2VDVE

Structure of trm8, m7g methylation enzyme
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
227
structure length
216
Chain Sequence
NPFSDHQLEYPVSPQDMDWSKLYPYYKNQMTKKVTIADIGCGFGGLMIDLSPAFPEDLILGMEIRVQVTNYVEDRIIALRNNTSKHGFQNINVLRGNAMKFLPNFFEKGQLSKMFFCFPDPHKARIITNTLLSEYAYVLKEGGVVYTITDVKDLHEWMVKHLEEHPLFERLSKEWEENDECVKIMRNATEEGKKVERKKGDKFVACFTRLPTPAIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Yeast tRNA M7G Methylation Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
molecule keywords TRNA (GUANINE-N(7)-)-METHYLTRANSFERASE
total genus 62
structure length 216
sequence length 227
chains with identical sequence F
ec nomenclature ec 2.1.1.33: tRNA (guanine(46)-N(7))-methyltransferase.
pdb deposition date 2007-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02390 Methyltransf_4 Putative methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2vdvE01
5GP1A 3G88A 2IPXA 5EZSA 4YUZA 5KS2A 2OXTA 3O4FA 2GAFA 4GC5A 2V7EA 4MIKA 2G72A 3EVGA 3P9NA 4PYNA 3IEIA 2VDWA 1KPHA 1FJXA 5BXYA 2ZIGA 1ZG3A 1SUSA 1QAMA 3LCVB 3OU7A 1KIAA 5EEHA 3VYWA 3WSTA 2OPBA 2CMHA 3LKDA 4F84A 4QPNA 2FPOA 4LG1A 3TLJA 3NDIA 1TW2A 3HCEA 5CD1A 5EHIA 3TKAA 3M6XA 5IH3A 3T7RA 2OB1A 3NDJA 2PLWA 2GLUA 3FYDA 3UZUA 2BR3A 3A25A 4WXHA 1BKYA 1NBIA 1KHHA 5DSTA 2IFTA 1NW8A 2R3SA 3BXOA 4AZWA 2UYCA 1YUBA 2YXDA 4FT4A 5K0LA 2NXNA 2ZCJA 3HVIA 4IWNA 5K0EA 5ICCA 3GCZA 1QAQA 2ADMA 4BY9E 3EVFA 2B3TA 3OPNA 3T7TA 5KQSA 1AF7A 2YR0A 3EVEA 2UYOA 3KQSA 3EEOA 3HA5A 1P1BA 4PWYA 3CKKA 3IV6A 1D2HA 3DLIA 4KDRA 4KIFA 3V97A 4C07A 4HG2A 4E32A 3PLAE 5GM2A 1RJFA 2HTEA 2H1RA 3M70A 2BH2A 1G8SA 1Q0SA 5CM2Z 4C08A 3M33A 2ESRA 2FCAA 3LKZA 4PINA 4B17A 2PT6A 3ELUA 5GWXA 2OB2A 4PYMA 2AOTA 3TM4A 2QRVA 3HCFA 1JG4A 1VIDA 2PJDA 2FK7A 2XVAA 4LWPA 2I62A 1RJEA 2HNKA 2EJUA 1JQ3A 1WY7A 4C05A 4PGHA 3KU1A 4YMHA 3BT7A 4P7KA 1IY9A 2ZSUA 9MHTA 2PX2A 2PT9A 5GIOE 5KVAA 4DKJA 4KRGA 4RVHA 1X1AA 3I53A 1VPTA 1YFJA 3DXZA 3ER9A 1JSZA 3GIWA 5DTQA 4FZVA 1ZKDA 5CIYA 3G5LA 2G1PA 3GXOA 3UJAA 3KKZA 3MQ2A 4NECA 1BOOA 2CL5A 3GRUA 3KQPA 2OZVA 3B89A 2PY6A 2ZBRA 4GQBA 4V0RA 2IBTA 1AV6A 2PX5A 1U2ZA 3GRZA 2NP7A 2UYHA 1IM8A 3I5UA 2PX8A 2O07A 2WA1A 4HGZA 5KQRA 5ICFA 4HRAA 3NW9A 4PIMA 5ERGB 3M4XA 2ZULA 4LWOA 3TM5A 5CVUA 5HIKA 5EMKA 4P7GA 5LQUA 1O9GA 3KQTA 3LCUA 3R3HA 1PJZA 4X60A 3BZBA 5K0FA 4GC9A 1D2CA 4X1OA 5E1DA 4ER6A 1PRYA 3KQWA 5K09A 5DXAA 5EMJA 4FS8A 1M6EX 5E2BA 2PWYA 2ZIEA 3QV2A 4PONA 3DUWA 4E2ZA 4RWZA 5DM2A 4YV1A 4AZSA 5JR3A 2OKCA 3EGVA 3CGGA 3LECA 5EC8A 2AOUB 2DPMA 1RI4A 4ER0A 5CVEA 4DA4A 4A6DA 3P8ZA 3FPHA 3UA4A 1XJ5A 2BR5A 4DF3A 1JTFA 1YFLA 3L8DA 1M0EA 3ME5A 5P8WA 2C7QA 1NW7A 4CKBA 3R6TA 1X19A 4CKEA 3FTEA 1QAOA 1EIZA 4POOA 3C3PA 5EQJB 2PX4A 3KQOA 3SXJA 3PTAA 3KPUA 4ER3A 2HR1A 4E2WA 4RYLA 1UWVA 4E70A 1TW3A 5EEGA 5F2NA 3UA3A 3MERA 3Q7EA 3HM2A 3G2QA 3HCBA 3ELYA 5K05A 3AJDA 2Z6UA 8MHTA 3B3GA 3M6WA 3P9IA 3UJ9A 2P41A 5FWDA 5K0GA 1Z3CA 3LBYA 3JWJA 4BP1A 4GF5A 1NW5A 2K4MA 5CVDA 3P71T 3SX0A 3OFJA 3FZGA 3D2LA 3HNRA 1JG1A 1WXXA 4QVGA 2O05A 5E9WA 3UJ8A 4X41A 1MHTA 1VQ1A 4E2XA 4QQNA 3DMHA 3ER8A 1O54A 4FP9A 1INLA 1FPQA 4HC4A 3RIEA 3IHTA 3EVAA 3FUXA 5FHQA 5LQAA 1XXLA 3C3YA 1XCLA 4QQKA 4FT2A 4R05A 4Y30A 2IP2A 2JHAA 2VDVE 4Z2YA 1ZHFA 2PXXA 4YUVA 2I9KA 1IXKA 3GRVA 3CJRA 3BWYA 5HZMA 3NVKI 2G70A 3DMGA 1JG2A 2NP6A 2I7CA 3CCFA 4OBXA 1WS6A 5K0BA 3QOWA 7MHTA 3G8BA 4QTTB 1RI5A 1JR4A 4HGYA 3T7SA 4AX8A 5IKMA 3GNLA 1I4WA 5LR6A 2VP3A 3OU2A 1XDZA 1ZGAA 3AY0A 5DLYA 1SG9A 1D2GA 1OR8A 1WG8A 2F8LA 2YX1A 3E7PA 2AZTA 5EIFA 2LD4A 3DOUA 5EVJA 4EKGA 5F2KA 4R6XA 5H02A 3DXYA 4DCGA 4XUEA 3MCTA 3FPFA 2QYOA 2Z6QA 4EKIA 5G02A 2E5WA 3R24A 2FK8A 3DH0A 5DX1A 3UJ6A 4BLUA 2VZ9A 1KPIA 3G5TA 4RTLA 4ER5A 4CXMA 3BWMA 1DL5A 3HCDA 2V74B 4F85A 3EPPA 5K8VA 3FRIA 1SKMA 1XCJA 2AS0A 2GB4A 5CCXA 1G60A 5GOZA 2DULA 1BC5A 2Y1XA 2ZBPA 3THSA 1Y8CA 2ERCA 4RTQA 3B5IA 5FWAA 4PYKA 5CVJA 4GBED 3KQMA 3KR9A 3P2IA 3E05A 3P2EA 5FQNA 3REOA 3ELDA 5M5BA 2IH2A 5CVVA 2EFJA 5BP7A 3NWEA 3TMAA 3GDHA 5FTWA 3LDGA 5U4XA 2PSSA 1KXZA 2AOTB 3HVHA 1XDSA 2OBFA 5LQRA 1MJFA 2FRXA 4RV9A 4CKCA 1ZGJA 3CBGA 4PIPA 1T43A 5E2AA 3THRA 3VSEA 1JQDA 1L9KA 5DX0A 2IGTA 4AUKA 5HEKA 3KPJA 5FUBA 5ICGA 1KYWA 2PVCA 3BKWA 3SGLA 4CTJA 3NMUF 3C0KA 3GGDA 2H11A 3EVBA 4P7FA 1KR5A 1ORHA 4KWCA 3I9FA 5EPEA 3V8VA 5FQOA 4ATNA 1YZ3A 3FUTA 3UJBA 3SMQA 3KHKA 3LX6A 4ZTBA 2IDJA 1N7IA 4OA8A 4PYIA 4YUXA 2GH1A 4M36A 1WXWA 4IKPA 2NNWB 3E23A 2OYRA 1O9HA 5FADA 5LQJA 4EMSA 1L1EA 2P3QA 3FPJA 4KDCA 1YB2A 3GO4A 5C0OE 5T67A 1X1DA 3U81A 2JG3A 1JG3A 3RODA 3B7PA 4KW7A 4FGZA 1R8YA 4G56A 5EMMA 2IDKA 2ZVJA 2Z6AA 1DUSA 1R18A 2AN4A 3HVKA 3OZSA 4BLWA 1YF3A 3CJTA 5DXJA 4HSGA 3M6UA 4XCXA 2ORED 3KPYA 3F4KA 4H0NA 5DM4A 3OZTA 5D1HA 3C6MA 4O29A 2AOXA 3BUSA 3KQVA 3P9KA 4HTFB 3FTCA 1I9GA 5DPMA 4XUDA 3P2KA 4KVZA 3M6VA 4X61A 2FYTA 3BGDA 1ORIA 1BHJA 2AOUA 2QE6A 2R6ZA 5E8RA 5GINE 5B1SA 5EOVA 1P1CA 5DTRA 3IYLW 3PVCA 1KP9A 1N2XA 3ERCA 1VP3A 1NE2A 3KPWA 2EX4A 3FUWA 2XYQA 4M37A 3SM3A 4X63A 3TR6A 3AXSA 3HA7A 1I1NA 2ONZA 3I64A 5DM0A 1KPGA 3G89A 5CCBA 5FCDA 1NV9A 4IV8A 5D1NA 2P7IA 5EIWA 4OA5A 3GJYA 5DWQA 4M7RA 3MB5A 4E33A 4RTOA 