4QJ3A

Structure of a fragment of human phospholipase c-beta3 delta472-559, in complex with galphaq
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
316
structure length
316
Chain Sequence
RRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPSYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanisms of phospholipase C beta 3 autoinhibition.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein/hydrolase
molecule keywords Guanine nucleotide-binding protein G(q) subunit alpha
total genus 110
structure length 316
sequence length 316
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00503 G-alpha G-protein alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.400.10 Mainly Alpha Orthogonal Bundle GI Alpha 1, domain 2-like GI Alpha 1, domain 2-like 4qj3A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qj3A01
1BH2A 4M22A 2FSIA 2WIBA 3KJGA 2OO7A 1AA9A 2C5LA 1YE8A 4EQ6A 3SEAA 5C46F 3W6PA 3TE6A 3RRMA 1MO5A 1P5ZB 5IK2A 4LSGA 4A2PA 4DSUA 1TX4B 4U7DA 2GCOB 2RHMA 4XD7D 5EE1A 4ASUA 2WTUA 2ZI3A 2G77B 4Y0VA 5JHGB 2ZI5A 3GFOA 3LNCA 4HLUA 3SOPA 3M0EA 3AUYA 2VYFA 1J99A 1D9XA 2DWPA 3W3AA 1JEEA 4NTZA 1MABA 1KDPA 3QKRA 4QHYA 3VU9B 4CDGA 1W36B 3GEIA 2FN4A 2O8EB 1EX7A 2ZRKA 2ZS9A 4HB0A 1JAHA 5UKDA 2PT7A 2XNDA 5DN6A 2GXQA 2CXXA 1N25A 2KI5A 3K09C 2ZRIA 3N5CA 1OJLA 5FFMA 3WRYC 4A0GA 2CVHA 2J0VA 2HYIC 2XZOA 1II9A 1W4BA 1SKYB 4XTCS 1CU1A 1OHHA 2O8FB 3D31A 5C1BA 2CE7A 1TF2A 3BORA 3KKQA 1HUQA 1EFHA 5HE9A 3SR0A 4Q21A 2IS6A 4BFVA 1Q21A 2QI9C 2WAYA 5TMPA 2XNDD 3MWLA 3X1YA 5DN6D 5JWOA 2BKEA 3SHFA 4E03A 1NSFA 3VHLB 1UBGA 3B6EA 3R9XA 1NSTA 1GNRA 4ZO4A 5J4YA 4LYFA 1N0WA 4U5XA 5H8WA 1KIMA 4TMZA 3RRZA 2HF9A 1NLYA 3LX8A 3AVXA 1F3OA 1UBFA 1XTSA 4JLVA 5E4FA 1CIPA 1MT0A 2OFXA 2RGAA 2GJ9A 4C4PA 3BFKA 5KPDA 1KI2A 4EQ6B 1IXRC 4QGHA 2J5XA 4TTPA 2LKDA 2XZPA 2EWWA 3GLHE 2ODBA 2R9VA 3B9PA 2WWHA 3GJ7A 4Q19A 2AKAB 2C03A 2IHYA 2ZVPX 1GP2A 2P5SA 2GZDA 1T3SA 1ZM9A 2KBEA 3SE0A 2PZFA 4Q9KA 4UNRA 1FFHA 2C95A 5AJXA 3I61A 4S35A 4Z1MD 4MDEA 4Y0AA 4XWKA 1ANKA 1I4TD 1U99A 3W6NA 4GL2A 4V0NA 1SVOA 1KAGA 3ICEA 2GRJA 4IW3B 2I3BA 3LAWA 2O8CB 2G0NA 2IW3A 4DLUA 4JJKA 4QRHA 1VCMA 4HLDA 5CIWA 4Z8XA 4DDTA 5EE5B 3H84A 3QQ5A 4KHZA 3UIEA 2Q0HA 5G3ZA 1TTTA 3EZ6A 3BC1A 1R5NA 2GDJA 1DO2A 4EJSB 3CNNA 2YINC 3A4MA 2VHQA 4TMTA 1G1MA 4A0HA 4AI6A 3F5FA 3RVBA 4A2WA 2J7PA 2VHCA 3M4YA 5L3RA 1GVNB 1Q1QA 3ADKA 3LVRE 3MJRA 1U9IC 1YJ5A 4FD2A 3K9LA 4BUJA 4HB4A 2H17A 4RCYA 2R62A 2QMHA 3RDPA 1ZW6A 4F4JA 2H92A 1KY2A 1GILA 4PHTA 2BMEA 1P9WA 1ZP6A 2QE7D 4RJLA 2KE5A 3I8SA 3L8YA 2RKOA 4E5UA 5B57C 1E32A 2A5YB 1KO5A 3H4MA 3CRW1 3BD9A 2ZS8A 3NC0C 4WBSA 3A1VA 3TBKA 4ZCIA 1YZLA 3AH8A 1T5IA 1YR9A 2ORVA 4C0KA 1X8JA 2FWRA 2QL6A 2WWXA 3H1TA 1G3MA 3CX8A 3QKRB 4L8GA 1N3BA 4PC7A 1G5RA 1RRPA 2QORA 2RHDA 3FKSA 3OEED 4G5SA 1NNEA 3AF0A 2FG5A 1KNXA 3HP1A 4TYWA 1ETUA 2QEQA 4N0EA 4IOJA 4NH0A 4M53A 3O8CA 1JEDA 721PA 5DHFA 4KCGA 2IXEA 3CF2A 3Q7PA 4CIDA 4XVRA 5LD2C 5C4MA 5DI3A 1AKEA 1OE0A 3GMTA 3ZS8A 1ZD1A 4JIMA 3ZYCA 3A6PC 4X8HA 1DAGA 2AWNA 3OEEA 4QJ3A 1XJ0A 1Q1EA 2ATXA 2F6RA 1DAHA 4X8LA 4DEXA 4IFBA 4KYIB 3NC1C 4L5BA 1PLJA 3R7WB 1OKKA 4LWZA 2JLRA 2WSSD 4NCIA 1X6VA 2IEZA 3WHKA 2AN9A 5CM8B 3QXHA 2L0XA 1XCPA 1I4LD 4DLTA 1EK0A 4CW7A 1U8ZA 1HE8B 1ZUIA 1XBTA 2FPMA 2ZYTX 1ZMXA 4IEIA 1NMXA 2WJHA 3BAFA 2OCPA 2WOJA 3B60A 3SNHA 1OIVA 5JHHB 1DG3A 1F5NA 221PA 2VIIA 4R71A 4E09A 4F38A 4NYJR 4Q48A 4DT1B 2WMOB 3QY0A 2OCAA 3VR2A 2J41A 1P9RA 2PMDA 4A92A 1RJ9B 3RAPR 1SKYE 3KL4A 2MSDB 3IILA 2JASA 1E9RA 1KGDA 4A15A 1FMJA 2ZI7A 4HZUB 3SN6A 2G6BA 3LW7A 4Q7LA 1CJVC 1G8GA 3C8UA 4MRPA 2R6CA 4OKSA 2PT5A 1SXJE 5IRCD 1NG9A 5JJIA 2Z6VA 4HSEA 4TTQA 4PHFA 2YOGA 1E2DA 5CYPA 1EFRA 2IL1A 2WWWA 3X1WA 3ETLA 3P32A 4B43A 1T6NA 3ECCA 4RY2A 3A58B 1E94E 2RGXA 3H2YA 3T06B 2F55A 5JJLA 2V1UA 5BN4A 3NWJA 1EGAA 4ON9A 4PAQA 2BM1A 2C9CA 3THWB 4JT4A 1R10A 1Z8FA 3L0SA 5EZ6B 2KJQA 2ZM5A 1KTVA 1E9FA 2MMGA 5KYKA 1EXMA 3WMGA 2WWYA 2GJSA 3EZ9A 2ORWA 4JKIA 1W46A 1IAQA 2QTHA 3HPQA 4GOJA 4BZQA 3GJ6A 1KYIA 3SYLA 2E87A 2RGNC 4YC7A 3LV8A 1GL9B 4RD2A 1R0ZA 4IXNA 1FUKA 5HE8A 5GADl 3WP0A 1K8RA 1F60A 1IBRA 1TF5A 2G9NA 2FDCA 4N1AA 4RZ3A 2F1HA 1L8QA 1JPJA 1LV7A 3TAUA 4LRWA 1CBUA 3ZS9A 2QMOA 1LTQA 4Q00A 2F43B 3DHWC 2QPOA 1SXJA 3O47A 1S9HA 4BLPA 1SXJB 2YZ2A 5EP1A 3LO5A 5FTKA 5HCIA 2IBMA 2O8FA 2EFGA 6Q21A 2GJAA 4PC6A 4B76A 3U7EB 1SVSA 3C4JA 4Q1DA 2WBLC 3D3QA 2QSZA 3ADDA 1E2HA 3TNFA 3NH6A 3U6BA 4DSNA 2E9SA 1T8TA 2BM0A 5LB2A 5IHPA 1IM2A 3IEVA 1J7KA 1RW4A 3KZ1E 5GVRA 1ZBDA 2RGGA 4UXJA 3A4LA 4JYCA 5F3WB 1N5KA 3BH6A 2RMKA 3AVQA 2IYUA 4BFWA 4WOPA 2ZTSA 1IN6A 2A5GA 2ASEA 5CB8A 5JMTA 1UDWA 4NP6A 1QRAA 4HEJA 4I1UA 2RAPA 4TMVA 3MD0A 2X2EA 4II7A 3VFDA 4B47A 3F8TA 2F3TA 521PA 1GOTA 1GTVA 4URUR 3VKWA 4DUGA 3ASYA 1Z6YA 5DSZA 3GLHB 4QHTA 2VP6A 5FH9A 2H7VA 1DBSA 1RIFA 1G17A 2FZ4A 2RH5A 4K8OA 1SZPA 4FCWA 4XSGA 3EC1A 1N6KA 2IYYA 3U4QB 1J70A 4AG5A 1XPOA 1RC8A 3QBVA 1XZQA 421PA 1YZUA 2HLDA 1WCV1 1ZM7A 1E0SA 3B1WA 1KKLA 1D5CA 3DMDA 3B9QA 4B44A 2O8CA 1OXUA 2P67A 4HZIA 3AM1A 1R7RA 3B78A 3PG5A 4OHXA 2QPAA 2R44A 5JLJA 4ABYA 1D9ZA 2AK3A 3AKYA 2GWHA 2QMUA 