2VDVE

Structure of trm8, m7g methylation enzyme
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
227
structure length
216
Chain Sequence
NPFSDHQLEYPVSPQDMDWSKLYPYYKNQMTKKVTIADIGCGFGGLMIDLSPAFPEDLILGMEIRVQVTNYVEDRIIALRNNTSKHGFQNINVLRGNAMKFLPNFFEKGQLSKMFFCFPDPHKARIITNTLLSEYAYVLKEGGVVYTITDVKDLHEWMVKHLEEHPLFERLSKEWEENDECVKIMRNATEEGKKVERKKGDKFVACFTRLPTPAIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords TRNA (GUANINE-N(7)-)-METHYLTRANSFERASE
publication title Structure of the Yeast tRNA M7G Methylation Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 62
structure length 216
sequence length 227
chains with identical sequence F
ec nomenclature ec 2.1.1.33: tRNA (guanine(46)-N(7))-methyltransferase.
pdb deposition date 2007-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02390 Methyltransf_4 Putative methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2vdvE01
3UJBA 3M6UA 4YMHA 3KPYA 1RJFA 2R3SA 1KR5A 4X41A 4CTJA 2IH2A 3HVKA 3FPJA 3DH0A 4C07A 1JQ3A 4PYNA 4RTSA 4CXMA 2FK7A 3FYDA 5LQNA 2UYCA 3KR9A 4WVLA 3DMGA 3THRA 5FUBA 3OPNA 5LSAA 1AQJA 4ER3A 4HH4A 4R6XA 2ORED 2AN4A 4XUCA 3LDFA 3P9KA 1X1CA 2BR4A 5E1BA 3VSEA 5BW4A 5GM1A 2FHPA 5DSXA 1KPHA 3SR4A 1ZG3A 5DM0A 3EGEA 4ISCA 2ZWAA 2ESRA 3O7WA 5DXAA 3TM5A 4BY9E 1RI2A 2G8NA 1TPYA 5FULA 3LBFA 4KDCA 3EVFA 3FPFA 3NMUF 2AOXA 3G2PA 1L3CA 4HTFB 4IWNA 4RVHA 2R6ZA 5GWXA 2QRVA 2ZFUA 3DXZA 4PYKA 3R0QA 4PYMA 1KIAA 4P58A 3CJRA 2K4MA 2GS9A 3EVEA 3HA3A 3BWYA 4PWYA 4R8RA 4DQ0A 1I4WA 4AX8A 4HGZA 5EKXA 5E1OA 5HIJA 5E9QA 3OFKA 5KS2A 2V74B 4OBXA 3FUUA 1AF7A 1XDZA 2AVNA 1VP3A 3G5LA 4KDRA 3LBYA 1Q0TA 1QAOA 1ZQ9A 3KKZA 5LQCA 3FUWA 5CCBA 5CVUA 2YTZA 4RTNA 5K05A 3B89A 4BP1A 3SM3A 1SG9A 4KW7A 5DTMA 4C05A 4RTPA 1XDUA 4YUYA 2C7RA 4HC4A 3OZSA 2I7CA 3OU6A 3ER8A 4MQ4A 2PXAA 3A7EA 3DULA 3PVCA 4DKJA 1BHJA 1KHHA 2ONZA 4YUWA 5EGSA 3UWPA 4PYLA 3B3JA 5BW5A 1KXZA 3UJAA 4WXHA 1N7JA 5K03A 2ZBQA 3CC8A 3ELUA 1XCLA 5K0EA 5DM4A 2P1DA 4U7PB 2HTEA 5FHRA 3FPHA 4ER6A 4M37A 5K0GA 2AOUB 3UJ9A 5EHIA 1N7IA 1UWVA 2JHPA 4PCLA 4LWOA 5DRYA 3R6TA 2PWYA 4GOLD 2NYUA 3T7TA 4YUZA 3BXOA 5EQJB 4E33A 1XTPA 3AXTA 3EVAA 3QOXA 3LKDA 4P7GA 3JWJA 4M7RA 1M6EX 2OXTA 5DWQA 3CJQA 3LL7A 1G60A 3LDGA 2VZ9A 4YV1A 2ERCA 3PTAA 1RJEA 3BGIA 2XYRA 4V0QA 5T64A 3NVKI 2ZW9A 4CKBA 5KVAA 2N47A 2WK1A 3K6RA 1N2XA 3MAGA 2HR1A 4P7JA 2NXEA 3BGDA 1SQGA 1FPQA 2YR0A 3KR1A 3KQWA 1NE2A 5C1IA 5HZMA 1JG3A 1XCJA 3G2OA 3C3PA 2DULA 1FP1D 1BKYA 2NXCA 4E30A 3IEIA 4C04A 2UYHA 3B3FA 4K6MA 3HM2A 1RI5A 3A26A 4H0NA 5E8RA 3C6KA 5ICFA 4RTOA 3NWEA 2G70A 5EHGA 5H02A 3G8AA 3GO4A 3PS9A 4RYLA 5F2NA 1KPIA 3ELYA 3PT9A 4CWAA 4OQEA 4Z2YA 1PRYA 3T7SA 1IM8A 1DL5A 2H11A 1VP9A 1EG2A 2PVCA 3C6MA 3MQ2A 1V39A 1X1AA 3AWIA 5EVJA 3SMQA 3TKAA 2IBTA 4HSGA 2OYRA 5K01A 3HNRA 5DM2A 2PSSA 4V0RA 2P3LA 4JXJA 5JR3A 3BKXA 4P7KA 2B9EA 3KQOA 3TQSA 3HEMA 1UFKA 1XXLA 5IKMA 2YVLA 2JJQA 5DX0A 1Q0SA 1AQIA 3EVDA 3R3HA 4YUVA 2XBMA 1ZHFA 2QYOA 2ZIFA 5EMLA 1NW3A 3HA7A 4QPNA 3DUWA 3GDHA 3DXYA 1VIDA 5HOQA 2QE6A 5EMKA 3BZBA 5FA5A 3T0IA 5LQJA 2YXEA 2IH5A 4GEKA 1B42A 4OX9Y 2P40A 3G7UA 3UJ7A 4DF3A 4PYOA 5ICEA 3L8DA 3P9NA 1NKVA 1G8SA 4RX1A 4AZTA 2GH1A 2PX8A 3DP7A 1P91A 1UIRA 1X19A 1L3IA 3P2KA 1RJGA 5MHTA 3EVCA 3PFHA 2O07A 1NW8A 5M5BA 1VPTA 2CMGA 3KR2A 2JHCA 2PX2A 5GP1A 1F3LA 3MCTA 5K0LA 1G6Q1 3JWHA 2F8LA 4KIFA 2CWWA 2PBFA 3A4TA 3TOSA 2CMHA 3M6XA 3O31A 3FPEA 1KYWA 3OU7A 2PX5A 3MCZA 3LCVB 4PGGA 3SSOA 4DMGA 3GRYA 5K0JA 1L9KA 2B78A 4Y2HA 4QTTB 3FUXA 4RTMA 1QAMA 2P3OA 3E23A 3MHTA 2FYTA 2AOTA 1EIZA 4IKPA 3EGIA 3HVIA 3NW9A 4NECA 4BLUA 5FWDA 3CVOA 5BP7A 2QM3A 3G89A 5FWAA 1YB2A 4FR0A 2JHAA 2C7OA 2FPOA 3R24A 5CVVA 3FTDA 3ER9A 3P71T 2AVDA 2PX4A 4X1OA 7MHTA 1JG4A 1YUBA 5DT2A 1JR4A 4E2WA 1P1CA 2YUIA 3EEYA 4OA8A 1F38A 5D1HA 5EMJA 3DXXA 3ID6C 3KQTA 3HP7A 2AZTA 3Q87B 4QPPA 5E2BA 1JQEA 3P8ZA 1T43A 4L7VA 5FQOA 3UJCA 5EOVA 3P97A 4KRGA 3B3GA 2VP3A 2AOVA 3ELWA 4BLWA 2IP2A 3LSTA 4DA4A 1QYRA 3TFWA 1TW3A 4XUDA 3PX2A 1X1DA 1O54A 4ER0A 2ONYA 5E9JA 1NBHA 3GJYA 4RVGA 5E9WA 3OZTA 3UJ8A 5HILA 3SVZA 2VDWA 5C0OE 1AV6A 2A14A 4PONA 2ZVJA 3QOWA 3KPUA 3UJ6A 2Z6UA 1I9GA 3G2MA 3G2QA 3GRVA 3I5UA 4QQNA 1IXKA 1RI1A 2I62A 3KQYA 3LCCA 1X1BA 5FADA 4FT4A 4EVIA 2V7EA 4RSRA 4CKCA 2ZCJA 3MTIA 2YX1A 5DXJA 5F2KA 3CGGA 4QQKA 1Z3CA 3KQMA 2VS1A 3UFBA 2IDJA 3HVJA 3PFGA 3HVHA 3DLCA 4LG1A 1NW6A 1FJXA 2P3QA 2OPBA 3FZGA 4DZRA 5DSTA 5DX1A 2BR3A 4YMGA 1QANA 4YV0A 4C06A 2NNWB 1TW2A 1ORHA 5D1NA 3BWMA 3TMAA 4QTUB 3HCAA 3NTVA 2ZIGA 1JTFA 4X61A 5CVJA 1NW7A 3AY0A 3SXJA 3R9XB 1O9GA 3OFJA 3FTCA 5E2AA 2AN3A 1YFJA 3DLIA 2G71A 2QY6A 3LX6A 3GRZA 4XCXA 1XDSA 1RI4A 3DMFA 3IYLW 4OQDA 4DCMA 4GQBA 2GAFA 3I58A 2IDKA 5LQRA 2G72A 1M6YA 2HV9A 1RJDA 2OY0A 3RIEA 2YXLA 3CJTA 2O06A 5ICCA 4AZWA 5EEHA 4E70A 3Q7EA 3G88A 3ANXA 4YUXA 1R74A 2QRVB 3KQPA 1SVUA 2ZSUA 5T6BA 2XVAA 5EZQA 1JTEA 5EZSA 3VC2A 4F86A 3DR5A 4FSXA 2PJDA 3EVZA 4IV8A 4EK9A 1WXXA 3AJDA 3TRKA 4RTJA 2P8JA 5E8JA 2VDUE 3HTXA 3GIWA 5DM1A 1QAQA 3NDJA 3VC1A 4DM3A 5HFJA 2O57A 3LHDA 5CD1A 5U4XA 4PIPA 4EMSA 3MB5A 5E1DA 2JH9A 3OE4A 4HGYA 4LECA 3EVGA 4RTLA 2P7IA 4OBWA 5K8VA 2PXXA 3DOUA 3H2BA 3A7DA 