2VDVE

Structure of trm8, m7g methylation enzyme
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
227
structure length
216
Chain Sequence
b'NPFSDHQLEYPVSPQDMDWSKLYPYYKNQMTKKVTIADIGCGFGGLMIDLSPAFPEDLILGMEIRVQVTNYVEDRIIALRNNTSKHGFQNINVLRGNAMKFLPNFFEKGQLSKMFFCFPDPHKARIITNTLLSEYAYVLKEGGVVYTITDVKDLHEWMVKHLEEHPLFERLSKEWEENDECVKIMRNATEEGKKVERKKGDKFVACFTRLPTPAIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRNA (GUANINE-N(7)-)-METHYLTRANSFERASE
publication title Structure of the Yeast tRNA M7G Methylation Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 62
structure length 216
sequence length 227
chains with identical sequence F
ec nomenclature ec 2.1.1.33: tRNA (guanine(46)-N(7))-methyltransferase.
pdb deposition date 2007-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02390 Methyltransf_4 Putative methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2vdvE01
3ELYA 3GCZA 8MHTA 5K09A 4AZWA 2PVCA 2A14A 3OE5A 3FPFA 5EEHA 3NVKI 4BLWA 1ZG3A 3NDJA 5ICCA 3UA4A 4EKGA 3LGAA 2B2CA 5EHGA 2P7HA 5GP1A 2ONYA 4XUDA 2ZIGA 4RV9A 3P9CA 5E9WA 4GQBA 1FPQA 2BM8A 1G8AA 1SUSA 4X1OA 4EQZA 3FPJA 3GJYA 5DSTA 4PYIA 3R24A 5DSXA 2ZLBA 5FADA 4DCGA 2C7OA 3OCJA 4L7VA 3G5LA 1KYZA 1R74A 2ADMA 2UYQA 1NW3A 1NBHA 4KRGA 4PYKA 2V74B 5E9QA 4DCMA 1DUSA 2G1PA 2FCAA 3HEMA 5DRYA 4M38A 2CWWA 3GU3A 3KQSA 4F84A 1DL5A 3UJAA 2IH2A 4C05A 4FSDA 5EEGA 2LD4A 1X1AA 4C08A 1EIZA 3LDFA 5E1OA 3EVBA 2FPOA 3KU1A 2FRXA 3LBYA 1UIRA 1I1NA 2DPMA 2EJUA 5HIKA 3E23A 3P97A 3O31A 4RWZA 3KPYA 4B17A 3G2OA 3EVDA 3G88A 3I58A 2B78A 3IYLW 5GIPE 3HCBA 2C7QA 5DM4A 1N7JA 2I9KA 2IH5A 5K0CA 1M0EA 3E7PA 3SXJA 3B7PA 3GWZA 3HA5A 2Y1WA 2HR1A 4CKCA 4A6DA 3FUTA 4RVDA 1WG8A 5EMMA 4IV0A 3BGDA 3JWIA 1RI3A 3BZBA 3FRIA 3P9IA 4WXHA 9MHTA 4RVGA 3LCVB 4OA5A 1NW7A 3B89A 5EIFA 5FHQA 4GOND 2HNKA 2N47A 3C6MA 1KPHA 1RI4A 3A4TA 5EZQA 4QPNA 7MHTA 1BOOA 3IEIA 5GOZA 2H1RA 2PWYA 3MGGA 3NW9A 2JH9A 5E2AA 1VP9A 4KW7A 3DH0A 2AOTB 3BXOA 3R0QA 3SGLA 4E32A 4KIGA 1BKYA 3ELDA 2YR0A 4ER6A 5LQUA 3HVHA 2VP3A 4PYLA 1F3LA 3KPWA 5FA5A 4PIMA 3Q7EA 2OXTA 4AX8A 5LQCA 3A27A 3B3GA 4DMGA 1G55A 1VE3A 2PX8A 1PRYA 2VDWA 2FK7A 2ZSUA 1XTPA 3L8DA 3UJ9A 3KR2A 3VC1A 4ER7A 3HTXA 2G72A 1T43A 2AS0A 2CKDA 2OKCA 4KWCA 4RX1A 3SSOA 2ZZNA 1G8SA 2PLWA 2JHPA 3IHTA 4PGHA 3UJCA 4BLUA 5CVVA 3REOA 3RIEA 2KW5A 4GOOD 5DXAA 3S68A 3KKZA 4PCLA 3G2QA 5IKMA 1JSZA 3I5UA 4GEKA 1Y8CA 3AXSA 5CVEA 5KQSA 2JHAA 2UZ4A 2IDKA 4LWOA 3OU2A 3MTEA 3SR4A 3TOSA 3HCEA 1QZZA 3ANXA 4AZVA 2Q41A 1P39A 5EIWA 3B5IA 4RTJA 1P1BA 4DQ0A 2EJTA 4RYLA 4JXJA 2HV9A 4YV0A 3UZUA 5K01A 2OZVA 3HM2A 4DM3A 1EAMA 4HGZA 3TRKA 4QTTB 4RVFA 1SQGA 3ER9A 5LQKA 5HZMA 4R8RA 4EKIA 3GRYA 3DMGA 3OFKA 1Z3CA 3BGIA 4GUAA 2IIPA 2O07A 3EGIA 3HA7A 4O29A 1R00A 1KPIA 1IY9A 2YQZA 4PIPA 4ZTBA 4E33A 3QV2A 5B1SA 1XCJA 3HCCA 4PCAA 2PX4A 3OE4A 4QDKA 3OZTA 1HMYA 2EFJA 5K0JA 2GAFA 2OY0A 4FZVA 5FUBA 5C9ZA 3MCTA 1AQJA 2YXLA 3JWGA 3MERA 3ERCA 3T7RA 4GOMD 1O54A 3U81A 5LQRA 4FP9A 1NV9A 2BM9A 3NDIA 1X1BA 2E5WA 1JSXA 5GINE 3TFWA 5KS2A 5K05A 5D1NA 3P9KA 2PT6A 5GWXA 5FA8A 2EG5A 3SM3A 5M5BA 2YUIA 5K0EA 1SQFA 4GOLD 5FQOA 2P41A 1BHJA 3E8SA 3KQMA 3GGDA 2P35A 4RTLA 1KR5A 2AN3A 4EMSA 5E8RA 5ICEA 5LSAA 1D2GA 2IBSA 2PX2A 3G2PA 2VZ9A 2O57A 1NE2A 3T7TA 2AVDA 5CVDA 1NBIA 4M36A 2VS1A 3DUWA 4PYMA 4QQKA 3WSTA 3BGVA 3V8VA 1DCTA 2XBMA 4RSRA 3VSEA 3KQVA 3EVGA 3TM4A 2WA2A 3DLCA 3KR0A 4MQ4A 2H11A 4QTUB 5K0NA 5K0FA 4CTJA 1QYRA 3BWYA 1NV8A 2YXDA 3SX0A 4RTSA 2QE6A 3DOUA 2XVMA 2FK8A 4RTNA 4XUEA 4PGGA 3LBFA 5EG5A 1OR8A 3FUUA 3CCFA 5MHTA 5FULA 4LWPA 5E1MA 1VP3A 4Y2HA 2EX4A 2Z6AA 1QAQA 3PT9A 3T7SA 3A7DA 4DA4A 2O06A 3LDGA 3VYWA 1H1DA 3C6KA 5G02A 3CGGA 4ATNA 4HRAA 1FP1D 4MWZA 2NXNA 2BH2A 4PYOA 2IGTA 2P3OA 2PBFA 2AOUB 2XYQA 3R6TA 1O9GA 3M6UA 3MTIA 5EQJB 2NNWB 3EGEA 3GNLA 3SMQA 5K03A 4C03A 5K0BA 4KIFA 1QANA 4OBWA 5E1BA 3DR5A 3EVZA 3EMDA 4U7TB 1L3CA 5DPMA 4Z2YA 3UJ7A 4EK9A 3M6WA 4YMGA 4OQDA 5CD1A 2FYTA 2PGXA 1P91A 1WXWA 3LPMA 3P2EA 5E9JA 3TQSA 1EJ0A 1R8XA 3DULA 3BUSA 3C0KA 1I9GA 2I6GA 1WS6A 3BWBA 3CJTA 4KDRA 1EG2A 1KIAA 3DTNA 4PINA 4CWAA 2NP7A 5DXJA 3T0IA 4QQNA 2P7IA 1XDUA 2ONZA 1RI2A 3DXYA 3KR1A 2ZULA 4KDCA 5EMLA 4X60A 3NWBA 3PFHA 4YUZA 3A25A 3M70A 1N2XA 5ICGA 3NTVA 4E2YA 4QVGA 3GRZA 3P2IA 3RODA 2AZTA 4YV1A 3UA3A 3DXZA 2PY6A 4QPPA 5KQRA 4OX9Y 3ELUA 3FUVA 1I4WA 1JR4A 5JR3A 3FPHA 5T67A 3I9FA 3UJ8A 1XDZA 5D1HA 3H2BA 3TKAA 1TW3A 3MAGA 1EJ6A 4AZTA 4RTKA 5EGSA 4GC9A 3G8BA 5JUWA 3KPUA 2UYOA 3CC8A 2ZIFA 3PS9A 3SVZA 3C3PA 1ZGJA 3EVEA 5LQJA 2NYUA 2Z6QA 3FZGA 2V7EA 1QAOA 4YUWA 1EQAA 3OU6A 4XCXA 3NVMB 2G70A 2I7CA 1X1DA 4P58A 3FUXA 1IXKA 2IDJA 3AXTA 4DF3A 3ORHA 3GIWA 2NXEA 1L3BA 2AOXA 3CJRA 4ER0A 2ERCA 2AOWA 2I62A 3QOWA 2GA9A 4HSGA 3CJQA 1R6AA 5FWDA 4YUYA 3NJRA 4RTQA 1G38A 1JQDA 2Y1XA 3M33A 5EMKA 1PJZA 3ELWA 1U2ZA 1RJEA 1X19A 2AOVA 3A7EA 3EVFA 3HCDA 5EKUA 5FHRA 3HVJA 3TR6A 1XCLA 2JG3A 2ZCJA 3FTFA 1JG2A 2OB2A 3B3JA 1XJ5A 2WK1A 3FYDA 1Q0SA 4NECA 5DT2A 3SSMA 2BR3A 5CCXA 3JWJA 2Z6UA 3OU7A 3K6RA 4UOEA 3KQOA 4HG2A 5CVJA 5KYGA 5EZSA 1SG9A 4M7RA 4X41A 4E2WA 4EVIA 1YUBA 1ZQ9A 2R6ZA 1AF7A 3MCZA 4P7KA 5DX1A 4POOA 4CKBA 5H02A 3D2LA 