1G7CA 3KUDA 1KO4A 4URYR 1R0YA 1B0UA 3G5UA 4EUNA 3A1WA 1W2GA 3TVTA 4DB4A 3W3ZB 3K70B 5A5GA 3A1TA 2IX3A 4F7WA 4ZI3A 3PR1A 2HYDA 2HCJB 1N6LA 2CLSA 2IYWA 5CYOA 3TUZC 4LCBA 4L16A 4MDFA 2PH1A 1YHNA 1AJEA 1NJGA 4Q4LA 1QG2A 3CH4B 2B8TA 3CWQA 1DAIA 1S3SA 2FFQA 3FVQA 4CEHB 1Y63A 1KK1A 4AWXA 1CEEA 3DOFA 5GJCA 4LBZA 3VTKA 1LS1A 4BFUA 5TV2A 1JXMA 3K0AB 4RZXA 2OESA 2GAAA 3GLGE 2CJWA 2OAQ1 3ZGXA 1A82A 5ELXA 2PLRA 2IYVA 1SQ5A 4EPRA 3CPJB 1Y3AA 2Q3HA 2OLKA 4BFYA 5CK4A 4Z51A 3IIMA 1QVRA 2OBMA 4PZZA 1A5TA 1CTQA 1E2GA 3PCRB 2I1VB 3A4NA 4YXWD 1H8ED 3CPHA 3T5DA 2CNWA 1P7CA 3B82A 3IHWA 4C7OB 4EAQA 1SVWA 2OM2A 4HAWA 1DPFA 4P4SB 3L82B 4JBXA 1MV5A 4IVRA 1JR6A 3DKPA 1GAJA 4NDZA 1G3UA 1IN8A 2WWFA 4QM7A 3IDQA 2HV8A 4O2RA 3RRYA 4LZZA 1M2OB 4JSYA 2KWIA 4OBEA 2H1LA 2J9RA 4P32A 1FUUA 1ZIOA 1CLUA 3O8DA 4HAUA 3W6OA 1KI6B 4K46A 1IHUA 5CB6A 3EPHA 2NMVA 3CX6A 3VU9A 1EFCA 2J59A 4IHQA 2V4ZA 1U0LA 3CM0A 1T8UA 4C30A 5EUMA 2KB0A 3THYB 1VG9B 2NOAA 4G3XA 4OHWA 2BEJA 1G3IA 4LOAA 2Z83A 4QC2A 4PSKA 4A1FA 4P31A 3QF4B 1M8PA 2WICA 2BCGY 1WMSA 1A7JA 3CBQA 3BRWD 3WBJA 1NI3A 2P65A 2ZUDA 4HAYA 2X2FA 2OAP1 4PQFA 1JAIA 1LS6A 4RKFA 4HUQB 3K09A 3LW8A 1FQJA 4DCTA 3THXA 3QPUA 1Q20A 2BMJA 3CX7A 3GJ0A 2OFWA 3LA6A 4F4IA 2ZYUX 1TAGA 4M9SA 4FMCF 4H9GA 3LRPA 4RZ2A 3BB1A 2C98A 1IONA 5L3SA 1UEJA 2FZLA 2ZAMA 2RB4A 4CVNA 1G4AE 4LC0A 4NCHA 1JECA 1OFUX 4H1VA 3LBHA 4QXAA 1QHYA 1CJUC 3SFZA 3RRNA 3K0EA 1OW3B 1GITA 3PUVA 3TUJC 4GOKA 3I73A 4LX0A 1J8YF 5E7MA 2IUTA 4NPHA 1Z83A 4BEJA 5JSZA 2D7CA 2NQ2C 1TEVA 2DB3A 4OHYA 1C9KA 4V0OA 4E22A 3C7KA 1A2KC 2AXPA 2WIAA 4AKGA 1G16A 1TU3A 2REBA 3QKSA 2FH5B 2O0HA 1F2UB 4ARZB 2XJ4A 3T1OA 4S2EA 2BV3A 1DAEA 3UANA 3AB3A 1DARA 1T0HB 4NYIR 2HDNB 2F7SA 2VF8A 4ZI2A 3I32A 1PLKA 2A5DA 1CJTC 4TYPA 4KAXA 1EFRD 2WKRA 5FR2A 3THOA 2W00A 1WP9A 1ZC3A 2JJ1A 1E2KA 2WJYA 1T3HA 1BMFA 2ZQ5A 3EAQA 5P21A 5L3QA 3KXLA 3KKNA 3WP1B 5JI2E 2OBLA 5FTJA 3B1ZA 5FL7D 3AP3A 2R6DA 1YZKA 1AKYA 4OK3A 5KSPA 2SHKA 3AKDA 2X1VA 5FOTA 4JLOA 2YWEA 4O25A 3AP2A 3T34A 2GTPA 1NN5A 3IO3A 3AF1A 3AKCA 1UADA 3EA5A 3IEUA 1W0JA 3B7GA 2GNOA 2REOA 4LHZA 3R9IA 1XTQA 3T15A 3EPKA 2XGJA 2OT3B 2VH5R 5GJWC 3U7GA 2IS1A 4WZAE 1C1YA 4LJ6A 2CL0X 2IS2A 4LC1A 3QVUA 3L43A 4LK2A 3B13B 3QOFA 3PIRA 2BJVA 2O52A 2RGDA 5FUWA 1VYVA 3E5HA 3A1SA 2F1RA 3JVVA 2CMKA 1SKQA 3A8TA 4NU0A 4B34A 3AVWA 1ZUNB 2CHVA 1RZ3A 5H70A 1E1QD 1AZTA 1GL7A 4V0LA 2IWRA 2JJ8A 2ZRJA 2ZVQX 4KFTA 1DO0A 2GEUA 1US8B 3L8ZA 4TQUS 4D81A 5K8LA 2IYLD 3CRMA 3EIHA 1R5OA 1RRGA 2GEDA 2WJVA 3SC3A 2R65A 2AFIE 3KUCA 2QBYB 3LX5A 5B58C 3LY5A 4Q02A 4TYQA 1TUIA 4AC9A 5JS7A 3DM5A 1Z29A 4ZDIA 3VKGA 5BN3A 1HQCA 1G5TA 1ZRHA 4F4CA 1G6HA 2YNMA 3UMFA 1WRBA 1YZGA 2ZJZA 1VIYA 2FSFA 4JL5A 1F48A 4R98A 1XEXA 2IK8A 4WZBE 1HV8A 2Q9CA 3FHOA 4CYMA 2BVNA 2O0JA 2W2VA 5JEDA 2QPTA 3ZH9B 1QF9A 3GJ4A 1XMJA 3EIEA 2BC9A 2W6JD 3ZVNA 4LHWA 1L2TA 1UKEA 5DGXA 2WJJA 4QBGB 3VX3A 2IYXA 4B3CA 1KZGB 1XD9A 1ZU4A 2J87A 5SZHB 2P6RA 3ZDQA 2QAGC 2VP4A 1NIPA 2V1XA 4D6PA 1SVIA 2QNRA 2EVWX 1AZSC 4FMDF 3U3JA 2F1JA 2IT1A 4C0BA 3EZFA 3GEHA 3SJCA 2NO7A 4URXR 2DFNA 2ZRHA 3LXXA 4X8OA 1KO7A 2E1RA 5CLQA 5AWFC 3RSOA 3W8NA 4UKDA 4M1MA 1OIXA 3CF0A 1GKIA 1G9XA 3TR5A 4QOSA 2FOLA 3IHLA 4Q7MB 3EZ2A 2ZREA 3BH0A 2Q3MA 1IY2A 3LXRA 2C77A 5AJWA 5L3VA 1P2VA 4ZDJA 4MGYR 2P3SA 2FGKA 4FMBB 1PZNA 1XPRA 4Q9HA 4MGKR 4BQSA 1AQUA 1P9NA 1W4AA 4IOMA 2RGEA 4DSOA 1NBMA 3OIWA 3RYTC 2PL3A 4DLVA 1Q3TA 2P5TB 1NMZA 1MO3A 1QHHA 3BB3A 5AUQA 4B75A 3W34A 3TAHA 3OZXA 1A2BA 3DEFA 3LFUA 2XX3A 1L4YA 1W1WA 3MSXA 4ZIRB 2O0KA 3KKOA 3GD7A 2XSZD 4C7OA 2GVZC 1N5JA 2QP9X 1O3YA 3FHCB 2CBZA 2OZEA 4MKFA 1F2UA 2PZGA 2QT0A 2F3RA 4M9QA 4EDHA 2H16A 1G5PA 3RLFA 4US1R 2VQSA 1GM5A 1KI9A 2QSYA 2JAQA 3RNLA 3RS2A 4TLEA 1N5IA 2DBYA 4XH9B 4FCTA 1XWIA 2VTKA 3W8RA 3VR3A 1MRNA 3ASZA 4IOKA 1DAMA 1M7BA 1UF9A 3QIAA 2FFHA 2P6UA 5JI3E 5D3QA 1GIAA 1E9CA 2JDIA 3WYAA 3P4YA 2HJGA 4A36A 3VNVA 3D6TB 1P73A 3BERA 5C4GB 3UXMA 2W2TA 4LV8B 1SULA 4OQXA 2NPFA 4R7ZA 4W5HA 3RS7A 3RC8A 2XXAB 4C9BA 1CKEA 1ZD8A 4TT3D 2G0TA 3FPAA 3U44B 4PR0A 1AS2A 4WIAA 5EP2A 2XB4A 2GHIA 2ZR7A 2QTVB 4HLCA 1Z08A 2G3YA 2ZROA 4ZPXA 1Z07A 2JA1A 2DFKB 1KSFX 3AV0B 1Z6XA 4TZ0A 1YR6A 4PSAA 4KFUA 1L7VC 4A8JA 3TW8B 3M6AA 3U7HB 1UJ2A 2ZSEA 3T61A 4BEBA 1E98A 2VPPA 2XTNA 2ZE8A 4IDQA 5KU1A 4IEEA 2V3CC 3SYKA 1UBEA 1MRSA 4WA7A 3ZD7A 4JKYA 2KBFA 1XEXB 1P2TA 2DWOA 5JWHA 5HPYB 4EPTA 1E99A 1NY6A 2GZHA 3HU2A 4MYHA 1Z47A 4TYYA 2N42A 2OXRA 3WY9A 2QM8A 4QGFA 4KFRA 5FOSA 2O8DA 2J0QA 4NHOA 4TLAA 2ZE7A 2W2XA 3QVVA 3MWYW 1VG1A 2ZYWX 4B33A 1TMKA 2GBLC 4RSGA 4CF7A 2GAOA 2HT6A 1E1RA 1W4RA 1X86B 1US8A 1XEWY 3DO6A 4O2LA 4HI0E 4DRZA 4C2UA 4AYWA 3IQWA 4QBFA 2OEPA 2JLXA 1NP6A 3SS8A 1EG7A 2XITA 2NZ8A 5KDLA 5AJYA 4MH0R 2IC5A 4JLMA 1VTKA 2AD1A 4C0QC 1CULC 1VHTA 2OG2A 4PO9A 5KPJA 4B3XA 3THXB 2YOFA 1KI8A 2A9KA 4YDHB 4HUQA 2VHUA 4NYIQ 1Z0AA 4MRVA 2ZJOA 2ECKA 2FSHA 1KK2A 3W5IA 2XNSA 2O5VA 5FOUA 2QP4A 3OFNA 4U00A 5L3QB 4D25A 3REGA 2ZI6A 4Q4AB 4UQOA 2ZRGA 1FX0B 2OV2A 2YV5A 3I4LA 1W2HA 1XDBA 3FMIA 1NVXQ 5EZ5A 2J7PD 3HU1A 3N70A 3ZJYA 5CJPA 4A4DA 1S2MA 3TR0A 1BYIA 2EYQA 2AR7A 1E2FA 2AL7A 3CW2A 2D06A 3K8YA 3TJZA 3PENA 5C2JB 