4QJ3A

Structure of a fragment of human phospholipase c-beta3 delta472-559, in complex with galphaq
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
316
structure length
316
Chain Sequence
RRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPSYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanine nucleotide-binding protein G(q) subunit alpha
publication title Molecular mechanisms of phospholipase C beta 3 autoinhibition.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein/hydrolase
total genus 110
structure length 316
sequence length 316
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00503 G-alpha G-protein alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.400.10 Mainly Alpha Orthogonal Bundle GI Alpha 1, domain 2-like GI Alpha 1, domain 2-like 4qj3A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qj3A01
4TQAA 3DVLA 3AVXA 1X8KA 1IM2A 2HXSA 4ZCIA 4OQXA 1QHYA 2GXSA 2IYZA 2RGAA 1L4UA 3GJ3A 4MDEA 4TLEA 1GRNA 2WSSD 3IQXA 1W4AA 2XAUA 2QRNA 3DDCA 4A0GA 1OV4A 3QF7A 5KSPA 5KSOA 4EJSB 1LS6A 3P20A 1VMAA 3CRW1 1XTIA 2QAGA 3TRFA 3NDBB 1E9RA 2D7DA 1F3OA 4FMDB 4P32A 3WHKA 1X86B 1W1WA 4LYJA 5L3QA 1I4LD 2NIPA 3MD0A 4G5GA 1X3SA 1JPNA 4YLGA 3T06B 2FOLA 4DKXA 3L82B 4MGYR 5LB2A 3E1SA 1MRNA 4NYJR 3LY5A 3GJ6A 1XNJA 4I1OA 2QE7D 4YDHB 5FPHA 3TNFA 3AF0A 4JLMA 4BLSA 2GVDC 4QFMA 3FPAA 2V8OA 4NCJA 2ODEA 1Z07A 3GLGE 4Q9IA 1BMFA 2FSGA 3QPUA 1II8B 1S1MA 2UKDA 3QKSB 5GJVC 4LZZA 3VX3A 4HUQB 1YR6A 3JZMA 4KU4A 2GILA 3BJIC 3QF4B 2Z5FA 5BYKA 2N42A 4QHSA 2P5TB 2PCLA 2XB2A 2J59A 3BRWD 4GP7A 1MT0A 1XEFA 5KDOA 2P65A 4BFYA 5HCNA 5JCPA 4V0NA 1R5OA 2A7QA 2MSEB 4D2IA 2H5EA 4W5JA 4DEYA 3B7GA 1KI4A 5JZVA 1M34E 2FA9A 3U3RA 4BFSA 1J70A 1G3RA 5FL3A 4JSTA 3FHTA 2IYQA 4NYIQ 1G5RA 3CRRA 4HZUA 2A5FA 1G291 5JSZB 2LWIA 1JR6A 4IOLA 1OXSC 1IOZA 1NI3A 1NG1A 4KJZA 4Q47A 5AR1A 1QHIA 3WMEA 1G7CA 221PA 1GILA 1FZQA 1VHTA 1SVWA 2B7CA 3CH5A 2QTHA 2XZOA 2XXAB 3K0FA 4C0SA 3K09C 1W49A 2C5LA 4I4LA 4NYJQ 1E69A 4IXMA 2JJ2D 3KQKA 1XPRA 2EWVA 4L5BA 4TLCA 3QKUA 2O8CA 3WBJA 4DB4A 4PO1A 1LV7A 1RJ9B 2G9NA 2V4ZA 1II9A 3NH9A 1QG4A 5HZHA 2BMDA 3GP8A 1FMJA 3IBGA 4BPBA 4AI6A 