4QJ3A

Structure of a fragment of human phospholipase c-beta3 delta472-559, in complex with galphaq
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
316
structure length
316
Chain Sequence
RRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPSYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/hydrolase
molecule keywords Guanine nucleotide-binding protein G(q) subunit alpha
publication title Molecular mechanisms of phospholipase C beta 3 autoinhibition.
pubmed doi rcsb
source organism Mus musculus
total genus 110
structure length 316
sequence length 316
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00503 G-alpha G-protein alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.400.10 Mainly Alpha Orthogonal Bundle GI Alpha 1, domain 2-like GI Alpha 1, domain 2-like 4qj3A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qj3A01
2ZJZA 2OAQ1 2ZITA 1QF9A 1KAGA 2CLCX 2ZRPA 4NYIR 3ZD6A 2GVZC 1E9FA 2Y8EA 3DL0A 4OQMA 5AUPB 4D4JA 3I3SR 2ODBA 3SJAA 4XVUA 4I4LA 1AQYA 4Q1BA 1FW6A 3MFYA 3M4YA 3GLHE 1ZYUA 3L0SA 3FHCB 1LB1B 1Z47A 1KZ7B 2HV8A 2O5VA 3DOFA 5FUWA 1ZP6A 2EFEB 2H1LA 4OHXA 3PEVA 1RRCA 4JBYA 1T8TA 2HXSA 5L3QA 1HYQA 1FFHA 4JZKA 3CKLA 1G16A 2CJWB 1JEEA 2O8CA 4R2HA 1G1MA 3LFUA 4HAWA 5KSYA 4C0LA 1NY5A 1NVWQ 4WA7A 3HWSA 1YZLA 3DPUA 3KFVA 3TMKA 3KB1A 1WA5A 3A1TA 3KKPA 4IRUB 4ZKEA 4F38A 2CCJA 2FMXA 1AJEA 1JR3D 2BM1A 2W00A 4GRAA 1VIYA 3A1SA 4PHGA 2OXCA 2EU8A 1KY3A 4MKFA 5BWMA 4WAUA 4Q1EA 4KFSA 4KBFA 2H17A 5F9HA 3RRMA 2DFLA 3NC1C 3LLUA 4YLGA 3U2QA 5B57C 3SBDA 1JR3A 1XXHE 2ZE6A 2IXGA 5SZHB 4HUQA 1J2JA 3HYRA 4OQXA 1F5NA 1N6LA 1KDTA 1UKEA 1W0JD 721PA 3EX7C 3P27A 3RSLA 4TQ9A 1NVXQ 1E96A 1OFHA 4P4SA 1P73A 2R2AA 1BOFA 1IY0A 3PUYA 1E32A 2ERXA 3NXSA 4LWZA 1K8RA 2TMKA 1GZSA 3LY5A 2Q9CA 2YNMA 4PC3A 4Q4JA 2JGNA 2WWYA 2ZXUA 4Q4AB 1XD2B 1Z07A 2XITA 2RGDA 2BBOA 2ZSFA 4DCSA 3ZVNA 3SYLA 3VHLB 3EC1A 3KXKA 5TXGA 4LGMA 1E0SA 2FSGA 4PZYA 1DAEA 4QJ4A 4O3MA 4HDQB 1Q0UA 4L16A 3B13B 4UNRA 1W5SA 2CVHA 1S4QA 4JLOA 2GDJA 2RGXA 1FTSA 4QOSA 4V02A 2IYTA 2V3CC 4UXIA 1HE8B 3LAWA 5KHOC 2QGNA 2GJAA 2ATXA 5FTMA 3C7KA 3GLFB 2QMEA 1E4VA 3AP1A 1B0UA 2Z4RA 4JVSB 1OSNA 2A2ZA 3ZZTA 2GHIA 1RZ3A 3I1FA 2PMKA 3FE2A 3C41J 2JDIA 5JBQA 1GFIA 5AJWA 4Z54A 1OT3A 1N0VC 2WIAA 1OXSC 3BB4A 3EIHA 2ZJ2A 3CNOA 1QDEA 3AF0A 4HAZA 4UNSA 3QBVA 1A5TA 1KO5A 1IONA 1JALA 1A1VA 4DVGA 4BLSA 2QT1A 4M22A 2ZRCA 2FE4A 3DMNA 3GJXC 1X8JA 1HV8A 2G1JA 1US8B 3QQ5A 2XZLA 1JJVA 2W58A 4Q1FA 1UF9A 4B3CA 1VMAA 3AGQA 3SEAA 4DZZA 3W8RA 2W83A 1K6MA 1U8YA 4KV9A 4F4JA 3L82B 1WBDA 1YR9A 4DKXA 1XTRA 3GLIA 1RW4A 1IOZA 5HE9A 1JXMA 1YR8A 2YC2C 4PO9A 2OBLA 3QXSA 2MSDB 4BFVA 2OFOA 1L4YA 3BGWA 5F9FA 2F3TA 1W48A 3CZQA 1A7JA 2ZRJA 4WBSA 1XBTA 2ZRKA 4MQBA 1NG1A 2GF9A 4KXFB 4A1FA 2GJKA 3I5YA 2H8KA 3O8BA 2P6NA 1UADA 4GSYA 1S1MA 5L3SA 1FUKA 1KAOA 3FTQA 2F9MA 1Z6TA 1DO2A 2QBYB 1COWD 3SR0A 4H1VA 4YXWD 1NY6A 3B1XA 1CBUA 2IYLD 2XTMA 2FPKA 1E9DA 2ZRBA 5L8VA 121PA 2BC9A 3CNLA 3EZFA 1EFRD 4US1R 4V0ME 1Z0JA 4YXWA 1E9EA 3GLGB 4A36A 1Z2AA 3N5CA 1DVRA 3QXXA 4CEJA 1DOAA 1EFRA 4TZ6A 1VTKA 2RGNA 3I61A 3WMEA 1ESNA 3TRFA 4X8OA 3EW9A 4HZIA 5EUMA 3LDAA 2R6GA 4KODA 1E79A 1ZAKA 4CEJB 5FFMA 3PJRA 1ZD8A 1PZNA 1XF9A 1FMJA 1P9RA 4QKQA 3FMPB 3GEHA 1AS0A 4S2EA 1ZM9A 2CBZA 2EYQA 4NYMQ 1GRQA 3KXLA 2PBRA 3ASZA 4A8JC 3BORA 1G6HA 3I73A 3KJIA 3O8CA 4M9ZA 5FI1B 1YRBA 4DLRA 2ZANA 1AKYA 2FZLA 3WYFA 3TR5A 2VYFA 4RFVA 4UXJA 1H8EA 4Q9HA 4C0AC 2O8EA 1G7CA 2GA8A 3RWMB 4AYXA 1VECA 3QF4B 4JVNA 1OH5A 2B7CA 1Z0AA 1YHNA 4LHZA 1S9DA 2FGKA 4DUGD 1CR1A 3FWYA 1HEIA 3LQRA 1LVGA 5JRZA 5BN5A 3UG6A 3RAPR 3H86A 5EE0A 4DUGA 3PEYA 1TQ6A 2BVNA 2CL6X 3OESA 4DLWA 3KQNA 4OQNA 2Z43A 1AZSC 1E98A 1KMHA 2BCJQ 2IS6A 1ZRHA 3PUVA 5BW8A 2YZ2A 4LC0A 5FOUA 5J40A 2C9YA 2ZPTX 2PJRA 1EWRA 1PUIA 2RAPA 2PH1A 2H5EA 3RNLA 1C9KA 1E3MA 3R20A 3NEJA 1G3RA 1CJVC 1G8GA 4LBYA 5CK4A 5DE3A 4DRZA 4Z51A 3B9PA 4XIGS 4QBHA 4TZ0A 1W2GA 3B1YA 1U9IA 4GBMA 1A82A 5FTNA 3AVYA 3B2EA 1XTKA 2DB3A 1TADA 4KITB 2GESA 1ZVQA 4Q7LA 1WQ1R 1WE2A 2O0HA 3T61A 4Q4HB 2IS1A 4KI0A 5C4GB 2P0EA 1T0JB 3MRSA 5HKKA 5HR5A 1JR6A 3TIFA 1KI2A 1YQTA 4A8JA 1SVOA 5EUQB 4JL5A 4PANA 1G3IA 2FG5A 3IO5A 4R9UC 3FMFA 4Q66C 3AF3A 5FPTA 4ABYA 2CCKA 2REXB 1HH4A 2CLDX 3C8UA 1GUAA 4JT4A 4V03A 3AM1A 3ONWA 2BKEA 2O8DA 4ACBA 2AX4A 4KSBA 1JI0A 5AR1A 5FL3A 4TYPA 3ZVMA 4C2UA 1UEJA 2PL3A 1J99A 2IYZA 1OJLA 3PUWA 1VKJA 2WMOB 3I62A 1R0WA 1ODFA 4ZV4A 4TLEA 1M7BA 2YOGA 3MLEA 2O8DB 1ZM4A 2J0UB 2H92A 3SOPA 1CLUA 2D4HA 1Q21A 4ZDIA 1IN8A 3AKDA 4M8NE 5CYOA 5BYKA 3Q9LA 1NBME 1NSTA 4OBEA 2HF8A 2AN9A 2ZUBA 3TH5A 1Q1EA 2DWPA 3F3YA 2WWIA 4N3NA 2GCOB 2QE7D 2L0XA 5IRCD 2FFHA 2WJYA 1E9AA 3UKDA 4E22A 1XB2A 4JYBA 1M1YE 2ZI6A 4ZI2A 1TPZA 1MV5A 3BFVA 2R8RA 1MO5A 2X19A 2GEUA 1CU1A 1MH1A 1GITA 4BLTA 4R2IA 1ZNWA 2B92A 1TTTA 1N6RA 1T4GA 3QNUA 3QI2A 1Z6AA 3QKUA 4LZZA 1FNNA 4WW0A 1R7RA 1VDZA 4HEJA 1A2KC 3SJCA 5J4VA 4B75A 2J5XA 2O8BB 1W5TA 1W1WA 2FPMA 1OKKD 2WIBA 3ND8A 5H70A 3C15C 1G9XA 1LFDB 4MH0R 4Q7MB 5AK0A 3SE0A 2F43A 3QOFA 2D2FA 2G3YA 1D8TA 3F5FA 2HJGA 4FMCF 4OHWA 5JEEA 5LB4A 2BIFA 5FTLA 5DSZA 2J9RA 4LK2A 4IXMA 2F43B 2ZYUX 