4QJ3A

Structure of a fragment of human phospholipase c-beta3 delta472-559, in complex with galphaq
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
316
structure length
316
Chain Sequence
b'RRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPSYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanine nucleotide-binding protein G(q) subunit alpha
publication title Molecular mechanisms of phospholipase C beta 3 autoinhibition.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein/hydrolase
total genus 110
structure length 316
sequence length 316
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00503 G-alpha G-protein alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.400.10 Mainly Alpha Orthogonal Bundle GI Alpha 1, domain 2-like GI Alpha 1, domain 2-like 4qj3A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qj3A01
1CR2A 3CO5A 1Z2AA 2VP4A 1VIYA 3QJYA 4PZZA 1DBSA 3I5YA 3OE7D 2HDNB 1JEEA 1GILA 1Z0IA 2P65A 3T5DA 4B71A 2FPKA 4RD0A 4Q9JA 2PLFA 2ZI4A 4Q9IA 4BLOA 4DXAA 1KSJA 4FCTA 1OXSC 2O8FA 5KSZA 1J8YF 4P32A 3L0PA 1OXXK 4C0KA 4M1OA 1IOZA 1OF1A 1JEDA 1ZW6A 2IWHA 1VIAA 3A4MA 4WAUA 4A4DA 2GRJA 2NOAA 2WWWA 1R10A 4A8JC 2A5GA 4OL0A 4U5XA 4Q1DA 2W6IA 3QQ5A 1R8SA 5IK2D 4B6FA 5JHGB 5L3VA 1GOTA 3EWAA 4BE7B 4C0SA 1TTTA 2XXAB 1HH4A 2GKSA 1RC8A 4BECA 3KQLA 5EXXA 3GEIA 2ZRNA 1BKDR 3GCGA 4WZBE 2JLSA 1QRAA 3HPQA 1FMJA 4A0FA 5FBQB 1MO4A 4FMDB 2CXXA 2FFBA 1E9AA 2BV3A 2A2ZA 3KKOA 2JGNA 4F4CA 2KI5A 1ELOA 1ZUHA 1KI6B 4KLNA 3UG6A 2WICA 4EPRA 1VDZA 1XBTA 3OEED 1VECA 2FFAA 4KSCA 1XD9A 3C7KA 4KV9A 5FOWA 3VR6A 4QBHA 1GG2A 4QGFA 5K8TA 3ETLA 4IOLA 4BRUA 3QG1A 3GJ3A 3L0IB 5JWHA 2GZHA 4UKDA 4KFRA 1TQ4A 3LQRA 4MKHA 2IK8A 3AF4A 4EUNA 4AG5A 3KUCA 4CVNA 4OHWA 4NL4H 4TYQA 4DLXA 2DB3A 1CR0A 1F6BA 4G5RA 3RHFA 1SHZA 1TQDA 4A36A 1OH5A 2C95A 2EFEB 3HDTA 3LVRE 4KHZA 1SKYB 4K46A 1K5DA 4D26A 2V4ZA 4UNRA 5E7IA 2OAQ1 2XNSA 1BOFA 4YQFA 1ODFA 2PEZA 4O0MA 3A1VA 1G6HA 1GL6A 1P9WA 1DVRA 1KK2A 2P5SA 4PR0A 4QNRA 4LZZA 4RZ3A 2ODWA 3KB2A 4LC1A 2RGAA 2WKRA 3OFND 1E2MA 1NBME 2JASA 3OEHA 3CRMA 4TZ0A 5A5GA 4ASUA 3GJ5A 2AXPA 2UZ3A 1RKBA 1XCGB 4RZUA 3WNBA 4DT1A 4ZDWA 1G7CA 4QGHA 5TY0A 2ZE8A 4PQRA 4AYXA 4B3CA 3NH6A 4PHHA 3WHLA 3N2EA 1FUKA 4DIEA 3HU2A 3AVVA 2WIBA 5HTKA 1GAJA 4NONA 2ZRBA 3KZ1E 4NMMA 5G41A 1P75A 1GNRA 1UADA 1ZU4A 3B8HA 4BRWA 5BYJA 2YNMA 1OJLA 3AGQA 2P6RA 2XZOA 1W5TA 2VO1A 5TMPA 1JB1A 2DFTA 5IF9A 2WTUA 1SXJE 4MRVA 1I4TD 1KDRA 1XCPA 5DSZA 5KNDA 1NVXQ 2OG2A 4YMTA 2CLCX 4RD4A 3SJZA 2IHBA 1N6HA 3UXMA 3DPUA 4LSGA 4E07A 1AM4D 3NWJA 5JBQA 4RD6A 2YWHA 5JJLA 3OIUA 1EFUA 1OFHA 3W3AA 1F60A 3A1WA 1G5RA 1MR3F 3MLEA 3RS5A 2QBYB 3CRW1 5LB2A 1G5TA 2R44A 4OK6A 5GJWC 1NG9A 2IS2A 2D06A 3LBHA 2C9CA 5K8UA 3MWLA 3RC8A 1YE8A 5KYKA 3CIOA 4ZCLA 1ESNA 2RMKA 1Q21A 3QOFA 3PV0A 4Q48A 5KU1A 2D7CA 3FKSA 2W0SA 2XX3A 1NNEA 2ZRHA 1E2PA 1HE8B 1G3RA 4XJXA 4S2EA 1C4OA 3UKDA 2OAP1 5FPYA 1G9XA 3WYAA 1FQKA 1KY2A 1T6NA 2ZJAA 2ORIA 2CE7A 2W2XA 2R65A 4J0QA 1OV4A 4BFVA 2BMDA 1XTQA 2OXRA 3SNHA 4JKYA 2OBMA 1UM8A 2YVUA 4M1WA 3LLUA 5JI3E 2OV2A 1S9HA 2CNWA 5KNCA 3W6NA 1ZNZA 3IUYA 3G5UA 1F2UB 3UANA 2Q3FA 3QKUA 1II9A 1VCOA 3VX4A 4BFYA 5BN4A 3AF0A 4ZPXA 1CKEA 1J8MF 3H4MA 4CT5A 3CONA 3VKWA 1OHHD 4TL6A 2AWOA 1F2TB 1LNZA 2GWHA 4EPYA 4IOMA 2ZJ2A 2ZSBA 1XXHB 2ZEJA 5B57C 3NKVA 3EIEA 2JA1A 1CIPA 4MKIA 3EX7C 4HB0A 2R6FA 4B33A 4B2LA 121PA 3U2QA 2NZ8A 2H18A 4QBGB 4BFUA 1WQ1R 1FTNA 1R5NA 3QSYA 4QNMA 4DCNA 3FWYA 2ZI6A 1KAOA 4Q7KA 2DFKB 1NBMA 2VF7A 1II8B 2G83A 1ZM4A 3KQKA 5TDHA 1S9DA 1Z28A 4MGYR 3B7GA 3MRSA 5GJCA 5A4JA 2RGXA 4U02A 2WMOB 3ECCA 3PEYA 2R9VA 3IBYA 1ZP6A 4QG7A 4WIAA 2ZSAA 3AP2A 3ZS9A 4GMDA 4GSYA 2NGRA 3VR2A 3H1TA 5JRJA 3C5CA 1XCMA 5EQTA 4Z8XA 2IUSA 4WA7A 4XD7A 3PXGA 4A0GA 3D7MA 1Q0UA 1SXJA 4MYHA 4KBGA 2GETA 2V9PA 2Q6TA 1UBGA 1XMJA 2EFCB 1GM5A 2C78A 4PAQA 2FNAA 5AUNB 2J0QA 1CJMA 4ACAA 1NSFA 1ZM2A 2Z4SA 2X19A 1T0HB 4HLCA 1SKYE 3CRQA 1E2KA 1IM2A 3CBQA 3LBNA 4Q4LA 3WY9A 3T06B 4YDHB 2JLUA 221PA 4CEJB 1SVWA 2JLYA 1EXMA 3G82C 4H1VA 5JLJA 5CM9C 1KSFX 3Q85A 4F93B 1II0A 1Z29A 3LXRA 3ZVNA 4KBFA 2A78A 1S1MA 4ARZA 5GADl 1OIVA 4N0EA 2NO6A 2GILA 4M4SA 3UMFA 3I1FA 4IOJA 1IN8A 1P3JA 5EUQB 2AFIE 4A82A 4NDZA 4EJSC 3PQCA 3T12A 2WJVA 4M8NE 2EWWA 2PZFA 1ZM7A 2VTKA 3S1AB 2WJHA 3BC1A 3GJ6A 4ZIRB 2GHIA 2ZTSA 4BFSA 1XF9A 4W5WA 4DLZA 1YR8A 3RRNA 1MV5A 2XB4A 1XTRA 3ADCA 1GKIA 2AHOA 5EUMA 1GWNA 2WHXA 1F48A 2C9OA 4A2WA 2ATVA 1GFIA 3B6EA 4YLGA 4CGZA 4PO8A 1VKJA 2CK3A 2V1XA 2Q9BA 4TWZA 1NVVQ 2XXAA 3MJHA 2CEAA 1KSGA 2BIFA 2ZE7A 3BH6A 3E2IA 4JLDA 4W5HA 5FOTA 1WRBA 3LXXA 4LJ4A 1G3IA 2ZM5A 1XTJA 1DAMA 2J7KA 3P4XA 4U00A 1FNNA 5GJVC 5EXSA 5FUXA 1CLUA 4A6PA 4C0BA 1AZTA 1XX6A 2IA5A 4HZIA 3ZJYA 1NLYA 4C0QC 4JSYA 2YOFA 4O2RA 4W9MC 4K81B 2X8AA 4US0R 4O25A 2AN9A 1WBBA 1KI6A 1ZUIA 4Q01A 3RWMB 5EZ5A 3CX8A 1L4YA 1QVAA 3EG5A 5CB8A 2QROA 1R0WA 3ZGXA 2GZAA 4CYMA 1DAKA 2WVJA 1U8ZA 1XEXB 4Q7JB 1W4AA 4TT3A 5F2EA 4EPTA 2QE7D 1WXQA 1XDBA 2VA8A 1D8TA 3UK6A 2RGDA 4Q4AB 1SVSA 3A4NA 1R0XA 3TBKA 4D4MA 2IYUA 1OXVA 4V03A 1K6MA 4JT4A 3FOZA 1CJKC 4LJ6A 3I4LA 4PPQA 4KU4A 4DSOA 2I4IA 3I72A 1JAHA 4TMVA 3NHBA 