA 1RVV1 1X87A 2GXUA 2JK0A 2OENG 1IY8A 1NF3A 3EDOA 4N5LA 4MWOA 4EG1A 2FFRA 4M22A 2B7LA 2FLVA 3BFPA 3AEXA 5LZ7A 2YN0A 1WLSA 3E9DA 1JLKA 1WXQA 1V3UA 1LBSA 2CKMA 2NYRA 3GFTA 1M7BA 4Q9AA 3T7RA 3VPXA 1UPTA 3TQOA 4Q3NA 3RIMA 1H65A 3H1BA 1E2LA 3GRVA 1DWOA 3HQ4O 4ZO7A 4DJAA 1WZ2A 1TZJA 2HF2A 1GLGA 1ZGBA 3QFCA 3UWOA 3K2IA 1KMQA 2WF8A 2X6TA 3ACCA 4LVNA 4ZRDA 1PR5A 5EYPB 3W6NA 3BL5A 1GIAA 1K8QA 1EIWA 3QYAA 8ATCA 4C20A 3FSRA 4Q48A 5D00A 4Y9TA 4BO3A 4NAVA 4WZAB 3T5BA 2EZTA 4KSYA 3WIVA 5DBOA 4BRZA 2ATCA 5AM0A 4IOLA 5DN6A 3QH4A 4RCYA 2EYUA 2ZT7A 3TZ6A 1H1LB 2HT6A 1E96A 4NBTA 5IVIA 2Z4SA 2BH9A 1XK6A 3BJEA 1R66A 4RZUA 3MC1A 3CCFA 3VNSA 3R9XB 2HMYB 5AIAA 1KVRA 2C4WA 3UMBA 2BFCA 5G40A 3L0OA 5C9ZA 1ZM4A 1TUBB 1E8DA 2DAPA 4JYAB 3L07A 2Z5VA 3KYIB 4K40A 1NQUA 4O4IB 3HJHA 4JJEA 1C1YA 3VTZA 1I8TA 1ZVQA 2PKQP 3PPYA 1V6AA 1PE0A 4X8HA 1EWVA 5CB4B 1MW8X 1HSZA 1NOIA 1PQWA 4N41A 1GEEA 3IAXA 2C0PA 3LDAA 4XAQA 1ZA2A 3KD3A 1HG1A 4FMDF 2ZI5A 2VTBB 1ZCZA 4HDAA 1VGVA 3H2JA 4C04A 4PSKA 1R37A 4RQUA 5DHFA 4BVGA 4CMHA 2QZ4A 4F4HA 4GMFA 4I50B 4S0ZA 2LKCA 4PHFA 1D7AA 3A2LA 2O1SA 3ZN2A 2GZHA 3RU3A 2W2NA 5CCBA 3V4SA 3A6GA 2D5BA 1NE7A 3MJEA 3OZXA 4KHPB 4W5NA 4FOSA 2O2EA 3GJ7A 4WKOA 1B0AA 2RGYA 4NATA 4RK7A 2G4LA 1W88B 3O8OB 1L5LA 1W4CA 4MGHA 1BSVA 2OL4A 2Y2UA 3JRNA 3Q7EA 2V9ZA 3AYXB 3ZDEA 3FZEA 4L8VA 2JGMA 1JR3A 3K32A 3E27A 4OL9A 5D3KA 9LDBA 3IAM6 4REMA 3KEGA 4P33A 4MWSA 3J7TA 2QLNA 5C7OO 3PPWA 1ZA1A 4INAA 4ZZ2A 3AUSA 1ULBA 4F96A 5AHXA 2O8EA 4AC9A 5LQUA 2XVXA 4IF4A 3TGLA 2A8YA 5BN3B 3O0DA 3OE1A 3GGJA 3HDHA 3HVHA 4UCXA 4CR6A 4CEHB 3E03A 2YCLA 1ZO8A 2Y1GA 4G0NA 4U7FA 5G4KB 2OM2A 4JQZA 3KJZA 5CH3A 2FZLA 4YMVA 1Z08A 2V0NA 4LXTA 4C5BA 2YASA 5DCUA 3ZD8A 4DT1B 3ANNA 3F6BX 1JH8A 3H4TA 2F17A 1F1JA 4FEEA 4I46A 1J20A 1EVYA 3EEFA 1P7CA 3GCWA 1RI1A 4M1TA 4ONEA 3R7AA 4NFSA 3RF6A 5L7YA 4MQEA 4L4ZA 1M8GA 2ONZA 1PJQA 5LUAA 2PA3A 4MKGA 1SAYA 3R0XA 1L5OA 4C1BA 1MJFA 3SWWA 1KI6B 3LWNA 4WNIA 1CEXA 5LLDA 4WXYB 4CXMA 4AY6A 4ABYA 2D7DA 1FXWF 1E7QA 1Z22A 2QW0X 1YDHA 2GA8A 4E15A 5BR4A 5A9TA 3RW9A 3CWZA 2IPLA 1ZCAA 2P3OA 3P0EA 4O4LF 5DT9A 3GBVA 2PKXA 5CFPA 3WTCA 2FU5C 2ZSIA 4AJLA 4JQYA 3JSXA 1QHYA 1LJLA 1PLLA 3EZ7A 1PSWA 3QKIA 1A7AA 2PIAA 4FFWA 1SXIA 1YJQA 1G4HA 1ZUNA 3HYTA 1YACA 4K87A 1T3TA 2JJQA 1MFZA 5CCEA 3EZ9A 3EUEA 3G8DA 4N82A 4B6JA 1EVQA 2O8NA 3NV9A 3PICA 3WQRA 1OB5A 4EELA 5EOVA 4EYGA 1NXSA 3ZQ6A 5A3QA 4OX9Y 5KHLB 5JDIA 2OM6A 2B7BA 2CJYA 2X0EA 2LNDA 3NT5A 4RS3A 1R10A 4X44A 4EK9A 5LZ9A 2VK8A 3GLGE 1IFXA 3VSCA 1ZK4A 3OIFA 4FGLA 2IC5A 2O05A 5BNTA 1PSDA 4LSMA 2VCEA 3KR0A 4MQUA 4XI9A 4O5OA 5F2EA 2XYPA 2YFQA 1U0RA 2QD4A 3VC7A 4E2XA 4BMSA 2HB6A 2RH5A 1NMYA 1UWLA 4GP6A 1RAEA 2N1MA 1F9EA 3AHDA 3O90A 3G0DA 3OKCA 5FL7A 3VZCA 2YVUA 2WIDA 5CDHA 1TF7A 2X2OA 2BRUC 1RZ3A 1VCMA 3FWYA 3ZUPA 1OHHA 3N2GA 1V25A 3G2HA 1F6WA 2SNIE 3OQIA 1GAWA 1QGYA 3OX3A 2ZRKA 3PS9A 4FXOA 4PLPA 4CIWA 1BXGA 4QPNA 1JEEA 3HGMA 3VR5D 3MCZA 3E0XA 4KIUA 1NPDA 2NUAB 2NU6A 2QD2A 3EG9A 5BYKA 1X86B 4D6YA 1YIDA 3HB9A 1RYEA 2W6PA 4PHHA 1LDGA 4WOKA 3T5DA 4HN4B 3ONWA 2VA8A 3F9CA 2IKSA 3FCAA 2VDJA 3W1EA 4C4YA 3K7EA 4EEXA 1H0SA 2XDYA 3TRDA 2FZVA 2H2GA 4R2LA 4RY9A 2NACA 3ES9A 1YA8A 4HFJA 4ARSA 1QB8A 3AEKB 3RRYA 3CURA 3ZLTA 2HX1A 2WQ6A 1ZX1A 1RXVA 1XV5A 1L5SA 3ETNA 2QPTA 4G4IA 1C4OA 2M1ZA 3JTEA 4NEGA 1U04A 3PYMA 1SC3A 1B76A 3OZEA 4ZAWA 3HZHA 1L8AA 5HJEA 2TMDA 3K70B 5AJWA 2JRCA 1L8OA 4QNRA 3Q8XB 2VHUA 3SY8A 2AG5A 2BGKA 3AU8A 2Z83A 2P3LA 2VEOA 3P7MA 4BTVA 4LYJA 1HYQA 5C51B 5EERA 1P1CA 4B34A 4C6SA 2REBA 2NVUB 3RIHA 5EP3A 2UZ4A 4ALMA 4XUDA 1HDCA 2J9FB 3EVAA 5AI5A 1XEXB 1W47A 4XM1A 1YCGA 2JCVA 1DLJA 3LDFA 1Q1GA 4YJFA 4LRXA 3ZDYB 1WDTA 1KEVA 3NXSA 3OT1A 4D8VA 1BWQA 4F56A 3KJGA 1QHGA 1T0JB 3E23A 4JK3A 4A10A 5J4HA 1NFFA 1XZQA 3NGMA 2P1RA 1N6NA 5EWMB 2YJ5A 1EFUA 2J9ZB 1ENOA 3WGHA 4HOYA 4A03A 1PGNA 4DHEA 3LQQA 4DLSA 4EHHA 3EC2A 5KQLA 2IHNA 3D3KA 4J0GA 4G41A 1YF3A 4M0KA 3AR3A 3DDSA 3F9RA 4EG6A 2C5AA 2PXAA 2YMLA 2FI1A 2A35A 3M1AA 5JZVA 1T2CA 2D2FA 1OVMA 4N5NA 