2GXQA 3KFXA 1KNXA 1NIPA 3CZPA 2X2EA 2QMHA 1DTSA 2XTZA 1VHLA 5LD2C 3KQHA 3VKGA 4LJAA 4NMMA 2ZR9A 1KSFX 3O8DA 5C1BA 4HATA 3OIWA 1YZKA 2YVUA 4A0HA 1FQKA 3CRMA 1NF3A 4TN1A 1FNMA 3OHMA 4MRRA 2GXUA 5LDDC 3CWQA 2J0QA 1XFAA 5IK2D 1OIVA 1QHHB 2OHFA 2WJVA 1W0KD 5JJKA 4CT5A 2NO1A 1Y3AA 3KTAA 3LXRA 2AWNA 5IK2A 1CJKC 1N6HA 4CW7A 5KPDA 3CLVA 1QZXA 3CPHA 4KU4A 4RCYA 3U7EB 3W5IA 3DO6A 4Q01A 2NOAA 3KDSE 5KNBA 4PSKA 1D6JA 1BYIA 1EFCA 4E07A 1JPNA 1QHGA 1YZGA 5KU1A 2V7QD 1LY1A 1G8FA 4PQRA 4L9WA 3B5JA 1BMFD 1G19A 1OXVA 3L0PA 5K8TA 2JLYA 4BFTA 5AJXA 4JIMA 4PC2A 1JR3E 4YDSA 5FR1A 1F60A 4PC7A 1RE0A 4D0LB 3FDIA 1BMFA 2XEXA 4Q9IA 4EPRA 2WJHA 2YWHA 2ZVPX 4N0EA 4QL3A 5TY0A 5EXXA 1ZM7A 3AKYA 1YR7A 3CF6R 3I4LA 4HDCA 4WXPA 3TQCA 4BZPA 5BXQC 5JSZA 3QXCA 3U7FB 4DSNA 2JLWA 4GDFA 3NBYC 4B73A 3ASYA 3BS4A 4RY2A 2WHXA 3BIFA 5JHHB 1U2RA 2ERYA 5AUNB 4W7SA 4CEHA 5EXSA 3AB3A 2EFDB 4K81B 3QKSB 3QXHA 4NCJA 5JWRA 2GWHA 4V0MA 1CRPA 4M1MA 4LYJA 4EJSC 4LJ7A 3MMPA 4QM6A 3AVPA 1NNEA 3IIKA 3FKSA 3IEVA 3AP3A 1RYFA 2XOKA 4PAOA 1RJ9B 1D2EA 2QAGA 1M2OB 4UQOA 3FVQA 5LD2B 3RC8A 1IN4A 4LPKA 1RRFA 1PUJA 2JJ1A 4D80A 3GLFE 2XB4A 4B71A 1R4AA 2XAUA 2NIPA 3AV0B 1EFTA 3A4NA 4YMTA 3WMFA 1RPZA 5EP2A 1E2LA 1IN5A 1NMZA 3H4MA 2ZE7A 3D8BA 1VYUA 4WZAE 4OJKA 1CRQA 3KKQA 1ZW6A 3LVQE 3LA6A 4IJMA 4F91B 2E87A 1WBBA 1UDXA 4I1UA 4KCGA 1SVLA 2YWEA 2JLSA 4Q9LA 3K0CC 3DZDA 5FPYA 1R6BX 2HLDA 2V1UA 1NJGA 4HB4A 2FU5C 1XPOA 1WB9A 2FSFA 4C0QC 2VHCA 1OHHD 1NVVR 1TF5A 2HT1A 3SS8A 4RD1A 2KI5A 3IGFA 1OH8A 1GVNB 4Q48A 2WOJA 1UBFA 2JLRA 1NN5A 4MRSA 4X8MA 4BFWA 1FP7A 2ZI5A 2MSEB 4U7DA 1E2DA 4JYCA 3GFPA 4RVCA 3OE7D 1Z5ZA 1PVOA 2R9VA 3A1VA 2P2LA 2R6FA 1M74A 1KI6A 2GNOA 1NLZA 1GP2A 2ZM5A 3THYA 4DCNA 2WSMA 2NPIA 2ZR0A 2F1HA 3K09C 4YDHB 5E3HA 3THWB 2J7PD 2BOVA 2PLFA 3P20A 4AY2A 4DDTA 1KDPA 1E2FA 4FXPA 1JXOA 3BC1A 1MT0A 1TUIA 3RANA 5M04A 5KDOA 2VP0A 4IDQA 1T5LA 3BBPA 5D3MB 4EJSA 5IF9A 1M6NA 2PZGA 4XSHA 1DBSA 2XNDA 4XWAA 2JAQA 4C9BA 1AGRA 2WAYA 5GJVC 3WXMA 2YOFA 5JZVA 1IN7A 2WM9B 3GLGE 4CGZA 3JVVA 2IS4A 2DY1A 4FI3C 1I4TD 5FBRB 3QG1A 4LV5B 3ADKA 2EFCB 1S0UA 4Q47A 1U81A 3BRWD 5JECA 4MDFA 2Z4SA 4BLQA 4EFNA 2XZPA 1E2MA 2D62A 4EDHA 1Q3HA 5DI9A 1SVMA 2VP5A 3VU9A 4BZXA 5G53C 3A4LA 4M0LA 5HTKA 4JLBA 1ZCAA 2H16A 4JKIA 1L8QA 2GJ9A 2YINC 3QUSA 3T06B 3KQLA 4BWYA 4GL2A 1F2TA 1GL6A 3QG5A 1F48A 2DFKB 4FD2A 4TMVA 1DELA 1ZCBA 2ODWA 3VR1A 4G5SA 3BOSA 2PEZA 2R44A 5A4JA 5EQTA 2PCLA 2GETA 4PPGA 1KSHA 2DWQA 3DMDA 3GJ5A 1NBMA 4WZBE 4BLRA 3K53A 3K09A 4MYCA 4RFSA 1OIWA 2C99A 3VKHA 2CEAA 2GJSA 4U5XA 3PEWA 3QF7A 3FHTA 2NZJA 2EVWX 5KDLA 1DAFA 1Q44A 5BN4A 4Y0VA 1MRSA 1SGWA 3JZAA 3HU1A 4RKEA 4TL6A 4FW9A 2I4IA 1BKDR 2QENA 2W6JA 4DEXA 4LHWA 2FOLA 2QPTA 2AR7A 2ZS9A 3HDTA 3LX8A 4PHHA 4TSFA 4TMXA 4QJ5A 4RD4A 4IEIA 4JJKA 3VHXA 3UATA 3ICQB 3AF4A 4HB0A 1OXXK 3K1JA 3P32A 2FV8A 3ECCA 4QHSA 4ZCMA 3PCRB 2VH5R 3DOEA 3FPAA 1OYWA 1XD8A 1FPMA 1Z6XA 1GILA 4EQ6A 2CE7A 1SKQA 821PA 4YMSA 1IXSB 4UNPA 1JAHA 1IAQA 2XZOA 3TVTA 3FHOA 4QBGB 4TYNA 4A2WA 1E0JA 4KSCA 1SVWA 4HB3A 3SDZA 2ZRNA 4L5BA 3SFZA 4XVQA 4JKYA 1Q57A 4LJ9A 1GNRA 4D0GA 1P2TA 4DLXA 1ZIOA 3QSYA 3KKMA 1TU3A 4JSYA 4AKGA 3UWOA 1KY2A 1NKSA 5J4LA 1E2GA 1ZNXA 4YMWA 2B8TA 2VSFA 3GFOA 5FPSA 1QRAA 1TF2A 4NH0A 4B3BA 4LHYA 4CF7A 1W7AA 4PPFA 1MABB 1ZNYA 1G17A 1EK0A 2OAP1 2ZJYA 2DBYA 2HEIA 4JBWA 3QPVA 5KO2A 2CJWA 2F9LA 1CR0A 1G4UR 4KO8A 4EPXA 1N0WA 2QQ0A 1RRPA 2XNSA 1R5OA 1AM4D 3FMOB 4POAA 3A4MA 1E2JA 4KHZA 4UNNA 1HUQA 1P9NA 4XJXA 4D2IA 3ZD7A 1R0XA 3ZS8A 1C4OA 2YV5A 3JZMA 4I1OA 4OJQA 3X1ZA 3ZIAD 1GWNA 2QA5A 4Z1MD 2AD1A 1WMSA 2CL0X 2NO9A 3CRRA 4O25A 5TV2A 1G3MA 2REBA 4TLCA 5JCZA 1P3JA 4JJZA 3ZIAA 4HLQB 5EP4A 2DHRA 3CR8A 2OM2A 4CDGA 5J5CA 3K0EA 1N3BA 2V6JA 4ZKDA 4RZUA 4BLPA 3QKRA 3UG7A 4QXAA 2ZE5A 4MYUA 2WSSD 2ZVQX 4JLPA 1SXJC 1P4SA 2YOHA 5JCPA 2P5TB 2ZSBA 2PX0A 3IPYA 1O87A 2PZFA 1N6PA 4ASUD 1CP2A 3PVSA 1A2BA 3QKRB 4KFRA 3T34A 3WBKA 3MD0A 1W0JA 2BJWA 1FX0A 2ZROA 3T1VA 4LV8B 4HYYA 1W46A 5IHPA 4D0NA 4M2LA 4Q4AA 1AA9A 1XD2A 2D7CA 3L8ZA 4JLNA 3LNCA 1Q1ZA 4NYMR 2BMDA 2CHVA 2ZTSA 3CNNA 4IOJA 4Q4LA 3OFND 1XEWX 3E5HA 1FX0B 4OKSA 4B44A 1C1YA 3CH4B 2BHRA 1E0AA 4B43A 2NGRA 2A78A 2ASEA 3H84A 4QFMA 5EP3A 3UMSA 3IBYA 3X1XA 2QRZA 2JLXA 5FOVA 1G7SA 3D7MA 4TTQA 5DHFA 2AWOA 3DDCA 2WKPA 3B1VA 4C0BA 2QTVB 5HZHA 2Z83A 2ZIAA 2YWFA 3NDPA 3GLFA 4RKFA 5JS8A 3SC3A 3TSOA 3EAQA 3RYTC 4L15A 4R98A 5P21A 4HAYA 4Q00A 5DNYB 1AN0A 2BV3A 2RB4A 3MWKA 3RS4A 1JNYA 3QE0A 4D81A 2BEJA 1YZNA 1VG1A 2XTNA 4BFUA 1YR6A 5CYPA 5KSZA 4Q9KA 2HF9A 2JASA 2IYSA 1ANKA 4QGGA 5TVKA 4MGZR 4TL7A 4B6FA 2JLVA 2ZRFA 3BD9A 3BERA 5DI3B 3ADBA 1CR4A 1RFLA 3CM0A 3A1UA 2IS2A 1W36D 3MAAC 1SXJD 3Q5EA 2QRNA 5HPYB 3K0AB 1US8A 4HZUB 1ZM2A 3BJIC 4LY6A 1VCIA 4B3XA 3QVVA 3W90A 3QKTA 1II8B 3D31A 3FMIA 1AS3A 4LC1A 1EFHA 2WMNB 4UJ3A 2QAJA 3K9LA 1KSGA 1IY1A 4FMCB 2F6RA 3AVUA 2G88A 1W36B 1SXJB 4DC9A 2GILA 2VP9A 4AD8A 1OB2A 5J4HA 1CULC 4W5JA 4PFSA 4LHXA 3L2OB 2C98A 2NPFA 4AKEA 1KJYA 1EX6A 4XOIA 3W6PA 3K0SA 1TEVA 2P65A 1XMSA 2IYXA 5EP1A 2AK3A 2UVQA 1YKSA 3RVBA 4CRWB 1DEKA 2A5DA 1RYHA 2WJJA 2WTUA 3WBJA 2IEZA 2ODEA 1KIMA 3ZLJA 4IXNA 1U94A 3BH6A 4P3YA 