3MMPA 1XXHE 3EPKA 2QNRA 2WWXA 2GAAA 5AJXA 5JJIA 3UATA 3V9PA 2ZRFA 2Q3MA 1NSTA 2QA5A 2GVDC 4PHFA 5LB4A 3U3RA 4AKHA 2AKYA 1E4YA 4LJ9A 4IOKA 1RRPA 3IQWA 4OHYA 2ZUBA 2C98A 2ORVA 1KGDA 4HYYA 4Q18A 3GJ4A 2IXGA 2I1QA 1ZD8A 3SYLA 2IYZA 4EFNA 5L3RA 3ASZA 2AXNA 3A1UA 1EK0A 3AVTA 4IHQA 1JQJC 2QAGB 1RZ3A 3A37A 3BOSA 2QRZA 3WBJA 3ZVMA 2GBLA 4LCBA 1PUJA 2GJAA 2XZPA 2E9SA 4LHWA 3FMFA 1OKKA 2EFDB 2ZROA 4OYHA 2G1JA 4TTQA 5HCIA 3QPWA 1L4UA 3LVQE 2HXSA 1OYWA 3PUYA 5L3SA 1ZINA 3JVVA 2X1VA 1OW3B 4UNNA 1OB2A 5FI0B 2NMVA 2J3EA 2N1BA 3AGPA 5G53C 4DUGD 3SI7A 2QY9A 4AKGA 3CUEF 2QENA 1QHGA 1KI9A 4OBEA 2CHGA 2QSZA 1E9FA 2DCUA 4L5BA 4R2IA 4W7SA 2RGCA 2IYLD 3BXZA 2BHRA 5DGXA 3W8RA 4AURA 4NCKA 4XH9B 2WSMA 1W7AA 1X8JA 1QVRA 2C2HA 621PA 1Z63A 2IYWA 1CU1A 1EG7A 1XEWY 1D2EA 4EFLA 2QBYA 1AN0A 2F3TA 4IDNA 4NYJQ 2GESA 1YJ5A 1OLOA 5JHHB 1IXZA 3DDCA 1GSIA 2JJ2A 2KJQA 2WOOA 3MUFA 4NYIQ 2H92A 4I4LA 2QI9C 4BFTA 3VR4A 4JL8A 1Q22A 2LKDA 4IDOA 3TJZA 5JWRA 1T0JB 1Z2CA 2QMHA 4HAWA 1GIAA 1T9HA 4N0DA 1P61B 1AJEA 1G7SA 3K53A 4IFEA 4NCNA 2CBZA 1N6PA 2F55A 2J45A 4K8OA 5ANRB 1IN5A 3NBFA 3TQFA 4URUR 5LPNA 4Q00A 1F2UA 3RS3A 1BMFD 2FSFA 3Q7PA 1NLFA 4MUAA 3W34A 3ADBA 2P3SA 1LS6A 1CJVC 1VG0B 3QXHA 3SC3A 2VHCA 4DCVA 1HV8A 3MAAC 1F2TA 2A30A 2HF9A 4AI6A 3C8UA 4GP7A 1XXHA 3VU9B 4M22A 4B34A 1WDTA 4JBXA 5JSZB 4TMKA 3KKMA 3EPHA 1NY5A 1ESMA 3CF2A 2C8VA 4H9GA 2WPDA 3TRFA 3B60A 3VHXA 4XIGS 2BM0A 2ECKA 2AWNA 4US1R 1E32A 2HCBA 2ZRDA 4OQLA 3T1TA 3AB3A 4XTRA 4UXIA 1T3HA 3QEOA 4YMSA 4GPTA 1IAQA 5JS7A 4BPBA 2IT1A 4JMPA 1MOZA 2GCPA 3B85A 2WWYA 1YZLA 4RVCA 4LBWA 4I1OA 4P4SB 4BLSA 3WMFA 2GVZC 1II8A 5FR1A 1KYIA 6Q21A 1VMAA 5C18A 2QMOA 3AKYA 3KB1A 1Z0KA 4LV5B 821PA 4L16A 3BRWD 1DO2A 1W36C 5IHPA 5J47A 1S2MA 2ODBA 3ASYA 4TYNA 3P4YA 3SDZA 2RGGA 3NDBB 3GP8A 5F98A 3SE0A 1JPJA 4YXWD 1PV4A 3DMNA 1L8QA 4W5JA 4MQBA 2G0TA 1GUAA 1ONBA 4XVQA 2AL7A 1E9DA 1IXRC 1EFCA 2YINC 1ZNWA 3K0CA 4LI0A 2NO1A 3PG5A 3ND8A 2CL6X 3KKNA 2Z6VA 4LHZA 4E22A 1BS1A 3WRYC 3MWJA 4JBYA 3EZ7A 3BH7A 3K70B 3ND9A 1KK0A 2Q0HA 2IYSA 5F9HA 1S3SA 2JAQA 4KCGA 2VYFA 4UJ3A 1E1QA 2WWGA 2FDCA 4CEJA 1SXJC 3KQUA 5LD2B 5EXPA 2J0UB 2ORWA 3QKRB 1N3BA 1T8UA 1U8YA 3GFOA 3KKPA 1LF0A 5EE0A 4TTPA 1IONA 1E0JA 1YHNA 5D3MB 2ZAMA 4D0NA 4EFMA 1G8HA 4PPNA 4PZYA 1SULA 5FBWB 1G7RA 4D0LB 3FB4A 4CEHB 3UPUA 2BBTA 4Z1MA 1QF9A 3T61A 4G5SA 2NPFA 2CL0X 3PENA 2Z4RA 3K9HA 3E5HA 3ZLJA 2FEMA 2GF9A 2ZETA 2AD1A 2GXSA 4TMXA 4WBSA 3U60B 1Z0FA 2CJWB 1GITA 4DDTA 1WP9A 4F91B 3U7FB 3WNCA 5AWFC 1G20E 2A5DA 2FWRA 4JYBA 4CDGA 1RW4A 4Q9HA 2O8CB 2YWEA 4NU0A 4TYWA 4RCYA 3UWKA 1YZGA 4PSAA 2B21A 1W47A 1K8RA 5KOYA 4BEJA 4ZIRA 4C2UA 3LFUA 4NE2A 5FR2A 3B1XA 1UFQA 2W6ID 2IF2A 1YR6A 2EYUA 4DVGA 3I62A 2HF8A 1TADA 2BWJA 4R2HA 3W3ZB 1CJUC 5J5CA 4KVAA 1KKMA 1FL9A 4V0ME 3VHLB 2DYKA 1W44A 4HI0E 2QQEA 4Z8YA 4LUCA 2ZJOA 1F5NA 1P9NA 2KWIA 3BFKA 1KJZA 4JLOA 3K0FA 4M1TA 4DLSA 4KFTA 1U9IA 4LK2A 2ZRGA 5CITA 1SHKA 1D9ZA 2O8EB 2EFHB 1QDEA 3MGCA 2IS1A 3CWZA 2GXQA 2YOGA 4HAXA 4LV6A 2MMCA 2ZUCA 2GNOA 3PEVA 5AR1A 1RRCA 1G3UA 1Q1EA 2VP6A 3TUZC 4QJ4A 1SGWA 3AVQA 3ZD7A 2V1UA 3CH4B 3P1JA 5JJKA 4FINA 4XSHA 5HPYB 2BKUA 2UKDA 1AS3A 3OF5A 4LHXA 4C0JA 1Z6AA 1KHTA 3K9LA 4MITA 3IHWA 3D8BA 1I4DD 1NKSA 1XWIA 2EYQA 1OIWA 4IEEA 4OJKA 1A82A 4O3MA 5HE8A 5BXQC 2JLVA 1XEXA 1HT2E 3FMOB 5EE3A 4MA4A 5FBRB 4PSVA 4EPVA 2FU5C 5BQ5A 1YRAA 4LV8B 4Q4AA 3QE0A 2EW1A 2MSCB 2PMDA 4ZV4A 3VMFA 2XJ4A 5DN6D 1VCNA 5H70A 3KXLA 1BIFA 1KNXA 2ODEA 2ZRJA 4A1FA 5IT5A 2ZIAA 1E0AA 4A9AA 1KTVA 1CXZA 3T15A 2DFNA 4HZUB 4Y0VA 2VSXA 3CF6R 3HJNA 2KSQA 4RD1A 1G4AE 2E87A 4A2QA 4AYWA 2CE2X 2JEOA 4OI4A 2ZJ5A 4EAQA 2IYTA 3QY0A 4PHGA 3OEHD 4EQ6B 2IEYA 5JS8A 4ASUD 2BOVA 1DE0A 4ZCIA 1KO1A 2J46A 4AD8A 4ZCMA 5DYGA 1UEIA 4DLRA 3BS4A 1X8LA 1EESA 3FFBA 2HLDA 3A4LA 3RWOA 4FMDF 1AGPA 2NQ2C 4A15A 2YJTD 3TH5A 2BDTA 2CCJA 4NYMR 4CEIB 2RKOA 1N2CE 1ZD1A 5FL3A 1LW7A 2PMKA 4PC3A 1UKEA 2QZ4A 1HQYE 1XTKA 5JCZA 3Q5DA 1C1YA 1VTKA 1Z8FA 3O8RA 1R5BA 1NI3A 3F5FA 1SVLA 3H0KA 2EWVA 2ZRCA 1EFRD 1C9KA 3A6PC 4Q21A 2V7QA 4PAMA 2MSDB 1X1SA 2PCJA 1KI8A 3D3QA 3DZ8A 2YOHA 2OZEA 2JIZD 2GBLC 3QBVA 1VG8A 4M21A 5TXGA 1KAGA 2NZJA 1OFTA 1R0ZA 1EX6A 4LRWA 2BKEA 1OH8A 2V54A 4V0MA 1N6NA 4MGZR 1Z08A 1TL7C 3FFAA 2AX4A 5CIWA 4C9BA 2ZANA 3U5ZB 3TK1A 5F9FA 1W49A 1R2QA 4IDPA 2V55B 3TNFA 1U81A 2WSSA 1M34E 2JCSA 3FKSD 5E4FA 1N5IA 3AVWA 1IJEA 1DAHA 5FTLA 4JLBA 4ZI3A 4DB2A 3NG1A 1K5GA 1G21E 4KLZA 3RC3A 5L3QA 2W83A 2GXAA 2B8TA 2J0VA 4IVRA 2YWGA 1S1CA 2FSIA 1XZPA 3MCAA 1FPMA 4V0LA 4MKFA 1M7HA 2QTFA 1E99A 3EZ2A 5BN5A 2QM7A 1X1RA 4PPGA 1IY2A 3PUZA 4LPSA 2H1LA 4QOSA 2ZQ5A 2CVHA 2GCOB 1XMSA 3SQXA 4AK9A 2VIIA 4R71A 1E2JA 2O0HA 3CR8A 4PC7A 4M2LA 5EE1A 3KJHA 4JL6A 1TF2A 4V02A 5DO9A 4BFXA 1E6CA 1P2VA 4RZ2A 2V3CC 2GJSA 2W2VA 1G291 2O0JA 3UMSA 5H1YA 5EZ6B 1W48A 3VU9A 1UBCA 4HDQB 2IL1A 4HLQB 3VR1A 2PBRA 5JSZA 2JDID 4BFZA 4A0RA 4QJ3A 1NVUQ 1YZUA 4G01B 1ZM3A 4X8OA 3DO6A 5DHAA 4CW7A 1PLLA 3R20A 1FUUA 3IBGA 1NBMD 1Q3HA 1IY1A 4QFMA 1N6OA 5J4VA 2QL6A 2ZU6A 3NVAA 2O5VA 3FVQA 3PUXA 4P4SA 3I5XA 3NBZC 3SN6A 4B35A 3CPJB 4V0OA 1V5WA 1Z07A 3F8TA 1E98A 4KAXA 5IK2A 2A3RA 1LV7A 5KSPA 3K9GA 4F4JA 