1II0A 1N32B 1BTOA 4EVIA 1Q44A 2H63A 2H08A 1TC1A 1ESMA 5ARDA 1HORA 3OEWA 3TLKA 4B4KA 3IUYA 2WWYA 2G5GX 4GOXA 3F6YA 3UG7A 3RVJA 2W0SA 4F2WA 2IHYA 2BEVA 2HCTA 2YC4C 3A6EA 4G07A 1IN4A 2RC5A 1AA9A 4MMZB 1HYBA 3BCHA 3MCWA 2ASVA 1ORVA 3SMQA 5D7NA 1T4BA 1N2HA 4IW3B 4OMUA 3SM9A 1RRCA 3I5YA 1K0UA 6ADHA 1TJNA 3W5SA 4U2GA 3VV2A 3UC5A 1E2JA 3OE7D 3U48A 5DCYA 4YPVA 1T8TA 1O9HA 4GSYA 2X7JA 4GR5A 4LJ9A 1PT8A 3EAQA 3MOSA 4JC4A 4F21A 3I9KA 4HX9A 1P31A 4Y67A 4BP1A 1YL5A 1GT6A 2QDKA 2Y1DA 5L6LB 3UPUA 5E4TA 5ALVA 4C2UA 4NONA 4HQ0A 1KYQA 1CQJA 1ORHA 3TPCA 4RKQA 1NAIA 2C7VA 1WQ1R 3EFEA 4OKSA 5B4VA 4YAEA 5F5LA 2EW2A 4FONA 5J5VA 4RTOA 5FFMA 4BS9A 3AF3A 3VU8A 5JU6A 5KJFA 3OHPA 1LPAB 1ZJYA 3BIOA 3HB7A 5BMVF 1R74A 3VDNB 2J0UB 1IEXA 2OBLA 3SFTA 3P0IA 4BJ6A 2V7XA 5A03A 5TMEA 4II7A 2XUFA 3HJAA 4NMWA 4YT5A 3LUCA 2JFQA 4LN1A 1J2JA 2CHVA 4WEQA 2X7XA 1MR3F 4UD6A 1CERA 4TT3A 1OLXA 1NF9A 1NBEA 5KYGA 1R9MA 2V4UA 2V7QD 2PCLA 4K8RB 1XQWA 2EZ9A 2WUVA 5JYDA 3QHPA 2FPXA 2YY5A 3SFVA 4A6EA 1K7SN 2D0OB 2DSNA 1SUPA 5LA6F 4PQEA 4JMPA 1BS9A 1JIXA 1R6XA 4KWHA 2PLNA 3AIKA 5IT5A 2QWXA 4GXQA 1C1XA 5EHXA 4LZWA 4D57A 1NONA 1E6UA 1FBTA 3LVQE 3FGPA 3R3SA 1A5BB 2WVGA 2Z9DA 2PFKA 3ENQA 3KZ1E 3L93A 4XYBA 4PYMA 1Y3IA 1N5IA 5TJ9A 3AKDA 4MI1A 2G6BA 3MLBA 3QLEA 1J0BA 5TY0A 3TIVA 3WKAA 2BKAA 1ZICA 3SPXA 4B7CA 2ZJ1A 1USGA 3NRCA 4ZHSA 4KSCA 5DYYA 4RC9A 4DLZA 3LSYA 2GN2A 3WYDA 4ASUA 5IFLA 1X7WA 2HJRA 2FRDC 1DV1A 4NULA 2YWEA 5AM5A 3C7DB 2IT1A 4OXKA 4AN0A 4Z9XA 4N65A 1F06A 5IMSA 5L4SA 2R2GA 4OQ4A 2R87A 2YZMA 4BLQA 5J2TA 2M6LA 1D1PA 4XGQA 2J6BA 3AI1A 3KHTA 2GJ8A 1NMZA 2RBGA 3IA2A 3QF4B 4GW3A 4J07A 3NDIA 3RRMA 6AT1A 2Q0QA 3DM5A 3LTNC 2PKYX 1L4GA 4YIKA 5JO0A 4CKEB 3HCNA 4U6NA 3CONA 1MGPA 3L6BA 3BH0A 4F4CA 2UUAB 4BCCA 1YVDA 1GQFA 3Q3VA 1E6EA 4UHHA 5AHOA 4NZPA 2NO5A 3RKRA 4L4UA 3UMFA 4K9OA 1J8VA 1CCWA 4Y0NA 2XWJI 1FP4A 1Q0SA 1AURA 2G5PA 3WFJA 3FVRA 1W4RA 3GJ3A 4ER5A 5J3JA 1P75A 5I5EA 2VZLA 3A2KA 3HY4A 4Q05A 4GPBA 3WZ2A 3M6UA 5IPFA 3K70C 3X1ZA 1XU4A 4ZI2A 1T2DA 2EQBA 1L9KA 3A3PA 4AZWA 2HZBA 3G0OA 3TECE 4E6EA 1CVIA 5BRAA 4E0BA 3TNLA 4OP1A 4C01A 2BGRA 1MP0A 4I5IA 5BQ3A 9ABPA 5AW7A 1PVOA 3KVNA 1DXHA 1M5TA 3H9UA 2AL7A 2MJLA 3RKUA 5D87A 5KMGB 1IBLB 1KWGA 2PWZA 4UASA 1Z5GA 1ZD9A 1Y8QA 4I6GA 8ADHA 1HDIA 1K6IA 1DO0A 3S40A 4MVCA 5F3RA 1KSGA 2XYVA 3PI6A 1Y6QA 1CD5A 4O08A 2I3GA 4KIJA 2B21A 5I4IA 3GLFE 4WKPA 2DLNA 3UA3A 1I6WA 3Q10A 2WZCA 3CF0A 2W11A 1RKVA 1R2QA 1XYVA 5IVDA 3ZJ4A 4DLPA 3AJEA 1YDFA 3HSKA 3L04A 5LWHA 5ED0A 4LK2A 3UXMA 1OX4A 4Q4DA 2IYYA 1FMJA 2BFFB 2HPVA 2V6FA 3NKVA 1P0FA 3U49A 3ZHCA 4RLQA 1TM4E 1FVOA 1ODIA 3II6X 2BDEA 1MH1A 2SCUA 3GU3A 1OGYA 4L1KA 4OHBA 3ZE0B 1LBIA 1UK9A 5IXJA 4B7UA 1RPAA 2PV7A 5I48A 1SXJE 1I1OA 1QIJA 1UBNA 4IFTA 3A6ZA 2CBZA 3DVLA 4U2BA 4P3NA 2Y27A 1RE0A 3AEKA 4FYHA 5CAEB 3PB3A 4HUTA 3KBOA 4PG4A 1BRTA 2XVAA 1GFZA 3EIQA 3GT4A 3OJOA 1CK4A 1NQAO 4ETWA 4XYMA 3GFVA 1X7GA 5AVKA 2M6KA 3LUGA 4LGCA 5HQ3A 1PSZA 1DO2A 4G0QA 3ZWMA 2GN1A 4A0RA 1KA9H 4RPIA 3VKWA 2ATIA 4KLNA 2X8WA 2NO6A 2OAP1 2NUTA 5F9FA 1E2DA 5JSKA 4IDNA 1Q6ZA 1XJCA 3SS9X 4JEMA 4F9TA 1YONA 5A5VA 1POWA 4I5DA 4JLBA 2R8EA 5CIQA 4LYDA 5F64A 4CMBA 4P3OA 5FWYA 5EIEA 4QC2A 4J1SA 2ZSEA 3ZWQA 2Q4RA 4GG1A 1ACMA 1HL7A 1EBBA 2VP0A 3OT5A 2CMDA 5H80A 1KVSA 4RM3A 4AO7A 2O6LA 3OBBA 1EM8A 3GIWA 4IV5A 5K8LA 3U60B 13PKA 1POXA 5G1OA 2QRNA 4HO1X 4MVJA 4DWJA 2A0UA 4L74A 2MSWA 4FZVA 3ZOKA 4ASUD 1SXJD 2PQ6A 3GRUA 1IOZA 1NUQA 3WGLA 3L5OA 4HBZA 4KN5A 1IN7A 4MP3A 1C3XA 2QXYA 3DDCA 4OHOA 3H2YA 2UYCA 2QI9F 4OHFA 4A2PA 4B1FA 4B7ZA 1KXJA 4Q3LA 3DXFA 4D5EA 5DI3B 2WYWA 4KWIA 1QAQA 5KTSA 1RR6A 1LZLA 3N39C 2QUAA 2EKBA 3M0EA 2H00A 3W04A 5KTRA 2FRXA 3SZUA 2OV4A 3TLGB 1PQUA 1MZVA 4YUZA 2B4TO 4LCBA 1GL6A 1TVKB 1U2DA 3RIXA 1Z0ZA 3IALA 1F8XA 1YOVB 4M6WA 1YFZA 2PRJA 2OHFA 3BK2A 3QEOA 5I7WA 1Z18A 2O48X 1IZ8A 1PBNA 3GO4A 2P6MA 3H04A 2Z2JA 1U9ZA 3RU7A 4XASA 1AKTA 1D5CA 2R7MA 1COZA 3GAZA 3UO8B 4AM8A 2B4AA 4WACA 1DAFA 4Q4HB 4X7PA 4C87A 3O3OB 4AKGA 1AS3A 3AP3A 2ZBDA 4RPKA 1C29B 