1SUIA 3LECA 3LCUA 5CUQA 2BM9A 5FTWA 4POOA 5K09A 2C7PA 2C7QA 3D2LA 1R6AA 3FYCA 3MTEA 5K0NA 4RTKA 5GIPE 2OZVA 4RVDA 3PLAE 1SQFA 4HTFA 4MIKA 4GC9A 2YQZA 4G56A 1WZNA 9MHTA 2P35A 2PXCA 4R6WA 3U81A 4DCGA 2B3TA 1SUSA 2PT6A 3UA3A 1IY9A 3SGLA 1L1EA 2NXNA 4GOND 1EQAA 4E2ZA 2IGTA 3THSA 3ORHA 5K0CA 5HIMA 4QVKA 4HG2A 2ZLBA 2B2CA 2P7HA 2XYQA 3ELDA 4RVFA 4E31A 1G8AA 5GOZA 4PYQA 3TR6A 1ORIA 1RI3A 4MHTA 3I9FA 5EC8A 2BH2A 5HEKA 2ZBRA 2FRXA 3FRHA 3KU1A 3SSMA 4OA5A 3BKWA 4QVGA 3GXOA 5EKUA 3O4FA 2Z6AA 2PKWA 4A6DA 4E32A 2EFJA 1Y8CA 2PGXA 1JQDA 4U7TB 1JG1A 5E1MA 3M6VA 2FCAA 4PYIA 4C03A 10MHA 2AS0A 5KQSA 5IH3A 2B25A 2JH8A 4MTLA 2NP6A 2UYOA 3BWBA 4F85A 3BT7A 2AOUA 1EJ6A 4AUKA 3OZRA 4M36A 5EMMA 4FSDA 5G02A 4C4AA 3CKKA 2FK8A 4ER7A 1XJ5A 2JG3A 2GA9A 1ZKDA 3LKZA 3E05A 5DX8A 3LPMA 2GPYA 4AZVA 2O05A 1PJZA 1YZHA 1VL5A 2PWPA 4Y30A 3RW9A 5C9ZA 5LR6A 5LQKA 3FPGA 5CCXA 3C0KA 3EVBA 3FUVA 3GRUA 4FP9A 2PLWA 3GWZA 1VBFA 4XUEA 4ER5A 4A6EA 4BLVA 2VDVE 3EPPA 3M70A 2I6GA 2ADMA 4C08A 3IHTA 4X60A 2UYQA 1YFLA 4EKGA 2PT9A 1BOOA 1M0EA 2ZBPA 3PX3A 4M38A 3P2IA 4PYJA 1I1NA 5LQUA 1U2ZA 4FS8A 1HMYA 2EJUA 5CVDA 4YV2A 3GRRA 3JWIA 3FRIA 5BXYA 8MHTA 1R8YA 2EX4A 5DLYA 3K0BA 2IH4A 4FGZA 5KYGA 1ZGJA 3BWCA 2AR0A 2XYVA 5EIWA 1QZZA 4QDKA 3UJDA 3REOA 2I9KA 2P41A 3ME5A 1R18A 3OU2A 5FHQA 3SSNA 5CVEA 1EAMA 1ZGAA 2GB4A 4KVZA 4GBED 3TM4A 1DCTA 4QDJA 2KW5A 2ZZNA 1WS6A 1G38A 5HIKA 2ZIEA 2ZWVA 3NJRA 1XVAA 1D2GA 3KQQA 4AZSA 3EGVA 5CM2Z 1P1BA 5DRTA 5T67A 2NXJA 3FUTA 3B7PA 5ERGB 2ZZKA 2Y1XA 3DTNA 3KPWA 5GM2A 2HNKA 2PV0A 3KR0A 2CKDA 3X0DA 4R05A 1WXWA 1YF3A 5DPMA 3B5IA 2OBFA 3MERA 4E2YA 1R8XA 3DMHA 3HCDA 3I64A 3NVMB 3P9CA 2EJTA 2IFTA 2AOTB 2IBSA 2YXDA 1KPGA 4PNEA 3SX0A 4CTKA 5LQAA 3A25A 5EIFA 3UZUA 3PB3A 1NT2A 3KHKA 4ZTBA 2O0LA 5EEGA 1VE3A 3GU3A 4E2XA 4KWCA 1JSXA 3QV2A 3CBGA 3T7RA 3V97A 3KQVA 5FA8A 1H1DA 4KIGA 1DUSA 3A27A 5K0BA 2AOWA 1BC5A 1KYZA 3F4KA 4FT2A 2UZ4A 4ATNA 3AXSA 4RTRA 2CL5A 3GCZA 4PCAA 5FCDA 3HA5A 3TKYA 3EMBA 4GF5A 1INLA 1JG2A 3LGAA 5GIOE 5KQRA 2H00A 3NWBA 2AN5A 4FZVA 2IPXA 1L3BA 3HCEA 5EG5A 1MJFA 2BR5A 4O29A 4R8SA 1WG8A 3V8VA 2GLUA 2Q41A 2WA2A 5FQNA 3OCJA 3UA4A 1YZ3A 2G1PA 3UBTA 4BP3A 3MGGA 5DTQA 5HIIA 1SKMA 3GGDA 3KPJA 3ERCA 1R00A 1D2CA 3M6WA 2EG5A 4LWPA 4P7FA 1HNNA 2BM8A 3HCBA 4RV9A 2NP7A 1OR8A 3FTEA 5K0FA 2HWKA 2OB1A 4RTQA 3TPZA 4F84A 2LD4A 2IIPA 3BUSA 2PY6A 4GOMD 5F2OA 2OO3A 1KP9A 1D2HA 3E8SA 1P39A 1VLMA 4PINA 5GINE 1FBNA 1O9HA 4PIMA 4X63A 3FTFA 3LDUA 2WA1A 3WSTA 3GNLA 2H1RA 3I53A 2DPMA 2OKCA 1FP2A 2Y1WA 3KPVA 3NDIA 3EMDA 4PGHA 1EJ0A 1MHTA 2ZTHA 3HCCA 3P9IA 4GOOD 2XVMA 5P8WA 4GUAA 4EQZA 2ZZMA 2E5WA 3M33A 5EPEA 3P2EA 4B17A 3EEOA 3RODA 4GC5A 3VYWA 5ICGA 4CKEA 3S68A 3HCFA 3M4XA 2HMYB 4HRAA 3BGVA 1WY7A 3E7PA 3JWGA 3TLJA 5JUWA 3OE5A 4RWZA 5B1SA 5CIYA 1NV9A 3CCFA 1VQ1A 1G55A 1NW5A 1NV8A 1NBIA 2OB2A 3IV6A 3G5TA 3KQSA 4IV0A 4UOEA 4MWZA 3G8BA 5DTRA 2Z6QA 1JSZA 3C3YA 2BZGA 4EKIA 2ZULA
chains in the Genus database with same CATH superfamily
4P2BA 3IH5A 5AW4A 1NNEA 1MH1A 2DBVO 1Y5RA 4BMDA 4FC6A 4IX9A 1SHTX 3HQ4O 1QFSA 1G7SA 4NV1A 4LC0A 1VZ2A 4OJQA 4JLOA 1ZX1A 1VJRA 4UFNA 5FRDA 3OJOA 1DBIA 1YV9A 4F5DA 3LDFA 3P9KA 3FWPA 1BX3A 2XNHA 1S2GA 5AOVA 4L8FA 3DFKA 2FHPA 2BW0A 4CR7A 5B2ZA 2I55A 3BMNB 2ZB7A 2HQSA 2QVLA 3VNBA 1LK0A 4ZODA 5JNTA 3H65A 3EZYA 4JLWA 5KWSA 3C1UA 3IMEA 3LQRA 1CJSA 3FPFA 4DLZA 3WVNA 5CB4A 3ND6A 5AICA 5H5JA 5TSDA 4NZNA 4PYMA 3DXZA 1LDEA 4FJ1A 4Z0PA 3S2IA 2D7CA 5T7BA 5F5NA 2GS9A 4P86A 4PWYA 1WMBA 3I12A 1DRWA 3D54D 1XZAA 1H2AS 2AFHE 3IVMA 3OFKA 5COQA 5E1OA 1WIWA 3W8DA 2UV8A 3RHSA 4JI4B 2D0PB 3UB4A 4EABA 3N2GB 3G13A 3TEMA 5AVRA 1VKOA 2PK3A 1QZ3A 1XJQA 5BMOA 1ZNQO 3FNEA 1CZNA 2B1JA 2D2IA 4YV7A 3J80A 5I8WA 1M67A 2N1BA 3OU6A 2IX3A 4ARSA 3ILXA 3EH1A 2ATVA 2HU2A 4YRSA 3RJTA 1QH0A 1YBAA 5AKKA 5ABPA 5JSHA 2VHVA 5K8LA 3W06A 3S6JA 4LMAA 4N82A 4W7IA 3GP8A 5A0VA 2XUZA 2GNOA 2A7QA 3CC8A 3H8VA 5HUJA 1UR5A 1YI8A 1SKYB 4LZAA 3H7AA 2WTMA 1FS4A 4ZC8A 2WJYA 1V7CA 2EG9A 4ZP1A 3UJ3X 1VMAA 3H16A 3OQ1A 1AQUA 2UZ1A 2YZKA 3AFIA 3GA7A 4Y9DA 3QJGA 5AW1A 5JQGF 1KWGA 1B73A 2PWYA 1VBMA 3BXXA 1PZXA 1KMHB 3RREA 1G3RA 1QYWA 2M6KA 4YJHB 1TM2A 5D3KA 2R1TB 3WIVA 4K26A 2JK0A 1DRKA 3RC2A 1T1SA 2W8BA 3MQ4A 1DQZA 5CURA 3MLAA 2ERCA 2VTKA 1SCUB 2OCYC 3OQBA 3LAWA 4FD2A 3FJ1A 1U2QA 2HA5A 2AIRA 2XB6A 3EXAA 4GVXA 4YA6A 5LMNB 1H1LB 1PX2A 2CJWA 1E9BA 2CXRA 4MPRA 3K9FC 3D5TA 2FFHA 1IQRA 1SQGA 2V65A 3EWSA 2KBEA 3KQWA 4LX8A 5MDHA 3DR3A 3FXAA 3AHHA 3G2OA 2I65A 1W6UA 1ZISA 1G0OA 3WYBA 2R65A 4Q3CA 3TJZA 1NYRA 1PD0A 4TYPA 3X44A 3BCSA 4Q7MB 4LE2A 4J4BA 4PSVA 3LF1A 3NWEA 4UD2A 1PEDA 3W5HA 3PS9A 1A9ZA 4RYLA 1CVIA 4C0HA 5G4KA 2DTEA 3MWYW 4OQEA 3COYA 1CC1S 2DFPA 3AU8A 1T0IA 4GBJA 1J24A 1VIMA 1YGYA 2E55A 1G17A 3LXUX 4MXDA 5TQ2B 1NBME 5F3DA 4XAQA 3MSCA 2L82A 5DHPA 3GP5A 4WOBA 3WL6A 3TQSA 2J5QA 4RFLA 2ZRBA 4OGGA 1QKJA 1GPWB 4MNTA 1NXOA 2FPPA 2RHBA 3HDTA 3ASYA 3L7LA 3O4VA 1J8VA 2JGLA 2Y4NA 3GAZA 2APJA 5JCZA 1ZHFA 1IXSB 2ZIFA 1XQ9A 3ON5A 1GNRA 2HQBA 4ADSG 3THXB 3NWPA 1LGYA 2PUHA 1XZ8A 1QVVA 2BE7A 4FHCA 1Z08A 1E6CA 4X7BA 3U3JA 1DEXA 3KLMX 4Q4HA 4YO7A 2XR1A 5B1HA 4MOWA 1JIJA 1FBTA 1R9NA 1SK8A 2C5AA 