2C7PA 3HP7A 2QRVB 1SQFA 3G2MA 3HCAA 3HVJA 3LBFA 5EZQA 3PT9A 3HEMA 2AOWA 1AQJA 2VDUE 1EQAA 1VE3A 5FHRA 4OQEA 1VL5A 3KR2A 4YMGA 3MTIA 3A7EA 3X0DA 3DLCA 3EVDA 3MHTA 1R6AA 2O57A 2ZFUA 3I58A 3SSMA 3HA3A 3PX2A 4HTFA 3SR4A 4PCLA 4PYJA 2B2CA 4EK9A 3SVZA 3HTXA 4DM3A 5DRYA 4UOEA 2CMGA 4E31A 2FHPA 5LQNA 4MQ4A 1JTEA 2XYVA 3PFHA 4RTJA 3NTVA 5GIPE 3OCJA 1F3LA 5LQKA 4MTLA 4RVGA 4U7PB 5HILA 4QDKA 2H00A 5FA5A 2ONYA 3EGIA 5EHGA 3A27A 3UJDA 3G2PA 2WK1A 1UFKA 2NXJA 2Q41A 3LDFA 3C6KA 3OU6A 1YZHA 2B78A 3GWZA 2QM3A 3CVOA 3AXTA 2PXCA 3MAGA 5E1BA 1Q0TA 4OBWA 4OX9Y 1SUIA 4FSXA 4GOMD 5F2OA 3DP7A 4RTRA 4QDJA 1F38A 4OQDA 3TKYA 2ZWAA 2UZ4A 2AN3A 2IH4A 2CWWA 4R6WA 3EGEA 3TQSA 3G8AA 4DCMA 3DR5A 3UBTA 4RTKA 3RW9A 1B42A 3MTEA 2YXEA 4QVKA 4E30A 5DM1A 2KW5A 4HH4A 4PCAA 2PWPA 4GOND 3GU3A 1SQGA 4EVIA 2XVMA 2ZTHA 1ZQ9A 3ANXA 1XVAA 4PYQA 5FA8A 3TPZA 3UJ7A 4RTMA 3PB3A 2GPYA 3AWIA 2AOVA 1G55A 1L3CA 5K0JA 2B25A 5LQCA 2IIPA 3NWBA 5T64A 3SSOA 4A6EA 3DTNA 3DMFA 5EKXA 2BM9A 4RTNA 3H2BA 3VC1A 2O06A 2EG5A 3E8SA 1NKVA 5E9QA 1NBHA 4PNEA 5EKUA 5HOQA 4RVDA 2P40A 3A4TA 4P58A 4CTKA 1EAMA 2O0LA 4PYLA 4DZRA 4RTSA 3BGIA 3SSNA 3K0BA 5MHTA 3P97A 5EMLA 3CJQA 1NT2A 5T6BA 1HNNA 2AR0A 3LDUA 2BM8A 1H1DA 4WVLA 1M6YA 5FULA 2ZZMA 5DT2A 3ID6C 4R8SA 2ZWVA 2UYQA 2PGXA 1NW3A 2C7OA 1VP9A 4GOLD 5GM1A 2GA9A 1TPYA 3EVZA 2YXLA 1R74A 3FTDA 3LL7A 3T0IA 3OE4A 5EGSA 2YUIA 2ZZKA 3FRHA 5KYGA 3GRRA 4L7VA 4RX1A 2G71A 5DTMA 3UFBA 1KYZA 5BW4A 2QY6A 3ORHA 4MHTA 4JXJA 1L3IA 2PV0A 3KR1A 3LGAA 3EMBA 2P7HA 2N47A 2EJTA 4LECA 3VC2A 2PKWA 5DSXA 2VS1A 4BLVA 4DMGA 3BKXA 4YV0A 1G38A 3A7DA 2XBMA 5HIIA 5C1IA 2HWKA 5C9ZA 2P35A 2AVNA 2IH5A 3R9XB 3LPMA 3TOSA 2AVDA 4RSRA 1AQIA 1G8AA 1EJ6A 3BWBA 1EG2A 3UWPA 3QOXA 2HV9A 2CKDA 3ELWA 1QZZA 4U7TB 2G8NA 2AN5A 2PBFA 3PX3A 3B3FA 3KQQA 5E1MA 4PGGA 5E1OA 4YV2A 4PYOA 4YUYA 2ZBQA 1HMYA 1UIRA 2OO3A 2P8JA 2YQZA 5K01A 1V39A 3LSTA 3EEYA 1VBFA 3OFKA 5HIJA 3Q87B 4IV0A 2I6GA 2Y1WA 5K0NA 3DXXA 2ZW9A 4C4AA 4ER7A 2NYUA 4KIGA 1XTPA 1G6Q1 3DULA 5CUQA 4F86A 4EQZA 3FTFA 4ISCA 3OZRA 3PFGA 3R0QA 5ICEA 2ZLBA 2JHCA 4CWAA 2P1DA 2JH9A 1P39A 2JH8A 1FP1D 4V0QA 1JQEA 4C04A 1RI2A 2NXEA 3G7UA 3NVMB 4RTPA 1JSXA 3A26A 3G2OA 2JHPA 3TRKA 1RI1A 2OY0A 1QYRA 3HCCA 3KQYA 3GRYA 4RVFA 5JUWA 1WZNA 2YVLA 3JWGA 5K03A 3O31A 2NXCA 1RI3A 3MCZA 4M38A 2ZIFA 1SVUA 3KR0A 4AZVA 3UJCA 4P7JA 4E2YA 3PS9A 2WA2A 1NV8A 4XUCA 5BW5A 4K6MA 5HIMA 4FR0A 4YUWA 1RJGA 4FSDA 4C03A 1DCTA 1R8XA 1X1CA 2A14A 2GS9A 4GEKA 4GOOD 2P3LA 3EVCA 3JWHA 3FPEA 4R8RA 4Y2HA 2PXAA 5DX8A 5HFJA 4AZTA 2P3OA 3CC8A 1R00A 3JWIA 3KPVA 5DRTA 1NW6A 3O7WA 1FP2A 2JJQA 3FUVA 5E8JA 4BP3A 3FUUA 5K0CA 1QANA 2XYRA 2BR4A 3EMDA 2YTZA 4DQ0A 3LHDA 5E9JA 1N7JA 3S68A 4MWZA 1X1BA 4QTUB 3MGGA 3P9CA 2B9EA 10MHA 3FPGA 1VLMA 3K6RA 3B3JA 2C7RA 1P91A 3TFWA 3BGVA 4GUAA 4QPPA 2HMYB 1EJ0A 4C06A 1RJDA 2IBSA 3LCCA 3BWCA 3OE5A 2ZZNA 1L3BA 1XDUA 5EG5A 5LSAA 2BZGA 1FBNA 3FYCA 3NJRA
chains in the Genus database with same CATH superfamily
4LDJA 1R0SA 2Y6UA 3QITA 4QDXA 4G65A 1WUTA 5KS2A 3FGPA 1CJMA 1FCJA 3IAEA 3RJ5A 4DABA 2DHEA 2JL1A 4L5IA 4FEAA 4JSTA 3DO5A 2B8EA 4EFNA 2X8LA 4P81A 4M1MA 2J46A 3OU7A 2VJPA 4AKTA 1KIAA 1VLLA 4FHGA 2WIBA 2X8JB 4O5AA 3OQIB 3CW9A 2IV7A 1Z5GA 5E6RB 4CM6A 4M0KA 3Q8KA 4Q9NA 1TKBA 2P4HX 3ROKA 4E07A 2JRLA 1KI7A 4KODA 1KI8A 4YACA 4NOJA 4WXHA 1R6TA 5C8YA 3RUHA 2XXAA 1PSZA 3NHBA 4HZUA 3FLMA 1SFRA 3NNNA 1YUMA 5CX1B 3ZUPA 5M3BA 2D7DA 1MGOA 4GRDA 2VDQB 4EB6A 1T1EA 1Y7IA 3WTBA 4P22A 5KNBD 1XZKA 4ZQEA 1JEDA 3UK0A 4UVHA 1TK2A 3EZLA 4HNHA 3U3OA 3MINA 3E5HA 4KLNA 1DAMA 1MJ5A 1JFTA 6YASA 1RJFA 3CVYA 3M70A 1G8SA 3P0FA 4AMYA 4N5IX 1QC5B 1W36D 3IE0A 1XTZA 3M9WA 4IWYA 4PSAA 3QVLA 5DM70 1NOKA 1QRSA 2R11A 4P4NA 5EY5B 1L5LA 2A30A 3EQZA 1AG9A 1GCGA 2DZDA 3IAS1 4PIVA 4EOGA 2QN2A 5C8DA 1BVHA 2WICA 5DO9A 2DT5A 2W5UA 2PAAA 2WR8A 3SC4A 2F3QA 1AQJA 4C05A 3KU1A 4HNRA 3MWEB 3AIMA 4GOJA 4QO7A 5DEIA 5BWLA 3WICA 2DBRA 2PG3A 3L7DA 1RZVA 2BEVA 2G88A 1FYXA 2RKWA 3WGTA 5FJIA 3BBLA 3STHA 3R7FA 2JFPA 5JJLA 2ZUUA 3E7WA 4I14A 3HY3A 2OG1A 4MRAA 1ZHHA 2FPIB 3N2LA 3OUZA 4WJLA 5KMGA 1ZUD1 1Z2AA 2YXNA 1J97A 2M2IA 3PTLA 4FFPA 1L5RA 1ZC4A 4BGUA 3ACDA 4J0KA 1YTUA 3UUEA 4ZVNA 5GONA 3FN4A 2NN3C 4UUAA 2W2XA 4AVYA 5LJLA 1V41E 2L82A 1WEHA 4IH9A 2RH9B 3C15C 3DAOA 5KINB 3BH7A 2DTDA 2DWOA 5G1PA 1ONBA 1QFSA 5ALLA 3MD0A 3D8UA 5CA0F 3C6QA 4GC9A 2YNMC 2HCFA 3DTTA 2GRAA 2D3WA 4UZSA 5EMJA 4BASA 4U0JA 2F90A 5A71A 4E2ZA 4JIMA 3FXAA 4PS1A 1NVVQ 3WJAA 2PBRA 3JTEA 2QSZA 2AMFA 3WWOA 2G9ZA 3M82A 3FWYA 4PG5A 2VNSA 1XTQA 4KNVA 4G5OA 3VAAA 1EM6A 3P8ZA 2P67A 2FFQA 2WAOA 4Z9AA 5HUJA 5CBPB 2CDBA 1UJ4A 4NQZA 5I7HA 1O58A 5JQWA 3NH6A 4R2MA 3OJ0A 1JTFA 3U4IA 3FDZB 3TTUA 2RMKA 5DI9A 5GVSA 2BMEA 2GOYA 3KJNA 4JMLA 1M0SA 5BV8A 2AI2A 4NOLA 1SK9A 1Z5UA 3HEBA 2PX4A 4RHCA 4ZJYA 2FJ0A 3AO0B 2Y0CA 1NOIA 1TW3A 1RCUA 2G0NA 1N9KA 3MERA 2NZVG 5E3JA 3RYFB 5B7QA 4HBGA 5ALRA 8LDHA 4CF7A 3MCAA 1W35A 5AJXA 4BNFA 2GERA 2QZ9A 2VF2A 1FW8A 5IT5A 1YZKA 3SIXA 5FWDA 3CH5A 1WSWA 3D6NB 4RD1A 4NCAA 5CVDA 3B8EA 1CB7A 1Y1SA 4MVJF 2IOQA 1NYTA 1ZIXA 2WHYA 4R7ZA 2UZ0A 5ER6A 3VKVA 2XZDA 3ZWWA 3ZHUA 5KPDA 3VAZA 7ADHA 1CRLA 4ZXFA 4KE8A 