5JT1A 3PITA 3DXZA 2I55A 2AZXA 1JV2B 4M8SA 3QBTA 1C50A 4MW7A 1ZJ6A 4M87A 1ZCJA 3T9EA 1W44A 3MBKA 3WHKA 4C0XA 4CG2A 1JR3D 3Q40A 3AR5A 2XQIA 4BLOA 5JYBA 1H1LA 5LN1A 2NO4A 4GC5A 4P5DA 2AJDA 1YA4A 5CT6A 3SSOA 4WT7A 3HGQA 1MJHA 1XO1A 2OPHA 5LQMA 1CUGA 3BZWA 3QPDA 5FO0A 4Q01A 3PGKA 3ZE7A 1NR1A 5C8YA 3PPIA 3P45A 1JPNA 2VBIA 4J94A 5SZIA 1V0JA 4ZVMA 4BQEA 2PZLA 5IAAA 3EPHA 2IXAA 2KYRA 1PGJA 4WOJA 4IGAA 1KPIA 1K2WA 3CVWA 4KYTA 2D06A 5E6UB 2FSSA 2R6DA 1DC5A 3JQGA 4HLQB 1Q20A 3GT3A 4GI5A 2OFWA 1T9CA 3RBXA 1NYQA 2A57A 2VSFA 2XIJA 3DOIA 1K5DA 3DDWA 5JXWA 4IOMA 4MRAA 4B48A 4OX9B 3PQ6A 4J43A 2XBMA 3TLJA 4B4UA 4HFRA 1EGQA 2JJ2D 5JCOC 1M7HA 4XFDA 5J23A 4R1QA 5GIPE 4EKYA 3JR7A 6Q21A 3V4PB 2B78A 3G2QA 1R6VA 3MJFA 3NV7A 3O8BA 5CURA 4YRJA 4D97A 4E09A 5JQGB 4TTSA 1ULSA 1QV7A 4DB2A 2QRGA 2Z57A 1IATA 5CVUA 2YV4A 5EWJB 3J81A 4RHEA 4I6JA 4DM7A 2FMIA 3DP7A 3ID6C 3IDSA 1WP4A 3IEXA 3IDFA 5EXXA 3NO4A 3ZGVA 1VM6A 2FUKA 4IL5A 4BCBA 1MPTA 2QU7A 2O0MA 1K06A 2GPNA 1NVGA 4FIZA 4GGOA 2OQVA 3U4QB 2N47A 3ZQUA 3LX4A 1QCYA 4QGBA 4JYBA 1LDMA 3IUSA 3QX8A 5DXFA 1A9TA 3R5TA 5ICFA 3ZV6A 2OESA 5HFNA 4MVJD 1J8QA 3R0VA 3M7IA 4O63O 3K53A 3ZU2A 4JB3A 2XTZA 3FVQA 1MTOA 2I5PO 2YIMA 2I7VA 5K51A 2CHQA 2VT6A 4P98A 2NTVA 5FT9A 1A7KA 2K7ZA 3I76A 1T91A 1VKZA 1NWHA 4DV4B 1NR7A 4NOKA 5G1NA 3BRWD 5FBQB 4NX2A 3SYLA 1LVGA 5DGCA 3CNHA 3JZMA 2ECKA 1Q3TA 3TX6A 3GFFA 4RTMA 1I3MA 1E3MA 2FRDA 4MRVA 2NSHA 1XWIA 3GZ4A 4TRNA 5CTJA 4IIEA 4YIHA 2P1DA 1H2BA 2VTKA 3R7LA 1PJBA 5KDDA 2FNAA 4Y18A 2OZVA 3GVPA 4KITB 1OGJA 3AB7A 5BQ5A 1RWQA 1ZIOA 1TUIA 1GILA 3KUCA 3W8FA 2P67A 4L9WA 1OWLA 5FOUA 2YIJA 3JQBC 1A8SA 4G4GA 4BPBA 5F1YA 4L7VA 4ZANA 3QWIA 4MKRA 4QHYA 1AKEA 1CRWG 3L4JA 1XSEA 1GAXA 4FDMA 3P94A 4HDKB 4HQOA 4S1WA 4XIIA 2X8LA 1W36B 2AR9A 1YWGO 4OBWA 3WDMA 2I3ZA 2A9PA 1XTBA 3KS9A 4KTTE 3KLPX 2IHBA 5L53A 4MWGA 1GNPA 3PJGA 2ZRPA 1JDVA 2N46A 3E22B 2GNPA 2V3CC 6GPBA 4C7OA 1VE5A 1YK0A 3C6KA 4OGLA 2IIBA 3AFMA 3E1GA 4IDGA 4GEGA 4EFNA 2Q4TA 3Q98A 3NYRA 2BMDA 4KQEA 4MGEA 2FMKA 3QI7A 3D6NB 3RYCB 2WE7A 2VHJA 3BHIA 4RV4A 1T9ZA 4BQNA 5M34A 1RM5A 3EGEA 2F67A 2W6QA 4JB0A 1PHRA 3DAHA 4BAGA 4UE3S 2REOA 4B3DA 3AETB 5F2NA 1ZAKA 5JZBA 5KNCD 4GDFA 2NMVA 3PQ2A 2AZ4A 3Q11A 4W6ZA 3CWQA 5C1IA 5FBVB 3OWXA 1MXFA 4QZVA 1NNEA 4TSKA 1EXDA 4PEVA 4REQA 5EJ2A 2VVTA 5TVKA 1X1AA 3OIDA 4TKLA 3S81A 1PK7A 3IIKA 5A5GA 3IAFA 4KZPA 4N7MA 4X90A 1DELA 5FUXA 3LYLA 3LH5A 3V55A 5GIOE 4FX5A 1ZIPA 2DHRA 3FUUA 4LBWA 5HZKA 2BW0A 3O38A 1RCTE 1RI5A 3HTXA 4KAXA 5BWMA 1W2WB 1Z5PA 2ZB4A 4ZC8A 4Q4CA 4FBLA 2FWMX 5AWFC 2A5DA 4WOPA 3L7NA 1DJPA 3DD5A 3NHFA 3F49S 4M1MA 4RVOA 3PT5A 4D26A 3B48A 3K0HA 2HYDA 4GPIB 2BMFA 2O8VA 4S2UA 2O54A 4EFKA 2BBOA 4AJ4A 4ND3A 3AVTA 5GMOA 3U7RA 4P36A 2HM7A 3GFQA 1TTQB 3G5TA 3JWJA 4JODA 1INLA 4PCLA 1G64A 5KHOC 4Q3EA 4K6MA 3GLFA 1Y5IA 2VH5R 4HLDA 3DBRA 1JZSA 1I1NA 1W35A 1W76A 3QNUA 3SQLA 5C8XA 3NIFB 1FLVA 4LBZA 1KP3A 1OUMA 4TVKA 4L5CA 1DBRA 2ZB7A 3HVIA 1U8XX 3VOBA 3LT4A 3NHMA 5GQSA 2X77A 2ZJ8A 2PTHA 4J4BA 2PZ8A 3Q7SA 1JU3A 4BZXA 3ESXA 1MHTA 3ZWWA 4HNAA 1XDUA 3B3FA 1N3YA 4C06A 3VC2A 4RJLA 1VL1A 1FDTA 2J87A 3DMHA 3SHQA 4EX7A 1KPGA 4B33A 4NFLA 4P1ZA 3OLWA 2ISCA 3T5MA 1ZD2P 5LZ5A 4B4OA 4CL0A 1ZUWA 1IZ7A 2W2VA 2Y8EA 4FE4A 3MAJA 5C37A 1S02A 4UNNA 2RB5A 1BXZA 2QRKA 1L8LA 1OB2A 3EZLA 1JJFA 2JI8A 2PL5A 3DKPA 3ELDA 4RIGA 3RJTA 4MWTA 1A2BA 1EVKA 4ZT3A 1KZ9A 1N6OA 1RXWA 2IZ0A 1B2LA 2B4QA 3U62A 4YDQA 5FYQA 1QRRA 3JPYA 2LCFA 2R85A 1WABA 3CHYA 4BEBA 1EVJA 1HEYA 1LRJA 4A16A 5JR3A 1RZVA 3MWJA 1XD2B 3UGTA 2R8PA 4HVAA 4GMDA 1FNCA 1I3KA 2I4OA 5HTOA 3EEQA 5MFPA 1AKUA 4ZTUB 3HEBA 1NVMB 4XRRA 1RJGA 1O7JA 2VAWA 1QVAA 1YAHA 3GJSA 5C7IO 3IOMA 1H3EA 1KQGA 1DEKA 4C30A 4MS3A 3DR3A 2O0KA 1EQUA 4OMDA 3BJMA 1WDWB 4OQNA 2H1CA 1ZKDA 1AKQA 3PE3A 3TVDA 1HM5A 1T5BA 3WP1B 3NOQA 2H06A 1RYHA 2IOHA 1L5YA 2GJSA 3U7EB 3FH0A 2GHQA 2MHCA 3ORRA 4E1BA 4H0CA 1CJKC 3BXEA 4A2CA 2XQKA 1AS2A 2IDKA 1QQBA 3EY9A 3DOHA 5K9ZA 3EA0A 3DUWA 4U7HA 4NZNA 2WYOA 1RE1A 2LGJA 4IJQA 2XWSA 4PYIA 4B3GA 2FG7C 