3K0AA 4DDWA 1PLLA 3TIFA 4Q19A 2NQ2C 3U60B 2TMKA 1AJEA 2OESA 4XOIA 2QPTA 2VHTA 2AWOA 5E7JA 3I8XA 1VYVA 4E5UA 4G5OA 1S9HA 1W5TA 2LKCA 2ZPTX 1OHHD 2WIBA 4HSEA 4DJTA 2R2AA 2CJWB 3U5ZB 4KYUA 5TVKA 3OEEA 4EDHA 1ELOA 4V0MA 4MYHA 4DWJA 1V5WA 3HR8A 1AKYA 1KI3A 5E3HA 3GLIE 1Q1EA 3S1AA 3EZFA 3LQRA 1DO2A 2QAGC 2QAJA 3DPUA 521PA 4I1UA 1S0UA 2VSFA 2JEOA 3IPYA 3L0SA 4IEIA 3L8ZA 2VP4A 1KDRA 1IBRA 2J41A 4B3XA 2O5VA 4W5WA 2ZANA 2PT5A 5GADl 2ZI5A 2EFEB 2N46A 2QAGB 2R6FA 1ZD1A 3OF5A 4RD4A 4DZZA 1JEEA 4FCTA 3EAQA 2HYDA 3Q5EA 5CK5A 1T9HA 2GETA 2G0TA 2P6NA 4NKRA 2WOOA 5L3QB 1EK0A 4V0LA 2WM9B 1IONA 3EA0A 4YXWA 3RHFA 2V1UA 2QPOA 5JMTA 1GTVA 2NPIA 4OJQA 2RGDA 1S8FA 5KDLA 3K0CA 1NBME 2NO6A 2YZ2A 5FH9A 2B7BA 4TQUS 2DPXA 4ITRC 2OFXA 621PA 3B9PA 3SOPA 421PA 1NN0A 2DFTA 3W8RA 1XPOA 1YE8A 3UMSA 1NN3A 3GMTA 2BDTA 4ZO4A 3PEYA 2BJVA 3MGCA 2QEQA 1KYIA 4XJXA 4HATA 2DWQA 4KFUA 1F2UA 5TXGA 4ZDJA 2QROA 1ZNYA 4JBYA 3X1ZA 5TDHA 1P7CA 3X2SA 3RLFA 1IN5A 1PZNA 4JL8A 3ECCA 5CITA 1KY3A 1A4RA 2ZI3A 5H68A 1CTQA 4HZUB 1ETUA 1M74A 2JATA 4AKEA 2REXB 3VX4A 3UIEA 2G1JA 1LS1A 3FDIA 3SNHA 3D8BA 3UG6A 1YZQA 1ZIOA 4NMMA 5SZHB 2Q0HA 3ADKA 1YRAA 5HR5A 3F5FA 1BOFA 1CU1A 3ADBA 5K8LA 4RD0A 3LBIA 2FH5B 4P33A 4A36A 3TAHA 4TN1A 3FHOA 4FMBB 4TYYA 3LNCA 3L2OB 1MRSA 1P2SA 2QZ4A 3EZ2A 2O8CB 2VYFA 1FTNA 1NF3A 1TAGA 4NH0A 3W9YA 1KY2A 4Q4AA 3EPHA 2GCPA 2BJWA 5BQ5A 1ZIPA 1HH4A 3AF4A 4CYMA 3K0AB 1VYTA 4QHTA 4G1UC 2H18A 2FDCA 2G83A 2W6ID 2D2EA 2OO7A 1XF9A 4AK9A 4OQFA 1EFRD 2ZU6A 3Q7PA 2ONJA 2NTYC 2BM1A 2GK7A 2QM7A 2GZAA 4QGFA 1D5CA 1W0KD 1YRBA 2HJVA 2CMKA 2GA8A 3AUXA 1ZM9A 3KUCA 1DTSA 1D9XA 4PFSA 1WQ1R 3B5JA 3NBZC 4Q01A 2OBMA 2O0HA 1ZU5A 2WMNB 3S1AB 1BYUA 4JLBA 4OK3A 3KKOA 1WB9A 3K9LA 2B8WA 3FOZA 1D2MA 2GBLA 5A0FA 3T15A 2FPLA 5DN6D 4A8JA 1JJVA 1EFTA 1FUKA 1DS6A 2HDNB 5DHAA 1CLUA 2VBCA 1N0UA 1TUIA 5C1BA 1WBBA 4FMCF 5DI9A 3CW2A 4DLZA 1Z47A 3A58B 3A8TA 4BFVA 1G8HA 3RSOA 4IVQA 3I3SR 3K0CC 3IHWA 4D0NA 1MOZA 2PZFA 2OM2A 3OESA 4QL3A 4UKDA 3VKGA 1JBKA 3NH6A 2WWYA 5P21A 3DMNA 1KI2A 3QQ5A 4JLPA 1BIFA 2W0SA 4NPHA 4C0LA 3BH6A 1CR1A 3CPJB 2R44A 1IY0A 3QG5A 4C9BA 1W0JA 4CGZA 2F1RA 4B32A 1TQ4A 4MRSA 2AWNA 4BFWA 2J5XA 