3SQXA 4B34A 2QBYA 2ODNA 4BFXA 1DAKA 2D7DA 4NCHA 1GIAA 2QROA 4KLNA 3KUCA 4WOPA 2A5YB 3V9PA 3GLGA 5GADl 3CO5A 4OK6A 1KI8A 4G0NA 1DE0A 1XTIA 2DPXA 4DT1B 4F4CA 1NMXA 4H9GA 3SHWA 5FUVA 1COWA 2MSCB 2DYKA 5CDFE 2C04A 2P3SA 2WBLC 2ZSDA 3MUFA 4LPSA 4NONA 3J81k 2ZYTX 3PQCA 3U4QB 4C2TA 6Q21A 2A30A 2W2XA 4D6PA 2AKAB 2OFXA 4AURA 3THXB 2HXYA 4LYHA 3TUIC 4IVQA 2FSIA 1ZC4A 4EPYA 5DYGA 2I1QA 3IIJA 2ZUDA 3QIAA 1Z8FA 4AC9A 3KX2A 1VCNA 4IOLA 4HAXA 4A4DA 4BFZA 4XD7D 4JT2A 3FFBA 4OK5A 3WHLA 4ERNA 1TNDA 4OHZA 2GJ8A 2GRJA 4MITA 3CWZA 3QF4A 4KFUA 3B7GA 1KHTA 2IXEA 2K5UA 3TBKA 2Q3HA 4PSVA 2BBWA 2VLIA 3LV8A 3EIQA 3CH5A 1DAGA 1Q3TA 3BWDD 3F0TA 4ZPXA 2J46A 2CLSA 3OIUA 1XTSA 5DISB 3O8RA 4KAXA 1Q12A 3AVOA 3CUEF 8OHMA 3VNVA 2ZEJA 2UZ3A 2WWFA 5B2ZA 3I92A 3MGCA 3CRW1 4Q5IA 1LV7A 1KI9A 4M1SA 4GOXA 1S8FA 5FUXA 4DCTA 4PSAA 1E4YA 2W2TA 1XJCA 5JRJA 4RD2A 4M4SA 3W6OA 1VG8A 2RCNA 1J90A 4IDHA 1EFUA 2JATA 2HYDA 3MG9A 1GM5A 1N6OA 3X1YA 3GJ0A 4M1WA 4OI1A 4RZ3A 4DSUA 3DKPA 4F4IA 5KNDA 3GJ3A 4BECA 4V0KA 3VX3A 5J47A 3U44B 4Q4HA 3K0FB 1ZMXA 3A6PC 1ZUNB 1BIFA 4ZDKA 5BN3A 3W8NA 3U6KA 2NG1A 1L7VC 3EWSA 3K9HA 5FL7D 1NRJB 4MA4A 4Q7JB 4MUAA 5CJPA 2YHSA 3T1OA 3WNDA 4TQAA 1KO7A 4TYYA 3KQKA 4QNMA 3KUDA 1OPXA 4M1TA 1MR3F 2D06A 5CLLA 1OV4A 4A6XA 2X2FA 3LLMA 1B23P 4PO8A 3SZRA 2V55B 4OYHA 1O3YA 1XX6A 3SBEA 1KKMA 5CIWA 4CIDA 4C4PA 2ZS7A 4US2R 3L8YA 4TMTA 4NTZA 5GJBA 4E5UA 2J0UA 4OQLA 1ZU5A 4DEYA 2QEQA 4Q1DA 2WWHA 2VSXA 2R6CA 3LW7A 4B33A 1DARA 3OEHD 1X6VA 4GZMA 2GVDC 3U3RA 3EPLA 2QSYA 1Q20A 3U61B 2GCOA 3AVQA 3UWKA 1CXZA 2FWRA 2BCGY 3G82C 1KK3A 1IXRC 2J3EA 3OEHA 3NVAA 4V0LA 5F2EA 1KDOA 1G291 1S3SA 4PAQA 5GJWC 2BMEA 4OL0A 4XTRA 5H1YA 3X1WA 3EZ2A 5DGXA 5G41A 5JEDA 3R7WB 3JVUA 4JL6A 2FGJA 3T5DA 1E2IA 3GJ4A 1OFIA 3R9WA 1E2KA 5KOYA 4QHYA 4DB4A 1QG2A 1ZIPA 2D2EA 2QE7A 4TL9A 3FKQA 1OXTA 4LCBA 1II9A 4ESHA 4RD3A 3ZDQA 2PMDA 2JCSA 1OYYA 1XU4A 2O8BA 4LJYA 3CBQA 2ZRGA 1UPTA 2RHMA 3EXAA 1HT2E 4GPTA 1VG9B 3EZ9A 3UIEA 3HYTA 4BFYA 2QZ4A 5G3YA 2VL7A 4II7A 1QHNA 4BUJA 2ZRLA 3A37A 2IYRA 1BS1A 5E7IA 1DG3A 2IF0A 4F92B 2LCFA 2XJ9A 3P4XA 1AS2A 1XXHB 3VKWA 4C0SA 2O0JA 2N1BA 5JI3E 2O8FB 1OKKA 5EE1A 2GCPA 4F7WA 3ZVRA 4LSGA 4RZXA 1E2NA 2QM7A 2VF8A 4HSEA 5TDHA 1KJWA 1CJMA 1JJ7A 4TQUS 5IT5A 3E70C 4UXHA 1F6BA 1FL9A 4Q7KA 2JJ8A 1NMYA 421PA 3DVLA 2GF0A 2P67A 4HAUA 1HA3A 1W4BA 1DPFA 4C0HA 1FP6A 3VNUA 1PLLA 3MWLA 2ZREA 2B21A 1QHHA 3C4JA 4M9SA 2HJVA 2ZJOA 3VFDA 4TLDA 4GI7A 1CS4C 1NSFA 2ZI3A 3RRNA 4BE7B 2VTKA 2QTHA 2OT3B 1R0ZA 4PHTA 5H8WA 3LBIA 1X1RA 5FOSA 2VHQA 1IQPA 2RGCA 1GKUB 4G3XA 1Z06A 2OE2A 3U6BA 2N42A 2ZYVX 1W0KA 3GJ6A 3K8YA 4BFSA 5JFGA 3B9QA 1WXQA 1OE0A 4URWR 2WAXA 3B78A 4G5GA 1E2EA 5HE8A 3RDPA 3U3OA 4A6PA 4DLTA 3CW2A 4MDEA 3W6NA 4YMVA 2IWHA 4ZIRB 3TGPA 1VYVA 3TR0A 4I1SA 3GEIA 1F3OA 3MWJA 1NLYA 2ZU6A 5LPNA 2ONJA 2UZIR 1KO1A 1IN6A 2B7BA 2Q6TA 2V7QA 3EA5A 4G01B 1OF1A 1JPJA 2J87A 2J0VA 2G1KA 5FBLB 2EWWA 3D6TB 2Z0MA 1GRNA 1GOTA 1TQDA 5EJEA 2NO7A 1D5CA 3LXXA 4ARZB 1KZGB 1TU4A 1XD9A 3R9XA 4KYIB 4EKDA 3B82A 2QP3A 1GL9B 4IOMA 2J1LA 5CM8B 1IHUA 1X3SA 1ZD1A 1E1QD 5KNCA 4EAQA 3B1ZA 3B6EA 3B1WA 2N46A 4O2LA 1KSJA 5AJVB 4D25A 3QKSA 1AQUA 3EWAA 3WYAA 2ZAMA 1E1QA 1Q1BA 1E9SA 1TAGA 1SVKA 4QGFA 4I99A 2OEPA 1T3LA 1W4RA 1GL7A 5J4YA 1N25A 3OIVA 4I81A 3P1JA 4FCTA 1RJ9A 621PA 3WY9A 2WPDD 1PJRA 4GT1A 1XMIA 3OAAD 5CDFA 3QEJA 3TE6A 2ZS8A 4BPBA 2FPLA 1KK1A 1NP6A 4YONB 2O0KA 2ORIA 5EE9A 5CLQA 3QEOA 2MMGA 2LKCA 3C5HA 1XMVA 2PCJA 1KK0A 2D74A 4M9QA 4QBFA 3BH7A 4HUTA 1YZUA 1P60A 1XJ0A 2CDNA 1TQ4A 1KDRA 2YWGA 2RGAA 4NU0A 4DB2A 1D9XA 1E2QA 4B2IA 4G1UC 2IF2A 2WWXA 1GAJA 4GOKA 3EA0A 1HE1C 2OCPA 1SKYB 1UKZA 3QJYA 2ORVA 3NH6A 4TYQA 2RKOA 3ZZ0A 5DLQC 1QVAA 2KBFA 1NKTA 3ZQ6A 2ZSEA 4Q9JA 2AHOA 2PEYA 5FPHA 1KO4A 1UAAA 1SXJE 3S1AB 2XX3A 1OHHA 1S96A 2OLJA 1IXZA 1E6CA 3AVXA 3IDQA 3THWA 3UXMA 4IFBA 4FCVA 2J41A 4M1KA 4X8HA 3TSWA 2JLZA 3NC0C 2Q0HA 3C14C 2C9OA 3WNBA 2JJ2D 2ZJBA 4GOJA 3Q7QA 4PC6A 4TMZA 1ESMA 4P4TA 1G7RA 1XEFA 1XRJA 1VCOA 3IQXA 3OE7A 2OZEA 2JJ2A 4MRVA 3HJNA 1GNQA 1P2UA 4PTLA 2WV9A 3HR8A 5D3MA 4ITRC 3R8FA 1E2PA 2J7PA 3NBXX 4P33A 4WVFA 2EQBA 3PG5A 4KYUA 4ZDWA 2AK2A 4JS0A 2PT5A 3RSOA 1HT1E 2ZI7A 3F8TA 2AFIE 5CK5A 4AG6A 1FOEB 3W9YA 1U8ZA 3I32A 2CK3D 4NHOA 4PQYA 1UBGA 3MSXA 1E2HA 1TQ2A 2CK3A 4ZCIA 3TKLA 1KK2A 5TMPA 2FSHA 2XJ4A 1JBKA 1W49A 3VR2A 1KYIA 3QPWA 2IHBA 3LX5A 5JI2E 1S9HA 3IPXA 1VHTA 3BFXA 2PZEA 4ILEA 5JJIA 3EPKA 2P5SA 3OZXA 1Q22A 3NH9A 4OI0A 3K0CA 5J4KA 1A4RA 4W5HA 2G6BA 1OFUX 2NZ8A 2QSZA 3SNHA 1VYTA 2J45A 2GEVA 2OILA 4EPVA 3ZJYA 3AVWA 4LUCA 3NEYA 2ZI4A 3L0IB 2CE2X 4L4UA 4BEBA 4GZLA 4A2PA 1I4DD 1RC8A 1IM2A 4NL4H 5ANRB 1G5PA 1P62B 2J7KA 3IILA 5L3RA 2BMFA 2BDTA 2FX3A 3OF5A 3VR4A 5A5GA 2E9SA 3L0OA 4AKHA 1UEIA 1U0HC 2FNAA 3IHLA 4US0R 5DN6D 2GCNA 3CONA 2NQ2C 4PPQA 1G8YA 1EESA 1G3UA 2YKGA 1KI1A 4P4UA 3NDBB 4U00A 4B3FX 2IK8A 2QGZA 1ETUA 3AVTA 4FN5A 1E94E 4EFLA 4ESVA 2AXPA 1IJFA 1XZPA 2R6AA 5JJLA 3R9IA 3BB1A 3V00A 4C7OB 3PITA 2RGBA 4EPWA 1NJFA 3AQ4A 5KPJA 1Z29A 5JLJA 2CVFA 2RGEA 1G8PA 3GD7A 5AJZA 4QHTA 3TAHA 3LD9A 1H65A 2W6ID 3A8TA 4L9SA 5K8IA 4OQFA 3UMRA 3A36A 4URXR 3FYHA 4MGKR 2OCYC 4TMKA 1CKEA 