1IHOA 3WYBA 4BLSA 5CVCA 2G5CA 4YCCA 1UKBA 3GG2A 4RVGA 3ECSA 4PC3A 4HXYA 3V3KA 3DLBA 5LP6F 1GUBA 1XMOB 5IT9A 1KH1A 5CA1A 4PR0A 4J1NA 3H2IA 1CE8B 4RY2A 4BE9A 2ZJYA 4BNDA 4BP3A 4Q7MB 4I9NA 2GAIA 4Q4HA 5DNAA 1Z63A 2ZJFA 2YYAA 3MVEA 4LKRA 4Z9AA 2WAYA 1K98A 3H5NA 2ZVJA 4OMCA 2OD7A 3L0PA 3RVMA 4JXZA 3FF4A 3UN1A 3JVEA 1TMOA 4B45A 1E7WA 1JHMA 4NCAA 3FFBA 3DNPA 5LMCA 1E4OA 4ZKEA 1JIVA 2CFRA 1FS5A 3R3ZA 4MDHA 4AVYA 4LVCA 1VL5A 1O0BA 1B26A 3MUFA 1OFVA 1Z0SA 2IXTA 3DVAB 3FWPA 4YX9A 5JYEA 1V5FA 4MVYA 3RJ5A 3IEVA 3VJKA 3GPIA 4YCNA 3RS8A 2B1JA 3Q7QA 2EARA 1RBQA 3MT9A 1ZGGA 1CIVA 1K8ZB 3PWSA 4PE5B 5EESA 1EWRA 4FTWA 4QG7A 3TKLA 1OGIA 2B2CA 1WMBA 3HR4A 1MPXA 2NXJA 3CMCO 4EA7A 3JQ9C 3R7WB 5C0OE 5GTDA 4N0QA 1XWWA 1C0LA 3N2KB 3BZBA 3SOZA 2P9FA 3COJA 1WZCA 2HA3A 2KHZA 1LGYA 1TJPB 2WJJA 3AFNA 5FV4A 1G1MA 1EWYA 3AHGA 2CL0X 2CHEA 3L0DA 2GRAA 4FYIA 3LOUA 4U02A 1TZBA 3DA8A 3HB1A 3I9V1 5HCUA 2AMJA 3K4QA 1U63A 1XLVA 3O1IC 4ENPA 3RRJA 3FPGA 3OY2A 4RF5A 3W2TA 1OAKA 3Q0EA 5G0VA 4X91A 1CULC 5A4AA 3ET5A 1I94B 3ZD9A 1JTFA 2H1FA 4PZAA 4WXRA 3U4AA 1WXXA 1M6HA 1NYRA 5C1OA 1XRQA 1XZDA 5HQJA 5E4JA 4PCVA 2YFKA 1TTPB 4XLZA 3IT2A 1PGPA 4QPJC 2XA9A 3RHZA 4TYWA 4EB3A 4HQRA 2IQIA 1XD8A 5L3ZA 1G291 4DLUA 3G9TA 4Q9LA 2A3NA 2O2SA 3I62A 2W90A 2QYOA 3CINA 1VJ1A 1EUQA 3EF0A 2IZ1A 2B82A 1G6Q1 1I7QB 1ENPA 3NHSA 4P0TA 3OP4A 3HSYA 5BVGA 4MW6A 2FSVC 2PVPA 5JD6A 1NQOA 1PZFA 1MNQA 4HBGA 3N70A 4QIHA 5SY9A 5LA6A 3USES 4CN9A 3RFCA 4ZTZB 1D0SA 1CP3A 2YTZA 5E6UA 5LYYA 5C5IA 2RG7A 4XVHA 4HWKA 1NWCA 5JRDS 3R8CA 3E7PA 3O47A 2QPLA 4B6GA 2EZ4A 1U0FA 4Z5XA 3U5TA 3FOZA 3TQQA 4D3DA 2GS9A 2G9NA 4MEJA 4AWXA 2W6CX 2X5NA 1KAEA 4PLYA 1OLSA 1J9EA 2HMWA 1NHWA 4MHOA 3TNDA 4B3CA 3TPFA 3ONEA 2WILA 3I5AA 3PGLA 3ND9A 4RA6B 1D1SA 4H7KA 4UVIA 2XNSA 5BV7A 1KFBB 4AJJA 3OJLA 1S5PA 2QRPA 3G88A 3TR0A 1F7VA 3GC6A 3QE2A 2A4MA 2CLEB 3T61A 1UBGA 1ABEA 1OXVA 2ERCA 1ST3A 3HO6A 3BMQA 3H75A 5FA8A 3HM9A 1HEUA 3QX3A 1GP2A 1CUXA 4IUBS 2FVYA 4DXHA 2UDPA 3A27A 2EX0A 3QP9A 3AEQA 5K4HA 2ISSD 3IBSA 1OYOA 1K5PA 1RPJA 1YUNA 1YUMA 4IQ0A 2V98A 2G36A 5FP0A 3WGQA 5I9LA 4I6EA 4UOQA 3HKBA 1IOWA 2YIVX 2JARA 4PS1A 2DBRA 2ZAOA 2ILVA 3G7NA 2H54A 4XSGA 2AJLI 3T7DA 3H5OA 2O07A 1IHUA 5ALGA 2O8EB 2WHEA 1Q74A 1PCXA 1BA3A 2QYHA 4RJ2A 4WA8A 2HADA 2OZLA 4LHXA 5D5QA 4QT0A 1S96A 2XKAA 2FSPA 3EULA 3KZVA 5GONF 4DUPA 1UFKA 3SYKA 1YR1A 5DZSA 2JCBA 1NGSA 4AWAA 4A36A 4PSVA 4LJSA 1GVNB 1NI3A 1CHDA 2XW6A 1MNAA 1NU8A 3MHPA 4KEAA 4RA9B 3RSLA 1G8SA 3IEPA 3S8EA 3R44A 4KBGA 4D9NA 3DF7A 3L4EA 4R2KA 4BKOA 4YI3A 3FYUB 4Y3UA 4US1R 5K0JA 1G41A 4YO8A 1M2OA 4L2IB 1V8DA 2FFJA 2SICE 2OYSA 3KOXA 3KHKA 1YASA 2HJWA 5SICE 4HGNA 1X2EA 4EY6A 2O7QA 2DSTA 3CJTA 5EN4A 2WSIA 4BEJA 4YAJA 4DF3A 3JQRA 2OLKA 1N77A 1ODCA 1AXGA 4MINA 1MG5A 1PX0A 2ZWMA 4MLPA 2FKAA 4CMAA 2NM0A 4BYGA 5B7NA 1IEWA 1IL0A 1GNSA 2QAGC 2NVOA 1VLQA 1RAIA 3BGVA 2GQ0A 3EIUA 3ICVA 4FFVA 4LHSA 2A0YA 1AGYA 4BNUA 2VLIA 4NLLA 2P2SA 3VX4A 3OZFA 2R00A 4RS4A 3EW9A 3F6CA 4LNUA 1E5LA 2DRIA 1FTGA 5IUKC 4MICA 3HA3A 1FC0A 2CXPA 3JASB 4ZT6A 3RSZA 3AVOA 3GLIA 1MB4A 5K0TA 2UXBB 1XLWA 3FSGD 4PN3A 3OO1A 2JI9A 1Y34E 3K94A 3TOZA 4P6VF 4RJJA 4G5OA 3WGVA 2H4JA 1QHSA 3I5MA 4ZT7A 5HE8A 4JFAA 2L0XA 4V0KA 1GZDA 3QMWA 4IXDA 1Y8CA 3LT1A 3R5XA 5LD2B 4K0RA 1NRJB 2OY0A 3GLFB 2JF0A 3UCFA 4DIKA 3TLAA 2HREA 5DM4A 1SELA 1Y5NA 3SEAA 5JC8A 1L1FA 4G37A 4DV0B 1UMDA 5CEJA 4NU6A 5BOVA 4BMNA 1JMYA 3KZNA 3LRTA 1AQLA 1Y1TA 4P54A 3C2QA 1AKWA 5EY5B 2XNDD 4JROA 4WBXC 2OMKA 2RIPA 1KBZA 3RKSA 5C52B 4IIVA 3WA6A 1U4OA 5KYUA 2CVZA 2JVIA 1ENYA 1XAHA 1ODSA 1OFGA 2H29A 3OCJA 1C3OB 1P2GA 3NJRA 4KR9A 4DNFA 4JLVA 1UIMA 2QZSA 4GWLA 1YZGA 5HWSA 4MVJG 3I72A 4UU1A 4L4YA 5KOJA 1AGNA 5BSUA 4ER0A 2YKGA 2P8SA 2YC2C 2ZYIA 3C6QA 4LOKA 3LPLA 4JA0A 1OMOA 5CA0A 3UPTA 4OGWA 2XUQA 4F6RB 3ZEAA 5G3YA 2UXDB 2YBDA 1JIKA 1LLCA 2VT3A 1KJIA 3EZFA 3SSMA 5A2GA 1NW3A 1UINA 2ADMA 1JQJC 3ENZA 2WBLC 2ZE7A 3E9QA 3PF9A 3QTTA 4RIEA 1F4PA 1N25A 2CWDA 4DWVA 4WZBA 3T3HA 2BL4A 1E4EA 5CNJA 2QP3A 1DHRA 3FROA 