1PDOA 4KDEA 3I5MA 4ARSA 4ONEA 1YBFA 5K51A 5FA6A 3K2IA 4M0CA 4P8RA 3GP5A 2H2AA 2BGWA 3LUFA 1GG8A 3C3YA 1VBMA 3C3AA 3UHAA 2ZT5A 2HHLA 1E32A 2OBBA 4TSFA 3GRCA 4U2CA 1TEVA 1GAEO 3I04A 1HT2E 1QU3A 4DNQA 1QZ3A 3EBPA 4QXRA 2RAVA 2TS1A 1QIDA 1XRPA 1ZA2A 2QMEA 1M6NA 1D0SA 5IKMA 2IDMA 1X3SA 4EY8A 3LCJA 4YR9A 3KWLA 4M1OA 4DQXA 4E6PA 1NTOA 1DJQA 4Z4GA 3C97A 2CE7A 1SG9A 2HEIA 1YR8A 1LU9A 1GYQA 1UBNA 2AZTA 4KQIA 1WXGA 2RGNA 4GX5A 1T8YA 1Z0FA 5F2KA 1GTG1 4L07A 3FKSA 3QHPA 3ABSB 4RYDA 3Q2OA 2R68A 4EPRA 4Y2TA 2Y3IA 4HLCA 4UD2A 3R3XA 1VHJA 1XTVA 1FUKA 3UJ6A 2B1GA 3ZG6A 2IYOA 4CG3A 1MENA 2WEKA 4PICA 2IHVA 4BFZA 1ZH8A 4XWGA 2FETA 4BFXA 3IERA 3NANA 4WOJA 1N6NA 4GEGA 1Q0LA 4DEYA 3CUEF 3DDWA 2ZBPA 3TCNA 1I7QB 3ZNNA 3CA8A 4Z4HA 1FUEA 1JFFA 3IRVA 1VMIA 2XVZA 4E5MA 3P2IA 2BDUA 5FQNA 4IYRA 1OA0A 4I4CA 4LK2A 3EZFA 3FI0A 4XM1A 2ONCA 3VZPA 5B3KA 2PR2A 3VZDA 4ZDIA 4JC4A 2C2XA 3TEFA 3OWHA 1T5DX 1ZJZA 1MQAA 1ABFA 2CFOA 3INRA 3K0FB 3M0EA 3THRA 2C8JA 1U3FA 2NV0A 2CD7A 3GX1A 5HP4A 3FBGA 2PA3A 4O0LA 1YSCA 5B12A 2AX3A 2PSEA 2RHRA 2GF2A 5AK3A 5IJWA 3NMUF 3BYZA 4EM6A 1ODSA 2Y0BA 5CLQA 3FD8A 2OD9A 2RIRA 3V8VA 5M34A 1AX9A 3DF9A 1EUYA 5JASA 2GZ3A 3C3JA 3GDWA 2NUPB 4HN4B 4K9LA 5LJIA 1DGQA 3BERA 3IH5A 1G41A 2BFFB 2Y99A 3G2IA 3NV9A 4QDUA 4XDHA 3HL0A 3OPVA 5LBUA 3Q8LA 5JD4A 1AZSC 1V4NA 3AFHA 1O89A 3UGJA 3FPJA 3FNEA 3FY4A 3U81A 5DNWA 1JG3A 1T0BA 3E81A 2HF9A 3NLLA 5AI8A 5EJ2A 4AMUA 4RM3A 1WEKA 2R6CA 3R7DA 2GUWA 2ROQA 3BMQB 2H59A 1QIFA 2YV3A 1M8KA 3LXUX 2A94A 5AVKA 4F1KA 5K20A 5T41A 4ZT2A 4J43A 1WMAA 1UKZA 1VMDA 1SVLA 1RC0A 1XEXA 2H5LA 2RAFA 2WNHA 4HTAA 1W0KA 4JYAB 5D1HA 1Z35A 1E4VA 4M6WA 1CUWA 2AOXA 1Y4ZA 2X4GA 3PHHA 5AJTA 1VHTA 5E4YA 1TZBA 2QTNA 4M1SA 2YVAA 5DPMA 1N3BA 3SOPA 3ZK9A 3QKUA 5HF6A 1P73A 1XEWY 4JDPA 1GDHA 4H17A 4D82A 5DHFA 2QE6A 1NHGA 3R4CA 2GJ4A 2DFTA 4YTEA 3MTJA 1Y7HA 4IMRA 2JFZA 1M67A 3JR3A 4X20B 4BJ1A 3AR5A 1AS3A 3NS7A 1U2DA 2OORA 4GPBA 1L5HA 3PITA 1HTBA 2Z5GA 3QA3E 1N4AA 4EPTA 4L4YA 2A8YA 1A95A 3A70A 3ZE2B 4M37A 4CUKA 5HTOA 2NTNA 1I1NA 3FHJA 3QF4B 4IV8A 5D1NA 4E11A 5JFGA 5G4LA 4XGNA 4K2AA 2WKPA 3WA6A 2VKQA 2G4LA 3DCNA 2C7PA 3DCIA 3JWPA 2QRVB 3LH5A 2DFKB 2FZGA 1EX6A 2MT9A 4M87A 4DHWA 3AU9A 5IDWA 5JJBA 3QE9Y 5EIBD 1FP7A 2DY1A 2XOKD 1QG4A 3CVXA 3ZHVA 4CR7A 4QRHA 1D5WA 4NX2A 5HGXA 5HJ5A 5LM3A 2X1HA 2KWIA 4HTFA 2V45A 3NV7A 2GZ1A 4Q4HB 2G09A 2CMGA 5GAJA 3VAYA 1C5KA 1DX9A 2GAIA 4IIXA 5IN4A 4HOYA 3F78A 2V5AA 2W4IA 3X2EA 1SC4A 4RTJA 4BZPA 3ZBPA 4G5GA 5H82A 2JEYA 3EXFB 4H1TA 4LSWA 2GD6A 2FWBA 5B7NA 1CULC 1CP3A 4RVGA 1ONNA 1A1SA 2VDNB 1SG0A 4RELA 4EG1A 3QVSA 4S0ZA 4OHFA 2QAGA 1EX7A 2GTHA 2J0EA 2O4CA 4NBRA 4W7SA 1N2ZA 4Q9LA 1DT5A 5EE9A 1JZSA 1P0IA 2JBHA 1NRWA 3UXMA 2FX2A 1GZSA 4OBWA 1B6SA 4PFQA 2XTMA 3SS9X 5HKKD 4G1FA 3E6AA 1EK1A 1EB9A 4HNAB 3IE1A 3RWMB 3DMNA 2QJWA 2C4TA 4D79A 4N3BA 3IQIX 3NAMA 3OE7D 3TH5A 2X2OA 1AVTA 2OAP1 3AVVA 3NYQA 1NQVA 3ZVNA 3U40A 5K4GA 1E9FA 3CX4A 5HF5A 2QV0A 3FCAA 4G01B 3VFDA 3AM1A 3K9GA 2C83A 3L8CA 1P7CA 5EJAA 4WLUA 1FLNA 1PSDA 1PZFA 2YHAA 1P9WA 1FUIA 1XVAA 4EJSB 3ZVMA 1U7HA 5EIXA 4LSMA 4DJDC 1PBTA 4RKFA 4IHAA 5KWIA 2F8MA 4B3JA 2PRYA 1V5WA 1F60A 3WNZA 4MW5A 5LQCA 1J07A 1WAMA 3A4LA 3JRWA 1DBVO 3DMFA 1R10A 1XCMA 1C3VA 4FFDA 4JVNA 1YVDA 2I99A 2PBLA 4PU0A 5T7BA 4MVXA 4P35A 3QFSA 3GLFB 1XU7A 3W0LB 4CTKA 4RABA 2JKVA 3DE7X 4ZVUA 4EG4A 1TB4A 1X2EA 4ZU1X 4ZVKA 3R77A 3U37A 1CVRA 5I45A 3D02A 4X8LA 2UZIR 2A1IA 1I0ZA 1KERA 2GZRA 3C3EA 1D2EA 2TMYA 3I92A 1PVVA 3LDUA 3OSUA 1JLHA 3WSWA 3NUQA 1SU4A 1EVKA 3D6JA 3Q9NA 2PJZA 1K7SN 2NZYA 4AZ0B 1V7CA 1UBMS 1I4TD 2BUCA 3JQGB 1QOPB 1SC1A 4F8EA 2C7OA 3R6DA 4KMRA 4YFYA 3UXEA 1LSJA 2D0OB 2UZAA 1FFXA 2GARA 1XWWA 2ZJ8A 4EFDA 2O7VA 3B7GA 2ZYWX 3SLRA 1KYZA 1W5EA 2XA9A 1U7DA 2HRBA 4JXJA 4QPZA 3CRNA 4AL4A 1PVOA 5T3UA 4IEEA 3WLEA 1WUIS 2VHJA 4EKEA 1EVIA 3DR3A 4DR7B 2PUVA 2VCYA 2Z9CA 5CB8A 1ATIA 3H9QA 4BO1A 2E4ZA 2CN1A 3TCKA 3U19A 2JS7A 3M4NA 1XL1A 2IUUA 1YQGA 4KPFC 3TOSA 4YJHB 2J41A 1C2TA 1EJ6A 1T6ZA 1YR2A 3DM9B 2QNBA 3NCTA 4N0DA 1F8FA 1NUQA 2ET6A 1JWAB 1UBOS 2VJCA 3A31A 3TLEA 1KTIA 3H97A 1SZDA 2A0YA 5AK0A 5KUTA 1PLJA 2AN5A 1N9ZA 1O8CA 1I9CA 2XT6A 1POWA 3B3FA 3KQQA 3O8QB 1T5OA 4DS3A 1ZJJA 2QR3A 2W6OA 1Y37A 4HD8A 4PCVA 5EKTA 5JSYA 2HDNB 4XWAA 1G6HA 1TO1E 2W37A 4W8GA 5C8VA 5JVDF 2C5SA 2XHEA 2QTMA 2IZ6A 4JLDA 1JNXX 3OOJA 4CIWA 3AR2A 1ZVKA 1A2BA 3OCYA 1SKUA 2P77A 4R8VA 4X92A 3L92A 4ZYWA 2YFYA 1D1PA 2ZTLA 3IQZA 3L0CA 1A5SB 1EYZA 5A6VA 1SHJA 4CIVA 4CV0A 1NN0A 1E5TA 3CY6A 3DZGA 4CWAA 1HYQA 4ZOLA 5HJ7A 1MC4A 2JGDA 4UQOA 4BMXA 4JXKA 3SJAA 4OMFG 5EJ6A 1Z82A 3O83A 1IPFA 1FFEA 4QL3A 3D6FA 1SKYE 3G2NA 3AI2A 2W2QA 3JYOA 3STUA 2FN3A 3WFJA 1KP2A 1ID8A 3H1EA 1A82A 2AHOA 4XM2A 3PL1A 3UXHA 1CY8A 2GFHA 3J81A 2HK8A 3KAQA 1JEOA 1K3TA 4MGKR 5AYVA 3F2VA 5IVIA 1KFBB 1U80A 3K9FC 3G5AA 2ONJA 1Y5RA 3FPKA 4A8JA 1Y8QA 4C7OB 1RJGA 1GFSA 4PAMA 1WULS 4RQUA 4IFIA 1UDAA 4ZRMA 2XRYA 1HYBA 2ZBVA 2C2ZA 3TOZA 5AQEA 2Q9BA 2KYRA 3EPRA 2IYYA 2NU9A 2PO5A 2E87A 4U7GA 1YCDA 2JNWA 4BO4A 2ECPA 1KJ8A 1V43A 3ACCA 4GLLA 1XR3A 2WFAA 3HU5A 4S3MA 5B7GA 3EMDA 1W36B 1NL3A 1J2JA 2ZM5A 1Z17A 4UOQA 4E03A 10MHA 2V7VA 1ATZA 3HYCA 