1E94E 2WKPA 3HR7A 1CJMA 2FEMA 1UBCA 4BZPA 5G40A 2IEZA 4BFZA 3MFYA 1MO3A 3E2IA 1E2MA 1K6MA 3KB2A 2Z4SA 2AXPA 1DE0A 1LF5A 1SVMA 3W34A 1F2UB 4TYQA 1KJZA 2YINC 4S35A 4B35A 4DLSA 1JB1A 5FTJA 3ZS9A 4RD6A 3J81k 1N6PA 1GOTA 1J90A 4DXAA 2BEJA 2DFKB 2IYUA 2J0UB 2OCYC 4AY2A 1YKSA 2ZSBA 2C95A 2W2VA 2CHGA 3LVRE 4TMTA 3W6NA 2RMKA 2NGRA 2ZREA 4HLCA 3KDSE 2IYYA 4LK2A 4NBSA 2X19A 2YYZA 5FL7D 4PQRA 1QHXA 1SXJA 2FFQA 2X77A 4URYR 1Z3IX 3GEIA 1W7AA 2FU5C 3KJIA 3LWNA 5M04A 4DLYA 4UNPA 5D3QA 2IYXA 1JAHA 2QE7A 5AWFC 3BERA 4HB2A 3NWJA 721PA 5JRZA 5JRJA 1FTSA 3T5DA 2FZLA 1QBKC 1R0XA 4Q4AB 4Y0VA 1OXVA 1M7BA 1OW3B 2WJIA 4DT1A 2EVWX 1E2FA 4ZKDA 1RZ3A 2G1KA 3BBPA 3E70C 1ZD8A 3CR7A 2C99A 1DAIA 1KAOA 3V4RA 1XFAA 1XJQA 4B34A 1GSIA 4GT1A 2A3RA 2YNMA 1NL3A 1PV4A 1LVGA 2DY1A 1UFQA 3V00A 1KZ7B 3SHFA 4NCIA 5JWOA 3VTKA 1CKEA 2W2TA 4JMPA 5GVRA 3VMFA 4CRWB 4B74A 1FP7A 1DELA 2VHQA 2UZIR 3UG7A 1NVUQ 3WMGA 2CLDX 3PXGA 2GBLC 4Q48A 3V9PA 5LDDC 1XJ0A 4A8JC 2ZSAA 1UBFA 4D0LB 3A1UA 1KMQA 1DG1G 3FYHA 3VU9A 4EAQA 4EPRA 1Z6YA 2MSDB 2V3CC 2D3WA 5EP1A 2WPDA 3KJGA 3VHXA 1YR9A 1T0JB 3JZAA 5L3SA 4V0KA 2IWRA 2W6JA 3BXZA 2JJ2A 3QVUA 3A36A 5AJWA 4KVAA 3TK1A 2KJQA 1SULA 5TARA 3IEUA 3GLFA 2DHRA 3A4LA 4CF7A 2A78A 4AKGA 2CNWA 1P75A 3OEHD 1H8EA 1Q3HA 4W5HA 2B6HA 4P4TA 4X8OA 5ANRB 1JAIA 2RHDA 2FGKA 3LLUA 2OLJA 1Z83A 3KKMA 3BS4A 3W5IA 1XDBA 3OIVA 1NP6A 3AVTA 1SGWA 1G3UA 2QTVB 1ZAKA 2QGNA 2WZQA 5IT5A 4EIWA 4QBGB 2YWHA 1OHHA 5DSZA 3W8NA 2LKDA 5IF9A 1ESMA 1OB2A 2RGNA 1E2HA 2GEVA 4MYCA 4TLAA 1KSJA 4IOKA 1AS3A 3EWAA 5H1YA 3AEZA 3QXSA 2OFWA 4WXPA 4LJAA 4V02A 3QI2A 3L8YA 2IL1A 2RKOA 3RWOA 4K8OA 4LBVA 1QVRA 3QENA 1AS2A 4OHYA 1DPFA 1VTKA 1QG2A 3IIKA 1SXJC 1P2TA 4M53A 2EFDB 4F91B 5EJEA 4PQYA 4DSUA 4N0DA 1C4OA 2CCGA 2JLYA 5LD2C 2FSFA 2DR3A 2IF2A 3FB4A 3T5GA 3GPLA 1OF1A 4PPNA 2YV5A 3REFA 4UNRA 4TT3D 2FF7A 4W7SA 1A1VA 1SXJB 4BEBA 2GAAA 1ZM3A 1LFDB 1QRAA 4Q7KA 2GJAA 2CLSA 3SE0A 1W2HA 4B44A 2Q9BA 4ESHA 1IAQA 2GEDA 2WIAA 5E95A 3VR4A 5B57C 2CXXA 1SQ5A 2OHFA 3LA6A 4IDOA 4O2RA 3CPHA 3N5CA 4F4JA 5CB6A 5J4HA 2YKGA 3QNUA 1EFUA 4Q1FA 2V6IA 3Q5DA 4Q02A 4C0JA 2ZUDA 5C46F 1BO6A 1EXMA 2IX3A 3LBHA 3EA5A 4B47A 4U02A 