2B6NA 2X0JA 3AUSA 3K16A 2X9NA 4IDGA 3DQPA 2NPFA 4DBLC 4CT5A 5LKAA 3GYGA 3SQWA 1Z6PA 3G68A 1L3IA 2VQDA 1JFLA 2HT6A 4DRXB 2GK4A 1GGNA 4M60A 3BJRA 3AWDA 5GJCA 1S8AA 2CMGA 3A0UA 3DEYX 2FGKA 5FL7D 5BPHA 3WYCA 2VPZA 3DO5A 3TOSA 2H1WA 3QXSA 3DE3X 4UUAA 4FHDA 1P1JA 4XJSA 4DAOA 4UEQA 1XTVA 1M8JA 2X42A 4A82A 3TIIA 1SXGA 3NHBA 4RKQA 2ZM6B 3DOOA 1MENA 3EVNA 4OREX 1WCXA 4BVHA 4YAIA 3ZHZA 5FWAA 5CB6A 3SK0A 5KSOA 1L5SA 2JHAA 5DXFA 2R5NA 3P9YA 4JEUA 3SR0A 3PJGA 3L4EA 5ARDA 1UC5B 5AXBA 1JG4A 5DT2A 3U7GA 3WFIA 5KREA 4G1VA 621PA 3DV0A 4TUYB 2JIBA 5I7VA 5DNCA 3I2FA 5IK2D 3NDBB 3KQTA 3PQ3A 4V0LA 2A0KA 2K5UA 3K5IA 1WXDA 5EI5A 1RHRA 4QBHA 5KTKA 5DN6A 3GDGA 2A33A 1FYFA 3JV7A 2BSAA 4I1RA 5C5IA 2XV1A 2RHMA 1D4FA 1S3FA 4QXQA 2I80A 2DOKA 2ETVA 3ND8A 1QYDA 1NY5A 2EP7A 2OHOA 3IA2A 4I4TF 4AZ0B 3P4UA 3OQIA 1OIVA 3CB2A 4PM4A 4RVGA 2IU0A 3IQWA 2REQA 3REGA 2P5UA 2LCQA 1WB9A 1VI2A 5IF9A 4ZOLB 2WU1A 2VATA 5D84A 2ZPUA 3PF9A 1EVJA 3A1CA 3K1AB 1LJLA 1CZKA 2BSXA 3G2MA 1WCIA 5AK4A 3RIGA 2HRQA 5FADA 2RK3A 2P9EA 1M2OA 3VNRA 4UCWA 2HF8A 3DTTA 2X0IA 3NGMA 1ZC4A 1Y98A 2FEMA 3IQZA 4GECA 4H0CA 2ZCJA 1Z34A 2ZIXA 4MVJI 5CG1A 1B93A 4B76A 3OOYA 4M8LA 3HVHA 1RBQA 4B6FA 4YPOA 1X7XB 2VPQA 2WM9B 4RDIA 3UV6A 1CIPA 1ADGA 5DX1A 3ROXA 3QU9A 4KO2S 3SBXA 1G20E 3C6BA 3H5WA 2P6RA 4OMFG 2CYBA 4KL8S 1X39A 3EF3A 1FQJA 5FOSA 1FX0B 3VAZA 5K6TA 4FDMA 4QTUB 1U6KA 4Q21A 1V95A 4WCFC 5IJXA 2ACKA 5TF0A 4EW6A 2I76A 1V9LA 1NW7A 2ECPA 4EJMA 4XLZA 1O9GA 5KQLA 2B4KA 1RXWA 5TMEA 1E2HA 1CBUA 2CUZA 1BXZA 2DUNA 3O4GA 4GSKA 1K7YA 3ABQB 4H3KB 4HNRA 4IDFA 4Q3AA 4XCXA 2EFHB 2WSLA 3M3HA 3U39A 1EP1B 4LQ4A 2I7VA 1C3XA 3JQDA 4R9RA 2VDKB 4A0RA 1KBOA 1XVLA 1Z0IA 3EOBI 2GAFA 1SXJE 1FEZA 4GQBA 1KE2A 1M6YA 3PZRA 3R8XA 3ROMA 3B36A 1IG3A 3JATB 4KBYA 3QEAZ 5AJUA 3DYVA 2R6DA 4YJDA 2CNLA 3R77A 1IAQA 1JU4A 3ANXA 4I4LA 4JYBA 3PFCA 1AC5A 1FFGA 3CGWA 3KQPA 5AFSA 4RXTA 3UANA 5EZQA 5HWSA 4FSXA 2JIZD 4MPJA 4IV8A 1ID1A 3OC0A 3N5KA 2Z08A 3PICA 1B8UA 2G3YA 4UMFA 3VPGA 3V8MA 3GVHA 2VHCA 4PCVA 4CIWA 1H6CA 9ATCA 4MAAA 1BCSB 2ATIA 2NT3A 3Q5DA 3H6GA 3U6KA 3UV3A 2CXNA 1L5YA 5FOWA 2R7MA 3ZU2A 5B5SA 2FG7C 4M86A 4KBFA 3O4IA 3I9NA 5HNKA 4YAEA 4GLLA 2OLJA 5C32A 2WQZA 4G1FA 3D4NA 1HFEL 5HW0A 1OAOC 1R0WA 3OEEA 5LXTB 3PNMA 3QF4B 2IQ5A 1SKBA 2XDYA 3WP1B 2O8CB 1M2VB 1T24A 4RVDA 2RHTA 1IOZA 3TSYA 3COJA 5HKLA 1M34B 4ZWNA 4YRZA 1AGXA 3KL2A 4B3SB 3EC2A 2C83A 3MJEA 3VRHA 1R0LA 2EZUA 3IBFA 4YWJA 5IDQA 3EAQA 3ISTA 4WV3A 3U81A 1EGQA 1PJ2A 3R44A 4LBWA 4R2JA 1SC1A 4K6FA 1P2VA 3PD0A 1YS2X 2ZUVA 1T8WA 4YQYA 3FBTA 3OHPA 4FCVA 4PU0A 4FZ5A 1CY0A 1XG5A 5ITWA 2Z0MA 5CJJA 1RI3A 1B6SA 2Q21A 4F2HA 1ISFA 4BMNA 1G21B 2B69A 1MRSA 4TTPA 3TR5A 2I34A 2D2FA 5J58A 5CXXA 4OXQA 1BS2A 1EDOA 2OBBA 5ALGA 1ZQ1A 2OORA 2P5TB 4DARA 3U4MA 3UAOA 5YASA 3M81A 3C3WA 2QTWB 2GSDA 2AOUA 1V6SA 2FF7A 4FMBB 3PUJA 1QU2A 5KAPA 1JQ5A 4LNHA 5CDFE 2O5EA 4LE1A 1XJ5A 3KALA 3O03A 4H35A 4TKVB 3GT7A 1B6GA 1M7BA 1D2EA 1CY4A 1ZD1A 5DX8A 5E6RA 1VTKA 3ZWOA 1OBVA 5LR6A 1YDEA 3C5HA 3JYLA 2YQ5A 3EA4A 4Q4JB 4Z1OA 1W8IA 1KETA 3ESCA 4JJZA 4AJLA 3CE9A 4MW5A 3I1IA 1OFUX 4KG7A 4OG2A 3PNPA 1QGDA 1SOWA 1XLUA 4A6EA 1K0UA 1EA7A 1VI5A 1ZM7A 2I4OA 2LVBA 2ADMA 3R76A 2V9PA 4EPWA 2NVOA 1O96A 3UN1A 4AF6A 1N57A 2I2FA 4RD6A 2CVPA 4DAEA 4DILA 4A16A 4DCTA 4EGCB 5IG2A 3LPNA 3RADC 4CHTA 2FVXA 5LQUA 1DG3A 1HMYA 1QLHA 3BF8A 4JUIA 5BSVA 2WM8A 1DWQA 4C1NA 4KMRA 1G3MA 3CNLA 3FRIA 5BRAA 2VHYA 3FE2A 1AT1A 3WLRA 5BXYA 3IIEA 5KTNA 5B1IA 2MR6A 3A1EA 2IH4A 3O73A 3BXHA 1K7SN 3SEFA 3H5RA 1ZAKA 5MN6A 1GGKA 5KYVA 3ZWMA 3I2KA 3DGFC 3FF1A 2NO1A 1ZHHA 3R3XA 3ZE7A 1A4RA 4RZHA 5JZOA 5FBVB 4MW6A 3ZDAA 1YDMA 3WADA 3UAZA 5U4QA 5D87A 3R0ZA 1PW5A 1KYTA 3L7MA 1BN6A 5HCIA 3VHRA 5KU1A 3H11A 2ZWVA 3TW0A 1FMCA 3QOFA 1FIUA 3I2HA 3PXXA 3UICA 3EGVA 3G2KA 2IYAA 1X1SA 2EBUA 4H08A 3O8BA 2IZZA 5T67A 3ZJTA 1VSBA 1QCCA 2AR9A 3OBIA 3X0DA 1VCOA 2P1RA 1FMTA 2I71A 2GM9A 2HMUA 5AVVA 3GIDA 5LWQA 5ESDA 3P1JA 5ILGA 1YZVA 4B8ZA 4EHNA 3E0QA 4BVAA 4CYMA 1AQLA 1D2RA 1OVGA 5AKGA 1AXEA 2L19A 4WTOA 4M0MA 3J7AC 1BMDA 1J9GA 1E4OA 4OHUA 3ZQKA 2G82A 5E3IA 4WOKA 2XKAA 3ANYB 4A8JB 4G25A 4L4SA 3V97A 1JEEA 1RRKA 4J3FA 3RUCA 1T35A 1X77A 4GKAA 3RCBA 2XIJA 3ZIDA 3AX6A 3UMRA 1V2HE 1UWLA 1IHYA 3C3AA 3D8RA 4G4SP 5J4LA 4LJRA 1R12A 1WDLA 4IMJB 1PNRA 2CSXA 5DYTA 2G5TA 4R1LA 4RZIA 3SDZA 1WUKS 2Q3EA 1L1RA 3MYRA 4I5DA 4LYGA 1E3WA 3DEAA 4M2LA 1Z26A 1IRXA 3T3DA 3FR8A 2I6SA 3L7JA 4YRNA 3JAKA 4O29A 2J0QA 3BDAA 3WJ2A 1JHYA 1NBMA 3W4JA 3ZBUA 4A2WA 4D96A 4CKXA 4X66B 5HIIA 1QMPA 3M8KA 1II0A 4FBLA 4N0PA 1CUZA 4BNNA 1JHUA 1IXRC 1SKAA 2FKAA 1TQ2A 1VLQA 2BGKA 3BK1A 3IERA 3K0FA 1MUUA 1MG5A 3NETA 3O4HA 2ZSHA 5DH9A 1WPXA 3QOYA 2PUAA 4UJ3A 4RTQA 1U3TA 1Y6ZA 4KR3A 2ST1A 3JW8A 4B3TB 4C9BA 1ENYA 3MS7A 4KFSA 4UEJA 4UKDA 1OFTA 1QE0A 4YLYA 1U02A 1JT2A 5DK4A 2VPWA 3UXHA 2QBYA 2IU6A 1OIXA 1ZFNA 1DC6A 4PIMA 2OM2A 2C9DA 4DMRA 3F98A 4MRNA 4WOJA 3WSTA 1Z75A 4IIJF 3DWGA 1W581 4LJLA 1CT9A 1DOAA 5CXUA 5TARA 4LOHA 4Y2QA 3O47A 1XHFA 4KAAA 5C2JB 1LTQA 1VCMA 3QG5A 1EK1A 1OWLA 3K15A 5FIUA 3MGBA 4ASUA 4PS1A 1GRRA 1QDUA 4K86A 4BJ3A 4Z9FA 4X44A 2JA2A 3EC1A 4E5PA 3S68A 2O9JA 4HYYA 4ZN6A 3BGVA 