5TGDA 5B1EA 1KC3A 4QOHA 4RH0A 3F3SA 1LD3A 4V03A 3RJZA 1UFRA 3S27A 3PE4A 1DBWA 3TQSA 4F4UA 3MMZA 3PQDA 3IEMA 3ZGLA 4PFKA 5JSQA 5JZSA 3VBCA 4IZOA 4OHVA 5I9MA 4XDZA 4Q18A 2E4ZA 3F4LA 4CCYB 2O4CA 1D0IA 2AJ8A 1J5PA 4EMBA 4AJ2A 2DUMA 4F72A 5C8VA 5JEDA 4GQIA 1JG7A 3RO7A 1KDTA 1UOEA 1G5QA 2HQBA 2ZITA 4RDCA 2I7XA 3X1WA 2JIZA 3AYZB 4PCAA 2W2KA 3R7BA 2CFIA 2PXHA 1KRHA 4ZCTA 3PWZA 3S5UA 4BNNA 3HBNA 5I51A 3HMQA 2XE8A 2Y1XA 2R62A 2NSLA 2Z4TA 3FMOB 3QZUA 1Z06A 2EKPA 5LQKA 1P73A 1KH2A 3OTGA 2H1SA 2AOTB 3ROZA 1ICIA 1QJ4A 5BOSA 3L6OO 2QROA 1ZUHA 1SZJG 2P27A 2PY6A 2NSJA 4FE3A 2HA4A 2PQ2A 2WWXA 3Q1KA 4H3VA 1BE8A 3N9IA 1WZEA 1IXKA 1Z6ZA 3FPBA 1B8PA 4B8YA 4CLEA 1JTVA 3UXEA 1QIIA 2RKOA 3LXXA 3DBIA 3HB0A 3OQ6A 2E4AA 4IVNA 4C7MA 5BMOA 4YEDA 1THTA 4UXJA 3UT5B 1H9CA 5AM2A 2GKSA 3AP1A 4W1PA 2GJKA 1KMHB 2BI7A 4MTLA 3ZWVA 3Q5EA 5KB3A 5DM70 1K89A 5K6TA 4CTJA 3DZ8A 1VPWA 1QFMA 1OIXA 5EHNA 4OJQA 4AMVA 1ISMA 3FM9A 1TVMA 5AOVA 2A6PA 3CW8X 3SK0A 1ZMXA 2Q3HA 2Z2YA 2FUG1 3DLAA 2C4KA 3QVJA 5EJGA 2SHKA 5T7BA 1NUPA 5E8RA 4QGHA 2JANA 1S0UA 3A7EA 1FW6A 1GKUB 4J0HA 2REQB 3GUVA 1PKXA 1FB5A 5CNKA 3SXJA 4HGRA 1VA4A 2B30A 2WDPA 1ILWA 3ZY5A 4CEHA 2RG1A 4E5DA 2X3UA 4MPPA 2Q5FA 3OJCA 3DKIA 2C9DA 3P9ZA 3ZCXA 1WF3A 2QP4A 3VVMA 4CIXA 4QTUB 4QDUA 3L8MA 1PR6A 4O2BF 1AU9A 4LVUA 2WJWA 5CNMA 3I04A 4D4MA 2IYVA 4JNKA 4TWJA 5ADUS 1U3CA 2JGDB 2PJDA 4E13A 3AL0C 4C22A 1V4VA 4ZOCA 3W8NA 3CBGA 3WRXA 3FTEA 3TSWA 1SQ0A 3HFGA 2M32A 3GH3A 4CR8A 1XMQB 2FOLA 2Q1TA 4QPZA 2IHVA 2EFYA 5IEBA 5TQ0B 3ZQ4A 3V4LA 3CT4A 1KI4A 2VJQA 1JDBB 4OQLA 4BWGA 2VDQB 4FEGA 4DPKA 3BTVA 3QRWA 2GM5A 4I1UA 2OAEA 3UAXA 1S8FA 4DV3B 1MGOA 1UXGA 1TEVA 3THWB 3HN7A 1GTVA 4FU0A 3W3AH 1QIDA 4ESOA 2G70A 1BVYF 4K6CA 1ODFA 4PRYA 4G5FA 3KCNA 3D3NA 4JT9A 3CXRA 4GBED 2BH2A 1E5DA 3GP3A 1T9DA 1V6SA 1Q7RA 1NL3A 4ZVRA 1HDOA 4FFDA 1FDWA 2C5LA 4H3HB 2P4UA 2XZDA 4C4TA 1G3MA 1OFIA 2WRZA 4IXMA 3W77A 1TK9A 2Z6AA 4WCFC 4WKBA 2FEAA 3DF9A 3IT1A 3B3GA 2C99A 1XZHA 3ELBA 3E7FA 2C3UA 3EPRA 1TLTA 1UBTS 5FULA 1PG0A 2DBYA 2W00A 5GP1A 5BSVA 5FL3A 2E4UA 4K3VA 1Z7EA 2RK6A 3EGWA 2ZUDA 1PJTA 1RAAA 4KQ1A 4MQ6A 3H13A 3I37X 4ZDJA 2B8TA 2WHYA 1TFRA 5F12A 2ZRCA 3JQQA 4J6EA 1NJ1A 2GPYA 3VSBA 2DH6A 5MN4A 4JLWA 4WLOA 5JWOA 3EIHA 4JLMA 4QXRA 5C8DA 3GP5A 2GHRA 2E55A 1JI3A 1EJ6A 1RBYA 4QFDA 4LGVA 2F4NA 3EBPA 4JL8A 4B3MB 3ZCRA 1I7PA 2HNBA 2PFGA 2IV7A 3O92A 5CG2A 5GM1A 5AVZA 2I62A 1U8ZA 4I9GA 1ULTA 2HV8A 5B7GA 4NXMB 1X7ZB 2QX7A 3I1JA 5B3AA 2MSKA 5AKIA 4DDTA 3BWYA 2LIVA 4U7GA 1A71A 4YALA 4M2LA 4B2IA 1ZUD1 5A1JA 3N3AC 5IHPA 5E1MA 4YLYA 4YRSA 1PJSA 4GOLD 5CVJA 3AR4A 3VV3A 4ZQHA 2W5UA 3Q9SA 4HMPA 5AT1A 5B6IA 1P17A 3R5HA 4W1QA 1SUAA 3K30A 1I0IA 1NBHA 3MNFA 4XCVA 3T38A 3X2SA 1NRWA 5KTKA 1C1DA 2OXRA 4RM2A 3RFXA 2QUIA 3GDWA 3OCYA 3FLAA 2WWWA 4RMHA 2FSFA 2Q6KA 3ZDXB 4Q93A 3RNLA 3HDJA 1QYCA 2CVHA 1L7NA 3RTGA 3R7DA 4ZJYA 4QVGA 1IXSB 3BG5A 2Z9BA 5LQRA 4N8DA 1C3EA 3M49A 2VXBA 2JZCA 4IIGA 5REQB 1E59A 4G4SO 3TK1A 2O52A 3CJQA 5CK5A 4B87A 2GPSA 3AF5A 5ALFA 2KWIA 1T6ZA 2FZEA 1M2FA 3DCNA 2Y1CA 3K1TA 3KL2A 4NQZA 4KRYA 4ZYXA 1B1AA 1PFGA 2M9MA 3D7KA 3ORFA 1P61B 2C9CA 4M88A 4BNDB 2EJTA 3Q1LA 1LSUA 1MLDA 3IQZA 1UJ5A 5JSZB 2WP0A 721PA 2YHBA 2QVXX 3E2PA 3IHLA 1YS1X 3KKNA 2QJTA 3KR1A 3DAYA 4Q6BA 4X71A 2PS9A 3JAKB 3BC1A 1TO1E 4U2DA 3IXMA 4L50A 5EIBD 1DKNA 3EUAA 1XTSA 1BWSA 1YMVA 3A4MA 4BWVA 4YMTA 3ZDAA 4KR7A 4HGQA 1N8SA 1MB2A 2IPMA 1PWHA 3OT1B 4LYFA 1YDEA 4LHZA 4WZBB 3PTAA 4NDAA 2Q62A 4TSFA 3KZXA 2QRMA 4HNSA 3Q7TA 2B1RA 4FPXA 4UARA 4D8TA 2VK2A 1W4LA 1ECBA 3PFIA 5T57A 3W5UA 3TW8A 4ISCA 5IABA 1SG6A 2PAFA 2IYOA 2OV6A 4I08A 1QIKA 3M83A 5MGBA 3ZQJA 4KQMA 4CIBA 1JQEA 1CNMA 1XNHA 3QUBA 4R31A 5HIKA 2Q5LA 2DR2A 1LPNA 1KI7A 2RGXA 3MW8A 2P0YA 3U44A 4MUJA 3GXOA 3W3AD 3GA7A 1FVXA 1UBMS 2WNSA 5SY6A 3K0FA 1O2DA 3C0KA 3GLRA 3WJ1A 5CBKA 1NG9A 3KUDA 4DUYB 1GXSA 2WZQA 3BB3A 3ESCA 3SJ7A 2C58A 3GX1A 4C7KA 1PTJC 2IXDA 1XEAA 2PGJA 2OBBA 4ZVVA 2QAIA 1XZNA 4YCJA 2J7KA 4EGQA 4UJ3A 4BQIA 4TLBA 2XNKA 3RODA 2C2YA 3ENNA 3OCVA 3L40A 