2FDCA 3EZ6A 4LI0A 4C0KA 2W0MA 1NN0A 4L8GA 4PHFA 2ANBA 3KKNA 1X86B 4OHYA 1NN1A 4DXAA 2WKRA 3RS0A 1E1RD 4LJ4A 3E1SA 2XXAB 1R5NA 1NL3A 4IDOA 1PV4A 2PJZA 3TJZA 5EXPA 3LRPA 4DJTA 4DHEA 1QHXA 1UKYA 4IDNA 5H68A 3K70D 3A58B 3PEUA 4MKIA 2QMUA 1MABA 2BBTA 3T12A 4R71A 2ZJ8A 2HDNB 3UPUA 4Q18A 4WZ6A 5KTYA 4FIDA 3KZ1E 2YYZA 4Q02A 1JB1A 2ZUCA 2FN4A 2WKQA 1XZQA 1D2NA 2XB2A 3BB3A 3AUXA 1NIJA 3K70B 1Z83A 1AKEA 2GK7A 3UANA 4O0MA 3GMTA 1ZINA 1DAIA 3ND9A 4NYJQ 2RGGA 4TT3D 3KB2A 3N2EA 5B30A 1N5KA 2OBNA 5C2JB 3PUXA 4ZCLA 5GVSA 1UM8A 3M1IA 2WJIA 4TT3A 1XCMA 4LX0A 5EZ6B 4QGAA 2Q3MA 2R6DA 4EIWA 4G5RA 5AJYA 4KVGA 4B3GA 1R2QA 2C03A 1V5WA 1R8QA 1GDDA 2PT7A 3LVRE 1RIFA 4JLMA 4PQFA 4Z1MA 5KSOA 4AYTA 4X8LA 2VPPA 2D3WA 2QNRA 2X77A 1RVDA 2OESA 3TLXA 2WVJA 3SI7A 3SU8A 1W36C 1KMQA 2G0TA 4XTCS 1JEDA 1Z0IA 5BYJA 5FTKA 4PAMA 2E1RA 4DCVA 2A5JA 3CRQA 3TQFA 2WSSA 4JMPA 3VR3A 2J0SA 4AG5A 1L4UA 4C30A 4XWKA 5L3QB 1G41A 4EUNA 1KNQA 2IT1A 3HP1A 4ASUA 2O8CB 4JLVA 2KBEA 3QENA 1YJ5A 4DIDA 2GK6A 5FPKA 4GP7A 1XMJA 1YVDA 2HT6A 2F55A 3EARA 5F3WB 3RS2A 2XGJA 2QMOA 3GJ7A 4DDVA 2OV2A 1XTQA 5DH9A 4E03A 3VMFA 3KJHA 4K8OA 2JA1A 3OFNA 1J8MF 1DG1G 4IW3B 4HAVA 5FI0B 3SFVA 1KI7A 3O47A 2FZ4A 1M8PA 3KL4A 2OLKA 4BGDA 4XVRA 3IUYA 2GZAA 4HUQB 2ONKA 2W0SA 1Z28A 4Z8YA 2KJQA 2V1XA 2ZJAA 1LTQA 3DM5A 1OH7A 2C8VA 2GAOA 4PO1A 1E0KA 2NO0A 4PXAA 1ZNZA 4P4SB 2C5LA 1G21E 3NBFA 5JWOA 4RCZA 1AGPA 1W4AA 3MCAA 2IWRA 5DI3A 4AYWA 3QY0A 3AF2A 1X8KA 3BXZA 2A5FA 3TW4A 4W5WA 2QP4A 5F98A 2EFHB 1YZTA 1GTVA 4NP6A 4P31A 4Q4JB 2EFGA 3K0AA 1VG0B 2GZDA 3MJRA 4HZUA 4DWJA 4LBWA 3CIOA 4LJ5A 1MO3A 4OI4A 1II8A 2IYUA 3IO3A 4FMBB 2VBCA 4P32A 2GXSA 2IL1A 2V8OA 4XWOA 3LBNA 2AL7A 1SXJA 1Z0FA 2EYUA 5UKDA 1QG4A 5SZKB 3LO5A 1XWIA 2ZYWX 1R5BA 2JDID 1G8HA 1P7CA 4DLUA 1BO6A 1QHYA 1M7HA 2ZQ5A 3DM9B 1XEWY 5DHAA 2RGNC 2G77B 1HURA 3BFKA 5FR2A 2VRWA 3VR5A 1P5ZB 2AFHE 4ZI3A 2VP6A 3IIMA 3EC2A 3MJHA 1AZTA 4DSOA 4Q21A 2X1VA 5KDDA 2IYVA 3DKVA 3FB4A 2ZAOA 1J70A 4PZZA 2OCBA 1P75A 1TF7A 1FMLA 5B58C 2CL7X 4FMDB 1UDWA 1HQYE 3TW8B 5AUOB 3CPEA 2BJVA 2IXFA 2NTYC 3TK1A 4RZ2A 4OK3A 5FUYA 3CR7A 1R8SA 4NYIQ 1S3GA 1PLKA 2VEDA 1E99A 2VHJA 3AKEA 4HLUC 4B6EA 2FEMA 1MO6A 4DT1A 2HCBA 5DIFA 4Q1CA 4C0JA 4RJLA 2KE5A 3FOZA 1OLOA 2ZR7A 2IA5A 3BK7A 5K8LA 3U4QA 3L43A 4LYAA 1XP8A 1Z0KA 2F7SA 5FBQB 4P0TA 1G5TA 3CB4A 3RS7A 3AGPA 2REOA 2QUZA 3GLIB 3THXA 4TYWA 1LF0A 1Z6YA 3TUJC 3U5ZB 1N2CE 2F1RA 3IHWA 1M7GA 1KJZA 1SQ5A 2C96A 5E7JA 1XDBA 3ZZUA 2JEOA 2WOOA 3GPLA 1PLJA 2HUPA 2QORA 3CX6A 1P61B 1YRAA 1SKYE 1Y63A 4JSTA 4MUBA 1VIAA 5L3SB 3LWNA 5BQ5A 1QHSA 4B32A 4I1VA 1NN3A 2IUSA 1MKYA 1WF3A 1ZU4A 2C77A 3CX8A 4MYTA 4XD7A 1S2MA 4YMUA 3NTUA 1E79D 1OW3B 5E4FA 1EG7A 4A92A 5JHGB 1U9IC 3B85A 2H57A 2CMKA 5FH9A 2A9KA 1DO0A 2OO7A 3LQQA 1SZPA 1NG9A 1XTJA 4A0GA 4AI6A 4OHVA 4LJ6A 1UBCA 1W47A 2LWIA 1WDTA 2R62A 4YQFA 1Q1QA 3FGNA 3VAAA 2ZI9A 4AIIA 4GMXA 3EG5A 3SYNA 3TNFA 1LF5A 1KTVA 1WCV1 2CCGA 1EXMA 3GCGA 1HTWA 4Q03A 3ZYCA 1E69A 1TL7C 2JLQA 3I72A 4RD0A 4HLUA 1UFQA 2V54A 4A2QA 3E2IA 1H8ED 5FOXA 3DHWC 1G4AE 3W3AA 4LOAA 3VR6A 4IDPA 3X2SA 2OFWA 3U7GA 4PC1A 4QBIA 3AF1A 1U8AA 1D9ZA 3M6AA 4NPHA 3U44A 1QBKC 3K0FA 1UJ2A 2C2HA 1KI4A 2W2VA 4FWIB 1G20E 4BRUA 3VX4A 1BH2A 2O8EB 4AWXA 3SQWA 3BH0A 1LNZA 1P2VA 3P26A 1M34E 2GAAA 2ANCA 3AUYA 2ZRIA 5G3ZA 1N5LA 1SHZA 2R65A 2B6HA 5FTJA 2GBLC 4CEIA 2Q3FA 2G9NA 2F1IA 3NKVA 1NLFA 1XEXA 4F93B 4IHQA 4B35A 3NWJA 3PENA 1CR2A 4M9XA 4TMWA 4XSGA 1G64A 2BMJA 2CNWD 2G0NA 5CB8A 4CEIB 3REGA 2VF7A 1XEXB 2YJTD 5EZ5A 3BE4A 2QI9C 2IYYA 1KMHB 2BBSA 5FL7A 2AD5A 3BAFA 2CNWA 3GFTA 2VP2A 1II0A 4U02A 3LW8A 3VQTA 3TVDA 2HCJB 5FBVB 3GP8A 5GVRA 3AVVA 1ONBA 3WRYC 3N70A 2FF7A 1WRBA 4E09A 4EPTA 4NCNA 1L2TA 1SULA 3PV0A 2ORWA 4NE2A 4D4MA 4DDWA 3W5JA 2VP4A 1N6NA 5ELXA 1I2MA 1DAMA 1OIXA 1T3HA 4HLDA 5LBIA 3T5GA 1JQLB 5HKKD 3NHAA 4UNQA 3CPJB 1R10A 3QPUA 1BYUA 5L3VA 1T8UA 3AP2A 3H2YA 5CIQA 2WJGA 2V4ZA 1T91A 2QM8A 1GRRA 3P4YA 3REFA 4B2LA 3GLHA 3R7WA 3TSZA 2VQSA 1KKLA 4EFMA 2MMCA 3KJEA 1U98A 4DSTA 2CXXA 3AEZA 1KOFA 3U60B 4CVNA 1SVIA 3NIBA 3GLHB 2V6IA 4QJ3A 1Z0DA 4A8JB 3NHBA 2NO6A 4QGHA 2QG6A 2RHDA 1S1CA 3AKCA 2A3RA 2Z6VA 4LBVA 3WP1B 1U90A 4V0NA 5HCNA 3RS5A 2ZJ5A 4K46A 4HLCA 1MOZA 1E9CA 4KLZA 2VHTA 4JL8A 2WICA 4MRPA 2CHGA 1MO4A 3OEED 4LV6A 2GBLA 2ZRAA 1XPUA 1N5JA 4TWZA 1XXHA 4Q1AA 1IY2A 1KI3A 1Z08A 4N1AA 2FH5B 3OEEA 3TUZC 3LH5A 2O8FA 2SHKA 2QP9X 2Z5FA 4QG7A 4Y0AA 4M1OA 5TB5A 1XJQA 5AWFC 2IUUA 3V4FA 4GNKA 4DDUA 1ZUHA 2IX3A 2VSOA 4ON9A 4JLJA 2EWVA 1FUUA 4IKEA 3G0HA 2RMKA 2C9CA 4RSGA 5C46F 5C18A 3UK6A 4URZR 4IOKA 1AIPA 4KVAA 3RABA 3T15A 4J0QA 3HPRA 3PXGA 1U0LA 3B8HA 4URYR 1OH6A 2Q21A 2I1VB 3LBHA 1N5IA 2BWJA 5FBWB 3RHFA 2F3RA 4FMDF 2PLRA 4MKHA 4IVPA 4G5OA 5A0FA 2Q9AA 2FA9A 4AK9A 3I5XA 2QU8A 3MWYW 1GNPA 4N0DA 4XH9B 4G5QA 3HU2A 1ZUIA 4LBZA 4UJ5A 3ZQJA 2QN6A 1AK2A 5CITA 2V9PA 4NCKA 2B8WA 1ZC3A 1K5DA 2VA8A 4NKRA 1N0UA 5CJ2A 4ZIRA 3D3QA 2ZRHA 1XPRA 2ATVA 1YZQA 1H8HD 3G5UA 3EZ7A 1F2UA 3CX7A 2AKYA 1P9WA 4FWTA 2YC4C 3IKJA 4IFEA 2QAGC 2FFAA 1H8HA 1XCPA 4R7ZA 1W44A 3ZVLA 4FCWA 4BRWA 4UKDA 3RLFA 3K9NA 5EE5B 5LB2A 4B74A 5FOTA 3DEFA 4TTRA 1F2UB 4ARZA 5E7MA 4URVR 