1INLA 1FBNA 3TLJA 4RTOA 2ZBQA 4H0NA 5DTQA 4MHTA 2P8JA 2PX5A 1KXZA 1UWVA 3K0BA 3E05A 1MJFA 2ZFUA 1QAMA 2DULA 2VDVE 4GF5A 2PXCA 2UYCA 2ZW9A 3EEYA 5HOQA 3I64A 2B3TA 4ISCA 1N7IA 1XXLA 2XYRA 3THSA 5CCBA 3VC2A 4K6MA 1NW8A 5T64A 4CTKA 3O7WA 3P9NA 4RTRA 1SUIA 3EVAA 3KQYA 4RTMA 2YXEA 4LECA 5DTMA 3M6XA 4E31A 2AOTA 3CKKA 2FHPA 2OPBA 2ZBPA 3GDHA 4CKEA 3MQ2A 5ICFA 3AWIA 1G60A 3LSTA 4MIKA 2PJDA 2B9EA 4F86A 4R6WA 4YMHA 3TMAA 2XVAA 3HVKA 3EVCA 3F4KA 3LKDA 5K0LA 2ZWAA 3QOXA 4M37A 4GBED 3Q87B 4CXMA 3NMUF 2CL5A 4QVKA 1L3IA 3UJDA 4YUVA 3LHDA 1KHHA 4FS8A 5K8VA 5E1DA 3M4XA 4PWYA 5GIOE 2F8LA 4QDJA 1YB2A 4PYNA 5BW5A 1R8YA 3PFGA 5U4XA 1FP2A 3IV6A 5EVJA 3DMHA 2VDUE 2BR4A 5CUQA 2IP2A 5HEKA 4FT2A 1YZHA 2C7PA 2B25A 4OBXA 3KQWA 1VPTA 1WZNA 4BP3A 3GXOA 3NWEA 1JG4A 1L9KA 3DLIA 5HIJA 2PXAA 3FRHA 3R3HA 2C7RA 3HVIA 5DWQA 3EGVA 3FYCA 1X1CA 3P8ZA 2OYRA 1VQ1A 5EPEA 3CBGA 2IFTA 4FR0A 2GLUA 1WY7A 2QY6A 4IKPA 4E70A 1IM8A 5GM1A 5F2KA 3FUWA 1F38A 3PX3A 3DXXA 4R8SA 5EHIA 3OPNA 3KQTA 2AN5A 3UBTA 2QRVB 2BZGA 3TPZA 3X0DA 2ESRA 3GRRA 2WA1A 1NW5A 4OQEA 5CM2Z 1VIDA 2NXCA 5DM1A 1M6YA 5E8JA 3LDUA 1JG3A 1KP9A 2ZIEA 1JG1A 3HP7A 3HCFA 4OA8A 4XUCA 2IBTA 3DP7A 2GB4A 4U7PB 4C04A 5HIIA 3ID6C 1TPYA 5FCDA 3PTAA 1ZGAA 2P40A 1MHTA 3UFBA 3KQQA 1JQEA 2YX1A 3GRUA 4G56A 5DX0A 1D2CA 3EMBA 4Y30A 4BY9E 2PT9A 4YUXA 3A26A 3BKWA 4ER5A 2YTZA 4C06A 3EPPA 2ZVJA 3AJDA 1SVUA 4V0QA 3PVCA 4R6XA 5DX8A 4F85A 4HC4A 4PNEA 3DMFA 1D2HA 3FPGA 4WVLA 2XYVA 2ZZKA 2UYHA 2GH1A 3HNRA 3EEOA 3M6VA 1VL5A 3HCAA 4BP1A 5KVAA 1YFJA 1RJDA 3TM5A 3SSNA 2ZWVA 3G7UA 1KYWA 1L1EA 2CMHA 5HIMA 1ZHFA 3B3FA 3G8AA 4FGZA 1ORHA 3LCCA 1RI1A 3C3YA 4FT4A 5FTWA 2PV0A 3I53A 4X61A 5BW4A 2ORED 4IWNA 3UJ6A 3V97A 4DZRA 2AVNA 1VBFA 5BP7A 4ER3A 5DLYA 2ZBRA 2G71A 4HTFB 3KPJA 2HMYB 4C07A 5LQAA 2CMGA 3THRA 1FJXA 1RI5A 4RTPA 5EKXA 1YFLA 1ORIA 2BR5A 2ZTHA 3KQPA 4E2XA 2YVLA 3HA3A 3BKXA 5DTRA 2K4MA 1AV6A 3G5TA 5P8WA 3BWCA 3G89A 3P71T 1HNNA 1ZKDA 1Q0TA 2AOUA 1NW6A 3KHKA 2GPYA 4R05A 5LR6A 4AZSA 3LX6A 5E2BA 4E2ZA 4X63A 3UJBA 4DKJA 5ERGB 3PX2A 5F2OA 1O9HA 3CVOA 3R9XB 5K0GA 1RJGA 3OFJA 1KPGA 4PYJA 3JWHA 2QRVA 4HH4A 3GRVA 3PB3A 5BXYA 5EOVA 5GM2A 5DRTA 1P1CA 2P1DA 4E30A 3PLAE 3AY0A 1SKMA 4C4AA 2OB1A 5HFJA 3ME5A 4YV2A 2IPXA 2IH4A 3FTEA 5FWAA 1BC5A 4BLVA 2AR0A 1YF3A 5FQNA 3FTCA 3BWMA 3KPVA 3LECA 2O05A 4RVHA 3G2MA 4P7GA 5C0OE 3MHTA 2OBFA 4FSXA 5T6BA 3OZSA 2PSSA 1JTFA 1R18A 1NKVA 1UFKA 1V39A 1XVAA 3LL7A 2QYOA 1YZ3A 4MTLA 10MHA 1AQIA 1G6Q1 2HTEA 3FTDA 2PXXA 4LG1A 2P3LA 4P7FA 4P7JA 3RW9A 2ZZMA 1JQ3A 5CIYA 5EMJA 3UWPA 4PONA 4V0RA 2JHCA 5HILA 3LKZA 5LQNA 1VLMA 1RJFA 3P2KA 5DM0A 3BT7A 4A6EA 2G8NA 4HGYA 4GC5A 2NXJA 2O0LA 3MB5A 5DM2A 5IH3A 1XDSA 2NP6A 2AN4A 2JH8A 2PWPA 3KR9A 3OZRA 2P3QA 2QM3A 3O4FA 4HTFA 4PYQA 2OO3A 2R3SA 5CVUA 1TW2A 3GO4A 3LCUA 1WXXA 4KVZA 2JJQA 5EC8A 1NT2A 4AUKA 5F2NA 3ER8A 2HWKA 1M6EX 3FPEA 4IV8A 3TKYA 1B42A 1JTEA 5C1IA 2PKWA 2GS9A 2H00A
chains in the Genus database with same CATH superfamily
1D09A 4TVOA 2WQ7A 2VSOA 4UAGA 2PZMA 3DHYA 3NBUA 1R9GA 2QJRA 4D9NA 2ZDQA 2H06A 4OHPA 4K05A 1YC2A 3K0HA 4HVTA 2PZGA 1WNTA 1NLZA 1UF9A 4P3PA 2BRUA 3S5UA 2Y1KA 2B2CA 3R9XA 2HF7A 1YZVA 2A5FA 3DOJA 3O74A 1GU0A 1GUZA 2GCOA 2YUTA 3IT0A 3S6JA 3DFIA 4B73A 2HRRA 4HCJA 1IDOA 4IWXA 4WZBE 5E9WA 1KR2A 5TQ2B 1CY7A 1WY5A 1ZI8A 5LWHA 4HN2A 3AJ9A 4EEZA 2X0EA 1WOMA 1XHFA 2R2GA 4BX3A 4COKA 4DA8A 1CEEA 1UKEA 1P5FA 1KWGA 2C7OA 3TSZA 1AMUA 3RE1A 4ONEA 3KUDA 1F0KA 3LRTA 4PYKA 3DZJA 5CGQB 3THSA 4DCMA 4F38A 5BWNA 3K1AA 3BFJA 1Q91A 1UM8A 3L8CA 1EK6A 2YHIB 3C3JA 3G0GA 4M3NA 3MWLA 4F4UA 3UOGA 1U0BB 2BTOA 1T4GA 1A72A 4C04A 1GPWB 3NHJA 1P4GA 5JZVA 1EFTA 4WK2B 4NCAA 2EJUA 1JEQA 4QBFA 4M7PA 3G2IA 4LRXA 3ZHBA 4XVHA 5BQFA 5CLHA 3MWEA 2A35A 4LGVA 3I5XA 4K6KA 1KIFA 4KQHA 4NHEA 3RC1A 4CL3A 3FZYA 3I58A 3MXOA 5JYEA 1FFCA 4FE7A 4DS3A 2X0NA 3DL4A 3IOBA 1NHGA 4RQBA 3C5WP 2LCIA 5DM4A 2CNWD 1DJNA 3L18A 3JQAB 1PK9A 3FVQA 1BIFA 4N0PA 2JPDA 2W6JA 4JVLA 3HA5A 2QJFA 3OQ6A 2JAWA 4QYIA 2J0QA 1P72A 3O4JA 4LXTA 2FVYA 4JXKA 1P1KA 1Z62A 3SBDA 2X0FA 5CM9C 3QUSA 1BGVA 1Y48E 5KTKA 3B51X 5F35A 1IATA 2R4TA 3R9KA 4C5CA 3K20A 3MGGA 3T5AA 3IUSA 3E48A 2MTBA 1KRWA 1AKTA 3GMTA 5BSGA 3VZSA 2G1KA 3PDCA 2XB9A 1QH0A 4L8WB 1IQRA 2I4IA 3EQ2A 4TYYA 1K4MA 1UDWA 4D5EA 4DMGA 3DE4X 2VUUA 4LNUB 1F2TB 2E89A 3KKKA 3BD8A 3KQKA 5LQSA 4F97A 2RHBA 3CNOA 5FOWA 3AU8A 2WKWA 3LQRA 4PLFA 5HRAA 4B0OA 1C4XA 2VLIA 3CNQS 4DGQA 2IEBA 2KW5A 1Q7TA 2Q7OE 1CFJA 1CY1A 1UKZA 4MARA 4PCLA 2OCGA 2Y6VA 4OBBA 3HMQA 1EI9A 3T54A 4WACA 2M6SA 4RF5A 5D7BA 3W3AH 1P2DA 1K0UA 3JYPA 3GUUA 1ZGGA 1YRYE 2CZQA 3MTEA 3V1UA 2JB9A 4TKUB 3BICA 4LE2A 1X7WB 1S7GA 4HADA 3WLOA 2H59A 3RU2A 1DGQA 1TECE 2FZEA 2QQ0A 3F5MA 2VXOA 5MFZA 2FSVA 3RHZA 5HG0A 3ZV7A 5GJCA 3H4TA 1W1WA 2WJPA 4MYRA 2E5LB 3CIFA 1QGUB 3FDXA 3PHBE 1I13A 1VSTA 2FRDA 3DAOA 2DCMA 1BTOA 5CXQA 5ITSA 5B1EA 1CD5A 4ZCLA 1PW5A 2AEJA 2P1RA 2ZYGA 3L0YA 3NI2A 4INAA 3WKEA 3GLFB 1ZL0A 1GQSA 2QTWB 3T7IA 4HTAA 4O1IA 4RXTA 1OLXB 1B6GA 1CC1S 2A5LA 3ISTA 2IIBA 2O1EA 4EHBA 4Z4QA 3ETCA 1FIUA 4ND1A 5K8CA 1WUKS 2JIBA 3PHCA 2G9NA 4EA6A 1VMAA 5ITZA 1DG1G 4WECA 5EYPB 1ZD4A 2PAAA 3CVXA 5FUBA 