4JJGA 4C14A 2BFNA 3FSGD 3VVCA 1XLWA 3PA6A 3NYIA 1NRJB 5CCEA 2CXOA 4NS1A 4P4UA 2M1XA 3ZW7A 5ICMA 4WT7A 1RQLA 3IV6A 3F7OA 3LV8A 3K6SA 3IR6A 2CDCA 1CDEA 3G8BA 4G4SO 4Q4LA 1OI7A 1JYEA 1VSUA 3SKVA 5D7NA 5MN5A 1ISSA 2DR2A 5E1BA 3UJBA 2D4AA 3S28A 3V9AA 4ESOA 3ENWA 4EMTA 2PNFA 2EZ9A 2R66A 2JLWA 4CTJA 4HNGA 3DAOA 1G9XA 1TJPB 3HVKA 4XE5A 3R9XA 2AHRA 3LG2A 4BPBA 5JTUA 2Z8ZA 1RQRA 3MS2A 4I99A 4J16A 4PZZA 3KR9A 3KX2A 1AQJA 5EIXA 4AYXA 5I6DA 3H9UA 3T5DA 4M1OA 1W76A 3RAFC 4I5IA 2DPGA 2R7LA 3MWLA 4ZJYA 2F8SA 1DKRA 1D6JA 1F2UB 2NAFA 5K1ZA 3SR4A 3R0IA 4QRDA 2GUGA 1LPMA 1QYCA 2Z5GA 3J81k 2H2WA 1R6TA 3I2JA 5HE9A 3TG2A 3Q7TA 4MWTA 4RE5A 3V7UA 3KS9A 1AX9A 5GWXA 2ON6A 2ZFUA 1CVLA 2IVZA 3TZEA 1ZD9A 4H77A 1CJMA 1TTQB 1MDFA 2B7LA 3V9PA 3KKMA 1AGYA 2QRPA 4WMLA 1JEAA 2IV3A 3PYMA 3BILA 4WWHA 4G9EA 2AVNA 3PUXA 3H1PA 2HHHB 5HKAA 2Y1LA 1A8QA 1JMVA 1WNTA 1VE7A 3CSSA 4GMDA 4A5SA 5J2TB 2BRUC 3B89A 4MMXB 4NBWA 4NCJA 5HUQA 5K05A 3IP6A 5AHKA 4CCAA 3ZK8A 4C7OB 2BISA 1GZ4A 4FFWA 4BO7A 3LPDA 4HMPA 2JFPA 4JZKA 4KMSA 4QUGA 1LLQA 2CE7A 2PXAA 5IC5A 3IAS6 1YCFA 2WLSA 5K5EA 3T9CA 4UCQA 2EC5A 4LSWA 3U2QA 1G20A 1ORDA 1L7DA 1VKNA 4DXHA 1SHZA 4J1QA 1WP9A 2XRMA 2JLBA 121PA 3NFYA 3QHQA 2O3QA 2V55B 4LNUA 4YRLA 5AM4A 2YFQA 7ADHA 1YQQA 1PS9A 3FYSA 4RZ3A 3S1AA 1PT8A 5BV8A 4H7JA 1X0XA 3CUTA 3PR1A 2PBRA 1IJBA 4ZOCA 3AFMA 5CNIA 4B3CA 3EXHB 3GLRA 1KDVA 4RU1A 4L5IA 5C51B 5EQJB 1H2EA 4RLSA 5FP0A 3BH6A 4WCVA 1NP7A 1KI8A 1A9QA 1ZCZA 1YR2A 1RE1A 2CDRA 4AIRA 1ABFA 1G5FA 4ZVOA 4QYXA 2VZ9A 5E4TA 6AT1A 5FWXB 1NVMB 4TYWA 1R0ZA 3BIJA 3R5HA 5HFNA 3THYB 4ARAA 1XTIA 2BMDA 4HQ0A 4ES6A 5IPFA 2H18A 1P1FA 1V48A 1DX4A 1NRWA 2HCJB 4GX0A 3VMFA 3CWZA 3TTTA 5ALRA 1RS0A 4M9SA 2JFVA 3KR1A 1P2SA 4QOHA 1ZL0A 5C1IA 3LQKA 4YIKA 2NUAB 5BSEA 1QRSA 2AC7A 4WZAA 4EJSC 4RK7A 4UM8B 1FP1D 2W58A 3JVDA 5DNEA 5ELMA 3FOCA 3LHFA 1CY8A 4LHEA 5JCOC 2UYHA 5FI5A 1D0IA 1QP8A 4WXRA 3D3QA 4C0LA 1IONA 3QVJA 5AVKA 2YJ5A 1JB1A 5HRCA 1R88A 3D3NA 1IN7A 5EE3A 3WYEA 4LC9A 1DARA 1DTEA 3F8TA 3A6ZA 3IIIA 3MCUA 5AJXA 3JU3A 5EXEA 2I2WA 1DL5A 3KXIA 5CTJA 5DHFA 3ZHTA 4D9KA 5HS4A 4MKFA 2A5GA 4Z1MD 3W5DA 1ZVQA 3SMQA 3T54A 4GR5A 1XDWA 3PC4A 1OGIA 3CXRA 3ROQA 4XOUA 3VISA 4EMBA 5KEIA 1M75A 1C14A 1NNSA 2BFFA 2MSKA 2HBZA 3JZFA 2O2DA 2DQZA 1CE8A 2OVFA 2QTTA 4WBNA 4ZYYA 2C0PA 4LZZA 4RVCA 4PCUA 2ZEJA 1QPZA 3QIAA 2NZUG 1L5HB 2MU1A 1RIFA 3I2GA 3FFXA 1MNQA 3K4PA 3O3OB 3IEXA 1CIVA 4UCFA 3L8ZA 3ZWNA 5IT5A 3KSUA 4QQ8A 1OWOA 3I5AA 4ZI2A 1NULA 4BATA 4J0HA 3A3NA 2H5IA 1RWWA 1VIDA 2QL7A 3W34A 5LQJA 1P5FA 4A9AA 3AEZA 2QMQA 4BLTA 1B42A 3A1NA 3RSZA 4KVAA 4M1KA 4DF3A 1S2OA 2IKSA 1SY7A 4EY5A 1ANKA 1T8RA 4E7PA 3O94A 2OAEA 4GI1A 3G1WA 2ERYA 3PPWA 3PUHA 3LT4A 4PLTA 5ESRA 4IH9A 3U0VA 1SIBE 4UHHA 4NMWA 1Y82A 3QUCA 3RBXA 5EJAA 3TLZA 1TO6A 5CDFA 1NC1A 1E2GA 3I05A 4ZPXA 4HMOA 3JWHA 2PMEA 1V71A 2DXIA 2F8LA 3MAAC 1BVHA 3PHLA 2AEFA 1HRDA 4BYGA 4URVR 1KYWA 1QLWA 2XOXA 4QU5A 3TNDA 2RGGA 5ECYA 2O0MA 3GRYA 4QHTA 1BNCA 1L9KA 5KOJB 2PGLA 4N5DA 4C0SA 1LDMA 1EFPB 1XDBA 3EGIA 4NOLA 2ZJ0A 4IFEA 4GKVA 3G89A 4QYTA 3W1WA 1VHQA 2EERA 1HRKA 2Q4TA 4HDNA 2WEKA 2R2AA 3HLYA 1JJIA 4O0LA 4N48A 3WV5A 4DNQA 2BGGA 1NATA 3ZVRA 1EWYA 5LZ9A 1REQA 4WKBA 3HU1A 5AI9A 1UAGA 2ZJZA 3FN4A 3RO7A 4AYWA 5KSPA 2XI4A 2DUUA 3EXG1 3LKVA 5HQJA 3WNDA 1RXYA 5JH7A 3QTBA 4MSUA 1C9KA 3HLTA 2AOVA 5IJ0B 4DR6B 3B6JA 3KT6A 4UBOA 5CHEA 5DGHA 3ICOA 3MELA 4J2OA 4ZVUA 3TOVA 1CNFA 2F9FA 2WG1A 3BORA 4J49A 4RK0A 2WTAA 3LUHA 3TS1A 2G06A 2WPDA 2VSXA 4X91A 1NLZA 5HSGA 2RGUA 2VHWA 3EGCA 3KTFA 1V8DA 4MO9A 3JD3A 4OFZA 4U5XA 3V48A 4JL8A 4G9BA 1PHPA 2P2ZA 3U31A 4M1EA 1IK4A 1A5AB 3BXEA 5K8IA 1MB9A 3KQYA 3VVMA 1PR3A 1W47A 1ECFA 1G6KA 2A0WA 2CEKA 2OGUA 3SHQA 1EFHA 1KFBB 3CN7A 1Q16A 4BQIA 5EKSA 4O4JF 4WEOA 1C8LA 4IDAA 2ZWOA 3D8HA 1QX3A 3TFQA 2P3QA 4TS1A 1M2WA 4C3ZA 2PZLA 3HS3A 4EFKA 5EYPB 5DSTA 2D2VA 4W5JA 4YV0A 4QRHA 3KT3A 1Z47A 3Q1KA 1G7RA 1ZD8A 2TMYA 1CS4C 2Y3IA 1X80A 3MQFA 4LXGA 5F35A 2JB9A 1DS6A 3FJYA 1N32B 1YCHA 4MCIA 3FOAA 2IZ5A 2W93A 1TMKA 4WACA 2FEKA 3HR7A 2V3CC 3DLIA 5FUXA 1Z4QA 3NEAA 3MJRA 4RZQA 5BSHA 1TU0A 5CAEA 1GTZA 2JLCA 3AKEA 3TQTA 5CXQA 1PJ8A 1CJCA 1KY4A 4PZAA 4R5MA 5DU2A 3FKSA 3W6ZA 3I5XA 4Z4QA 1TZCA 5A6VA 2QVYX 1W93A 3OPQA 2W83A 2HV9A 2G9VA 3E1SA 1IN5A 1NBWB 1QO0D 1GNVA 4MAFA 1Z6ZA 4R1MA 5C4IA 4X97A 5EJ9A 1E0AA 2CL7X 2JJ8A 2O1SA 1WQ1R 2Y1EA 1ZGGA 3COVA 4PAWA 5AKYA 1KRXA 2HRDA 2PKQP 1EINA 2Y0BA 3CZCA 4EK9A 3AJDA 4EELA 1N5RA 4B2PA 3EG5A 3P0EA 1FYWA 2DHQA 2WWGA 2R62A 1KBZA 5DM1A 4A8JC 1DWUA 5LLDA 4FDVA 4CGZA 2DY0A 5CD1A 1J0EA 2ZATA 3C1OA 3ZN2A 4LI3X 4YDSA 4C4XA 2AI3A 1JSRA 2Y92A 3STWA 3VVBA 5A62A 3MIIA 4LFBB 2BFPA 1LQTA 2QQEA 1FK8A 2G5PA 3GVPA 1KC3A 1TF2A 2Y9MB 2IYOA 5B1EA 2YS7A 3D2LA 3CRMA 4QLAA 2WWVD 2ONCA 4E13A 2LKCA 2PQ0A 4BBPA 5KSZA 1A5ZA 3TRFA 5BQ5A 3KUXA 1N8SA 1WZNA 4WESA 4DYHA 2P2NA 4GVLA 3ZHBA 4BKPA 4XWKA 1BDHA 2V59A 2X58A 2YZ2A 4R2WA 4NENA 5CFQA 3L3BA 3SGLA 2M6SA 3TR0A 1E98A 1MX9A 2Q5HA 1QIEA 5IHPA 2PEZA 4FZ3A 2IF0A 3CW9A 1NBEA 1ZM3A 1QXSA 1U1EA 4ND4A 1ULAA 2X8LA 2XEXA 2XYQA 3GJ8A 3T8YA 4RVFA 4E31A 3N75A 3DG9A 4YDRA 4HQNA 1Y6FA 1UMCA 3RHZA 1W88B 4ZVSA 3H83A 2FB9A 1CY6A 