3RNOA 3ADPA 4HGPA 1EFTA 3BN3A 4IWXA 1A0OA 2PMWB 1IZ8A 1O94C 4DNOA 1QV6A 1O0CA 2D5IA 2F64A 3BXZA 3EZXA 2NUPA 3ZE0B 2H29A 1W96A 1Z7GA 5FL3A 3VR5H 2P9TA 5C4GB 3TRDA 1FDVA 1P2TA 3VH2A 4TYMA 4B34A 5I48A 4B6FA 3H4TA 3LA6A 1F2TB 3K4HA 3EVGA 1T9AA 2QENA 3NHSA 2QHXA 1NGSA 3B5EA 3IPYA 5TR9A 3GJ3A 1I7SB 3N6VA 4AY4A 4ZYYA 3ORYA 3MBKA 3W9SA 4D3YA 1OH6A 2C88A 2IYZA 1WABA 1MGPA 3V4ZA 4BX9A 1JJAA 2O2HA 4O2AB 4KREA 3PUWA 1RBQA 1WF3A 1XB2A 3EY9A 3C1UA 3R0VA 1TFRA 3NDJA 5L53A 2O7QA 1Q2XA 3ZJTA 5E9AA 3A25A 3IESA 1IXSB 4Q37A 1U99A 5EPOA 4EFKA 2YXDA 2DHQA 4TVOA 2G1JA 1AQYA 4YQZA 1IJBA 3WYEA 4ZAXA 3NHPA 4ZEOA 4QNNA 1RXYA 1Z13A 4B8ZA 4XEHA 4BZZA 1UXJA 4D81A 2XQIA 2FI1A 1CUGA 1P1BA 2JFYA 2ZJFA 1BMFA 1MB2A 2I2XB 3CKKA 3MJEA 3RF6A 3SIPA 1H4QA 3TR0A 2BKVA 1EM8A 3PR2B 2VPIA 4QLOA 3K30A 4RKEA 3PGXA 4UTVA 4KDFA 3GUVA 3AHGA 2ZJ7A 1UP7A 4CM4B 4QOHA 2V4ZA 3M33A 1FX0B 1NMSA 3BSYA 1II0A 3GG9A 5L6MB 2QVGA 3L0IB 1A9ZA 3LT2A 5BT9A 4PYMA 3AHHA 2QKYA 1H0SA 4JSRA 1C30B 5LDHA 3W5AA 3OURA 1GGEA 3BT7A 4L5AA 1A7JA 4TXHA 3RTAA 4HNUA 3QYPA 2CVHA 4D42A 1AQUA 2I1WA 2PQ0A 4ZT4A 4N8SA 3RTEA 1BS2A 1MV8A 5KTTA 3HE3A 3I53A 1JKIA 1HSZA 2QROA 3BIJA 3PU6A 1JSZA 1L8AA 5DTQA 5G0UA 3GUHA 4KUGA 3T3PB 1SUBA 4Y2YA 2G63A 2VUHB 5HJEA 1XYYA 1A9XA 1L9XA 1MP0A 3A1DA 1ZHOA 3SIWA 2C78A 4P0PB 4MGYR 2Q0SA 5ELLA 3GMTA 1U1GA 1U2ZA 1XAHA 1DOZA 2PN1A 3GRZA 4S12A 3VV2A 1USWA 2J59A 3AUKA 3HKEB 2O8VA 5PGMA 2GYWA 2JI8A 5C18A 4U7FA 1SUWA 2MSEB 1ONOA 3ZZUA 4XPZA 3DZFA 5FO0A 2XE7A 3HR4A 5JXWA 1LY1A 4YI3A 4YRRA 3L43A 1OFVA 5KJ6A 1Z29A 4MWEA 3PUXA 3RLFA 3N2YA 3U7QA 2PRJA 3FPAA 1GPJA 1ZSVA 3PC4A 4P4TA 1TMOA 4Q9IA 5DBFA 3RYIA 4D25A 1D2CA 4EG5A 3BA6A 2WUWE 1DHTA 1RRGA 4OG2A 5DCUA 1F12A 5C80A 4H0CA 4L4XA 4Q02A 4N8DA 2WQ7A 1SC3A 2IYAA 2QV7A 3EZ2A 1RU3A 3RWBA 4HSEA 2XW6A 3V5NA 2BFFA 1M7GA 1OX5A 2FP3A 2WKWA 1UAAA 1T2AA 4ZXPA 4BWYA 4Q7MB 1RI4A 2FUG6 3V80A 2M98A 1T6BY 4CKBB 4IDOA 4IJUA 5KC8A 4QFDA 1VSTA 2ZI6A 3EY4A 5FBZA 4F3RA 1OZAA 1YJQA 4U8HA 5JNUA 1CIVA 1WE2A 2VH1A 3FCSB 4U1RA 1LNQA 2ZU6A 3GZ4A 4BRUA 3DE5X 4POOA 4ER3A 2EWMA 4O59O 4MUIA 3HV2A 1JR2A 1PFUA 1UF9A 1MVNA 1XTKA 3OZUA 2Z6UA 1HDYA 2QE7D 3S2UA 4PC6A 5F73A 1E1YA 2PJUA 4OQNA 3W8EA 3ZXSA 5A9SA 1ID1A 1PYOA 1NW5A 1UDWA 1Q0RA 2G5PA 4IRXA 5IZCC 5TB5A 1SOUA 1IVYA 3FDJA 3OJOA 1DKLA 1GPWB 2ZSIA 2LUOA 3PIIA 2Q4EA 1DMRA 1YVUA 4Q18A 4URWR 4ZQBA 4ZAZA 4F60A 4B45A 1SEPA 2JLYA 3PXEA 3PDCA 2A9QA 3U4CA 4A9AA 4KR3A 3DMHA 4HC4A 4YJGA 1LDEA 3ABOB 4MS4B 2J3LA 4B4KA 1VA5A 2HJVA 1APBA 4HNGA 4QQKA 4ZAGA 2P27A 1T9BA 2QRHA 4FT2A 2Q07A 2QLFA 1LUAA 5F4BA 3RS7A 2RK3A 4PHFA 3CH4B 4WLFA 1HL7A 5IXSA 1LV8A 2BEJA 4TKUA 3B1KA 1M6HA 3TJRA 5DP1A 5EQDA 3CCFA 1FLAA 4DG5A 3OM9A 1ZMXA 3WGMA 4HGYA 1WX1A 1MH1A 5ELMA 5EUBA 2VYCA 3DO6A 4DPKA 3E7PA 5EIFA 4DZTA 4B3GA 1U4NA 4OLFA 1CR6A 4NY1A 1NXSA 2G36A 4MUNA 4PO3X 4RHUA 1N5LA 2OFOA 5F78A 3GVHA 3WA7A 4KAJA 1TECE 4DDVA 2X3FA 3ZDDA 4RA9B 3D0KA 2WG1A 1WB4A 2ZBFA 3N70A 4L4RA 4WK6A 1C1XB 1H2XA 4RFLA 1SXQA 1KARA 3BWMA 4XLTA 2RHGB 2OP1A 3KHUA 4UEJA 5GZ3A 1C8BA 5KC9A 3JARB 1V95A 1ETUA 5JQGF 4C7XA 5ISMA 3OFSA 2PZKA 1Y7TA 5BN3B 1YRWA 3RQSA 2Z2YA 4AKIA 2QAGB 2ETXA 1P3DA 3K8YA 4LF6B 2I4LA 5M5BA 2ZJ3A 5HA5A 1M2JA 3E05A 2HSGA 3FJYA 4LRXA 4NESA 3QI2A 3A2LA 3G8CA 5F5NA 1Y3CE 2EFJA 4DLAA 2HGZA 1S5PA 3GNQA 1FTGA 2C5BA 4QUHA 1M83A 2J48A 1GTJ1 1R5NA 3G0OA 3Q8XB 4EAQA 3CVJA 1Z8DA 4OGKA 5DISB 4DJTA 3U3XA 3F7MA 4HXEB 3LTEA 3WGYA 1Z5PA 4RJKA 2OHHA 1ISPA 2GEKA 3ROFA 1TAGA 1TM2A 1ZN9A 1KYWA 2H9YA 2OWEA 3AIKA 3I4CA 1JXQA 3KLBA 4JB2A 5AKKA 2BMWA 3WRWA 5IT4A 4P33A 3W8RA 2C3OA 4ATNA 3JPYA 2IC5A 4S1OA 4EA6A 1WKVA 3DZCA 2EYQA 1XPUA 2PR7A 4MMYB 13PKA 4TLDA 3ZV4A 1ZRNA 4RMJA 4ZCQA 1ZL2A 4ZMSA 3AR7A 1LLCA 3DTVB 3JYQA 2WSSD 3KU4A 4LQCA 5P21A 1DXOA 1KAOA 1SXGA 2PH7A 3HCNA 3R2JA 1NRIA 1L1EA 2F43A 2M6RA 3JCZA 3NBMA 5I7AA 3SPXA 3WB9A 3ZDBA 2OCLA 4BVHA 3ONNA 1B1CA 2P2NA 2FR8A 3E7FA 1ZK1A 3LA8A 3TQRA 5DN9A 4B79A 3PWZA 3OC0A 3M4JA 3UOWA 4HLNA 3KZMA 1DUSA 1O7JA 4X91A 2J31A 3CJTA 3JQCA 4FKZA 1JA1A 4V2UA 5DXJA 2G1AA 3G2KA 1ISRA 1L8QA 1N6PA 1SKQA 2R4UA 1PEYA 1JAZA 1PT8A 1Q84A 3BAFA 1LPOA 4F3CA 1JH8A 3KALA 3SD7A 5KIAA 4PFJA 4E5DA 1G8JA 3TE6A 4OM7A 1KP3A 3KQKA 3VR5A 1G6KA 2I3ZA 1ORIA 2HMWA 2EF1A 3T4XA 5CFQA 2GEJA 3PE6A 5B1SA 1FFWA 2YS7A 2EARA 4RHEA 4RF5A 4E22A 1Q0PA 3F49S 1N2XA 1FSFA 3OIDA 1VP3A 4YO7A 3N0XA 4BNUA 2QMUA 3SFZA 1SZPA 3U1TA 4GYJA 5LB4A 1ULUA 1CF2O 2P69A 1JLLA 4YT4A 5MDHA 2ONZA 2NO4A 2RFLA 3D6UA 3OJFA 4JJAA 4O0MA 2HA7A 5E6SB 1MBZA 3Q41A 1SCKA 4TRNA 2PPVA 1NX6A 3Q98A 1JU9A 4JEIA 4M7RA 1CB0A 3BL5A 1D6JA 5DWQA 4RVCA 3TQCA 3TQOA 1A8PA 2HO4A 3ESYA 3QM1A 4AMBA 1BN6A 3PC8A 3RVSA 2JGLA 3BL8A 2IZZA 3HKDB 3JQ8A 3MS7A 1C9JA 2O8NA 1LS1A 2YV2A 3ZWDA 1XTBA 1YVEI 1YH3A 2VRCD 4D9JA 4DG8A 3BL6A 3EVDA 1XF9A 5HZKA 3VTFA 2LP4Y 1AV6A 3HTXA 4WZ6A 1GCUA 4JD5A 1IQRA 3VC3A 2X9VA 3DVAB 4IDGA 5GQSA 3EJ6A 2VZEA 4NQRA 2O3SA 5K3CA 5DLQC 3PK0A 3TUIC 2VYVD 1XMPA 3DDSA 4DIKA 3TOXA 1T8RA 4Q6BA 5AW9A 1E9DA 2I34A 5EJMA 1TM1E 2FZLA 3MNFA 4YEDA 5IJ9B 3EPJA 1BMFD 2WK1A 1PZXA 1XLWA 2NXJA 3N3BC 3C6KA 1A9TA 1CEEA 4DNFA 5AVTA 3LDAA 4E7OA 5LOVB 1BFKA 1JEYB 3QVTA 5JCJD 4YMIA 4TKUB 