2VDVE

Structure of trm8, m7g methylation enzyme
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
227
structure length
216
Chain Sequence
NPFSDHQLEYPVSPQDMDWSKLYPYYKNQMTKKVTIADIGCGFGGLMIDLSPAFPEDLILGMEIRVQVTNYVEDRIIALRNNTSKHGFQNINVLRGNAMKFLPNFFEKGQLSKMFFCFPDPHKARIITNTLLSEYAYVLKEGGVVYTITDVKDLHEWMVKHLEEHPLFERLSKEWEENDECVKIMRNATEEGKKVERKKGDKFVACFTRLPTPAIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRNA (GUANINE-N(7)-)-METHYLTRANSFERASE
publication title Structure of the Yeast tRNA M7G Methylation Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 62
structure length 216
sequence length 227
chains with identical sequence F
ec nomenclature ec 2.1.1.33: tRNA (guanine(46)-N(7))-methyltransferase.
pdb deposition date 2007-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02390 Methyltransf_4 Putative methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2vdvE01
3KQPA 5ICFA 5EMKA 3VC2A 2HMYB 3LPMA 3ER8A 3LDFA 2AN4A 3B7PA 4YV2A 3FYDA 3IV6A 4PINA 4PYOA 2QY6A 1FP1D 5EKXA 1Q0SA 3LECA 3ME5A 3OZSA 4YMGA 1SUIA 3G5TA 5HZMA 4MWZA 10MHA 2Z6AA 5BXYA 2G71A 3T7SA 3VYWA 4RVDA 2YUIA 1DL5A 5KVAA 4OA5A 4X41A 3P9NA 1KYWA 4UOEA 1NV8A 5U4XA 1BC5A 3HEMA 2IGTA 1EAMA 2ZIFA 1D2HA 1G55A 2G8NA 4R8SA 5F2OA 4YV1A 4IV8A 5E9QA 2AN3A 1JR4A 3GRZA 2NXEA 3H2BA 3SX0A 2HR1A 3FYCA 4A6DA 2ZZKA 2ZTHA 2EJTA 3UWPA 3LCCA 1NW5A 5GOZA 3G7UA 2PXXA 1PRYA 3CC8A 3FUVA 5E1BA 3KR2A 4MTLA 4RTRA 2AOTB 3Q87B 4PGHA 3NDIA 3FPFA 5CVUA 3NJRA 3SMQA 4GUAA 5BW5A 4P7FA 1G6Q1 1NW6A 4PWYA 3KPYA 4QDKA 4R6XA 3GCZA 3DP7A 5EPEA 3TFWA 3PT9A 3JWGA 5DRYA 4B17A 3E05A 5DSXA 2PX5A 5EHGA 3LSTA 3R24A 4YUVA 5HIJA 1I1NA 4PCLA 5FUBA 3TM4A 3TQSA 2ZCJA 2FYTA 5CVJA 1NV9A 1KYZA 2VS1A 2ZVJA 3MERA 4PYNA 2JG3A 5E9JA 1FPQA 3FTEA 2ERCA 5FA8A 5JR3A 2IP2A 2QE6A 4YUZA 2XYRA 1L9KA 1EQAA 4MQ4A 5P8WA 4L7VA 5CIYA 5E8RA 3C0KA 1XDZA 1ZGJA 1B42A 3EVBA 1X1BA 1G8SA 5K03A 2VZ9A 3K0BA 5C1IA 2XYQA 4RTKA 3M6UA 1YFJA 4O29A 1AV6A 3DULA 2PT9A 3NVMB 3PVCA 1RJFA 4KDRA 4RTOA 4OX9Y 2IH5A 4RVFA 1R18A 1WXWA 1KHHA 2EJUA 2PKWA 3G5LA 1YB2A 3GRRA 3UA4A 3G2QA 3ORHA 4CTJA 1NE2A 3L8DA 2P41A 5DM0A 3UJBA 4FT2A 1SQFA 2CMHA 2PV0A 2ZSUA 3CBGA 3HA7A 4E32A 2DPMA 1O9HA 4F84A 3ERCA 1FBNA 2ZW9A 3V8VA 4M37A 3KQTA 4BLVA 3CGGA 3LBYA 2BM8A 3MAGA 4OQEA 3E7PA 2PWPA 1O54A 1R6AA 4RVGA 3K6RA 3MTEA 1NBIA 1YZHA 3GGDA 3JWIA 3RODA 2I7CA 3DLIA 3MCTA 8MHTA 4U7TB 4HRAA 2ZULA 3FPEA 2PX4A 4PYLA 3KQQA 2A14A 3JWJA 1WY7A 4H0NA 4KIFA 1NBHA 3DMFA 3UJ6A 1BKYA 2GPYA 3KQMA 5DM2A 3G2MA 3TM5A 4KWCA 3KQSA 1ORIA 1X1DA 4XUDA 1FP2A 3NDJA 3P8ZA 3DXYA 3GIWA 3RW9A 5KQSA 5GM2A 3HVIA 4AUKA 1JG4A 2P3QA 1AQJA 5KYGA 1WS6A 3LX6A 2JHPA 3GXOA 4HGZA 3OZTA 5HFJA 1JG3A 2PY6A 3P2IA 4PYJA 3TLJA 2GA9A 1KIAA 2OKCA 3M4XA 3CKKA 4ER0A 4RSRA 5M5BA 2ONZA 3KPJA 2XVAA 4AZVA 1N2XA 4Z2YA 3P71T 2PWYA 4C04A 3GNLA 1VIDA 2PSSA 3UBTA 3NMUF 4FSDA 4C07A 3P2KA 1ZQ9A 3R3HA 4ZTBA 2ESRA 2VP3A 1RI5A 2AVNA 2PGXA 3KU1A 1M6EX 1P91A 1QZZA 2NYUA 1YZ3A 2BZGA 5K05A 4V0QA 3UZUA 3I58A 3DR5A 3BXOA 3R0QA 1VP9A 4PONA 2AOUB 2P1DA 4QPPA 3UJ8A 2H00A 3TPZA 5KQRA 1MHTA 3FUTA 3C6MA 3MTIA 2C7PA 3EEOA 1R00A 4GQBA 5GIPE 5EIWA 4G56A 2YXLA 3U81A 5ICCA 4C06A 5EG5A 5ICEA 5DPMA 1MJFA 3IEIA 1NW7A 3KQYA 2E5WA 1G60A 4QVGA 3GJYA 2NXCA 4QPNA 2ZIEA 5K01A 1P39A 3LGAA 3FRHA 3LDGA 4KW7A 2YVLA 4F86A 3GRUA 5K09A 2UZ4A 4HH4A 1UIRA 3Q7EA 2R6ZA 2HNKA 3AJDA 4DCGA 3DOUA 2AOWA 3BUSA 4DZRA 3UJCA 3OFJA 2OBFA 4K6MA 3M33A 4PYKA 5DXJA 4GOOD 1AQIA 3TKYA 5F2NA 3T7TA 3DXZA 4X60A 3C3PA 1AF7A 3ELUA 3SR4A 1HNNA 1KPGA 3LCVB 4YUWA 5EKUA 2YTZA 2P35A 4YV0A 3HTXA 1P1CA 3F4KA 1Q0TA 1ZKDA 2YX1A 3ID6C 4FT4A 5D1NA 2IDJA 5K0GA 3LKDA 3SSOA 1X19A 3LCUA 2OO3A 1Z3CA 1RJDA 4QVKA 3LBFA 5HILA 5HIMA 1UFKA 3BKWA 3PX3A 2JH9A 5EZSA 2ZWVA 4EMSA 1VL5A 3S68A 2C7RA 2H11A 3EVCA 5LQAA 3NVKI 1RI4A 4GBED 4PIPA 2VDUE 2ZZMA 3HA5A 2GB4A 1G8AA 4FSXA 3BKXA 3KQOA 5E1MA 2PBFA 3KPVA 5EIFA 4BP1A 5LQCA 4OBXA 5CCBA 2LD4A 3E23A 4M7RA 4MIKA 1Y8CA 1QAOA 5T6BA 5LR6A 1SKMA 2OXTA 2IDKA 2PXCA 1RI3A 4YUYA 5CD1A 2BR3A 3VC1A 5HIKA 1FJXA 3EVEA 4HG2A 3OFKA 4U7PB 3HCDA 5K0EA 2FPOA 3PFHA 3HM2A 3O31A 1RI2A 3G8BA 5FWDA 4OQDA 4KDCA 2OY0A 2QM3A 3TOSA 4ISCA 4HTFA 2AN5A 5DLYA 4RTSA 3TR6A 5LQJA 4C05A 1IXKA 3FUUA 1ZGAA 4R6WA 2QRVA 5HOQA 2AVDA 1TPYA 3BWBA 5IH3A 5CVDA 5EMMA 1NW3A 5EEGA 4OBWA 5E8JA 4IV0A 3B5IA 3EMDA 5DX8A 5BW4A 1IM8A 5CUQA 1VLMA 3I9FA 3BGDA 3VSEA 3O7WA 2B9EA 5EZQA 4V0RA 3MHTA 1EIZA 1JSZA 3HCFA 2CKDA 2OB1A 4RWZA 2P40A 3BWCA 3FTCA 5EVJA 3TMAA 3OU2A 5DRTA 4ER5A 1TW3A 4X1OA 5K8VA 3P9CA 3NW9A 3QOWA 4E31A 3EVDA 3PTAA 3ANXA 3RIEA 3DMGA 2YQZA 4KIGA 2WK1A 4NECA 1V39A 2ZFUA 2QYOA 3B3FA 3CJTA 3SSNA 2B25A 2AOTA 2Z6QA 5JUWA 2OPBA 4EVIA 2AOXA 1JTFA 1QAQA 2YR0A 5FADA 3PX2A 3PB3A 5CM2Z 4LWPA 4CKEA 4GEKA 1L3BA 2IPXA 2V7EA 3M70A 4CKCA 2PXAA 4E2XA 3I53A 5H02A 3QV2A 5FA5A 1VE3A 2FHPA 3AWIA 2P7IA 3KQWA 2WA2A 3B89A 1YUBA 3LHDA 5DTRA 2HTEA 2YXDA 1RI1A 3SVZA 3HP7A 1XDSA 3KR0A 2PJDA 3BGVA 3BWMA 3EVAA 5EGSA 1XVAA 3OU6A 4QQKA 3EVZA 3G88A 5E1DA 4P7KA 4E2YA 4FP9A 5CCXA 3I64A 3R6TA 3C6KA 3DUWA 1QANA 3FRIA 2NXNA 4MHTA 5IKMA 4PNEA 2AR0A 5FQOA 1RJEA 2EG5A 5FQNA 1JG1A 2B2CA 1INLA 1SVUA 