3GJ5A 4XSHA 5GJBA 3A37A 4DDVA 5FOVA 2CVFA 4PPGA 2ZIAA 4EKDA 4MRNA 4YMSA 2NO6A 4M1KA 3RWOA 4ARZA 2C78A 2HXSA 2YOHA 3PEWA 3EC2A 4QBHA 4QHSA 3Q5EA 1UBCA 2OCYC 2XEXA 1NVVR 2GF0A 4RD0A 3N2EA 2ERXA 4IKEA 2LKCA 1T0JB 2AX4A 3ZIAD 5EXPA 1U2RA 3CR7A 2EYUA 4JVNA 4LJ9A 2JIZD 3QENA 4D4JA 3GLGA 2IUSA 4PANA 4WAUA 1FMLA 4AIIA 3IO5A 5TARA 1VMAA 1RVDA 3HU3A 3SJBA 5HTKA 3E1SA 4AD8A 3EPJA 1M6NA 2X19A 1DE0A 3K0FB 2FA9A 1X8LA 4M2LA 4ITRC 3ADBA 1QHIA 3QF7A 4GMDA 3MLEA 4A0FA 2RGCA 4XVUA 1FPMA 3B5JA 5G41A 1TPZA 4Q9IA 1BKDR 4TL6A 4MRSA 1DAKA 3KX2A 4Q1AA 2JLSA 5L3SB 1OH7A 4Q1CA 3QKUA 4IVQA 2ZSFA 5FUXA 5B64A 1D8TA 5KTYA 2R2AA 1JBKA 2G1KA 3QXXA 4UNSA 2JDID 4Q1EA 4CEHA 3AEZA 2V55B 3TSWA 1T3LA 3PV0A 4ZCLA 4AYTA 3SBDA 4M1SA 1Q0UA 3MGCA 2W58A 3OIUA 4B6EA 4LYJA 3I62A 2LWIA 1LB1B 5F9FA 1Z0IA 5JWRA 1GRNA 4LHXA 3KQNA 2PX3A 1YZTA 2Q21A 3I3SR 1G8HA 4D4KA 3VQTA 1KI4A 2CE2X 3QG1A 1HURA 1W49A 1E9BA 3SU8A 1NJFA 3NKVA 2H57A 5TVKA 4IDNA 1R8QA 3GFTA 2FEOA 3NVAA 3OEHD 3TMKA 4LHYA 1KI6A 1XD2B 4B35A 1CR1A 3EWAA 2IYSA 3ZZUA 3TLXA 1S0UA 3KJEA 4OQNA 3GLFE 1OIWA 4G5OA 2QQ0A 3QXCA 1A1VA 2WWIA 2GJKA 5DH9A 5FL3A 3DM9B 1FW6A 3TW4A 2HLDD 3MUFA 1E2MA 3Q8XB 4TSFD 5TDHA 1JNYA 2ODWA 4B3GA 5D3MB 3GJ8A 2V7QD 1GL6A 3FWYA 4I1VA 4CZ2A 2N1BA 4OI4A 4W9MC 2OBNA 2FJUA 4KJZA 4QJ5A 2BBWA 2ZS7A 2BJWA 3IPYA 1HQYE 1KY3A 1KKMA 4LJ7A 4BFTA 1E1QA 2CCJA 4JSTA 4MYCA 3Q72A 4KI0A 1M7GA 5AUNB 1E96A 1D2MA 1F2TB 2NZJA 4Q4JA 3GLIA 821PA 2J0SA 4GZMA 2ZRLA 3CUEF 4AG6A 1FZQA 3FMPB 5AJZA 3O8BA 4KSCA 4DLWA 3EWSA 5JRZA 3TH5A 2V6IA 3BB4A 3GJ3A 2QAGB 2WAXA 3NEJA 1N6RA 3IQXA 2PZEA 3I8XA 5K8IA 3HR7A 1XXHA 2VBCA 1VYUA 4JS0A 1YRBA 2OSBA 3T12A 3LD9A 1E2EA 5CIQA 2ZU6A 4ASUD 4XOIA 2XSZA 2Q6TA 1II0A 4HZUA 3PFIA 4CEJB 2ZE6A 1U81A 4L15A 1G7TA 2FMXA 2VO1A 5KUTA 3FHTA 3VAAA 5HKKA 4RD1A 2Z43A 4JBYA 2WVJA 1COWD 4L4UA 5FTLA 3ICQB 1QBKC 2IYTA 2GCPA 2PJZA 4HB3A 4JLJA 4NZYA 2PX0A 4A9AA 2DPXA 5GVSA 5KDOA 5E7IA 4URVR 2VRWA 5KOYA 5JJKA 4QGAA 4URZR 5CJ2A 1R0WA 4EJSC 1XEFA 3CB4A 3FKSD 2P0EA 3RSLA 4C0LA 3ZVMA 1O87A 2QE7A 3F3YA 3P1JA 2CCGA 1GRRA 3R9WA 3R7WA 4PPFA 3NH9A 3KJHA 4B2IA 1AGPA 2W6ID 3FGNA 3QPVA 4F92B 1OV4A 5KHOC 1PUJA 1WF3A 4NL4H 5J4HA 1P75A 1W0KA 3REFA 3G0HA 5DI3B 121PA 3QXSA 1A4RA 2CEAA 3CO5A 3CZQA 3Q5DA 3K70D 3I1FA 2A78A 4PSVA 1XD8A 2A2ZA 1S96A 4PQYA 1QZXA 3V4RA 2W6IA 2VLIA 3AP1A 4XJXA 3TGPA 3CONA 3KQUA 3GFPA 3K0AA 2HT1A 1FQKA 3NBZC 4US2R 4P0TA 4IDHA 5FOWA 1W7AA 2LCFA 5IT5A 4PTLA 3EXAA 1ODFA 1BOFA 1QHXA 4DLZA 1OYWA 2BOVA 2VA8A 3I72A 3CF6R 2B8WA 2IXFA 2ZRNA 3I92A 4LJAA 2F43A 1WE2A 3CPEA 4JVMA 4TLBA 1GZSA 5BWMA 1K5DA 1GKYA 1JR3D 3MFYA 1Z06A 4ESVA 4I99A 5H68A 3FFBA 2HUPA 2RCNA 1DAFA 4P4UA 3IPXA 2DR3A 1XTIA 3B1YA 4MYTA 2JLVA 2DFTA 1DVRA 3TSZA 3WYGA 3K0CC 4IRUB 1FNMA 2GXSA 1IY0A 2CK3A 3TKLA 4RFSA 4DKXA 5J4VA 1E9AA 1U94A 3HYRA 3RS4A 4HUTA 4R9UC 5B30A 4DZZA 2WWGA 2PJRA 1N6PA 3BK7A 2VSFA 3B1XA 5FI1B 2WV9A 4CT5A 2GXAA 1IJEA 1D2EA 1NG1A 2D62A 2EFDB 4MGZR 4AURA 1P2SA 2ODEA 3C16C 3UMSA 4DSTA 1Z2CA 5J4LA 1CR0A 3MAAC 4BASA 2VP5A 4TL7A 4FINA 5E3HA 2W0SA 1OXXK 1G8FA 3GLHA 1VCOA 4NE2A 4RVCA 3VR4A 4DLRA 5AJVB 4BLRA 5FBRB 2V7QA 1GRQA 2ZUBA 4TSFA 1TADA 1KSGA 3H86A 1KMQA 4LY6A 5A0FA 3VHXA 1E0JA 3V9PA 4RD3A 4YXWA 3NTUA 5J40A 1IN5A 4TMXA 1GSIA 3EX7C 5A4JA 4G5RA 3K0CA 5FPTA 4ZDWA 3UWOA 1JI0A 2BHRA 2BKUA 4JLKA 1E2NA 1KSJA 4UNPA 4RZUA 1KAOA 1Q1BA 1XEWX 1ZNZA 5BW8A 5HR5A 4DEYA 5LDDC 4KU4A 3OAAA 4R2HA 1TUEA 2GZAA 2J46A 3CRRA 3EA0A 4ACBA 2J7KA 2K5UA 4PX9A 1KO8A 1Z6TA 5LD2B 1VCNA 1P60A 1EWRA 4Q1BA 1JJ7A 3A1UA 2QAJA 5FPSA 2AXNA 2QY9A 1XP8A 1GNQA 4UXIA 2VF7A 4GPTA 2EWVA 2A5FA 4XWOA 5JRJA 3CIOA 3KJIA 4UJ3A 1H65A 2ZI4A 3LQRA 3NIBA 3O8RA 2ZSBA 3MCAA 3UKDA 4OHZA 3IGFA 4PC1A 1X3SA 3DL0A 5FUVA 5KSYA 4JZKA 1N5LA 1KMHA 4KYUA 4RD6A 3GP8A 1ZNWA 4B74A 1S9DA 4BLOA 1U90A 2YWHA 3FDIA 4LBVA 2OCBA 3RHFA 2IYQA 4W5WA 1KDTA 2ZE5A 4D0NA 4WXRA 2EW1A 3MMPA 1NVVQ 1YZQA 2A7QA 4JLDA 3GLIB 4IVPA 2QA5A 3U2QA 5DO9A 2IF2A 2BBOA 3V00A 4GP6A 5E7JA 3UK6A 4I81A 3VX4A 2PCLA 3X2SA 1G4UR 3GPLA 2JCSA 1E6CA 1ZVQA 1QHNA 4FN5A 3EARA 4LDJA 1N6OA 1N6NA 1NLFA 2QU8A 3JZMA 4V02A 1RYFA 4YONB 3ZD6A 4C0SA 2ODNA 3QE0A 1NY5A 4PO1A 4XVQA 2C96A 1NMYA 3FOZA 2NPIA 2VL7A 4KLZA 1Z0KA 4KFSA 4TT3A 4WXPA 3AQ4A 3HDTA 3JVUA 3K0SA 4BZXA 2DCUA 2X77A 4MKIA 5AR1A 3KB1A 5G53C 3ZIAA 4PAMA 3EW9A 1JALA 2DY1A 1J90A 1W4CA 3MG9A 4V0MA 3PUWA 1TEXA 3ZZ0A 3T1TA 1RJ9A 1Z28A 1UKVY 3C41J 1OFHA 4BRWA 1JB1A 1S8FA 1CF4A 2GEVA 1H8HD 3L0OA 3D7MA 4HAXA 3ZQJA 8OHMA 3WHLA 1NN0A 1WA5A 2JJ1D 1Z22A 2QROA 1I2DA 2RGBA 2WSMA 4OK5A 3RS3A 5JFGA 5KSZA 5FUYA 2J3EA 4XWAA 4EJSA 1YRAA 4ZV4A 3CR8A 1NKSA 1KI1A 1X1SA 4G5QA 1OF1A 1LVGA 1RRFA 5FL7A 1ESMA 4JVSB 2UVQA 4WVFA 3AKEA 1BS1A 3U60B 1XMVA 1LNZA 4LI0A 4DIEA 3D8BA 1NVWQ 3U6KA 1CR2A 3TUIC 2OILA 1HA3A 4D2IA 5EP3A 3K70C 3AUXA 2YWGA 5AK0A 3T35A 2ZJAA 4NYJQ 4KO8A 3T1QA 4B2LA 4B6FA 5J47A 3DZ8A 4CGZA 2C9YA 2JATA 4B48A 4OQFA 3E2IA 1MO4A 3BS4A 3KFVA 1W36D 3LLMA 3IUYA 3DOEA 4LJYA 1XF9A 4M8NE 1LFDB 3NBXX 1E9SA 1N6IA 3C14C 1ZNYA 3MRSA 4IDOA 4OHVA 3FKQA 1COWA 5FTMA 5BXQC 4PC3A 4TN1A 4DT1A 1P72A 2GETA 2FPKA 3OIYA 4LYHA 3KKPA 1W44A 2WJGA 3CZPA 1U0JA 3BFVA 2GESA 