4BBAA 4HMOA 3GG2A 4QTZA 3ZQUA 5FPHA 1OILA 3V8NA 1OAAA 5HP4A 1HZZC 1DLIA 4M0PA 1GNSA 3O9ZA 3RVNA 3RS7A 5JAUA 2IUYA 1NQTA 2V7TA 4TV8A 5EXXA 3D4NA 5E4TA 4RY8A 1D4FA 3IMKA 3NUZA 2F1KA 2ZWIA 4IG4A 4N6GA 4AJLA 4YP6A 2B8NA 4PHCA 1J5PA 1ECBA 2O20A 3PQ4A 2MSNA 3GARA 3LWZA 1D2GA 2WHEA 4TSFD 3AHEA 3OOWA 1Z4LA 4LN1A 2ZJBA 4A2CA 4C0BA 4QM7A 1ZXLA 3DUWA 5AM1A 4MRMA 4K6CA 3H9GA 2G5PA 3A2MA 5LXTA 1JPUA 4DG8A 3HJBA 1X87A 1ZVVA 1H1LB 3KYJB 4LZNA 1S4QA 4FE3A 1KSGA 1V41E 3D81A 2J8ZA 4CNQA 3FZEA 2X5NA 1VG0B 4QJ3A 2IPMA 4NC9A 5KKAA 1FLAA 4EG7A 4FONA 3HBJA 5KYXB 4Q7QA 1TU4A 4LWPA 4F4HA 3IEKA 1GZ7A 4AMVA 4MNTA 2WSSD 3MPUA 1H0RA 3PT9A 2RHWA 4A0RA 3M6MD 1BQ3A 4R2WA 2IY7A 3KOYA 3VZQA 4K6GA 4WDQA 1AT1A 4QEDA 4YRJA 4DMRA 1CVLA 1J1UA 1RWPA 5HVNA 2BH2A 2BZSA 4XIJA 4E09A 2QIPA 7MDHA 4V1CI 4JYMA 3WMEA 4QARA 4EB0A 1U98A 4URYR 3R5HA 2H07A 1QANA 3DP9A 3ENWA 1ZGBA 5JYBA 3D3WB 4EATA 4F6RB 3I2IA 2HDOA 4FEGA 3V34A 5JCJD 3I8XA 1FLVA 4NV0A 3BH6A 4GO1A 1O7JA 4R51A 3UGTA 1W5TA 3UXHA 3EX7C 4MVJI 3ZTYA 3B6ZA 1HTBA 2W22A 1KEVA 3GFVA 5JPDA 2NP7A 1JKFA 1ICIA 2Q4DA 1T34A 5KNCA 4NZNA 3TQIA 3IL2A 2Z2YA 1JDSA 4C3OB 1L5VA 3EPJA 4KDCA 2Y67A 1E2IA 4HQ0A 3GGGA 1J2RA 1XEXA 2B9VA 1W5BA 2HZBA 3KYCA 3BXPA 4EYGA 3ADBA 1ZAKA 1G3IA 3IFSA 4QAQA 3NTVA 1JHPA 4Z0PA 4E2YA 3UA3A 2EG9A 4I1YA 5H8WA 2B92A 4GI1A 2WD7A 2XCSB 4TYNA 4HY3A 4ND6A 1MPTA 1N5JA 1OXVA 4XA8A 4AZTA 1X1QA 2HMSA 3CE6A 4GXRA 1S8NA 4G0NA 1XNQB 1JR3A 1SBZA 2HJWA 2GM9A 2QAGC 1W9MA 3ZZ0A 2RH5A 3UK6A 3SVZA 3HJTA 1M73E 2V7EA 2ZRHA 4LOLA 2WMDA 3JQ6A 3DTVA 3NOVA 3HJGA 4LJ4A 3NVMB 3TLGA 2HV8A 4NCKA 3KCNA 2GETA 3AXTA 1GRRA 4IZHA 1DCMA 2NXEA 1KNQA 3VR3D 1L3BA 1SBHA 1XN1A 4ER0A 3MRSA 4TL9A 2XAAA 2KYRA 4N9QA 1X7YA 4ESHA 2YMQA 4A2QA 1YA8A 2CZGA 1JA1A 2GUWA 2OFWA 1XMJA 2H2IA 3GT0A 2AOVA 4DNFA 2GGSA 1BE1A 3LVQE 3FB4A 1FU8A 1YQWA 1T2UA 4FDAA 4I4LA 4M7OA 3HCOA 2GTPA 4A0HA 3ONFA 5F78A 3AR5A 5E0KB 3H9CA 4YPVA 3K6RA 1BX0A 1FOEB 4N6NA 4Z7QB 3L40A 2FF7A 2CJFA 1SG9A 3HCWA 1QVZA 3CF4G 4M7RA 1ZQ9A 5DN6D 1N32B 3NIBA 6CHYA 1ESDA 4R69A 1NG1A 1BWSA 1WKCA 3FCSB 5T3UA 2IUTA 3WNBA 2Q49A 4GE3A 3K8QA 1WMSA 2O3SA 3MT9A 1BSVA 5DTQA 5TGTA 3N6RA 1FRNA 2VJLA 1U9IA 3QEOA 4PQRA 1T9KA 4W1SA 4DLKA 2VPTA 1UWVA 2WMOB 1H85A 1CQJA 1C9KA 3DA8A 3EAGA 4JEUA 4RF4A 5F76A 1NVFA 4NPAA 4Q37A 4QPDA 3EXEA 3EUFA 2FP3A 1CUGA 1CS0A 1GSAA 1GZUA 1HLFA 2BY4A 1CRZA 3PP8A 2OD7A 5D3KA 3R2JA 5IPFA 4C6HA 4KPYA 1Z0ZA 4OI4A 2KQUA 4HGRA 5I48A 4JKIA 3TLXA 4KXVA 2AFHA 2ON6A 1UT6A 1WP9A 2XKJE 3I2HA 3OLZA 3PD1A 4L73A 3LFHA 4Z7OB 2G4VA 4RSHA 3CKKA 2FHPA 3QU7A 2Y1LA 4CIDA 3F78A 3HM9A 1VHDA 4Q9KA 4C7KA 2CF5A 1KZHA 4C14A 1L4NA 4GL2A 1YHZA 1DIRA 3IR6A 3A31A 2QMYA 1L8OA 2VJPA 4DTCA 3QOXA 3COZA 4HNAA 4WNIA 1EFRA 4J76A 1DCFA 1CR4A 3C5CA 3UJDA 1JEAA 3I12A 1T4CB 5M2QA 3ICOA 1E7MA 1TF5A 3GPCA 2AD1A 3I1YA 3KZXA 4DDVA 3MUNA 1Q1NA 2EERA 5B3LA 1IEXA 3OI7A 3P2MA 4DCUA 2UYYA 1EWTA 4XDGA 3TR0A 4E03A 4G3XA 2N3ZA 2XRYA 3ZNOA 1ABBA 5EVJA 2I1QA 2WJ6A 2X8JA 2HIGA 3CPJB 3KAKA 2Z5LA 2YIMA 3ROKA 3R5SA 2G82A 3ZDZB 6ADHA 3KQWA 3DLBA 3LL4A 3L7DA 3PGKA 1HDXA 1OASA 1EVLA 4G63A 4GR5A 3B2EA 4WESA 2C2YA 4EVQA 3ES9A 3HVIA 3T3NA 1H69A 1OBVA 2RFLA 2Y99A 4BO2A 4YC7A 5JRDS 1OWLA 1IB0A 4YRZA 4FR0A 2QLFA 3NATA 3OLCX 2IHBA 2PWAA 1F38A 2IHJA 4C3UA 4UHJA 1LPAB 1QPBA 2ET6A 2YMLA 2VT2A 3F3SA 4EHDA 3R7FA 2JLRA 4CLOA 1LDMA 4HDNA 4EL0A 3ZDAA 2IXGA 5DM1A 3PQFA 1PW7A 5AVXA 2WF9A 3OTQA 1T29A 4NULA 3DDHA 3RK1A 1QFSA 1E9RA 1ZGAA 2BD0A 3UATA 3IQWA 1MHTA 1OV4A 3D8HA 2QENA 4YONB 2FU5C 2YHAA 4YVFA 3UPDA 1YRBA 4QXRA 3RF7A 3R9WA 1Y3FE 3OUZA 4ZEOA 4YJHB 5BNFA 2R751 3BKWA 5JAZA 2HAEA 1HDGO 3O26A 4FUTA 1E0SA 1UOPA 1K27A 3PNYA 4NX2A 2GH1A 3URKA 2O8FA 4DLYA 1RZRD 1GT91 1TYBE 4I19A 4LYJA 3RC9A 2GKSA 1G8YA 1RM4A 3FDZA 3OQIA 3R8FA 1KYWA 3JS5A 3TZ6A 5HIMA 2HJSA 1LK0A 2DU8A 2CZCA 2FEXA 2WTNA 1XTIA 3GVPA 1CIJA 5EFZA 2O50A 3SDZA 3JQFC 3W6UA 2JJ2D 5LYJF 1AKMA 1ZM2A 4XWTA 4XVRA 1B1AA 2FOLA 2J46A 3CCCA 1SBTA 3EGDB 3HJUA 3OZFA 4OREX 4RQAA 3UJ6A 1E2EA 5NLLA 3V97A 4YYEA 1BFUA 1F9EA 1KYIA 2O7SA 1K7CA 2ZBRA 5JXIA 1D1PA 1QPZA 3CF0A 2AV6A 4C7MA 2CMGA 1A9XA 1RHUA 1UINA 3CR7A 2B69A 4XFKA 3FGPA 2CMDA 3DKPA 3H87A 4EG6A 3H1EA 3KQPA 4MUYA 1RAIA 4CDGA 5ALFA 2ZOSA 1EA7A 3T5MA 5C8YF 1LLFA 3K9NA 5FPSA 2BMVA 2UZ3A 3GMIA 2WJAA 3L77A 1C8LA 3ZVRA 2PRSA 3A37A 4LZPA 4EG8A 5JD5A 3TB4A 1FE8A 5THQA 2D0DA 2R1TA 3QFHA 2FSSA 4R2LA 4ZQCB 4YQEA 1C4WA 5LR6A 4CG0A 3EJWA 3GLGA 1LNQA 3AK4A 4OK5A 3EZ9A 1DBPA 1PUXA 1SUWA 2CW5A 2LCFA 4ETWA 3L8YA 4CM8B 3EN0A 2FJPA 3E9YA 1SKMA 1E2NA 2OCDA 2JGMA 2WJWA 1UFVA 1W94A 1GTSA 1Z08A 4C4YA 4OBEA 4FYHA 4QDUA 2DKOA 1ZUWA 4IYJA 4UDNA 1FSSA 1DBVO 4X3CA 4E1AA 1Q0ZA 2JASA 1P45A 2VOEA 1FDSA 2WAYA 2DETA 3HSKA 2H7XA 3H8WA 4G23A 2PK3A 5LYJB 1YWGO 3L79A 3GLFE 2H16A 3QVTA 4NYMR 4B2IA 2ATVA 2V7XA 2OCBA 2DQSA 1IEQA 5K45A 2YH2A 2P68A 3CFYA 1WMBA 1TEXA 3QP9A 1SZCA 3NDBB 1VDZA 1GPBA 1NC1A 4UNQA 3BSWA 1V3QE 2QT9A 1C5KA 3ILHA 3ZBUA 4AXXA 4QQFA 2VLBA 4JT9A 4A0SA 1WZIA 5FL7D 3SHWA 3O2JA 3AL2A 2IXEA 3CZPA 3SZUA 4JVOA 1GZ3A 4UREA 4MQMA 4KQCA 4UNPA 5C8YB 5DM0A 3SYNA 2VJAA 2Z56A 5CP8A 1E9BA 2NUPA 4GC5A 4TZ6A 1FFWA 1P2UA 3IVXA 4HN9A 4R0MA 2PWPA 