3GU3A 4JXJA 5ICGA 5DX0A 2AS0A 2FRXA 2NP7A 1JG2A 3KQVA 5GWXA 4EKGA 4P7GA 3P2EA 4XUCA 2N47A 1NW8A 3HCEA 1R8YA 4Y2HA 4BY9E 3G8AA 1L3IA 2OYRA 3C3YA 2P3OA 2NNWB 3HVJA 1KPHA 2ONYA 5GP1A 4GF5A 4IWNA 4CTKA 4E2WA 4ER7A 5LQRA 4XCXA 2JH8A 3T7RA 4EKIA 2NP6A 3ELDA 5C0OE 4C08A 1JSXA 3EGVA 3LDUA 4YMHA 5BP7A 5LQKA 2O57A 3DMHA 4RVHA 1EJ0A 1I9GA 4F85A 2AZTA 3FUWA 1X1AA 5K0JA 2IBSA 3DTNA 1NT2A 2FK8A 1EJ6A 3AXTA 4QDJA 2ORED 4FR0A 1N7JA 3OCJA 3OZRA 4WVLA 2G72A 3SSMA 4RTPA 3HA3A 4LWOA 5B1SA 3JWHA 3G2PA 2P8JA 1HMYA 2EX4A 4RTMA 4RTNA 5LQUA 2XBMA 3NTVA 1SUSA 2OZVA 2PX8A 1M0EA 1F3LA 3I5UA 1RJGA 3EGIA 4KRGA 4DF3A 4DM3A 2FK7A 1WZNA 3TRKA 2UYCA 1TW2A 2V74B 3FUXA 1VPTA 4R05A 5EMJA 4OA8A 5LSAA 5GM1A 5K0LA 3HCAA 2KW5A 4A6EA 4E70A 3EGEA 3BZBA 3O4FA 3M6VA 1NKVA 3ELWA 3R9XB 4PIMA 3A26A 3TKAA 3EVFA 1ORHA 4GC9A 2ZBQA 3G2OA 4BP3A 3B3JA 3EVGA 4EQZA 4AZSA 3SXJA 1QYRA 5K0FA 2ZBPA 3UA3A 2G70A 1UWVA 2ZIGA 2JJQA 3M6XA 4GC5A 2VDVE 1WXXA 3GWZA 1T43A 2P7HA 5DX1A 5HEKA 3REOA 4RX1A 4PYIA 4C03A 1JQ3A 2AOVA 5DTMA 5DSTA 4E33A 4R8RA 5HIIA 1M6YA 3M6WA 1YF3A 2O05A 2O0LA 3E8SA 5MHTA 2JHAA 3MB5A 4E30A 1G38A 2I6GA 2AOUA 5EEHA 4XUEA 5T67A 5E2AA 1XXLA 1L3CA 2ZWAA 3A7DA 1XCJA 2PVCA 3MGGA 4HC4A 3NWBA 1QAMA 2P3LA 3AY0A 1KR5A 2DULA 4GOND 4DCMA 5DWQA 3X0DA 3B3GA 4GOLD 3IYLW 1WG8A 1KPIA 5CVEA 4PGGA 3MQ2A 2HWKA 4M36A 3HVHA 3IHTA 3CCFA 4LECA 4POOA 3OU7A 5EQJB 4EK9A 2UYHA 3OE4A 4Y30A 3G89A 5K0NA 5E2BA 4CXMA 4P7JA 5K0CA 2GLUA 4FS8A 2O07A 2C7OA 1D2CA 1XDUA 3HCCA 5FULA 5DM4A 2I9KA 4X63A 3BT7A 3UFBA 3PLAE 3ELYA 3CJQA 3V97A 5KS2A 2ZZNA 1OR8A 1DUSA 1H1DA 3MCZA 2XVMA 2YXEA 2O06A 2NXJA 3KHKA 4RTQA 3EMBA 2PLWA 2ZLBA 3KR1A 4QTUB 4C4AA 3UJAA 3HNRA 3GDHA 1SQGA 5LQNA 5GINE 4ER6A 2WA1A 2HV9A 4GOMD 2XYVA 5EHIA 2B78A 3CVOA 5DT2A 2PX2A 3KPWA 3AXSA 4RTLA 4X61A 7MHTA 3BGIA 5CVVA 1R74A 3T0IA 3THRA 5K0BA 3HVKA 4M38A 3BWYA 3GRYA 2EFJA 3KPUA 4FZVA 5E9WA 4AZTA 2C7QA 2IBTA 5ERGB 1ZHFA 5DM1A 3OPNA 3P9IA 2GS9A 2BH2A 2R3SA 1VQ1A 2OB2A 3A25A 2IIPA 4KVZA 4LG1A 4DA4A 4WXHA 2F8LA 3PS9A 5T64A 3UJ7A 2Z6UA 2JHCA 1VP3A 3CJRA 1BHJA 4RYLA 3UJDA 3KR9A 3DLCA 4PCAA 5DXAA 4ER3A 5FHQA 3SGLA 2IH2A 2VDWA 1JQDA 3PFGA 2BR5A 1F38A 2B3TA 2BM9A 2BR4A 2GH1A 3A27A 3A7EA 3D2LA 4IKPA 5EOVA 3DH0A 1JTEA 3EEYA 4RTJA 4E2ZA 3GO4A 3FPJA 4CKBA 1DCTA 5GIOE 2CWWA 1I4WA 5EC8A 3EPPA 5DTQA 9MHTA 3FZGA 4DKJA 4AX8A 2PT6A 2GAFA 4BLUA 3FPGA 1EG2A 2FCAA 4HSGA 4ATNA 1VBFA 2Y1WA 1IY9A 2ADMA 1U2ZA 4RV9A 5E1OA 5FHRA 4P58A 4CWAA 3DXXA 3HCBA 3QOXA 5G02A 1P1BA 4PYQA 1X1CA 2G1PA 3OE5A 3P9KA 5C9ZA 1D2GA 1BOOA 2I62A 4QTTB 5FCDA 2IFTA 1L1EA 4QQNA 3A4TA 4HGYA 4DMGA 2Y1XA 2IH4A 3SM3A 1R8XA 3P97A 3FTFA 3FPHA 3UJ9A 5FTWA 3FTDA 1XTPA 3KKZA 1YFLA 3THSA 2UYQA 5EMLA 1SG9A 2K4MA 4DQ0A 4YUXA 1JQEA 2CMGA 3NWEA 1KP9A 1O9GA 4BLWA 2UYOA 4FGZA 4HTFB 2ZBRA 4PYMA 3GRVA 1KXZA 1PJZA 3LKZA 3WSTA 4AZWA 3ER9A 2CL5A 1N7IA 2H1RA 5FWAA 5F2KA 3LL7A 2Q41A 2QRVB 1XJ5A 1ZG3A 1XCLA 5D1HA
chains in the Genus database with same CATH superfamily
4MS4A 3FCOA 5ALKA 4ROTA 1LCIA 2GN2A 3MSXA 1UPAA 1YJAA 4ZCIA 2O2XA 4MPTA 4YQFA 2WABA 1DO2A 2FX3A 4RZIA 3LA6A 4A1FA 4RUKA 1VIMA 5FPYA 2CJWB 1DQPA 2E37A 3ORQA 1QNFA 3PLRA 3ME5A 1WDMA 2XR1A 4K6GA 3V3TA 4BCDA 5I7HA 3VC3A 1Z75A 1XQ9A 3WK9A 5HZMA 2AX3A 4TV9A 5MGNA 2Z6AA 4MVJI 1PD0A 1C1DA 2XKBA 5LIPA 4YLGA 5A1TA 2EU8A 1PUJA 1OQAA 2CV2A 3N2LA 3NORA 4HY3A 2BHRA 3GQBA 4UUOA 1EVZA 3DT6A 1XTKA 1D2HA 3AY7A 3WBBA 5JROA 2FUNB 3OLYA 1A8SA 1TDJA 1H0RA 2QJWA 4NULA 1ECBA 1WZEA 1T5BA 4KDFA 4BZZA 4WDQA 4ZVTA 4DCUA 4U6QA 3UWPA 2VHCA 3LM8A 5T8KA 3P32A 4B3JA 3GAAA 2PXXA 1N78A 2GM9A 1CUUA 3RRXA 3A1SA 3DFIA 1B3BA 3V1UA 1U1DA 1OHHA 1E1LA 3FPFA 4KXWA 2WZQA 3DNFA 3MBKA 2G76A 1PR4A 4UZFA 1RXWA 4L8WB 1XELA 1IMOA 4PWYA 4AWXA 2BY4A 3KPYA 4JZYA 2H4JA 3K0FB 1Q19A 3EZ6A 2TRSB 1ODTC 4K6FA 3EXEB 1T0IA 2A5YB 1L0BA 3UVEA 3AUSA 2NAFA 1ECFA 3Q5DA 4PYNA 1QRUA 3RV3A 3T3GA 1XMIA 2AEJA 4JLJA 1MJ5A 1QTRA 4Y1FA 5JR3A 3DZ8A 1UOOA 3I92A 2IUYA 2VPZA 3WG9A 1J5XA 3K9CA 3ZE7A 3K0SA 4EY3A 1ID1A 1YZQA 3QUSA 1CS4C 5LU8A 3LHSA 4K81B 1QPZA 1EB8A 1DT5A 1Z4LA 1OKKA 1M1YB 3A1FA 3EXG1 4WK0B 3AG6A 4F5ZA 4ZZ0A 2QLBA 4YP9A 3D3NA 1PBTA 5DNEA 4B2PA 4YMUA 3R9KA 4P82A 1DLJA 1ADYA 1I80A 1WMSA 2XWSA 1PD1A 1TYCA 3GEBA 1ZSYA 3PDJA 2B4KA 1SEPA 4QGGA 1R4NB 1CB0A 1UQRA 3FYUA 1EA5A 4MUYA 4K03A 4DXHA 5A5DA 1KHHA 1SCKA 3JQAD 1JWLA 4I55B 1OAAA 1F0PA 3VRHA 2RHJA 4TWZA 4IPTA 3UJBA 3OM9A 5BWCA 2QY9A 1VE5A 2PR7A 3Q41A 4KG7A 4WGGA 4ZVMA 5AW6A 4OYLA 4P3YA 3KLMX 2QUIA 1MT3A 2GF0A 2GZ2A 2EERA 2E7ZA 3QVUA 5ALXA 4LHXA 3U62A 3V8VA 4CG1A 5FTKA 4PZCA 3SHVA 3MJVA 5EWJA 5KSWB 5IDWA 4BNJA 1Q12A 3TUIC 4PWZA 4FYKA 3PC2A 4M6WB 1Z4PX 3AFIA 5TPWA 3ENVA 3DLIA 4OK6A 1PG0A 5AT1A 4L0QA 4U2BA 2AZXA 1SRQA 1DTWB 2JFGA 2V3WA 3AINA 3CZ9A 3FI9A 3IJPA 5DBFA 2W11A 5JXIA 2GPYA 3GLGE 3P9QA 1UT6A 3U7QB 5LJLA 3AFOA 1ORIA 2FWJA 4OOEA 4Y0NA 1IN5A 3VPFA 3EYAA 2QV0A 3NHZA 3DAHA 2VTDA 4W1SA 3GJSA 2ZTLA 3ZHYA 4IJUA 1FXWA 1Q7RA 3K5IA 1W48A 3V4VB 2F8SA 3KLPX 1PDWA 1CJBA 1OXXK 1H3FA 3EHDA 5JZ9A 2YMQA 2AQ8A 1SBYA 1LC3A 1JDZA 3W1EA 5BN3B 3NYIA 4PZPA 3M4XA 4R1UA 3SLKA 4E94A 1EGHA 5D01A 2NZXA 4Z9YA 4AZVA 3O0DA 1UL1X 3T1YB 4XAQA 2B1JA 3QITA 