1OXSC 1HYQA 5SZKB 1NBME 3FB4A 5K8UA 1WB9A 3K1JA 2BCJQ 4JLBA 1HE1C 5CK5A 1OT3A 1Q3HA 5B2ZA 1XCGB 1EESA 5LBIA 4PAOA 2YHSA 3W90A 1B23P 2QM7A 3TQFA 3SQXA 1FP7A 2HF8A 4JLNA 1NN3A 2FX3A 4U02A 5JS8A 3AVUA 1X1RA 4K81B 1FP6A 2W6JA 3CH5A 5BQ5A 1KJYA 1XJQA 3Q9LA 4B3DA 4MITA 1OFTA 4OI1A 3UG7A 4A2QA 2FEMA 1H8HA 5EE0A 5CDFE 4ILEA 1TQ6A 4M9XA 4JT2A 4EPVA 2ZRAA 3QXJA 3Q7QA 2WJIA 2CL7X 3DMNA 1Z5ZA 3L0PA 3TK1A 3U7FB 2R6FA 2OFOA 4JL6A 1E2QA 4DCUA 4NCJA 5L8VA 2GCNA 2ORIA 2WOOA 5JECA 4Q5IA 4IJMA 1NKTA 3OAAD 3BBPA 3R8CA 5DYGA 4D4LA 2XB2A 1ZCAA 1DADA 1OXTA 2GCOA 2V6JA 1NBMD 1E0KA 1G41A 2G88A 3BXZA 2C99A 5CITA 3NHBA 4O0MA 4TYNA 4H1UA 1DOAA 2MSCB 3QEOA 3WMFA 2EU8A 2J45A 1KMHB 5HZKA 1AM4D 2MMCA 4YDSA 3AGPA 2B7BA 3BOSA 1ZIPA 4LJ8A 4POAA 2QZ4A 4YMWA 3J81k 1WQ1R 3TRFA 1HY3A 3K0FA 4TL9A 1KI3A 4E07A 4FIDA 4EFMA 2YKGA 5DI9A 3ZLJA 2CDNA 2JLYA 2O8DB 4JYBA 1P2UA 1UKZA 4GNKA 2XAUA 5KNBA 1Z0DA 1YR8A 4XIGS 1G3QA 3KTAA 3VNUA 5EXSA 1GNPA 3OE7A 3WBKA 4EPYA 5FI0B 5KNDA 3QPWA 2OXCA 4GP7A 1VG8A 3B1VA 2EFHB 2ZJ2A 3SHWA 1W47A 3UMRA 4HATA 1I4DD 3MJHA 3RWMB 5CDFA 4GMXA 3WNDA 4A8JB 4D0LB 2C9OA 4ZKDA 3W5JA 3I5XA 4GT1A 4PZYA 1QVAA 1ZD9A 4WW0A 2PEYA 3W9YA 3NEYA 3FMFA 2NG1A 2W83A 1G3RA 1RFLA 1ZM4A 2YC4C 1UDXA 3U44A 4CRWB 5CM9C 1ONBA 1ZYUA 3K9GA 4PZLA 4URWR 1E2PA 1XXHB 1P62B 2GK6A 2JLZA 2J0UA 1YKSA 3C5HA 4M4SA 3LWNA 1W5TA 3PVSA 3LH5A 5ANRB 1IOZA 4M0LA 3PXGA 2OHFA 3VR5A 2JLUA 2Z4SA 4N3NA 4Q4AA 1D2NA 1HTWA 2EFEB 2NGRA 3VKHA 1NRJB 2D2EA 5D3MA 5EJEA 3F0TA 5G3YA 4QNRA 3KQLA 5DYIA 4HAVA 2H5EA 1BIFA 3RS0A 3ADCA 4MKGA 2A5JA 2WKPA 2Y8EA 1Z0FA 2R6GA 2ZRMA 4GI7A 4TLDA 5EQTA 4PQRA 2OE2A 3AF3A 3KQHA 4Z1MA 3TIFA 1AK2A 3B2EA 2FGJA 4ZDKA 2ERYA 3A36A 4A6XA 3MWKA 4A8JC 4ERNA 1WDTA 4HDOB 5F2EA 1PUIA 1R0XA 4EIWA 621PA 1PV4A 3JZAA 4TQ9A 4IFEA 1IY1A 5J4KA 4HB2A 1IN7A 1S3GA 1II8A 3NBFA 1G8PA 3UWKA 4DB2A 4CEIA 4GOXA 1FNNA 1S1MA 4UNNA 4OJQA 3K9NA 5TY0A 4Q03A 4A6PA 2JJ2A 4ACAA 4DLSA 3T1VA 3TSOA 1XB2A 4CEJA 4QFMA 2QG6A 5TB5A 3V4FA 4DIDA 3VMFA 2BWJA 4LBWA 1MKYA 3LVQE 3OE7D 4LPKA 3WNCA 1N6HA 2IEYA 1XRJA 2ZJ5A 2VP9A 2GVDC 1KJWA 2F1IA 3IBYA 2ZAOA 4C0HA 2D3WA 1XMSA 3ND9A 3AF4A 1GWNA 1KI7A 4YMUA 5IK2D 4OI2A 5FBQB 4DLXA 2F9LA 3QJYA 5EXTA 1TQ2A 4NCNA 3RABA 4QM6A 1Q57A 2CNWD 4DC9A 5BYJA 4D80A 1W0KD 3K9HA 5DLQC 1SVLA 3DKVA 4RKEA 3CLVA 3QI2A 4B32A 1YR7A 1E2IA 5EP4A 1U8YA 4TTRA 1PJRA 4DLYA 2Q9BA 4BWYA 4BZPA 2HJVA 4PC2A 4LYAA 3BIFA 2ZRBA 4JBWA 2NO1A 2CHGA 3CWZA 4C0AC 1LF0A 3CRQA 1G18A 1KDOA 4OL0A 1GUAA 2W0MA 2WKQA 4MGIR 4NCKA 4HLQB 1YZNA 2G83A 4G0NA 4KITB 2YYZA 3OF5A 4Q01A 4BFXA 2ATVA 2ZANA 4RFSB 5G40A 2JIZA 2BBSA 1BYUA 4FWTA 4X8MA 4QBIA 1Q44A 4I1SA 1FTNA 1E4YA 3NXSA 1JR3A 2FFBA 2AD5A 2GF9A 3R8FA 4D26A 3L0IB 2HCBA 4G1UC 5FPYA 3KB2A 2NTYC 2NIPA 1G64A 2FF7A 2PCJA 2DFLA 1OLOA 1KO1A 4OQLA 1AQYA 3CNLA 5GJVC 4B3FX 5IF9A 3SFVA 2O8EA 4ZKEA 5FTNA 2KSQA 3X1DA 2ZJYA 3LLUA 2ZSAA 4V03A 2UZIR 5HCNA 2XXAA 2F9MA 1MABB 1F2TA 4Q4JB 4KBGA 3MWJA 1R6BX 1G7RA 2WPDA 1VHLA 1MH1A 2D2FA 4BFSA 1ESNA 4P3YA 3R20A 2IUUA 1EWQA 1FX0A 4ESHA 4Q4HA 1OPXA 1UEIA 2TMKA 3KXKA 1R5BA 2O8BB 4DBLC 3OIVA 1G7SA 3SDZA 2YJTD 1OXVA 4M1OA 1M34E 2Q3FA 2Z0MA 2GJ8A 4JJZA 1E4VA 4OYHA 2GKSA 2R6AA 2QN6A 3C15C 4DCNA 4CT4B 1OH5A 2D7DA 4LGMA 2IF0A 1XX6A 2B92A 4Q9JA 5E95A 2PBRA 3C5CA 1OH8A 3GEEA 3SYNA 1XD2A 3AGQA 1FL9A 4FMDB 1R8SA 1V5WA 3BFXA 5TXGA 2X8AA 2ZRCA 4PHGA 4TL8A 5FBVB 3S1AB 5EUQB 1LY1A 1KDRA 3FE2A 3PUYA 1XFAA 2N46A 1XMIA 3BH7A 3U3KA 2YVUA 2QRNA 3QBTA 3AF2A 1XNJA 2QENA 1E9DA 2ZU0C 2IA5A 4M1WA 1ZM2A 5KO2A 2NO9A 4QG7A 2QBYA 2HEIA 4GSYA 2WZQA 5DNYB 2AK2A 1JPNA 3B85A 2CCKA 1Z0JA 3Q3JB 3QG5A 4OI0A 4D0GA 3RS5A 1Q1ZA 1Z3IX 1ZUHA 2NO0A 3KFXA 1UAAA 1VG0B 2IS4A 3P20A 1KHTA 4FWIB 2Z4RA 5FPKA 1E9EA 1RYHA 2REXB 4JLAA 2QAGA 3H0KA 2GK7A 5KNCA 3L2OB 4XD7A 2JLWA 1QHSA 2ZETA 4JMPA 3HJNA 4KSBA 1T4GA 3IBGA 3M1IA 3PITA 2IWHA 3DPUA 3LBNA 4B3BA 5DISB 3KXIA 1E1RD 1TQDA 3NHAA 1KNQA 5J5CA 1RPZA 1TF7A 1DELA 1UM8A 2WPDD 1S4QA 2O8BA 1KJZA 4LV6A 2DHRA 1U8AA 1XPUA 3SI7A 4DCSA 3GLGB 3QSYA 3OFND 1UFQA 1SGWA 2QUZA 1NN1A 3HR8A 1C4OA 3ZVLA 2C8VA 3U3OA 4JL8A 4QKQA 4V0ME 1R2QA 1YU9A 1NLZA 1PLLA 4DUGD 1ZJ6A 1KK0A 4B2PA 1LW7A 5H1YA 3GLFB 2PMKA 4TZ6A 3I5YA 3EG5A 4FMCB 1QHHB 3EIQA 4HAZA 5JBQA 2J1LA 4EFLA 2QGNA 3G82C 4KVGA 4LPSA 4YLGA 4LJ5A 1W48A 1XCMA 1HEIA 4JVLA 2IXGA 1E2JA 2A30A 4P4SA 1EFTA 1G291 2BMDA 2YC2C 1ZU5A 3BGWA 2XTZA 2OUKA 2XOKA 1U98A 4ZCMA 1MO6A 1NVUQ 4UNQA 4DJTA 4DWJA 1J2JA 2C04A 4WZ6A 5JEEA 5C18A 3EPLA 4OK6A 5FR1A 2EQBA 2QMEA 3ND8A 5LPNA 3KQKA 3WMEA 1V43A 1UPTA 3UPUA 1Q22A 1OFIA 3AVPA 1AN0A 1E69A 1VECA 2XJ9A 4RCZA 5DE3A 4HLUC 5FOXA 1XU4A 3PEVA 4FI3C 4MA4A 5EXXA 4M1TA 2FV8A 1TU4A 4BPBA 4IDPA 2I4IA 1GFIA 5KSOA 2IYRA 5BN5A 2ZJBA 3PQCA 3TVDA 4M21A 2QP3A 2DYKA 3E70C 3KDSE 1G20E 3GLIE 1WBBA 1ZNXA 4FCVA 3GJXC 4Q47A 4M1YA 2AFHE 2VHJA 3QF4A 1NIJA 2UZ3A 2JEOA 3WRXC 2PEZA 2PLFA 4US0R 4B71A 2ZEJA 2IYZA 1M74A 3P26A 4AK9A 5AUOB 2JJ2D 1JQJC 1IXSB 4NBSA 3CNOA 4I4LA 3IIJA 1HH4A 4PPQA 1SXJD 3KTAB 1CRPA 4HDCA 2CLCX 1QG4A 1R4AA 3U3RA 4EPWA 2BMFA 2ZYVX 1ZC4A 4FXPA 4IOLA 2WMNB 3OEHA 4MUAA 5DHAA 4D4MA 1G6OA 2V8OA 3BE4A 4CEIB 4C0JA 4HYYA 4TWZA 2P6NA 1I2MA 