4IDAA 4IQ0A 2IDMA 2UUOA 4XARA 1H2EA 1JLLA 1PKXA 3BSSA 3KJQA 3MBIA 4ABYA 4I36A 3WLQA 1H2XA 3ZEAA 2VRWA 1RU3A 2BP7B 4WJZA 1GTJ1 4MS4B 5FP0A 1R2QA 2H00A 1ENPA 2PZBA 3ANYB 3JAKB 1PGQA 3QQ5A 5AP9A 3QIVA 3ZWNA 3QKWA 2RAUA 4AZWA 4L6CA 1IJEA 3ZZMA 3OE5A 5GOTA 2FHSA 1N9GB 2EW8A 3C3CA 5H7XA 1JYSA 1K8XB 1N8SA 1X3LA 2GPTA 4DSZA 1CFZA 3WDLA 1PG0A 2P62A 1WU7A 2XNHA 2Z8YA 4EKGA 2BFEA 1OREA 1R12A 5TPWB 1C8VB 3SBOA 4OGWA 3CO5A 3E03A 4OO3A 5E6SB 4F3TA 1Y8AA 1I3LA 3PDHA 3P9CA 4R2XA 4LY9A 4EQZA 5JWRA 4G5FA 5TS3A 1FNBA 2CNOA 1FP6A 2XWBF 2JFFA 3CVYA 2JAQA 3PQ7A 4I9NA 2IQIA 1PK7A 2JK1A 2WEKA 4GSKA 4DV3B 5KPDA 5GZ6A 4JQZA 2ADMA 3Q6NA 3S28A 1T0JB 4C3ZA 1X1RA 4KQMA 1G8HA 4AJNA 4G8BA 2FZCA 2NVUB 3KJXA 4DG5A 1QK5A 1W9HA 2K2WA 2OLJA 2W6PA 3ZZTA 2CHUA 1NX6A 2HJRA 2OV8A 4R1UA 1WWKA 1CRLA 2AC7A 3JTMA 4HPWA 3VR5H 1Q22A 4KVGA 4PPFA 5E1OA 1VFNA 2BZ0A 1E5DA 2QPLA 4MCIA 3IX7A 4MQEA 4N0MA 2D5BA 5BMVF 4RC9A 4RFLA 3VSBA 4ZANA 2CYBA 1EXNA 4R1PA 5EWJA 1ID8A 2CJWB 1YDMA 2HBZA 3SF8A 1NVTA 3H75A 1LW7A 3LVBA 1HDOA 1OX5A 4M0CA 1T3HA 2BFCB 1C0IA 2OD2A 1F0PA 5L6MB 1NWCA 3VV3A 1AOXA 3NHAA 3PITA 3PHLA 4QPZA 3U5ZB 1NUQA 3WK9A 1QXSA 2EP7A 1Q3TA 4I14A 4DV5B 1P5ZB 3TBKA 4COOA 2CD7A 2XEDA 3CRW1 5LB4A 4XKJA 3V4FA 3QTBA 3QFTA 1VMDA 2IYZA 3UB2A 3OOYA 4X84A 4NCIA 1Z2PX 1N25A 1LVHA 4QECA 1ODFA 5G0VA 3B89A 5DKFA 4E21A 1V26A 1HZZA 1JU3A 2I3GA 4E88A 1LJLA 1EUCB 1SKUA 5EZQA 3IULA 3T7KA 5I5EA 1RYZA 3A6ZA 3RADC 1FUIA 3QJ5A 2H1RA 4Y9UA 2W6ZA 1RWBA 1VP9A 5ERYA 4IM7A 1EBFA 5JMPA 3DEIA 3IDZA 2WOJA 3D6NB 3DAFA 5CITA 3IB6A 1E3IA 3CRQA 3MT8A 1QRSA 3NAGA 3F4BA 3MOGA 1UKCA 1G4AE 5LLTA 3WK8A 1HNWB 2OKCA 3SSOA 1XV5A 3DVSX 3PWTA 2A1UB 2XRMA 2JHPA 4WCFB 3TDNA 5G3ZA 5BMVB 4OMDA 3JPYA 2FN4A 3H2JA 3GL9A 5DXAA 3U4DA 4ES6A 4LOHA 3RABA 3VAAA 1SBNE 4KSYA 2GXSA 5FD8A 4LMBA 4RCYA 4BJ3A 1BVYF 4NG4A 2D5IA 4HVAA 1NNI1 1W36C 1K86A 1FP7A 2FR8C 2PUHA 2YQ5A 4OXYA 4PZPA 4YRQA 4ZICA 4TKVB 5FNZA 4AJ2A 1EZ1A 4CGZA 1FTGA 3GVHA 4DVJA 1ZEJA 2JCYA 1VRWA 4J4BA 2RKOA 5DM60 1NVWQ 2C4TA 2PYZA 2ZRQA 1KJIA 5CT8A 4BNHA 1I7PA 1ZH4A 3JQPA 1WUIS 4GM1A 4ZCRA 2XOKA 2J0EA 3T61A 1A4RA 5BRNA 1UJ5A 3GRPA 3QVOA 1C7QA 3OCWA 4A0QA 2A5JA 1XTKA 3H86A 3NBZC 2BH9A 1XCBA 2J9YB 3RTBA 3N59A 1XLTA 4MDHA 3RPEA 1ID1A 1I94B 1SCNE 5CHEA 3BMQB 2QUKA 3D31A 3A0RB 1IHYA 1LSOA 4QU5A 1SRQA 2A1TR 3NAMA 4S1NA 3NHPA 1AZTA 2ODPA 2HJ9A 2KI5A 2WRZA 3OZTA 4XM0A 1E9DA 1NUTA 4WXMA 3ZE9A 4FYIA 2EFHB 1QCYA 3P2JA 4LE0A 4UTZA 3HRIA 3VTKA 1QS0A 5JBQA 4EECA 5HF8A 1MRNA 3TTXA 1IWBB 2OHHA 1KA9H 2GBLC 5LBIA 3KKLA 4FX2A 4ZIRB 4XM1A 3AUJB 3CLSD 1E20A 2C0QA 3N28A 4JU8A 1GADO 1Z73A 3O4VA 4C9BA 1QP7A 2QG6A 3T9DA 4TVKA 4E5DA 1UT8A 4TLEA 2MSCB 1Z39A 1NVDA 2AMFA 3ESXA 3CEHA 2OHGA 4TXLA 1XP5A 3RFCA 4DJDC 1J00A 5AUOB 1LDNA 2EV9A 3AVTA 1WEKA 4C2AA 4DDHA 3ZCUA 3TNDA 2W2XA 2V65A 1IFXA 2VP0A 3O9VA 1F6BA 5AOVA 2NU8B 4JQOA 3TM4A 3VA7A 4N48A 1TD1A 2X4LA 2ZRFA 1DRVA 2YW2A 3QPDA 3LQ4A 1T8PA 4NLLA 4CGYA 4IHQA 4MVXA 3LT4A 4RTSA 2NO4A 4P82A 2W6CX 5EG5A 1NYRA 1DE0A 3DZHA 3UMVA 4GLLA 1FVFA 3A3PA 4I8IA 5IRCD 2OECA 3WXMA 2FJ0A 2Q4EA 1O4WA 5CFLA 2C99A 4XM2A 2ZJYA 2GD2A 4I5FA 4YCAA 3AH8A 3G9TA 3PXAA 3U3OA 1DBRA 3A4LA 3WGVA 2CXNA 4DLAA 2NXNA 1SU4A 1IN5A 1SXJB 4PYOA 4MO2A 1BWQA 2JJ1D 3T4XA 4KYIB 2VP4A 4KE7A 3GUYA 2OHXA 2Q5IA 4E7PA 3SBEA 4D8YA 3ITEA 3VGPA 3DR5A 1IK6A 1YCHA 1ITZA 2AG8A 4G1UC 1O5IA 4MAAA 3Q85A 5GONA 3S1LA 1ZA1A 3ZGXA 4XYLA 2XXAB 4ND3A 1K6XA 4UBJA 1PFKA 2OBLA 1VE9A 2C20A 5LWQA 1XX6A 2JVJA 1IWPB 4R5HA 1GCOA 2OE2A 4G1EB 4KYUA 3DMDA 3L8GA 2OBBA 4QBIA 4AAYA 3VZBA 3FH0A 5TQ0A 2DFNA 5DMXA 2EIHA 3F1KA 4EJSC 3NWBA 3PFHA 3RVMA 1ADFA 4MS3B 4RIFA 1KTVA 1OJLA 3UJNA 3KUCA 2GLTA 1KO5A 1ANKA 1HSZA 1C80A 1N0WA 3ELUA 4A73A 2VHUA 1U0FA 5FIUA 5A3SA 4JT2A 5KOJB 3HJAA 1TK9A 3F7TA 4UTNA 1AN0A 2PU7A 3D3KA 4FI3F 3S7TA 1WKVA 2KPOA 3NQ41 3ANMA 4OOFA 4UFOA 3T0GA 3DE2X 2EOAA 4ZV7A 2F00A 2D4HA 1J4AA 4LISA 3CC8A 3ACBA 1P9WA 3PS9A 3UENA 3DVQX 4BBPA 2OFFA 3GWGA 2YYAA 4Q47A 1U6IA 1E1DA 3LYLA 1L8XA 1EEXB 4BZWA 3LYUA 5KWSA 3HHPA 3LPCA 3JALB 1JV2B 4OHYA 2DH6A 2BKEA 1IXKA 1P9NA 1RZ3A 2C97A 3KD3A 4IUCS 5A0FA 2W2LD 4JZKA 5TQVA 2WYHA 3NT4A 3CEPB 3ZE1B 2P2GA 4PC6A 4YUYA 4YCLA 1R66A 2Y1XA 4KPUB 4UJ3A 1PJZA 2JJMA 3GQBA 5F33A 4DRXA 1X19A 5FLXA 4LV5B 1MVNA 1YTLA 4NOLA 2JG3A 1XXHA 2YW9A 1G6OA 3IHKA 3AVXA 1TAUA 1JU9A 5BN3B 1BG6A 3IKJA 1OB5A 3GA0A 4UZSA 4DIFA 2BGTA 1JJFA 2C2MA 2YBDA 4LYFA 5H3LA 1FUKA 5GJVC 4E14A 3AKDA 1UMDB 3HFRA 4N01A 1RJ9A 3NIGB 4HT3B 4CM4A 4NH0A 2PUVA 3FPKA 1RPNA 3MCZA 4W6QA 3CX6A 3NCHA 3R44A 3RKUA 4DIKA 4JR0A 4M1WA 1G59A 1QORA 1HLPA 3UMSA 1J8FA 2FEMA 2VBGA 2FPIB 3CZCA 1P9RA 3AQ4A 3IDAA 1OJ7A 3PRYA 1HETA 3TE7A 3U61B 4EHHA 2WV9A 3H84A 3G59A 3KLOA 1ZCAA 4UTPA 3CVVA 3QVLA 1YH3A 3T3PB 4AB1A 2POQX 1PWZA 1UIMA 2B3TA 4YFYA 3GAAA 5I9NA 3UKOA 1Z25A 5F51A 1L7MA 1E8DA 2ERYA 5B64A 2HF9A 3P9NA 4M89A 3IBTA 1TZ2A 1SUIA 2YWHA 3WY9A 3EG5A 2RHCA 5HKOA 2BKXA 3LP8A 3K72B 4BFUA 2VNIA 1NVBA 2EP5A 1LLUA 4MLZA 4Y0VA 1DIGA 3LQ2A 1P2BA 1EBUA 2XA9A 3PQCA 5K3SA 3AHJA 4EQ6B 1VDMA 4EYSA 1JAYA 2BFBA 2FUCA 3NOOA 1EP1B 5DBIA 3S4YA 3CN9A 3I42A 4D8XA 4ZJZA 3SC2B 3QELA 4GECA 2IEIA 4CKXA 4CXMA 3IPCA 3JQFA 