4HJRA 3LWZA 1XQXA 5BN1A 4JJ7A 4JL8A 1KVSA 4D1YA 1KZGB 1ULTA 5CA0A 1M2WA 1KZ7B 4IY1A 1P0PA 3I01A 4DDWA 1Z5WA 1M0TA 2J5KA 2H57A 2VF7A 5JAIA 3OVMA 3ZD9A 4CM3A 4AJKA 2WVHA 4HAYA 1RIFA 1ZGCA 2HLPA 4MV1A 2C83A 2G1KA 4WOPA 5HP4A 3N53A 1AMOA 4ZYUA 4P3OA 3WJAA 3JQFA 3R7NA 5KNDA 4RPLA 1VE6A 4Z0PA 3SAJA 4X54A 2VNSA 3ANSA 3L7NA 3RRJA 2D5CA 2JGMA 3M6AA 4NFYA 2BBTA 1PFQA 2YOFA 2WD7B 3QVVA 4GQBA 4EUFA 2BEWA 1RPNA 5EIWA 5K8JB 2BGNA 4KTVE 3U81A 4AF8A 1KI4A 3QFRA 2C9OA 1BVHA 2NWQA 2IYTA 1G60A 3TTWA 3GJYA 4BO3A 2OV4A 3CO0S 2N42A 5DH9A 2ZIEA 1OZAA 2HKIA 1BZYA 1WMEA 3FSGD 4HYEA 4KXMA 3PJEA 3WXBA 3LDGA 4DV0B 4WLEA 2D3TA 4LDJA 5IS2A 1G8HA 3ZU4A 3C3XA 4Q37A 2HNKA 3HHEA 4AD8A 4N1AA 3DOUA 2AOWA 4GM1A 3A6DA 1WD5A 2X42A 1I5OA 4GOOD 2O3QA 3ZI7A 1HC7A 2J45A 1ZITA 1M5TA 2JJMA 3C16C 3E9QA 3ELUA 4N6GA 4OK5A 4TT8A 1OV4A 2FFHA 4TSFA 3TRDA 3OQJA 4PX3A 2C4UA 3OZGA 2OCKA 1K88A 5CB4F 5HJ2A 2DY1A 3PFIA 5DIFA 1C81A 5LDGA 2I2DA 3TRJA 1VBMA 1W85B 3N9IA 1DAPA 1MEJA 2VZLA 3LKDA 5BN5A 3FPSA 3Q11A 3VNRA 3OIVA 3LCUA 5TQ0A 4QVKA 1RJDA 4KWEA 2H1CA 2J07A 1XRSB 5IAKA 4RJTA 5HQ3A 2OC9A 1QZ3A 4A27A 1AKUA 4N41A 1U0BB 1OA0A 3U7JA 4N76A 3DO5A 3DPIA 5TQ2B 2D74A 3OPYI 4GPAA 5KVQA 1YCGA 3FHLA 2Y1CA 2YBDA 4FYXA 3H6GA 4PIPA 4E4YA 1QZXA 1S3SA 3BMQA 3JXEA 4HDRA 4OFXA 4LBWA 3BH6A 4DV7B 5J1SB 1CIPA 3CH7A 5CX1A 1II9A 2WSYB 2DQSA 3SR3A 1OLUB 4YO7A 3DLAA 1ZUWA 3P9ZA 3QVGA 5HIKA 3UK6A 5KX5B 3OQOA 5ELMA 4RKYA 2QE7D 2H2FA 2IUEA 2PYZA 1FP7A 2V8BA 4M7PA 3UV3A 2R79A 3ETCA 1OLXA 5F5NA 2PIDA 3B5EA 4I1YA 1H66A 4L78A 2AN5A 3LWDA 2BGGA 4BIIA 5ALFA 4KAJA 3TDMA 4CCYA 1NTOA 1ZL2A 5CT8A 4OHYA 3WGLA 1CRPA 4A10A 5EQFA 1N0VC 1TUEA 4R2HA 4MYTA 1G2IA 2IYYA 3VISA 4M89A 3BWBA 1WB5A 3QKSA 2UVQA 3N8DA 1J25A 4DLUA 2OKGA 4GZ5A 3QV1A 3JS5A 3DWFA 3NM5A 1CEEA 1BVRA 4BN4A 2XNCA 1TMYA 4L08A 2LBPA 4HXYA 4D9KA 2G5GX 3G9TA 2JHGA 3NVDA 1PFKA 2IY9A 3IO5A 1P44A 2BSQA 1OBHA 4BZQA 4UNQA 3ZQJA 2WHPA 3E5NA 3NU1A 4WPGA 1E9RA 3W90A 4DXDA 4EABA 3CR7A 4FZJA 4U7GA 4BKQA 4D56A 2O8EB 1WSAA 3OE1A 4HDOB 4J29A 4MI6A 4RIHA 1WKVA 1JFLA 4RWZA 1KH1A 2C29D 5H81A 3TL6A 1VZ3A 2VXYA 3S3TA 1E18A 1DC8A 3OU2A 3HWX1 1HDCA 1FRQA 1DEOA 2OLJA 4WNAB 5IJ9B 3ZVMA 4LIPD 3CTMA 1YF3A 2P0AA 1VG8A 4X1KA 1CPYA 3W5IA 3U13A 2ZE6A 4MRPA 4KREA 5BYKA 2N1BA 3C3WA 5ALOA 1TECE 4I46A 2B92A 5I7WA 3GNQA 3AOEC 2NU6B 2V7QA 4V38A 1GPDG 1NW4A 3E7DA 3H2KA 3O90A 4PN7A 1FRVA 2X0FA 3VYRB 2YWCA 3IV7A 1BCRB 4XD7D 1JTVA 2W2TA 3QOFA 2O2GA 3JWEA 2R4TA 1FP4B 1EDEA 3F1KA 3M70A 1IJFA 1MH9A 5HF6A 4E2XA 3O3CA 1XTIA 2Q3HA 1T34A 4GEGA 4N5IX 5DTRA 2F3RA 2NN3C 1TOAA 1UBHS 5AH0A 2PJDA 4UKDA 4PHHA 1M2HA 1T0UA 3E5MA 1JAHA 3AVYA 3IMEA 5HFNA 3WLNA 5ADVA 4AY5A 1P6XA 4YY3B 1JEDA 3EGDB 4YROA 1RACA 1RYDA 4TN1A 3OESA 4ZVLA 4MA4A 4UD2A 2C9CA 4MTCA 3L6UA 4CIVA 4ENSA 1L7AA 4FYYA 1WJGA 2VHWA 4JJFA 2AJBA 5JNWA 1R8YA 4B3RB 5BUZA 4UHCA 5K6AC 2JFXA 1FJGB 3H0CA 2BM0A 4D0RA 3CM0A 1EWTA 2DYKA 4BVKA 5KINB 3ROFA 1XCMA 1KJ9A 2WNHA 1XKQA 3PUKA 4RDHA 4GI1A 1E2EA 1SVLA 3W5AA 3AKCA 5EKDA 4JWTA 3HXMA 5KWVA 5BRAA 5JQGF 1FDOA 2QPTA 5TQJA 3WICA 3NGLA 2PUWA 5DSZA 3CX7A 4WASA 4X93A 3K2QA 5EPOA 2NSYA 4A8JC 5JAMA 3WK7A 2GETA 1J0EA 2O8DA 4FWIB 4EYOA 2PUBA 4G3XA 2PKQP 2XV1A 3G2PA 5ERYA 4OIFA 4U6SA 5HF8A 5DCUA 3C5WP 2P79A 4Z8XA 3GUVA 2G77B 3EODA 3Q6MA 4EHAA 5HUHA 4RTNA 2XBMA 3T3MB 5K6AA 1E2MA 1SUSA 4BS9A 3O9VA 2O5EA 5DHAA 1Y63A 2PM8A 4K0KB 1E3TA 3B1XA 3EGIA 3EZYA 3LA8A 1GGVA 3TIVA 5A3VA 4OGKA 4BO1A 3TRFA 6GPBA 1FQKA 3VNUA 2YVAA 1H6BA 3HNPA 4HVTA 1K1EA 1VJGA 5A7FA 1BWPA 1PV2A 1TO1E 5FLYA 3WO1A 5DCYA 4AXBA 4JQYA 1TAHA 4CT5A 2Q28A 4H18A 1FLVA 2PUEA 3ESZA 4RZXA 4Z53A 1NBWB 4ETWA 1QDLB 3SXJA 3TWOA 5L3ZA 2AG8A 5AUPB 3IB6A 1MIOA 3RSFA 5K6TA 2C7BA 4BUCA 1WXXA 2GEVA 3C8HA 1X92A 1YR3A 2QTRA 3BSWA 2ZKLA 3E61A 3JAWB 3NAGA 3OICA 4LGCA 1RAHA 3CUKA 5AJYA 1TO6A 1MB0A 2PVSA 3VR2D 1U02A 1IJKA 1GPKA 3M6WA 2O0LA 1M34B 4MROA 4GIBA 2B0CA 1G38A 4X6UA 4E30A 5I4BA 4JGIA 4WW0A 2Z56A 4UBLA 4GZMA 3DUFA 1Z4OA 5LMCA 3ZNPA 4LBVA 2ZWAA 3AETB 3CG0A 4IEFB 4QYMA 3JALB 4JYMA 2VP5A 2G7MC 3EZFA 4LNAA 3KLOA 1B23P 4JC0A 3LD9A 3IX7A 1UC4B 2D59A 2H7XA 3L04A 4RK7A 2CSUA 5TLSA 5CT5A 3IHTA 3CCFA 1T1JA 4Q9AA 4RQTA 3KYBA 5A4IS 4CQJA 2V3CC 1Y6RA 1LS1A 1R9JA 3EDRA 2DKNA 2HRRA 3EXHA 1FYEA 2R8BA 2RHOA 1YQUA 4LS3A 5EHQA 5JDCA 1Q77A 2DPGA 2ZYSA 3RVRA 3R4CA 2M1XA 4NS1A 1AV7A 1UJNA 5GGXA 3T9AA 1Z7BA 2J0EA 5EMHA 3G0HA 1SXJB 2NLOA 1K7SN 1XAHA 1ZU5A 5CHEA 1Z7WA 3WLLA 4C6TB 4DG8A 5HW0A 2ZT8A 5JO9A 4RHCA 4WINA 1K8YB 2HXSA 3L40A 4DPMA 4WD3A 5IC4A 1QCZA 3T3IA 4CF3A 3ZDFA 2EX1A 3ADKA 1XD2A 2G1AA 4S24A 2HV9A 2XYVA 3COPA 4E1VA 8ABPA 1EWRA 3WRXA 3AK4A 1S2NA 4JKIA 1E9DA 1NPDA 1KNXA 1X38A 1MX5A 4OQYA 4YTEA 2UVPB 5ICMA 4JX8A 1YGPA 3VNBA 2QTWB 2W2KB 2GSWA 4EPWA 1GADO 1RZUA 2B83A 1EDDA 1KEWA 2XQIA 2UUBB 3PS9A 1CLEA 4FYMA 4KXNA 3GH1A 4R8VA 2CDNA 4E5VA 5A5EA 4I50F 5DHQA 1AZLA 1M0SA 5G0WA 1E64A 4M0PA 5CTAA 4F4FA 3MN1A 3RFXA 4P3PA 1KOGA 4NJMB 3GEMA 5DHSA 4IKPA 5H7XA 1PF7E 5L4SA 2O2EA 3TH5A 4QATA 4COOA 4E2ZA 3WL3A 5DMXA 1FDWA 1ENOA 2PD4A 5SICE 2CHQA 2O48X 3GFSA 3HEAA 4J16C 4Y6OA 3A6PC 1JXAA 1KO8A 2CBXA 2OECA 3NUGA 1F6DA 1MXHA 3A2LA 4DRZA 3EVNA 1VLVA 2CJXA 