2VP6A 5TV2A 1ZC3A 1NN1A 4M1WA 2J87A 1COWA 1OJLA 1AQYA 1Z6XA 4JL5A 1KHTA 4EPYA 1NG9A 4QKQA 4URXR 3MMPA 1UM8A 2OEPA 2Q3FA 1LW7A 5EP2A 1Q1ZA 3GFTA 4AG5A 4ARZA 3AF3A 1X1SA 4FW9A 3MJRA 1O87A 1KI9A 2XZPA 1T8UA 4MA4A 3GEEA 4QHYA 4A0RA 5D3MA 4UJ5A 1ZD9A 3AP1A 4HUTA 1PUJA 4F7WA 2GAOA 4D82A 1EWQA 4IW3B 4PSVA 2OV2A 1YZTA 4K81B 4MKHA 3VU9B 2GNOA 4R71A 3ZD6A 1C1YA 1CS4C 5FPYA 2ZE8A 2J7KA 5L3SB 2QSZA 2PZEA 2NG1A 4D26A 4A1FA 5DYIA 3SR0A 3SS8A 5KPDA 3PR1A 1XD9A 4Q9KA 4CDGA 4DBLC 2IUSA 3NBFA 2X2EA 3I92A 3QEJA 3EZ7A 3GLFB 1O3YA 4L4UA 3BORA 3IEVA 1DAEA 5EXPA 4A9AA 3FFAA 2F9LA 4RJLA 2F9MA 4GRAA 5FOWA 3ZGXA 4MRPA 3B1WA 1DVRA 4TYWA 2C03A 4PC3A 3LD9A 5J4LA 1EFRA 2ZRHA 4AKHA 1JXMA 1TL7C 2D2FA 2G6BA 2R6GA 4TLDA 2ATVA 2PJZA 1W0KA 3ASZA 4BFXA 3AVWA 1S96A 4LOAA 1KI1A 5HE8A 1CRQA 1XXHA 2VO1A 2VH5R 3GFPA 5JCZA 4DB2A 1Z6GA 2ORWA 1FPMA 2AHOA 1KAGA 2VHJA 1VG8A 1J2JA 3SJZA 2KSQA 3B85A 1GWNA 4X8MA 5CYPA 3FMFA 1E0JA 2WAXA 1KI8A 3SYLA 1KK0A 4IFEA 5JHGB 3CZPA 1PLKA 1QDEA 2PLFA 1E2JA 4GL2A 1S2MA 3LW8A 3K0SA 2OUKA 3KZ1E 2F6RA 4LV6A 1OKKA 2FJUA 2ZRIA 4M2LA 4F93B 3P26A 4ASUD 2IXGA 3ONWA 1FFHA 2W2XA 3UMRA 3LV8A 2OZEA 3UPUA 4OQMA 2EYUA 2NOAA 1X1RA 4YQFA 4GNKA 2GRJA 3H1TA 3ND8A 4US1R 1RYHA 3OHMA 1G8YA 4O25A 5CDFA 2PLRA 1GFIA 1E9EA 1D6JA 1NSTA 4NCNA 1MV5A 4OL0A 4RVCA 3AP3A 2JIZD 2ZETA 2VF8A 3OE7D 3VR3A 1WE2A 5HKKD 1Q1QA 3WP1B 3T35A 2VA8A 4TMZA 1ZYUA 3U3KA 2XZLA 4P0TA 4DUGA 1OIXA 4ARZB 2ZROA 2ZYTX 2YC2C 1QHSA 1RVDA 4GMXA 3UKDA 3I72A 3WYAA 4AIIA 4EPTA 4NU0A 3RWMB 4BLRA 4O2LA 5CB8A 2AK3A 4QOSA 2D7CA 5JI3E 2PMDA 3ADCA 4KLZA 1QHHB 1PUIA 5BWMA 1MKYA 1U9IA 4HAUA 4B71A 1E2EA 3B2EA 4E22A 1KJWA 1R4AA 3L0IB 1AZTA 3BE4A 2WOJA 2B21A 2A5GA 5FPSA 4XVUA 1MABA 3VHLB 2IYLD 2F1HA 2X2FA 1G6OA 1FW6A 1RRGA 4R2HA 4IOMA 4AURA 2PX0A 3HPRA 1ZINA 5HZKA 3U4QA 2N1BA 4TYNA 1HYQA 2KWIA 4GMDA 4WZ6A 4Q1CA 3PVSA 3P32A 4LC0A 2ECKA 3TQCA 2C8VA 4MRRA 2EFHB 3FHCB 3I62A 1DAKA 5J5CA 4WAUA 1CJUC 2R62A 1OYWA 4FCWA 1G3MA 3PEUA 1E1RA 2VP0A 1XEXA 2FFHA 4Z1MA 4MRVA 4L9WA 4CVNA 1N5KA 1RYFA 2C9YA 1E4YA 2FV8A 2XX3A 1VKJA 3SEAA 1XXHB 2FEOA 2WWIA 1B23P 2CCKA 4RFSA 4V0ME 1J8MF 3R9XA 1E2LA 4LJYA 3RDPA 4Q7JB 5C4MA 4ON9A 1B0UA 