1IY2A 4Y0AA 1C3VA 3HO8A 3RM3A 2W37A 1QB8A 2NUBA 4HP8A 6NULA 2QD1A 3AFOA 5EUCA 4URWR 3WAKA 3MRVA 1KAHA 1Z0IA 2AG5A 2BUBA 2HOQA 3L9WA 3QQPA 3RVKA 3KEQA 4G4SP 5IJ9B 5SY4A 2QMZA 1FP2A 1FJGB 1Y3IA 2QT0A 4GVLA 1YBFA 2D7JA 2R68A 5BSMA 2C7PA 3K9BA 8OHMA 2J87A 2ATCA 4F8YA 2ZS8A 3NRCA 3TMKA 1O97C 1TFUA 1F2DA 4BP3A 4Q9IA 3BRWD 4IF6A 3SKVA 4AN4A 5ALWA 2DR2A 3N0RA 3ZY2A 2BWJA 2VAPA 1H4QA 1EM8A 1XB2A 4OEHA 1E99A 4M8KA 4BEWA 2H5LA 3KUXA 1ZJZA 4MV6A 4MIYA 4KPFC 5J5AA 1VB5A 3H4MA 4WRRA 1W76A 2GI4A 4JWKA 5GJBA 2B1GA 5ENDA 4E3WA 2C1XA 3HVRA 3X0DA 3EA5A 2AL7A 3M3HA 3U49A 2ZIXB 4PFQA 1DX4A 3VTFA 3AERB 5ECDA 1K8RA 3HUUA 5U4QA 2Z57A 4C22A 4JGGA 4BVBA 2DKFA 2OESA 3BRCA 2Q62A 5DASA 2YX1A 5JVDA 2AXNA 1V6AA 1XLWA 4GEGA 3OZCA 3ZE0B 2R8XA 3ANTA 2XSZD 3AUYA 4FGSA 1GZ4A 3QF7A 2GERA 3PXBA 4MCJA 1SVUA 5M3BA 2DY0A 1KEKA 2FPRA 2OA0A 1E5XA 2CL6X 3BTVA 3RS0A 2XYVA 1D1QA 1VHLA 1Z0SA 2WYOA 4AZ3B 3IRUA 4GLBA 3AU9A 3WB2A 1X3SA 3C8HA 1KC1A 1YB7A 4J49A 4UE6A 4YN3A 1KK3A 4LVUA 4BP1A 3E9EA 2JRCA 4DE5A 4JA2A 4GX5A 2W9XA 3USCS 1Q11A 2HHCA 2QVGA 3CIOA 4N82A 1GPYA 3RT9A 4AJOA 4D9EA 3G5AA 3K0AA 1CQZA 2PV0A 4U5XA 1SVWA 4WGGA 4E5NA 5HDQA 4C89A 1GAWA 1S5PA 1ZA2A 4XGNA 2OQRA 1M8JA 3IPYA 1QYCA 2B35A 4PRYA 5JAPA 3RV3A 2Q1YA 3A1FA 3WGNA 1ZO8A 1TQ8A 4DZTA 2ZS9A 3I2YX 4RHXA 4B3IA 5EKXA 2ZAYA 4TTIA 2B5WA 3LKVA 4GZLA 1RABA 3G8CA 1G9TA 1D07A 1XHEA 1N4DA 4F06A 2K4MA 4UM8B 5IF9A 4YREA 4IZIA 2PQ2A 5G1OA 1U7TA 1IN6A 1NXXA 4KO4S 1W1IA 4OY3A 3QF4B 2GJ4A 1P6XA 2PU5A 2BBWA 4R05A 2JFQA 1O6ZA 3G7NA 5ESXA 4Q3LA 2OCIA 4RFSA 2GD0A 2VYQA 3QTTA 3FJ1A 1LA2A 4Z2AA 3VJKA 5HK8A 3TCKA 3SWWA 3SXUB 4FWIB 5AW8A 2VQDA 3EWSA 1DLJA 4HWOA 3IERA 3UOWA 4A26A 3V1NA 4II3A 3AG5A 4Q1EA 2IH4A 2RJOA 4NMMA 4F2PA 4F71A 5DK4A 3PDUA 2IYPA 1FNNA 4GYKA 4OTZA 1LWOA 1A71A 2VJOA 1GPLA 1FB5A 2EFCB 2GKOA 3ICPA 4RVHA 1THZA 3W0LB 4NE2A 1EFDN 3DFFA 2O2YA 4NFSA 2IYFA 4Q3BA 1KERA 3G79A 4UCXA 4RORA 1FSGA 5JRZA 1FMTA 2XD4A 3RKRA 3RUFA 1KFEB 4P93A 1GGVA 2Q2QA 1ILEA 4LYGA 4FFDA 2F3RA 4KTVE 2AN9A 4YCDA 4XW2A 5FR1A 1NQOA 3NT5A 4BMPB 4X20B 3L43A 3EW9A 4RABA 5CIYA 4IRXA 2N0SA 3LNTA 1MC1A 3AJAA 3L7YA 4PONA 4U6NA 4MVJH 1QRAA 5HILA 5TNXA 3EAQA 1QM5A 3Q9NA 3P2KA 4AT1A 4BQSA 4D4KA 3MB5A 2O1XA 4OM8A 3LZCA 3FGOA 1YOVB 5FFFA 3V8BA 1N8KA 4G0ZA 4U02A 2RHDA 1TU0A 2R3SA 4YPFA 5GVRA 4MKGA 5BQ3A 3AR4A 4WPGA 2EEPA 5EC8A 3ER8A 4I6EA 1XDDA 1M2FA 2EF1A 1EEHA 2RGNC 4TX1A 3H8JA 5JO9A 4FGLA 4MI6A 2QU7A 3K1TA 1ES9A 4BJ5A 1P2FA 3HB7A 5DE3A 3HZHA 1TK2A 1NN3A 1I7LA 5CPBA 5EEHA 2AWNA 5ELMA 4BV8A 4Q9JA 4IDEA 2HK8A 2E37A 3GJ8A 3EIOA 1ULTA 5BRJA 2CKMA 2PBRA 5CTAA 5FJIA 4JI5B 3U3XA 4DRZA 1NC3A 1USUA 5EHGA 2P9JA 2QRQA 1Z2EA 1G8GA 4Z4HA 2O2IA 2ZR7A 4NENA 3ZCRA 1QOPB 3FHLA 4KJZA 5AUNB 1FPQA 2Q07A 1VGRA 4X85A 3AIIA 4GGMX 3TCNA 4CL0A 3W78A 1JQLB 1SXJE 5LLSA 4KMSA 4Y6PA 3UAYA 4F2DA 4JIMA 1NBHA 1ADGA 4WJLA 2QLBA 2FMIA 2ORYA 3O1JC 4D0RA 2FR8A 1CY6A 4GP6A 4P0QB 5JXHA 1EWRA 4E51A 4J0GA 5HW0A 4B85A 1IY8A 4CF3A 3N8IA 5FI0B 3HC7A 4FYMA 1TADA 4XGKA 5J2UF 1V9LA 3NOXA 4YXFA 3KSAC 4OYHA 5DCUA 2UVQA 2ANCA 5I7SA 1MEEA 4B5LA 5THKA 2CVFA 1XKQA 1CE8B 4OJTA 4EENA 2DUMA 4JLUA 2B34A 4GX2A 2Y1DA 1Z7WA 1QE3A 3MWDA 5ENZA 5F7XA 4LXGA 5T5QA 1OI7A 2NWQA 1L5WA 1T35A 2QT1A 5IANA 1M0EA 1V5EA 2PEZA 4ARZA 2F48A 5AKGA 3SXJA 3N1UA 3B7PA 4QUJA 3HB5X 3LIPA 4QWWA 6REQA 2HR1A 2PKQO 3DQQA 2X1LA 1QYXA 1Y3AA 1OHHA 4B6EA 3BZBA 1GRQA 4B7AA 1GCAA 3LCVB 4IAOA 4Q39A 1XL0A 1DBIA 5LZ8A 2WY2D 5TIIA 3FCAA 2GBLA 2I03A 1Z6XA 1IL0A 1D2AA 5BSUA 1KQOA 3B9QA 3PXCX 3QGMA 1BYUA 4KW7A 3SGLA 3R0QA 2WWIA 3R41A 4NRDA 4ZOEA 5ED0A 4K8RB 1JR6A 2OV1A 1AKQA 1RAFA 2OXTA 2BJVA 3A27A 2Q1SA 3K73O 3FFWA 1XYGA 1C0PA 4A1OA 5J23A 5J2UB 1C3XA 3ZG6A 3L06A 4QUDA 4C21A 2X2OA 1DAKA 1DXQA 5I9SA 5DNAA 4ND8B 4N5HX 5IKMA 2YVQA 1L8QA 3K05A 5BQOA 1NN0A 2J3DA 1NRWA 2AX3A 2VCEA 3CUYA 3GLQA 3GJ7A 4JJAA 4J0HA 1KEEB 1QTIA 5LIRA 1JTVA 4PAMA 1ODJA 2EAUA 2MSWA 2QTFA 2ZYUX 3EQ8A 4W9NC 4QKQA 3NTLA 4UDXX 2H9YA 2AMLA 4CI9A 1ZC3A 1J5XA 821PA 2MINB 4YRKA 3IAAA 5EIWA 4IXMA 4ROTA 3NS7A 1IBSA 2B1RA 3LXUX 1ECPA 1V95A 2J41A 3R74A 4G0WA 2Z43A 4LHSA 4XQ9A 2ZWPA 2ZKLA 3DLPX 1E4YA 2FZKA 3ZDEA 1F4PA 3Q4GA 3ZJUA 4AY2A 1UBNA 1QKKA 1GPJA 1LDYA 1X9IA 2WNIA 3MCVA 3V1YA 1OF1A 3A6LA 5EWLB 3UAZA 1OIWA 5B7NA 5JRJA 4EG5A 4CEHB 2FY8A 5A7HA 2FMTA 4B3JA 3QEKA 4K5QA 3II6X 5ALGA 1X0VA 2EJVA 5BURA 5IZCA 2AD5A 3ECCA 1I7SB 1RIIA 4Q3OA 5TC4A 2I3ZA 2OGSA 4NZPA 2VUTA 1IM2A 1KMMA 1D4ZA 4WUTA 4EJSA 2HGSA 4DIMA 3ZHVA 5IKOA 5AVSA 1BX1A 1XU4A 1SVKA 1G2PA 1U9ZA 1ZICA 3JWGA 4GPTA 4JFAA 3OQPA 3DYBA 3LPNA 4YWHA 1O54A 3FWNA 3T34A 2ZROA 4Y98A 3Q6IA 2QWXA 3LY7A 3KG2A 5LQRA 3AR2A 1O77A 2J7KA 5JYCA 3V7WA 1U5CA 1C41A 3NKFA 5EUMA 5FA8A 2EG5A 1NSYA 2IE8A 1XEAA 3I1FA 5CDGA 1DMSA 1N2CB 1XZIA 1YHYA 2M1ZA 3UV7A 4DNOA 4P0TA 5LSAA 4EMSA 5JC8A 3RNOA 1F2TA 2VT7A 1D6JA 2GVZC 4PPYA 4KBFA 1C50A 2XD9A 4DJAA 2VS1A 1B93A 1DCTA 4QOGA 4YP9A 2O2JA 4KFUA 3KOUA 1HDEA 4QTUB 3U09A 2X7JA 1Y89A 1PKEA 3ETHA 3QVKA 4AYWA 2FK8A 1QK4A 3RFVA 1TE2A 1PD1A 3PI6A 4U3JA 3FUUA 4RJJA 1ZNYA 2C07A 3CZ4A 5FULA 4TKUA 1S8FA 4PGFA 4BIIA 1EGAA 1MO2A 1WXDA 1XA3A 3HCNA 1X7WA 2CSUA 4J1NA 2Q8PA 3LT0A 4AJ1A 1SR8A 