2ZRJA 3GP5A 2IT1A 1QH1B 1SULA 3I3SR 4W8OA 2ADMA 3N8KA 4BU1A 2MSEB 3DXXA 3QVLA 3T1HB 5F21A 1JDBB 3QOXA 2JGDB 5HBGA 2VEOA 3OM8A 1P4JA 1U7TA 1ZK0A 1BH2A 3RYIB 5JRDS 2BKVA 5M34A 1TUBA 1U0FA 2Z83A 4FEAA 1BW9B 1D09A 3UJNA 3VU3A 3IAEA 3JAMA 4EHBA 1OROA 3DHYA 4AP6A 5KKNB 4C30A 1W0KD 3FTFA 3E2MA 2H2HA 3ZLTA 3ED5A 1V11A 2ALJA 4G37A 2XCLA 3THSA 3CUVA 3NWEA 1AE1A 1L7BA 1Z0KA 4YI5A 2JJ8A 2ATEA 3RUCA 3PWTA 3HYNA 1UANA 2ZBRA 2YWRA 1GILA 3DMTC 5B1HA 1G7CA 4GBMA 3VAAA 1W87A 3OZVA 3EB9A 1KJWA 3HY3A 4JLAA 1FDUA 1L7XA 3OOEA 4NMXB 5FUYA 3VR5H 4DPLA 2OP0A 3WBJA 4BMVA 3H5TA 3O7MA 4IEEA 4M1SA 4C87A 2H9YA 2V7UA 4X45A 4XFDA 1YOVB 2HMYB 4OHBA 3TNJA 1I6KA 2G8LA 3IMFA 2G82A 2OXCA 4PINA 1CQXA 3EBPA 4ML3A 1NHWA 1QIIA 4J90A 4PYOA 5AYVA 4O4HB 3PJFA 4Q16A 3QEOA 1XLVA 2FFRA 4ZYTA 2GR9A 1JFSA 4LXHA 2PSDA 3DEIA 3KK0A 1M33A 3AZOA 3A31A 5TF0A 1A8PA 4OGWA 1JAYA 1LRJA 4KNVA 4PRZA 1ZKMA 1J6UA 3FGNA 5FBHA 2IHBA 3HEMA 2BFEB 1SVOA 2IGTA 2ZIFA 4O4JF 4UUMA 3X2EA 4N12A 2DJIA 2XRFA 4G89A 3GRZA 1UBUS 4DBZA 2BFCB 2W70A 3WGKA 4R51A 4MKFA 5DN6D 4UUBA 3UWOA 4MINA 2Z3VA 3ONWA 3MUOA 4ZO8A 5DTEA 3UHOA 3G0BA 2REQA 4E13A 4RPHA 4GM4A 4JP1A 4CCAA 1FFGA 3KWJA 4M8SA 1E89A 1UPXA 3I2HA 3H83A 3SF0A 1VBKA 3K0HA 4Y2XA 5FP0A 4EW1A 5BQFA 1Z22A 1XBTA 3K2IA 2FR0A 1D4ZA 2Z08A 4H7JA 3UH0A 2IW3A 3D7KA 1OTHA 3PE3A 3KXPA 3L77A 1F2VA 5HIJA 3TQSA 2H4XA 1KO7A 1O2DA 2HU8A 3MMPA 4LNUA 3T1NA 3URMA 3VZSA 1UODA 2I3BA 4G23A 4HDMA 4IRMA 4YYEA 4Q9JA 4DUPA 2NMVA 3B1YA 1CLUA 1L9KA 1M3SA 2RHMA 3P2JA 3VXKA 1QFJA 3ZTYA 1PDVA 3ZWOA 3L7YA 2E4ZA 4XJVA 1NYQA 1XFAA 1GCAA 5AHWA 1JJBA 5F7ZA 4GMGA 3UPDA 4BB5A 4DLYA 2GK4A 1B4DA 1DADA 4KO2S 4N48A 2QTZA 1G3MA 2HEGA 4ZAVA 3UAXA 3DT8A 1I4OA 3PWKA 3G0GA 4IX9A 2RGBA 2YJGA 4WKNA 2WIGA 3OJFA 4Y6LA 4RA6B 5AOBA 2PO7A 3F9IA 1JHQA 2DHRA 1YB2A 1K6XA 1QE5A 2I29A 4BMXA 3O8CA 2OZLA 2RFLA 3TE7A 3FG9A 1J39A 2RAPA 2GASA 4HUJA 4EJSB 4YT8A 1VCOA 3RHFA 1FBNA 1VTKA 1G16A 3NTXA 2V55B 4F9GA 2A3RA 2H65A 4QYSA 4YDQA 1T36A 3PEYA 3IKVA 4MUAA 1AK1A 2XQKA 1V4VA 4X1YA 4JFRA 5C8XA 3UK1A 1J8MF 2RJNA 4HNTA 5JH7A 4JJKA 4OKNA 1BA3A 4S05A 4R2KA 2AB0A 4OP2A 4HT3B 2J1LA 4U7TB 2FN9A 3D8NA 3S70A 5F23A 4OVKA 1A69A 3NHSA 3N58A 1GTVA 4KIFA 4CDNA 1NBHA 3QKRA 4U2FA 2ZJFA 4JITA 2Q49A 4XYMA 5HF5A 5B7NA 3CEMA 4UNSA 1P2UA 2FP3A 3SJUA 3F3YA 4OPMA 4RFSB 1JRLA 4CKXA 4AUKA 1JMYA 1XNHA 1DPFA 1JR3D 1Z6AA 2EF0A 3IQEA 4Z2AA 3MM4A 3ZHUA 5CFRA 2BFOA 5BSGA 1MO3A 2YVUA 3V7UA 4JJ8A 2AJTA 4X20A 5KTTA 1EU1A 2A84A 1QG2A 4Y2GA 1HFEL 5EE0A 3VC7A 3BD9A 5MFPA 1MVNA 5CH3A 4C04A 2BUBA 1QX3A 2H07A 3NB0A 4NZYA 3RYFA 3QU4A 4GKBA 3UHFA 1QHHB 5BR7A 4B0PA 5FUMA 3RABA 2ZROA 2D06A 2P62A 4ZTBA 4A36A 1JEQB 5ALTA 3LVFO 5KSYA 4RK4A 1VHLA 1RYFA 5B1IA 1ZL0A 3VM6A 3KZCA 1JG6A 3MB8A 4KO3S 1DZIA 1QPGA 1T4CA 3KBBA 4MPRA 4U6NA 1N8KA 1TLFA 2WNSA 4BNMA 2OSBA 3DR5A 3I58A 3QW2A 1X1TA 4C1NA 4D92A 5FLEX 3ND5A 1UXJA 3UFXB 1QDUA 4J3JA 5ALLA 3U3ZA 4YCAA 4YBZA 5JATA 2A92A 1P0QA 1Y7PA 1MG0A 5GIPE 1PJCA 3W9BA 1PAUA 2E4VA 3K4HA 3EASA 1ZESA 2FX5A 2YDYA 4PBTA 1KSHA 1IN6A 1Y3CE 2GUWA 1CZKA 1F2UB 5CYOA 4LF9B 3KEQA 1OFUA 1EIWA 4RESA 4WJLA 4KN5A 2J4DA 1FQOA 2VK4A 3HO8A 5BSWA 2F9MA 1UEJA 1K4MA 3IVAA 4KSBA 5DYYA 1KQ3A 4HH4A 4WQMA 2DVMA 2E3JA 3IHKA 4XJSA 3ZH2A 4BO4A 4KDEA 4MULA 1SH7A 4DCGA 4EJ2A 3L0BA 2L42A 3B6EA 2TMYA 3T3OA 3D5QA 4AFNA 3F8SA 1EA7A 1CY2A 1RE0A 1AQIA 1KEZA 3MLBA 4TTRA 3DXZA 1RQRA 3DFFA 1RFGE 3ZHCA 1E0SA 3SDBA 1QU2A 2B9VA 1IXRC 2QLLA 2I4RA 3H65A 5AOVA 2WICA 3L2OB 4R2XA 3NOVA 2HRZA 1P9RA 2CNOA 4FVTA 3RFCA 3I6BA 5AM1A 2QR5A 4JYZA 2V0GA 3EMVA 2RHDA 3ZYCA 4RMGA 5PNTA 1NYTA 1U4NA 3HKCB 5SY6A 3C74A 3PTZA 3W77A 3QHQA 4BPBA 4C4RA 2OILA 1XQVA 1KU6A 1VL5A 2ZS8A 3BMOA 5EPUA 1J1ZA 2IGBA 3CZQA 2IWHA 5FUQA 1ZW6A 1RI4A 3UTCA 2GJKA 2QUBA 4GBED 1R6XA 4OXRA 2ZWOA 1ZINA 4C4OA 2PUCA 3PR2B 2GNPA 2VA8A 3BREA 3VPDA 2WIBA 1G8JA 2KB0A 3EDOA 1XA3A 1XNJA 4ALJA 5FLXA 2QRLA 4BP1A 4KLZA 2ZRGA 1D04A 2AA3A 4L74A 4WK2B 3VMMA 1VLJA 1PGPA 3UMGA 4B7ZA 2OXTA 1U3CA 3ZIAD 1ISGA 2Y67A 3HBMA 2CUZA 5CG1A 4XWTA 5K0EA 3HCDA 1Y48E 5T3UA 5CAEA 3SHQA 1ZJWA 4K26A 2VNAA 4I19A 2ZRKA 5CEEA 1IY1A 2IC5A 4JBWA 1N6HA 3M3PA 5F2EA 3X1DA 2VSNA 3P4YA 5SZHB 2OXRA 3S7ZA 4CV0A 2R1ZA 2W2LA 1WHSA 3AO0B 5FPSA 1NHGA 3INRA 2ETVA 1ZGAA 5A3QA 2B8JA 4HK4A 6REQB 1TPYA 2P2LA 2WTMA 1Z62A 4GX0A 4HNSA 4HJXA 4QU0A 2ABWA 4HCJA 1OE0A 4EATA 1W8IA 1F8XA 3V8QA 3V2HA 2WTAA 1HT2E 1XDWA 2VJPA 1NDQA 4F8YA 1OPXA 4UXHA 3AEZA 3GROA 1J1UA 3A1CA 2CCKA 1BCSA 1ZH6A 1YZVA 4XH9B 2D1RA 5IX8A 1ZSVA 3O8NA 2FHSA 4QTXA 1TQ8A 2QGZA 2PS3A 4RETA 5IM4F 2GYUA 1JA0A 5BURA 5IJAA 4RKQA 3BWCA 2QAJA 3JRWA 3UCFA 4WKOA 2EFCB 4S1PA 1NA5A 2NQ8A 3P9CA 1WPXA 4ZCTA 1FDRA 2XSZA 3NS7A 3RRNA 2WQ6A 4C7OB 1YI0A 3L0ZA 3WYCA 3COJA 1GNRA 2G1UA 4C4ZA 1A9TA 4UAVA 2XWJI 2HHJA 3DWEX 5DEOA 2PKRA 3B3FA 4KGDA 2ZRBA 3CW8X 3L6EA 4UEOA 4XJXA 3ZXSA 3QPDA 2BFAA 1TO2E 3SZOA 4B9EA 4DVJA 4M54A 1GD1O 5CLFA 1XAJA 1BRTA 2ISCA 3WGTA 1IIRA 1EWYA 1VE1A 3EG5A 3F67A 5BV0A 3ZW9A 1P18A 1V41E 3GZNB 2Q50A 5EXDA 5THXA 3ZHZA 4Z7JA 5A04A 2HDOA 1P0IA 2ZT5A 2QQGA 4ZI7F 4A23A 4BV8A 4OKIA 2WJJA 3SZ3A 4QSHA 1MA0A 4NHOA 3EGOA 1VE3A 1VMEA 4PAQA 4C20A 1ZUNA 4TMTA 5CITA 