4N1AA 1KO7A 4BLQA 2QNRA 4LWZA 3O47A 2Z6VA 3DOFA 3D6TB 1Q44A 4XVRA 3FMPB 1IJFA 3THXA 2ZYVX 1DG3A 1GAJA 2P6RA 3SFVA 4ZI2A 4FMDF 2JLQA 5K8IA 4TQ9A 3BH7A 2YWFA 5BN5A 2C96A 3OEHA 1A5TA 1TQ6A 4KBFA 2IYSA 2AKYA 2AX4A 1T91A 4HI0E 4N3NA 2GDJA 1D2EA 5AUPB 1NKTA 3TQFA 3C5CA 3ZQJA 1N5IA 2CEAA 2IEYA 1UBGA 3B9QA 4JKYA 2HYIC 1J99A 4Q5IA 2IS1A 1G7RA 4PC7A 1G21E 2JJ1D 2YWEA 3H0KA 3PV0A 3FKSD 4YMTA 2VF7A 2HCJB 1N3BA 5BYJA 2QP3A 2IF0A 3WNDA 2PZGA 1AQUA 2OFOA 3Q85A 3NVAA 4Q9JA 1OFIA 1W36D 4LRWA 3PJRA 4RCYA 2C77A 1ZW6A 1TQ2A 4DRZA 4MKGA 3THOA 1UKYA 1KK2A 5FUYA 4D81A 1P72A 2HF9A 2QTFA 2ZJYA 4DLXA 1M8PA 2FMXA 4PC1A 1G9XA 3CX8A 4DVGA 1U9IC 2BEKA 2NPFA 1U98A 2CCJA 3CH4B 3CKLA 5C18A 4DCUA 4KXFB 2QU8A 4LGMA 3DM9B 4TL9A 1SHKA 1ZCAA 2ERYA 3PEVA 4OYHA 5KU1A 2GXQA 1M7HA 3QIAA 4ACBA 2VLIA 4B3DA 4C0AC 3CLVA 4B3GA 1MABB 1WA5A 1CIPA 3I5XA 1OH5A 4KSBA 4DC9A 1Q57A 3U44A 4Q00A 3EASA 4PSAA 3QBTA 3QKTA 1G7TA 1A2BA 3EZ9A 4KLNA 1E79D 3HYRA 1RRFA 4YC7A 1T3SA 4ZCMA 4URVR 2CDNA 2QMEA 2QY9A 1XD2A 4WBSA 1XEXB 2HT1A 3LDAA 3CRMA 4PTLA 2AKAB 3BGWA 4JLOA 1R5BA 5JBQA 3Q8XB 1KO5A 2O8EA 2WJYA 3MWYW 2GESA 4RFSB 2CE7A 1Z28A 3MJHA 1P9NA 4JJKA 4AD8A 1NLZA 1U8ZA 8OHMA 3K9NA 2QP9X 1IXZA 1KJYA 4B2LA 5BN4A 3B1ZA 4KAXA 5G53C 2WBLC 3MG9A 4US0R 4HLDA 3QKRA 4KFRA 3AVUA 1Y63A 2FZ4A 3DO6A 2ZRFA 3THXB 4H1UA 1G7SA 4A0HA 5KTYA 5FBRB 2H57A 3U7GA 4QM7A 1AKEA 4A6XA 5JFGA 2ZYWX 2RH5A 2NZJA 2XEXA 4JBWA 5JWRA 2MMGA 4M9ZA 4AYTA 4DDTA 1XBTA 4Z51A 1I2DA 5L8VA 3B1VA 1A82A 1U8AA 4BECA 4LBWA 2EQBA 2ZRCA 2RGGA 1G4UR 3TE6A 5F98A 3KFXA 1KO4A 1JR3A 1UDWA 2ZAMA 3R7WA 2NO1A 1XTKA 2JLXA 1GG2A 3K0FB 4YMSA 2VRWA 3A1TA 1CEEA 1V43A 2C2HA 3P1JA 3IUYA 3ZQ6A 1GNPA 3ICQB 2BOVA 4IHQA 2OSBA 4D4KA 3R9WA 1Z06A 2BKUA 5FBVB 3KKQA 3K53A 5AUNB 1R5NA 1KI7A 1DAHA 5JHHB 4M1YA 3SHWA 2AD5A 1NIJA 4NP6A 2ZJ5A 5JJIA 1JPJA 1Y3AA 2BMJA 4LV5B 2JLWA 3R8CA 2R65A 3N70A 3BB4A 4NL4H 4ESVA 1MH1A 2ZS9A 5FTMA 5B2ZA 3AVVA 3LLMA 4EPXA 2E9SA 1Z6AA 3DMDA 1HT2E 2ZYUX 3T1TA 3K1JA 1OB5A 1CP2A 3C8UA 3NHAA 3EPJA 1NN5A 3PEWA 4HAYA 3ZDQA 1KDTA 2BM0A 2QG6A 3K8YA 4LBZA 2ZRPA 3ADDA 5HE9A 1T3LA 5TMPA 1KDOA 4M1SA 4XD7A 1P9RA 2ZJ2A 1WP9A 3LFUA 5L3VA 3AKCA 1P6XA 4ASUA 