1R1DA 3H1TA 3SJ7A 2OYCA 3VR2A 5KYYA 3EQZA 1SC9A 1W2HA 4MPDA 4AZ0B 3ENZA 3BMCA 1MHPA 1Z4PX 2W0MA 3QNMA 5AI5A 1KZ1A 1XPJA 5J59A 3W1WA 3GLRA 2I54A 3JQRA 2XYQA 1KVUA 3M6UA 4U7HA 2Y4NA 3U7QA 4POAA 1Y37A 3SMQA 2GEUA 4B8WA 4JLJA 4FNAA 9LDTA 2WR8A 3LOUA 4GM0A 4U7TB 3EMDA 4R3WA 1MB4A 1P33A 4YMGA 4EKEA 3C6QA 3U37A 3RJZA 2YOHA 3NT2A 4ZAXA 4RE5A 5JNSA 3T1NA 3TQSA 5KTMA 1P2SA 1XWIA 5E9AA 3INNA 2R8EA 5B37A 3ZK9A 1J33A 1UEJA 3CJTA 3QMMA 1XQXA 4KDRA 3UYKA 3PYMA 1H05A 1L5NA 3WSWA 1G1MA 1M8FA 1U2SA 2X1VA 3HXMA 1A7KA 2QMOA 3ZYCA 2YIVX 2PS3A 2EL7A 1Y81A 2Q9UA 3CQ9A 3GNSA 2UV8A 4PPGA 1U0SY 1KTIA 3D4OA 4AS1A 1DFHA 3V2UA 5A5VA 4KFCA 4K9SA 5ICGA 1ZJYA 3UPUA 4MI1A 2IA5A 2MYUA 2FW6A 4XCQA 1RS0A 2YWGA 4B35A 5A03A 3ER6A 4W6ZA 5JBIA 4L74A 4YAWA 1PGNA 1U8YA 1WABA 4G2NA 3SNKA 5HKKD 1RPAA 1PJ4A 3HBFA 5TQJA 3IRVA 2XQJA 3BWXA 2RARA 5EJAA 4BLSA 3TPFA 2LP4Y 4B6QA 4MUJA 1TAQA 3UK1A 1X1EA 4WW0A 4E4TA 4LRWA 1NDUA 3EVEA 3AEXA 5KTTA 4V0NA 4DHEA 5B5SA 3K6JA 1PJ2A 2CXXA 3TTYA 4BIMA 3HVUA 4MRAA 5DW0A 1NUUA 3KT6A 3GELA 1TYEB 3PR2B 4EVRA 2OM6A 3EZYA 1P80A 3OM9A 1KI1A 3FMPB 1SBCA 1XQ6A 2BFNA 5KYXA 1I4EB 4XDYA 1GNTA 3PK0A 4MV5A 1GM5A 3BYZA 1IOWA 4CLRB 5DHUA 2JAPA 3C3DA 4CMJA 1X80B 3FR7A 4LZJA 5FWDA 3FNHA 2PMEA 3W2HA 1UAGA 2WJ4A 5A5FA 2HMVA 4YLYA 1ZIOA 4YJGB 5FBRB 4TN5A 3ZWPA 5AW1A 2WK1A 2L82A 3WBBA 5JNUA 1NQ5A 3FZNA 3AP2A 5HS4A 3D3WA 1H4SA 3IE0A 3KOXA 4MQBA 1F6DA 2Z3ZA 3BHMA 4R1SA 3UHOA 5I4IA 4EVIA 3ADOA 4URVR 4MPPA 4LF8B 2PGDA 1ZCZA 1SIBE 2ILTA 1TC2A 3D8NA 1A69A 2ZJ7A 3FBTA 3LWNA 5CT4A 3H7IA 3NC0C 5A06A 4Q03A 2XGJA 3H2KA 1S1MA 3N5KA 4ZVNA 1Z22A 1XMQB 2HF2A 2DWCA 2D2IA 4HLDA 4YAFA 3WLTA 1WCIA 1PQPA 2VHQA 2G67A 4UUPA 1YB5A 1W52X 4LYHA 4XRRA 1BHO1 1EK2A 1NJSA 3BD6A 3OQOA 1SXHA 2YCLA 2H1FA 4HQOA 2Y1GA 4RTRA 2WJHA 2IOFA 3LLUA 2RGDA 2BFOA 3RWBA 1HSOA 2HHLA 5CIWA 1K89A 2YN0A 2F3UA 2I1WA 4UBNA 1KYTA 1YIOA 2NIPA 3OE7A 1JIQA 5EIEA 1UBTS 2BW0A 4ZI5A 2C3OA 4IO1A 5KI6A 3OZWA 4FEEA 3TMAA 1E8MA 2J67A 5F98A 4ESOA 3LKDA 1G41A 3QX8A 2QV0A 3I9JA 1TYCA 1AUVA 1IY1A 1MTOA 2YRFA 5F9HA 2F8LA 2PZEA 2WU3A 2XF8A 3QVGA 3TX6A 2B6HA 3KUKA 1UBMS 3JAMA 9ATCA 1RRCA 4EHIA 1WP4A 1V4VA 4IJUA 5HEKA 4B81A 1I5OA 1WZUA 2JIRA 4N7RA 3LS2A 2NO6A 2FMXA 4MR7B 4XSGA 5GPBA 1W8DA 1K6EA 2BM0A 4RSMA 2XX3A 1L5SA 4XWWA 1AY0A 2GM3A 3EVNA 1XMOB 3A2KA 1MRZA 4RD1A 1A97A 4D74A 5BV2P 4Z86A 2AYYA 4A8JC 5JAMA 1JPVA 3QZUA 2IFTA 4R4JA 1V3VA 4NAHA 4IKPA 4A6XA 5LYYA 4RZSA 2DBQA 1U3FA 4JU9A 3VOBA 1PR1A 1J8VA 3OPYB 1W29A 3OIYA 1YRLA 4B8YA 4BFVA 4BWGA 2BZGA 1SXIA 2J3EA 4OI2A 5HQ3A 4NZ9A 1OXBB 3HBLA 3OOHA 3TD2A 3K3PA 4G0MA 1JSLA 5DCYA 1I1HA 3PEUA 2NXCA 2EP8A 2V7QD 1M6YA 3DE1X 3PE3A 4URUR 1YMQA 2HQBA 3UF0A 3FCEA 5AI8A 3W5HA 2CJPA 4YJFB 1Y1LA 4L16A 3ID6C 2YOGA 3NH9A 1EFPB 3EWIA 2KHZA 3H5LA 3PTAA 4G5GA 1ONSA 1JHYA 2XUIA 3DZBA 4K9QA 5EERA 2BFMA 4WL0A 4MP8A 2EKZA 4O2LA 3BAFA 2V54A 3EULA 2J1LA 4RETA 2VHTA 5EE9A 3VR4A 1E9AA 2XUAA 1UZNA 3G8YA 3HRHA 1M0SA 5HQJA 1FX1A 1P44A 1ZOIA 5EJ2A 1NQWA 3BK1A 3GA5A 4NPHA 4WVLA 3V80A 4BDSA 4PNEA 5HQTA 2DB3A 1NF8A 1LDBA 2GYUA 3IUYA 1GPMA 4QULA 4R0VA 1Z7YA 2A3RA 2XWQA 3FHOA 3WZMA 4WXYB 5BWOA 1GOTA 1C3EA 3FDFA 4LMPA 1T4CA 4NIMA 3T9BA 4KNVA 2V8BA 1KWKA 4YY3B 2C4KA 1CERA 1GTL1 1PV2A 1PR0A 2LE0A 5IG2A 1JI0A 1GKKA 2FUG6 4M87A 1G9XA 2AVNA 1G5PA 3PNMA 1V4BA 5EUQB 3RIGA 2IPAB 4B0PA 3I1JA 2IEAA 4QXOA 5BT8A 5EHXA 2G71A 4LEIA 2YWRA 4WLNA 4GZ6A 2MWMA 4AX4A 4CTOA 4MP6A 1WUHS 3N76A 3ZBTA 1XUOA 5LD2C 2R5NA 1Q0QA 4BN5A 3AR3A 3R3YA 3ZWBA 4IZ6A 5KKNB 3HA3A 3VJMA 3S2FA 4BE7B 4FKBA 3R20A 5P8WA 2IS1A 2BONA 2ZGVA 5EESA 4JOQA 1HNNA 3BDVA 1MKYA 2AOUA 2W5UA 1OMOA 4MRNA 3L6DA 3W7AA 3PDJA 2QRNA 2I7VA 3ZS9A 3LX6A 3B13B 5C4GB 2ISCA 4PYJA 3N2NA 3LOPA 3W79A 3GEGA 2UXBB 4ABTA 4X8LA 1BD4A 2H85A 2Z8YM 2GZRA 1R0LA 1FNDA 4FI3C 1IRXA 1RLUA 3L8ZA 3JQ9C 3N2GB 3PC7A 3ZW9A 1TM1E 5HNKA 4G4IA 4KI7A 5AM0A 4C6TB 3W4IA 1VI6A 3DT8A 1CV2A 2VH1A 4LCBA 3ND6A 2J9GA 6PFKA 1FDUA 2VH2A 3GJXC 4M9SA 4ZZ1A 1OPXA 2X40A 3T5CA 2CBXA 2EU8A 4JODA 3ASYA 4WBXC 3VH3A 1USGA 2Y93A 3DFKA 5CW1A 2GJ9A 5C4IA 1Z56C 3Q15C 4OF4A 4EI2A 1HYHA 1YDGA 5D01A 3K16A 2YFQA 4YJHA 3SIPA 1R6DA 2VJBA 1C1DB 3OOSA 2CDAA 5T6BA 3BB3A 3BZWA 3ZGYA 4BAUA 4R7GA 4L3OA 3VDNB 1SC6A 1TJYA 2O2DA 3Q0EA 5D8DA 8ADHA 3M6IA 1T13A 1LBTA 4X92A 1UFKA 5CDTA 1K7FB 5BMOA 1B43A 2DLNA 4MDYA 3W3AD 4LG1A 1MENA 4D82A 3RW9A 3VKUA 2PYDA 3UGJA 4WAUA 4FFWA 4FOPA 4CT5A 5JXGA 1EVZA 5DI9A 2FMKA 1KEWA 1KDZA 4DCPA 3GVXA 3KO8A 1QQ7A 2WM9B 4FMDF 2WNHA 1SCUA 2W2KB 4L4UA 2O0LA 2JI6A 5EN4A 2XMQA 2YY5A 3DEJA 4KIUA 1NKSA 3FFXA 7ADHA 1N2CE 2DF8A 5D6OA 5KU1A 3KSMA 4YCNA 4KAFA 2GX6A 4AKTA 4Q34A 5AW7A 1GFZA 4BEVA 3GZNB 5F4BA 3U44B 3QVUA 3SHVA 5C1IA 2HIHA 3VPHA 4EHFA 3EWNA 2PKWA 2XNJA 1RXYA 1I7QB 2GS9A 2ZE5A 1WHTB 3UKDA 1JQJC 4IDCA 1N6LA 1R7RA 4M8NE 3HB0A 5DHTA 5G53C 5F7OA 1JAHA 2JI7A 5HCUA 2AXEA 1JW9B 3QIAA 1POXA 1Q7RA 1QHXA 2HZ7A 2J6IA 4R31A 5AM4A 4YECA 4I1RA 4ZQEA 4DCCA 4P54A 1W35A 4JXXA 3PFFA 1Z4NA 4PG8A 4ZI3A 1XVVA 4P4LA 3PRJA 1X8KA 4NVRA 5CYPA 1YO6A 1ZIPA 1J9ZA 2J30A 2OXIA 2XT6A 1TJ3A 2BZ1A 1Y8RB 3OLWA 2IPOA 3P4XA 3HUEA 4QFBA 1UWLA 2DWPA 1V16A 2IEGA 3HACA 4J2HA 3IODA 4XDHA 5BSHA 3BERA 