4XQCA 1QIJA 3LLSA 4AG3A 4PYRA 5AW8A 2IZ5A 5IH7A 2YJ6A 1UWKA 2F3TA 4OYHA 1TCUA 2QTBA 3HN6A 1YR6A 2HHAA 1MOSA 1T1GA 4KH1A 2HJHA 4U7HA 3PFBA 1C29B 1PR2A 4N3CA 4RPHA 4Y7DA 2NU6A 4W5HA 4LE1A 1P0PA 4RAOA 1Y8QB 1AH2A 1P17A 2YXEA 4QVKA 1OC4A 2GN6A 3MRVA 5DNAA 4HH4A 4BGEA 1RPTA 5TNXA 1IN8A 3GU3A 4FQ8A 2JHFA 5H4GA 2YV1A 3O82A 5CMLA 4EZIA 2ZTHA 3MXOA 4F6LA 1NQUA 4XW2A 5AM5A 5KEIA 4EARA 1EQUA 2KB0A 3K0EA 4X1YA 2VA9A 1NJ5A 4ITRC 1X92A 521PA 3KCNA 1V3TA 1I51A 3H2BA 4CM9A 3G9ZA 1E1NA 3HYSA 3NIFB 1NKVA 3GFOA 4CDMA 4CM8B 2O8FB 1JQBA 2P40A 2QN6A 2WUEA 4IDEA 4TYQA 4UMVA 2DEUA 1O97D 1YZFA 4XGKA 4JL5A 1H2WA 4M9RA 2NSLA 3K0BA 1W75A 2C9MA 4PAWA 4K03A 3HZZA 1QTQA 2VWPA 3I12A 1K6JA 3HUFA 2AR0A 3KSUA 4W5WA 4C01A 2CVOA 1V4BA 2QTCA 4UFNA 4WNIA 2PUGA 1DELA 1F2TA 2DQ4A 1KMMA 1H2YA 2OCXA 3OTWA 1IMOA 5H0IA 4CLHA 4QG3A 4FE4A 3OBBA 4UBNA 3EEBA 3STXA 3W2HA 3UFBA 4MUFA 5BW4A 1AIPA 3ZU4A 1JHZA 1SVWA 3D3WB 2A88A 4JASB 1N6RA 1JUDA 3VPHA 3D5QA 5H4HA 3U62A 2F59A 2P0YA 3KCQA 4PLVA 1DQPA 2HIGA 3N1UA 3N28A 2B7LA 2ZEJA 2XUQA 3LM8A 2JLVA 3VR6A 1QUEA 2JGAA 3B1JA 4O8ZA 1L7PA 3ICPA 4RXUA 4IIBA 1YJCA 3MD9A 5TSDA 4C9BA 5IX8A 1W5TA 1J0BA 2QD4A 5LUAA 3GGCA 5DWDA 4HPWA 3H87A 3HCPA 4Z7OB 1XKQA 4RNDB 3DS8A 3RC9A 1GKYA 4ENPA 1FTYA 3B3AA 2WE7A 1PJQA 2HU8A 2W2OA 4KR0A 3T4UA 1CU1A 3L6BA 3A10A 1EQ2A 1PJAA 2H2DA 2SNIE 2BI7A 3K0HA 1HORA 1KDTA 3RE1A 4JUBA 1XALA 2MSCB 4QDZA 4ETIA 1J8YF 3GBVA 1G0OA 2VCHA 3H1TA 3LFUA 1Q14A 4UMFA 1MOPA 1QG2A 2Z1DA 1FDRA 3MRTA 3WKBA 4PWZA 2ZJBA 3JYHA 1KZGB 4B5LA 5ALSA 3BCHA 3DEFA 3ZD9A 1O6CA 4F9GA 4OI0A 4KAFA 5DV9A 5JI2E 3WRYA 1DIGA 4GXRA 1R6XA 3BIFA 4WWHA 3QUSA 4P0TA 1HDRA 3RYHA 2XJ4A 3GDOA 2JHCA 3PUIA 4B46A 5J4YA 4OAPA 1EK2A 2Q6OA 4V0QA 3HN7A 3NGXA 3DQQA 3WWPA 1EFVB 3GR6A 3QFRA 1LBTA 1T9KA 4OH1A 1VSVA 5THQA 2CMFA 4F8JA 1C4WA 2BMDA 2XD9A 1FYWA 4N0EA 3PUJA 1WZCA 4M38A 2GHQA 1LSSA 4H77A 4OP3A 5BSUA 3VVCA 3MJFA 4DADA 4OK3A 4DDHA 1U6JA 2R751 1ZWLA 3GQVA 3OHSX 4P7JA 1NV8A 3SYMA 1YIOA 4TWBA 2XB4A 3CLSD 2CY0A 2TSYB 4MJXA 1RYBA 3IRUA 5EHNA 3WLOA 4TN1A 2A14A 2R6JA 4QREA 5B6PA 1AKUA 2P3LA 5HFJA 4G6ZA 3GH1A 2NG1A 1HLGA 1HF3A 5ADUS 1BDIA 4LX8A 2EQ5A 5FEUA 3G0HA 2XB8A 3PD1A 3MWEA 3TAXA 2Q7DA 1AK1A 5AICA 3PEEA 3WJ7A 5L3SB 5BR8B 3PC6A 5DYIA 2HF8A 1QE3A 4O1HA 2VTBA 2BDTA 1CUVA 2PUTA 4JI1B 2QLNA 4N0MA 4A1OA 3OTHA 3TSOA 1OFUX 1LQUA 2C7RA 4BFYA 2E18A 3RC1A 2YHBA 5ESRA 3GJQA 2AKEA 2QRQA 3ZBTA 4MW0A 1S2OA 1QPBA 5JS8A 3EIEA 1NMZA 3EFEA 3QLJA 2CB9A 2GPAA 4RKWA 3T1QA 2HMUA 5EZSA 1DLIA 4JVMA 2O54A 1EESA 4IX1A 2NQTA 1ZU4A 1UPTA 4J75A 5I7RA 2PL5A 5BQ3A 1DXQA 2NV6A 2DUMA 3TD9A 2OHFA 1UKVY 4WUTA 1QAMA 2NSYA 1X38A 2AYZA 2GCEA 5JWHA 4V1CI 1O1YA 1WVMA 2EWVA 3JVIA 3S1AA 4Q19A 4CDGA 1SXJB 5EHIA 2UUCB 3HB5X 3OT4A 1KOLA 1H5UA 2XA1A 1DIHA 3FYDA 1TA9A 2J5KA 1QGOA 3CF6R 4FX2A 1XMQB 1RC1A 1GNPA 2PGJA 2J9FB 3ZDXB 4JP1A 2KBFA 3UN1A 3AR4A 2XE8A 2NM0A 3QWIA 4ZRDA 3ZEIA 2E4AA 2YY7A 4AJLA 5CYGA 3DMTC 2VNAA 3EVFA 2IT1A 1ZH6A 4EHDA 5EIOA 1NJGA 5JRZA 5K8IA 1ZBQA 4LIPD 3BA1A 3VYTB 3HA5A 5JAPA 4C1NA 4D98A 1Z28A 1E4EA 1P6QA 2VAMA 4PX2A 4UAJA 1G0NA 4LJLA 3ICVA 1RTTA 4GGOA 3GN2A 2VOJA 2ZIUB 5ESXA 1Y63A 5JEEA 3O4IA 3T94A 3E5MA 4BAZA 4ZDKA 2ZYDA 4IUBS 2PZ8A 3ZBQA 2O5VA 1FSPA 1WZUA 4Z99A 4RHYA 2BRUC 4FR2A 2ACKA 3E35A 5FBRB 1E2IA 4MRPA 1QJCA 1NNI1 4BS9A 3CUWA 4D92A 1AMNA 5LDGA 4Z1MA 1GN8A 1CJTC 3ELUA 4IDAA 4PLFA 4B9AA 1YT5A 5F5LA 1G8HA 1HXHA 4GPAA 1P5FA 4NAUA 4RSGA 3VU1A 3FF4A 4QM7A 1U2TA 4M0LA 3CM0A 4C4XA 2C1XA 3LSYA 4LQLA 4PGHA 1FFCA 2A9VA 4P7KA 1PFQA 1Q50A 4LDAA 4LSGA 9MHTA 1KY5A 5AVYA 4LK3A 2C4UA 2Q6IA 3IKMB 3DE3X 2FMIA 2DOKA 4EUKA 2YV4A 3GFBA 2A58A 1MIOB 2PK3A 5ENDA 5A4AA 4B82A 5DVZA 3MQ2A 5G4KA 4G1MB 1BOOA 1XE3A 1BKSB 1C1XA 2HA0A 1PG5A 2OZVA 2YOFA 2Q6VA 3JALB 3S7TA 3RAEC 2PX5A 2ZUVA 3OM0A 1L7QA 3LAWA 4PLHA 1O6ZA 1XZNA 2QI9F 1QJ4A 1QWSA 2VQSA 3DBHB 1TCBA 3WWCA 2WA1A 1PZGA 3D2BA 1M0TA 3R41A 3JASB 3G79A 1X42A 1GTRA 3PD7A 3ORRA 4OHWA 2IYSA 3DAHA 1XJ0A 3NC1C 3IEMA 2R1TB 2YJ5A 5JCZA 5HVNA 3SC2A 5CX4A 2VZ8A 3NTXA 2WLTA 1ZKMA 4M1QA 4ARAA 5AM0A 2XKAA 2ZAIA 2C7GA 3R1IA 2PO7A 2C2MA 2ZJ0A 4ZFNA 4UHJA 1GSAA 2DPXA 2O6LA 4ZK6A 1U02A 4FFLA 3RS3A 4K9DA 2G28A 2J9GA 4NKRA 9ATCA 3VI4B 4LXQA 4KN5A 4L50A 4LF4B 1I5OA 5EPUA 1ZD9A 2QR5A 4UEQA 2R6GA 4Y2GA 2L2QA 4V0NA 1NW9B 5G0SA 4ARBA 2CLDX 3D43A 4L16A 5TDHA 1W19A 4WBSA 1NWCA 3GRAA 1LPPA 3SBDA 5HPYB 1ND6A 2ZUWA 3ABZA 3F7TA 4B3SB 4YP5A 1BTOA 1W47A 4CKEA 4Z7JA 1NQ5A 2SKDA 4XH9B 3IP7A 2FRVA 1T4DA 5EQJB 4KQMA 2YJGA 1CQIA 5BSKA 3WMGA 1GAWA 3BCUA 4BVJA 3W77A 1QF6A 2BZ0A 1E2DA 3CT4A 2GYVA 3ELYA 2V7PA 5JVDA 3N75A 3A11A 4R2KA 2FZ4A 1MDFA 2XZLA 4XDGA 3IKLA 3I37X 1VDZA 5D7BA 3RYFA 3U3MA 3UHOA 5HX7A 5L3SA 2VHVA 1HQKA 4D99A 1JKJB 1RE0A 3T35A 4G0NA 4L6IA 1W1WA 4M0MA 1BD4A 3KEQA 1SHLA 3N2IA 4NYIR 2ZS7A 2J4FA 4MYCA 5E9WA 4MIYA 2FMUA 5KJ1A 1N5RA 2H4HA 1AKVA 1DQYA 3L0SA 1U28A 1O54A 1XEWX 4GZMA 5DNDA 1NUAA 5C1BA 4ND8A 5B3LA 2QT9A 2CFCA 3EA0A 4QM6A 1KDPA 4R5HA 4EJMA 3H11B 1XI2A 5T8KC 1GKKA 3FOCA 1T26A 3GLHA 3GAAA 5FI1B 3ZHRA 2RG7A 4D9KA 4F4JA 3GRVA 3K0AA 2ZRIA 2E89A 3D8NA 4J1NA 2V54A 3QQPA 2OV4A 4XJTA 2VC2B 4G9EA 2E37A 3F46A 2FN7A 3GJ5A 1WS6A 1CZNA 