5J9FA 3BCHA 4HPJB 4TWJA 4YXFA 5AVRA 3L8GA 4LRQA 1AY0A 3M6FA 3ZG6A 4MICA 4RORA 2FVXA 3H4MA 3V7NA 3WRVA 3ZQUA 2C0PA 4KODA 5DI9A 1M7BA 1DUVG 2EBFX 3Q9SA 4G1FA 4UTRA 3SMVA 1E60A 3KT3A 3EDCA 3NEPX 1VYUA 2FMUA 3M4YA 4X7BA 4GP6A 2EG5A 5FQOA 4A2QA 1D07A 4MITA 4RV4A 8OHMA 4DPKA 1PW7A 1UQTA 1D4AA 1BE1A 3QK7A 2NP7A 3W5UA 4RA9A 4JEIA 3H1BA 3BXZA 4WJKB 4TKVB 1Q84A 1FXSA 2B1QA 2OYRA 2YFHA 4MJXA 1PS8A 1KPHA 3BRCA 4HWKA 4FNMA 4XCXA 5IPFA 3FCUB 3LBNA 2ZJ6A 1KMCA 1BTOA 3NIFB 4PO8A 4QOFA 3LDUA 4YMHA 5BP7A 4BWFB 2C5AA 4QULA 3WHKA 2DUUA 4JLOA 1TRKA 4YP5A 4IG9A 2C2BA 1PZFA 4OH1A 2MSNA 3QFFA 4YAJA 3CRQA 3MJRA 1NC3A 2ZR7A 3JRXA 1GQQA 3PC7A 4HEQA 5LLSA 4EA7A 4MZDA 2ORED 2YHIA 5DYTA 5AWFC 2JLZA 2ZIXA 4BJ1A 4TROA 3I04M 1PJRA 5CLQA 4EI7A 3GRFA 3EXIA 4AN0A 1FC0A 4UTPA 1KH2A 2P8JA 2MYUA 3ABOB 4LJYA 1K4KA 1SZDA 3ONDA 4D9JA 1OMOA 5FD8A 1I0ZA 1R8SA 1XZJA 1Y5RA 3HDHA 3KBOA 1T1IA 4PXYA 1EM8B 1WZNA 2IOQA 1EZZA 3AY3A 4Q3DA 3HCPA 4WFIA 4MYRA 4OX9B 2HOQA 3DV9A 1YHNA 4LBYA 1LEHA 2Z58A 3OMWA 1CFJA 2O2YA 1NKVA 4JBIA 4TYQA 1N9ZA 3RAPR 3G9UA 2XOKA 4MAMA 2DECA 3BTVA 3OOHA 5JFGA 3FTPA 3AZQA 1M2VB 2R5FA 5C35A 2AI3A 2GD6A 4A6XA 3S28A 1TJ4A 3AHEA 3PGXA 1QQ7A 3CLTC 1OLSB 5FOXA 1RE1A 2BRUC 3W3AH 1C8LA 3KOXA 4GC5A 3TUZC 2O2CA 3TQQA 3GFOA 3GWZA 3PDWA 4U7WA 4V0NA 4XX1A 1Y1TA 3BRSA 1OAOC 4O2AB 1NJ2A 4KXYA 1WF6A 1V47A 1U1FA 1NAHA 2EFDB 1FXUA 2JHAA 4QOIA 4H7FA 5H3HA 3OT1A 4BKRA 4L8FA 1DLIA 3RVQA 5E2AA 1SWVA 4MMYB 1CRLA 1XXLA 1NLZA 3LRTA 2ZAMA 3X1MA 2NQ2C 3L0PA 1YDFA 1VKNA 2J9XB 1TE2A 1A9XA 1DKLA 3M4NA 3PEEA 2QGNA 1E2PA 5CVEA 5ALWA 3OAAD 4AJ2A 3FETA 3IQGX 4R7GA 3DBVO 3B38A 5KYWA 4UATA 4QLOA 5EQJB 1P6UA 2QMOA 5BMOA 3EYWA 1KMHB 3MWFA 4UASA 1OH6A 4NCIA 3JYPA 2WWIA 3WLKX 2C94A 3GJRA 1ZXBA 1KOLA 3KAJA 3EZXA 1B6TA 1YQQA 5TMPA 3M5CA 1KS9A 4CGZA 1Z7YA 3AILA 3UFBA 4JI8B 1WMDA 2QNBA 1DEAA 1U0GA 5IVDA 4IDEA 2GPTA 3K6JA 2NXJA 3FGPA 3V80A 4Z4IA 1TMKA 2ZLBA 1ZGHA 3BMCA 2FE4A 1FRNA 2KM1A 3IIKA 3NYQA 4MYSA 2JAWA 3IGFA 2X4GA 1RQXA 4ARCA 2JLBA 2UZAA 1NUHA 2KBFA 2O3UA 4GPBA 2GERA 5H70A 4C6HA 2GBLA 1S5PA 3CVOA 3F6EX 2PX2A 3SR0A 4A0HA 5KOIA 3BGIA 5KYKA 1G17A 5TPZD 2OFPA 4N0DA 1KY3A 5E9WA 1UMKA 3KPUA 5T5QA 3I76A 1JBKA 3C1OA 3E5HA 3FKSA 2VO1A 4FJ1A 2OT3B 4ENTA 4EG6A 4EY7A 1KQNA 4W9MC 1UJ4A 1N8TA 4XLZA 2FSVC 5FO0A 3KVNA 4W8HA 1IOVA 3TD9A 5JXHA 3EXEA 1ZD1A 4NJOA 2HBYA 2N9UA 5JSHA 3DEYX 4C0WA 4B8YA 5AVZA 1P1HA 5JG7A 1NGSA 1PIWA 2BR5A 2GTIA 4OUDA 3CNLA 5AHRA 5EOVA 4AY3A 4EG4A 2QN8A 5DNDA 4KMSA 5CIQA 5KC8A 4Z3DA 3L4BC 4N7JA 3ZKWA 5C5CA 2OAEA 3BN3A 4LDNA 2HRCA 4B6OA 4JN6B 5C7OO 4NCJA 3LUGA 5B4VA 3Q8KA 1ZH8A 2FGJA 2P9JA 3N3BC 1T3TA 2YJ4A 1W35A 4W5TA 4NCBA 3P94A 2VCEA 2OLEA 2R87A 4ATNA 4DLZA 4NYJR 4HNQA 4Z1OA 2C4TA 3WFIA 3V2IA 4G07A 4LYDA 1A71A 5IWAB 1UM8A 3LPNA 4LHWA 4XX0A 5A4DA 1G6OA 2PTGA 1RZRA 1QQBA 5AESA 1OFIA 5DM70 2BUCA 2OHVA 2X7HA 4U3JB 3QU7A 2JIQA 2ZRDA 3QI7A 4LQLA 3ZE1B 4YJFA 1AIPA 1PFGA 5DI3A 3DP9A 3EG9A 1P2FA 5IHPA 2BTEA 2IH4A 5ARCA 3DCJA 4L9WA 1I3OA 1PUXA 5TGZA 4DIFA 2D00A 3RSHA 3GVCA 1F48A 3A1VA 2CXSA 4RIIA 3TW8A 2R86A 3KKZA 2AMYA 2UYQA 3OIFA 1I1QB 1E5QA 1X87A 1KHTA 4ZYLA 1SN7A 2NACA 4FYIA 4C29A 1Z6PA 4BLWA 2WDPA 4E3WA 3TSOA 4GPZA 2WSSD 2BTQA 3WSTA 2HA4A 2NUAB 1ZI8A 1P8AA 2CL5A 1N75A 2H1RA 2XMGA 2GEUA 2PXHA 3BAZA 4D45A 2QRVB 3PT5A 1M75A 3EOAI 3JX9A 1ZG3A 5F33A 1A5ZA 3UAGA 4KR7A 1NJ6A 1P1KA 2PMKA 5JD6A 1XCGB 4UW9A 3HGQA 2QRUA 2Q5QA 4WLFA 3U7HB 3ROGA 2YZMA 4U5QA 5FDFA 1U1CA 4FUTA 2EP7A 4PNZA 3N6VA 4DIUA 3KQLA 1FFCA 4UTXA 3RGWS 4Y67A 4FOTA 2G71A 4MQMA 4D46A 4OFWA 4PNPA 5B7PA 1T6ZA 1ECGA 3ER6A 2H1WA 2VXBA 1YDEA 4KP7A 2V6FA 4UOEA 1B14A 2XHZA 1SVIA 4AZ3B 2GCIA 2QRGA 4C7BA 4C6RA 1Y1RA 3T5AA 5AK6A 5IYZF 4AG5A 3H2BA 3NV7A 5AHXA 1DKQA 3CH6A 3GJ0A 3O8BA 2JAHA 4WBXC 4Z86A 1BYIA 2JATA 2SKEA 5IUNC 3CW9A 1ISPA 3OFND 4ZAZA 1U9CA 2ZIVB 5AVWA 3IXMA 5IFKA 2VCYA 3IBSA 3CVYA 1HLFA 3O3MB 3OZ7A 2A67A 4X0EA 1RFLA 4IQFA 1U8XX 4YRTA 4PN3A 4IWXA 1NBME 1RJ9B 4JJAA 3LTNC 4OB8A 2VWGA 2VR1A 4PNHA 2BFDB 4ZU6X 3TFWA 5HM6A 4D8XA 3IE1A 3GBSA 1O7JA 2HBQA 3PGKA 5HFAA 3LT0A 2O2HA 4HEJA 3SBXA 4FM9A 3ZU6A 5JJLA 1R4AA 2FQQA 4FFDA 4YHBA 4MKZA 2I2CA 1HEYA 2ZVPX 4KH0A 1SCUB 3ODPA 1ISSA 2ODEA 3NHYA 1UBGA 3D4BA 3QMVA 1U7PA 1YVRA 4NCNA 2ID9A 3Q3JB 4LTDA 4BNDB 3NQ41 3SQXA 4IIJB 4YECA 3JZDA 4FKMA 4Q4LA 5BVGA 1Y8RA 2YFYA 4M0FA 4NMWA 2KX7A 2XF8A 2BZ1A 1RRVA 4JDUA 1X1BA 4F9EA 1G8SA 3D6NB 3HNOA 3LWBA 1Z73A 1R8QA 1Q2UA 1YFJA 1P1FA 1R5OA 2DE0X 2W2OA 3HG7A 4PPFA 2PT9A 3STUA 3PVCA 1W2GA 5BOVA 4QTYA 5KTYA 4P31A 5HS6A 2JF0A 4OGFA 4PC2A 1YUNA 1C50A 3DEFA 1QGUA 1UAGA 3AF2A 3UCEA 3KXIA 3N8GA 1RXUA 3HJBA 1U8CB 3G59A 3PNSA 4F84A 5JNUA 1Q0TA 1PDOA 3HHPA 3ECSA 3FYSA 1PW5A 5A4FS 3KQTA 4XVRA 5JTUA 2WKPA 2BGWA 1ZUHA 3AJEA 4IDGA 3O4JA 1CJUC 1NN1A 1JMKC 2QZJA 4RVGA 1FJ2A 3RHZA 4AT1A 1PUIA 3RYHA 3NHKA 4PSKA 2DHQA 3FOFC 1TCBA 2QLNA 4J4BA 3UGJA 1ULHA 3L8HA 4DR2B 1OSNA 2FP4A 3X1JA 2DKOA 2PO5A 2R48A 2WUGA 4WZAB 1QP0A 4PAOA 1BO6A 2ZPTX 1KZYC 1TTTA 4ESVA 3U80A 4A0GA 3FNEA 1XO1A 3TYXA 4DEYA 3AWDA 1OWMA 4MDFA 2PA3A 1JG4A 3WK5A 1XRRA 5C8YA 4MHTA 2CLLB 4M0LA 3EAQA 2V7GA 4C4YA 1MO5A 4J91A 1KNQA 4KAAA 1UOPA 1PGNA 3LBHA 4HNHA 