2D54A 3EIEA 3P9ZA 4RA6A 3HVUA 5EWMB 1G8FA 2NZ8A 2C2OA 3ACDA 1M7GA 2PD4A 2CYAA 2X9LA 3H9BA 2XW6A 3BKWA 1QM5A 2DECA 4XD7A 3BRWD 4AY4A 4S1PA 4W5NA 2C57A 2GOYA 3FWZA 1C1XB 1KSGA 1JQDA 3CLKA 4QUKA 1A04A 3C8UA 2Q5FA 4ZYXA 1DC4A 2DQ4A 2W6JA 3QEOA 4JB3A 5EWLB 1F7VA 5AHWA 4C04A 2AYZA 4K28A 3OD1A 1EJ6A 2VSNA 1GWNA 4XWAA 2MSDB 3RROA 1TL7C 3L2OB 2PKQO 4LRUA 4JVNA 3FWNA 4MUBA 1IIBA 1W5FA 4UU0A 5JNLA 2ZDHA 3GHHA 1NHWA 3EFEA 3RGGA 4JT2A 5IBQA 1KJJA 2F2TA 2G88A 3EQ7A 4J4HA 1Y0BA 4BMSA 3B1YA 2CV0A 1OLUB 4N18A 1DKOA 1JLLA 1JFFA 1K1EA 2D4HA 1YJ5A 3AEUB 2GZDA 3IHTA 4TMFA 4F2DA 1E0KA 4CETA 1W4LA 1AUVA 3BX1A 1TXGA 2VDPB 3BXFA 4A73A 4L2IA 3W5IA 1HI9A 3VPCA 4D98A 3F73A 2GPNA 4HD8A 1JXOA 1V7PC 3NUGA 1PEKE 3GC6A 4KSCA 1XYGA 2V6MA 5AI6A 4HATA 2PO5A 3GOQA 4R2XA 2YJNA 4X3CA 1GYRA 6REQA 1JTVA 4DCVA 4YV2A 2Q6LA 1LSSA 2QAGA 4FCTA 1R8YA 3UB2A 4RY0A 2BFCA 5DLEA 1GCUA 3DLAA 1JW9B 1Y7IA 3OY2A 5DLYA 1NG1A 1BGVA 1YQGA 1UK9A 2NU8A 3CPEA 5DASA 1WBBA 3C39A 3JQGB 1A4UA 1M1YE 3PQDA 1WHTA 1RP7A 1PQYA 4EB8A 3DM5A 2NV2B 3FGPA 2P41A 1QCDA 3GPDG 2QTBA 4NABA 5HA5A 2YN2A 1EAMA 1DCTA 2H4ZA 1XF9A 2FPMA 2NTYC 1DBSA 1E96A 3A1DA 4K6HA 1X8LA 1TI7A 2AFIB 4PO9A 4Q0MA 4ZCLA 3U3DA 1VECA 1ONSA 6GPBA 1TZ2A 2R86A 3VM6A 3WWZA 2EJCA 3A2KA 1GT91 2ZZKA 2Q1UA 3K73O 1I2CA 3Q72A 2MJLA 4IY1A 2D13A 1ZRSA 1HOTA 4E2YA 1UBCA 3R09A 3HR8A 3N7TA 4KXLA 1H4QA 2C96A 4K9KA 4NMLA 2C1XA 1V8OA 4MKIA 3I92A 3IUMA 3LI2A 4JV5B 4IGEA 4LK2A 5JD3A 2F55A 3PB3A 4HAVA 4KYVA 2ABWA 1FYDA 3P94A 4HX2A 1YJBA 1P1KA 5KYKA 4IDDA 1N9KA 1QG6A 4EJFA 2Y66A 3K0HA 5HDBB 1JSXA 4MIEA 1EGAA 5FA8A 3O1JC 4YCAA 1ONOA 3T5GA 2PA0A 3SS8A 3ZE2B 1YA8A 3EXHC 3H2JA 3PQ2A 3GJ7A 4PSDA 1ILEA 3GNQA 3M0EA 2AD5A 1R5BA 2VJMB 2JAXA 4FLFA 4MQEB 4XOIA 3KV3O 2WF9A 1C7EA 1P3DA 4ZCPA 4OHOA 3ET4A 5ALSA 1WMSA 1V1MB 1SOMA 3TQIA 1WCWA 1WG8A 3RHFA 3IILA 2JF0A 4JP3A 1S4MA 2O19A 2W43A 3ZQUA 3L0BA 3A9VA 4UDOA 4FE4A 3ZE8A 4K81B 3WIOA 2D2XA 3BE5A 4TZKA 3B6IA 5DZSA 3O0TA 1FFSA 3KJHA 1UOPA 4IQ0A 4OYHA 1Y1TA 4BV8A 2VTBA 5JPCA 4DC1A 1N5JA 3DAPA 3E1KA 3PC7A 4BNDA 1N0UA 2QPAA 4XYMA 1A8UA 1BJRE 3L06A 3QP9A 3QVOA 1YI1A 2QN7A 3QW2A 5IU6A 3PEEA 4ITRC 1O9HA 1FLVA 1L8OA 2JJMA 1RYNA 2BLNA 2R25B 2INGX 3KZNA 2PSDA 5AXDA 1ECJA 3E15A 4JN6B 2W2LA 2Y1WA 1FP2A 4H18A 3HCCA 4LF4B 1NNLA 4UM9D 2PRYA 2V7TA 4DJ5X 4YMUA 1O4WA 2OZLB 1BX1A 4IIHA 2X8AA 5SYNA 1V7QA 1WXEA 3QFRA 1J6UA 5CYOA 4DSUA 4UTPA 5AUPB 2WHXA 2WJVA 3WK5A 4AYTA 2OGSA 4MHOA 1QGZA 2FJUA 4JQOA 2H85A 3WHPA 4LSMA 2QW0X 1AS0A 3H0CA 2IXDA 1K7FB 1ZUNB 2H3EA 2P5SA 3W8EA 3IQHX 4BIIA 3GUHA 1G55A 1HDOA 1TE2A 2BMEA 4YXWD 4MS3B 1EX1A 3SDSA 3VDMA 1GHTA 5E2IA 3DDSA 2PG3A 3FF4A 4MWSA 5D8DA 1BE1A 1I30A 3HO8A 3QIVA 5KOIA 4DBVO 2WT8A 3QY9A 4REOA 4WIAA 2I67A 1M2KA 3AY3A 3GEDA 3TVTA 3FDZB 3VOTA 5KYYB 3PJRA 4PZCA 4OHBA 4YAOA 1OHHA 1Y3BE 1RPAA 2UYCA 1NY6A 1GLNA 1PWYE 1QF7A 1T8YA 1P4AA 4V38A 1NQ5A 1Z25A 1LK7A 2VP0A 4YP6A 3O75A 4YJ2F 4IMIB 1GTMA 1X1CA 4HQKA 5BW4A 4PQFA 3OT1A 3WWPA 2WIJA 5GVSA 1ESEA 1SIUA 3ZX5A 1GL3A 4YT8A 1A2OA 4O6VA 4AY3A 1NUTA 1O94A 2VJDA 3JS5A 3SHWA 4TKUA 3OETA 1IN6A 4KDCA 3NTLA 3CH5A 2VJOA 4PTZA 4RD1A 1UK7A 2O7NA 5FNVF 5KWEA 2IS2A 2L69A 3DB1A 2REXB 2FCRA 3W79A 2YMLA 4IUCS 5HQTA 2B6HA 1JH8A 3QNMA 4DV4B 1XCMA 5KS2A 4NP6A 1Z7GA 5ELXA 1ZK4A 5CFLA 5EXTA 5LYJF 1KP2A 3AHDA 1XDZA 3HI6A 2YH2A 3PDWA 1G9TA 3PJEA 2FQXA 2G76A 3BIFA 3LA6A 4FFRA 4F45A 3CR3C 2YASA 2VYFA 1Y80A 3N70A 2MYUA 1AKTA 5LB2A 4Z4IA 2BHTA 3IBCA 3G5UA 2ZIVB 1RLIA 3CWQA 3NHAA 4QYSA 3K31A 3W1EA 1QQ5A 3DEFA 4DTIA 4JBHA 2J6BA 2NZWA 5IFLA 5EGSA 4PPQA 3BSSA 5TGZA 4R16A 3U26A 3V00A 4MS1B 4JBIA 3HFSA 3SJZA 3GBSA 4N0QA 5B6JA 1JNXX 1LJUA 1IJEA 1ZD3A 3T7JA 3ANLA 2BMFA 3D3WA 4Y2SA 4FB4A 3NDPA 3T38A 1GUYA 1N9GB 4QKQA 1CUGA 3EXEB 3QLUC 2XOKD 1DCKA 2GQ0A 1GVHA 4FMCF 3UT6A 4D4LA 4ZAYA 2EWVA 2JHFA 3FWKA 4NYIQ 3RVDA 1EI9A 2R6HA 4LQDA 2O2IA 3UATA 2FN3A 4RC9A 3RTBA 3F8WA 2YWBA 1H1TA 1RMQA 3OQ6A 4MV3A 2C5FA 3GUVA 5AM0A 3AH8A 4E33A 5BW8A 4M7RA 3S99A 2SCUB 2C8LA 1XEFA 2E0IA 5FORA 4DA7A 1D04A 1FMLA 1UZNA 4ZOBA 5DWQA 5AJWA 1E1RA 4QOJA 3QZUA 4X45A 1E20A 1NVBA 2OV8A 4TTVA 3TLEA 2B4QA 2A67A 1K7CA 1Q84A 1ZXBA 3I61A 3FCUB 2PUFA 3JQRA 3UYLA 2I6UA 5A4DA 4YN3A 5DOZA 3RYFA 1SQ0A 2ZTMA 3A37A 2AEMA 2XHZA 4WZBA 3IEPA 4UTZA 4D25A 4M4SA 4C87A 3DTVA 4J7CA 3GNSA 2ACWA 1HQYE 1BKYA 1C0IA 1IXZA 2NXCA 2SHKA 3QFHA 4JL5A 4QFBA 3UMMA 4MUFA 2P2GA 5ICFA 1N3IA 3WLTA 2C7RA 4RHXA 4OL9A 4FYJA 1U04A 4GLFA 1II8A 3SZOA 1LJ8A 3A14A 4B6RA 1WMEA 1IC6A 2HJWA 4JJIA 5WRFA 1PRYA 1OZAA 3ZOZA 4NCBA 4ANFA 4HZUB 5HP4A 1CUVA 1PJ3A 1YKGA 1Z5WA 4A91A 1LSJA 4GG1A 4UEOA 3TH5A 1X3SA 2CFOA 2ZUEA 4G63A 1RZRD 2JZOA 2WYIA 2AUNA 3L6RA 2O7VA 2P3LA 3CX8A 4PBTA 4QATA 3PEVA 2IYPA 4MIYA 4Y7DA 1ZITA 1M76A 4JJEA 3RB8A 5CDYA 1G1AA 4EJ2A 4LF9B 4S0XA 2AXEA 5F52A 2I2BA 1QQ6A 2CHEA 3C8DA 4Z4CA 5IVPA 3ROTA 2E5LB 1YVPA 1TTHA 2CNKA 1T9KA 3FY4A 5TPWB 1MT3A 1CUFA 3IQEA 2ZSFA 3UT5B 1XT6A 2OBXA 4KLRA 3AVPA 3NBUA 2WMYA 4PC3A 3F7MA 3W2HA 4U8GA 5HUHA 2O8DB 2DHCA 1F2TB 1Z16A 1LBHA 3TWOA 1CJBA 3V80A 2YY7A 2WU0A 4BNZA 1I7SB 3D0OA 5E7IA 4EGSA 1P0MA 4WOCA 4ZEMA 4PN3A 1T3TA 4KTVE 1SXIA 4IP0A 2Q3JA 1ZJ4A 4X8MA 4BVFA 4BOYA 3MWEA 