3IMGA 2OQRA 4LBZA 4YECA 1IRXA 3T7SA 4CKWB 3GNLA 4QEZA 1P7YA 2DKOA 3MUNA 4QARA 1M34A 3S1AB 3A9TA 1Y42X 2X0FA 1XKLA 1OR8A 1YU9A 3WYGA 1B16A 1V6AA 2ST1A 3QYJA 4A5SA 3MTBA 3ZE9A 1KVQA 4DMFA 1CUXA 1N2EA 4WNAA 1DX4A 1FDSA 3DXYA 5DGXA 3T1YB 1FPMA 5HS4A 3T7KA 4ASUD 4G0UA 1RFGE 4LWQA 3FPFA 5LFAA 3BWDD 4G36A 4DC1A 1RZRA 3A1CA 5HRCA 3TQIA 1JDNA 3QHQA 4AICA 2DFNA 1T13A 3MC1A 4RJLA 1I2CA 1P4SA 1W85B 1WPGA 2GM9A 2PMKA 3KOWA 4M86A 4RZUA 4WZBE 4CZ2A 1V4VA 2FPWA 4N49A 3AVXA 3T1OA 5CCXA 4OFBA 1EAYA 3GVXA 3EC2A 1XP8A 1ARZA 2PGOA 5E2IA 1P7PA 2FPPA 4H60A 3JSAA 3KQMA 4AO8A 1HX7A 3EXIA 4GZ6A 2BP7A 2Z04A 3ZWCA 2Y93A 4GMHA 3TJZA 4YXWA 2QT1A 1LDMA 4YWJA 3NWEA 3EGXA 2DWCA 1F4LA 2QW1A 2OBFA 2JI6A 3IVAA 3II6X 1N2GA 3QW4B 4XI9A 3PJFA 1B2LA 1O5OA 3OEEA 5B4VA 5F51A 4MV8A 2WYOA 1QVWA 4UEWA 4LE0A 1KMCA 1OXVA 2J0UB 3C0KA 3W90A 4KUEA 4JQCA 2VBIA 4RZSA 3FETA 1ESEA 3M9LA 3L79A 1UINA 1V16B 1YMVA 3L46A 4G97A 5LN1A 2JLCA 4ALLA 3MT7A 3RSSA 2IDJA 4P08A 2BE7A 5DCLA 3QH4A 4TMTA 3TAHA 3TSYA 2OWDA 1IY0A 4HB4A 1JMVA 1YS4A 3ETJA 4ZVOA 1B3BA 1DBRA 2EF0A 4RORA 4QWWA 1LDBA 2VHTA 3M4ZA 4G56A 4ZQHA 4BB5A 2IDKA 2VK2A 2V65A 1R0LA 2JCGA 4LJ9A 1K8YB 5BSVA 3M6UA 4CTMA 1JEQB 3H5LA 4EY3A 5FTMA 2A0XA 2OQVA 4XCXA 1UODA 2REXB 3F9CA 4BLOA 3I73A 1RC8A 3IILA 1B2RA 1PNQA 1SVOA 2RJNA 1G2PA 2XZPA 3BWEA 1I0LA 1E2HA 1TZMA 3BREA 4BJ6A 4G1EB 3KQVA 1A3CA 3A58B 3VR2D 2E4WA 2AMVA 2FYTA 2OV3A 2IYNA 1DFGA 2R6ZA 1IIBA 1EE9A 2V7BA 3BIXA 3QKRA 4LOAA 2CBGA 3KQLA 4LKRA 3A4YA 1REQA 4FJ1A 4RQAA 3A37A 1EXMA 2WDPA 4EUSA 2A4KA 1UCFA 2MR6A 2C94A 2IY8A 1L5HB 3WDMA 4KV9A 1H93A 3QWAA 1NJ8A 4N40A 5TVKA 3WLJA 3E8MA 4OXQA 1A96A 1RYNA 2Y66A 3FW1A 4KRFA 1WOMA 1P7WA 3WNVA 3ITKA 1JA9A 5C35A 1P3JA 4JITA 3INTA 4MQLA 1EQAA 1YO6A 2WYWA 1A8HA 2WSSA 4NMHA 2ZBUA 5SY4A 4CFSA 5IRCD 1NI4B 1E96A 1NTRA 1SCDA 1C0EA 3HI6A 1OU4A 4B35A 3F3KA 1CW2B 1P75A 3ZNPA 5JFOA 4BAGA 2QUJA 3QQ5A 5JZVA 2XYVA 2HU5A 2KM1A 5E4FA 3TINA 1QORA 1WB5A 2AWNA 2CT8A 3SU8A 4DLNA 4P9NA 1GIAA 3AEQB 1XQVA 1J2RA 3VYSB 2DE0X 5A9RA 1O6GA 1OJ7A 2J07A 4UZEA 2LTAA 1UPCA 1R1DA 4NWIA 2YMQA 1II8A 3EARA 3IBTA 3MMZA 4X1KB 6NULA 2VPQA 3H7IA 2Q3HA 3ZE1B 4E4TA 3H16A 3CEJA 1OIXA 4EGJA 3K0AB 3CTMA 4ZANA 2HI0A 4GQIA 1QOQB 3U44B 3OQBA 4OJNA 1YS1X 3ABIA 2C00A 2FG6C 3EGOA 4TS9A 4X71A 1RRKA 2LR0A 1E2NA 2XDQA 3EH2A 3RSZA 2AN3A 3RRXA 2G80A 3ZV7A 4EF5A 2OG2A 5HFAA 5JH7F 4K86A 3GEBA 5ERXA 4Q1AA 1Y6FA 3DAFA 2Y05A 1TZJA 3WIVA 1SCQA 1B42A 3IV7A 2XGOA 4YPFA 4C3VA 4YFVA 1ML4A 2WIAA 4DY6A 2ZBDA 5JTTA 4IO0A 1ISJA 5AW4A 3A3PA 4G0PA 4CKCB 2DSTA 4QWMA 3RJTA 5FA8A 2E5FA 2COUA 3QKIA 3LL4A 3AW9A 3AWIA 3PFNA 2LWIA 3HFRA 4MO9A 2QN7A 4MS3A 4G84A 1FSSA 2AJLI 1EA5A 1I01A 1DG9A 2D62A 3RBAA 2F6RA 1J5PA 5C53B 4CQMD 2O50A 4CI0B 1BE1A 1JIUA 1FQOA 1S7GA 1X8LA 4EB3A 5IBRA 3OTIA 1NLZA 2I4NA 4LTNA 1EFDN 5ARDA 4TUYA 4BFUA 1EXVA 4LISA 2HMVA 3LGSA 5JZBA 3NHWA 4HK4A 1LVGA 1SCBA 4QPCA 4OO3A 4QTYA 5MHTA 3QPCA 1H85A 1AGRA 3STVA 5EMLA 4MEBA 1IK4A 4H1VA 4N12A 5EI5A 3VMFA 1IZ7A 4G41A 5ALOA 3EGCA 3IHKA 4HAZA 3OQPA 2R6AA 1CWUA 3AOGA 1AZWA 3ID6C 1URPA 3KJHA 4FGLA 3LY7A 4JLPA 5K3DA 5KAPA 3U7JA 2OFPA 3WLNA 3F6BX 2PZMA 3AFIA 2G0TA 3D1LA 4I5DA 3OEWA 5C1OA 2ZZKA 1SVSA 2DX7A 3FRHA 4N7JA 4PAQA 3WQHA 3AEKB 4JKIA 1IUKA 4S1PA 3A0UA 6REQA 2JF0A 2WKQA 3TO5A 3QUCA 3GGPA 1OYYA 1D0IA 1R6VA 1XCBA 1ZN7A 2IPLA 2PV0A 2N47A 3GDFA 2X5XA 1A5TA 3M83A 4TTQA 3VZCA 4I81A 5D51S 3KIPA 4GX0A 3PV0A 4G81A 2P9QA 2J9FA 3NZEA 1L1FA 2AEFA 3D7LA 3WVNA 1SBHA 4O5OA 1CNEA 1NNUA 2AVDA 2UVPA 2GBLA 2R8EA 3R74A 4DWJA 1FP6A 1DRWA 2OGSA 3IB6A 3F6SA 3OJXA 4FMDF 2GCPA 1Q2UA 4HAOA 3ZY4A 4BVLA 4EFMA 2JCVA 3PCRB 3S29A 3MCUA 2WTUA 4IUCS 2C4KA 1CEYA 3FFWA 1M76A 4UPDA 3RVBA 5J59A 5IHXA 2BEUB 2ERXA 2YQZA 2P8JA 5SY6A 5HKOA 2B2XA 2KMLA 3W3AA 1QKKA 2FQXA 3TW8A 3IVRA 1W6RA 4JOBA 1UBTS 2UUOA 4ED9A 4R71A 4HWKA 4M9QA 1UWCA 4TV8A 4AIIA 1GR0A 3FMIA 1NQTA 4BX0A 1H4TA 1WUYA 2XCSB 3PRYA 1WD5A 2P9YA 1E2JA 5LB2A 3FTFA 2WMOB 5M2QA 4IEIA 1KJNA 3MN1A 4KSBA 5JLJA 2QVXX 4W8HA 3DDOA 1JQEA 1NFQA 2EYUA 1MJGA 2OZKA 3WIEA 1JSXA 4NE2A 1AK2A 1CQJB 3K9BA 5ENZA 5LA6F 1UR5A 2ZT7A 3C5VA 3C3CA 3COVA 2HSEA 3UCXA 3E9ZA 4HH3C 1ZRHA 3PLNA 5FBQB 5CHYA 4GRIA 4OHPA 1GUAA 3OMWA 4D6YA 5BORA 3L8YA 2ZRPA 2PAFA 5G4KB 2Q6LA 4BV2A 2Z4RA 2F4VB 5U1PA 4OOFA 4TTPA 4TTVA 4Z0NA 1U2GA 2H1LA 2JIOA 3C14C 2WYIA 3JQBA 4GE3A 4JJIA 3F6EX 1QIEA 4LV6A 3VH1A 4KP7A 4PPQA 2W0MA 1G19A 4BV9A 1UXHA 4Z4CA 1P7VA 3O1LA 1EBUA 3TLKA 5LC1A 1R00A 2QNRA 2RGRA 5I8ZA 4WW0A 2B5OA 4WZBB 1H2FA 5D85A 4C7BA 3NTOA 3WSVA 3E53A 3OQOA 2QMOA 4TKLA 1N57A 2PX0A 1N0VC 1HFWA 5JCOC 4Q82A 1W1IA 2R00C 3N76A 1IU9A 1PNVA 2PH1A 4J2TA 1SUPA 1FU8A 4ARVA 4QPPA 4F4UA 4LKOA 2X41A 1N9GB 3AI3A 2YDXA 1QFYA 1Z0IA 4GECA 4NCBA 2JGRA 3ZN2A 1XDUA 3FR7A 2X9NA 1MC5A 3AU8A 4JVSB 3AB7A 4Y9RA 3QVJA 4YUZA 5ECYA 3DOJA 1UM9B 3KWMA 1KZYC 1H5NA 4Q7EA 4W8OA 1NFFA 1PGPA 5FJJA 2A6PA 3JVUA 4OFXA 2DU8A 2JAHA 1IOLA 3MWGA 3KNZA 3KSBC 4CV3A 1Y98A 1OU0A 1R5JA 1Y0BA 2EIXA 2HQOA 2R7MA 1GG2A 4OSOA 4Y2SA 2ODPA 3D7NA 3LOUA 4FMPA 4N54A 2RH5A 4C88A 1TPZA 2V6IA 3HBNA 1HDXA 4AIRA 3GFTA 1K66A 4FZJA 5AMXA 1KBZA 1O08A 1BKYA 5A6SA 1LEHA 4QYIA 3TVDA 4DR4B 5REQA 