1CF4A 2OCAA 4DBLC 2VO1A 1ZBDA 4MGYR 5D3QA 3I8SA 5CB6A 1G3QA 4PX9A 4JVMA 1DADA 1KGDA 4NZYA 3EASA 3RWOA 3W34A 3KTAB 2J59A 1OB5A 3C16C 4A15A 1T9HA 2FFQA 3T35A 2PX3A 2KB0A 2I3BA 1WP9A 3FFAA 1CJTC 4M53A 3PIRA 4CYMA 5DO9A 1ELOA 3THOA 3KQUA 2C95A 4WIAA 5B64A 1KO8A 1J8YF 3SN6A 1E9RA 2BKUA 4LDJA 1EWQA 2OXRA 3RRYA 1T3SA 2QT0A 4JVLA 1Z63A 5IDVA 5JWHA 1CJUC 2EW1A 2RH5A 5FOWA 1U0JA 2WPDA 5JMTA 3OAAA 3WP0A 3SYKA 4IVRA 1XNJA 4DLYA 1T6NA 1CTQA 2Q9BA 3GQBA 1SVSA 2QQEA 2HYIC 1EGAA 5K8UA 4IEEA 4B48A 3A1WA 1QVRA 4WXRA 4HI0E 5JSZB 2UKDA 1MRNA 4A0FA 2BM0A 4CZ2A 3PR1A 4PZLA 3FKSD 1YE8A 1QHIA 2XOKD 2CHQA 4A9AA 1G5RA 3ADDA 2JLUA 2QPOA 4CEHB 2JJ1D 2VHUA 3Q3JB 1R0YA 2JIZD 3WNCA 3S1AA 1IJEA 3KXIA 3U7HB 4ZDJA 1ZD9A 1FQJA 2JIZA 2QL6A 3PUZA 4DIEA 3U3MA 4QM7A 1VCMA 3CF0A 4BZQA 2KWIA 3WMGA 2QAGB 3WHKA 1JAIA 3IEUA 3EPJA 3WYGA 1U99A 2QTFA 4LHVA 2FFBA 3R8CA 2LKDA 4LYFA 1G6OA 2HLDD 2ZRMA 2H18A 4GMDA 2IUTA 2XSZD 3HPQA 1FZQA 2IBMA 5DYIA 3RC3A 1TMKA 3OIYA 3T1TA 1Z3IX 4NDZA 5E95A 1G7TA 2XSZA 1I2DA 4NYJR 4A82A 3HR7A 5KUTA 4W9MC 2DWOA 1CIPA 2GTPA 4RD6A 2DFNA 3AH8A 1RKBA 4QC2A 4HDOB 1NVUQ 2FJUA 1Z2CA 3NBZC 4QNRA 1I4LD 4TL8A 5HZKA 5CM9C 3KKOA 4B3DA 2WWWA 2ZU0C 3NG1A 5AUQA 5KYKA 2ZSAA 3K9GA 5SZIA 3GLIE 1X8LA 3KJGA 3SJZA 1SHKA 2G83A 3Q7PA 4M1YA 2OSBA 3I8XA 5EXTA 1KI6B 4DLVA 3THYB 2KSQA 1K5GA 2C78A 4TLBA 1P6XA 5G40A 3HU3A 1J7KA 4OI2A 5JS7A 4HB2A 1TX4B 2XNDD 4KFTA 3IBGA 4M21A 4TTPA 5KSPA 4BLOA 4B76A 2H7VA 4GP6A 4JLAA 4MKGA 221PA 1N6KA 4QRHA 3ADCA 3V4RA 2IC5A 4D26A 4NBSA 4AKIA 3VTKA 2ZE8A 4GFDA 1X1SA 3SJBA 1XCGB 3QXJA 3N2IA 2GEDA 4EJSB 3K70C 3EPHA 4B47A 1VPLA 2ZRDA 1W2HA 4H1UA 2QY9A 3GEEA 3IQWA 4BEJA 5HCIA 3DZ8A 3Q72A 2ZETA 3RRZA 5GJCA 2A7QA 521PA 4BASA 3TAUA 3CRVA 3PFIA 2OUKA 1LW7A 4KJZA 2A5GA 1GKIA 2O52A 2VIIA 3QBTA 3ICEA 3Q8XB 4BQSA 2GXAA 4Z8XA 1JQJC 2NMVA 4C7OA 1LS6A 5DN6A 1EX7A 1G18A 1V43A 2IEYA 4YC7A 3EIEA 3VU9B 1TUEA 2DFTA 3X1DA 1P2SA 1NI3A 1UKVY 4D82A 2X8AA 2DCUA 4PPNA 3C5CA 4NCIA 2P6RA 1GSIA 1YU9A 2OBMA 1NBMD 5TARA 2BEKA 1Z6GA 4KBGA 3Q85A 1P72A 3Q5DA 1JECA 1F2TB 1T0HB 4JBXA 1CEEA 3QVUA 4MRNA 3SHFA 4Q19A 4D4KA 4D4LA 3ETLA 4TLAA 2OG2A 4JLKA 3W3ZB 2IW3A 5C4MA 4CT4B 1D2MA 1ZM3A 2XXAA 1HY3A 1IBRA 2W6IA 1DAHA 2AXNA 4FINA 1DS6A 1FTNA 2W6JD 3H0KA 1T5IA 4PR0A 4TSFD 4A0RA 2GZHA 1OXUA 1HQCA 4MGIR 4DCUA 2IHYA 4RFSB 1N6IA 4ACAA 3B60A 2GKSA 3U3KA 4DLZA 3ZS9A 4S35A 1UBEA 3H1TA 1W4CA 2FEOA 2WWGA 3ZH9B 1E1RA 2IYQA 4V0OA 4DLSA 3T1QA 2P6UA 3WRXC 4LRWA 2F1JA 4ZO4A 3M0EA 1OFTA 4O2RA 2WZQA 1ZJ6A 2ECKA 5SZJA 5EE3A 1LS1A 3ZGXA 4JLDA 1GG2A 3CF2A 3RS3A 3U3JA 2IYWA 2QPAA 1E9BA 1RRGA 2DR3A 4LJ8A 4MYHA 1TEXA 1Z22A 4EQ6B 4B2PA 3GJ8A 4URUR 4C3ZA 3UMFA 1NVVQ 1GKYA
chains in the Genus database with same CATH superfamily
2YZ7A 3INRA 2ZIFA 5AFSA 2CLCX 2PH3A 2EKPA 2ZRPA 3DLCA 1DX6A 2AN5A 3BDAA 3Q10A 4IYRA 4NVRA 5T6BA 4CU2A 2X4DA 2Y8EA 2NYRA 4OQMA 3RTGA 4ZARA 4DTIA 2W4IA 3NWPA 2YFKA 3FPCA 3I3SR 4KWEA 3QWBA 2M6SA 1AXGA 1SU7A 3OURA 1P0PA 3OX3A 4XR9A 3SJAA 4UAUA 4I4LA 2O3SA 5DPMA 2ZQYA 2Z2KA 2BSAA 1GCGA 1N7HA 3E5MA 4QLBA 3IMGA 2YDXA 3TX6A 1ZYUA 3DT8A 1QH1B 4MV4A 4F5YA 1FYDA 2HV8A 4NEQA 4J1TA 4DLNA 1T9GR 2EFEB 3KZKA 3P9YA 5IM4A 2P27A 2CBGA 2ENWA 3UN1A 2H1LA 4G9GA 3CZ5A 1AA6A 4WERA 2UV8A 1T8TA 5ESWA 1ZQ9A 2HXSA 1XDZA 4Z7NB 4OUDA 5L3QA 5HP4A 4JZKA 1ZJWA 2CJWB 3FNQA 3H5RA 3WXBA 4M89A 4R2HA 2Z8XA 1HKUA 5CH8A 5DEIA 1O58A 3CURA 4D41A 2I2WA 5G0WA 2ZUTA 1EXWA 1U0EA 1NY5A 3F3MA 3FM9A 1NXXA 1T4MA 4WA7A 5KSYA 1TO6A 3HWSA 4BU1A 1YZLA 3RW9A 1M1ZA 1QSGA 4OBXA 5CPFA 4IRUB 3GEDA 1B1AA 4LF6B 1J42A 2FMXA 3HVKA 2BM1A 4UC0A 1YIOA 1VIYA 4F1WA 3HC7A 3RRBA 3AR7A 1KY3A 3ZKWA 4BGUA 5JZBA 5F9HA 4CF3A 1NUAA 3G5AA 2PX8A 3SBDA 2ZE6A 4HWOA 1EHCA 3N0RA 1PUXA 2IPOA 3D5QA 2C4UA 1N6LA 3EMBA 3RLIA 4YCCA 1CIJA 3HB9A 721PA 5B4VA 3KS9A 4LEIA 3O2QB 5DV9A 3WFJA 4CG0A 4TQ9A 1NVXQ 2Q1TA 4E08A 2KMLA 1ABBA 1YJCA 4MICA 4ETWA 4PPYA 1BOFA 1E32A 4ZPJA 3K6SA 1B43A 1TIPA 1NV9A 2XR1A 3G2IA 3OA0A 1MEOA 2YNMD 3EXEA 4FU0A 3RKSA 5CG2A 4MB2A 2I76A 2ERXA 2P78A 4XDYA 3V8BA 4AWAA 2PZJA 4AJEA 1K8RA 2TMKA 3IOBA 5ILGA 2GEBA 2G1PA 2VJAA 3Q15C 3EZGA 3RAGA 1ZD4A 2XYRA 1BS2A 4X54A 4Y6SA 4Q4AB 5F3DA 3T3NA 2XITA 4RX1A 2ZSFA 2A4MA 3ZVNA 4PYIA 4HX5A 2AC7A 2GD0A 3EC1A 3EPRA 3VHLB 1NVMB 2ZTUA 5TXGA 1KGSA 1T4CB 1LK0A 2ZWAA 1E63A 2FZKA 5HILA 3OE1A 2P7IA 3GN1A 4H1TA 3VYWA 3ZGZA 3VR5H 3N7TA 3FMVA 1I01A 5DWDA 1PFWA 3B13B 5FO1A 2FR8C 5BQFA 5KIAA 3BUSA 1IATA 1EUDB 5I7OA 1JGTA 2RGXA 1FTSA 3A10A 2GKOA 3FTDA 2ID4A 2IYTA 4QOSA 3MRXA 1JR2A 3ZE6A 4GM1A 2H07A 3ZHQA 4C3UA 2XMSA 1SO8A 3LAWA 2B1QA 1X38A 1G8KA 5IX8A 3F6EX 2QTCA 4FC7A 3AJ9A 3COPA 3ANSA 3PXXA 2VTBA 1K3TA 3C7KA 3C8DA 1GEGA 5HWSA 3ENVA 3AP1A 4MUNA 2Z4RA 3FJYA 3HKCB 1E7SA 2A2ZA 5EA2A 3ZZTA 1E3MA 1K4MA 1RZ3A 3G8YA 2PMKA 3H9GA 4IIEA 1JDBC 1IWBB 4WZAB 5ERGB 3C3KA 2FUNB 4HDKB 1Q0ZA 2W4QA 5AJWA 1Z5VA 1OT3A 3FCSB 2WIAA 1ODTC 1H0RA 3EIHA 2ZJ2A 3B70A 4GI5A 4HCJA 5ALXA 1BHSA 1VSBA 1YUMA 2QUKA 3OZ7A 4HAZA 1A5TA 1Y8RB 2II6A 4GGPA 1NUSA 1U7WA 2BUBA 2HTFA 3ETDA 4JJAA 3E22B 4KQ6A 2CFTA 3RG8A 1SD1A 5IF3A 3FHLA 1OWMA 4Q0MA 1JJIA 1TKCA 2WV7A 2ZRCA 1UBSB 3NTRA 4L08A 4MRMB 5IVIA 1P4AA 2I65A 