4TKMA 2XKKA 2PX2A 3AMVA 1DJOA 2P4QA 4BP8A 4CPDA 5BVGB 5KVCA 3HDHA 1XGKA 3RKSA 4I5GA 4F71A 4U7DA 2DHDA 4RKWA 4PTYA 1R3DA 4TXNA 1I3CA 4IX1A 1P7VA 3CT4A 4MULA 3QVGB 4V1CA 3HXKA 3QWHA 1C81A 4I08A 3F4BA 1ZINA 2AOTA 2RAVA 3AUXA 3DMTA 4HN2A 4DZZA 4H6VA 4K3VA 5FWDA 5K3SA 1QIIA 3VPHA 1XEXB 5DBFA 2M32A 3G9UA 3U09A 5CNMA 2E7ZA 3PC8A 3O21A 4DC9A 4IXDA 4RVSA 3TNFA 4R83A 5FJJA 1L9XA 5D1HA 1JKJB 1SU4A 2WUFA 4RUKA 4XX0B 1NLFA 4MIOA 3WOVA 2JFWA 2ODNA 5CYGA 4HWPA 1U4NA 4JA0A 2M6LA 1F8UA 1JHDA 2R4QA 3ESDA 4CM6A 3B3GA 1A3CA 3ELWA 4OJKA 4MW0A 4F3KA 2CLLB 3DE5X 3RDPA 1GU1A 1M1YA 3BFPA 1G98A 1VL6A 4MK4A 3L7CA 3PNSA 2A7XA 3EMKA 3PXCX 2WKWA 4KE9A 5J59A 1E9RA 5G53C 2VDWA 4PN7A 1QHYA 3U9SA 3K9HA 3GFBA 5C0OE 4YCCA 5FBHA 3VHXA 1MHPA 3EF1A 4XYGA 2FOIA 3BRSA 4M55A 3ISVA 3UXMA 4C76A 2VPYA 4KSBA 3T4UA 5HJ7A 1K98A 3G2QA 2R8XA 4OHKA 2IITA 3SNKA 1TX4B 4CKEB 1JHRA 2PQ6A 4EITA 1NPTO 5DXJA 3VSAA 3PF8A 2DWCA 1ZOSA 4M54A 2D7JA 4U1RA 2R8YA 1U0TA 3C7KA 3VX3A 5ED4A 2ILVA 2VL7A 3VZRA 4DZRA 3L0OA 1BGWA 1HT1E 3ESAA 4HRVA 1E1DA 1OI2A 3LIIA 1NSFA 3V5NA 1NWCA 5J1TB 2MCFA 1AV7A 4OXNA 4F60A 1WHSB 2DJ5A 4UHDA 3TSWA 1EXMA 1EFTA 1WKCA 3BWMA 3IIKA 2O2SA 4HEHA 3LXRA 3ZUGA 1O77A 1RZ3A 2I6XA 3GFGA 4A0SA 4DDKA 4EFMA 1B74A 4RHCA 2ISSD 2FW9A 3QBDA 4YI5A 4GIBA 1UP4A 1W87A 3HH8A 4HTAA 5TLSA 1XPOA 3CVUA 1GAEO 1N8TA 1YR9A 3HC7A 3LXMA 1IY2A 4OEHA 1D5CA 3DMFA 4CU2A 5JVDA 4ENWA 1TCCA 2PKRA 2GXAA 1E59A 2DWPA 2A9OA 1RM5A 2IEBA 3GD7A 3H5OA 3VMMA 4KXNA 3VH3A 5B37A 1PZFA 2R47A 4LXXA 1XQYA 3D1VA 1OZGA 3HN2A 2A78A 3RTDA 3T1TA 2GBLA 1MTZA 2K87A 1KVUA 4XWYA 1OD6A 1SVUA 3D8BA 3IT3A 3AI1A 4G1MB 3W1VA 1M8PA 4KPUB 1F14A 2FWJA 4MRAA 1SUAA 4PFKA 4ZO6A 2OXEA 4W9NA 4IVPA 4AJHA 4B8WA 2VDUE 4C2UA 1HNZB 1UBKS 1Q1BA 1PLJA 4Q82A 1DMSA 5HFJA 3V2HA 1MP0A 4OO3A 4F2PA 4MR9B 1W29A 4U6QA 4HWTA 2AF3C 1BD3A 2GZ2A 4UVIA 2ZAOA 4HNUA 1KYYA 3H2BA 1PUJA 2YDXA 3LCUA 4J9VA 4RVUA 2PL9A 2GCNA 2ZIAA 3D7NA 1TYBE 4Y67A 4YJ3F 3TZ6A 3O6VA 3DOIA 3TXAA 1EHYA 3UMGA 4XDYA 5JYCA 2VHUA 3LA8A 2OZVA 3JALB 5AVUA 3DDOA 1EFVA 5DBIA 5C46F 4OK3A 1NDQA 2BM0A 3E9CA 3KYJB 3F9CA 3W4KA 4BVEA 4L51A 3KSRA 4RK1A 2WJ6A 4HNQA 1O57A 1P18A 1XMOB 3HJTA 3SS7X 5JDCC 5A4JA 5BOVA 4NF2A 3V2IA 1SCBA 4K9RA 1W96A 4INAA 3W3AH 4II2A 5TQVA 2PFSA 1K63A 2VLIA 3L7DA 4HG2A 4X20B 4CEJB 3D0RA 1XA4A 1P1RA 1ZH8A 4MEBA 3DKVA 1ZI6A 1JEQA 1XLTC 2CVQA 3EBPA 3D7LA 3GH3A 3KU1A 1Y9JA 5BXQC 1RFLA 2GGSA 3L0IB 4JBXA 1YL5A 2XCTB 4QVGA 2E9SA 4I4IA 1XFDA 2BEWA 3G23A 4U2GA 2PGXA 1UC4B 1M6NA 1GGHA 2P9GA 3KZOA 5AJHA 1I2ZA 4BJ1A 4C03A 4PRZA 1T5TA 1LS1A 2NP6A 4EHLA 1J2EA 1E3IA 2F7SA 4XVUA 2XZDA 3SD7A 3TD9A 4RNDB 2PKCA 4K0KB 2GZ1A 2X77A 1FRQA 4COOA 3A3OA 2IXFA 1NR7A 1ZZEA 1A8SA 3H5VA 1B16A 4C4AA 1S0UA 2FK8A 3HJRA 4JB2A 4R2LA 2V3VA 2MHCA 5DYYA 2GZAA 2A94A 4C2TA 4I6GA 4LHYA 5DFAA 1WM1A 2NU7B 1M5RA 3MMSA 1R0KA 4CEHA 1U3GA 5BSRA 2YIDA 1X42A 3L8HA 3NHMA 5EIBD 4CTNA 4DUGD 1BXRB 2OZKA 3NP9A 5A3SA 4ER5A 3OHMA 1FNDA 2MWMA 3EXFB 4IG9A 2FSUA 4GFDA 2NU9B 2HHLA 3ZQJA 1IM2A 3G8YA 1SVKA 3AI7A 1QOPB 1LNSA 1KAMA 1YQEA 2H63A 3I28A 4M38A 2V7QA 3ASUA 5I7UA 4NMXB 5JMWA 1WF6A 1Q3TA 1LVHA 4HT3B 5H81A 4MQBA 1Q15A 2QN6A 1N9ZA 2J4DA 5JZBA 1R0SA 1R4ZA 3I6MA 3JWIA 4Q03A 3PGMA 3RLFA 2CNWD 2VKQA 3MLEA 5CX1A 3AG5A 2ZSEA 2AR0A 2XYVA 4J76A 3UO8B 4DTCA 4KQIA 1RWNA 1UEIA 4RD4A 2E37A 1YUMA 5DTIA 3RI3A 3UHAA 4OQMA 1Z56C 4F6RB 1HEIA 1APBA 3OU2A 3CPSA 5JE8A 4Z7JA 3FDFA 4A10A 1T9GR 4P54A 1O6ZA 1GSHA 5C18A 1ODIA 3N6XA 2IYVA 3N86A 4Q3LA 3UCFA 3H9GA 4RCYA 2RC5A 5EZ6B 4ZT2A 3RG8A 4LZOA 1R9MA 2NXJA 1IAVA 2H51A 4YT4A 1OIWA 4R8MA 4BNGA 3Q88A 4RS3A 4HLCA 2CKDA 3U3RA 5ALHA 3LQFA 1E92A 2WKSA 3FRJA 2NGRA 2Z1NA 3AY7A 1NUPA 1QIJA 3FCCA 3H3FA 2QTLA 4BJHB 5IJWA 4DWOA 3CVXA 1ZY2A 1X92A 3OF3A 1OFHA 5FL7A 4OP2A 4U9HS 3QJ5A 3SC4A 1RWKA 4Y2JA 5G0WA 4D2IA 4RAQA 3BJEA 3VHQA 3A6LA 3MK31 721PA 1DIBA 4DIOA 4ENRA 2VH5R 2DWQA 3IT2A 1VA4A 4GE3A 3I32A 3MTAA 1Z3IX 4RTRA 2RI1A 4PBSA 2P79A 4MW2A 1D6SA 1SWVA 4CDMA 2X1LA 3EARA 3H86A 1DAEA 1FVOA 4JMLA 8GPBA 5IM4F 1HT0A 3HCEA 1IMJA 5BN3A 2N3ZA 3GQBB 2NXWA 3UK7A 1Z5OA 2OUKA 1KOGA 4MR8A 5IK2A 1LWNA 4D8UA 3G2HA 4A8TA 3UW3A 1VRVA 1YZ3A 3WDLA 2O8FA 5BSMA 1F3OA 1XTBA 2GVNA 4D1YA 5E95A 2O59A 1Z15A 1W0JD 3GGDA 2GERA 1HFWA 3KUKA 2F59A 3RNLA 2EBFX 1TDJA 2ONKA 3LS2A 4GZ6A 2NV6A 2Q46A 3WWCA 5CA0B 3HJHA 1BEEA 1Q14A 2RB5A 1DAMA 1FYVA 1GRNA 3KVVA 4MA5A 1PZEA 1P9OA 3HB5X 4YRPA 2BYTA 3WB2A 2FWRA 1K6XA 1L4EA 3VA7A 1L5QA 1I7PA 3GLHE 4BCDA 4BKOA 2XA9A 1MOQA 5B53A 3AUJB 1VLMA 4J1TC 4QECA 1JHZA 1OXBB 1STOA 1Y1LA 4YFVA 3AUAA 3FTFA 5EJ2A 2GJSA 3KOMA 4KHZA 1U3WA 4ZD6A 3Q9SA 4YCDA 3BFJA 1DB3A 4TQUS 1T2AA 2FWMX 2QRLA 4I1PA 2H9YA 3OCYA 1JQAA 2XVMA 4XVRA 4AECA 1N6PA 3ES9A 1T3ZA 4FR2A 2F17A 2R1VA 2C95A 4N5LA 4YACA 2X0KA 2BGJA 4MYHA 2FPWA 4H7KA 1YOVA 1L4HA 3BN3A 3BD8A 2W0MA 1WKBA 2JAUA 3G85A 5TDHA 1LBSA 4CEIA 2DERA 3NNSA 3A9WA 4I8IA 4LX0A 1ODJA 3T94A 5JUWA 1AS3A 3ML1A 3KAKA 3PXUA 3BA6A 2XLBA 3IOBA 4B87A 1N36B 2C3UA 1RYFA 1XMJA 4HDKA 3A9SA 3NG1A 1V96A 1CZLA 3AFGA 3Q98A 5COAA 5IAJA 3RC8A 1VA5A 2VUTA 3BWEA 3DT9A 4UBNA 2HUPA 4ENUA 2CLCX 1J0XO 1OW3B 1K7EB 2I1QA 2E4AA 3HWWA 3PYLA 3Q7IA 5EZYB 2XCSB 5C8YA 