3JZAA 4Q1FA 2ZJBA 4JS0A 2F1HA 2DWPA 2P67A 4XD7D 1BO6A 4HUTA 2FN4A 5K8IA 3U7EB 2ASEA 1N6KA 5DYIA 1MT0A 4DLYA 3EWSA 3UG7A 1M74A 4JVMA 5GVRA 1RFLA 2OCAA 2ZJYA 1SVKA 4ON9A 1E2IA 4B47A 2FFHA 3TLXA 1Q44A 4BGDA 2O8DB 1RYFA 4CIDA 1YZTA 3C4JA 1XPUA 3SHFA 1J2JA 2KBEA 1TU3A 5KPJA 4M1SA 4L9SA 1G19A 1CBUA 4UXHA 1NLZA 2GDJA 3NEYA 1W0JA 2Z43A 3AVXA 2H8KA 4OJQA 1EX7A 1P2TA 3IHLA 3K0CC 1CTQA 3C14C 2J0UA 3QKRA 1NP6A 4Q9LA 3SBDA 3CX6A 1NMXA 4H1UA 3B9QA 2XTZA 3GLIB 3SZRA 4X8LA 2ERYA 2F9LA 5D3MA 2B8WA 2ZI5A 5SZKB 1P62B 5HKKA 1FOEB 4CEHA 3M4YA 1DOAA 1OT3A 1M7GA 2OSBA 2OESA 2R62A 2OCPA 4KYUA 1KKLA 2DFLA 1FTSA 2OHFA 4JSTA 3AKDA 1DELA 3IO3A 3TGPA 5EXTA 2XSZD 2RB4A 5AUOB 2O8CA 3SFVA 2QAJA 1H65A 3IILA 3A36A 2DPXA 4KFUA 3SYKA 4DHEA 3VAAA 1ZMXA 3AKEA 1G8FA 2CHVA 3KJIA 3SOPA 3QUSA 1TAGA 3RS4A 3X2SA 3PITA 2GJKA 2BCGY 3L8YA 5B64A 2BJVA 1KDTA 4ZDIA 1DEKA 1E79A 1W2GA 1P72A 1YZNA 3I32A 5C4GB 4XOIA 2CCGA 4I99A 2X2EA 3TSWA 2J0SA 1B0UA 1ZRHA 3LLMA 4HB2A 3U44B 2GZDA 4YMWA 4ZKEA 2HJVA 1HURA 5CK5A 2O8EA 2TMKA 4AIIA 4EDHA 3SS8A 1O87A 3KJGA 3LW8A 5FPSA 1YZKA 4KODA 1QHSA 4Z54A 5SZHB 4MYUA 2ZVPX 5KHOC 2C96A 2PCLA 3U3OA 2V6JA 4JLNA 1U9IC 3K0SA 2AD5A 2RGNA 4OQXA 3FPAA 4KJZA 3I3SR 1JR6A 3LH5A 3WNDA 3B2EA 1Y3AA 2YC4C 4X8HA 1PLJA 2VP5A 3EIQA 3VTKA 1AS0A 4LJ5A 1LB1B 5DHFA 1XJCA 1COWD 4DBLC 4LX0A 2Y8EA 2XOKA 1GRQA 3NHAA 4FXPA 3GPLA 1RRGA 3ZD6A 3GLHB 1SVIA 3OAAA 2IBMA 1KZGB 2FH5B 3AUXA 1P60A 2P6UA 1NKTA 2PX3A 3QPUA 1UDWA 4HZUA 2V8OA 2OT3B 2YV5A 3B1ZA 2B6HA 2GJ9A 4FCWA 3PJRA 4BZQA 3QI2A 2N46A 4RFSB 3PEWA 5HCNA 2HEIA 4XWKA 5FBVB 1SZPA 2ZRKA 3TW8B 2B92A 3BB4A 1WMSA 2R6GA 4EQ6A 3BIFA 2QM8A 1G8GA 1U0HC 3IO5A 1JR3D 3FHTA 2ZS8A 3VKHA 4TTRA 3SHWA 4LYHA 1OHHA 4ITRC 2QP4A 4HB4A 3SYNA 3WP0A 1X3SA 4CEIA 4XSGA 4PXAA 2GAOA 3NXSA 1XP8A 4TLEA 2D62A 4KXFB 1OKKD 2ZYWX 1TMKA 4V0NA 3ONWA 5G3ZA 1YKSA 3AV0B 4Q4JB 3P20A 4TYPA 1JALA 2ZI7A 3TUIC 3TW4A 5B58C 2J7PD 1D9XA 3GMTA 2OCYC 1DAEA 2R8RA 1HA3A 1ZC3A 3HPRA 4C30A 3U4QB 3C5HA 1ZIPA 4PO1A 4TLDA 3NC1C 1J90A 5CB6A 4GZMA 4GOKA 3CKLA 3C15C 1S3GA 3O8BA 4NPHA 2G3YA 1E69A 4M9QA 2H57A 3OIVA 5FL7D 2F1JA 2AR7A 3OIYA 1GP2A 3F3YA 3P26A 3OZXA 4LHYA 2WBLC 3N70A 5EP3A 1EWQA 2D74A 4P0TA 1E1RA 1XJQA 4LPKA 3KQNA 2JJ2D 1NMYA 3C41J 5K8LA 2QT1A 4TLAA 3KJEA 3A1TA 1TUIA 3R9IA 3GLIE 4IXNA 3SEAA 3W90A 1OFUX 4WVFA 4RSGA 2WWFA 3X1XA 1XPOA 3DM5A 4ZDKA 5AJZA 4QHTA 2VP9A 1JPNA 2CL7X 2JLXA 1NN0A 1W0KD 2Q9AA 5CYOA 4NTZA 4YONB 2EU8A 4DDWA 1IHUA 2P2LA 1VHTA 5DLQC 2WOJA 3NBXX 4EJSB 3B82A 2JJ1D 2VPPA 3DZDA 5FPKA 1E0KA 3BK7A 3QENA 2IS6A 3Q5EA 2O8BB 4MKGA 1EGAA 3IKJA 3ZZUA 1TF5A 5HR5A 521PA 5ELXA 2DHRA 5C2JB 1TF7A 2HV8A 3CLVA 3E70C 2WJGA 4NHOA 3TKLA 4FI3C 4HATA 2ONKA 5FUWA 1CJTC 4P4UA 1G18A 1S96A 1UEJA 2NG1A 1OXTA 3RYTC 1KO7A 1WF3A 5DI9A 4IEIA 1NY6A 1I2DA 3TSZA 1JQLB 1A7JA 4M0LA 4POAA 4DEYA 1U94A 4BQSA 1H8EA 4G5OA 1E94E 3T5GA 1OSNA 4JJKA 1AIPA 4Q1BA 2ZI9A 1G8YA 4MRPA 4DJTA 1SVMA 1G6OA 1NIJA 3TUJC 2WKPA 1L2TA 4OQMA 2JATA 1E0SA 4G5GA 1OB5A 2F1RA 4DDUA 2V6IA 5J40A 3Q7QA 3E1SA 1G41A 4AY2A 1RJ9B 2JLZA 3W9YA 1GNQA 5AJVB 3X1DA 1G5PA 3M6AA 1LY1A 3R9XA 2VHQA 3LAWA 3U7HB 1TU4A 2FFQA 1ZAKA 3BJIC 3ADKA 4A6XA 4JZKA 4RZXA 2BBSA 4YMVA 3CH5A 4PC6A 1G17A 4C3ZA 3V4RA 3GLHE 4WXPA 4B44A 2BMEA 1Q1BA 3GJ8A 4JLJA 5UKDA 3IQXA 5CM8B 2BMFA 1CR4A 2O8DA 2PX0A 2VLIA 3AVPA 4P3YA 3EPJA 2WAYA 1E1QD 2A9KA 2D2FA 3QIAA 2IUTA 5E7MA 1Z22A 3GLGB 1HEIA 3KFVA 3L8ZA 3QKTA 4MGIR 1E9BA 1AKYA 2FGKA 2VH5R 5AUPB 4QRHA 3L2OB 1HT1E 2QE7A 2XGJA 3KKQA 3DM9B 4AWXA 3ZQ6A 4Q7LA 3SQWA 4XWAA 1RRFA 4DB4A 3K1JA 4Z1MD 3GLIA 2W58A 1OFIA 4D25A 3PFIA 3H84A 3TVDA 3K70C 1Q1QA 3T1VA 4WZAE 3RABA 3AF2A 3QF7A 2RGBA 2UVQA 5A0FA 5LD2C 3I73A 4Z51A 4Q9KA 4NYJR 3MG9A 2B7CA 1KDPA 2G9NA 3ZDQA 1CF4A 5FUVA 4TL8A 5DH9A 3QXSA 1CULC 3UMRA 4TZ6A 3CM0A 4KO8A 3CB4A 3K0AB 2FV8A 1P2SA 1VG1A 3TQCA 3ICQB 4CF7A 2HYDA 4DWJA 3BB1A 3HU1A 2W6JD 3B1WA 3PIRA 1PZNA 1RIFA 3CR7A 4BUJA 5JWOA 4AKEA 3EPLA 4IKEA 1G16A 4UNSA 2XZLA 2CCKA 5KDLA 2HT1A 4LBYA 2ZXUA 1GL7A 1N6LA 3U44A 2MSEB 2P0EA 4IW3B 3DKVA 4C0LA 2FEOA 1TNDA 1KY3A 5J4HA 2REXB 3WXMA 4DUGA 4EPWA 4HUQB 2EFGA 3HU3A 1KI3A 4LBVA 2HCJB 1Z0AA 1ZJ6A 2ZREA 3KUDA 5LDDC 5G40A 4MRRA 3AM1A 1U8AA 4DEXA 3QEJA 4B48A 1X8KA 1Y63A 2FMXA 3GFTA 2ERXA 1DADA 1YZQA 3BORA 3IPYA 4QJ5A 2QU8A 2R6AA 3MWYW 3SJBA 4D0GA 4PC1A 4GT1A 2H5EA 2QGZA 4Q1CA 3TSOA 4LC0A 3VR3A 2BM1A 3EIHA 1G7TA 3QNUA 4PC2A 3GLHA 3MFYA 1TQ6A 5EP1A 4HAZA 2RGNC 2DWOA 1OXUA 5AJWA 5B30A 1CP2A 3RSLA 3QF4B 4TLCA 4OQFA 3IIKA 2QSYA 2XTNA 4TYYA 2A7QA 4P4TA 1HY3A 3Q8XB 4JJZA 4PX9A 4Q66C 3VNUA 1ZCAA 4RFSA 4AC9A 5CDFE 4FWIB 4TL7A 3W8NA 3CNLA 2OFOA 3CW2A 1PJRA 3HP1A 4Q03A 5EP4A 3AQ4A 3NEJA 3PCRB 3S1AA 1Z06A 1QHIA 2Z5FA 2PLRA 1QG2A 3GQBA 3HWSA 4LYJA 4NCHA 4QBFA 1Z6GA 4OI2A 3ZQJA 1UAAA 2OBLA 1G8PA 4N1AA 3NIBA 5AUQA 2QGNA 4ACBA 2ZRIA 1ZC4A 4CRWB 2ZR7A 3DMDA 3KXIA 1G64A 4LWZA 2ZSDA 1P73A 2Q9CA 4Q4JA 3W5IA 1GDDA 1R6BX 3VFDA 1DG3A 1A5TA 4HAUA 4DLVA 2PZGA 2XTMA 3FDIA 3PR1A 4RY2A 2Q21A 5FOVA 2QPOA 4XWOA 1U2RA 4YC7A 4JL5A 2QQ0A 4Q1AA 3U3JA 2YC2C 3WMEA 4KITB 3QVVA 4Q7MB 4GNKA 2OLJA 3U4QA 2QPAA 2IYYA 3GLFB 3LNCA 3V00A 4KSBA 3SR0A 4BZPA 4GRAA 3BFVA 4Q47A 