5KNDD 1YUBA 2ERYA 4FT4A 1I3KA 3K72B 4JGBA 5HGJA 4JVOA 3WLFA 4KFUA 1J09A 2Q4DA 2EKDA 2AEEA 3LWZA 1JVSA 3T7TA 1WBDA 2QN1A 1YQ9A 2WD8A 1NRJB 3P5BA 3FROA 1FBTA 1LB1B 1CVIA 2QGZA 3KQSA 3QKRB 3V32A 1COWA 1R0BA 2XBLA 5AXBA 3NXSA 1Z62A 1H2HA 3QU4A 3A9SA 4OPMA 3ZWKA 2WJWA 3DT8A 3O84A 5CVCA 4BB0A 2EHJA 2RC5A 4ACBA 1GG9A 2ZRCA 3QPWA 3UWSA 5BW6B 2IU4A 1Z22A 2C4NA 1HDIA 4C08A 4J4HA 1B8PA 3HYLA 3F96A 5DKFA 5FAKA 2YVQA 3KKPA 4MMXB 5GWXA 6ABPA 4XWOA 1GKLA 3L0PA 5TGZA 1IWBB 1FC0A 1M9NA 2NZJA 2IIBA 4J8PA 4R51A 1DO2A 1RJEA 3BMNA 4C78A 4R5MA 1CZKA 4IVQA 1Y3IA 4TTRA 4EHHA 3NYRA 4RMIA 1BJKA 4JR0A 2BWJA 2FEAA 3L6DA 1E2UA 2JFXA 4M2LA 3L7JA 1LRLA 2PMCA 3MQFA 5H59A 1UMCB 3UJAA 1SN7A 3MINB 3IMCA 2I71A 2OAEA 1PJ8A 3KKZA 4C4ZA 1XROA 4KIJA 2V9PA 4RPIA 1USVA 5DOVA 2IBTA 9ABPA 1DXYA 4GLBA 5IYZA 1JJ7A 5K0TA 4XTCS 2CZCA 4XJSA 5CPBA 4B7ZA 5KQRA 2BEUA 4UQLA 4W5QA 2CUKA 2E0IA 2ISSD 2J9ZB 3H8JA 3ITEA 1BEEA 4J0JA 4HVCA 5KDDA 4L8GA 4LWOA 5IKOA 1ADBA 3U44A 5FPQA 1KOGA 3TB6A 4I1OA 1E79D 1KY4A 4AY6A 4FBLA 1Q7GA 3BZBA 4N5HX 4EKNB 1LNSA 2VI5A 3AESA 4MA4A 3DC7A 2QXTA 3IR7A 1G21A 2JKYA 3MJDA 4Y2UA 3TZEA 5EFZA 4D2IA 5B3JC 1WSDA 1PEDA 2AEMA 2JK0A 1XNQB 4K3VA 3KBBA 2R4TA 3QIAA 4DJFC 2H8KA 5JY1A 4K9NA 4HO1X 1H3FA 3OOSA 3T3EA 1KZ6A 4YK7A 4Q1CA 3C8DA 3V4PB 1BDHA 1OYOA 2Z5FA 5IPFA 2JANA 1KS2A 1SQ5A 3DZKA 2WM2A 3IB3A 3FOBA 4YJ2A 1NVXQ 5L7WA 1GQQA 4URVR 2J9XB 3HCWA 3OEHA 4TTSA 4JI2B 4A0SA 4DA9A 2CDRA 1A9RA 1FYVA 1U3DA 3HR7A 1SR8A 5LKAA 1ZM3A 4CKBA 5AM3A 4WJZA 3ZH2A 5A2QA 1YVPA 3QVVA 5BYAA 2H5EA 2O8BA 2BOVA 3PTAA 1Z68A 1KU6A 4AJHA 2XB6A 4RYLA 4E70A 5CYOA 2BW0A 3CNQS 5A04A 2WSLA 3H1FA 4XQ0A 3F9IA 3NWPA 2VYNA 1YNOA 1KYIA 1OXSC 2J33A 2VWGA 5K05A 3HI4A 8MHTA 3TQFA 4AQ7A 1BCRB 4F3KA 5JIBA 2XKJE 3VOSA 3EDMA 2EFDB 4J7AA 2UZ3A 3V7WA 1XRRA 1HQCA 1UAGA 2CXHA 5AUOB 4K3UA 4BO3A 2F9LA 1STOA 5K4HA 2PL1A 4CM9D 2X76A 1PT6A 3VI3B 1J33A 3F8TA 6REQB 1CUHA 2G8LA 1Z6AA 2D5BA 2DPGA 4FWBA 4Y1GA 5BO5A 5KWSA 1TEZA 2V03A 4FP9A 4MICA 5F77A 4MRRA 1K97A 2HWWA 3PQCA 4URFA 3RIEA 3BDAA 4DUZB 3RC2A 1GOTA 3UMGA 4JP2A 3UQZA 1IRIA 4PN3A 2LKDA 3IDSA 4EELA 1E98A 1T1RA 4EENA 1IG0A 3MA0A 3JVEA 4LY0A 4U2BA 4Z2YA 5EVCA 5LBTA 2BISA 3IAM1 4REQA 4F4IA 3GB9A 1LRKA 1OH7A 4EUHA 3GN1A 3B1XA 5LLSA 2Z1MA 1P4JA 3NHLA 2KPOA 4ENWA 3RJZA 1F4VA 3WHIA 1B41A 1SXIA 5KSOA 4A1FA 5LXTB 4CLDA 1J49A 1ZGAA 4JR2A 4RF3A 2PZBA 1WG8A 2YX1A 3I52A 3LT1A 4GWGA 4I55A 4Y9SA 3B3QA 4QYMA 4LNUB 1BXGA 3SIRA 2V6BA 1BFDA 3AEQA 4TKZA 3E0XA 3GFRA 4D4MA 3PQDA 4R3UC 3ZVRA 4TV8B 5BT8A 3IUYA 1XMIA 1KYYA 3UAVA 4O4HF 3DBVO 3Q7QA 4Y0VA 5KYVA 4X90A 2HQRA 4LMPA 3UB4A 1YJXA 4Q03A 5BPFA 3ZJ5A 1N0UA 3TAUA 5AW5A 2CHEA 1YL7A 1ZD1A 3CX7A 3VKUA 3R5KA 5CT9A 3AUYA 4V24A 1M72A 2B4KA 2XDQB 3LX4A 4EKDA 5CLJA 1OV4A 1RWKA 3C7DB 4QKQA 1LGYA 3ZLJA 3INYA 1MORA 3N5CA 3Q3CA 2JJMA 1TF5A 4MUMA 2EXXA 5ALNA 1XDBA 1DWUA 1W0JA 2O1SA 2WWXA 3LPDA 1TQHA 2YFHA 4U0KA 4MQEB 5BWCA 3RU3A 4CKCA 2RHHA 1ZGJA 3V9PA 1NQWA 2PU5A 2IGTA 4ZO9A 3BRWA 2P2GA 2GD0A 5ALJA 3A6PC 4GBMA 1YD7A 3HBAA 1FTNA 2QEQA 1KE2A 4NBLA 1QHYA 2JAWA 1P77A 2A7XA 1EWYA 2DAPA 3EC1A 2H11A 2OHJA 1A98A 4NK4A 4NMWA 5DHTA 3V3KA 4G26A 1SHZA 5CDUA 4HDCA 2I3BA 3TRHA 4DV6B 1U4OA 2GH1A 5F7ZA 1ISFA 2QT0A 4Q4AB 4O4IF 4ON9A 3UFXB 4G37A 4ACAA 2CVPA 4JQSA 4QYWA 3T52A 3UGTA 1N2IA 2IU0A 3LW7A 3SHWA 4TKVA 4S1NA 5DYYA 5LKRA 2XE6A 2NLOA 2FP4B 3CV3A 3GZJA 4PSDA 1YFZA 1T5SA 1NG1A 2J1LA 2F43B 3RD5A 5THXA 1P3Y1 3HVKA 2XUPA 4DV2B 4JKYA 1ZAYA 3GBSA 5ALVA 2FN9A 4H7EA 3ILYA 3KPYA 1HBJA 4RULA 1RJ9B 1S8AA 1XA4A 2BL4A 4MW4A 2AFIE 3BXXA 3HCRA 4XPIB 3HUEA 1ELOA 3CEAA 2B98A 4LYFA 4O29A 3VR4H 3WZMA 1PFVA 3BUSA 3G6WA 2AZXA 621PA 2HBYA 1IJKA 2BELA 2DFDA 2D13A 1XN4A 3DVRX 3LU1A 5DMXA 4F6RA 1TT5B 3BBPA 4U6QA 4LHSA 4BKPA 4G25A 1QO0D 4O8CA 1BAPA 1L0BA 2BAGA 2QJTA 1QGAA 2NZ8A 3SXUB 3PHBE 3WIDA 1XV5A 3T95A 3ZCTA 4A8JC 2FVXA 4X7RA 2FW1A 1MAVA 2VHEA 3A6HA 3JQFA 2Q50A 1Q91A 2IYUA 3SM3A 1E99A 3F98A 5TQ0A 3HABA 3OJLA 5AXCA 4ZYZA 3OKFA 4OA5A 3EZ7A 4NZOA 1X15A 4XIGS 4DLSA 2J0SA 1NXQA 1V35A 3EZ6A 2XYPA 3HCAA 3V4FA 3BJEA 4DREA 1MA0A 2O4UX 3ZY3A 3KVYA 2SCUA 3TL3A 4JBXA 1P9NA 3A7EA 2O20A 3F6RA 4NPAA 2R2AA 4QT0A 4PCLA 3PICA 4BQFA 4DNXA 2VWQA 2ASEA 4MA5A 5JJKA 4MUEA 1SVIA 4QJIA 1XTJA 1U0SY 2VR1A 1A69A 4UVGA 1GPNA 3CRMA 3PFHA 3V4OA 3WL4A 4BNJA 1JXMA 3AG5A 1Y6GA 2IITA 1PFGA 1H3NA 2QQEA 2NT3A 3UJDA 4CMIA 1XPJA 4R1NA 3TL2A 3AVUA 2H2HA 1G18A 1E64A 2VK4A 1BEZA 3FNQA 2BFWA 3JQAA 3P9XA 4NJMA 5BQPA 1V45E 1V6SA 3QK7A 1UQTA 3CVOA 4WGFA 4GSYA 3MAGA 1UH5A 5DEOA 3PQ3A 1GGHA 3QUBA 3UJPA 5ERYA 1K1EA 1ZU5A 4AROA 3S5JA 3OT5A 1X8XA 5TGDA 3FKQA 5C7YA 4BGVA 2YWXA 3SK0A 5DNCA 2BYTA 4KN9S 4HXFB 2EFGA 1VM6A 4QELA 2PS0A 2QZ4A 3PNYA 4FNGA 1EFAA 1QP7A 4DCMA 2BONA 2W4QA 1P45A 3ZW9A 3JATA 1HNWB 2YIVX 3DW3X 2P65A 4Q4HA 4RMGA 4WKCA 3V1KA 4ZCMA 1Y9ZA 4IIEA 5FNZA 3TZHA 1HE3A 2DMRA 1DX6A 1AXRA 2I0FA 3O90A 1WHTA 3WJ1A 1I2BA 1EGHA 1U3VA 1ZONA 2AF4C 3K05A 2QIOA 1G5RA 4RTMA 1AKMA 3COSA 1LF5A 1UBKS 1LXCA 2WFLA 3U9SA 3VNSA 3WB0A 1R66A 4MYSA 5EIEA 3GEGA 2V5UA 4JJEA 2AMLA 1OCEA 3M1YA 2AW3A 3B1ZA 5A3VA 3K96A 4PNEA 1L5KA 2OSBA 5A4IS 4DR1B 4BX2A 4C0HA 2BVNA 1T2CA 2OL4A 2XUFA 2FJPA 