2X86A 3GJXC 5JJCA 2QRLA 1HV8A 2FMIA 3M6MD 4JQOA 4CKYA 5M7EA 3ADDA 3W7VA 3V3KA 5HDQA 1SB8A 4Q1FA 3ZQKA 3AZPA 4DZZA 3W8RA 3NO4A 1K5PA 2IRWA 1SR8A 1K6MA 3KWLA 4KV9A 4N0MA 1YR9A 1IK4A 4U7WA 1NBAA 4CMIB 1IEXA 2WZCA 3NXKA 1PE0A 1CJCA 3EGXA 1JXMA 3Q3EA 4PO9A 2Q8PA 4W6ZA 1T2VA 3QXSA 3F2VA 3Q7TA 5H81A 1OJ7A 1Y3DE 1O57A 1M6WA 3UO8B 1J06A 1TRKA 2C54A 2Q5OA 1A7JA 4HQ0A 5FYDA 2J3DA 3GVPA 2AVNA 3B1KA 4ZQCB 2ZRKA 1JRLA 2HQOA 3D3WB 2GF9A 4MQBA 3V97A 2GJKA 1ISGA 2DULA 5JSKA 5IH7A 1JNXX 4YRCA 3V46A 3QEAZ 4D7AA 2ZXEA 1NXPA 3VC3A 4CM4B 4KAFA 2Z30A 3VHRA 3GHYA 1FDOA 1S1MA 3BWMA 1LVHA 4AKSA 4XX1A 4B5LA 2YVLA 4RTSA 3LPCA 4D44A 3EEBA 2PDAA 2FW9A 4P7KA 2PS3A 1JIUA 3B1XA 3J80A 3ABZA 4MB0A 3RUPA 4DV3B 4V0ME 1RHJA 1VIVA 1EFRD 1Y8AA 5EKXA 4CTMA 3GLGB 5KTPA 4IYJA 1HQKA 1T2EA 2CKMA 1DVRA 3B3JA 3QXXA 4JWKA 4DZTA 1ULHA 1NOKA 4WPGA 2FSVC 4KXVA 3AB7A 1L0BA 1T36A 3J7TA 4UCXA 1Z38A 3I61A 1ESNA 1XTBA 1Y81A 2ZGVA 5EUMA 5TMDA 4KODA 4TQGA 1E79A 3DHEA 5FHQA 3ZXSA 1ZAKA 3DMTC 3MTEA 4AZ3A 3ASUA 1IY9A 4TT8A 1KFJB 1RWOA 3I6BA 4JJIA 1ZONA 3EN0A 4CMAA 2AG0A 3KZOA 4QKQA 2P11A 3ZTTA 1BX1A 1ENPA 3GEHA 4FLEA 4GMHA 4YRJA 2QUIA 4BWVA 1N75A 1VBNA 2CBZA 1E7RA 1SC3A 1UKCA 3QOWA 4ZREA 1GRQA 1HDOA 3NHPA 2P90A 4TWJA 2I62A 5CA0B 3EXIA 1G6HA 2IHZA 4JCCA 2ORYA 4L6IA 4RULA 3GRKA 1T3TA 4CV1A 1HDZA 1YB5A 4FNGA 3H2IA 5CD9A 1SHLA 2B34A 2ECOA 3WYFA 4UXJA 4PLFA 4Q3CA 4RH3A 4PXSA 4KR7A 2VT6A 4YCDA 1KWGA 1KEPA 1IOLA 1Q19A 2JIPA 4RTOA 1X94A 3VZBA 5IC5A 4EY5A 1FVHA 3F97A 3FN4A 3KSDO 4YP0A 2D1FA 1ZJYA 2XYHA 2JAHA 1W29A 3BWVA 3FVRA 1HDGO 1CRLA 4ZVRA 1LVGA 3RU9A 1DEHA 2BFFB 3UGTA 4HAIA 5EE0A 4DUGA 3PEYA 1ADYA 3MYYA 4I4TB 4EX7A 4CV3A 2CL6X 3CV3A 5JZOA 4DLWA 1YAJA 1WKVA 1P9OA 3ZWXA 3KSAC 1RHRA 1QH9A 1G5QA 2FG7C 1AZSC 1P74A 1SJ9A 3GRVA 1KMHA 4MGEA 3WLHA 4C1NA 4F3TA 2IS6A 1SXPA 4EMSA 2HIAA 2I7XA 5F3RA 4PSCA 1BJTA 1JG3A 1MZPA 1KYQA 2ZPTX 4OXRA 4PZEA 3WLFA 4XRRA 5D01A 1Z33A 2RAPA 2PH1A 4J4HA 3DDWA 5EINA 1C9KA 2OGZA 4MW2A 2WF7A 5EFOA 1X1EA 3ROZA 1IPFA 1SKAA 5CNMA 1G3RA 4DRZA 5C51B 2AN4A 4HPWA 3M34A 4EG0A 3B9PA 4XIGS 2XWSA 2CD9A 1L5YA 2FPPB 2CHUA 4L1KA 3AVYA 3CVWA 4Z9YA 1CP3A 5IZCA 1ZXBA 3KP1A 3B2EA 4PZ0A 1X0VA 3F71A 5EMLA 2QRVA 5EIEA 3IAHA 3LUJA 3I9OA 2HWWA 1L4FA 4KITB 1JQDA 1QCZA 1X1AA 3CE9A 1HKHA 1WE2A 3K1TA 2FRDC 3N8HA 4RV5A 3T61A 3B3GA 2D00A 4BEVA 2P0EA 3ANLA 3E82A 2VJYA 3UEOA 1YZ3A 1KJNA 1XJ5A 2C3MA 3MIIA 2OR3A 3NHFA 4MA0A 5AQEA 3TIFA 2V0NA 2VRBA 4A8JA 5K6TA 1JIXA 3FVVA 5EUQB 5K0GA 1XLTA 1T5SA 3FAKA 3FMFA 3AZQA 3IO5A 3WISA 2AG1A 2REXB 2CLDX 2VLBA 2YV3A 4IMPA 1PR4A 3DHVA 4V03A 1NUHA 2B4QA 3BMQB 3OOYA 1JHRA 3DFFA 4RZQA 3SEQA 5FL3A 1OXMA 1Z36A 4P7JA 2JFWA 4UHBA 4X63A 4EVRA 1UEJA 2Q4DA 1YQEA 1Y1LA 2H1SA 4ETMA 3R1IA 2R1VB 3PUWA 1PJ2A 1U2PA 2WMOB 5F35A 1ODFA 4R68A 2O8DB 4MUEA 1SU8A 4DQKA 3SOPA 4ZDIA 1IN8A 5CYOA 5BYKA 5CLJA 2FDRA 5JPDA 2UUPA 2XE7A 5CDSA 2NU7B 2ZUBA 2FPGB 1JSXA 4DCJA 1SMKA 4YAWA 3GL9A 4D99A 4CFZA 5JMTA 1XZKA 4JHXA 2YW2A 3Q41A 2A6PA 3OU7A 3MBKA 3Q0IA 2ZI6A 3I9JA 1R50A 2IKQA 3O26A 4IQ0A 2WWTA 4MJ7A 4WY8A 5DN9A 3B5IA 4BO4A 5C4IA 2P4QA 1U3WA 2GEUA 2X19A 3IIEA 1BWQA 1GITA 1ES9A 3PWSA 1ZNWA 1N6RA 3JQBA 2WG2A 2DPHA 2A88A 1VDZA 1Z8DA 2NM0A 4N49A 3UK2A 2IDZA 3SJCA 3U4GA 5J4VA 3H87A 4O2BB 5I8ZA 1TM4E 4GC5A 4IQ4A 3UW1A 4B75A 2ZIEA 5FIUA 1PL8A 2R5FA 4ZYYA 3CZ4A 1B3BA 4FKBA 1OKKD 1PD1A 3OP4A 3S6JA 1UPAA 4AROA 5J9FA 3PKJA 4BVAA 2BPOA 4YAFA 3MM4A 5AK0A 3QVGA 2FMTA 1VGVA 4MCJA 5JH7F 1K27A 2I7CA 4E4RA 1ZA1A 4G0PA 3OTWA 4N5HX 2F1KA 5JEEA 1QAMA 1WHSA 2TMDA 3FG9A 5FTLA 1HEUA 2W6ZA 3MJFA 3LOUA 3RD5A 4LK2A 2NO5A 4IXMA 4EYGA 1SXHA 2F43B 3AIMA 4IRXA 4Y2UA 3N87A 1KNXA 3JQFC 3BJZA 3I42A 1V4VA 4KZKA 3TW6A 1C8LA 3JWPA 4B17A 2XTZA 1NF8A 3KK0A 3KQHA 4G0MA 3U62A 3AINA 2ZR9A 4CUZA 5C1BA 1UWLA 2D5CA 1C4XA 3OIWA 4HATA 3UK7A 1YZKA 4A0HA 2OD9A 1RXYA 1U3TA 3CRMA 3AR9A 3K9CA 1L1RA 1FNMA 4MRRA 2PPLA 2W43A 4FYVA 5DTRA 4DUYB 2J0QA 2F48A 3M49A 3C3DA 1QHHB 2OHFA 4PU0A 3I37X 1W0KD 3ZWDA 2PZAA 1L7BA 4CIAA 4LCJA 1V5EA 5IK2A 1NX6A 1RBQA 3OPMA 4MHSA 3BHJA 1M8JA 1Z75A 4NECA 1QZXA 2YZKA 1PEKE 3W5IA 1SOMA 2VWQA 3BIOA 4Q01A 4ICIA 2CY0A 5CURA 1TYEB 2TMGA 1S2DA 3C70A 2VCYA 3DBRA 1E59A 4FCCA 4PS1A 4ZODA 2OXFA 2AEJA 1QHGA 1NX9A 3LIPA 1GGJA 1WEKA 1LPOA 4DVJA 2V7QD 3OQNA 1G8FA 1EI9A 1NVGA 3HL4A 3B5JA 1PJAA 3IDFA 4XDZA 2R86A 1ZIYA 2V7TA 3JYHA 1AUVA 1Q0PA 1MUUA 2J9FA 3ET5A 3JQ7A 3L0PA 2SKDA 1F60A 2XYQA 4JIMA 5AJXA 3D6NB 1M2WA 2PWPA 1RE0A 3OCUA 2QMQA 4DQUA 3LOPA 1SXGA 4Q9IA 5HJ5A 4KNYA 3HYLA 2YWHA 3MCVA 1GUBA 1A71A 2V97A 1E2BA 3HKEB 4QL3A 4D3ZA 2RAVA 1I7SB 5EXXA 3AHCA 3OLZA 3OSZA 3CF6R 3FPSA 3LFTA 5G1NA 3WLSA 4HDCA 4WXPA 2J5QA 1L4KA 3D6FA 2OC4A 1P3Y1 2Q3JA 4Y2XA 5B3AA 3RRJA 4BZPA 3IP6A 3GJTA 3PNPA 4DJFC 5BXQC 6AT1A 2IHVA 3DGFC 4ES6A 5AI5A 4B73A 4NJEA 3WJAA 1Y7HA 3ASYA 3EOAI 2PQ6A 3I3OA 2ZSUA 2W8BA 4UZSA 4B4DA 1FNBA 4RY2A 3TTWA 4RY0A 1U2RA 4PAGA 2BRUA 4W7SA 5FT9A 5JCXA 5DK4A 5YASA 5HEKA 2BN4A 2EFDB 2H59A 3QKSB 3QXHA 5L7WA 5DDIP 1N32B 1KIAA 2ZJ6A 3HMKA 3MMPA 2FK8A 4Y7CA 4QM6A 2QDKA 5KTSA 3IIKA 3FKSA 2VDUE 1ZSVA 4H3HB 4LAFA 5C8YB 3C3BA 2XOKA 2QAGA 3EUWA 1RADA 1M2OB 4ZVKA 2WM3A 3ZZMA 4BMDA 2MWMA 