3K9GA 4MITA 3D31A 2ZE6A 4OHVA 5DISB 1HV8A 2D4HA 4XIGS 1SXJE 1E4VA 3AGQA 4C3ZA 1Z8FA 4DLWA 1LTQA 1Z22A 4URUR 2QQEA 3C14C 1W2GA 2ZRKA 2ZSEA 3ICEA 3ZVRA 4IFBA 4L8GA 4TMXA 1G18A 4QJ4A 5FR1A 2OBNA 1GKIA 4OBEA 5FR2A 3UATA 1XZPA 1ODFA 3IIMA 4PAOA 4Q7MB 3VFDA 3U44B 1UBEA 2QGZA 3TVDA 1HURA 1UPTA 2JIZA 2ZRMA 2BCJQ 4JT4A 2UVQA 2QBYA 2D74A 3OE7A 5FOXA 2OCPA 3NXSA 1Z0AA 4Q1BA 1E1QA 1XD2B 4NCKA 3THYA 4U7DA 3UWKA 2IC5A 5KOYA 4GI7A 4E07A 2XTZA 3LQQA 3G82C 1U8YA 3GJ5A 5H8WA 1CR2A 2YOHA 1YR7A 2XB4A 4QGGA 4WW0A 4NHOA 1TNDA 4XH9B 3SC3A 3UK6A 3CNNA 2O8EB 4TMVA 1M2OB 3WP0A 2RB4A 2HXYA 2FPMA 2WJHA 4XTRA 3LO5A 2DWPA 2QQ0A 4I99A 4HYYA 1Q12A 1BYIA 5IK2D 1UEJA 2Z43A 3QKRB 2PL3A 3BOSA 4DSTA 2WSSA 1U0JA 3EC2A 1R2QA 1DO0A 2XTMA 5KO2A 3DKVA 3KL4A 4MUBA 1NY5A 2FNAA 5SZJA 1F60A 3GLFE 1XMSA 1TMKA 4WIAA 3BB1A 5CK4A 3AVQA 1JNYA 1PJRA 4RD2A 1P2UA 5G3YA 3CF2A 4PAMA 1EWRA 3I8SA 1F48A 3R7WB 4BLPA 1WCV1 3TUZC 1FOEB 2VP9A 1GUAA 1VECA 1ZNWA 2WWGA 4HB3A 4M1OA 3UWOA 3CRVA 1ZVQA 1E0KA 2JLUA 2BWJA 1E2GA 1R6BX 4G5RA 1HUQA 1Z0JA 1F5NA 2G88A 5EE1A 1FQKA 4KFSA 4TL7A 2R6CA 3P4YA 1OXUA 2F1IA 4P4SA 2IUTA 1E9FA 2JDID 4US2R 2JA1A 1CR4A 3AV0B 1D9ZA 4QNMA 1GNQA 4IRUB 5GJBA 1YZKA 3LRPA 1LY1A 2I1QA 2Q3MA 3HU3A 1G41A 4TMKA 1E32A 3TGPA 5FBWB 4ZI3A 2ODWA 3KXKA 1UKZA 4O0MA 3M0EA 1KKLA 3WNBA 4L16A 4LBYA 4LJ7A 4IDPA 3OFND 3GLHE 1P62B 4DCVA 3CR8A 5KHOC 5FPKA 2O0JA 4A92A 3WRYC 4PZLA 1OPXA 4CT4B 1DAGA 1HQCA 1W47A 3DM5A 3L0PA 4LHVA 2D62A 2F1JA 3RS3A 3UMFA 2X1VA 4EKDA 2GJSA 3GEHA 3SJBA 5CLQA 2J45A 3UXMA 1W5SA 4QBIA 4C0KA 3GJ8A 2QA5A 2WJVA 3U7EB 1ESNA 3PUYA 3RANA 4UJ3A 1BMFD 5EUMA 3K9HA 4QNRA 4D4JA 2ONKA 4KHZA 4QBHA 5JS7A 2ZIAA 1FMLA 1IJEA 2F43A 3U3JA 4BQSA 4Q4HA 4ERNA 3WHLA 1Z2AA 4AG6A 1U90A 4MYTA 2CVHA 2IYTA 2ZAOA 5G41A 1CXZA 4JYBA 2AR7A 1T6NA 5CJPA 2QBYB 2ZRAA 2FSIA 3R8FA 3EIEA 4BUJA 4NZYA 4JIMA 4JJZA 3TAUA 2FSHA 2KBEA 2BV3A 3THYB 2ZS7A 1Q20A 2ZM5A 1KNXA 3A1VA 3ZIAD 2H8KA 3MLEA 4BLTA 2FWRA 5LBIA 3W6PA 3NIBA 1AK2A 2DFNA 1M6NA 1MO4A 1P9WA 5J40A 4B43A 5EP4A 4JVLA 4LSGA 3BWDD 4PSKA 5JJKA 2P0EA 1EG7A 3PUWA 2JJ8A 3T34A 3AVOA 4DLRA 1N6KA 4HDQB 1E9CA 2CK3D 2GXAA 1Z0FA 4E03A 1NMYA 2H7VA 1AIPA 4AKIA 