5HZKA 4D4KA 3K0EA 2D3WA 1E4VA 2ONJA 1YQTA 1GNPA 4FMBB 4RCZA 1YR7A 2PT7A 2ZRAA 4BZXA 1MO6A 4FD2A 3RANA 2QTVB 2GXUA 2PJZA 2WSSD 3GLGE 1JXOA 3NTUA 421PA 3IEVA 1KI2A 2A5JA 4MDFA 4YMUA 3QKSB 3BE4A 5FTKA 4YXWA 1YR9A 4XVUA 2L0XA 2AKAB 3B1VA 3EW9A 3U61B 4E5UA 1XEWX 3L43A 1E2QA 4NZYA 3TIFA 2GK6A 2XEXA 1IBRA 2DBYA 4URVR 2H17A 2NO0A 3PEUA 4NYMQ 4R98A 1G3MA 3BB3A 5D3QA 2WKQA 2X77A 4GBMA 3DKPA 2IWRA 2D2EA 2FE4A 3WBKA 3CWQA 4HEJA 4HLUA 1MO3A 2XAUA 3JVUA 3M0EA 5EE9A 1QHYA 3HYRA 3N5CA 3H86A 2K5UA 4D81A 3DHWC 2ZJ8A 1ZIOA 2REBA 2ZUDA 2ZU0C 3PUWA 4BLQA 5KDDA 1XNJA 4JKIA 3ZYCA 1LFDB 1Z83A 2QPTA 4TSFA 4Q4HB 3ZIAA 5L8VA 3C16C 2O8BA 4C4PA 2WIAA 4DCSA 3K09A 1Q12A 1R7RA 2AFHE 1KNQA 1XD2B 2IHYA 3BAFA 3EA5A 3GFPA 3BERA 3GJXC 3MJRA 2QAGA 4UJ5A 4UXJA 4BWYA 3GD7A 2GEUA 3BFXA 1FX0B 2D4HA 3N2IA 2ANBA 3NDPA 1UJ2A 1NN1A 4B3FX 4GL2A 1US8B 1UPTA 2AK2A 3REGA 1Q1ZA 2ZE5A 5CDFA 4LJAA 1JJ7A 1TEVA 1H8HA 4UNQA 1W4RA 2WWHA 1G1MA 4IDHA 3CPHA 1IQPA 2H7VA 2R6DA 4KFSA 1UBFA 1UBEA 2XNDA 4HB3A 1TUEA 4A0HA 3CF0A 1QHNA 4KVGA 2ATXA 1ANKA 2W2TA 3THXB 4QHSA 1E9EA 2WJIA 2J59A 4LYAA 3EXAA 1XFAA 4D6PA 4Q19A 2QMUA 3A1SA 4F7WA 2CLDX 1RJ9A 2EQBA 3DL0A 5DI3B 1M7BA 2BBWA 2EVWX 3AEZA 4RKFA 4DSNA 4GI7A 3U7GA 2OFXA 1MKYA 4A2PA 1RYHA 2HYIC 1XMVA 1A1VA 4YDSA 5DISB 1X86B 2GA8A 4PHTA 1WCV1 4LY6A 2VP2A 2WAXA 3U6BA 5KSYA 1R8QA 1WBDA 1QZXA 3EAQA 3K70D 3AH8A 1FP7A 2ODNA 4FCVA 3ZS8A 4TQUS 2ZVQX 1D5CA 2FF7A 2FG5A 2QORA 1U98A 1W0JD 1BYUA 5CJPA 4FMCF 5FH9A 2RGEA 2CNWD 3T34A 2FPMA 2QRNA 3OESA 4LJ7A 4D82A 3GLGA 3D31A 4OI0A 2QG6A 3THYB 3H2YA 2FSHA 2IX3A 2QUZA 5KPDA 1KZ7B 1N0WA 2VQSA 3QVUA 5HKKD 4M9ZA 4Y0AA 4BLRA 1QBKC 2ZSFA 3THWB 4NP6A 4DKXA 2IXFA 2WZQA 2NTYC 3WP1B 2CDNA 2LKCA 4GP6A 4TMWA 5DN6A 1JI0A 4ESVA 1U99A 4L9WA 4LJYA 2RH5A 2IXEA 3FMPB 4NCIA 4IDQA 1KIMA 1R5OA 3WHKA 4A8JB 5AK0A 4AKIA 5JEDA 4FMCB 1ZNXA 1YRBA 3EASA 1QHHB 5SZIA 2CLSA 1P2UA 3OE7A 3P27A 1OE0A 3LDAA 1EFHA 1W36D 2DY1A 1I4LD 4FIDA 2F6RA 1NJGA 2C5LA 4TL9A 1CRQA 5FPTA 1TPZA 2C03A 4OK3A 1T5IA 5C1BA 3K0AA 4B2PA 1N25A 3KXKA 5FPHA 4D4JA 2IYQA 2SHKA 3KQHA 1KI7A 3GLFE 1N0VC 1E79D 1R0YA 2VSOA 4Q02A 2GEDA 5KNBA 1X6VA 2PT5A 1LF5A 4JLKA 3RS0A 1E3MA 1AQYA 3KDSE 5L3SB 1Z6TA 2IEZA 2GJ8A 4LDJA 5C4MA 3VR5A 3X1ZA 1AQUA 2J5XA 3B9PA 3L0OA 2C77A 4DDVA 3VQTA 1SXJD 4DIDA 3IIMA 2R6CA 4RJLA 3T1OA 1KJYA 1EFRA 1HE1C 2ZJZA 2QT0A 1W46A 5E95A 3QXCA 3LO5A 1FW6A 1W4BA 4D2IA 1JJVA 4HUQA 2QTHA 3BGWA 1IXSB 2JIZA 4D80A 1XB2A 2F43B 4WZ6A 4DCUA 3IDQA 1MH1A 4DLTA 1DAGA 1YU9A 3OEEA 2OBNA 3DOFA 4GMXA 3RVBA 2DWQA 4I1UA 5FTNA 1YVDA 1S4QA 1U90A 4G3XA 1KMQA 1N5JA 5KUTA 2HUPA 2F1IA 2PZEA 2XOKD 4JBWA 3A58B 4XVRA 3Q72A 3TAUA 2IC5A 5BYKA 3WYFA 3OAAD 4EKDA 5M04A 1NRJB 1XTIA 2OLKA 3A8TA 3FMIA 4L4UA 2BBOA 5CJ2A 4URXR 3RS7A 2P5TB 4QL3A 4MRSA 1M1YE 1D2NA 1RE0A 4NBSA 2ZYTX 1E2LA 1XPRA 2CJWA 3QF4A 3WRXC 2Q3HA 1Q20A 3NC0C 1T3SA 3TR5A 2C99A 2F3RA 1E9SA 4IFBA 3KTAB 4M1YA 5JZVA 5DIFA 2JLQA 1BYIA 4B6EA 1MABB 3OFNA 1JAIA 4L15A 4TLBA 2ZE6A 3R8FA 4II7A 5HZHA 4PQFA 2WMNB 1ZBDA 1IY0A 3T35A 4I81A 3LY5A 4B3XA 2CK3D 1EWRA 3EA0A 4TQ9A 3KFXA 1JECA 4OQNA 1GTVA 1AZSC 2B7BA 3QXJA 2F9MA 2JJ8A 4URWR 2JDIA 3IIJA 3CZPA 1S0UA 3LRPA 2RCNA 5B2ZA 4FN5A 1JBKA 4I1SA 2OCBA 3IGFA 5FTMA 5JMTA 2VRWA 3ZZ0A 1Z6YA 4TQAA 1NMZA 3GLFA 2ZR9A 3RNLA 3SJAA 4B32A 3O8CA 3X1YA 3GJ7A 3FKQA 3ICEA 4ILEA 1F3OA 1KSHA 1MO5A 5DNYB 1NN3A 3SJCA 3AKCA 4TT3D 4L8GA 5TV2A 3VX3A 1ZM9A 4NCJA 1E1RD 1NJFA 2PEYA 5JRZA 2ZI3A 4O2LA 1AGRA 1VCMA 4HAYA 5SZJA 3FYHA 4CT4B 2PL3A 4DSUA 4B43A 3L82B 1E2GA 3QKSA 4A92A 4RD2A 3U6KA 1MRNA 3BD9A 5TARA 1ZU5A 2J9RA 4HDCA 3L0SA 4B76A 1AS2A 2OO7A 3NH9A 1DS6A 2ZR0A 4D4LA 4M1KA 3F0TA 1UKVY 4KYIB 4Q1EA 3RDPA 3RS2A 1XTSA 1D6JA 3IEUA 4B73A 4TN1A 3VNVA 1OIXA 5BN3A 4EIWA 4QXAA 4PANA 4DLUA 2FOLA 4R7ZA 3RSOA 3GJ0A 1LS1A 3AP3A 3BWDD 3OIWA 1J70A 2ZAOA 5H68A 1W5SA 4C7OB 5KDOA 3HYTA 3RLFA 2OM2A 2WWIA 4OHXA 4M9SA 3TR0A 5GVSA 2YHSA 4Q4HA 3EZ9A 1WB9A 1JR3E 4HSEA 1CEEA 3HR8A 1FP6A 1G4UR 4JIMA 4LYFA 1XD2A 4CZ2A 5J4LA 4HLUC 4BASA 1JNYA 2FGJA 2OILA 3R7WB 1W2HA 1FX0A 3LBIA 4JYCA 1JXMA 1H8ED 1OPXA 4QHYA 2XB2A 4G0NA 3B5JA 3REFA 1US8A 3PVSA 2KBFA 1KO4A 2XSZA 5E7JA 4IVPA 4ZI2A 1IJFA 1HTWA 2BCJQ 3X1WA 3K09C 2O52A 3Q9LA 1N6RA 4PSKA 4P33A 2QAGC 4NH0A 1KDOA 1TQ2A 3LX5A 1BH2A 1NN5A 4PFSA 3TAHA 5E3HA 5J4YA 3CNOA 5TVKA 721PA 5J4KA 3SBEA 1KJWA 5IRCD 3ZVRA 2QP3A 3THXA 4RD3A 3K0FB 1GVNB 1KO8A 4ERNA 2WJJA 2IUUA 4V0KA 2A5YB 4MYTA 5DI3A 1E9CA 4X8MA 4PPFA 1MRSA 3CPEA 3ZH9B 1KK3A 1T5LA 3K9NA 3TVTA 4DCTA 4QBIA 1KK1A 4JVSB 1QG4A 1AKEA 4F38A 3Q3JB 4PAOA 1GZSA 5P21A 5CK4A 5FBLB 3LA6A 1FQJA 1NVVR 3VKGA 1KMHB 3SFZA 3WMGA 2YKGA 3EZFA 1V43A 3LV8A 1HUQA 2CVFA 1A2BA 3LQQA 4M53A 1W1WA 4IXMA 2BC9A 2FZ4A 4S35A 4E09A 3U3MA 4FWTA 4ZDJA 2VEDA 5JFGA 1B23P 2KE5A 3DVLA 4HDOB 1CS4C 2KB0A 3THYA 3U3KA 2A5FA 2FX3A 3AF1A 5JI2E 4WW0A 2PH1A 1COWA 1T3LA 1ZD9A 1OH6A 1KO5A 3TE6A 2GCOA 2XITA 2QP9X 4AG6A 5C46F 3THWA 5FUYA 2ZYUX 4EPXA 4QGGA 2REOA 4PZLA 4JLAA 4DRZA 3P32A 1XRJA 2ZS9A 3MSXA 4P31A 4A8JA 4GOXA 1Q57A 3W6PA 1AK2A 2VBCA 2DR3A 3JZMA 2WPDD 5KSOA 4G1UC 1QHHA 1Z3IX 1GRNA 3I92A 1NF3A 5CYPA 3O8DA 4C0AC 5JEEA 2FA9A 2GEVA 2O8FB 2F7SA 