3WB9A 4DSUA 1BH6A 1AGPA 1VOTA 1C1XB 1W0JA 2WF5A 4H4CA 4WL0A 1MT3A 3K0EA 1K7FB 3SSNA 3THSA 2R2AA 3SU8A 3KCQA 3MERA 2ZWOA 4UM7A 5HF8A 1JHQA 1JHPA 3BWXA 3GJ0A 3FSJX 4GM1A 4NHEA 2FOXA 4D79A 4GLOA 4ZU6X 4F0JA 1YA6A 4BNXA 2GXAA 3TM5A 3DQZA 1KETA 1SCUA 5A4DA 1M2VA 4LI3X 2X6QA 1T34A 1X1DA 3MUOA 4PRKA 3UZUA 1GNRA 2ZK7A 1G5TA 2XOXA 3QNWA 4D8WA 5BNFA 3D0OA 3WL5A 2NOAA 5KYWA 3DXYA 3QF7A 1K88A 1GUFA 3SHVA 1Z39A 3SHWA 4LPKA 4JJFA 2YZKA 4D9JA 4QGAA 1XDSA 4JELA 1T3HA 1V9CA 2F3UA 1JFRA 1G7RA 2HK9A 2OBFA 4HLCA 4NYIR 1KF0A 2Q2VA 4II3A 4WCFB 2QMUA 3RS7A 1M2GA 2AG6A 1ZNZA 4YROA 4WE3A 3LL4A 5JAQA 4KYUA 3ZCSA 5AM3A 2HU7A 3ZVNA 1OH7A 1R50A 5THKA 3LHKA 3RADC 3QYPA 1GNVA 4Y9DA 3FDIA 4CEJB 2N75A 3V7UA 3C3PA 4JP3A 4RWZA 5IC5A 4P80A 3BGOS 1KHHA 3GZTB 2Q29A 4ZWNA 2HBZA 3IULA 4HUJA 3W5HA 5LFAA 4ARVA 3LX6A 5I45A 2DJ5A 3KFLA 2IE8A 5DDIP 2JI6A 3KYCB 1UJCA 4KV7A 1ISRA 3RS0A 2OOSA 3QVGB 5LP6B 2OUIA 1G7SA 3VQTA 2D00A 3OM1A 2O3JA 1PJZA 2BF7A 3OFNA 5AKKA 3B3QA 4GRDA 4J0IA 1EXMA 2Z3WA 3IO5A 2GJAA 3LUDA 4KUEA 2Z95A 3QVXA 3LBAA 1XAJA 1AK2A 5ILGA 3N0WA 2VCHA 3AESA 4G09A 4HY3A 4BLUA 3OZRA 2Y2VA 4CDRA 5EIHA 5KS2A 1SULA 2LV8A 3EZ6A 4QA9A 2F48A 3UUWA 5JADA 4EJMA 2VJKA 3MWDB 1GYRA 2J4FA 4JP2A 4ZMBA 4Q0MA 5JNSA 1QHEA 2L2QA 1PR4A 3EMKA 3MINB 4MVXA 1JT9A 1E6KA 3NWBA 1MQ9A 3KWLA 1F1BA 3GELA 1M5RA 3OFVA 1P8AA 5DX0A 1VJTA 2FHSA 3EXEA 3BSWA 5AVSA 1GZ5A 4NCNA 3OJ0A 2HZ7A 4NR0A 4ALKA 1KDRA 4XXHA 3N0RA 4IS3A 4JT8A 3OP1A 1KY4A 4M9ZA 3WK5A 4MVJI 2AW5A 2RCYA 3DDUA 4RKFA 2ZYRA 5A0FA 4BGEA 3ONDA 4D8YA 4B5KA 4CDGA 3PL1A 4N9WA 4POOA 2WK1A 3EA4A 3TB4A 3Q3CA 4EA9A 1UEXC 3LECA 4FI3C 4YS6A 4PYJA 1P7VA 2QL6A 2JKYA 4TT3D 2FPOA 1QGOA 2W2LD 4BX2A 5BUSA 2BN4A 2QRJA 2YJ3A 5DXJA 3M5WA 1XL0A 1GPWB 3NH6A 3WGUA 2QSZA 3GGGA 3GCDA 4KGXA 3OF5A 3EQ6A 2DCMA 2VBGA 2IH5A 2DKFA 4N39A 2WJIA 5EIAA 3U4CA 4TMYA 3ZXIA 3NBQA 4X45A 5CXQA 1HE2A 1OKKA 2ID4A 3ASYA 4RX1A 1Y8QB 3SHTA 3UBMA 1NY5A 1WUHS 3NP7A 4HWRA 1H2RS 4X1YA 4FMDB 2WM3A 3DG9A 2QXUA 3QE0A 2YS6A 4PQYA 3ZY4A 3GHHA 4KE6A 5DW0A 3A1FA 3R7SA 4AF7A 2H2WA 4EW2A 1B6SA 2C2XA 3A70A 4Y7DA 1Z45A 1P2DA 3TQIA 1QP8A 1A69A 1NDUA 1M2NA 1Y1SA 3PR3A 2HA2A 3L8CA 4EUEA 3HU1A 4R3WA 1XCMA 3TDKA 3TSAA 5IP5A 1WD5A 3WO1A 3DVSX 1G59A 3MTDA 1Z73A 2A0KA 1AQJA 3DDHA 5EZYB 5IM5A 4IJUA 2A9RA 1GPBA 2CJFA 3DEKA 4L2IA 5BW8A 1SVKA 2FW6A 4XGIA 4BXOA 1UKYA 1WKBA 2CVPA 4F71A 4E22A 4HCJA 2AS0A 3GGCA 3H9GA 4E7OA 3FE2A 2D54A 4FZJA 1GCAA 3UHFA 3VMMA 5KOJB 2AN3A 1YQXA 2H16A 2RI0A 3BSYA 3NHRA 2G80A 3KFXA 4LAFA 2ODQA 3U56A 2OMEA 3PUWA 1XMSA 2AG8A 2OBXA 3M5CA 5IJ9B 5BP7A 2H2DA 5JXIA 1ZG3A 3HZRA 2XWPA 4FFRA 3EQ9A 1XZEA 2O1EA 2IU0A 3SQNA 1JTEA 2ORIA 3WMWA 4KQ6A 5BWBA 3FWNA 5IDQA 2ZI9A 2HRRA 1EM6A 4EHKA 3SNHA 4RDIA 1OFTA 1E6MA 2PRKA 5HZHA 4FIDA 1XTIA 3GGOA 5KVVA 3ZBPA 3QWBA 1JB9A 3IJRA 3D1JA 3MT0A 1G4AE 1K5HA 5IXYA 1ORDA 2I8CA 2JBAA 2WHXA 2BE7A 3AP2A 2BM9A 4LHYA 5JFOA 2CDNA 2XCOA 1NX6A 3BRSA 3K0AA 1N2CE 2QT9A 1SBNE 2VDWA 2RKBA 3N2EA 2FPUA 1PGQA 3ED5A 4L15A 4EFMA 4LJKA 4C3VA 4HQFA 4E46A 3SZOA 3ETJA 3LC0A 3Q15C 3P5BA 4QOEA 5BV0A 2ZI6A 1XZLA 3AOGA 5I8PA 2W4QA 4JI4B 3OVMA 4L4SA 2XWQA 4MKIA 3K0KA 3QHQA 3MRSA 3FSGA 4NS1A 4OJKA 3K92A 4IHJF 4GKVA 4ZVSA 5C8YB 1OREA 4ZCLA 2PUFA 3HU3A 3CQ9A 5AI0A 4DJ5X 4M9SA 3OKAA 5K8TA 5JD5A 1CJCA 4I3HA 1N1EA 3MN1A 4I0WB 4OK6A 3LPDA 1SJ9A 3CW2A 3GNQA 4JR2A 4DMMA 3LGAA 1T13A 3PJFA 1N33B 3IV7A 1JPJA 4GVLA 3TZHA 1SH7A 4LC9A 2HXYA 1P9NA 2J48A 3LY5A 3EC1A 3QXSA 4D43A 4YRMA 5GM2A 3BDAA 1SUEA 3NBYC 3ZWNA 3L0YA 4IHKA 1EQAA 1OQAA 2IZ7A 3E3NA 1LA2A 1B0ZA 3BE8A 3U7GA 1P2SA 4XJTA 1BE1A 3CNEA 3LUKA 4CQNA 2QTFA 4IIHA 1J5EB 1YRAA 2JFYA 2PJUA 4ZU3A 9MHTA 4Q1DA 1RFLA 1KY5A 3JVDA 4MPRA 4RJIA 4EVQA 4PQRA 1JG6A 1TYCA 1W4ZA 4WIAA 3G8BA 4BMXA 3CZ5A 3RSSA 4WK2B 1RKBA 1R6BX 1A76A 3B6ZA 3CG4A 4YDSA 3N05A 1AKYA 4GC9A 5ALTA 1YKGA 4WDQA 1NJGA 4QUBA 4LJ7A 4Z4HA 1C0KA 3CMMA 1YTUA 2D74A 2GZAA 3KPYA 2ZQYA 3NR2A 3PRJA 2AQIA 4JBNA 1ST2A 2MOKA 3HADA 3HKDA 4S1VA 4E14A 5FLXA 4URUR 1KO4A 1BH2A 1U28A 4P2GA 5AKLA 3ZI4A 1KARA 