5HCIA 1SVKA 1N5LA 3A4MA 4PAQA 1G1MA 1N6OA 3KKPA 4MKIA 1GNRA 3AH8A 3VKHA 3SQXA 4B3CA 2IHBA 2WAYA 5FI0B 1ZMXA 4B3BA 5FUVA 2ZXUA 2DWOA 3A1SA 3K70D 3B60A 3EWSA 3F3YA 2GWHA 2VEDA 4I1VA 2KE5A 3QE0A 5JS8A 4GP6A 4B6EA 5HTKA 4ZDKA 1FQJA 1YZGA 4GBMA 3HYTA 2ZR0A 1CJKC 4R7ZA 3EC1A 5AJXA 4BZQA 4OI0A 1L4YA 3OEED 1I4TD 4Z8XA 4P4SB 1RC8A 4JS0A 5DI3A 4LDJA 1XCMA 4DT1B 2IHYA 3DHWC 3WYGA 2A2ZA 1XXHE 3MRSA 2HLDD 2JLZA 4IVPA 2GK6A 4MGZR 3VQTA 2J0QA 1KTVA 4LPKA 3CBQA 4NCHA 4JLAA 3EIHA 4CIDA 1KMHA 4A2WA 3GD7A 3IILA 1E2NA 3CO5A 2VIIA 1AA9A 5GVSA 5KSYA 3CX7A 3LVQE 1HTWA 1R0ZA 5J47A 4WZBE 1AGPA 3Q3JB 1XCPA 2GCOA 2Q9CA 1KK3A 2WSMA 4I81A 1D2NA 5J4YA 4CEIA 5F9HA 4PHHA 2XGJA 3A4NA 4AC9A 3AP2A 2K5UA 1J7KA 2L0XA 1NVVR 2P67A 2ZR7A 2XSZD 4DCNA 4HDOB 2CLCX 2CL6X 3K0EA 3EPLA 4YXWD 4G0NA 5E4FA 1Q22A 3QUSA 1NJGA 4J0QA 4POAA 4D25A 1AZSC 2NO7A 3FKQA 3LH5A 4TL8A 3WMFA 1NSFA 2V7QD 4GFDA 1KOFA 3ZVMA 2VP5A 2YJTD 1KK1A 1T5IA 1W36C 2OT3B 2F3TA 3M1IA 3B1YA 1X6VA 1GZSA 2J0SA 1CF4A 5EUQB 5CDFE 2F43B 2G77B 3NEYA 3IO3A 3RRNA 2GJ8A 4LYHA 1R7RA 4Q4HB 3EG5A 4EFMA 4N0EA 1JXOA 1N5JA 2YC4C 3DOEA 4TLBA 2AN9A 4P3YA 2BBOA 5FOVA 4BZXA 4P31A 4TTQA 4O3MA 4NYMR 1UDXA 2F3RA 2RGNC 3KKNA 3C41J 1W36B 1TF7A 2AFIE 2W6IA 2QT0A 3OIYA 1AGRA 2OG2A 4IKEA 1Z0KA 4JZKA 4KSCA 4ZDWA 1JEDA 2IWHA 3RNLA 1OH6A 3ZLJA 1OSNA 1ZC4A 4NE2A 1R0YA 2WVJA 2VSOA 3O8DA 1GDDA 3SN6A 3BFVA 5AUOB 5KPJA 5IRCD 4I1SA 1S4QA 1NVVQ 3CONA 2NO9A 2QMUA 4YMUA 1IHUA 4FN5A 2QI9C 2VQSA 2BMEA 3R20A 2I1VB 4XWAA 3BB3A 1KO8A 4WXRA 3QG1A 2CE2X 4Q4JA 1ZJ6A 4KITB 1RRCA 4F92B 2QM8A 3I32A 4NONA 4RZUA 5CIWA 2IK8A 5DGXA 3ZS8A 5DN6A 3ZVNA 4HB4A 3HDTA 1KGDA 4RKEA 3IDQA 121PA 4LJ9A 1HE8B 2CHVA 2Z4RA 3KB1A 4QBFA 2ASEA 4JVMA 4Z8YA 3QY0A 4DLVA 1M7GA 5EP3A 2C9OA 2GZDA 2I3BA 3P27A 4HUQA 3TSWA 2ZUCA 1Q0UA 2H1LA 3F0TA 3QXHA 2P2LA 4NYMQ 3KQHA 4ZV4A 1BKDR 2IS6A 1KDPA 1NBMD 3HU1A 1GKUB 3ETLA 5CM9C 2AFHE 5FTNA 2ORIA 3BK7A 3KUDA 4FCVA 3T12A 3VNUA 4OI4A 3KJHA 2W83A 5FBQB 1SVLA 4MRNA 2VTKA 3L43A 5DI3B 1G3IA 1IQPA 2Y8EA 1GIAA 4W9MC 1PLJA 2PCJA 3ZJYA 2QL6A 4QXAA 1TF2A 2MMCA 1IN8A 4U5XA 5AUQA 4L9SA 1R0WA 4PANA 3VR6A 2KBFA 3L0OA 4BFUA 5IK2A 1XTSA 2OXCA 2IS4A 2UZ3A 1ZM7A 