3B78A 2WV9A 4GFDA 1NIPA 2H16A 4F92B 2OFWA 5FFMA 2E1RA 2G88A 4DLWA 1N5LA 3QXXA 3TMKA 3R8CA 4GOJA 2JLWA 3FHCB 1DO0A 1XZQA 1JR3A 2GCNA 3FGNA 4LHVA 2GTPA 1CRPA 4JLPA 5FTJA 1VYUA 3AVOA 4QKQA 3CRRA 4LOAA 2VHTA 4ABYA 3MWKA 1UDXA 1S8FA 3T1QA 2IYXA 2NIPA 3OHMA 2RHDA 1GKUB 1GRRA 3IPXA 4Q5IA 4BLTA 1WA5A 2J7PA 4U7DA 4MUBA 3AVUA 1U0LA 3LWNA 2VHJA 1CR1A 2R2AA 5JECA 2HJGA 2NO9A 2LCFA 1FMLA 2ZS7A 5BWMA 2J1LA 4WXRA 2IF0A 2PJRA 1AA9A 2F43A 4QM6A 1PVOA 5LBIA 5EE5B 4G5QA 2GK7A 5CIQA 3G0HA 3EC1A 2AK3A 5FL7A 1IN7A 3LW7A 1T8TA 5DE3A 3UWOA 1E2FA 4QM7A 2CHQA 2J41A 3BBPA 4I1VA 4JT2A 5TB5A 5EJEA 3O47A 1LTQA 2ANCA 1U0JA 2OE2A 4F4IA 2D7DA 5G3YA 1M8PA 5F3WB 3AF3A 5L3QB 3CNNA 1N6IA 5FI1B 2OEPA 2VL7A 4M1MA 4BFWA 3I8XA 1UKYA 1DTSA 4B3GA 3AP1A 1DAFA 4N3NA 4PO9A 2HXYA 2MMGA 4AYTA 1G3QA 1RPZA 1O3YA 1W0KA 3RRZA 1T4GA 3SU8A 1RVDA 1W4CA 4M9XA 4KI0A 3EZ6A 3W6OA 2BEKA 3KTAA 4NYIR 3RRMA 2JJ1A 5CLLA 4JVNA 1Z47A 1DPFA 4DT1B 1XMIA 4UQOA 3FHOA 4DSTA 1MABA 4IVQA 1ZVQA 4GDFA 3KX2A 1FZQA 5BW8A 3GEHA 1KOFA 1E2EA 3RRYA 1VG9B 1Z6XA 4WOPA 2IYVA 3GEEA 1XU4A 4C0HA 4B3BA 4FW9A 2ZITA 1TX4B 3UIEA 5CLQA 8OHMA 3DOEA 1EFTA 1QHXA 2J87A 1PLKA 1FFHA 2WJYA 1N0UA 2BJWA 4PQYA 5H8WA 1DAIA 2CMKA 1M6NA 3KL4A 4ZKDA 3B13B 1E2HA 4LGMA 1SKQA 4B2IA 1KI4A 1VCIA 2VHUA 1WE2A 2ZRMA 1HYQA 4QGAA 3BH0A 3QBTA 2IS4A 2HT6A 3RAPR 1Z0DA 2BVNA 2JLRA 4OHZA 1KI1A 1A2KC 4JLVA 2QEQA 2Z83A 4NKRA 2RHMA 2YYZA 1VYTA 3NBYC 4OHVA 4OI1A 2IW3A 2O0KA 3V4FA 1SVOA 3CRVA 5KTYA 3AVYA 1VHLA 1NL3A 2IYRA 1ZCBA 4OKSA 4ESHA 2I3BA 4C2TA 2YZ2A 2P6NA 2ZPTX 2X2FA 1NVWQ 1L7VC 1OH7A 3DEFA 3FTQA 4RKEA 2OUKA 3W5JA 2W00A 2FPLA 4QC2A 2WM9B 1FNMA 1P7CA 2XJ9A 4URZR 3PUVA 5FOSA 1E9RA 1E2DA 1SQ5A 1ZNYA 2NPIA 1P6XA 2C04A 2UZIR 3EARA 2FZLA 4TMTA 1N5KA 4MDEA 3ADDA 3EC2A 1ZYUA 2G6BA 2W0MA 4TMZA 5JCPA 2N42A 4TSFD 3ZIAD 3WYGA 3HR7A 2G0NA 4C7OA 2HLDD 1ZUNB 1UKZA 3K8YA 1HQCA 4B74A 4BEBA 4PTLA 2NO7A 4DZZA 4BLPA 4ZO4A 1BMFA 3I61A 4HAVA 2LWIA 2Z0MA 2RAPA 4UNPA 2FJUA 4E03A 1M2OB 2ZRPA 1Z5ZA 3LX8A 1VYVA 1E2NA 2OXCA 4MH0R 3R9WA 1TEXA 1XJ0A 3QG5A 3LD9A 4GZLA 2G1KA 3R7WA 4JVLA 1IN6A 2VP0A 3FE2A 1W36B 1NG1A 2VF8A 1H8HD 1Z0JA 1J99A 3CZQA 1DARA 4HLDA 4IJMA 4LJ8A 2VSFA 2V7QD 3MD0A 5AJYA 2I1VB 2XNDD 4B3DA 3AUYA 2G77B 3J81k 3ZVLA 4MYCA 2W6JA 5FOXA 1LVGA 3B1YA 1VPLA 2BEJA 4DC9A 1Q3TA 5IDVA 1P5ZB 3THOA 4MGKR 4XTCS 2ZSEA 1GKYA 1J7KA 1R4AA 3CX7A 1DG1G 4B75A 1IN4A 1GL9B 1XD8A 4LBZA 3QPVA 1SXJB 4R9UC 3D6TB 1D2MA 2ZRLA 1ETUA 4MRNA 3I8SA 1UF9A 2C9YA 4RFVA 2ZYVX 5HE9A 1E96A 2YWFA 1PUIA 2QMEA 2GF0A 1KMHA 4OK5A 5KO2A 1XEFA 1OYYA 4IRUB 1T91A 4JLMA 2BMJA 3M1IA 1I2MA 5FOUA 4URYR 4EJSA 2FSGA 1P4SA 4US2R 1P9RA 4ARZB 5EP2A 3ZZTA 5GJBA 1A4RA 2QN6A
chains in the Genus database with same CATH superfamily
3SZ3A 5NULA 1Z2AA 4QXMA 4CDNA 4ZQCB 3Q8WA 2WG0A 2WM8A 3NOOA 2Q07A 2HA7A 2H9YA 3DHYA 3NUZA 3CRNA 3AIIA 1N2GA 1JEEA 4ENTA 1SCKA 2P65A 1PFVA 2VJDA 3T5DA 1Y48E 4RD0A 1BGWA 3UV6A 3RU2A 5DNWA 3N0XA 1ZL0A 5BNTA 5K0BA 2G1PA 1NDUA 3FUCA 1AUXA 3NGMA 5TS2A 4DXAA 4IIUA 2YY7A 4JC4A 1XVVA 2R8PA 4OXXA 3WK8A 2XHZA 4WBNB 1J8YF 4EKNB 4P32A 3L0PA 1OXXK 4M1OA 1IOZA 1OAKA 3UJCA 1OF1A 5AHWA 2IWHA 1J21A 2YWCA 1VIAA 4CQNA 2NOAA 4ZN6A 4AN4A 4E31A 5IH7A 2YJ5A 4OL0A 3S44A 4V39A 4RQBA 3RTDA 4GW3A 3RJ5A 2Q7XA 4OCZA 5A2GA 5IK2D 1ZN9A 3HCWA 5DOZA 3W4JA 1E1CA 1SK9A 4A5SA 1GOTA 1XAIA 3H11A 2OG1A 1JEYA 2XXAB 1LLQA 1RS0A 1KYYA 1TVMA 4U2BA 3JV7A 1DCKA 4BECA 5EXXA 4N6OA 1QYDA 3KQLA 3ZU5A 3GEIA 3Q4GA 1ZO8A 2CJXA 2H54A 3HYLA 3ZCUA 2YJGA 5D51S 3GCGA 3L1UA 4L4RA 1J00A 1CUCA 3QRWA 3TFWA 5HQTA 5ELMA 2F8SA 5JAZA 3HPQA 1ZK1A 2NYVA 1TZMA 4MPJA 5FBQB 1JFFB 1SUPA 2IBSA 2ZWVA 5BSHA 3KWJA 1ESZA 3FPGA 3PQ8A 3KKOA 3M82A 4F4CA 4G9GA 1GN9A 4WL0A 1TW3A 1ZUHA 4UHKA 1V2GA 1M0TA 2JKZA 5B58T 1LZKA 3T7KA 2Q3LA 2QTZA 1MAUA 1QK4A 1UBUS 1Z5VA 4G1VA 2OZPA 3IXQA 3LT2A 4K1XA 2FFAA 3H5WA 4QO7A 3M1YA 4Y18A 1QRUA 1J97A 4KV9A 5FOWA 2MCFA 3VR6A 3ESXA 4E7PA 4QBHA 3WAGA 2FWBA 4MEJA 1V5GA 3GH1A 2GUWA 3ETLA 3F74A 3DTTA 3WNZA 4UUAA 3UTCA 1PJ8A 1HE5A 3NHRA 2A57A 1GZVA 1XRQA 3GZNB 3LQRA 3CC8A 1P0CA 4AG5A 3KUCA 1NVFA 1KZHA 2DB3A 5HCUA 2DKNA 4DLXA 4KDRA 1F6BA 2AUTA 4UCXA 2VPYA 3KJQA 3IEMA 1SHZA 2XWJI 3V34A 2BTOA 1E7SA 5B2EA 2FETA 3TECE 3NZEA 5HA5A 1MUUA 1DLJA 1Y5IA 3CLHA 4K46A 2V7PA 1AZLA 1N3LA 5DBFA 4YGYA 2FW7A 4IIYA 1BOFA 1QFXA 3DE7X 5JY1A 2C7BA 5GIPE 2QYHA 1G6HA 4MV6A 3F47A 5JT1A 1ZGJA 5B3LA 4TUYB 1ZIXA 1IATA 1OCEA 3A3KA 1NMQA 3I4FA 3K9QO 3M70A 4QNRA 1S2DA 2XB8A 3D4LA 4XR4A 5CX1B 1CY6A 3OFND 1EUCB 2QRJA 4IINA 1NBME 4ND8A 3SG0A 5F78A 4TZ0A 5DBOA 1XLWA 5EWLB 1WNTA 2AXPA 1RKBA 1SC1A 1XCGB 2DF8A 2UZ3A 4DT1A 5IC5A 2R5WA 1V26A 3L1JA 1TEHA 4QGHA 5TY0A 5A71A 3BAZA 3NH6A 2EOAA 3WHLA 1IYZA 1WKBA 4EZEA 4DIEA 2QVYX 2F90A 1SBHA 3HU2A 1QG0A 1L5QA 3I5UA 2W2KA 3C5EA 3D2BA 3VR4H 4AX8A 2VXCA 5HZMA 4FEAA 3O8LA 1EIWA 4YAIA 1BCRA 4RPHA 1PNRA 3GNSA 5G41A 2JVKA 1GNRA 3WDKA 4DUPA 5JXJA 2IH5A 1RI4A 4BRWA 4FOLA 3U4DA 5BYJA 5CG2A 3A2MA 1OJLA 2C00A 1IHPA 2LXNA 4FNMA 1PK9A 4LMRA 3TDKA 1P18A 4EARA 1PSDA 5IHXA 2P6RA 1JB1A 1HDEA 1TVEA 1LDBA 2VDNB 4HXFB 4CWAA 4L1KA 4NZ9A 5G3ZA 1D09A 2Q5EA 4RJ2A 5T64A 4YMTA 5KNDA 1QQBA 5JAMA 4RD4A 