5IJWA 1X1EA 3IE0A 3MOGA 4M88A 4TV9F 4A5OA 5IBQA 3HYCA 4PFSA 3OZDA 4DJJA 2WF9A 3HKDA 3IPXA 5C51B 4ALIA 4WDRA 2D5BA 4A0FA 3G79A 5EJIA 4FJ2A 4YQZA 2V58A 2A1UB 2PSSA 3CX8A 5D5PA 1S8FA 5F1PA 2JD0A 2NX2A 3IUSA 4I5DA 3WIBA 4C07A 2J08A 2L82A 3A37A 3C3BA 5KX5F 1IAVA 2PLAA 3AI3A 1HNWB 1JDTA 1TMOA 4HX2A 4PZYA 2G9UA 4YRQA 5FPKA 1DBWA 2J0SA 3NAQA 1L5FA 5E2IA 3E9NA 2CYAA 2C8VA 1RAFA 1JHAA 1JSCA 1E9SA 3K09C 3D3KA 1D9ZA 2AC7A 2BW0A 5KQRA 2ZPAA 3IV9A 3M7IA 1CU1A 1U7HA 3QX8A 4G1CA 3F6PA 2CXPA 2VDRB 3T4EA 3Q2KA 2VK8A 4PEVA 3VZPA 5AKXA 5C81A 3MINB 3ZE6A 4WNAA 1GRVA 2Q62A 5IJ9A 5LA6B 4XE5A 1XAGA 2R8OA 3JQPA 3MMSA 3PHLA 1NF2A 1YS4A 1ZYUA 1HGXA 4UXJA 5B4UA 3JD3A 3QLVC 4F5EA 3QELA 4WTOA 3ZY5A 2NPFA 2WTNA 4Q9LA 5CG2A 2W0SA 3NLLA 2ZRIA 5FPTA 3LXXA 1E58A 1T2CA 4K9RA 2CLHB 3GP8A 3F97A 3L0SA 4Q4AB 4TKMA 5G0UA 1X77A 3KELA 3CHYA 3WY9A 5DXJA 2IYFA 3ISTA 1SXJE 5A0TA 1AS3A 5CLIA 3C3PA 2X19A 2O1WA 2OBNA 4G9EA 4Q1DA 2FSIA 1DRKA 4KCGA 4MQUA 5IAJA 4BFXA 2QNIA 4NVRA 4LC1A 3N74A 1YIAA 3JQAB 3GRCA 3MCUA 5ESXA 5DNUA 2PZJA 4FT4A 1EM6A 3SHWA 3B12A 3H9GA 4FE7A 4MR7B 2BFFA 2JFVA 1XZDA 2RGDA 1VYHA 1N33B 3KYDA 3PYXA 1W59A 1JKJB 4B79A 4ARAA 4G4GA 2J6CA 2WTEA 4B47A 4CIWA 2PSHA 1PQYA 2JLUA 3HACA 2H11A 3E9EA 5JC1A 3M81A 4OCZA 1PL8A 2OCGA 2X7XA 3VO8A 2E55A 3ANLA 4IIYA 2MINA 2EG9A 3HA5A 2DUWA 1EQ2A 4P2GA 3WWOA 5H8WA 3ZJUA 2QVBA 3GN2A 5ECWA 1NXSA 2AK2A 3G8CA 1QAOA 3FJOA 3RUEA 1C9EA 1GQYA 2HL6A 3C85A 1CNEA 2W4IA 1RI3A 1U5CA 1N3BA 3AV0B 1NVEA 2R5NA 4J76A 2AZMA 3TSAA 1D6MA 4PRKA 1W9MA 4D6XA 3R5SA 1L5VA 2VJQA 3FY4A 3UENA 3WA6A 5AI6A 1ZO8A 2CL7X 3BPSA 4ISCA 1WHTB 1CR1A 2JBAB 4FFOA 4NI5A 2TS1A 4MMZB 3LQ2A 1PR1A 4MW4A 4WEQA 5AVXA 2P5UA 1X70A 2A9RA 2CE7A 4BJHB 2DWOA 2IUTA 3I0ZA 4FMCF 4C05A 5HOQA 3QOYA 2AVDA 1TQDA 2ACEA 2F48A 4IMIB 1QTIA 5IH3A 4LJRA 5AJZA 1IXZA 1P7WA 1PJBA 2QTHA 3UKJA 3WWPA 5KNLA 1UQUA 2A58A 4YRMA 1M5RA 3UXHA 4FD3A 2VPQA 2PZBA 1SUBA 1C3LA 3QUCA 2X2FA 1Y3AA 1N0WA 5CUQA 1O5OA 2QL5A 1CDEA 1KQFA 4B3FX 5F9FA 5CIWA 1I10A 2XKAA 3HDQA 3BHNA 5EZQA 1C3OB 1EK1A 3U16A 2GZSA 2BD0A 3UV7A 2CWDA 5D7BA 4ZVPA 2HCFA 2W22A 4V1CB 1XTQA 4UNIA 1F8UA 1MQSA 1NXQA 2J67A 2VAMA 2VATA 3UG7A 4LZWA 3TL3A 3E15A 3Q2OA 2J3KA 3BE5A 3NW9A 4E31A 2VOJA 5LOVF 3BK2A 1B16A 4KMMA 1TD1A 3QBEA 2WIKA 2PCJA 3A2MA 4Y3UA 1NU6A 3LLMA 4QT4A 1AA6A 2J5BA 3G1WA 3AFGA 3PXBA 4O2BB 4G0UA 3CH4B 1BDJA 1DB3A 1EVQA 1GPH1 2HUPA 3GPDG 3F6YA 3NUZA 1H2WA 4FEGA 3AETA 1EP3B 5FADA 1G5TA 4YJGA 2VSOA 1KYQA 4NBSA 4U9IS 3PUZA 3KJGA 4L4YA 1COWD 4N3NA 2OORC 3D02A 2VI5A 1E1KA 2IPXA 2V7EA 4ACAA 5H0IA 3W2FA 1AH2A 3C97A 3C15C 4B3SB 4L3OA 1YIOA 1D7AA 3CVJA 3OJLA 4MVJD 2RGYA 2RGNA 1W36C 1GG2A 3K0CC 1P75A 1IJBA 2OGSA 2X9LA 4AZ0A 1SC9A 2IEGA 1DO0A 3CQ9A 1HT1E 2NV0A 3FX2A 3LUDA 5BPFA 4GQAA 5L45A 1M1NA 2QD3A 3BL6A 4KWHA 3ZCVA 4CTMA 1QIEA 2Q0XA 4F8EA 1V6AA 3MWGA 1B3RA 1DRVA 5AW9A 5I48A 1IB0A 3F71A 4RMNA 5IKMA 5KOJB 2B61A 5DE3A 4BE7B 4HGOA 3NHUA 3K35A 2XDYA 2XMRA 5FNVF 1SU7A 2VSFA 4TRMA 3GEPA 1VA4A 1XXHB 4F96A 4R2IA 3KVRA 1V3QE 2H4YA 4EL0A 3ZDDA 3G8AA 5B12A 1I33A 1C8BA 4B2IA 3HUDA 4DNFA 5KYXA 4EKIA 1MRSA 2PS0A 1ZFNA 3W6OA 1TNDA 5ITVA 2ZR9A 4M8NE 3CKLA 1J9GA 2VYVD 1EJ0A 1KAHA 3V48A 3FUWA 4PBRA 1T0JB 1ZW1A 3TOCA 1NT2A 1TJPB 4NWIA 4X8OA 4CTOA 1FQWA 3FR8A 4ZCMA 3IEKA 2MWMA 1N3YA 3UKOA 3LOUA 5KPJA 2XE8A 1YMVA 1AJEA 4XFKA 3X43A 1DEHA 2YMLA 4L5IA 5EXSA 1LSJA 1S2OA 2GHIA 2OZVA 3ROXA 5CB6A 3H7AA 3FWYA 1F20A 1PWXA 3QXHA 4RFVA 1FNSA 1T6BY 3WYDA 4AMUA 2OVBA 4CM7A 4FW9A 9ATCA 4BP9A 1QRAA 1YL6A 2ZK7A 4OHRA 5E7MA 3DONA 2ZANA 3A6LA 1IHXA 1CZHA 2B82A 3Q7QA 3ST7A 1ORHA 5DGDA 2HIGA 4GYJA 4LF8B 2IYQA 2Y6VA 1UCFA 3TQFA 4ZAYA 3I9NA 4F2HA 5AQEA 1GAEO 1RWQA 3U19A 4I66A 3HUUA 4HXFB 3E9DA 2H08A 1E5XA 3QJGA 2JJQA 5I8WA 1K7XB 1CF9A 4ENVA 1P4AA 5ARBA 4G6ZA 3DHVA 3IHWA 1M6YA 3GZ4A 4K3VA 3SZLA 4C4PA 5E0OA 3J80A 5KTPA 3MB5A 1ZD4A 4ALNA 5MGBA 2JEYA 1KK2A 2HHLA 4B3CA 1N6PA 2PANA 2BIFA 1HOXA 3ITKA 4YLYA 1L3CA 4PLGA 1I01A 3GEEA 4AF7A 2WQZA 3TDKA 5JHGB 1PNRA 3ZGVA 1W5EA 2NO5A 2NO4A 3O1LA 2KQUA 2HA7A 4QX6A 3WYFA 3ZLBA 3GJZA 2VTEA 4M36A 2O1XA 1SKUA 2WJ4A 2YY6A 4BMOB 1EUZA 5L3VA 2POCA 2VJLA 2LW7A 3TOZA 4A2CA 3MRTA 3OBBA 5LFAA 1A9RA 1R0SA 1H05A 3TW6A 1R1DA 4M53A 2G67A 2P77A 3N0RA 4DABA 3BT7A 2L2QA 1M6NA 5FULA 8ADHA 4X63A 4CF7A 1MMFB 2HHCA 4D8TA 4PLWA 3JVVA 3DTYA 2XWQA 4PTLA 1QRDA 3VOSA 5B30A 1H1DA 3ETHA 3O83A 2YXEA 4GNKA 4R8LA 3UJ3X 2SICE 1OFHA 3KHKA 4D5GA 5KUTA 3RYCA 4JUCA 2CUKA 2YHSA 4CMJA 1EFTA 4AURA 2R8ZA 2WKSA 3PHHA 4N7BA 2VYNA 2QAGB 3HO6A 2PGLA 4PGAA 1A8UA 1AKWA 3SD7A 3TL2A 3LCMA 2HMAA 1DCKA 3AXSA 4LVCA 5JAQA 1JJ7A 2MOKA 2NYVA 1C14A 4FXPA 1NQVA 3R4VA 1KZ9A 5K3EA 3I9V1 3C7AA 4YONB 1Q16A 3O4IA 3THRA 2ZOSA 2GHTA 3S1SA 4AZTA 4KR6A 2XUDA 3QA3E 5FBVB 1CRZA 3JQ7B 4ZT7A 3WWZA 4YJ3A 4XD2A 3SYKA 4UXIA 1TF7A 3PV0A 1CUYA 1QGZA 5BWMA 1A5BB 5BWOA 1CC1S 3DLCA 1OT3A 4IDDA 4QRDA 5FHQA 2GM4A 1P7YA 3PFGA 2GH1A 1SOMA 3T3PB 2Y9MB 1NLFA 3A7EA 5KB3A 3LU1A 3EJ6A 4RTJA 4CG0A 1BMFA 4ZGGA 2FQWA 5HTOA 4HYTA 4HDSA 2H31A 1BQ4A 3HZOA 3NOQA 4BAZA 2CFSA 3B82A 4GR5A 3T1QA 4DIMA 5I7FA 4AS1A 5JH7F 3D1LA 4ASUA 4K9NA 3G9ZA 3M2TA 3N7UA 1THZA 5FOSA 5J1TB 4BFLA 3U3OA 4AM8A 