2MSEB 1JQLB 2ZITA 3DZDA 3NBYC 1E79A 2CHQA 1ZINA 4XTRA 5K8TA 1IN4A 4NMMA 2B6HA 1SHZA 3GLFA 3S1AA 1PVOA 4DDWA 2Z5FA 3DVLA 4GZLA 5CLLA 4AKHA 3BWDD 1MOZA 2QT1A 4PXAA 4QJ4A 1GDDA 1Z63A 1KZ7B 1DS6A 1P3JA 1W5SA 1RRCA 2BEKA 2VHTA 4UJ5A 5FBWB 2VEDA 1VIAA 2B21A 3SQWA 1KOFA 1S1CA 1VCIA 1CR4A 1WXQA 4Q7JB 2WM9B 1W36C 1AS3A 4P33A 5M04A 5F98A 2AHOA 3OHMA 2H18A 2JLQA 4J0QA 4RD4A 1XJCA 2FSGA 1OB2A 3IKJA 1E3MA 4QL3A 4C3ZA 2ONJA 5EE3A 5FPHA 4NYMQ 4A82A 3NG1A 2CJWB 4BLQA 2D74A 2AWOA 4TMKA 4TQAA 4Z8YA 4N0DA 1VYTA 1FOEB 3P27A 2ZXUA 2BBTA 5FBLB 2EFCB 3HPRA 3X1XA 2OLJA 2XZLA 4QNMA 4ZIRA 4B73A 3AVVA 4GFDA 4AKIA 2UKDA 1Z6AA 3IIKA 4PHHA 1YQTA 1XTKA 4V0KA 2QQEA 1ZAKA 4NKRA 1K5GA 5JZVA 4YMTA 4MYUA 4DXAA 4EFNA 1OKKD 4Q66C 3TQCA 3QKSB 4AYXA 2ZJ8A 1VDZA 1HT2E 3FFAA 3X1ZA 1RKBA 1E0AA 2FFAA 1P61B 1CJMA 3DDCA 4Q1FA 3AVOA 4LV5B 3WYFA 4RFVA 4F91B 1CJKC 3QKTA 2G1JA 3CRVA 4G5GA 1KSHA 4MRRA 5LB4A 1N0VC 1ZM3A 3GCGA 1P4SA 1L4UA 4KVAA 2DWQA 1SVMA 3U4QA 1VKJA 4DDUA 2ZPTX 1XZPA 4C2TA 3UG6A 3AVTA 4BLSA 1E79D 1XTJA 2XOKD 2CLDX 3U61B 4TMWA 2FNAA 4PPNA 1DEKA 1TQ4A 3QNUA 2CK3D 1FTSA 3ZQ6A 4L9SA 2GXUA 4TLCA 2H8KA 4BGDA 1WBDA 1EX6A 4UXHA 4W5JA 4Q7KA 2ZI9A 2QRZA 1XTRA 1QHGA 1JJVA 1BMFD 2IHBA 5HZHA 4YQFA 1G8YA 4D82A 1T91A 4DVGA 1TNDA 2D4HA 2GBLA 2ZRDA 3SJAA 3ZZTA 2Q9AA 2JGNA 2CL6X 1MR3F 3PUXA 3EZ7A 2ZUCA 1AGRA 2ZRFA 1N2CE 2C2HA 4BRUA 3VR6A 4EPXA 1HT1E 4KLNA 1IQPA 1G21E 2HXYA 3B8HA 4PO8A 5KDDA 4GDFA 3PEYA 3THYA 5DIFA 2VSOA 3LQQA 3Q85A 1GKUB 2FE4A 3CKLA 4GBMA 4R2IA 1JR3E 1M7HA 1CRQA 2FU5C 1N0UA 4MQBA 1AIPA 4BLTA 3LBIA 2ONKA 3WXMA 4AY2A 4KBFA 1RE0A 1QDEA 2WSSA 4LJ4A 1K6MA 4IXMA 3FTQA 2P2LA 2YWFA 2FPLA 1M1YE 4MUBA 5F9HA 2ANCA 4O3MA 2QGZA 4L9WA 4PFSA 1CP2A 1OSNA 1ELOA 4OQMA 1LF5A 2BDTA 4JLPA 4KV9A 3SZRA 1NF3A 3PJRA 4M9ZA 4W7SA 1D6JA 4Q4HB 4LUCA 1IXZA 3KKMA 1JXOA 1Q12A 2VSXA 3NDBB 3RANA 4GRAA 1Z6GA 4YMVA 4Q18A 3NDPA 1DG1G 1UKYA 1SVKA 3QEJA 1OYYA 2A3RA 2ZSDA 1P6XA 1ZCBA 1Z2AA 3OESA 5EE9A 1EFUA 1H8EA 1YVDA 3K53A 3SJZA 2ANBA 1W0JD 3EASA 4Q9LA 4KODA 4MKHA 3BJIC 4AKEA 3THWA 4DCVA 5AUPB 1KK3A 2B7CA 3LDAA 1VPLA 2RGNA 1XXHE 2GA8A 5SZJA 3U5ZB 2GILA 1J8MF 2AKYA 1NL3A 2BIFA 2I1QA 5BYKA 2VP2A 2ZR0A 1BO6A 2J0UB 1GG2A 1OHHD 3PEUA 2ZR9A 3QUSA 4NYMR 4BE7B 5HKKD 4QGGA 1TL7C 1E2LA 1U0HC 3ONWA 3FYHA 1SXJC 5IDVA 3ZVRA 3HWSA 4KXFB 4BFZA 1AS0A 2R8RA 3U3MA 3HYTA 1OB5A 3FMOB 1X8KA 3T5GA 4F93B 4NONA 1F6BA 3UATA 3N2IA 1CXZA 3GQBA 1CS4C 4G01B 4BECA 4HDQB 1SHKA 5JSZB 3RC3A 4I1OA 1II8B 1U9IA 2ZRPA 4OJKA 3AVYA 4FW9A 2XTMA 1DTSA 2QTFA 2VP0A 1OH6A 1IJFA 1T9HA 2WHXA 2V54A 4P4TA 3VR1A 4Z54A 2V9PA 4A0RA 4DHEA 1G19A 3PUZA 5JCZA 5SZIA 5JCPA 1T5LA 4LHVA 3WNBA 3P4XA 3SBEA 4LBYA
chains in the Genus database with same CATH superfamily
5THKA 5IKEA 1TFUA 4M22A 4L8YA 1MEJA 1WMAA 2V8BA 4H7IA 1EG2A 2NTNA 4Y1EA 4KAAA 4RE5A 4ZYVA 4C43A 1VMKA 3NDRA 2XGMA 2D1RA 3CXRA 2OVFA 2J3MA 3W6PA 1JB9A 2B2XA 4PS1A 2RDMA 1UBNA 1P5ZB 3GDOA 5IK2A 3INRA 4ENRA 3CTPA 3Q12A 2AOVA 4LYYA 5HX7A 1E5DA 3P9PA 1TX4B 2YRWA 3DMYA 1BDBA 2RHMA 4LEIA 2AFHA 3I2KA 5EE1A 1WZNA 4RVNA 4KBYA 4Y0VA 3GFOA 5CNJA 1U3DA 4D9GA 2ONZA 1K5HA 3ADOA 1J99A 4NTZA 4F4JA 4CDGA 3DLAA 5T8KA 3K4PA 1VGQA 5K6AA 2FN4A 3HDVA 4X24A 2O8EB 1EX7A 1P1CA 2ZRKA 2Y6VA 3F47A 1JAHA 2RHOA 2HAEA 1E1NA 1T2AA 1ZSVA 5DN6A 3RVKA 4MUNA 1KMNA 3QFTA 4YT2A 1C7QA 1X2BA 1SUIA 2ZRIA 4D74A 1UFOA 4RYDA 2HYIC 1USVA 3V8BA 5GWXA 1W4BA 3UJNA 3O3MB 4CGYA 4C06A 2DC1A 1JQDA 4PR3A 5ULLA 1YK0A 3WVNA 2CE7A 1TLTA 3BORA 1B16A 3D4PA 4R3NA 1U3GA 4D79A 2GBCA 1TD9A 2YNMD 3T7SA 1M76A 1WMDA 5HVNA 1V5IA 2IS6A 2QI9C 1Y1PA 2WAYA 3GWGA 5DN6D 5TMPA 1SCIA 4H31A 5JWOA 4HQFA 2BKEA 1JXQA 2X9QA 3CVXA 4ARIA 2KMLA 3WL7A 4PLFA 4XJTA 4E03A 3Q3HA 1NSFA 1R8YA 4DRXA 3VHLB 2WAMA 1EIWA 3TDKA 1KPGA 2BMWA 3OTGA 2CYCA 4IILA 2BM9A 4MAFA 1OFUA 4K6CA 3L4EA 1T5DX 4WLUA 4B6RA 5H8WA 1KIMA 5JR3A 4BNIA 3MN1A 4ER6A 3RRZA 1BDIA 2ZDHA 3B3FA 4QXPA 4DBZA 1B14A 3NI2A 3TLYA 2G67A 4DFDA 1V47A 1MT0A 4BKOA 2FJ0A 3KBBA 5ADWA 2CWWA 1IXRC 3HFSA 1QH0A 2J5XA 2PKEA 2LKDA 4L2IA 2XZPA 2EWWA 3GLHE 3MB5A 2ODBA 2R9VA 3I1YA 1U31A 2WWHA 4XCXA 3K9BA 3SC2B 3GJ7A 4NBRA 2RK4A 2W90A 1XNGA 4FPXA 4S0ZA 3R8XA 4B8ZA 4CKWA 1GP2A 5IEJA 5JO9A 2H4JA 2KBEA 3SE0A 3C3AA 3YASA 4CIVA 1FFHA 2XXJA 1U6IA 3I61A 5BV0A 1X7XB 2OOSA 3ZHTA 4YMLA 3L0ZA 1ANKA 1CB7A 3AONB 1I4TD 4CM1A 1ZI8A 4DG9A 2EIHA 4UTZA 1U99A 4WBNA 1VKHA 1A96A 5KX5A 1Q92A 4X1IB 2QM3A 3ICEA 1O7JA 3JD4A 4IW3B 3C7TA 4BTVA 3WS7A 4C89A 4JJKA 1ZVJA 4Z8XA 5K0GA 1IVYA 3GH3A 1IZYA 4NBLA 5K05A 5TS2A 2FEWB 3H9UA 5KQLA 1I1NA 2Q0HA 3O3OB 4ETIA 4KMOA 3OQ6A 1QLWA 3LQ2A 4L0MA 4UTRA 3WB9A 3PNYA 1TTTA 1R5NA 2FZEA 1VE9A 4HP8A 1DRWA 4EJSB 1UKBA 4KXYA 3A4MA 2J8ZA 1G1MA 4A2WA 1ZZEA 4EM6A 2P1DA 2VHCA 2VPTA 3L18A 1KFCB 2H7XA 5L3RA 2HJ9A 2KHZA 5A0VA 1K7XB 1U9IC 2O2GA 1KBOA 4FD2A 2WSIA 3GJRA 4HB4A 3ANTA 4LXTA 3MBKA 1CIVA 3K73O 1DWUA 1BRTA 4UBKA 3R7NA 3VPGA 4BQRA 2ZB8A 2FDXA 2H92A 1IPEA 2HZBA 2WKWA 3ANSA 1JYEA 3BJRA 3PXAA 2BMEA 2C2OA 2QE7D 4PSUA 1JSLA 4R05A 5BW6B 3RFVA 4A27A 3QVKA 3I2YX 3I8SA 2RKOA 1O96B 4U39A 4DS3A 3R3WA 4EUEA 4XPZA 3RYFB 3NC0C 1XZGA 2ZS8A 4JP8A 3A1VA 5F9MA 3SSAA 3VHXB 1YZLA 2Q4EA 4FFPA 4O08A 