1ZN7A 2ZRQA 3LZDA 4CLRA 3C5VA 3LUJA 1R5OA 2C4UA 2QN3A 2IGBA 3WR5A 1QF7A 2CNWD 2GPWA 2I8LA 2VKTA 5C5DA 3WLMA 2DQZA 5CVTA 2ZRAA 1XALA 4JLUA 5AJYA 4MJ7A 3THRA 4AXXA 4F3NA 5EIXA 1NDHA 2UV8A 1Y37A 4ARZA 1OTHA 1RPNA 2WKRA 4XKJA 1KVQA 1QHXA 4MI9A 4MCHA 3SZRA 2ZWAA 1FFEA 2BFDA 3HV0A 1DJQA 3R41A 4HEJA 1XZMA 2VJCA 4MB6A 4TWAA 3UNXA 5IYZB 4FD2A 2X1HA 1M0TA 3B7PA 1PNTA 4GYYA 4LUCA 4V2IA 1ZD5A 1ZHOA 1TZKA 1N0WA 2Z2XA 5DGDA 1JUDA 4ZCMA 4AJ9A 4NK4A 4P3YA 1NATA 1KEWA 1RLUA 4DA0A 2VYVD 1C3JA 4FUTA 1T1GA 3WLKX 3AERA 4QL3A 4DQKA 1M34B 4FLMA 2H7CA 3VU1A 1BHQ1 2ZJ5A 3H2SA 4H6PA 3RS3A 2XT6A 1U6IA 1GNLA 2EIHA 2M1XA 5MN5A 2WUFA 4NARA 5BMVB 4PLZA 5JJBA 4X66B 4WESA 1EEXB 1EJBA 3TW4A 3L7KA 2VF8A 1IG0A 4OATA 1PR3A 4UNPA 2I6GA 2P4SA 5CGZA 2FW7A 1JIJA 1RKQA 3EMDA 4S2EA 1JVNA 1L4MA 2V7PA 1A9RA 3I1FA 2OVFA 3RRFA 4F5ZA 2BBSA 1QE5A 2P77A 2R8XA 2ST1A 2X9VA 4NJEB 5J47A 1GTMA 3TL3A 2VDOB 1MB3A 2XEXA 3LWBA 4PAMA 2WU4A 4B3HA 4CNBA 4MUKA 4LHVA 1EUCA 4OB8A 4RULA 1UPUA 5EJ7A 2YHAA 1FU8A 2AHOA 2WFZA 4KXFB 5KSPA 4KGDA 3W34A 3LGXA 4XJXA 5I9IA 5LSAA 5P8WA 4LF9B 5BWNA 2Q5OA 5CYOA 1SPXA 4TYMA 4YJ3F 2VWHA 2FZCA 2JBHA 1XG5A 3ILVA 5EQTA 4YRPA 1YBAA 4D4IA 4ZVNA 2QJWA 5HZGA 4CFZA 1CJTC 4M0DA 3LIIA 4JAVC 4TS9A 5EUMA 1SKMA 5HMMA 1FW8A 1H22A 1QQ7A 1T8PA 4CETA 1YHNA 3RFVA 2XNHA 1QS0B 3B1XA 2PD3A 4GZ6A 1E61A 2G82A 2HFKA 1JEOA 3M6AA 1QU3A 2Y6VA 5E7JA 5G0TA 4TXMA 3N07A 4F38A 4GYWA 4COOA 5BN1A 3A36A 3RRNA 4EI7A 5LU8A 1HE4A 3O94A 3OHSX 3QVSA 5JS2A 2XJ4A 1XNQB 1AF4A 3KYCA 5EJ5A 3P2EA 5DGHA 3NTUA 2XX3A 4B3IA 2V6GA 1O96A 2XUOA 3FNFA 3W8DA 2ZSKA 4Q6WA 2E4WA 3FYUC 4G1MB 4UTOA 3S2ZA 2V6IA 2CXXA 2Q7XA 3WNDA 5KX5F 3KSBC 1AK9A 1E58A 3AESB 3FPAA 2ZM5A 2B5OA 2ZPTX 5ARCA 2HF8A 1KJQA 2NW6A 1GTZA 2V5UA 2WW8A 2QX6A 1G21A 3GQBB 4TMTA 2DPXA 2LP4Y 3JPWA 4XE5A 3UMSA 1ZVVA 2WVHA 3COSA 3WSTA 1HOTA 10MHA 4XWAA 4PO8A 5C34B 1PT6A 4NK5A 3TMKA 1YBFA 3FR7A 3RYCA 1O6CA 1R00A 5AKHA 3QV1A 1DAHA 3LCCA 2FJPA 4TWBA 2HC9A 5TE9A 1XXHB 4JVNA 5JBQA 3GAFA 2D5IA 3I32A 4BLVA 3E9ZA 4R0NA 4Z2YA 1H8ED 5CM2Z 3NORA 4HNAB 1WPQA 3GNSA 1CUZA 3QUCA 4BGVA 3IJEB 5JHGB 1PK8A 4FEYA 3IE1A 2NXEA 4YUVA 1HQDA 2CXTA 2LCIA 3KDPA 3SAJA 3RVRA 3RDPA 3WRVA 4AY3A 1O0SA 3NAQA 3PENA 2KM1A 3CUSA 5JMPA 3ZHTA 4V0ME 2Z8ZA 4KIWA 4YONB 4QYMA 2YFYA 4BV8A 3G7SA 3B9BA 1XP5A 1ES9A 1MMFB 2ETVA 3I3SR 2G83A 3TR5A 2HPZA 3LKBA 2CV1A 1UBCA 1AUXA 3H1EA 1RYZA 2GAJA 1SHLA 1TM2A 2AR7A 3LX8A 2PH5A 3NONA 2Q28A 3JQFC 5I4BA 3UAVA 2BSXA 3R7NA 4GGPA 4QU0A 1RU3A 5B4TA 3EVBA 3CE9A 4X6UA 5B1IA 1VCIA 2CLKB 5GINE 5FJJA 5DMXA 121PA 1C9MA 2NU9A 1RQPA 4M8LA 5B37A 3OJWA 1AA6A 3MSCA 2Z1MA 1IHYA 5LA6B 3ENVA 1GPLA 4PLHA 3QEKA 4E03A 2WQ7A 1N6KA 3U3XA 2R6JA 3CLVA 2GEFA 3K8ZA 4MITA 4P4NA 4KL8S 1NBMD 1GZ7A 2HOQA 5BW6B 3SJAA 4KFRA 3TDMA 1U0HC 5E9JA 3P2MA 4GUAA 1OAOC 3PFWO 1CNFA 3ZJVA 3DV9A 2GARA 1RLIA 3F97A 3RUHA 3USZA 4O4IA 2P7HA 4F5EA 2B4RO 1H66A 5CVEA 2HIGA 2R5WA 1UCFA 2XTMA 2C4VA 1BKSB 3Q85A 1U9IA 1CF4A 1P77A 1HTTA 4XDGA 4PF1A 2GZMA 1VE9A 1RWVA 2ZZKA 2PX8A 2QTZA 2NXNA 3ZHXA 5C81A 1IZ0A 1PT7A 3QKSA 4MGIR 4B82A 2HUPA 2Z0MA 4TV8A 1I2AA 2WSSD 2OHIA 3HM2A 1BFKA 4OI2A 3HCWA 4PZYA 3M82A 1N5JA 3NTLA 4QOGA 1Y4ZA 2PM8A 1BX1A 3IGFA 4MR8B 3TYXA 2PWPA 1QCDA 4GYJA 2NNWB 3V4ZA 2QLJA 3G5MA 3KUKA 5FHQA 1SB8A 4NHOA 4CR7A 1Z2DA 3EGDA 4INZA 3LSTA 3O8QA 3AHJA 1E1QD 2IRWA 1LBEA 1CUVA 3Q5GA 4JYPA 4QXPA 5AJTA 4K7JA 5MF6A 3L8EA 3E3OA 2PNJA 2WAOA 2LRHA 3HXKA 2P41A 3D5TA 2GZSA 2J5KA 1H9BA 4HYEA 1GY8A 2YWFA 7REQB 1CR4A 1TCVA 1OE0A 3G68A 3SICE 3ER9A 1JJAA 3M4JA 3PDIB 3MGGA 2ODNA 3AX6A 3L82B 3R4CA 3KC2A 1R16A 2W93A 5AYVA 3NHLA 2REXB 5CXSA 2W43A 1Z35A 3DQPA 1KAGA 3W9BA 1JKIA 2IEAA 4PAOA 3SDSA 1JJIA 4EJ0A 4NKRA 4RTRA 5LWQA 3DS8A 3H83A 3Q6IA 4Q12A 5HIMA 3UJCA 1FQJA 4GO1A 5AQ1A 3NHJA 1AMUA 3OTOB 1PS8A 3IKMB 3EPLA 4MVWA 4ZVKA 5I9TA 4Y2XA 3SLKA 1U2TA 1Z4LA 3E8XA 4OPMA 2Y1KA 4MCAA 5D7BA 1GITA 5JQGA 4JYZA 1KYYA 3QFSA 2FR8C 2CBXA 1F60A 2ZATA 3L7BA 1AB5A 1VLHA 1CEEA 1HQCA 1U1FA 4Z86A 4M9CA 2UZAA 2B36A 1GD1O 1SXJC 2HU8A 4PU0A 