1RRFA 1GZHB 2JJ1A 2WIGA 2V6GA 1XE3A 1L4NA 1AH2A 2BZSA 2XAUA 4DWOA 1EFTA 1EVIA 1ZFNA 3A4NA 4B31A 3BWYA 3SCZA 3OZWA 2HJHA 3D8BA 1VYUA 1R4ZA 1EIZA 4OJKA 2HQRA 4GQAA 2NVWA 1JFSA 1KEKA 4NCBA 3M81A 1HT3A 2L42A 2E87A 4RTJA 1WBBA 3B3FA 1SVLA 2YWEA 2ODQA 1MC4A 1K8XB 4R8KA 3JZFA 2W6MA 4GPD1 3K0CC 5K3EA 1W87A 4IJWA 1CSEE 1N57A 3DZDA 2MINB 3HY4A 4RJ2A 1R6BX 4YPVA 4P3OA 3OE4A 1U2SA 3E7FA 2V1UA 5EZYB 4V24A 5HMLA 4MR9B 2B1GA 2FSFA 3DO8A 1TF5A 4NICA 2IX9A 3MK31 4FEEA 3T94A 3FTCA 4D8XA 4U2BA 2A92A 2C2BA 1GVNB 1K97A 4JJGA 1VLZA 2WM2A 1COZA 2MDTA 4NE9A 1T6YA 1USVA 3MERA 3PA6A 4U3JA 2QRHA 1KZ6A 5K3FA 1R6DA 2B99A 1FP7A 5F76A 2MSEB 4OLJA 3W7AA 4MRAA 3ELYA 2OKGA 2NVUA 1TRHA 3I04A 3LY8A 4ND8B 1U1EA 2Q5LA 3NJRA 1D2HA 4FXOA 2R9VA 4WCDA 3AT1A 4YMIA 3FSGA 5G0TA 4P5EA 3IESA 4FYYA 4B87A 3R75A 1NQVA 3U4CA 1I14A 4BEWA 2JGDB 3MJTA 4M8SA 2VH1A 2DOKA 2P1DA 1N1EA 2G28A 4ZC1A 4L85A 1E6MA 1FUIA 1YS4A 3NBQA 3NFYA 3RUIA 4DDTA 3RF6A 3UJ6A 3JX9A 4UMDA 4G8BA 3UAXA 2K87A 3VPCA 3ZU6A 1YXMA 5COQA 4E30A 2PU5A 1Z4KA 3O8OB 5KDOA 5FRDA 2XADA 4D4IA 3SEFA 2E4ZA 3CW9A 4PY2A 3VH1A 1T5LA 1PFQA 4BO1A 4EJSA 1D2RA 3NB0A 5E0OA 1DLJA 2PZGA 1EMDA 4W63A 1CRWG 1YT5A 4UU8A 2G82A 3B48A 1BZYA 2I2XB 2ZYIA 3N0VA 2XA2A 1DBIA 1XAGA 4D8VA 2DT5A 2WM9B 4C4TA 3JVVA 3T3HA 2OQRA 1GU0A 1I4TD 1XLWA 1CHNA 3N6RA 5DKFA 2HD4A 1PG2A 4D8WA 4ZYWA 1OFVA 3OX4A 4FQ7A 4XIFA 1S0UA 3FCUB 3BRWD 4YB8A 3IQGX 3LIIA 1L6RA 1VPVA 2Z4SA 3RVOA 5JECA 4YAGA 1KH3A 4W8GA 1AX9A 4EFNA 1E2MA 1YZYA 2CF5A 2ZP1A 3OJXA 3F5QA 2OHXA 1XCJA 4Y7DA 3IS3A 1VA4A 2XHEA 4FFOA 3G85A 5ALDA 5F2NA 1VMEA 2FY8A 1L8QA 2VI5A 1XGKA 2D5IA 3T7SA 2IVFA 4EYQA 2VEOA 1FYVA 4E2WA 2DR2A 2VHXA 3QP9A 3MRVA 4X7BA 4MR7B 3RIGA 3KAPA 5LZ7A 1Z4MA 4B8YA 5AOVA 4QXOA 1SHUX 4UCFA 3V7WA 4FD2A 2DFKB 1DELA 4JC8A 3VR1A 3H13A 1F9EA 1RC1A 4O4HB 2FWPA 3RVSA 2F8SA 4OHKA 5KOHB 2DWQA 2O2ZA 3DMDA 3GJ5A 3O4JA 4MVYA 3ROGA 2Y93A 5ICFA 1AHIA 1WP4A 4M0MA 3K53A 2JFQA 4RXMA 1LV8A 4EENA 2CEAA 1QC5B 2PS0A 3PEWA 4QQKA 3EZYA 3RADC 5KAMA 1J2RA 3GBVA 3K0KA 3PHBE 3STXA 5C5EA 3L7IA 3YASA 1H5UA 4N9QA 4LDRA 3C6BA 2EL9A 2FQQA 4FW9A 1W59A 1BKDR 4TL6A 2W42A 2FOLA 2QPTA 3HDTA 3LX8A 2OGUA 4J7XA 4JQSA 3TTSA 4QJ5A 3HVRA 2GR9A 4HMOA 1VE7A 4IEIA 3VHXA 3VPAA 1OX6A 1OXXK 1VJRA 4G41A 4HB0A 3VPFA 5TLSA 2Q49A 3E9ZA 3CLSC 3PFGA 4D74A 4ZCMA 4UZFA 2VH5R 3FPAA 4B3HA 1L1FA 3V1YA 4CCYB 2VNKA 3DT9A 2HMVA 3HS3A 4LW8A 4Y2GA 4DIMA 4EQ6A 2CE7A 1SKQA 1FFXB 2XMBA 1PR3A 3AESA 4CL8A 4TTIA 1C3JA 4EG3A 1JAHA 1SA0B 2XZOA 3HUUA 3FHOA 1RI5A 4XX0B 4A2WA 3G9XA 3PF8A 1SVWA 4G81A 4L5BA 5H9WA 1BAPA 3RFUA 1OU4A 4KMMA 2CHFA 1E18A 4LXUA 1QGUB 3QSYA 4AKGA 4JSYA 1WU7A 2EJVA 4WD3A 5J4LA 2AJTA 4A27A 3HGMA 1PQWA 1QH1A 1U6JA 3D4BA 4PCAA 2MU1A 3DULA 3ETGA 4R8MA 4LHYA 4B3BA 5F7OA 4CF7A 2R25B 2WP8J 3PXEA 4PPFA 1M73E 4YASA 4J6EA 3F6YA 2JHFA 3DL2A 3LT0A 1G17A 2HRCA 3PHIA 3PU6A 1R64A 1ZUWA 2HEIA 4X85A 3JALB 4JBWA 3QPVA 5FJIA 2FUG1 5KO2A 2CJWA 1USKA 2H11A 1ISSA 1QM5A 3ZKAA 4XQGA 1GV0A 1JPVA 2QR2A 4KO8A 2V7VA 2XNSA 1NW7A 3MILA 5DYNA 4HPJB 4DRXB 1P9NA 3K6RA 3ZS8A 1GTZA 1C4OA 2WYOA 4OYRA 1ZPDA 4I1OA 4OJQA 2ZCJA 2QA5A 3NRJA 4O25A 5TE9A 1TMOA 4JBNA 1QPGA 3AEUB 4N18A 4U7PB 4B45A 1C1XB 4LMPA 4JJZA 4RENA 2D0PB 1RXSA 1TCCA 2I8LA 4PLGA 2B6NA 1L9XA 1V3VA 3CR8A 3LS2A 4CLOB 4MP8A 5K3CA 3UXEA 4FE7A 1E5QA 2ZIUB 3EVDA 1N3BA 2C4MA 2NT4A 2Q4TA 1OWNA 1YRWA 3L7AA 3H4VA 2FETA 3DZFA 4FOTA 4JXJA 1UUFA 1R00A 1C7ZA 2NSDA 2ZE5A 4MYUA 4CMHA 2GD1O 2OENG 2R47A 3F9RA 4GF5A 1SXJC 5FQNA 1T5DX 3ZZ1A 5SICE 1P4SA 2YOHA 3Q2OA 4KZPA 2ZSBA 3WWOA 5ES3A 2PX0A 1NNSA 1O87A 1WB6A 2ZWPA 4KOEC 2P62A 5DWVA 3WR5A 2YHAA 4DEVA 4F12A 2GEKA 1XK7A 3HZRA 1HRKA 1OFGA 3T1VA 4HYYA 1W46A 4ONEA 4Q4AA 4JX9A 2G67A 1PCXA 2JFUA 4YIKA 1JHZA 3I39X 4ETNA 1D8AA 4OG2A 4MVJM 1DKRA 2ISSD 2ZTSA 3QI7A 3CNNA 2QWXA 2QLLA 4HEQA 1NJSA 4NYMR 5K4GA 1FRQA 1XEWX 1T4CA 3KT3A 3E5HA 4FHCA 1V7PC 4B44A 2QSUA 1C1YA 2FVXA 4YT2A 5BWLA 2Q45A 2QIPA 1C5KA 3JQ6A 3WLKX 1E0AA 2AZDA 2NGRA 3TZ6A 1GPMA 1P1KA 2QTVA 4JXXA 2ASEA 2WU8A 4ARSA 2WWVD 1EUDA 1K1EA 3OO1A 2OP1A 4TTQA 3SYRA 2AWOA 2C5EA 2QD1A 3DDCA 4QUIA 3RBAA 3AG6A 4YCJA 1PSZA 4AB1A 4F2PA 2ZIAA 3ELUA 1UP6A 3NDPA 2O2HA 4IIUA 5AW0A 4RKFA 1VE9A 1QK4A 4UUMA 3B36A 3HKCA 3OM9A 3ZV5A 3ZWBA 5CDTA 5JBIA 16PKA 1W76A 3FF1A 3RS4A 2H1CA 4WTOA 2R5WA 3LECA 4WZAA 4Z4GA 3SLGA 2ZQZA 4LECA 4HDKA 4D81A 2OCIA 2Q46A 3L6BA 1VG1A 1QYXA 5LJIA 4YAKA 3NNSA 4QQFA 3LCCA 4UBJA 4IJ6A 4Q9KA 4UUOA 3SR3A 2HF9A 2ADOA 4BNJA 1B76A 2JASA 4KXWA 1Y8RA 3L5OA 4EB0A 5DNUA 4TL7A 2JLVA 1YMUA 2ZRFA 4QUJA 1QO0D 3E22A 1NQTA 3L4SO 3AFGA 4KV7A 3KVNA 3UHOA 3USES 4QTUB 1SKBA 1EFLA 3CM0A 4C76A 4F21A 4MRMA 3Q5EA 4UEKA 1NR1A 2QRNA 3IP1A 1X39A 1F4LA 4GBJA 4NK5A 4PLCA 5AKZA 3K0AB 5DYYA 3WDLA 5A3QA 4FHEA 1T2UA 3F6PA 1RWMA 1L8OA 5CXUA 1B2RA 2C2YA 2CDRA 4OQEA 3IA7A 2UZ4A 2C59A 3QKTA 4ILKA 3D31A 2YBEA 1DRVA 2FMHA 1AS3A 1V11A 4UASA 4BMXA 1BD3A 4NR0A 4YLEA 4CMIA 1KH1A 4D79A 3VR5D 4J0IA 5TPWB 4XFKA 1P2DA 4ZD6A 3COVA 3TD6A 2G88A 3KDAA 3W5BA 3ZV4A 2XKKA 1OB2A 2F8TA 3WK9A 1MAVA 1MJHA 1CULC 3PHCA 3M1YA 4LHXA 4PFSA 4W5JA 4URHA 5EJ2A 4DDMA 4DABA 1RZUA 3L2OB 2FF5A 3BRSA 4AKEA 1WHTB 4XOIA 3FOFC 3K0SA 3B6MA 