3WGVA 1NP7A 2ZKIA 4BNJA 4FIZA 3H1TA 3RWBA 4DCOA 3CX8A 3CEMA 4PCUA 3BE6A 1N3BA 4WH0A 1VE1A 2WYHA 3VDRA 1RKQA 3SIPA 3A7EA 3PK0A 2RARA 5KKCA 1BXGB 2TMYA 2FG5A 2XXBA 1OXMA 1KNXA 2BGJA 1QE0A 3E8XA 3HP1A 4OD0A 3RTGA 1FFWA 5AOAA 2V97A 4DLKA 2DETA 4N0EA 2XT6A 4CLOB 5A71A 1JEDA 1V3QE 2QTWB 3W4JA 1C50A 3MCWA 3TTTA 4YJ2A 1ORIA 1IWOA 4ALJA 1B74A 5DHQA 1GR0A 1XRPA 5JE8A 1LWNA 2G25A 3GMTA 3K6JA 3PPWA 3H97A 1EE9A 4LZNA 3M6VA 2ATXA 2B36A 1DAHA 4W8GA 3SXPA 3I37X 1RHJA 5JQGB 3O94A 4EHDA 2GM9A 3MERA 2BSXA 3R7WB 4NXNB 1P1KA 3HK2A 4EL0A 4F8JA 4ND5A 4TWJA 5KNLA 3Q11A 5A7FA 3WWEA 1G5QA 4XDZA 3T7AA 3OLCX 1PR5A 2CB9A 2L0XA 1I4LD 1K8YB 3G8AA 1EK0A 2XWPA 4CW7A 1HE8B 2FPMA 1WCIA 3TZKA 1H4QA 1NMXA 2WJHA 5CPBA 5IT4A 2YY7A 3B60A 1OIVA 3RVSA 5JHHB 2BLNA 5ALZA 2YW2A 4XUDA 1F5NA 3UY4A 4E09A 1H0HA 3OOSA 5K0EA 4BNVA 4EEZA 5BVHA 1U8UA 4UPDA 1VPVA 2WMOB 4FE3A 3T95A 4KPGA 2J41A 4QXRA 4UEJA 2APJA 4RHUA 3A6GA 1J49A 4YCLA 4RTNA 3GNQA 2V6GA 4BNDA 3NBQA 4U2BA 1YDHA 4BAUA 1I3OA 3IILA 1X1DA 1E9RA 2H2GA 2J9ZB 3DKKA 3FVWA 1X7WA 2YXLA 3KLMX 3ELUA 3ESCA 3H1PA 3JARA 4GIBA 4WN9B 5AI6A 2WM8A 5DX8A 5EMMA 5HQTA 3OA0A 3EYAA 4Q7LA 4TXMA 2G76A 5KS2A 1Q83A 3U4GA 2WA2A 1QGED 2ZUTA 3IAS1 4Z9BA 2VYND 5GM1A 4HSEA 4TTQA 3PFBA 1L4LA 1RABA 3IP1A 1CUYA 1JIIA 3GT3A 3KUXA 4LOLA 1E2DA 3IE0A 4OPMA 5CYPA 3K5HA 1NFQA 3ETLA 1NR5A 2QRUA 4B43A 5JXIA 4WBNB 2JLAA 3GT0A 2BFEB 4U2EA 4FSDA 3CEPB 1ECFA 3GT4A 3H2YA 2BY4A 2DLDA 1CNMA 1L9KA 4HWPA 3WK7A 5IAKA 5BN4A 3A27A 2QMYA 4G1FA 2VYVA 4PAQA 2H7YA 4ON9A 3ET4A 3S8MA 2O3TA 3TFWA 4BVLA 3ZE2B 2CJFA 5SY6A 1PYGA 4CKXA 1H3EA 4HBZA 3DAGA 3S2ZA 2DHQA 3EZ9A 1ENPA 3RFTA 1DP4A 4V24A 3FYSA 4WLFA 3W04A 2I8CA 1U7UA 2KX7A 3FYUC 2AW5A 4JJ7A 4QPDA 4UM9D 2HLHA 4F0JA 4YC7A 3EBLA 1EFKA 1EFAA 3JWHA 1V45E 2IZ5A 1R0ZA 4IXNA 5CHYA 4H77A 5K0LA 5J23A 1U3UA 1F60A 1REQB 2GAFA 1SHTX 4PFKA 4N1AA 2EG5A 4MHTA 4IWNA 2A9JA 3URMA 4I5IA 2PUVA 3LLSA 1L8QA 3MQ4A 3P4UA 4XQCA 3BE8A 3P2MA 2ZW9A 3RM3A 4QQFA 3TAUA 1SKBA 2DEUA 1CBUA 1VA4A 3L4BC 3OJFA 2QMOA 2JFBA 2PYDA 4Q00A 3JQGB 5BT9A 4X65B 3EEIA 2O4CA 5ALUA 1BXRA 1SXJB 3BWBA 4C4OA 3HP7A 5EP1A 3HB5X 2ZLBA 3LO5A 4H7EA 4YV7A 1BHO1 3UB3A 3LWZA 1ISIA 1YQUA 2GJAA 3HDGA 4PC6A 4B76A 3T94A 6Q21A 1SO8A 3WLKX 4ILKA 1MD9A 4INZA 5ECYA 1BX0A 4OMCA 2CLLB 3D3QA 4Q93A 2QSZA 3F71A 4HUJA 3H4IA 3TNFA 1PK8A 3V3TA 3T1YB 3OQMA 1V48A 1RYZA 2PY6A 3H9QA 1UFKA 2E9SA 3LYHA 3G7SA 5IHPA 1IM2A 1L9XA 1L7PA 2NTEA 3GRCA 3V3KA 5CGQB 4F6RB 2O1SA 3KZ1E 3M4NA 2SCUB 4PNEA 1ZBDA 2RGGA 3E9CA 1CSEE 1J5EB 3LHKA 5F1PA 3JQ7A 5LN1A 3H5RA 3VZCA 1ACJA 4YBZA 1MRZA 3ZNOA 3ER9A 2EJUA 5CEFA 3V1NA 2QKYA 3L8CA 2ZTSA 2PLNA 1IN6A 1UDWA 2C4MA 1GPJA 1T5HX 1NW7A 3MS2A 2RAPA 4LGYA 3L9XA 2UVPA 1CG6A 4N5NA 2W22A 3RVMA 2X2EA 3PGLA 4II7A 4E31A 2PUCA 4WTOA 1J21A 2R00A 2GVNA 2W2LD 521PA 3QPDA 3CF4A 1GTVA 2IKQA 2K4MA 4R2LA 1EKXA 1Z6YA 4QYTA 4UZFA 5BSMA 4PYOA 1VJ5A 4QHTA 2JGRA 1K97A 4X54A 2IFTA 4ARSA 4C2BA 4D98A 2A3NA 3HYSA 1O08A 4HDNB 4G09A 3P2KA 3QX9A 4HNVA 1T4BA 3DFZA 2O3UA 3WIUA 1GFZA 4BDTA 4ZU6X 2IYYA 4C88A 3NBAA 1C8LA 1XPOA 1RC8A 3NLLA 3R3YA 2HMVA 2R1UA 3QBVA 4MZDA 1FMCA 2ZAIA 1QFXA 4DLNA 1WCV1 1ZM7A 2XA2A 3LZDA 3ZXIA 5JXGA 1USGA 3GEMA 4OY3A 2HK7A 2BFAA 1L8OA 1OXUA 2FOIA 3B9BA 3AM1A 1CS0B 1R7RA 4TTJA 2O8CA 2OXEA 5E6SB 4F9TA 2AVDA 1YCHA 3QKWA 1B0UA 3A1WA 2XD9A 4TTTS 3WKBA 2W2NA 1H2FA 3A1TA 4FHGA 4REQA 2NVWA 1TA9A 2DQZA 3QPBA 4TXNA 3CKYA 3FW1A 4ZI3A 2HCJB 3H1BA 3PD1A 5CYOA 4D57A 3F7NA 2LTAA 4L16A 4GWLA 3VYVA 4TGLA 4Q4LA 1MDBA 4XR9A 3PIIA 1RI4A 1JHAA 4MS1B 5LDHA 1DAIA 1S3SA 3KYIB 3AFHA 3R6DA 1JU4A 3WJ1A 5JBNA 2UU9B 3ABSB 4OJTA 1CUFA 4GLJA 3BEDA 3ZEAA 4QT4A 1LS1A 4BFUA 2VDRB 1PJBA 3OMLA 2AMFA 3P9YA 4MRMB 2GAAA 4ABTA 1Q91A 1UEXC 1Y3IA 2CUTA 2NTJA 3B20A 4N47A 3RKRA 3V7WA 1FBNA 2OAQ1 3HCCA 4OGWA 5F5NA 1BVHA 3UMGA 4XCVA 5HJ5A 2Q6VA 1ATZA 1NLUA 1SQ5A 3PC8C 1CUCA 4FI3F 4EVQA 4GYYA 1KFBB 4L0CA 5AQEA 4YAFA 4YRBA 1Z16A 2VDWB 3BMQB 3H2GA 3IIMA 3ZHVA 4PZZA 2A0YA 1A5TA 1CTQA 3NIGB 1QAQA 3PCRB 1YFKA 4R2XA 1T8YA 4WXYB 5F7XA 1LDNA 1XZJA 3A4NA 4YXWD 5JCOA 2FVYA 3Q40A 3DAFA 3RBVA 4R69A 1C1DB 5CA0B 4NV0A 3MOIA 4G6ZA 5IDYA 4PXSA 1BC5A 3R6WA 2CNOA 1FU7A 2CL5A 2OM2A 4O02B 5B55A 3F1KA 2C57A 3L7NA 1FVFA 4EO7A 2LGJA 4RABA 1S7GA 1CF2O 3B6JA 1ZD2P 4IVRA 5G4KB 5LXTF 1R9MA 5SY9A 4F4UA 4TVSA 4C0XA 2YZMA 3DKPA 1GAJA 3OE4A 4QM7A 1IN8A 4EHIA 3IDQA 3RRYA 1V2HE 1CUEA 1M2OB 2EZ9A 2XBLA 3ENZA 4FMPA 1XZDA 4UUNA 1RP1A 3L01A 3F97A 3OM9A 3VZPA 4I1IA 1IHUA 3UMMA 1SOWA 1UPXA 2W6QA 3CX6A 3I3OA 3VU9A 4ZHQB 1PR2A 1C41A 1XAHA 4LYDA 1EFCA 1T4CB 3MJFA 1U0LA 2JGMA 4QARA 3QMWA 4OHMA 1R4ZA 2P5UA 5EUMA 3V2UA 3EOZA 3THYB 5ALSA 2XRMA 5TQ2A 1VG9B 3FTPA 2IITA 4LOAA 5BW4A 4PSKA 1XK6A 1QFYA 5E38A 3ACBA 4IGIA 4LJRA 4MPPA 1G2PA 3HJRA 4P31A 1TAUA 1VCHA 1YRQA 3I2HA 1WMSA 3OT5A 4PGAA 4DE5A 3CBQA 2G40A 1PZEA 2P65A 2ZUDA 4MW4A 1R5JA 1ZQ9A 3EIUA 4HAYA 2X2FA 4PTZA 4RKFA 4HUQB 1X38A 2PRSA 5FHRA 1JFFA 2RFLA 1FQJA 3THXA 2JFPA 4DV1B 3R41A 5IPFA 1KEKA 3GJ0A 1FNDA 2OFWA 1X94A 2ZYUX 3FRIA 2JIDA 1DJLA 4WSOA 3ZXYA 6CHYA 1IONA 1UEJA 2FZLA 2RB4A 4MAAA 4CVNA 4LC0A 4NCHA 1JECA 1W75A 1NU6A 2EKDA 3A9CA 4O2AB 1M2NA 1OFUX 3TBFA 2ZUVA 