3FZNA 2G9QA 2AE1A 5JADA 3ZCQA 4CKZA 4BU1A 1TTQB 2VKTA 2RAUA 5FKJA 3CLSD 4G0OA 1AM4D 1KWKA 5JBQA 3EQZA 5JASA 4DM7A 5JJLA 1CVLA 1C3JA 1ILWA 3TL2A 3IE2A 1COZA 4CIXA 1T24A 2EQAA 1XTBA 5ER9A 1G5RA 2DWCA 1EZZA 4PCLA 4Z6KA 5J58A 2G72A 2XEDA 3NONA 5LB2A 3WGVA 5GJWC 5LLTA 4C21A 4KXNA 3CIOA 4ZCLA 4N3GA 1Q21A 1IG0A 4NH4A 4KO2S 3PV0A 4I1YA 4W1PA 1Y0BA 4V0RA 3U0BA 5IBRA 3K6RA 4ESOA 5KU1A 4X95A 4OLAA 4ISCA 3R7NA 3X44A 2ZRHA 4OA5A 1E2PA 2OMEA 4E0BA 3EH2A 4P3NA 1PJQA 3IP6A 4JP1A 2H52A 5WRFA 4JI0B 2OAP1 2X0EA 4MUGA 3WYAA 1EDDA 4BBAA 1KY2A 4CBVA 1NNI1 1T6NA 4DWWA 3OTOB 4AY6A 1G1AA 1LH0A 4Z86A 2HWWA 1AN9A 1UKBA 2ZBUA 1C9MA 2P5YA 1YONA 2BMDA 2NXWA 2OXRA 3C3EA 4BMPB 4Y6PA 3RFFA 1UM8A 3R6TA 3OHSX 1VXOA 2YVUA 4M1WA 4YAJA 2LDXA 1XMQB 5H02A 1X13A 3ESBA 3ICPA 3LLUA 1ZN7A 5JI3E 2CNWA 1TCCA 1XF1A 1V16B 2VJKA 4EY3A 1O77A 5KNCA 3IUYA 2B20A 4WK4B 2X4LA 2EIXA 1PL6A 3E0QA 3E58A 1U8FO 1VCOA 3JWHA 4MQ4A 3ZHRA 3D2CA 3AF0A 2PUDA 4O4HF 4UU1A 1CKEA 1J8MF 1WHTB 3H4MA 4WDRA 3CONA 2EX4A 4RDHA 1YR1A 3CINA 2HPVA 3FCSB 4QREA 4FDVA 3OT5A 5LP1A 1LNZA 2GWHA 5BMOA 4LXGA 5MHTA 4HWTA 2ZSBA 4L02A 4H31A 1XXHB 4URFA 2H1FA 2ZEJA 1FRQA 5B57C 1M2OA 4O6VA 3EIEA 4FFVA 1V7CA 3ZY2A 1V1JA 1SM4A 3DTVD 4MKIA 3UHAA 2H0RA 2R6FA 4DJEC 5B7PA 2V6GA 2PU5A 3IBCA 2H18A 5LQUA 4W7IA 3PFFA 4N39A 3EXG2 1PFUA 4NVRA 5DRYA 1KAOA 4IPTA 1NWCA 2H9IA 1OR8A 2CSXA 2G83A 1ZM4A 3DDZX 2ATEA 2GEKA 3GZJA 3MRSA 4HYQA 2RGXA 5FV7A 5GJCA 1JSLA 4U02A 5D86A 3DEYX 3ZLBA 5DXJA 2MWMA 3U17A 4LOIA 2C54A 2C8KA 2WG2A 5A02A 3PSHA 1TT5A 4NZNA 2FWNA 3NUGA 3ZCTA 2CGEA 3DWEX 2NSLA 4JCOA 4L7VA 3LGSA 3HK2A 4NENB 4M0MA 4YRAA 5EQTA 2W6CX 4DW8A 2IUSA 2AG1A 3BJEA 5FNVB 1QKKA 1Y6QA 2FMIA 3D7MA 3CBGA 1Q0UA 1SXJA 4MYHA 2EKQA 1NTRA 3K5IA 4I6EA 1IZ0A 1UBGA 2WLSA 3B1KA 3MVEA 2XYQA 4AJ2A 1PR0A 3CB2A 4D43A 1LJ8A 1JAZA 2Q8QA 3PNMA 2X19A 4G8BA 4NJMA 2SKDA 3EGOA 3GOQA 4OHCA 4LVUA 3LBNA 4Q4LA 2X58A 3WY9A 2VK2A 4IIFA 2IZ7A 2OZLA 3D0OA 2BFEB 5F7XA 2JLUA 221PA 2Y0CA 1KQPA 1XEAA 3CLRD 1NW7A 2XCLA 2XRMA 4I66A 4E5KA 1Y81A 4H1VA 3ZDBA 1SA0A 3LY8A 4GEKA 1BX1A 1UOPA 3MWGA 4KLCA 1RCTE 3Q85A 4XGIA 1II0A 3OQPA 3DQPA 1BGXT 2ATIA 1JH8A 3D6NB 1JMYA 4ARZA 3JTEA 1TKRA 1OIVA 2PA3A 4RACA 1ST2A 2NYAA 4QULA 5KTOA 4H4EA 3VPGA 2Q4DA 1M66A 1KZ4A 4R7TA 4M4SA 5AK3A 4H1TA 2XWQA 4N47A 4JUIA 3EVGA 1R27A 3KUUA 2YZ7A 1B00A 4IOJA 1IN8A 3BWCA 3DG9A 4MULA 5AOAA 5EUQB 3EXIA 3L1KA 1H6CA 1JGTA 1ACMA 1NGSA 4YP0A 3K35A 3HFJA 1BTOA 3IB3A 3JD3A 2DLNA 3P71T 2IVZA 3SJ7A 3VSDA 4JYAB 1JU3A 5HIAA 4BAUA 2JK1A 2X7XA 2A1IA 4PZ0A 3NIGB 1UP4A 2GN4A 4HNUA 3TQIA 1SC3A 4RMJA 3W2GA 3IP1A 2FX2A 3OLWA 2FHPA 3ETNA 3OY2A 5T5QA 1SCQA 1GKIA 1VJDA 4MS3B 1ZW1A 2AHOA 5EUMA 2YN0A 3VPHA 2VYNA 1YQQA 1GFIA 4NARA 1VKJA 4PO8A 4BP8A 4E4TA 1NVVQ 4P08A 2XXAA 3OIFA 4S1TA 2CEAA 3OQ1A 2BIFA 1O6GA 2YJ3A 4JLDA 1XK6A 1E5TA 2E5FA 4TMYA 4LNAA 4C2BA 2FVXA 4UM9B 4MPTA 5BUQA 1DAMA 4U00A 4RNCA 4ZVLA 5GJVC 4B5LA 3ID6C 4A6PA 4C0BA 3RVOA 1AZTA 1PTJA 3FOEC 3H4VA 1BD3A 1YE3A 2ZUTA 1V3VA 1GGKA 4QAQA 4LXQA 3BGSA 2COUA 4G1EB 4NBTA 4R51A 1E61A 3HCAA 3GLRA 3GT0A 4K81B 2X8AA 4US0R 3SBXA 4O25A 5KTTA 4QECA 3OX3A 3UJ3X 2AN9A 1ZUIA 3H1EA 5HM6A 5HJ2A 2QYOA 3GP3A 3CX8A 1N5OX 5EZ5A 3G9ZA 5JAOA 2C3YA 2HHAA 4QSHA 4K6HA 5KMGA 2NU7B 1KMMA 3S27A 1LRJA 3ONEA 1S5PA 2WVJA 4OXNA 1UT8A 5DLDA 1WETA 1XEXB 3MJDA 5DNAA 2J0EA 4Q7JB 3T1NA 5F2EA 4EPTA 2RC5A 1WXQA 2CXSA 2VA8A 2VSNA 1GGFA 1YRYE 2LNDA 3AWDA 3A4NA 3O73A 2ZTUA 3TBKA 4D4MA 5ENDA 3MCVA 3UJ9A 1D6NA 2Z5VA 1AG9A 4N5NA 3FOZA 5THQA 1YBVA 3PPVA 3ZTTA 4AJIA 4YP7A 2QOEA 4PPQA 2GEBA 1BX0A 3OTIA 4KU4A 3T7EA 4NRDA 1TD1A 3HZZA 5JFOA 4FDTA 3PQ7A 1FP2A 5L3ZA 5K0SA 4AQ7A 2JCGA 4XWTA 4Z0NA 1LPBB 4JBLA 4JWTA 2I4MA 2Q3MA 1XVAA 3GAAA 2QA5A 2GVDC 2OK7A 3OU6A 3PRKE 4ZVKA 1GPAA 2AKYA 1VSQA 4IOKA 4LJ9A 1MTZA 4MV4A 1RXUA 1HDGO 1RQLA 2IZZA 2LVBA 1HT3A 2AMVA 1XRMA 4TUYA 3T0GA 2ORVA 3WQBA 4AZ0A 3SLRA 2CJYA 2FZ5A 1ZD8A 5HP4A 1RKVA 5CX1A 3RS9A 3G89A 1EUCA 4RJKA 3ASZA 4DJFC 3A4TA 3A1UA 3O03A 4ZOAA 3RRXA 1P45A 5EWLA 1MB2A 4TXJA 2GN9A 1E20A 1T1SA 3NHZA 4IHQA 5CX4A 2Z5GA 3TLYA 1GCOA 1ABEA 3A37A 4OGWA 4OQ4A 5DKFA 2Q1TA 4I8IA 2EJBA 1G63A 5DGIA 3ZVMA 2GBLA 1IDOA 1QH8B 1PUJA 2GJAA 2PD4A 2XZPA 3GROA 5IAKA 3X43A 2BD0A 4LHWA 3ZHSA 4K0KB 1ZJ5A 1EJ6A 3A11A 2C5SA 3KVYA 1N7HA 1OBCA 4TTQA 1IAVA 9LDBA 2X1VA 3JQEA 1S7GA 1OB2A 3HJCA 2N1BA 3AGPA 1L3CA 5T4EA 1OWOA 1PT9A 3T3GA 5KTRA 3CUEF 4I1IA 2C92A 4TTVA 4EENA 5KTMA 4OBEA 3HCBA 4TV8F 2DCUA 1Y3FE 1Z25A 2RGCA 4IDBA 3B3GA 1KZ6A 1VDMA 3A70A 1MN6A 4ZQGA 1Z8DA 1YAHA 4AURA 4NCKA 3I6YA 3CS3A 5JZBA 1JU4A 3OQOA 1OGIA 4B3IA 4DIUA 4C7JA 1LD3A 5KQGA 2IYWA 2CVQA 3P0RA 1CU1A 1PT5A 1B73A 1EG7A 1Y9ZA 5FXMA 2ZB3A 4R1OA 2OGWA 3ZG6A 2F3TA 3DAGA 1C7QA 1WSWA 5JXGA 1UJMA 4IDNA 4YWJA 4ZQBA 1Z7BA 4FI3F 2QN8A 2GSDA 1Z4PX 4M37A 2X8BA 2XNJA 3NV7A 2IY9A 4P86A 2BELA 5GWXA 4MB6A 1GSIA 2G4CA 2JJ2A 2VH1A 5G1PA 3MUFA 5IYZB 1Y6GA 1AKVA 2H92A 2O1SA 4NCBA 4H2DA 4HWSA 4BFTA 3USCS 1ZMBA 4EB6B 4HT3B 2H11A 4HNSA 4JL8A 4E2ZA 1K89A 4WFJA 4ZD6A 3W8FA 5FT9A 1JWLA 4IDOA 3GCWA 3SMVA 1Z2CA 3B36A 1H2EA 1RWOA 4HAWA 4LFCB 1P61B 1BKYA 1QQ5A 4D3SA 3LKZA 3K53A 4R54A 4DM3A 4AZWA 4YRSA 1T35A 1SZJG 2WILA 