5WRFA 3TECE 2R8BA 1CE8A 1ZCJA 3FR8A 5IWCA 5HK8A 1NBEA 4C4PA 3S1LA 4RTSA 1MOQA 5DFAA 3P97A 1W2WB 4I5EA 2H63A 4JHLA 5T6BA 3RSHA 1E9AA 1SKYB 1OB2A 4G4SO 2A5GA 1JXAA 2C1EA 1N5DA 4R8SA 2H9AA 4G4GA 4BCDA 2Q45A 2COEA 1J42A 3IURA 3EVZA 4WFQA 4H7FA 4QUIA 4C43A 4KZKA 3R0JA 4WKPA 1Y8ZA 4KR6A 3SN6A 1ABBA 4RX1A 2DC1A 1A9OA 2EBUA 2WJIA 2XOXA 4HADA 4PXSA 4HDMB 5TXGA 3T5BA 4CG2A 2XEDA 2P9BA 1KC1A 2H4FA 2JBAA 1FX1A 3DV0B 4JI6B 4FFNA 1MG0A 1KSGA 5TMPA 4PRZA 4WXRA 4XVQA 4KAXA 3I9NA 4OAQA 4D9NA 1TK9A 3NHRA 4JC0A 3ULKA 1TQ6A 2CJFA 1J0DA 3QU9A 3WZ2A 4RJJA 5A6SB 3K5HA 4TPKA 1QP4A 4B8WA 3E18A 4LJ6A 2PBZA 5B6JA 3ZGXA 1OT5A 1Y34E 3EPLA 4LJ7A 1EUQA 4TKVB 5HKLA 3OCXA 3S2ZA 4EITA 2HFKA 4ZYVA 3OCCA 3PG5A 2HK9A 3PXBA 1SAYA 1V1MB 3MOIA 2BTQA 1TCCA 2OO3A 2QD5A 3Q3HA 5ITZB 3GCGA 4YP1A 1L4MA 4PTZA 2V58A 3A9VA 3CB2A 3C85A 2Y1WA 3MWDA 5IHPA 1QCCA 1T5BA 1SWVA 2D5CA 1YRQA 1JP7A 5FLEX 2NU8B 3PGA1 1FS5A 1MB3A 3AYZB 3PXXA 4ZOAA 2GFQA 4ISCA 3C6ZA 1NOJA 2RHOA 4WOKA 4IPTA 4WNCA 3V4SA 1DVRA 2DFLA 3MTGA 3WTCA 4YCLA 5GV8A 1TC1A 1R15A 2ZLBA 1G9TA 1K0UA 4ZAWA 3BMNB 3GFVA 4RJ2A 3TX2A 3WLQA 1EVJA 3UCEA 1IUNA 1U8TA 1XLTA 4G0QA 1U2PA 1V71A 4GI7A 4QOGA 2EJCA 3TLBA 1CUIA 1U90A 2OY0A 1I6WA 2VDKB 3A28A 4GBGA 4TV9F 2WJYA 1JF8A 1W48A 2J3EA 2R5WA 3NM4A 1LPBB 3BTVA 4GT1A 4OHVA 3TI9A 4GKBA 4PNHA 4L3OA 3ZZTA 1G2IA 4ZKEA 2DUWA 2NUTB 2WIFA 3DV9A 4G1VA 1WETA 4WPGA 1Z36A 5AKLA 1WL8A 2JJYA 4I66A 4X7BA 2AC2A 2NUBA 3D6HA 1VRCA 4WK4B 1TNDA 4JI3B 1M2VB 3FX2A 4MSUA 4BC1A 4Y2HA 5JZSA 2PXAA 3F4BA 3P32A 2XHZA 2QPAA 2GCIA 1YB5A 3CC8A 3DEIA 3SZLA 1PWXA 1VKZA 3AHCA 3F5QA 4WA8A 5AT1A 4L6AA 3M1IA 4HCJA 3VHRA 1VE1A 3IXMA 5K0CA 3NOVA 4GKKB 1YBVA 5HCUA 4BV8A 3RK0A 2Q8QA 4FHDA 4TM8A 4BCBA 2UKDA 3BXGA 1NKSA 1NMYA 4I9UA 4PGMA 4BVAA 2HMYB 3BZWA 1RKVA 4IQ0A 1O0BA 2CJPA 4Z9YA 4B4OA 1KNQA 4JLWA 5CAEA 1GTMA 3QSGA 2REBA 1YS9A 2IYEA 2ZI9A 2WJJA 2ZAOA 4GL2A 3QA9A 4WI1A 3DMDA 2VNJA 4H7PA 4YJ2B 2VHUA 3RRMA 2AXNA 5C7OO 1DAEA 2EBWA 2POCA 7AT1A 4EQ6B 1J22A 1M2FA 2VO1A 1E94E 2G72A 2E21A 4LC9A 5SYMA 4HF7A 1VHWA 3AHJA 3PNOA 4TZKA 4JLKA 4E6EA 2XZOA 1P5ZB 1G291 2VH2A 1J1ZA 1KZ1A 4ZTUB 3E4DA 2O5EA 1AGPA 1C7ZA 2VP5A 3ZGOA 4MKHA 1AC5A 1EZZA 4MVJE 4LYEA 2WIJA 1CUSA 4MW7A 2CZQA 2IUSA 1QQTA 3GCXA 4Z3DA 5NULA 2FWRA 3WI7A 5GADl 5C7IO 1IN4A 1YL5A 4HMPA 3PNMA 2IFTA 2KBEA 2Q28A 2C5GA 1IM5A 4JJFA 5AVRA 2VT3A 2FW8A 2Q3MA 1JH9A 1D7AA 2CEAA 4IEFB 4D3SA 1Q3HA 5KVCA 2JRCA 1HEYA 2I76A 3O2NA 3HUTA 3IPXA 3NAZA 2K7FA 3IOEA 1MEOA 5JS6A 4LVCA 2DCMA 2WU4A 4BLRA 4ZN6A 1E3IA 1NW4A 1K5DA 3LGXA 4KIFA 4KWTA 3PLAE 2C2OA 3DOOA 2H1CA 3M81A 5GM2A 5BW8A 1GZHB 3Q9SA 1UIMA 2YRWA 4J0EA 3KZNA 1VYHA 2RHCA 4PC2A 2R44A 1TYZA 1T8PA 4BE4A 5JZMA 1H1LA 3BB3A 1NWHA 4BX8A 2VHWA 4UZFA 5K8JB 4HAUA 4TT8A 1UL1X 3MJRA 4PZLA 3OEHD 4MKXA 1OWPA 3HCFA 4LRYA 2O7SA 2FK7A 3LDHA 4XSVA 2HPHA 5DI3A 1JQ3A 1N1GA 4NYJQ 2HWXA 3Q11A 4P4SB 4MUAA 4S2UA 1LX6A 1VJDA 1YQEA 4HDRA 4DV7B 2PT9A 2VK1A 4C0LA 2GSWA 2OCGA 5FP0A 4F92B 2IVZA 3GLIA 3GIWA 3OZIA 3HP1A 1Z4NA 2HXSA 2VHCA 4P3NA 4NMLA 4EJSC 3JD1A 1PEKE 3PFWO 1RPJA 1T3TA 1V5GA 4BMDA 2CLHB 1QZTA 3PNSA 2PMDA 3PDWA 4R0MA 1JE0A 1TIPA 2F1HA 3AM5A 5DYWA 4ZICA 3HY4A 4AKGA 5JXIA 3AEYA 5F21A 1CP2A 2ATEA 2O07A 4HGZA 1R4MB 4ZCTA 1RWNA 5H3LA 4HRAA 4MQEA 3ZQ6A 1L5OA 2HHHB 4A4DA 1C7FA 3GGGA 5I5EA 1ZIYA 2ZI5A 4LZLA 3U6BA 1VCHA 2YC4C 3V4RA 1DRVA 3PXGA 4N5NA 1T5IA 4HQOA 1C1YA 1AUPA 1KTVA 3ANTA 3KQTA 3R7BA 3ZR4B 3L1HA 4K6FA 3HZRA 4ER6A 8ABPA 2ZDQA 3KQWA 3R6GA 1RQPA 1CS0B 2JLQA 1YZTA 3SC2B 1F4PA 3HUDA 4JLOA 4RH0A 4XB6B 1J0AA 4EDFA 2CJYA 5HHTA 1RYMA 3MVEA 4YV1A 2GXQA 4ZI3A 1ESNA 2J3KA 5IJ0B 3UFXA 1W85A 1S2DA 2PRKA 6GPBA 4AY5A 4Q15A 5IAGA 2V0GA 4GVXA 5DCWA 2NPOA 3PPXA 5ENVA 2NPFA 1A9XB 4A6DA 2AIRA 1PIWA 1T10A 1UKAA 5HW0A 3ZXXA 1YFLA 3IIEA 4O2AF 2F9MA 3T54A 1ACMA 3OIVA 3FPSA 4RF2A 1W4BA 3OFVA 5BXQC 1EBBA 1NSFA 4LSZA 2HY7A 1T0UA 2HSWA 4JT9A 4XXHA 5DYGA 2G08A 1YQQA 4I1YA 4WASA 4RY9A 3RIYA 3TPFA 4CQLA 4HI0E 2IWRA 3N0TA 1JDUA 2V7QA 2FP4A 3UAYA 3GLHE 2XDAA 3MZ0A 1CUAA 2VHQA 1SOAA 3C8HA 1BDMA 1I6LA 1QK4A 1RWVA 3PRJA 4EYQA 1F8XA 2QORA 3SEZA 3N8KA 2XRMA 3NHFA 1N32B 3N0WA 3FCEA 1QF7A 3NTRA 1IHYA 3KOOA 3WFIA 2K4MA 2I2CA 2V7UA 2X19A 3D4PA 3PIDA 4IDHA 4KGXA 5DBIA 1FDUA 4IFEA 5ESDA 1H66A 4GDMA 3HKBA 4Q93A 1OAKA 1KFKB 2D5AA 3IBGA 1I24A 1TVMA 2GHRA 3EZNA 3HJAA 2PD6A 3MS4A 4Y6GB 4EPVA 4KEAA 5AI6A 1QRTA 3MSXA 4QQNA 3QTTA 4KBGA 2RI0A 4JC8A 3HJUA 1P1RA 1D4OA 1PV2A 2ZUTA 3B1YA 3GJRA 3O74A 1R64A 1HT1E 1NVMB 5AXDA 3I3OA 3VX4A 1DEXA 2WF8A 1AUQA 1C3OB 1AQ6A 3OEED 3LY5A 3VU9B 4HYEA 2I9KA 3Q9LA 4NH0A 4KK4A 4EUNA 1XFAA 1OWNA 2G70A 4M9UA 4UASA 1DOAA 4RGYA 2AW5A 3NETA 1PBNA 1X0XA 4QICA 4F9TA 3HRHA 4OHCA 7YASA 4D4GA 3T4PA 4CBVA 1JR3A 1Q1EA 3JR7A 2IYWA 1O77A 4TVSA 1VCOA 1P44A 2WT9A 2QSYA 2XT0A 2CHUA 4W6ZA 1KMHB 2N75A 4RFSA 2Q2VA 4XGQA 3R24A 2FK8A 4FI3C 4J07A 2WYVA 1FNDA 1Q1QA 2GWHA 2CDCA 1OFTA 4ZZIA 3WO0A 3LVQE 4LJYA 1G8YA 1PJ2A 2BKAA 5DNVA 5IDYA 3C1AA 5SICE 4YJ3A 3VQTA 1NBME 3CEPB 2GB4A 3RU7A 1ECGA 3A9UA 4D43A 3LRXA 4OBBA 1JHPA 1PJCA 1USUA 2QPOA 3DEYX 3IQEA 3PGJA 3UXYA 5D01A 2FZKA 4NMXB 3UTCA 4C0AC 4YCCA 1D3AA 1ZK2A 4JCOA 4LCBA 4ZV7A 3RGWS 5HNKA