3D3WA 1CPYA 2IYXA 2AK3A 1YKSA 1DEKA 2A5DA 2IH5A 5D5HA 5ALZA 2J4CA 1M0TA 3SGLA 3WBJA 4CM4A 3DAFA 1FSFA 1K6IA 4D9GA 2VH2A 4P3YA 3SQXA 4JEIA 1A88A 4WI1A 5I9IA 2AA3A 3AUFA 4BV2A 1MRZA 3UJBA 1LUAA 1EM6A 2D7DA 4C4AA 3PC3A 3NTVA 1VJGA 4L9AA 4B6PA 5JUWA 1SCDA 2FW8A 2QN7A 1NYRA 3KUCA 4GYKA 5B37A 2XMQA 3GLGA 5GADl 1S2NA 2KHZA 1U1IA 1Y3FE 3HCAA 2ISCA 4TSKA 1E3IA 2DPXA 3T9AA 4W1RA 4QEZA 2O1WA 4S1WA 3QV1A 5IUKC 2P8JA 2XH8A 2Y67A 2AQHA 2W6QA 3OCZA 1DC4A 3SSAA 4F4CA 2JVJA 2DUNA 5FUVA 5HIKA 2PNFA 4OH7A 2MSCB 2C04A 1I32A 3SHVA 1E20A 1W6RA 4FGZA 4IQFA 2C7RA 4UBIA 2PWAA 2JAUA 4BBAA 4EEZA 3LUPA 4AUEA 1SY7A 2GQ0A 2YHUA 1ZH4A 3W5SA 1XAJA 1NOJA 2OFXA 2HXYA 4QUHA 2O1EA 5FA6A 4BQEA 2H2AA 3ADPA 3RFVA 3ZY2A 1ZC4A 2J33A 3HCNA 2I1QA 2NYVA 3IIJA 5EMMA 2ZUDA 5CA0A 1U8UA 3KX2A 5T5QA 2CSXA 1T0BA 4JYMA 4MQ6A 4A4DA 4XD7D 1NWCA 5ITVA 2NXWA 4W1QA 2A0YA 2PJDA 4TUYB 3GDFA 1GO2A 1EGVB 1RQ2A 1RQNA 2PXCA 4HC4A 4YPOA 3OQOA 1YJAA 4W6QA 1ZMRA 4FX2A 2HDHA 4DLPA 4IUYA 5JYBA 5HKAA 5EZQA 1KHTA 1A50B 1SPBS 2IXEA 2K5UA 1UXJA 4L0QA 3SFVA 3WIOA 3GWZA 3MTIA 3OT5A 3TX2A 1KORA 2VLIA 3TB4A 3WGQA 1L5OA 1DAGA 1QLJA 2JAXA 2NXNA 2BFFA 2WTMA 2CLSA 3OIUA 3MTBA 4G0ZA 4RIGA 1EAMA 3GPBA 3M6WA 1N0IA 2XNKA 3VNVA 1EB8A 3PQ4A 2WG1A 3F47A 3WJ1A 2UZ3A 1Z25A 2XMZA 3F98A 3NHKA 1RU3A 3MT9A 2WWFA 4FYPA 3T0GA 3B1FA 3GARA 1IBKB 2JAOA 2O7NA 5B3JC 1E5LA 4GOXA 4RW0A 4D5GA 2PV7A 4FM9A 4LI3X 2BKAA 3ZY6A 4U63A 4ZYZA 1D0SA 2NSHA 5IJZA 4AF6A 3WKAA 4HNSA 2JPDA 2F67A 3REOA 5FUQA 5IT4A 5JRJA 1DXQA 3W6OA 1UXIA 4XWYA 1VG8A 4U9IS 4IDHA 1S8AA 3WSVA 1XJWA 3GZNA 4X41A 4CFYA 2FPPA 1F0YA 5JAPA 3GJ0A 5J1TB 4OI1A 2CMDA 4G0QA 1YDHA 1VJCA 2XAAA 1E3DA 1V3QE 4YDQA 5TRTA 3CVYA 4BHTA 2QYOA 1L7PA 2YV2A 1BX3A 1O77A 1MB9A 2CFOA 2JC3A 5CTJA 4XKJA 2IHUA 1JA1A 1WZNA 2RG7A 3NHRA 2G72A 1ZMXA 2PL1A 3DBOB 3HVJA 2HCRA 3A1EA 4MDHA 2E1PA 4X97A 3W8NA 5HM6A 3EWSA 1J7JA 5BV1A 4Q7JB 3OT1B 3ZR4B 5CJPA 3PIDA 4QZVA 2AH5A 3T1OA 3IHTA 1FDUA 2HHCA 4EY3A 4NNJA 4QNMA 3S8MA 3KR0A 4M1TA 1OPXA 5CLLA 2XODA 3BMQA 4EL5A 4PFJA 1OV4A 2HO5A 5DLYA 4BAGA 5DEOA 3FLBA 3PNBA 5M29A 2Z6UA 1U7PA 4YPFA 3QY9A 5LQNA 4JFRA 2IP2A 3SBEA 4C21A 2IOFA 3ETJA 1VL1A 3IR6A 3OF2A 5CIWA 4COKA 4W9RA 4PIMA 5ES4B 3L8YA 1JMVA 3UY4A 1J5EB 3PDCA 2OGTA 3OLWA 1XVVA 3QGMA 4KW7A 4BX2A 1XQ9A 1F7UA 2CMFA 2VTDA 1LGYA 1RPNA 1XYGA 2WWHA 3E8SA 3FDZB 2P9TA 1KP3A 2AIRA 2B4KA 2R6CA 1E77A 1PZEA 2NU7A 1WF6A 3KL2A 1DARA 2FPGA 3NORA 4O08A 3IEIA 3CX3A 5F5XA 2GVDC 3PRHA 3MCWA 3U3RA 1MJGM 1Q20A 1K7XB 3TDMA 3U61B 3TFWA 1O5OA 1O7JA 4UFOA 2LRHA 1RI1A 4Z9AA 1IXRC 3ECSA 5F2EA 1YA4A 5I7SA 1GPDG 1KDOA 2VAVA 1S3SA 1HORA 1J2EA 5H1YA 3O94A 3VSBA 3TXXA 3EZ2A 3O0DA 5JEDA 2E55A 1CDDA 3JVUA 1N5OX 1TTHA 2FGJA 2VUUA 1EDOA 4ZAVA 1ODKA 2O57A 3SHOA 3D6UA 3ZE8A 4Z0TA 1E2KA 3O74A 4BQPA 1WULS 2D2EA 3U13A 4TL9A 3ESAA 3FKQA 1OXTA 3O1HB 4J7AA 2HOQA 4AS3A 1TJYA 1V1RB 4RD3A 3U9SA 2IIQA 5J2TF 1V7CA 3ENZA 1AV7A 2IOYA 1HDRA 3E2MA 4O2BA 2DERA 2ZJ3A 2GFHA 1OYYA 4G24A 4C01A 4B4UA 3VUFA 4AY3A 1E8NA 1HZZA 2BR4A 2DUWA 4QLAA 1SCKA 3W8EA 1ZI8A 3ECAA 4HEA1 3JQCA 2X1HA 1ACLA 1F9AA 2WD9A 4GPTA 3PXBA 4BFYA 2NN3C 4ZVNA 5JZSA 5CLIA 5FLXA 2YVKA 3OUUA 4WKNA 3ZY4A 3D7RA 1TA0A 4I2NA 4IGKA 1GEEA 4I7EA 1JFRA 1BS1A 2C57A 1VRCA 5E1OA 3VKVA 2IF0A 4F92B 4CQNA 3G0GA 4IFIA 2VQ3A 1J25A 4O8ZA 1DIGA 2JFYA 2N1BA 4OJMX 2ONCA 1OKKA 1JKJB 2AFVA 3GBSA 3VU0A 4LGVA 4A2CA 3PEEA 4QUDA 3ZVRA 1RP7A 4RZXA 2H0QA 2AHRA 3OQJA 5TDHA 1A7AA 1UKBA 2I22A 3W4JA 4DR4B 1KJWA 1JJ7A 2IZ1A 1ECCA 3KELA 4TQUS 1F6BA 2QXUA 4Q7KA 2JL1A 4Y6LA 5AICA 1EFAA 2V6FA 4BP3A 3T9BA 4D6XA 2R8ZA 3DJYA 3TQHA 5G02A 4C0HA 1T0PA 8GPBA 1EK5A 1KJ9A 2P2NA 3FYCA 1NTOA 3U40A 3RE1A 1L4HA 1NRXA 3CRZA 1QHHA 3HWWA 2HBRA 3PKZA 1D1SA 3AM4A 4PWZA 2EF0A 2CJYA 1ORVA 2RBKA 1NR5A 3L0CA 4MUGA 5H80A 3WOVA 2VZEA 3B52X 3BTOA 4NXNB 1VB3A 2DBQA 4BE7B 2QTRA 4MWZA 4DIOA 4OD0A 2DGDA 3OMLA 1C0LA 2GM5A 1AQIA 2HF2A 2BE7A 3R0JA 5E6RB 1IQPA 2RGCA 4BVKA 4D5EA 1Z06A 2QDXA 1SC1A 4ZO7A 4I36A 1RQRA 3Q3GE 5HOEA 5K05A 5ENDA 1LK7A 3U6BA 3CNQS 1Y33E 1W0KA 1IVSA 3ER9A 5CBPB 4F1KA 3QPDA 1NFFA 4KPUB 1KJJA 4LGCA 4V2IA 1EP2B 4URWR 2HA0A 2WAXA 3WQBA 3ENKA 5HE8A 3RDPA 4MO9A 1J56A 1R4MB 1R9JA 3CW2A 3HUEA 3PSHA 4NZOA 1J8FA 4DLTA 4YMVA 1OASA 5ER9A 3EEYA 1VYVA 1VFNA 3TR0A 3IT2A 4B7AA 1A8IA 3ZWVA 3OZDA 3HKEA 2ZU6A 4WE3A 3W5AA 4RWZA 4WDRA 2PA3A 2V7QA 2Q6TA 1XI2A 1P33A 2IITA 2PWYA 2YXLA 4G01B 3LVBA 2J0VA 2G1KA 1J0AA 1YQUA 2IEAA 1ONNA 1IUPA 3DZBA 1VSUA 4HJXA 2RDMA 2AFHB 5IUJC 4TKLA 2YXPX 3NGLA 4MV7A 5BT8A 3ENWA 4FD3A 4R3NA 1XD9A 2ETVA 5HFAA 1GL9B 4XYMA 3D9QX 4JI7B 3RHZA 1X3SA 5KNCA 5AJVB 1Y5IA 2VR1A 3UHFA 1CUUA 3DVRX 3QKSA 4C04A 1UJBA 5THKA 3WLJA 1SUSA 1GUDA 1CCWA 1E9SA 4NV1A 3OIDA 2OEPA 4I99A 1JQ5A 4C3VA 1YRLA 3PRYA 1CDZA 2IPLA 1JVNA 3OIVA 1OQAA 4I81A 2Y0DA 3EQ9A 3F4KA 5C8YA 4FCTA 1S89A 1M2OA 2XTAA 1R3DA 2ZRQA 1VL0A 3T0FA 4GT1A 4B6QA 3QYJA 1OBOA 3TE6A 5BV0A 4D3XA 4ZI7B 2D2IA 1DBQA 1KK1A 1OBVA 3KM0A 5IMBA 1LPPA 4CI9A 1KS9A 5CLQA 5DB4A 1FJGB 2LKCA 2WYWA 4CR6A 3S2FA 7ABPA 1T6XA 1UBTS 2NNLD 4MIOA 3VR0A 4EYOA 2DJ5A 2O6LA 1N2CB 5JXHA 1UBUS 1H2WA 3GW8A 4HUTA 4ZAYA 4B3MB 1XJ0A 3K4QA 2YYSA 4FJ0A 4U7JA 5L6MB 1J9ZA