2LRHA 4UNIA 3IV9A 1D8AA 4TMFA 4B9EA 5JALA 4URUR 1QAOA 3ZDDA 1V16A 1N3IA 2ZB8A 2ZIUB 4R8KA 3JQAB 3D43A 5M29A 4URHA 1NXQA 4YP9A 1BMFD 1MAWA 2FSFA 4DVJA 5EPEA 4MUAA 2WSBA 3DAYA 3ADBA 1WHTA 4E21A 3AM5A 2VHCA 1DB3A 4ITVA 4OHUA 1LBSA 5DW0A 4DCVA 3EY4A 2WJ4A 3O4RA 5GM2A 3JYOA 3EQ9A 1XXHA 2H51A 3AR4A 1EA5A 3Q88A 5EYPB 1SHTX 1Z18A 5LOVF 1YQUA 1MVOA 4JBXA 1QX3A 1V37A 2O3RA 4CN9A 1E18A 1ESMA 4H9GA 2C8VA 4JA2A 3STHA 5B4UA 4XIGS 4US1R 2QJTA 4ARVA 3T1TA 5DTMA 4CU2A 3AB3A 2JK0A 1QV9A 1T3HA 1CUVA 3QEOA 2RFLA 2ATCA 3GJSA 3DVRX 2WWYA 1SUWA 2JFGA 2O07A 2YHAA 4GYKA 2IHVA 4RVCA 5FO1A 1J2EA 1H1TA 1T5SA 1CE8B 2GVZC 3OMLA 4O4LF 5CW2A 5BWLA 2N1MA 3SP1A 2F2TA 2KS6A 6Q21A 2PIAA 3PRJA 1FU7A 3KB1A 2ZBEA 1N2CB 5HF5A 4LV5B 4Z2YA 4EX6A 4EG3A 2QRKA 1LU9A 4DV6B 1A9RA 2B4RO 4CKEA 2CBXA 1WB4A 4ZOCA 3TX6A 1W36C 1S2MA 2X76A 3CG4A 3IUJA 5L4SA 2ODBA 3FUXA 3KEQA 1ZLXA 1EIZA 3NX4A 4C4RA 3S5JA 2MT9A 1I2CA 3CNQS 3UJDA 1I9GA 2J48A 3NPMA 4JGBA 4NENA 3NDBB 4YUYA 1RRKA 3FLBA 1K5HA 2D2IA 1SELA 4L75A 3DMNA 3ZI7A 3A7DA 5FNVA 4MQBA 1GUAA 2AL7A 4FEYA 1YUNA 1IXRC 1SOAA 2F1OA 4HVLA 1ZNWA 1JQAA 1U7WA 3FSRA 4GVXA 4GWKA 1EVEA 4LHZA 5EQFA 1DJNA 3K15A 2AE2A 3ISVA 3VYVA 2CD7A 1R4ZA 3G8DA 3Q6MA 1PGNA 3BH7A 1SIOA 4G85A 3ND9A 4PLGA 3K70B 1I51A 2IYSA 4O4IF 3SMQA 1EBBA 2K7ZA 1S3SA 3FDFA 1PR9A 5KYTA 1U0SY 2C20A 3ZDYB 2BFEA 4E14A 1E1QA 4JOCA 1SXJC 2RHRA 5LD2B 1GARA 2I54A 2X0JA 2J0UB 4ENQA 2Z8YM 3HDQA 4G5YA 4S2UA 4F9FA 4Y9SA 1LF0A 1Z26A 4NOLA 4TTPA 1OZFA 4HVTA 3KKLA 4D8UA 3GG9A 3R76A 5IMSA 4TOIA 3BHMA 2IHJA 4LQCA 4PZYA 2M9MA 1PDOA 4HDMB 2O3JA 3DNFA 4CEHB 1CEXA 4YFVA 3UPUA 3HDHA 1QF9A 2HO5A 4G5SA 1DTWB 2HOQA 4K9PA 1JQ3A 5E4JA 2Z4RA 2J6BA 2QR2A 3E5HA 3K9HA 2GF9A 2ZETA 5FO0A 4ZVVA 4BATA 2AD1A 4M98A 2X0DA 3BMNB 3HWWA 1V8BA 4QE3A 1WP9A 3A6JA 3KZXA 2HMTA 4A10A 2AJLI 2FLKA 3IRUA 3QW4B 1G20E 2FWRA 2VPZA 3WL6A 1HM5A 2VJBA 2XUKA 5HJ7A 3UF0A 2R3SA 2O8CB 1DZIA 2YWEA 4M36A 3VZCA 1EVZA 2QUAA 4RCYA 2RH4A 4PSAA 1XLTA 1W47A 3ILSA 1FJGB 4X84A 4MB2A 1RKXA 4PEVA 3LFUA 1YUBA 3ABSB 3D7KA 4J2OA 1UFQA 3AHCA 4EKYA 4XUDA 5CLGA 4MKXA 2OYSA 1I3OA 2I99A 3A7EA 1Y4DE 1L5FA 2HF8A 3FTNA 4MS3A 3TW0A 2XKBA 1GAXA 4R2HA 4L5JA 3W3ZB 3R3UA 3HABA 1KKMA 2V6FA 3FGPA 4ZHSA 5KQMA 3VTFA 2P6MA 5DU2A 1QPBA 1YCHA 4LUCA 2ZJOA 1P9NA 2KWIA 2HSGA 3BFKA 1KJZA 3R0XA 4JOQA 5EJ2A 3RH0A 3MYRA 5FIUA 3JW8A 4M1TA 3UA4A 4UEKA 1F1BA 5A6SA 1U9IA 4E94A 2ZRGA 2IH2A 2X1MA 1FYWA 3WQHA 1LDMA 2E4ZA 2JEYA 2ZZKA 5C5EA 4NV1A 2EGHA 3QVJA 1OTXA 4QQFA 1T8RA 4MQUA 4HAXA 3P2MA 4LV6A 1CVIA 1W85A 4DQKA 1RRCA 1QLHA 5AP9A 4BMZA 3TUZC 4WADA 1C0KA 1RHMA 3P1JA 4FINA 3UGKA 1AV6A 4XSHA 1K3FA 5KI6A 1U80A 3LK6A 5CUQA 3U9TA 2UKDA 3QUQA 3ZWKA 4PYMA 5EZYB 5BOSB 4TM7A 2VJAA 3VNAA 3OF2A 3IHWA 2NU7A 3D8BA 3DZJA 1UBOS 1NKSA 1XWIA 5TT0A 4IEEA 4EF5A 4F04A 1A82A 1OASA 1PTJC 2R5FA 2X0IA 3WL3A 1U3UA 4BO4A 1XEXA 3B3AA 1KOJA 3FMOB 5EE3A 4I55B 1T29A 1V6SA 4PSVA 1WUIS 2FU5C 2WT8A 2ZBPA 4Z0TA 4LV8B 2EW1A 2W2QA 4R0NA 3H19A 1KFEB 1HFKA 3C24A 4X90A 3IBTA 1KTVA 3AYXB 1CXZA 4M76B 3HFRA 3T15A 2DFNA 4JU8A 2BF7A 5U1PA 4MCJA 4KXLA 3FLAA 4YO7A 2AMLA 3E7FA 2PUAA 1N2BA 4DY4A 1XAJA 2GO7A 3HJNA 4MWDA 4B80A 4RLSA 1G4AE 3ICOA 1ORRA 1PT7A 2XWBF 5FWAA 1YRLA 1INLA 2GD0A 2GPBA 4PV7A 1F5SA 2PWYA 1V9SA 3B5IA 4DMUB 3WL5A 3INYA 3MGBA 1BWPA 2HCFA 1AGNA 2IYTA 4IG9A 3D54D 1TVCA 3OEHD 2BI8A 5I7OA 5JS8A 3T7SA 2BOVA 1KO1A 2J46A 2XQIA 3L7KA 5H59A 2G70A 1P9OA 1CF9A 1X8LA 2D54A 3MLAA 3RWOA 1F9EA 1KP9A 5FLXA 2C42A 5K4HA 3NGLA 3QFSA 3UGQA 4Z9AA 1LW7A 4P1ZA 1XTKA 2P41A 4IQ0A 3Q7IA 4PLHA 2N0SA 3WK5A 1C1YA 1QH8A 4QDTA 4F9EA 2JFBA 3LPAA 1Z8FA 2Y4OA 1OI7A 2RBGA 1R5BA 2B36A 2YR0A 2BFCB 3QYAA 1D2GA 3E82A 3OZCA 4B81A 2FRVA 3F5FA 5CAEB 4CMAA 1Z39A 1C9KA 2DPYA 2R87A 4PM4A 2HR1A 1HORA 4LKRA 5JZOA 3JD0A 5CD9A 1NNLA 2VZ9A 4NIMA 1X1SA 2PCJA 1KI8A 3D3QA 5KWIA 3IE1A 2OZEA 1NNSA 2YHBA 4JP8A 2GBLC 2QSJA 1IEVA 5TXGA 4B4OA 1IUNA 4FDLA 1STOA 4JUFA 3T1HB 3AESB 4A7PA 3CZ4A 4MRAA 1R0ZA 1EX6A 4H6VA 2BKEA 4NFLA 3UMCA 3WKCA 3E03A 4ATNA 2OYCA 5LQKA 1FSPA 2I80A 4QSMA 2H7CA 3F5SA 4MGZR 2E4YA 1SVUA 1HG1A 4ZOLF 4UFPA 1AQJA 3FFAA 3IKMB 1PR4A 4XIJA 1GEEA 3TK1A 1W76A 2V55B 1KMCA 4WLOA 1GSAA 1C3EA 5GOTA 4ALLA 3Q8MA 2WFLA 2JCSA 1S2OA 1DUVG 3FKSD 3B89A 1PZMA 1WXIA 2FFJA 4JLBA 2X8JB 4Z4GA 3TLEA 2AA3A 3NG1A 1RSZA 2X9NA 2BTQB 4KLZA 5IYZA 3DLTA 4EEKA 3CRZA 4EB6A 2PKCA 2J0VA 1JVBA 4G9BA 2FSIA 3VDXA 4IMJB 3BGOS 2WLTA 4FVTA 3PX3A 2PD6A 2QTFA 1TXGA 2BEVB 4BXOB 4HQLA 4ZMRA 4OP2A 5AVXA 4RSHA 1IY2A 3KXDA 3QVXA 1KJIA 1JFVA 3DO5A 1R1DA 3O1HB 4KG7A 4LPSA 4MI1A 1PWHA 2ZQ5A 1BROA 1MMFB 2CVHA 1JSCA 3OKPA 4JP2A 4RF4A 3JQAA 3VKFA 3HXTA 2VIIA 3O95A 1E2JA 2I3ZA 2JFXA 2O0HA 2WF5A 3GUHA 3ONVA 3DEKA 1FE8A 4UULA 1BS9A 1TF2A 2JD0A 3SX4A 3R3SA 2HZ7A 2CLEB 1L7PA 5ECWA 1H2AS 1PG0A 3JQ8B 4H0CA 5K0LA 2QN7A 2O0JA 3PXXA 4YCBA 1FBNA 3DXZA 1OBOA 1CDEA 3KQOA 4HLQB 5DFAA 3CSDA 3FDZB 3RBXA 4BFZA 4D02A 1FDUA 4G01B 4CW7A 4EF4A 3A31A 2JJQA 4JN6B 2QVZX 3WZLA 1LPMA 4YV0A 1FUUA 3IBGA 1NBMD 2RJ3A 3B6ZA 2VR1A 4FONA 1G59A 4MYSA 2DFVA 4QQ8A 2JFNA 2P7IA 5J4VA 2B94A 2ZU6A 3NVAA 1I7QB 2O5VA 3I5XA 2YWXA 3NBZC 4B35A 4GICA 4RK7A 3AJ8A 1Z33A 2HM7A 2WNSA 1DC5A 