1EG2A 3FD8A 2G5TA 2GJSA 5CGZA 1L8XA 3GXBA 2Y1WA 4E5SA 3B6MA 3D81A 5JARA 3MMNA 3QEKA 4NV0A 2ZUUA 3N07A 1G8YA 2G88A 1RIIA 1GUYA 4KI0A 4XOUA 4U2GA 4ZCRA 1GCIA 5JCJD 3IO3A 3EY4A 2ZXUA 3GBVA 1X8JA 4ID3A 4IUCS 4X24A 1SKYB 5FCDA 5C9ZA 2O4CA 3LUCA 4HGYA 5DHTA 1UZNA 1M2NA 3DAYA 1BKSB 3GUCA 4ZAXA 2I3DA 4L72A 1P60A 2XLBA 3H5RA 1JQJC 4HUTA 1QSGA 3O8DA 5FWXA 1YL7A 4B34A 5JE8A 4CQLB 4DQ0A 1JQEA 3RVMA 4UAGA 5DBOA 2R8XA 2I4IA 3BFPA 2QQEA 1O5TA 3JYLA 3NAMA 3L7BA 4WN9B 4AJNA 3QVSA 1SXJC 2QUZA 5BQ3A 4QU9A 4M0MA 4EFDA 3HEBA 1PSWA 4QXOA 3PQEA 1LPPA 1YB4A 2QXUA 3UW1A 2BI7A 2DEUA 1N1GA 4NICA 5LYJF 3ER8A 2F1IA 4AQYB 1TIKA 3E9CA 3KKEA 4V3BA 3R7AA 3BWEA 1Y6ZA 3U4GA 3F9RA 3VPAA 3LECA 1CG6A 3G1UA 4A2PA 3V4OA 1NNLA 3AW8A 2Q5HA 3JQGB 4N3CA 4UE2A 4X71A 2HJ9A 5HYVA 5BXYA 3V7WA 3WNDA 4DMHA 2ETXA 3P96A 3TZKA 4URWR 1VLHA 1SIUA 4C6SA 1HPLA 1L7QA 1JKIA 3Q8WA 4QGFA 5T6MA 4QKQA 1JEQA 1M1XB 3OLZA 4ALKA 3SFVA 1ZD5A 3IJRA 2Y76A 3KT8A 4RO0A 2AN3A 4W99A 1XTSA 3PQ8A 2OGWA 5ALNA 5BQPA 3U4DA 3K1AA 4AG6A 4DRXB 2ZETA 3QYPA 2B36A 2N1MA 4NQRA 3CC8A 3FUVA 3DZJA 2ZS9A 3DHEA 4G1VA 4F2PA 2JCGA 1AURA 3LHFA 2VZEA 3KZ1E 2LGJA 5BW5A 1RM5A 3IMGA 5HBRA 2WJYA 3ILYA 2QJRA 3KHTA 1J5EB 3PHGA 4HS4A 5ARDA 4BO6A 4EDHA 4XWWA 2LKCA 2WYWA 2CSXA 4PCLA 3C3JA 3TNYA 3R8FA 1AN0A 1Z82A 5DBGA 3AHGA 4F3NA 1U8AA 3N2EA 4RH1A 1O5IA 4GU5A 3L0CA 3FCEA 3TVYA 5CIYA 1JHDA 4ZHSA 4KK3A 3OC6A 3G7SA 1Q57A 3ZOZA 3WX0A 2PEYA 3GJTA 1GFSA 3K0BA 4WY5A 3B2QA 1L1RA 3IUBA 1CVLA 4KQFA 3C1AA 4KDRA 2RGWA 3K30A 1XRPA 4OLBA 3OQHA 3OOSA 1ZLXA 3PLNA 4EYGA 4J1TC 3ADBA 1XK6A 4DAOA 1GTSA 4WY2A 3C8DA 2CMHA 4BNNA 3NBKA 4KV9A 2Z9BA 1J0XO 4I1VA 4ND8B 4KN9S 5FKJA 2Q3EA 2VAVA 1JLLB 3BQMB 3U39A 3FYUC 4IFIA 3LBYA 2XOEA 4MPDA 1DI0A 2NO9A 3MK31 4EG3A 2XUZA 4NZPA 3QMMA 1VL0A 2P6UA 3ABIA 4OHCA 5CPFA 5EWLA 5GONA 2INGX 2N46A 4KR3A 1XZGA 3NC4A 5KJ1A 4MI1A 3W06A 3WSVA 4K9SA 4BNFA 5AKJA 3LT4A 1IUPA 1BKYA 1HL7A 5BW6B 1HDEA 3T4XA 3D43A 1R5BA 3IPAA 3A3PA 3TM5A 4CN9A 1HR0B 4MPPA 4QVIA 2HSGA 3BCUA 4PPNA 2YC4C 2X8JA 2XWPA 3D31A 3A0RB 1GGHA 4YPFA 2AXPA 2A1IA 4FZ5A 1YACA 4LJ4A 5TNXA 3OWOA 1C4KA 4M9RA 4OXXA 4FWTA 1X1SA 4QM7A 1JG3A 2P9GA 4PYJA 3G68A 4NYMQ 4MDHA 3LTEA 2COUA 3AKEA 2AFIE 3LUHA 4QD3A 2UXDB 1DFHA 2XD4A 1ZS9A 1XWFA 1L8OA 2EBWA 5G4KB 5TF4A 3UBTA 3D3QA 2QB5A 2I2FA 4KBGA 3AEQB 3DBHB 2F1JA 2VP3A 3A4MA 2Z2YA 2UZ3A 1O95D 3RO7A 1T1EA 4ZRDA 1EAYA 3PICA 1G21B 1UKYA 3H8VA 5I7AA 5M7EA 3BTSA 4K9OA 3S55A 3BK1A 2ZB7A 4W5QA 1VP9A 4U0KA 3OE7A 4Y6QA 4C78A 4DOMA 4LZPA 3IVCA 4M98A 4KIUA 1KO1A 1YZKA 4EWLA 1UXOA 1ZN2A 5E6SA 3FJ1A 5HHTA 2A9JA 3MD0A 3O03A 4UPEA 4OAPA 4TTSA 4LHSA 5CD9A 4DDHA 5I3CA 3LT2A 4C06A 5JT1A 1UBNA 1YHZA 3D6TB 3JQFC 1MV5A 3QF4B 4IOJA 4KPGA 1Y89A 1W76A 4QVGA 3R9IA 1Y3DE 4Q9HA 4J1QA 5F7XA 3QMPA 4HGPA 4Q9KA 4JUDX 3MTJA 2D1YA 1JPUA 4F86A 4BZXA 1GTG1 3KSRA 2FMKA 3HFGA 1UIRA 1D6JA 4HNRA 3T61A 5ELXA 2JAPA 1U8FO 5FNZA 4DZRA 3NDRA 4EJSC 4GG1A 1GZ3A 1ST2A 4G84A 5JQGB 5A6SB 3VNVA 2F1OA 2HMUA 4X60A 2JA1A 2QXTA 2YS7A 5A4AA 4JHLA 3A2NA 4NQZA 2J9YB 4XB6B 1H2HA 5FPQA 1KI6B 4D0GA 3FHTA 1L7MA 3LVQE 2HCBA 2JGKA 3JSXA 4CDMA 1U0SY 1EESA 1N4DA 1ZKDA 2YX1A 2FY8A 3ID6C 4MV8A 4N5DA 4MW1A 1Q17A 2CEAA 2EJVA 2VPTA 3BGSA 4H16A 5ALZA 1DEXA 2ZYHA 3DOFA 4QJ4A 3UHJA 2VHVA 1RLIA 2R8EA 3TJZA 4DTIA 2WINI 5F9HA 4RHYA 3ZGXA 2O8DB 4MI9A 1IPHA 5FYDA 1MO2A 3GT3A 1YQGA 4ZT4A 2P0EA 1P0MA 3DL2A 4DR6B 1JVNA 4CDGA 2FGKA 3CT6A 1ONNA 3NIWA 3FUCA 5IUKC 2CHVA 3H2SA 1DZ3A 4GBJA 4BRSA 4R2WA 1IWOA 1D1QA 1HEUA 3AJRA 1NQTA 3SYNA 3GG9A 5JSKA 1K7YA 3L0OA 4LSGA 4QZVA 4KXVA 3ROMA 3DZGA 2X0IA 1Z6ZA 1P5ZB 1S8OA 4ABTA 1YE8A 3KXLA 1ZNQO 2ECQA 2R1UA 4HMQA 4JLSA 4M60A 1CUGA 4GBGA 2VJMA 3O2JA 2Z9CA 3Q0TA 4OGLA 3VYSB 3NI2A 2R62A 3VR6A 3L9XA 2XMQA 2FKNA 3PEWA 2PZAA 2GLTA 3PIIA 3ZK7A 4HTFA 3M34A 5LU9A 4CEIA 1YZNA 2OXEA 3FH0A 3LX4A 2A9KA 3F3SA 1AO3A 3PUHA 2PJZA 4HQ6A 5BV2P 3CX4A 3TX6A 2R6FA 5EIBD 4NKRA 2O2ZA 4ID9A 4BNUA 2EZ8A 1CUHA 2XDAA 3U3JA 1LX7A 1T5DX 1HE2A 3N8NA 3QE9Y 3BMXA 4ZVKA 3L4JA 4KKVA 5TX7A 2OEPA 2EGUA 2QLTA 1QFZA 3EIQA 4OB6A 2V7XA 4O4LA 3I09A 4XLLA 4UQLA 1E62A 3HB0A 3BIOA 2G09A 2NAPA 4X1IA 4R71A 5KOHA 2PWAA 3R5XA 3AU8A 3OD1A 1UBLS 1UXHA 4NHEA 1HDZA 4URYR 4JWKA 2GF9A 3CUYA 4R83A 3HL4A 3AH8A 2PZGA 3QSGA 2C2MA 2P40A 4XPZA 4IHJB 3GVXA 4R8KA 2LZ0A 4DUZB 4MWGA 3VNAA 3C14C 1PGJA 3B9BA 4YCSA 5LYJB 1C3VA 2R47A 4TMKA 4CGYA 2PDAA 5SY4A 4XKJA 1N2ZA 3F73A 4LJ7A 3UEOA 6AT1A 1JE0A 1UZMA 3E6AA 3U56A 1YTLA 1ZVVA 1NSTA 3DYVA 2IYVA 4KVFA 1YRBA 3GJ8A 4RPIA 4YJDA 1G4AE 1ILWA 1B1CA 4ZI5A 4HX9A 4DYDA 4CEJB 1Z0JA 3H8JA 3I4CA 3BWDD 2Q1XA 3OLCX 4TTPA 2JK1A 4R1PA 1S9HA 3NWJA 4WJZA 4Y0AA 1YNOA 4D3SA 2QBYA 1EUDB 5JW6A 2EKPA 1DQZA 2HA6A 4MR8A 4QG3A 4V3CA 5FFMA 4N5LA 1CIVA 2OZEA 3ND9A 3LPDA 4YRPA 1KH3A 1YUBA 3TLAA 3F4BA 4CW7A 4YXWD 2QQ5A 4UULA 3HP7A 5LB4A 4F6CA 4U7FA 4J0GA 2RGXA 4DRYA 1M76A 5GZ6A 1Z5NA 1FTQA 4LHYA 4O59O 1X7GA 3D8HA 2W48A 3R0JA 3WLSA 5CCXA 2PX0A 4NCAA 1Q7BA 4AS3A 4YV7A 3ZX5A 2QDXA 3M83A 4ZDIA 3TN7A 2DT5A 2P9BA 3BE4A 2AEFA 4LK3A 4MCAA 3FOZA 1FW6A 1S7CA 3ED1A 1JT9A 3G0CA 4TUYA 2BMEA 7AT1A 1CUIA 4F21A 2DBRA 3ZDZB 2BMJA 3QWFA 5B6IA 1RTKA 4IHQA 2N47A 3STYA 1U2DA 3NXSA 