5KOJB 3IALA 3LBHA 1QQAA 1CJUC 4ZALA 3MGAA 2DHEA 4FJ0A 4W6QA 1GITA 4J91A 1IZ0A 1PHRA 7AT1A 1XNRB 1J8YF 5E7MA 1B8UA 2IUTA 1Z83A 2J5QA 4NPHA 1PN3A 4AVYA 1TEVA 1Z12A 3QVTA 4BEJA 5JSZA 1CQWA 1ZJ5A 1IIRA 1SUSA 2AOTB 2HQOA 1A2KC 3RUPA 1AU9A 2XIQA 3LUPA 1G16A 3IMFA 4NI5A 1W25A 1ZSYA 1RYBA 1F2UB 2AIRA 4FZVA 4LVNA 5HBGA 5IM5A 2XJ4A 4AXBA 3K30A 3T1OA 2IXBA 3GC6A 5JARA 4W5TA 1DARA 3A10A 4GP9A 3BF7A 1O6GA 4L5JA 2RBEA 1PLKA 2K2QB 2A5DA 4MWGA 1NXPA 1CJTC 1U5BB 3DEZA 4FDAA 4M7WA 4UE6A 5I9LA 4AQYB 2WKRA 5FR2A 3ZY4A 1H4TA 5U9CA 2W2OA 2XD4A 4RADA 1WP9A 1ZC3A 2I54A 3K71B 1T3HA 1BMFA 2BEVB 3C6XA 3I6YA 1S8AA 3A9SA 3EAQA 1ML3A 3PEEA 4F2PA 1JEYB 2HY7A 4LF7B 3DF9A 3KXLA 3KKNA 1GZUA 4ZC8A 3WP1B 2HA5A 1SBTA 2CBXA 2P7HA 4JI5B 5FTJA 4Z0PA 4G4SO 5DGDA 1ULTA 1PFYA 1W5EA 3G1WA 3I5UA 2GRAA 3NBUA 1GN9A 3USES 4X94A 4JLOA 1JHOA 3GFBA 2HHHB 3RC9A 3T34A 2GTPA 3AF1A 4FQ7A 1UADA 1DOHA 3EA5A 1RS0A 5LP6F 4LHZA 1UK6A 2YS7A 1EQ2A 1RQGA 2OT3B 2VH5R 3B3JA 5IFLA 1UCFA 1EI9A 1YCFA 1B8NA 4RY0A 1RCUA 3U7GA 2CEKA 2ID8A 1W5AA 5M2QA 3D4OA 5EFZA 3T4UA 5BQ3A 3PPXA 2O6LA 5K51A 1KDVA 3CCBA 1KVQA 1DG9A 2AB0A 3E2PA 3H9JA 3NAQA 4LC1A 4MVJA 3WG9A 1RZVA 2VPZA 3WAKA 3H6KA 1QYRA 3QA3E 4UAGA 1KOGA 5HQJA 1IM5A 1CUVA 1PR1A 5FUWA 1DIAA 3RFFA 1NXXA 4AZ0B 1TVKB 3E5HA 1CUSA 3TZCA 2JIQA 1I51A 4NU0A 4B09A 4K9DA 3A8TA 2EL9A 2CHVA 2HF2A 2HOQA 2EERA 3W5HA 4F2DA 1U0EA 3DOIA 1LI5A 1P39A 2XTAA 2PSSA 4PIPA 1BU5A 4QFDA 4YI5A 1HG0A 2B94A 2XHZA 1JHRA 2PPLA 4MVJD 4U6QA 3CRMA 4UU1A 3VBEA 5BOSA 1UIMA 1BE8A 1YBHA 1Z5WA 2R65A 1FDVA 1YJBA 1EGQA 2B1JA 1DEAA 4NECA 4Q02A 1R1DA 1ONNA 3VH2A 5I6DA 2FYTA 2XYRA 2D59A 3QWAA 4NZZA 1ZRHA 4YV2A 1G6HA 2WTMA 2YNMA 4R41A 1WRBA 1J06A 4UBOA 5BSTA 5CBPB 3U9LA 2P6MA 4KK4A 5MFPA 5LZ7A 1QFMA 2NVUA 3O93A 4IHJB 3FHOA 2EZ8A 4CYMA 3AETB 2W2VA 4J2HA 5LWHA 3MWDA 5JEDA 4LRQA 3DTYA 4PZ0A 2JVKA 3ZH9B 4BHTA 3GJ4A 4KXQA 2BKLA 2ZYSA 3QU9A 5D5HA 5DGXA 3LECA 4WWHA 4QPNA 5C34B 3UUWA 1AK9A 3RCBA 1FA9A 3NS7A 2IOYA 4J9VA 1UK9A 3F1LA 3SC4A 5JJCA 5SZHB 1JWAB 4HMQA 2J4DA 2ACVA 2ID9A 1SVIA 5H83A 4IUDS 4WXEA 4XE5A 1AO0A 5IVHA 4H4CA 1J2UA 3ETGA 4D3XA 1UZAA 3NV9A 3TOCA 4HWRA 2DFNA 2JH9A 1DWQA 1W8DA 5IYZA 5JCJD 1KO7A 1X42A 2GD2A 2E1RA 2QNIA 3DHEA 5AWFC 1RCTE 5J5VA 1I4WA 3W8NA 4M1MA 5A5VA 4CMEC 1L0BA 4J0JA 5CURA 1G9XA 2CUNA 2Q1TA 2G09A 3TR5A 5CFMA 1XQ1A 2DULA 2I7DA 3G2QA 1KWGA 1E6KA 3CB2A 4JI1B 1U0RA 5DLYA 3AUFA 1ZGZA 4Z9XA 5DHRA 1PTJA 5EZQA 5AJWA 3RVQA 1P2VA 3DSRA 4RNCA 3PE6A 1LNQA 2P3SA 2FGKA 4FMBB 4PO3X 5A06A 5JD6A 3HBLA 1DC7A 1KC3A 3IUMA 4BQSA 4YN3A 3RU7A 3D6HA 4HVCA 3OICA 1KEWA 3GRRA 1KRXA 3E9ZA 2ZYHA 5BOSB 5FQNA 1Z6QA 2PL3A 3GLUA 1O94D 3TDMA 2P5TB 4OXQA 5EN4A 5B37A 3BB3A 4W9NA 4PXYA 2PIDA 2VN8A 3UENA 3I2FA 1HI9A 4B75A 2VF2A 4WBXC 2L82A 3FNIA 2XX3A 3BX1A 3TR6A 1FFEA 1W1WA 2H5LA 1AGXA 3KKOA 1M1YA 3MSXA 4G89A 4WFQA 4BVJA 3GD7A 2XSZD 3RTBA 4L8FA 4C4XA 4CL2A 3PXBA 3VR6D 4GUDA 2EJBA 1ZCJA 3MELA 4M7RA 4P93A 5F73A 1G5PA 3WO0A 1EMDA 2PU5A 1CFZA 2POCA 3DOUA 3LDHA 1Z68A 2VQSA 3SR4A 2QSYA 1JILA 2GZSA 2XECA 4OAOA 1PFUA 4H2DA 1NBAA 4E4TA 4XH9B 3V8EA 2VTKA 3ENNA 3LGXA 3HY6A 3W8RA 3ITKA 4ZCSA 2GUGA 1BE6A 3HS3A 1MRNA 3VR3A 1RD4A 3T3OA 3IAAA 4E13A 1M7BA 1U7HA 2FFHA 3IBSA 2FRVA 3TINA 1SY7A 1UBKS 2HJGA 4U9IS 4NR0A 4KXMA 5AH0A 5HUHA 3GOHA 3UXMA 3ZV3A 2XZLA 1DINA 4LV8B 2ZUSA 1S3FA 3L7YA 3ZTYA 5CAEB 1GCGA 1TT7A 5IYZB 4XI9A 3F78A 2QTLA 4LNUA 3ZWKA 4D5EA 5CAEA 3VSAA 3FPAA 4JASB 5ALOA 4YUVA 1XLWA 2GHIA 2B5WA 2QTVB 1FJXA 2ZFUA 3KWJA 1WMFA 3TQHA 1Z07A 4DCMA 4F9FA 1KSFX 3L6CA 5JYCA 1JVSA 3TL3A 2VRBA 3DL7A 3BZWA 2CFRA 2VF5X 4KFUA 2HA0A 4PSAA 4RF2A 3GRVA 3RUCA 3VR4H 4ZOAA 2WHPA 2VQEB 4MIEA 3VMMA 1QQ7A 5ALVA 3T61A 1LK0A 2VDUE 3D8UA 3DWGA 1YUBA 4LVOA 1IZ8A 1P7VA 2DY0A 2PGDA 2IUFA 2VPPA 3DDUA 4IDQA 4ZCPA 3RK0A 4UOZA 3SYKA 1UBEA 1FIUA 1CEYA 1X80A 3GBSA 3LVBA 1GSHA 4JKYA 5AVUA 3P0FA 3JY6A 3OC0A 2HK6A 4YGYA 2JK0A 4RY8A 3T0FA 3GBVA 5JSHA 4DJDC 3LF2A 5DIZA 2C2WA 3DT9A 1VBMA 3QK7A 1GTJ1 3FGZA 3PFWO 1F14A 2BGRA 5J2UB 1TT5A 1R88A 2ZYWX 4HF7A 2WYWA 4EH1A 3C8MA 4YJ3F 4AF8A 1TMKA 4RSGA 4B33A 3BTUA 2M2IA 4CF7A 1TUBB 2EW2A 2UXCB 3HCAA 5TLSA 1E1RA 3ZPXA 1SOAA 1VE7A 1MAHA 1XEWY 3DO6A 4O2LA 4YAJA 1CYDA 5ALMA 3IQWA 3I12A 3S44A 1D4OA 1ACMA 2NNLD 4OATA 4TVKA 2A1UB 3TW6A 1YIDA 3TXAA 4L1KA 1XHLA 3HJTA 2ZBRA 3ZHSA 5EWJB 1ZUNA 2IC5A 2ZUEA 4JBGA 2AD1A 4PICA 4OFBA 1CULC 2OG2A 1VHQA 4I0WB 4PO9A 5HA5A 3N6RA 2VDMB 4UULA 4GYKA 4DXHA 2OMKA 2YOFA 1Z8DA 4HUQA 2VATA 4AW9A 2BZSA 1O0BA 1M0EA 2ZJOA 3CX3A 4Q34A 1DQRA 3K05A 4W8OA 1ILEA 2WTXA 1XZHA 2BAGA 1WL8A 1OU4A 1TJ3A 2XNSA 1J9ZA 4NZOA 4EATA 2R47A 4Z7JA 2IELA 2LCIA 2PQ0A 3GMDA 3OFNA 1Z56C 3NTXA 4HX2A 4RW0A 4D25A 2ZI6A 4Q4AB 3HZOA 4UQOA 1G2IA 2YWCA 3I4LA 4QAJA 3VR3D 5DNVA 5LSAA 1E7RA 1W2HA 1XDBA 3IT3A 4R1QA 5F1OA 5KTRA 4YP0A 3T7EA 2B5VA 3HHPA 2Q62A 1PZXA 5CD9A 3EVFA 4EJMA 2O8NA 2ECFA 2AL7A 3AWDA 3CW2A 3K8YA 4G0MA 1YFJA 3A4VA 5BSRA 4HPXB 4BUCA 3GJ5A 3ND6A 2BEUA 3A37A 3DLPX 4HX9A 4CMAA 4DDVA 5GJBA 1N3IA 1J07A 1M6EX 2ZIAA 3FDZB 2B1GA 1W1IA 4MRNA 4NSNA 5DW0A 4TV9A 3L4JA 1VOTA 3H9GA 2GS9A 3BM5A 1HNNA 4PBSA 2C78A 3I5AA 2HXSA 4IWYA 4UMDA 1I0ZA 2YOHA 3R7SA 3PEWA 1VPTA 