4G0ZA 3OLCX 1NYQA 4V0OA 3VOSA 4D92A 4DA8A 5JCXA 1Z07A 1N2CA 1RM5A 4P7KA 3ETGA 3NATA 2YW9A 3MBIA 2ZJBA 5E38A 4EW3A 2P67A 3C2QA 1PJBA 3DR5A 5KMGB 3R9XB 2AJCA 5HHTA 4RVFA 5K8IA 3U7EB 1U63A 2GEFA 1TOAA 3VHXA 3H05A 4DLYA 3W5DA 4ZVNA 1HDZA 3CXUA 4QFCA 2UYQA 4JVMA 1U7ZA 1RKQA 1FNSA 1Y8AA 1RFLA 2RIPA 1SIUA 3I5MA 3OPMA 1GZ7A 4LK3A 4L78A 5JAQA 5HOEA 5AVSA 5IAJA 5K3CA 3GVXA 1E2IA 5B12A 1XRNA 4A03A 3HDGA 3TLXA 2DM6A 3MSCA 1A5ZA 3SOZA 3DFUA 3K2QA 3ZKAA 5KPJA 2OP1A 2I2WA 4M1SA 1QTIA 1G19A 3DNMA 4I14A 1CBUA 4QUEA 2DUMA 1CJSA 4AXBA 1NLZA 2YXEA 2GDJA 3T54A 4KL8S 2JZCA 5E1OA 2H8KA 4Y9UA 5IBQA 4QOGA 5BSWA 1D07A 1WCIB 2Y4NA 3ZU3A 3GJYA 1CTQA 1VP9A 2J0UA 1YS6A 1QHEA 1CUGA 3Q6NA 1DL5A 3SBDA 1L1QA 3V7YA 4H1UA 2XTZA 1V4NA 2XHEA 4IZIA 4X8LA 4IHKA 4IFIA 2F9LA 4LFBB 4B17A 2HSWA 2CF5A 3SSAA 5D1NA 4XOUA 5GP1A 3DBHB 4HDMA 4ZAWA 1MP0A 4W6ZA 3VPBA 4CEHA 4FEEA 1DTWA 4YRKA 2R62A 4FGUA 4F21A 3UZUA 2OHFA 1HGXA 3BMNA 3HJUA 2XA9A 4AMYA 1N8NA 1YASA 1NBAA 1T3TA 2JZOA 3IO3A 3I04M 4GI1A 5AK5A 4BS9A 3GFQA 3OY7A 4IGIA 5DHRA 3M3DA 4QFDA 1WVGA 5F73A 1THGA 2FTKE 4QEKA 4X3PA 2O8CA 3Q41A 3SFVA 1AD2A 4U2KA 4WT7A 2NV6A 3HWX1 2C2OA 1U5BB 3V4ZA 2ZVDA 1YQWA 1AA6A 4CIVA 1ZMXA 2O2CA 1KF0A 3OPNA 3JD1A 4YRJA 2O2ZA 4WBXC 3SOPA 5IABA 3QUSA 5BYAA 4WN9B 2I0FA 1RBMA 3VV2A 5K3SA 5B64A 1W581 1N8SA 3KZVA 3M6WA 3P9PA 4HR7A 4D9KA 4ZDIA 3HEBA 3GB9A 1W2GA 3LKDA 4KQ1A 3LDGA 1P72A 2Z9BA 3PYMA 4LXIA 1YZNA 3QPCA 3FH0A 3I32A 4MVJI 4GPZA 3FNGA 4I99A 1XLTC 2BGUA 4JROA 3LLMA 3ER8A 4B79A 2GZDA 3W7AA 4ZKEA 4L3WA 4ZRNA 1CQXA 2GFQA 2HJVA 3TL6A 5ITSA 1C81A 1HURA 4Y2TA 4XLZA 4NV3A 2LGJA 3FCOA 4MUIA 4C7KA 1FP4B 3GC6A 1QHSA 1T5DX 2BUBA 2Z9DA 1FXSA 4MV1A 5SZHB 2IGBA 4FUQA 2CMHA 2C96A 2GUGA 2J3LA 4M55A 5EFOA 5I7HA 5CXQA 1HNNA 1FXWA 4JLNA 3ZV7A 4CM5A 5EZYA 1U9IC 2LV8A 3PQ2A 4RDCA 4F84A 5BOSA 2OR3A 4HYEA 4FGJA 2E49A 2JGRA 2P5UA 3OSZA 4KJZA 2YN4A 3MWFA 1CNFA 1GPBA 1CRZA 1JDPA 2EZUA 3LCVB 5HWSA 4X8HA 2AHRA 1PLJA 3ENNA 3FVTA 2PUHA 4B1FA 1OXKB 3EIQA 3PFBA 3Q5GA 4LIPD 4MQ5A 3VTKA 1VKZA 3UHOA 2CXUA 4I55A 1TW2A 1XJCA 4GYYA 1I94B 4LX0A 4NDAA 3AHFA 5KX5B 1ISJA 3AY0A 3MOSA 1ZN2A 4FXPA 3GPLA 3ZJVA 1RRGA 5IC6A 4J1SA 1ECJA 2XNHA 3IT3A 3I0NA 2CEKA 4HX2A 4A26A 4P36A 1ZVMA 1J2TA 2LPMA 3AUXA 1P60A 2ADOA 1NKTA 3TINA 4EW2A 3HJBA 3QPUA 1VLJA 2GPYA 5GONA 1QP0A 1SG9A 2QL9A 1H2FA 3QFRA 2ZCUA 2YWJA 3URKA 4CG2A 2OCKA 3PJRA 3BF7A 4BZQA 3FY4A 4DV1B 2HTEA 4R8LA 3IVXA 3RIEA 4LF7B 4ZVMA 5F76A 1P17A 3OFKA 3KZCA 3CJTA 2H2GA 1A72A 4YO8A 2HEIA 2ASVA 2GZSA 4IMIB 2XA2A 4HFJA 1MJHA 1P19A 1SZPA 4O4JF 4LOKA 4QU8A 5DK4A 3LQKA 2R6GA 3GQBB 3D6FA 3U13A 2RC6A 4XCXA 3LCRA 3OLVA 4EB3A 1C8KA 4GG1A 4NBWA 2QW1A 1W9HA 3IO5A 3L0ZA 1SQ0A 3CV3A 4MX8A 1KEPA 4LYHA 3KD3A 4ITRC 3DE1X 4JAVC 5A4MS 4LCEA 5BQXA 1NI4A 1KR2A 1NM5A 1X3SA 2I8AA 4MVWA 1GPKA 2XE8A 4XSGA 3W06A 3LQYA 4B31A 5HMLA 3A1CA 3F4BA 4S1OA 1DXOA 1RYDA 4KXFB 4BNKA 2JZNA 3S99A 5A62A 1YKSA 4PICA 1T9ZA 2GHTA 3ZWPA 1FC0A 2BFCA 2Q99A 4W99A 2ZI7A 4WHMA 2R7KA 3USES 5CAEA 4IHAA 1C0IA 1NBWB 4FNAA 2R8RA 4MJXA 1HA3A 3HPRA 3LIPA 3EISA 4IX9A 3MBKA 3HVJA 1A97A 2HGSA 2VUIB 3M4NA 3C5HA 4GVPA 4PO1A 2YQ4A 2ZDQA 1J90A 4MDYA 5CB6A 4AJ1A 1BHQ1 1CUUA 4QUHA 3RC2A 4IUBS 2CYBA 2DX7A 3WFZA 4AB1A 4XQCA 4CCWA 4XVCA 4HWPA 2G3YA 3V32A 4M9QA 2PH7A 3OIYA 1GP2A 1DIHA 3EMVA 3IEXA 4IILA 1HLFA 3D5QA 4RV5A 1NYLA 4ENSA 3LBFA 2CB0A 1NU8A 1TYAE 2D74A 2NXCA 4P0TA 1XJQA 4LPKA 3ELYA 3I64A 4B09A 4N9WA 4HWKA 2CDBA 3VSAA 5H5JA 1NMYA 4H27A 4X1YA 2QT1A 4KRFA 1ZH6A 3M6LA 2X8JA 3VR4D 4WK2B 1RADA 1RKUA 3PNVA 4IXNA 3R9IA 1NJ8A 2HGZA 2YRFA 4R8SA 2BTQA 3GLIE 4IZOA 1Z16A 3Q1KA 1QDLB 3HYNA 5KAPA 3RASA 2PT6A 2XDYA 3AO0B 4LDNA 3RHZA 4LY9A 4V1CB 4ZDKA 2LR0A 3PC7A 5AJZA 4QHTA 3DP9A 3L7OA 3SY8A 1YB1A 3M9LA 3UT6A 3W5BA 2I76A 2WUEA 3OU2A 1SR8A 2VRCA 1EX1A 1WEKA 5CYOA 1Y1SA 1V1RB 2BEVA 3FZQA 3VAZA 4V24A 1QO9A 4MVJM 4BXOA 5DLQC 5J9FA 5CP8A 2B7LA 4M6WA 4EJSB 1GUBA 3LP6A 4JVOA 2RBKA 2X5OA 2O7VA 3Q5EA 4MKGA 5BNZA 3DMGA 3ZZUA 5I4BA 5LYJB 3H75A 3QIVA 1JHMA 1TF5A 1RWQA 4CM8B 1LPAB 5HR5A 1X7HA 1BH6A 3GRFA 5C2JB 1YZFA 1NJ2A 1ORHA 3GIWA 2JFWA 1N1MA 1JXQA 1ML3A 1KC3A 3HMKA 3TKLA 4LZAA 4J9UE 1Y98A 4HATA 2ONKA 3JQ8A 4RC9A 3TD9A 2YJNA 2C7QA 2BGGA 4ZI7F 2VBGA 4W1QA 1G18A 1Q84A 1WDWB 4MZXA 1S8NA 3RYTC 3H3XA 1WF3A 3E9YA 4OO3A 5DI9A 1NY6A 3FDZA 3TSZA 1JQLB 2XF2A 5IJ0B 2IV2X 3C6MA 2FPGB 5TSDA 4BQSA 4KXMA 3RE1A 1E64A 3L8FA 4G5OA 1E94E 5AVVA 1M72A 1RYBA 5I5EA 2JIDA 4F60A 3H16A 4DV5B 2ZI9A 4QJIA 4DJTA 1SVMA 2PH3A 4E08A 2P9BA 1E89A 4BNHA 1G6OA 1NIJA 3ECSA 4MUFA 3TUJC 4E5SA 2WKPA 3CUTA 5HQ3B 1L2TA 2C9ZA 4UTRA 5DIZA 1MPTA 4WOBA 4RZQA 1PFGA 2JRCA 2HLHA 4GR4A 3ROKA 2FN3A 4YMIA 4XIIA 4AY2A 1RJ9B 1YUMA 1CIJA 3N7TA 3W9YA 2ZWOA 3RG2A 3X1DA 1JHXA 4PY2A 1JT9A 3B3FA 2PMEA 4WCDA 1R6XA 3R9XA 1XNHA 2OGTA 3BJIC 4UBOA 2ZTHA 3I6BA 4A6XA 1VZ2A 5DT9A 2AMJA 3U16A 4JZKA 4GM4A 1FFSA 2E37A 2PN1A 2ZJ6A 3PQ6A 4YMVA 1IJKA 3R9KA 2WTBA 4PRYA 4C3ZA 4CMJA 3V4RA 3TZEA 1QV6A 3GLHE 4HXYA 4B44A 3MAJA 4JLJA 3GJ8A 3OOHA 1J06A 5KVAA 2HJ9A 1U7PA 4EVIA 1C2TA 1YH3A 3A10A 2JA2A 3A9TA 1Q74A 1U8TA 3H1BA 3IQXA 4UDNA 5UKDA 1CR4A 3TKYA 4JBHA 5CFRA 4BKRA 2VLIA 2AFVA 3MF4A 3LZDA