5DK6A 4C5BA 4RF3A 3SDSA 1Q1ZA 4ER7A 2JH8A 3QGMA 1EX1A 1P45A 1U8YA 4DMCA 1LPMA 1ZVMA 2FTKE 4UU7A 5A2QA 3KU4A 1FE8A 3R7DA 3LSYA 4Q39A 3NHMA 2O57A 1I9GA 2DP4E 5K20A 3M4ZA 2QX9A 2VQDA 4W9NA 4GHWA 4JSTA 4FGLA 1HO3A 1SHKA 3OCJA 2GCNA 5G3YA 3TSCA 4BOYA 2NTEA 3E1GA 1KR2A 5B1SA 1YZYA 2FR1A 4UNRA 3KB2A 2AMJA 1W47A 2PMWB 2WSIA 3KVVA 3O84A 1SNYA 4US2R 1MAVA 4MYCA 3RGGA 3SEFA 4EARA 4MHSA 2Y9PB 3V8BA 3Q8LA 2C5HA 4R05A 1ZJ5A 5GJWC 3UHAA 5J2UF 3DOEA 3ZCTA 3CA8A 1C4WA 4IGEA 2HHHB 2H7CA 2JCVA 1ODSA 1T9AA 1NQAO 2OBYA 3ELWA 2GDZA 3M6VA 5D3ZA 4ZXFA 3SZUA 1I6LA 2FJ0A 2OGTA 4NY1A 1IN8A 3IAM1 4Q3CA 2V3VA 5AVVA 3E3MA 4RJKA 3TTYA 4EPXA 1QYRA 5TS2A 3VYTB 4MRMA 1ISIA 2IZ6A 1N5OX 4RD0A 1P1JA 2D4HA 1XMOB 3M6XA 3HFSA 3LXMA 4GVXA 4RD6A 2IF2A 3ZHXA 4JUAA 3TI9A 4KK4A 4C5AA 4NNOA 1J9ZA 3OEEA 4YBRA 2C95A 4NXNB 2XB4A 2WF5A 5DFAA 3VOAA 1JFFA 2VH5R 4HAXA 4H15A 5GZ3A 2Z5GA 3JRNA 4YAGA 2VP2A 2XUPA 3IOMA 3OJOA 4IUYA 4KVGA 4II3A 3W2IA 4L50A 3QW4B 2ZR8A 2X1VA 3ENZA 1OU4A 4X6LA 1NYRA 4ARUA 4ZQGA 4HC4A 2YL2A 2E49A 5JFOA 4BX8A 1JMVA 1IG0A 1RPAA 5JEDA 3OTWA 1DNPA 5EFOA 3ZS8A 3N28A 3H2ZA 3Q6IA 1WVMA 2HO5A 3N76A 3HVHA 4ALMA 3Q72A 4TV8A 2Y4OA 1EWVA 2CD7A 3BH0A 2CFTA 3VR5D 3NYWA 3F2IA 4PS1A 2NADA 2FPGA 2A9VA 3F46A 4UMFA 1I9CA 1CNMA 1GAQA 1JF8A 3M89A 2B5WA 2MR6A 1JZQA 3CF0A 3H1PA 2I1LA 4MLDA 2VWPA 5FOVA 3O8LA 1TVMA 3HCCA 4RZUA 3BE6A 3I4FA 1V5FA 4O0MA 3D1JA 3WS7A 1Y3HA 3EXHC 2QGFA 2NIPA 3LVRE 3AYXB 3IJEB 5JDCC 4ZTZB 3H9CA 1RAIA 1QYWA 2RKOA 5EJMA 3GF4A 5C53B 3ZLVA 3TI7A 4FFRA 3N2YA 2P4QA 3EIOA 5B7QA 1BA2A 1I13A 1PVVA 3U31A 2P6RA 4NDAA 4INAA 4HDCA 3BQNB 5ALSA 4NG4A 3NHAA 5J5AA 1ABEA 1UKZA 9LDBA 1RT9A 4ZI2A 3K96A 5LLTA 1R4MA 1R74A 2SNIE 4UBNA 5GTDA 5JXJA 3NEJA 5J4KA 2I2XB 2J9GA 1CZUA 3LL4A 3DBLB 3MTQA 2C7QA 3CF2A 4C7KA 1C9NA 5BV1A 5J4VA 3VKGA 4PLYA 1OUMA 2OB2A 2UV8A 4IBOA 1EFPA 1XNQB 1PX0A 3WRXC 4QFMA 4CIDA 4XZ3A 2CV1A 2OCXA 2BKEA 5AM2A 2FZVA 1G19A 1SFRA 1DQYA 1M2OA 2QTMA 2YASA 4PCAA 2C2WA 1BWSA 4GMFA 4C7VA 1GSAA 1Z0IA 2F7SA 2B0JA 3CONA 1XMQB 1ZK4A 2BEVB 3DV0A 4ZIRB 4ZC8A 1W6RA 2RHBA 2YDXA 4B83A 2B35A 2YZKA 5IAEA 1ZOPA 4ZQFA 1G3IA 2CJPA 2PT6A 4BBJA 5HWSA 2XCSB 1M6VA 4F04A 5L6LB 1IY9A 1KYYA 2D2EA 2OBLA 3RC3A 1RHKA 2MSDB 3FW1A 3HCBA 2QP9X 3DYBA 5AW1A 1A8QA 3P1JA 3ASUA 2R1VA 4HDKB 1AOXA 4Y2VA 4QGAA 4OXNA 3SSAA 4G9GA 1R66A 4IMPA 4EGCB 1P5RA 3TO5A 2XF2A 3A28A 2ZIZA 4FC7A 4FFWA 1R8XA 2PZ8A 4L15A 1MENA 1YR8A 2JD1A 2VTBA 2I6SA 1H5NA 1SG9A 3KJIA 4KAXA 3H19A 1IRIA 3WZ2A 4BX0A 4ZHQA 4DZZA 2B69A 1L5WA 1LU9A 4TS1A 1AS2A 3JQ8A 4DA7A 1PJZA 3N0VA 1IDOA 1GV0A 4MVJP 1SUDA 1B8VA 2LP4Y 3VSAA 2XBLA 3L0IB 1HWYA 4FNOA 2PUHA 2G7ZA 4EAAA 1LUAA 3RU9A 2C2KA 4ND3A 3KFXA 1N5KA 1SBCA 4B81A 5CA1B 5JPCA 1I3CA 3LDFA 1E3QA 3DVAA 2DY0A 4PG6A 1FTYA 3G02A 3S6JA 1E9EA 2JEOA 2ZJ5A 4RF4A 3W7AA 4FLFA 2A6PA 1PR5A 2W6PA 1B43A 3CLTD 4I4TB 4EB8A 1UWCA 3ASVA 2XOXA 2FWBA 2XT6A 4NBNA 2B2XA 2NQTA 2DT8A 3BEDA 1G5IA 3W0LB 3WMRA 4EL5A 1BDMA 1JLHA 1HYGA 1PJTA 2OCYC 3WI7A 4ZAFA 3KL2A 1XZFA 3SJ7A 1MABA 3JPWA 1JPJA 2JFZA 2PD3A 3SF8A 1ADCA 2PLNA 2ZTHA 3HKBA 1H9CA 1EMDA 3B6IA 5JJ5A 1DIOB 3NBQA 4ANFA 2H7VA 5H59A 4LYYA 3AY6A 5LP6B 3A2KA 1NBAA 2VPXA 3PNPA 1USKA 3K0AB 4HEA1 2QNRA 4KXLA 2W93A 1EX6A 3I5AA 3U3MA 3UT5B 1XKTA 1A97A 2PT5A 4B33A 4JENA 5B6PA 3UIEA 3CE9A 2IYLD 1W4CA 4JSYA 3ANTA 3EXFA 3LE8A 4L28A 3ROEA 1ZLYA 1XL0A 4KL8S 3RBXA 1L9XA 4CQMA 3ACCA 1U7OA 3JQ9A 1I1NA 3MJFA 1QCYA 3OZCA 2FPUA 4S12A 4ZD6A 3TR5A 4AJLA 4D0SA 2ZVJA 3BQ9A 3MERA 3WLEA 3HXPA 1HNZB 5ES3A 1LDYA 1FPQA 3AHIA 1ZM7A 2BAGA 2FSFA 2WJPA 2XMDA 3OC0A 4IG4A 5ALUA 1PZGA 3OX3A 5KDLA 3KYJB 1MX1A 5T4EA 3IPCA 4URHA 4DKXA 3UKDA 1RWXA 4WMLA 5REQA 4CM5A 3EDYA 1TA9A 1X7YA 3RANA 3FMFA 3KQUA 1VLLA 2BJWA 2Y66A 2LRHA 4H1VA 5BXQC 3MXTA 4OHUA 5C1IA 3WP0A 4Y9SA 5COAA 4BTVA 1DG3A 1Z8FA 2C78A 2DFVA 4RTOA 3USCS 3GLTA 2IPMA 4IX1A 4RVFA 4I55F 4NAHA 1QHSA 5GPBA 3UA4A 1PR6A 1CVRA 3WBFA 2P41A 3KIPA 3PR3A 3QUBA 4MVYA 4BO8A 2PV0A 4DCSA 3MXOA 5HKOA 2CXHA 3ZWAA 1KGSA 4J0HA 4RY0A 3FLEA 4M37A 2HJVA 3UOAB 4BLVA 3IKLA 3IERA 4HN4B 4L9RA 2DFLA 1NLYA 3PC8A 1NRIA 1OX4A 1JSLA 3HDTA 3IE2A 2LDBA 4X3PA 2V45A 1HYHA 3GGDA 3HP4A 2GA8A 3RU3A 3C1UA 1VIAA 1GG9A 4YJ2A 4MKIA 1IZ8A 3C3AA 3CZ5A 5GY7A 1J33A 1QVWA 1ORDA 3A9CA 3R5FA 1WP9A 3Q3VA 3KAQA 4DCVA 3OEWA 3MJCA 3GFBA 4XR4A 2JIOA 2NU7A 2V6MA 3OZFA 4JLPA 2R60A 1ZN7A 3RW9A 1E0JA 3H2GA 3QE0A 5GM2A 3HVIA 3WIOA 2G9VA 2DLCX 2D62A 2JZCA 2XZDA 3FDIA 4W9RA 2JFWA 4ZEMA 3AC0A 1H8HA 1UXIA 2Y27A 4FYJA 4N7MA 2BLNA 4RZ3A 4F4IA 4F11A 5FUVA 3CRVA 1L4EA 1CJCA 3PI7A 3R3UA 4HMPA 5L3QA 5HGJA 1K68A 1AXRA 4M86A 5KI6A 4U02A 4Q1AA 4FW8A 2DSNA 2AW5A 2FPLA 3EPLA 2FSSA 2NUPA 3OHSX 1YCHA 3O93A 4V2IA 3IIEA 4X7RA 3U0VA 4BVFA 1N5IA 1ZQ9A 1JU9A 1FA9A 1W88B 2GILA 1NR7A 1OTXA 2GK3A 1ZJZA 2YC2C 3VGJA 1XZNA 2P75A 1SVMA 1JYEA 4RD3A 3SYRA 4ZP1A 4LZOA 3PE4A 1H65A 3H42B 5KKCA 5K05A 2GT1A 2E6KA 4GH5A 5DLQC 3KZVA 5LCXA 4EDFA 3MTDA 3YASA 3OX2A 2YIJA 3EZ2A 1NP6A 3SK0A 1XYYA 1WNTA 4MQBA 2Y1LA 3BFXA 1J8DA 3FDZB 4OJYA 4XW2A 3RUDA 1HDYA 4F6RB 3IJ5A 1GZHB 4S0ZA 1B0AA 3CVUA 3KG2A 4XQEA 4U2DA 1GO2A 3VKUA 1P0FA 4WLUA 2ZUTA 1NVUQ 3BDIA 1XTVA 5EG5A 1KDTA 1UMCB 3MOSA 3MF4A