3SX0A 4MLPA 4K9OA 4EFNA 1CF4A 1NW3A 5HMMA 3V7YA 2J08A 4H6WA 2X0DA 2WQ6A 4FFBA 3P20A 4HFMA 4Y6OA 3Q8KA 1EDEA 2C78A 3MGCA 2GK7A 4W9NA 3NDRA 5LYJA 5BYJA 4FMDB 1JB1A 1XA4A 2OCKA 2Z58A 4C05A 5KNBD 5U9CA 1G3QA 4C08A 5CA1F 4J29A 4RF2A 3L0SA 2R2AA 4X1KB 3NORA 3OUTA 5IC4A 4B3CA 1KBOA 1VMKA 1YD7A 1F5SA 3O31A 4RWZA 2DRIA 4FQ8A 1ZRHA 4D6XA 3C5VA 1FVHA 3ZY6A 1PGPA 4JASB 1J8DA 4M22A 1H1TA 2GDZA 2RI0A 5C8YA 1HE5A 5CD9A 4L6AA 3U48A 4CFZA 5L7WA 4DR2B 2IH5A 1LBEA 3M6AA 3AEKB 1P5JA 1RXCA 3G0HA 1LBQA 3VQTA 1RVDA 3CN7A 2QJWA 1U11A 3F1LA 4N5MA 3WLKX 4MIEA 1ZC4A 1U4OA 1SU8A 3TL2A 1I2AA 2C5HA 3GZJA 4I9HA 1NXWA 3W6NA 3I62A 4WXHA 5ETJA 2BP7A 2ST1A 1JYFA 2AXPA 2CL7X 2ZRDA 4MS4A 5EIFA 5JS2A 1M34E 2JEZA 3JAKA 3NKLA 1RI4A 3NXSA 4EA8A 3AM3A 3BMNB 5ERXA 2BFDB 2JH9A 3ZU6A 1GGNA 3I72A 1YACA 3H6HA 5FOXA 1DKQA 4LPSA 2BEJA 2F1RA 3ICWA 4NZYA 4PAOA 2VF7A 2YR0A 4INJA 3WRWA 1NG9A 3DLHA 3KPWA 3AT1A 4L57A 3JARB 4HBGA 3L1UA 5JCOA 3ZYZA 1ZS9A 2PX8A 3ZC3A 3ZJ5A 2Q9BA 3QI2A 5CA1B 1KFJB 1SKYB 3C7KA 3UJCA 1WPGA 3JCZA 3UTCA 1CZUA 1V2HE 4NMHA 5SICE 4CEHA 4E11A 4NBUA 3SLKA 3DOIA 3VU9A 2RK3A 1OFUX 4I1OA 4MV1A 5TE9A 4BWYA 1AH2A 2NVUA 1GAQA 1T3ZA 4CM7A 3EGXB 2YV3A 1KZ9A 2J7PA 2BGLA 1OKKA 4AD8A 1PR6A 1QZZA 1O95D 2QZJA 3SHQA 3TRJA 1XF9A 4NWIA 2PAFA 3LVRE 4PZUA 2G0NA 1X9GA 2K2QB 2YNMD 5FBZA 1AUXA 1XQYA 1S8AA 3BDIA 1UOOA 1WDMA 4C0XA 2PO5A 4BE9A 5LVAA 2DAPA 4NKRA 4F2GA 2BFCA 5F4ZA 4JKYA 2ENUA 4HO1X 4DMLA 1P9LA 3I34X 4US2R 4HGZA 4R3UC 1FNMA 1GYRA 3T1OA 4YRAA 3ER9A 3DMGA 1MNAA 3IOCA 2ODQA 2O07A 3SZ3A 2PA0A 1DEKA 1QHEA 4ZTBA 2VJDA 2YQZA 4M98A 1V8OA 2HH9A 1ZD9A 1QDUA 4OHKA 2BL4A 3GIDA 3VZDA 2J3IA 4QOFA 2OHVA 3ESBA 4MEBA 5AVVA 4CZ2A 4I55F 5KB3A 1EESA 1PJAA 3I4CA 1QX3A 1SAYA 3EBLA 3WTBA 2HPZA 2F1OA 1KQFA 2J45A 5C37A 2BJHA 4BMYA 5FPYA 1EUCA 1T9HA 4FYVA 5BUZA 2WAXA 4LQLA 2QTRA 3REQA 3CLUD 3NDIA 3L4JA 1TFRA 1X1BA 5AJWA 3FBWA 2IE0A 4I81A 2BGGA 1RWVA 3I9KA 3KD2A 5GWXA 1L4HA 1X77A 5JSUA 1RAEA 5BSWA 1SQ6A 3NP7A 3BBPA 4B4UA 5FQOA 5SZHB 4KRFA 1FUYB 1NGSA 1UZUA 2CLMB 4EFDA 1RBMA 3WKDA 3WR5A 5JSHA 3WIOA 1L5HA 5KOHB 2NG1A 2H4JA 2COKA 3FDIA 3WGJA 3BB1A 1JBQA 4WCFA 1B26A 2V4MA 2FSIA 4US0R 4OHZA 1E6WA 1G5TA 4AG6A 4AY6A 1AK2A 2DSTA 5K0NA 2AHOA 2Q3HA 1GSIA 2YC4C 3IT3A 1TVMA 1YR3A 1ZK0A 2HEGA 3IMEA 4CVNA 4LZLA 2I22A 2I5PO 3PR3A 4N18A 4RTNA 3WGIA 3AM1A 4BMNA 1OR8A 1VI2A 3HYSA 5KKCA 2GEFA 1N2EA 4WBNF 4KXLA 3F9RA 3TLKA 4BXOB 2OV4A 2PTHA 2V6BA 1KSFX 3CV3A 3D7NA 3K0FB 4YK7A 5SZJA 3U4HA 1JR2A 4RE6A 3LD9A 1EXVA 4RLFA 2QR3A 5G02A 3RLIA 5AHKA 4I55B 4A92A 3V1TC 2VJYA 3GP5A 4IX1A 4LZWA 2BFFB 4EHKA 4RVOA 1LD3A 1Q0RA 2NV2B 2O1WA 4NH4A 4RVUA 1N7GA 2PE5A 1QQTA 3LWDA 4IQFA 4K3UA 4Z2YA 1NBMA 1E6UA 1PI3A 3O4IA 5DPMA 4RMGA 4BECA 1OBHA 1JWLA 3LP6A 4ML3A 4R8MA 4CJXA 3JQGB 4RHUA 4MWDA 2GN4A 3AKCA 3U0BA 2ZSHA 4E07A 3U7JA 3EASA 3KJEA 1EWQA 3GFQA 2D7CA 2WIJA 1DC8A 1SHKA 2GZMA 1I9GA 1PR2A 3T5DA 3MHPA 3F6EX 2O8DA 4CWAA 3N70A 2OG2A 3Q3JB 1ZJWA 1YB4A 3ZI4A 4QQNA 3X1JA 4J4HA 3I6MA 2JK0A 2X8WA 4RIGA 1K3UB 2XE4A 3AOEA 3OT1B 4MH0R 1NRJB 3TLYA 3WRXC 2XIQA 3WB1A 1QCCA 1YE8A 4GPEA 1DHRA 2GR9A 4W82A 1VLLA 2AZTA 2P79A 2LZ0A 3LE8A 3QWIA 4B7UA 4YAIA 3H2YA 1SEVA 3OJXA 1JHDA 1E2BA 4X8MA 4IVQA 3C5EA 1SVMA 5D1HA 2QVCA 1EJ6A 2IZ0A 1QHHA 3WG9A 5JADA 4MLDA 3M8KA 2JGEA 2ZKIA 3IIKA 3B6KA 2W2MA 4JBHA 4PAGA 2A78A 4WBNB 3F3YA 2Q6VA 1JGTA 2RDMA 2QBYB 1FEZA 4WKGA 3C3PA 1ZGJA 3IQHX 5HM6A 2NU8A 2AFRA 4N0EA 3ITDA 3HZOA 3NDPA 2QR5A 3KOWA 3SIWA 1PL6A 4ZVKA 3W7VA 2QE7A 4WOCA 4YMSA 3QPVA 4YP7A 3H7AA 3MTBA 3PGA1 4H7KA 3T7EA 1ZD5A 3EUEA 3UTDA 1NR5A 1RCFA 3EB9A 4OAQA 4FK8A 5AK6A 3NVDA 4CODB 1E7RA 1ZLYA 4Q6BA 1DC4A 2VNJA 1ESCA 5AUQA 3RFFA 2PVSA 3DAGA 3WYCA 1WMDA 3AONB 3IIEA 2ZAMA 3B1WA 5FV4A 4OQNA 5CW2A 3NJRA 2QVYX 3NYIA 2V6IA 3W2FA 2NO9A 3HUTA 3OD5A 1Q6ZA 5EKUA 3A1TA 1SXJA 3FTFA 3RUPA 3ECAA 3GJTA 3KAPA 3UMCA 4AICA 4E46A 5L8VA 3EMKA 1Q0SA 4QHSA 2VYFA 3KM0A 4A8JA 1NBAA 1BHSA 5L3RA 2OORC 3B3AA 4OFXA 3ZE6A 3ZI7A 2DERA 2AYXA 2XXAA 3KQOA 5A0TA 3KJIA 1PL7A 4FNOA 2E48A 5EZSA 1EDBA 2P9HA 1N2IA 1YZUA 3HN6A 2XGSA 3U4QB 1A1SA 2QN6A 3F8TA 3OAAD 3WJAA 5H02A 3ZI0A 2Q46A 1M7GA 1UP7A 3OOJA 1LTHR 2X15A 2C2GA 4FW9A 4HX2A 1OXMA 3TD9A 4AIIA 4DA0A 4R71A 1CYDA 1KK2A 5JMTA 5I01A 3V33A 3WA7A 2PLRA 5BNWA 2ZFUA 4G97A 5FRDA 3EEIA 3SF0A 2UYCA 1ELOA 2R62A 4MS3A 1JLKA 2QDKA 4MDEA 3H6KA 2XW6A 4XUGB 1QHIA 2RBGA 4YGXB 1R0ZA 4RELA 3U3KA 2ZI3A 1UQRA 1JHVA 1NN5A 3O7WA 4A8PA 1VIYA 2HCRA 3K09C 3KQYA 1GTZA 1T3TA 1YIDA 2YXEA 3PV0A 5H68A 4BBJA 6YASA 2YYZA 2CLHB 2II6A 3R6DA 2P4EA 5KDLA 1H42A 3Q7PA 4EKNB 2ZUUA 3GDHA 4D7AA 5GZ3A 4R16A 1Q7EA 4V3CA 4OUKX 4EHAA 3RS3A 2PHZA 2B9EA 4WY8A 4EFLA 3OJCA 4LS3A 1GFIA 2Q2OA 3RSGA 4E3ZA 1PT7A 1YS9A 5DJ5A 5JBNA 3QVWA 1XMPA 2EWMA 2IVFA 1QIIA 4PNZA 2H92A 1NUAA 3R0IA 5GGYA 4ARBA 3ZV3A 3DDZX 3OZEA 1AQLA 1LRLA 1L8LA 2OVFA 3HKEA 3UB4A 3ZXUB 1J5EB 3TZQA 1GN9A 5E1DA 1QTQA 4KLZA 2DLCX 3SZLA 2O7VA 2OFOA 4PLZA 1CQIB 1EBBA 1SCKA 3LYAA 2ZYHA 3UG7A 1PGOA 2QZZA 4J94A 2BFPA 1X92A 3QMPA 3B20A 1RQLA 5U4XA 3L8FA 4F92B 2GJKA 5HSGA 2I4NA 3O94A 1YZHA 3H2SA 3QFRA 5IBPA 4Q3EA 4CE6A 3MCUA 4WXEA 3TBHA 4GX0A 5BN3A 1K66A 3AUFA 2V7UA 3OX2A 4MVJP 1RQPA 