3TX2A 4I50A 2V5VA 4P0QB 2XTAA 3PXGA 2QN1A 3KJQA 1LWNA 4OREX 4DC1A 1NLYA 3WGKA 1ESCA 1UADA 3WA7A 2L19A 4KQKA 1YZYA 2C8VA 5EIFA 2W7TA 2C3MA 1CY7A 4CT5A 2IU3A 3WWPA 4KRXA 3DE7X 3Q3JB 1J5XA 2HPHA 4TT8A 3EGXA 4ODIA 1UXJA 1M6NA 1UBHS 2O2YA 1HRDA 3EXG2 1U6KA 3ZBUA 3JVUA 1QLJA 5CHEA 4D4HA 3L6UA 3PXAA 3V8QA 1D8TA 1Y7LA 4GBJA 1CQXA 1UBSB 2AIRA 2RJ3A 5E6RB 1KK1A 3ENWA 1IXYA 3TUJC 2BEUA 1LS6A 4B85A 1YB7A 2G09A 5DO9A 1NXVA 2JEZA 3CGGA 3VO8A 3IRVA 2NPIA 3CNNA 3WV4A 5KYUB 4N3GA 2IX9A 4DMHA 3EQ2A 5A0TA 2DR3A 3KALA 4TS1A 5CVVA 3O82A 1TK2A 3FLEA 3BX1A 2B8EA 3GMIA 1IJKA 3D64A 4G86A 4RFVA 4BO4A 1ZRMA 1GJRA 5L4LA 1GGMA 4DEVA 2OCLA 3FUVA 4GEKA 4Q3CA 1COWD 3AF2A 5KQMA 1UEJA 2ODWA 3L7DA 1ATZA 4PZDA 4D92A 5I9BA 1A9XA 3W7VA 2GT1A 1Q3KA 2A14A 2VOJA 1C8LA 3H7AA 1R15A 1SN7A 1SCIA 3LA6A 1T8RA 3AEUA 5EWLB 5BRNA 1YZHA 5EKXA 3OUZA 5DHPA 3NATA 1P3JA 4CM1A 4AUMA 1H4TA 3TW0A 4NNJA 2A84A 1CY6A 2WD9A 3AG5A 3TBKA 4URZR 3S68A 2C4NA 1YMQA 4G8BA 5EC8A 2DWCA 5I7HA 1P72A 4I19A 3BHJA 1NN5A 3R75A 3ZCTA 3K0SA 3WQHA 5LDHA 1U0SY 4CU5A 1JFVA 1YQDA 1LDEA 5AXAA 3C7CB 3OFND 1H1DA 3SC3A 1H2YA 1MVLA 1PQ4A 3B1FA 1B74A 3BCSA 4UCQA 2D8AA 2FPKA 3RF7A 3PHJA 2IBMA 3O3CA 4Z3KA 5JYCA 3V4RA 1GPMA 2YWXA 3NM5A 3ODGA 3OOSA 5BYJA 3W5BA 2IEIA 3OC6A 2I1VB 3Q9NA 4X3PA 3I2JA 1C0EA 1FY2A 3SVTA 4X5OA 2GD0A 4CTKA 4W9MC 4CKCB 2NYUA 4R7ZA 4UBLA 2CSUA 4DCMA 3E7XA 4IHQA 5H83A 2V4MA 1UJMA 3K15A 3L8HA 4B74A 1ZQ1A 2E4VA 1P2BA 3KG2A 3FOCA 3R09A 4K9RA 4RCZA 5K0SA 4LF6B 3A32A 1TVCA 1FFSA 4HQLA 4PZ9A 4UEJA 3UHAA 5JECA 1A50B 5I5GA 3EGIA 3T9CA 3HH8A 3N8NA 5B2ZA 2QTBA 3ZCQA 3JQAA 2VDKB 3WBJA 4EG3A 5JROA 4Z0NA 4IH4A 1OWOA 2D2EA 4J4HA 4ZHQB 3D7NA 2BEWA 5L6MB 3DYVA 3U3RA 5HJ2A 1HZZC 3S2IA 1QPGA 2ZSFA 1J70A 2JK1A 1KYVA 1TUGA 2BDTA 3O2SB 4P08A 5E1DA 3UV7A 3P9SA 4BB5A 3TFOA 4LOAA 1SHZA 1JDBC 1RKUA 1T4CA 3KKOA 5LU9A 3KYDB 3B36A 2BR5A 5T4HA 2D8MA 1V26A 4D2IA 2RH4A 3DDOA 5JD4A 1KEZA 4PX3A 2ORYA 4A2WA 3EDRA 1I9CA 4R2JA 2HQ1A 5I3CA 1T9HA 2OZLB 4EO7A 3QPBA 2EL7A 2I2CA 3HUFA 1SU6A 5IK2A 1E0KA 1V3VA 3D8TA 2ZGVA 4EZBA 3SQDA 1HK7A 2MINA 2YXEA 2H6EA 3ND5A 2J3IA 4HDOB 2Y0PA 4CV2A 2PCJA 4QTTB 3IEIA 2PD4A 3GLUA 1XA0A 1TM3E 1RCUA 1VBMA 3AGQA 1XRMA 4W82A 4MW5A 5J2UF 3QA9A 4JIGA 2CZCA 3QLUC 1KIAA 4EB6A 1CZKA 4HDRB 5E8JA 1RWWA 1TA4A 5DU2A 3FOFC 4WFKA 5F5XA 5GADl 1VDZA 1BE0A 4CODB 1M75A 1R4MA 1TW3A 1YUBA 1LPSA 4XX0B 4LFAB 1X42A 1ZESA 1EUZA 2JJYA 5CUQA 2J9FA 5AJVB 2CW5A 1GAJA 1XKXA 2CJXA 1F2UA 2PD6A 5EQDA 3ZK8A 4BC1A 1ODJA 3OZTA 3GJ5A 5I8WA 1RYYA 1D09A 3B1VA 2R60A 4PM4A 4W9RA 3S2EA 4EKEA 5BVHB 3I92A 2VK1A 4KNVA 4Q7QA 3WYCA 5A04A 5IVHA 3O8QB 3OCUA 3QU7A 1K6EA 4D9KA 1ZY2A 1L2TA 1ADJA 3EE6A 4O25A 4PZEA 3TL6A 1CR0A 2GKOA 3BYZA 1ZR2A 1NHGA 2K4MA 4RAQA 5I01A 2XB8A 1DC3A 1F5NA 2QMHA 4NEQA 1KYZA 4D99A 1OH5A 1R9GA 3JARB 5LB2A 3RVBA 4KMSA 4EQ6B 2HF7A 3TIFA 4Y1RA 1QO0A 3KETA 3IB3A 1KR5A 3BE4A 3LKVA 2WZDA 3L0SA 1XE3A 2BZ1A 2IBSA 4WK4B 4OY3A 4ZZ0A 2QR5A 1WCV1 3F5SA 4HWGA 3DMRA 4WBNF 4ZOLF 3GXBA 3N74A 2QW1A 2Z9CA 1U9JA 2ZG6A 1FMLA 1K63A 5KYVA 4Y2SA 2PZKA 3U7FB 1LI5A 5T64A 1TU0A 3LS2A 5K8CA 5EQJB 5EJIA 1WSWA 2A9JA 1C7QA 2HMSA 3CUEF 1M1NA 3UW3A 3CNBA 4I4LA 4DR7B 1JAYA 3RREA 3JQ9A 4LV5B 4YCMA 4PINA 4RUKA 1I14A 3IR6A 4AMZA 2NU9B 4YAWA 1NQWA 2IZ5A 1H0HA 3JZIA 4LDQA 3OEHD 4TKZA 1KOLA 1WX1A 3MA0A 1E3QA 3JQAD 3GMTA 2YOGA 3T94A 1L7PA 1II9A 2WV7A 4JLDA 2PL1A 2E87A 5KYXA 4R6WA 1LCIA 1Q7GA 2YRWA 3QVTA 3GJXC 2POCA 2VF5X 4JC5A 3ZKWB 3LBYA 2BGWA 2O3SA 1ZIDA 2UUOA 1N2BA 2D3TA 3KOYA 2QUZA 4PY2A 5K3AA 4ZYWA 1YVPA 1PNVA 2C7BA 1FRVA 3LQYA 4ZREA 5T6BA 1U0BB 4Z1MD 1MAVA 3M8KA 2QTVB 5FNVB 1DAEA 3ENKA 1Z4IA 3PHCA 3VUFA 2QT0A 1P6QA 3KQTA 1FRZA 4HS9A 3EOAI 3F5FA 3U7JA 1W93A 1ZH6A 2A5LA 2VUIB 3KQUA 5A4MS 2B3TA 3ICCA 1YU9A 2CXUA 3P2JA 5L45A 3B2NA 3KO8A 4PXYA 4V1CA 5JBIA 1NVKA 4O4HF 2PX5A 1BJKA 4KXVA 5CDGA 2FH5B 2ORED 1XZJA 3LIPA 4J0FA 3T7SA 3LP5A 4L4RA 1Z8NA 2I33A 3H1PA 4FXPA 4Q4JA 3MD0A 3OTHA 1K7CA 2F62A 2UKDA 4BTLA 3G82C 1BROA 3WYEA 2BYTA 3MYRA 3DFFA 2VRBA 5D5PA 1W73A 5F98A 3BD6A