4G0UA 1QB8A 2J3LA 4DR2B 16PKA 3GT7A 3HEMA 3LTEA 4W5OA 1WXHA 4IZIA 3KD3A 4IX1A 3OCYA 1QJ4A 3Q4GA 2TECE 2YWXA 3BPSA 2AX4A 2WJAA 4B5LA 1CK4A 3CR7A 5JMOA 1ABBA 1L8XA 2EYUA 5E7QA 3ISJA 4CE6A 3IVMA 2CFTA 4R8RA 5LKAA 3IO5A 3PZBA 5TARA 1K2VN 1VMAA 3HU3A 3SJBA 3TRHA 4AN4A 3EPJA 2D1YA 3E0XA 2B25A 3HB0A 3VKVA 3M3DA 4UEOA 2X19A 1DE0A 3K0FB 4GPD1 2VK1A 4M2LA 3GEDA 2A9VA 4ITRC 1QHIA 3UGQA 3UOWA 4LJKA 1ZJJA 4EECA 4ZHQF 3ADBA 3VJRA 4BKPA 2B2CA 2IZ6A 3BGDA 2QGFA 2GPYA 2RGCA 3C5EA 1IH8A 4D97A 1C9YA 2FR1A 3C70A 1DRUA 2B1IA 4HADA 4M1EA 4RVHA 5BR7A 1VPWA 4L3VA 3EAFA 4J16C 4EYSA 3PNSA 4IVQA 3WGUA 3FPKA 2PU7A 2ZWVA 4EW2A 4ZCRA 2QRQA 1NI5A 4EUKA 4EYOA 5KTYA 2XH8A 1UP6A 3JQFC 1JDNA 4PYKA 2JDID 5KNCD 3AEZA 2V55B 4E5MA 1PKEA 1HG1A 3MINA 5DM4A 4ZCLA 1D0SA 4L4RA 5TQ2B 2PVCA 3LQ4A 5A5GA 1RXIA 1KAQA 1PT6A 5TE9A 3RT1A 3WLSA 2K7FA 4Y2HA 4V3BA 1LB1B 3T7IA 1Z0IA 2SECE 3ET5A 4RYLA 3ZV6A 5T4FA 1M1UA 1U4SA 5BNWA 1TZ2A 1EHIA 1ODIA 4A5OA 5J2UA 1F7UA 2PX3A 2O14A 3NORA 1ZONA 4KGVA 1SCKA 1QK4A 2HJWA 3BKXA 2GASA 3SHWA 2QQ5A 3R44A 4A26A 1B15A 1KZ6A 1NUQA 1E9BA 1JP7A 3MJSA 3FYUB 3P97A 4IDNA 2VUHB 1DC3A 2W98A 2ZXFA 1AUQA 3NVAA 4PINA 4TKUA 5JU6A 4AT1A 1FFAA 3Q10A 2P62A 1XTZA 1U5BA 4IR7A 4YQEA 5CDTA 2I6UA 3C7AA 3LKDA 1XD2B 3D8NA 5EWLB 1PTKA 3OWOA 4CFSA 3RAFC 1G21B 4ZGBA 1ISPA 2XMGA 3KEQA 3LC1O 2IYSA 4NZNA 3ZZUA 3N8KA 2Q6LA 4OQNA 5KEIA 1KYVA 1F51E 1LBQA 3G8YA 4U2DA 2OBFA 4N5IX 3CVYA 1JX6A 2QJRA 5FL3A 3DM9B 3TW4A 2V4UA 5TDHA 3GJ8A 4BQIA 2GQ0A 4KRYA 1WTCA 2VPYA 3IRUA 3OQPA 3H1AA 4N65A 4BO9A 2P1ZA 4O5OA 1NASA 1A8IA 1UWLA 1JVNA 2FJUA 1YJAA 4KJZA 3DUWA 4FFBA 3A6FA 2ZS7A 1ZMRA 3RARA 1ZESA 3IPYA 1KY3A 1GO2A 4XUEA 2WY2D 4BFTA 5EHGA 1IYZA 2IJGX 3M3HA 3ZK9A 1M7GA 5A9RA 4ENSA 3LIPA 1P29A 821PA 5I7WA 4Y8VA 1F1BA 1WSDA 2F4VB 2BZ1A 3AVUA 1DJPA 1FZQA 1M2VA 1OFGA 4R54A 4OLHA 4ENWA 1CHDA 1OWNA 3TGLA 3CFYA 3NRCA 4F4FA 4YLYA 4FT2A 3VPSA 4CWAA 3U80A 4YCAA 3Q5GA 3BVPA 3WL4A 2W6ZA 5L6LB 4JODA 3BB4A 1HF3A 2P5YA 3H6HA 3MXOA 3M70A 4QUAA 4FWBA 3LPAA 3NEJA 4OGFA 4XRRA 3TI7A 1Y7LA 3Q8KA 1RKUA 2YFQA 3ZI4A 2W7TA 4G2NA 3IV7A 4YPOA 2VBCA 5I47A 4RKYA 1XL0A 5F5LA 2QX9A 1VHDA 2ZWIA 2HADA 4TSKA 2I29A 2BUAA 3AFIA 3G5AA 4BQEA 4B2YA 3PX7A 1E2EA 5KQSA 1JWLA 4FFMA 1SR8A 5AKIA 3VR2D 4CEJB 2FZGA 2ZBPA 4N18A 1XALA 1R18A 4I50B 2CXNA 4RV4A 3NC4A 5HKKA 1MX1A 3IPAA 3DOJA 4JBYA 4KE6A 1N34B 1TU0A 5CFNA 3IEXA 2P3QA 1GCOA 3M7IA 4X6UA 3WLRA 2Y05A 4HB3A 1GUBA 1VJ1A 1RI2A 3O8LA 4L50A 3TPZA 4P86A 1TKRA 1PW5A 3TZHA 4A9AA 2DPXA 5E7IA 4KMSA 5BRNA 5HHTA 3H8JA 3KSBC 3IUPA 1N1EA 1SXGA 3G9XA 1DKNA 3CGWA 2HFKA 2VPXA 3NHUA 2GO1A 3IERA 3BN3A 5AIAA 1O87A 4IO1A 3UJ3X 4ZOLF 1VHJA 1GRRA 2CCGA 2GH1A 3DV2A 1B8PA 2GEJA 5CLFA 1JFRA 2MYPA 4I4TB 2FF5A 1PDVA 1ZHFA 3QPVA 3PNVA 1OV4A 4HO1X 4F92B 3STHA 5I01A 5J4HA 5T7BA 1RBQA 2ZOSA 1DWOA 5B7NA 2CEAA 3G59A 4BCDA 2O8VA 5EJ5A 3V4SA 3WGLA 3K70D 4PSVA 1HLFA 3HFGA 1QTQA 1JIVA 3BMXA 1QIDA 3M6UA 1ZA1A 3ICVA 4QDXA 2HMYB 3QRWA 4TWBA 2XB6A 4HWSA 1N32B 3NHZA 3KT8A 3IH5A 4XDYA 4J0HA 3CONA 1VLJA 1RDFA 2QZPA 3ROXA 3KQUA 1FQKA 2JFFA 1SIBE 4YECA 2W2KA 2LCFA 3LZCA 5IT5A 4PTLA 2A6PA 1TC1A 1BOFA 1QHXA 3ST7A 1WXIA 4Z9AA 2I87A 4J94A 1ES9A 3K6KA 4ERXA 2VA8A 1BWQA 1NQXA 3CF6R 5I9BA 1BXRB 3I92A 4UAUA 1F6WA 3Q6MA 2EZ4A 2VPWA 3GGDA 3OEWA 1KPHA 1TLFA 4CKBB 1WE2A 2XUHA 4EFKA 1GZSA 1X19A 2BFPA 3N39C 5BWMA 3NDJA 1VPEA 1K5DA 2XDQB 3NV7A 4MEAA 1JR3D 3MFYA 4P7GA 5KCZA 1Z06A 1SZJG 1UL1X 2GYVA 4I99A 5H68A 2AI1A 1BE0A 2HUPA 2RCNA 4C76A 5HOEA 4OXIA 2DT8A 2DR3A 1FUIA 2H1FA 2JZOA 2OZKA 3E9MA 5KZMB 5F64A 1DVRA 3EVTA 4Z86A 4JI6B 1B3BA 1P18A 2MU1A 2OGUA 4UREA 1DQYA 2QTBA 4DKXA 2GHRA 1YBAA 3OZDA 1DQNA 1P4GA 3PIDA 5DXAA 5B30A 4DZZA 3TQSA 4B3RB 3LCMA 4C4AA 1PJQA 2ISQA 4GX2A 2RIRA 3BK7A 2VSFA 1ZHOA 1BZYA 1DHTA 1R9NA 4EGCB 1J42A 4IIJB 3QWBA 2DSNA 1M1ZA 3TS1A 1DZIA 2NZUG 1P2SA 3C16C 4J0EA 5DNDA 2GSDA 3SVTA 4TL7A 1UZMA 1QZUA 3CV3A 4K1LA 4J16A 2OK7A 1G8FA 1TJ4A 2A9RA 1VCOA 3I6BA 3MCUA 4DLRA 4L3OA 2P1RA 3GL9A 5F1KA 4R4JA 4BMYA 4CV3A 1C1XB 5F23A 1P7WA 1YZFA 5FBRB 3RJ9A 3F4BA 4TSFA 1J56A 1GV0A 4EO4A 3LX6A 3RNOA 1E0JA 3V9PA 3H65A 5IAGA 4YXWA 3NTUA 1Y81A 2V7BA 4LWOA 5J40A 2C4WA 2X15A 1GPMA 4Q37A 2B1RA 5A4JA 2P6PA 4G5RA 4D46A 3OKPA 4F86A 4JFAA 5BN1A 3A1DA 2P2SA 5H59A 5GIOE 1BEZA 1X7WB 2O1WA 1FNBA 4O63O 3G2LA 2BFWA 5J58A 1QP7A 4L4YA 1KSJA 4UNPA 3OJWA 1KAOA 1V1RB 1KIAA 1Q1BA 2JHAA 1E1CA 2ODPA 3BE5A 4WLEA 5F33A 4R2HA 4B7XA 3IFSA 1TUEA 3R09A 1LWOA 3HBNA 1RZUA 2IOFA 4J8PA 2J7KA 1YULA 5HJ2A 1SN7A 4DA9A 2K5UA 5B7QA 1Z6TA 5AW9A 1VCNA 2FLKA 4DCJA 1JJ7A 4RIEA 4XQ0A 3QX7A 3A1UA 2GEFA 3T7KA 2QAJA 4PLCA 2QY9A 2VNHA 4EA7A 4YJKA 1B8OA 4CJXA 1HT3A 2VF7A 4M99A 2XGSA 4GPTA 5FAXA 1NJ8A 1SWWA 5LLSA 5TMBA 3ZIUA 3QU4A 4IPTA 1X87A 2NQTA 3CIOA 3IDAA 3G85A 2OORA 2ZI4A 2WUDA 3L7MA 4Q16A 3ROTA 5M29A 4RS4A 3AF6A 2QLTA 2RBKA 4EJ0A 4AF6A 2V5AA 2I1WA 3UKDA 4EHNA 2VHVA 4NFHA 5D3KA 4PC1A 4YR9A 2PXXA 1N2OA 5KNDH 1FU8A 5FFNA 3TSCA 1V5FA 1UBOS 2NUBA 1G66A 5L53A 1KYYA 1N5LA 2P35A 2NU8A 4RHFA 3OPYA 4WCFB 2H4ZA 2ONCA 3DW3X 4JC8A 1TJ5A 3EF1A 3GP8A 1OFVA 1ZNWA 1NP3A 1U90A 2OCBA 3AEUB 2DH5A 3F9CA 3PJEA 4W5WA 2V98A 4PAGA 2R751 1KDTA 3IDFA