3H9QA 5IT0A 5K3AA 3L0PA 1YVUA 2QX4A 4CXMA 1JKMA 1NDUA 3MF4A 1XB2A 1O0CA 1K4MA 3OM0A 4L27A 3QPUA 5E0KB 5NLLA 4CKYA 1PTJC 1UFRA 3AW9A 3MT0A 1ONNA 2W6QA 5DSXA 5J2UB 2E6KA 2FMKA 4GZMA 4NVRA 4ISCA 3ESXA 1VYUA 4D3ZA 3EODA 3NAMA 1W36B 1GKUB 2RFLA 1CZUA 4DQUA 3B3QA 3E27A 4LYYA 4AJJA 4OQNA 3RK1A 1ZR4A 1X86B 4P3XA 2ZTSA 1JDJA 2GD2A 1FRVA 1OYOA 2ZYSA 2A1UB 2Q27A 3BWYA 3MCWA 3WHLA 1T5IA 3AKYA 1T1EA 5DE3A 4C6RA 4F5ZA 1D9XA 1LPPA 1JE0A 3O4JA 5JQGB 5LOVA 4RK4A 1JFVA 2C7VA 2I87A 2VK8A 4H4CA 4OXRA 3USZA 5CIWA 4PC2A 1QAOA 4US2R 1RAAA 2VPPA 5CCBA 2MT9A 4F1KA 1UOEA 4FCCA 1RBZA 5TC4A 4M0LA 3K4HA 1Q7EA 1KI6A 3H42B 4L73A 2DKFA 3BRQA 1D0SA 3DSRA 3GFPA 4JIGA 4K3UA 5DCYA 1AGNA 1FFCA 5D51S 1H2ZA 1LBTA 1QHHA 2Q0XA 2RKWA 2ZJAA 3DULA 1EUDB 1N6NA 3PVCA 3QVVA 4QTYA 1XRQA 2WSMA 3UWPA 3KRTA 2P9ZA 4PYLA 3C5EA 3S2EA 2EFDB 3O3NB 1Q2XA 4G9GA 4CIYA 5F1KA 1N7JA 1WTCA 2VZEA 3V2GA 5K03A 5IC6A 1L4BA 4OHZA 3MJTA 4F46A 2I78A 3QITA 3L1IA 3NS7A 4OM7A 2VA8A 4L75A 3QM1A 5K0GA 4YQZA 3UJ9A 4W8HA 4EPVA 5JBNA 3Q8KA 2OCGA 5DRYA 3RS8A 2ILTA 4GOLD 1NLMA 3T7TA 4A0FA 4HL6A 4CLXA 4E2FA 2CJXA 4RV4A 4PIVA 3T9EA 2HN9A 2O3UA 1KHTA 5DBHX 5UKDA 4BB9A 1QIDA 1TRHA 4IGFA 5BY2A 1BA3A 3KJFA 4FGSA 5HOEA 4DN6A 4JI2B 3DFUA 4Q02A 4OKIA 4V0QA 5IVDA 5C7YA 3NATA 2AZXA 4M1WA 2WHYA 3OPYI 1EGVB 5A3QA 1EWRA 4R31A 3Q7QA 2A5FA 1OPRA 5TS2A 1XRPA 2YZ7A 2NXEA 2OBYA 1JE1A 3BWXA 4QTZA 1NKSA 5DYIA 4ZJUA 3PFIA 2XAUA 2I8AA 1VLLA 1JG3A 2X40A 3TUJC 2C9BA 2FW7A 1YS1X 3FB1A 3GJ0A 5JO9A 2ZI3A 4GQIA 4W5TA 3BHIA 4RYDA 1OH8A 4ZQBA 3B3FA 1AVTA 2G9RA 3KKPA 1WLSA 4Q1BA 4FOTA 1T25A 3HCNA 4GYJA 5DW0A 3UPDA 5EJ8A 3TLYA 2GPBA 3G8AA 4XIJA 3AF6A 4GRIA 1P4SA 2H06A 1TVCA 3ODPA 3M1AA 3ED5A 3K9CA 4XX1A 3C6ZA 4EF5A 1TTTA 3QNUA 4KPFC 1E8DA 1P77A 3NQ41 1XQWA 4PPFA 3RFFA 4HSGA 1N75A 5HFAA 4K9MA 5DM2A 2VHTA 1CJUC 1JJVA 3AINA 3B53X 1RCUA 1EDEA 2N75A 3CRW1 3FMGA 3BKXA 3ETEA 5HIAA 5EP2A 1GARA 3KYIB 1XWWA 2IYSA 1PVVA 1Z5UA 1E4YA 1Q0SA 3ZWXA 5I7EA 3FLMA 4L8GA 5LQMA 3ZGVA 4OH7A 3FGNA 5CU7A 1NBAA 3ABOB 4J3JA 4A23A 3LSYA 1CQPA 4HFMA 5EL0A 1GRVA 2RHDA 3DQZA 3PWSA 1CRLA 1XAGA 4WCFA 1X2BA 5HRAA 3FNGA 3U0BA 5G41A 3PGLA 5J63A 4AZTA 3S81A 2GD6A 3HDYA 3D7SA 2FSSA 1ZGHA 2D5BA 5C3UA 4KCGA 2QPTA 1IMOA 2V6IA 4LDPA 3LCRA 1XMPA 1JIIA 5CPFA 1BYIA 1E60A 1ZIYA 1UBGA 3KJEA 3UF0A 1JHOA 4ZTZB 1F3LA 4ZEOA 2FEXA 2W22A 1VLHA 1XELA 1YR3A 4J4TA 2RHWA 3RWOA 3EY4A 1CEQA 1XYYA 3WGZA 2HLDD 1QJCA 2VR1A 3GF4A 3LCVB 4WADA 3ZDEA 1I33A 2XUHA 4DMLA 2QT9A 2B78A 3OOEA 4I4TB 2V9CA 1X0VA 4UE6A 1SCNE 1E61A 5ELLA 2EATA 4YBZA 1T4GA 3EOZA 1FW6A 4I19A 3AEXA 2ZBEA 4MB6A 4ZOAA 3VR0A 4DADA 4N41A 3CMCO 3PWKA 1CK4A 1VYTA 3DBHB 3U80A 4UUBA 1RLOA 3G9QA 3QNWA 1VC2A 4MV4A 4QPPA 3HP7A 4I1YA 4Z9BA 1HLFA 4L7VA 3T9BA 1JAZA 3L8FA 2AHOA 1OAOA 2BJHA 3MAJA 3JQCA 5CLHA 4A1FA 4A36A 1YB5A 1FP4A 4BLWA 4D46A 1Z0UA 4X8HA 5AO9A 5LU9A 1QYRA 3L0SA 1OPXA 2O8VA 4LHSA 3CHYA 5JATA 2ONYA 3QX7A 2VXBA 1KEKA 5CLJA 3M83A 3BTUA 2G8LA 3OTOB 5LVAA 1Q44A 2HAEA 1ZCAA 3A1SA 4JP1A 4J6FA 4MR7B 4RLHA 2XXAB 1HE8B 3ZVNA 2VTEA 3K1TA 3R3SA 4YEDA 2H7VA 2QR5A 1OXXK 1XEWY 1B8VA 3ENQA 4OUDB 3KXDA 3TAXA 2OFFA 3UGTA 1NR5A 2GNAA 2HDHA 1TU3A 3SOZA 1D4ZA 2PJZA 3VKFA 3ZWQA 4HNVA 3MTIA 4OBEA 2Q5JA 2ZRFA 1BDBA 3I37X 5E6SB 1AKQA 1HWYA 4Y6QA 5AHRA 3E61A 3F5FA 1D9ZA 4LFCB 3FZGA 3KOZA 3KAJA 3BIXA 2XY4A 2NO9A 1EJ2A 3T4XA 5C1BA 3HYRA 4KIJA 2CD7A 1TEXA 4MWCA 3KT0A 1TW2A 1U81A 2FLWA 5D1NA 5AK3A 3L6DA 1PWHA 1QB8A 2JARA 2P9QA 2V7BA 3FSGA 3GLTA 3HKCB 3NTVA 2ZIGA 4G0MA 4LJYA 4CMHA 3KTAA 4JLSA 5EUBA 2IYTA 4G1CA 1N8KA 3U4AA 3RRFA 4AN4A 1G8HA 2Q5LA 1Z8DA 4YRRA 5C80A 3VKGA 2GCIA 2QRZA 3CX3A 1A8PA 1AQYA 1C7IA 3MB8A 3SQNA 1DVRA 4C7BA 1KBQA 4R81A 4C0JA 1HLDA 2VPIA 4C4OA 1TAUA 1A7KA 1N7GA 1NVTA 5COBA 4XB6B 4YRQA 1G21E 2WJJA 3EZ6A 5IN4A 5ICCA 4ZGGA 2Y1GA 3EZ2A 3U40A 2AQHA 1MDBA 2VDLB 3BF7A 3NTXA 4ECAA 2VDMB 2C5BA 1TQHA 1QQ7A 1XPJA 4FMDB 2WM2A 2QRVB 4IEIA 4JYMA 4RJ2A 8OHMA 5EZSA 4MRMB 1JTEA 3FPLA 3LRPA 1PVDA 2HM7A 4RTJA 1DQYA 1UEXC 3JTEA 3LPLA 4D45A 3RUDA 1VKZA 4QQRA 1ZN8A 3C3KA 3I72A 4ZYLA 4K46A 4XVCA 4NZPA 1E9FA 5AT1A 3B20A 1QAQA 1KJQA 3R40A 1EVZA 3ZU5A 1Q7BA 2YJGA 1W1UA 5EE0A 2C78A 4B4VA 3MB5A 2OCIA 4Q6BA 3RF6A 2HJHA 4A27A 5EJGA 3WB9A 2DKNA 2H6EA 3BMNA 4J0GA 3OVMA 1Z4OA 3T61A 2ZE7A 2PRIA 3EIWA 4NOJA 4EVRA 2ODPA 4IMRA 2JLRA 5JU6A 5L53A 3LBHA 2Q5OA 3N8DA 4PEVA 3WGMA 1UODA 3BBPA 4P22A 3ILVA 4MIKA 1L4LA 4KLCA 1RWVA 4AKIA 2OCKA 1PFQA 4NESA 4BNFA 1Q0LA 4TTSA 1XZMA 4IVRA 2OBMA 4LHVA 1QVWA 3WR5A 1TEZA 2K2QB 3SQLA 2OESA 3IELA 1YBMA 2IUYA 3X1YA 2WMNB 1SULA 3TZKA 5AI0A 4GD3Q 3RIYA 3N2GA 5LQDA 5HIMA 1B8NA 5DNDA 1SHLA 2P4UA 2P7HA 4N0MA 1G8AA 1K66A 3SZLA 3T1QA 4D57A 2J08A 1ECLA 4BMPB 1XTSA 2OL4A 1SU7A 4B6JA 2Y9PB 3BHNA 5CA1B 4MEAA 4C6SA 3MWGA 5LDHA 4QIHA 1N6KA 4XGKA 2J46A 3HJCA 5DHTA 3NIGB 1JSLA 1B2RA 4A6DA 4UHCA 4IJQA 4CKBB 5H9WA 1I7DA 3C7AA 4MUAA 1RAEA 2Q1XA 1O1YA 2UZAA 2FVYA 1T0HB 1P3JA 4BKRA 2X9QA 3MJFA 2CLFB 2PSFA 1KYXA 2BBTA 2XRYA 1QNLA 3N87A 1GQ2A 2FMUA 2HDWA 1QWSA 3OLQA 3WZMA 4JBYA 3ZDCA 4KZPA 1NONA 2HOQA 3MINA 16PKA 3V4FA 4B82A 1Q21A 1GEGA 2H0RA 4YJHA 1DJMA 2R1TA 5KINB 3E05A 1WB4A 4D0GA 1E5DA 1T91A 5JLJA 2EV9A 4N3NA 