4Y7DA 2HU8A 2YXNA 5BT9A 2C7RA 2YYSA 1DQPA 4MW4A 1BMFA 4F93B 2DLDA 4B5KA 1UMDA 1FYVA 1BEZA 1SHUX 3ENVA 3PNQA 1QGZA 5TX7A 1KJNA 2DZDA 5A3RA 2CFCA 1XZBA 3PPWA 2A9RA 2BCJQ 4FWBA 4WFIA 5T4EA 4RLSA 1Z7GA 4RPIA 1N6OA 4YI5A 1WDWB 2WJVA 4Q1DA 4QSHA 4FQ5A 3NETA 3H17A 2SCUA 3TTVA 1RLMA 3JQ9A 1DV1A 2FPIA 3HH8A 3N7TA 5DNEA 4EPXA 1NTOA 2YXBA 3BHIA 4TTPA 1NW5A 3B7WA 2JLQA 3KVYA 2WF7A 5T3YA 2CLOB 3D2AA 2OMKA 5DGDA 1XRNA 3TFQA 2YS7A 2LIVA 4XVCA 3E9ZA 1Z0UA 5KYUA 3HCFA 1JECA 1Z5OA 4RENA 4LVNA 4M0MA 3TDKA 2IEZA 1U0NA 3F6YA 3CISA 1IJKA 3TLMA 3GLIB 4IICA 3UC9A 3I2FA 1P2GA 4X6UA 3A11A 3GRUA 1WULS 3E9RA 4JJ7A 3NALA 1P0CA 4IJ6A 4MW0A 1JJBA 4BBZA 3ANNA 1YB6A 4DIEA 4V0ME 2IUUA 2JGDA 2NTEA 3PVCA 4BNUA 4EQ6A 3GJSA 3K70D 3D1LA 1A27A 1IK4A 3PUYA 3QPBA 3O8OB 1V5IA 4XWGA 4BUZA 5K8UA 4YMTA 3SC2A 4YH1A 5L9AA 1H2HA 1W48A 4QJIA 3DEYX 4HPJB 3L49A 5T57A 3U13A 2WIDA 4ZKDA 2XUQA 3T6KA 4OL0A 3VR5D 1YBMA 1N1EA 1N5IA 1Z5PA 3KL2A 3M34A 3FAZA 3KVVA 4KVFA 5EINA 2VRCA 2XMRA 1XPUA 4Y9RA 5IJ9A 5MDHA 4D25A 1ECCA 1E2UA 3WL3A 2FSHA 5DLYA 5DNYB 1RJWA 4FBGA 1ZDMA 1IMJA 1TLFA 4OH1A 4OYYA 5FO0A 1Q15A 2Y05A 4ZD6A 2DFDA 1RLTA 1RXEA 2DGDA 2JDIA 1GZ6A 2QAJA 1Q50A 2OZEA 3DC2A 4LJ8A 4LXUA 4E5MA 3QVSA 1SVIA 4RHTA 5DTRA 4C0JA 1C1YA 3VR1A 3RV4A 3K96A 2DBYA 1Q0TA 1RE1A 3TSYA 3A1VA 2XECA 3ZKWB 3H1GA 3PFCA 2ZE6A 3RRFA 4HDCA 1J09A 3NH6A 2G0AA 2AN1A 4H3SA 4O08A 1RNLA 4OXRA 4EYOA 2VDMB 3D5QA 5K0GA 1EVIA 3Q2KA 1ISMA 2F90A 3G68A 3JWHA 2OBYA 5AKKA 4HH4A 4P36A 1TI7A 3AUTA 1TAGA 3S99A 2JBAB 3A9TA 4L72A 4Z0NA 5CJPA 1XLUA 4ZRNA 1A77A 4CM1A 2OVBA 5HHTA 2XWPA 4L95C 4C4AA 1UPTA 3FPAA 3HA2A 4RM3A 3BXZA 1FX0A 1I4OA 2GCIA 4R8VA 1ISPA 4DDWA 3QEJA 3GFFA 4KR3A 1IEWA 1JAIA 1R0RE 1A88A 2X4GA 3LX8A 2QRJA 3WWZA 2WVGA 4D3ZA 3W5AA 4LVCA 2CXUA 1I0LA 2A30A 3ZUGA 2GOYA 2OZPA 4BE4A 5CK4A 4A2PA 5AKEA 1TU3A 2HQRA 3VOSA 4EF6A 4P4SA 1T5SA 5G0SA 2QYOA 1DPGA 2W2NA 2I80A 1AQIA 2WFZA 1NBOA 2EC5A 3RRZA 3UW1A 3ZVNA 4Q3DA 1YQGA 1FFAA 2ZB4A 2KLBA 1QFMA 3AEUB 3NEPX 2J4FA 3IKLA 4U7FA 2IODA 4QYMA 4DQXA 4H1VA 1P60A 1SIOA 2R87A 2VYNA 3IPXA 1WAMA 3L0ZA 3LOQA 3TDMA 1I7DA 3PKIA 1YSCA 5CCDA 1ST3A 1IUOA 4U9IS 2C2ZA 3EVTA 2M6LA 1A9TA 1RHJA 3HU2A 3OZGA 4ZJUA 2QN1A 3RBXA 4HZGA 1WXXA 2NU9A 3NR2A 2R6FA 1OZHA 1KYYA 1O8CA 1G9SA 1B42A 1K7SN 3NHLA 3ZE8A 2O5CA 1KDTA 3B1VA 3GT7A 3INRA 3O8NA 4J0DA 4ZQFA 3ZWQA 4C0AC 5K20A 5CNKA 4BB5A 3JV7A 2BLNA 3ND5A 2QI9C 3ZWCA 3MWFA 1UBEA 2C5SA 2QLTA 3ZNQA 2LXNA 2ZR9A 3CF4A 4E08A 2FQ1A 3DO5A 1DC6A 1GDTA 1E1QA 3OT5A 2JAXA 2OBNA 3MTDA 4CIXA 3SXUA 1ZMRA 1ZK1A 1DWQA 1NP3A 2A3NA 4LQ4A 1KDVA 3DZKA 2Q0SA 5KJ6A 3D6MA 3KXLA 4UUMA 3WLFA 4QJ4A 1EVEA 3G5UA 1SUFA 2Q99A 4WLVA 1FUUA 3MTQA 3TS1A 5K4HA 3GN2A 3ZCTA 5IU6A 1Y5MA 3W4JA 4AJ9A 1CUCA 3G5LA 4LJ9A 4YR9A 2VNSA 5C7LO 4AO6A 2V74B 4GICA 2O59A 1MG0A 5EHQA 2X1MA 2BE9A 1VJ1A 1Y5NA 4C2TA 1C9NA 1MPXA 5FO1A 2NUTB 4CR6A 2D59A 1DO8A 1N1DA 1U0OC 2IH2A 2OAEA 3EZFA 1QKIA 3CNNA 4RPHA 2JGLA 1PO7A 1GA1A 3LHIA 2P30A 2OILA 1HKHA 1PVOA 3QXSA 1M1UA 4X54A 3P0IA 1ZCBA 1TJ4A 1G8MA 1NX9A 4OB6A 4X20A 2XADA 4ZMBA 3ZR4B 4IJQA 5A9SB 1OUMA 1KBQA 4H60A 3O21A 3QU5A 4H6XA 4QGSA 1N75A 3LK7A 1OYYA 2A0UA 5AVYA 3C4JA 3ND9A 2ACWA 1E96A 2F67A 1RT9A 1UPUA 2QL7A 3C7CB 3MJRA 3Q11A 3O8QA 3KNZA 2ZI6A 3UMJA 5ALPA 3R6GA 1YOVA 4MRPA 3S8YA 3EIWA 3KYIB 4A6DA 2JIOA 4U2BA 3W1VA 3WL8A 4TROA 1DC5A 2IU3A 5EE0A 5FI5A 4GG1A 3RWOA 3S2ZA 2AJTA 2R48A 4DSUA 3FR8A 5IK2D 4OUDB 4UDYX 1RYNA 3SC3A 4TXMA 3HEAA 2ANBA 1DADA 3IIIA 4AWAA 4MGEA 5KPJA 3M5PA 1XZDA 3DDUA 1HDYA 3EIUA 5DP1A 2BEVB 2AOTB 2H4ZA 3KZMA 4Y2RA 4YP5A 4ZCSA 4KIGA 3ZWMA 1GJRA 3RCBA 4CQMD 1VPDA 3ELDA 4BNGA 3PXGA 1MW8X 1AK9A 4DUGA 2YDXA 3L8MA 4DYHA 5C3MA 2YZ7A 2ZDGA 1OX4A 4WV3A 5CX1A 3AF2A 1L7QA 4CL2A 4DPKA 3FPCA 3RYIB 4QT4A 1TQDA 2GVNA 4ZAFA 2X2FA 5H81A 5IFLA 2Y1FA 2G5TA 1RQXA 3ZE2B 5D2CA 2WICA 4WINA 3OEWA 2PUEA 2Q50A 1XCPA 5LP6C 4CT0A 1Z0DA 1Q3KA 1ZGCA 1W6UA 1QWOA 1KGSA 1MCZA 2O0JA 2ONCA 3K9QO 1RYFA 4MDFA 2P78A 2IYOA 1NYLA 3ANXA 2ODWA 5JANA 3CINA 4QBKA 3ZZNA 1RFGE 1PR3A 1R0CA 4IHJF 2A8YA 4TWIA 2WVAA 1MT3A 4H4EA 5ISMA 1LZKA 2BMEA 3UB3A 3WA6A 1AD2A 2PWBA 4RTJA 1EVQA 1E1CB 2B5VA 4EG1A 2PZFA 1LSJA 3E1SA 4H35A 4AVYA 3DAHA 2W71A 3AZQA 4JEIA 5FUWA 3FNQA 3OUUA 2C83A 1PFUA 1YXMA 3AL0C 1RLIA 3TRKA 1GXSB 4M1QA 5LQKA 3U3ZA 4URZR 3G5MA 2IYTA 4Z3KA 3R8XA 3OESA 3HU5A 1R00A 3AP1A 1HYQA 5C1BA 4E33A 2G17A 2FMHA 2WG0A 5DIFA 2H57A 2C0CA 1TIPA 3RG8A 3WYDA 4HXGA 1A2KC 5JATA 1RKXA 3CVJA 4QU0A 2BHRA 2EFJA 5BWLA 3Q5EA 3WGMA 5ES3A 5C9ZA 3DBRB 3PTZA 1Q17A 1K5PA 4G41A 1OD6A 2WG1A 2G6BA 4E4RA 3ERCA 3R9XB 4B9AA 3IBYA 3RSOA 4OPMA 3ZHZA 3MF4A 4A27A 3R3VA 1S1CA 1JIKA 221PA 1E6EA 1W0KA 4A7PA 2QL6A 3RS4A 3JVEA 3WB0A 4EEKA 5K05A 4IGIA 1OH7A 1RHMA 2ZRCA 3CZQA 3P9ZA 3N2YA 1R6XA 3KQMA 1E58A 1TKBA 2CVQA 2F17A 1MC4A 2QTZA 3JASB 2ICAA 4NI5A 1N2BA 2W6OA 4EUEA 5KIAA 3RC3A 3MD9A 1QB7A 2ZBEA 4IJKA 4G09A 4IHJB 4NY1A 3C7TA 4PYMA 3I9V6 1BNCA 1T91A 1J8MF 1YIAA 1VG1A 3E9CA 3OZAA 3V3TA 4BEBA 4ND8A 2H11A 1J21A 1LK7A 2VA8A 4KRYA 2PMDA 5FPKA 2BHLA 1OVGA 3AZOA 3DQZA 3FOAA 2E4UA 5FWXB 1IZ0A 3DOUA 3DW1X 4WT7A 2WIAA 3F96A 4MP3A 3Q7RA 2FW9A 4U7WA 3U4AA 2CVOA 2UVPB 4GLJA 4NYIR 1BA2A