1X8KA 5CT8A 2PSJA 1G0NA 2J6IA 4XQEA 1GCIA 5FB3A 1SCUA 3RYIB 5K45A 3VAAA 4P3NA 4HAXA 1DP4A 4RM2A 1RZVA 1DIGA 1RXUA 1C7JA 2VDVE 5DBOA 3ZGOA 4BLVA 1U1GA 1H1LA 4YJGB 3M70A 5EFZA 1F5NA 1MC1A 1MX3A 2GN9A 4ZDKA 1B15A 5B4UA 2H9IA 3CR8A 1EE9A 2ENWA 4NJMB 1YFLA 3IE2A 5GAJA 1O58A 4D4JA 1FLNA 4MEJA 1I1QB 3ZCRA 3RARA 3CIOA 4JJ7A 3OE7D 1MD9A 4GXQA 4MVJP 1I1NA 3QKRB 1QWOA 5HZKA 4ARIA 1U31A 3JZDA 4LY6A 3COSA 4Z1MA 2WINI 1E7SA 1YIAA 2VOJA 4GU5A 4IIXA 3H4TA 3GXBA 1JQLB 1YT5A 4Q3NA 4KXVA 4GMKA 4PLHA 4PHFA 2GWRA 3EJ6A 1TKAA 2BTOA 3ONFA 1O97C 4L4RA 3TDKA 4C4SA 3SCZA 4M9ZA 2Y0PA 2I4MA 1W36C 1SXPA 4U63A 1QZZA 4OX9B 3IJEB 1W5BA 1AZLA 1W19A 4UNQA 2I9KA 4U7HA 4PX3A 3LD9A 1F1JA 2NTJA 5CVEA 3TM4A 3G5MA 2JGEA 4PE5B 2F67A 3S55A 1VSVA 4UAJA 3RUHA 2XZTA 4D0SA 2WDZA 3L0ZA 1VSTA 4OMUA 5DKFA 2DPYA 1EFRD 4HWOA 4I50B 4OHCA 4PGMA 3ZHRA 4F3TA 4GI7A 3AVXA 1SCAA 2I2DA 1TJNA 2CLKB 1M5UA 4NTZA 1DDIA 3OMLA 2PKEA 4I55F 3MRXA 4P36A 4H1VA 3IV7A 1TVMA 2FEPA 2O6LA 4I8XA 2VEOA 3H0KA 3H1FA 3NC0C 4JSRA 4QJ3A 4YCNA 4Z3KA 3RH0A 1W0KD 3L1UA 3T1VA 4W5QA 4GWKA 4NONA 5LZ8A 1O7JA 5EIFA 4ZT3A 4GR4A 4MQLA 1A96A 3TW4A 4BX2A 3PG5A 3R23A 1Q7CA 2ZI6A 3GFSA 4DRXA 4IPTA 3D4PA 2FPKA 2D1YA 2WJ3A 3KQVA 5C53B 3SQXA 4GP9A 4P2GA 4B45A 1ODTC 4DLSA 2UZ4A 1MU0A 1Z4IA 2FR8C 4IHAA 2OAQ1 3O8DA 4YP0A 1FNCA 5TGTA 1FL9A 1RAIA 1KFEB 3AOEC 3VHLB 4EHHA 2RGCA 4DSAA 3DZFA 5K8UA 5KQRA 2AN5A 2V0CA 3K2IA 2WVAA 2R60A 4L4YA 4IIJB 3T5BA 5KKAA 3ZTWA 1ZOLA 3I2IA 1WDKA 4ZO4A 5AM2A 2V5AA 3G0CA 2EKZA 1DRUA 3KVRA 3GUUA 4EW2A 2AGVA 4BEWA 2XE4A 3RU2A 4BDTA 2YUTA 2HJ9A 1RYBA 1QQTA 1FTWA 4KOEC 4TUYA 2BRUA 4X54A 1OR8A 2X4LA 1VG8A 2RH4A 4G09A 1U9ZA 4GDFA 2CL0X 4D8VA 2QJTA 5IYZB 1ONBA 4UM7A 4ZQFA 4F91B 2HSGA 2VP6A 5H0IA 4PG8A 4BUCA 1MRZA 2WAYA 1ZWKA 5LZ2A 1E8MA 1VKHA 4M1TA 4TWBA 3I3OA 4IO1A 5AVJA 1Q77A 4AZ0A 3JX9A 1IZYA 2Y2UA 5EGNA 2O54A 4TSFD 1KY2A 1QUFA 2ZBGA 1NU8A 1CZRA 3N53A 4IM7A 4GGMX 2UZ0A 4PGHA 5AKEA 3WZLA 1QGOA 2ZTHA 2WF5A 3K09C 3I0MA 4ZOLA 1KKMA 4NG5A 4HNTA 3WB1A 5ES4B 2RONA 5EPEA 3K1AA 2VH2A 3DDCA 1CUYA 4F0JA 4REMA 4XQGA 3LDAA 3SN6A 1YJCA 3HZZA 3UVEA 3T3MB 1FNMA 2XNJA 4I9GA 3HCFA 1JIVA 4BGVA 4MKXA 1V3UA 4W8OA 1W85B 2GPTA 4MGKR 4ZO8A 2NTEA 4B44A 1XDGA 2X2FA 4FJ0A 1X7XA 2UYGA 2O0JA 3B5EA 3I5MA 4TMKA 2G1AA 1NBIA 2VDJA 5ADVA 1U7WA 3WGIA 4JJ8A 1VMIA 5K2MA 2YYAA 1V3TA 2BFMA 1ZNWA 3ADPA 4LRWA 3FM9A 5FNZA 5SZIA 4AJEA 3Q9UA 1XRMA 4CT4B 1FX0A 1OY1A 1NI3A 3U4IA 5IX8A 1WETA 4YDHB 3VNSA 3DNPA 3K1YA 1KSJA 2IRWA 4G0YA 2GJ9A 4G41A 1IN8A 1QO0A 1U80A 3S2FA 3F46A 5JCOA 2IF2A 5FUBA 4BQOA 1XAIA 2C8JA 2O2HA 2R4TA 4KXXA 2HJVA 2VAMA 1Y3AA 4HDMB 1JZQA 2BDEA 5CLLA 1IWBB 1WSDA 3B5JA 3AM1A 1KEEB 3C3XA 3QFSA 4K1LA 3JATA 2PTGA 1CUEA 1N1EA 1XKLA 1TT5B 1ZKMA 3K2BA 4XEUA 3RSHA 4IV5A 1QTIA 1UF9A 2QGZA 2YL2A 1L4YA 3IOCA 4WZZA 4DA0A 1QQAA 4UM5A 2WFLB 1EK0A 3DNFA 3HA3A 4ZVPA 2XMGA 1YBHA 1S3GA 4BGDA 5H68A 1FMJA 2NIPA 3CUSA 3FHCB 4ZXPA 2Y0CA 1W36D 1BCSA 1DIRA 1RHMA 4KSYA 3GFRA 4MW4A 3DE1X 4GYYA 3RS9A 4TZ6A 3GEHA 1SG9A 4B0OA 1N4AA 4JT8A 1KZYC 1ZIPA 4M21A 2NPOA 1JFRA 1T2UA 3B9RA 5KX5F 4KREA 3ER8A 3CLSC 2JLAA 3E82A 4X90A 5LXTA 3QF4A 4BFYA 4CLEA 4DKJA 5KO2A 3KKLA 4AF8A 2O8CA 1M2VA 4Z4GA 1KI1A 2PH5A 3MTJA 1FUUA 2QR3A 3FOFC 1X7YB 3DMPA 1M34A 2R8PA 4IHKA 4WBNF 4GPIB 3ZY5A 2HJRA 1JPNA 3E84A 2C4VA 2JCVA 4Y0VA 1A4XA 5ICSA 3ELUA 2ADFA 5FV4A 2P69A 2AK2A 4ALJA 1CSEE 4UHKA 1U3DA 1XTTA 4G97A 5DO9A 3TK1A 4UUNA 5FHRA 3WKDA 4ZICA 4DSOA 4IH1A 3IHLA 4EPRA 3LPAA 3NCTA 4S04A 5ITZB 1TLLA 4MJ7A 1LC0A 1X38A 5BYKA 4Q05A 2HWXA 2GJKA 3G2IA 2LV8A 3GY0A 1NVDA 3OG9A 5DGTA 3T9AA 2D0IA 1NZJA 3U1BA 2D5CA 1SK9A 1G21A 1YOBA 3LDGA 3W7BA 1IEXA 3X1WA 1U8AA 2EQBA 4DPKA 2O14A 3RWMB 1YRYE 2FX3A 3WRYC 3V33A 2QTRA 2E4WA 4EO4A 2AV6A 5JOQA 5LFAA 2Z2XA 2WWHA 5CHYA 2JPDA 3K6RA 5JC1A 1QH1B 2BH9A 3H5AA 2QJFA 1YB4A 2EP8A 4G85A 5FR2A 4EVSA 4CTOA 2HR1A 3GLIB 5E7MA 1T3HA 1NE2A 1SQ5A 1T2FA 2PRSA 3MWDB 3VI3B 5HZMA 3JYNA 4OJYA 4RH0A 4X1KB 2PWAA 4WKOA 1E6MA 1G8MA 1Y9DA 4K9LA 4M9CA 2VNJA 3VYUB 5JMOA 2FQQA 4OBBA 2WI8A 4TROA 4TKVA 2QTHA 3AEQB 1BMFD 2JCYA 3WBKA 4IEFB 3I5YA 1RI5A 1W1WA 1DDGA 4MLDA 4DZTA 4E11A 4RTOA 4XB2A 5H02A 5IKOA 4I1UA 3G7SA 2G1JA 2QMEA 3PGJA 4Q4JA 4GKJB 3PPVA 2JGFA 2Z5VA 3T7SA 1C4WA 2GA8A 4KE6A 4I5EA 4JYCA 1E3TA 4NU6A 2IUEA 4MDYA 3U6BA 1M1ZA 4KQ9A 5JH7F 3Q85A 4B3JA 3QLVC 4DJTA 1D03A 3AFOA 1ITZA 1YZYA 7REQB 3AOGA 4RKRA 1WTAA 1CUWA 3MD0A 4W8GA 1U0GA 2WJGA 4P0TA 3ZU3A 1CZOA 4OSPA 3HXLA 4B7XA 5DX0A 4OY3A 5ISMA 1AQIA 3EVDA 1PJBA 3QXJA 4QJIA 1A9SA 4XQ9A 4JOCA 5I4KA 2PZEA 4YUVA 3CTPA 2XBMA 3L84A 5FT9A 3R3YA 3UG6A 1UJ2A 1A69A 5JZMA 5DWDA 4QBFA 1JDVA 3BJMA 2F8TA 2RGDA 2QE6A 4BO6A 3WZ2A 3FETA 1J7JA 1C8KA 5J5VA 1KDTA 1NYLA 4FSHA 2V7PA 4UBKA 4MVCA 4CMEC 2CUTA 5HQ3B 4HAZA 5BT8A 2ZRAA 1A2QA 3OH8A 3MPUA 3OLYA 4C2AA 4J0DA 1UIRA 1DIAA 1W1IA 3LOQA 2HA6A 1Z6QA 3MGCA 5HE8A 5C7LO 5MHTA 1ZD5A 2D8AA 3EVCA 1MXFA 4JCOA 4YUAA 2G83A 1G7TA 3B6KA 1JG6A 2C5LA 4C2BA 1I2DA 3MCTA 5K3BA 1DFGA 1MO5A 3S44A 2DFVA 3S0JA 4TV9F 4GOJA 3AR2A 5HR5A 3PRKE 2XB4A 2P68A 4NEQA 1LNQA 2PX5A 4FMPA 3VH2A 4Z5XA 3CRVA 4HGOA 4F3YA 1KZ9A 1U2RA 3GL9A 4MLCA 5IKEA 2ETXA 2P3OA 3DV9A 3E23A 2BTEA 3DZCA