1N25A 3CM0A 4KFTA 4Q9HA 3I61A 4RZ3A 1ZBDA 2F7SA 2REOA 5DLQC 2IYWA 1E2DA 1G5TA 3C16C 2GCOB 1XJCA 2WHXA 4IXNA 4CEIB 5EQTA 1OT3A 3FFBA 1P4SA 1XU4A 2ZI4A 5D3MB 3VKWA 1E9AA 4M9SA 4EUNA 4URWR 1GL9B 1S9DA 3OAAD 1N6LA 2KI5A 3B8HA 3I1FA 1OFHA 4HDCA 5FL7A 4OI1A 2O8FA 1D8TA 2J1LA 3W90A 1XX6A 4XTCS 4TSFD 3ND9A 4BFTA 4PO8A 1Z0DA 4JL6A 3W3AA 1W0JD 2DYKA 2HJGA 3CRQA 2OXRA 1XMIA 3R9IA 2YHSA 3GCGA 4GPTA 3RS7A 1P2VA 2RGBA 2QMOA 3W6OA 2EW1A 3SYNA 3B13B 4Q4LA 3FMIA 5IDVA 3O8RA 3RABA 3U7HB 4OI2A 3SU8A 4GSYA 4M1KA 3WYFA 4RCZA 3DEFA 4PPQA 5J4VA 1G16A 1JQLB 1RRPA 2DCUA 2BMFA 1E3MA 4UQOA 4BE7B 2J7PD 1CR0A 5DHFA 1P73A 2A30A 1E9BA 2OAQ1 3G5UA 3C7KA 4QJ3A 2QENA 2ZEJA 4KYIB 4LUCA 4R9UC 5GJWC 3OFNA 2IXEA 1IN4A 1Z63A 3BC1A 1XMJA 3FMOB 4KI0A 2GF0A 4P4UA 4NYIR 4OHXA 1N6IA 1KZGB 2ZI9A 2XOKD 1E9DA 1VCMA 1E9SA 1ZRHA 1KSFX 1RE0A 2XJ9A 2IT1A 4IEEA 5JWHA 1SXJD 3AF1A 4DCSA 5KDDA 4QGAA 3SJCA 3VAAA 3EX7C 4Q4JB 1ONBA 2FGJA 4NTZA 1EFCA 3U6BA 5FOSA 1OIWA 3TMKA 1YJ5A 3LXXA 4JLVA 4Q66C 2PT7A 4XWOA 1KNQA 1DADA 3SQWA 2E1RA 4QJ5A 4NDZA 2WWWA 2QRZA 1E99A 4G3XA 3NBXX 4PR0A 4II7A 2ZVPX 4L15A 4TL6A 4WVFA 4RKFA 3WRXC 4BRUA 1J8YF 1NMZA 4OHZA 2ZVQX 3QJYA 3SBDA 2V6JA 2ZI6A 1TF5A 2H17A 3RS2A 1XZQA 1N6RA 4BASA 2NMVA 3RRZA 1SVOA 1I4DD 5K8TA 1SKYB 2J9RA 5BW8A 1C9KA 2GVZC 1CJTC 3IO5A 3RS0A 2CVFA 4M8NE 2E87A 4UNSA 3B78A 3ZZ0A 2EFCB 1RPZA 3ZIAA 3KXIA 1GRRA 5FOUA 4CEHA 3TVTA 3PITA 1EFHA 3A1WA 4GZLA 3JVUA 4H9GA 4GOJA 3TSZA 2A5YB 1X8JA 1R8QA 2WPDD 1P3JA 4RZ2A 3O8CA 2W6JD 4IVRA 1E2IA 2CK3A 1XEWY 2ODBA 1YVDA 4HLQB 1W46A 4UXJA 3AQ4A 3FVQA 2CNWD 2OE2A 2Z83A 3I73A 3IPXA 3QEOA 1OH7A 5FOTA 5AJVB 1H8ED 3KXLA 3BAFA 4MGKR 3HPQA 4A82A 2O8BA 2J46A 1FNMA 3MSXA 2O8FB 1JR3E 3ZD7A 2XNSA 4TT3A 5DNYB 3SJAA 4KVGA 3G0HA 1PVOA 3EXAA 1OFUX 2OCBA 2R9VA 4MH0R 3GLGA 2C04A 1UKEA 2WWFA 3RC3A 1MO6A 4HAXA 3C5HA 3QXCA 1X8LA 2QT1A 5F2EA 4TZ0A 1Z6TA 5TB5A 1II0A 4R2IA 3U4QB 4ZCLA 4CEJA 2W58A 4JBXA 3KX2A 3EW9A 3U3OA 4C0QC 3CX6A 2ZUBA 4Z54A 1E0AA 4PZZA 1FNNA 2HLDA 4Q18A 3CB4A 4LHYA 4A6PA 4EQ6A 2V9PA 1F6BA 2BHRA 1K5DA 1WXQA 3QBVA 4GDFA 1UEIA 4K46A 3W3ZB 1DAFA 1N0WA 2ZU0C 4LJ4A 4ZIRA 1JECA 1OXTA 4F4CA 5J4KA 3X1YA 2IA5A 3FE2A 2XNDD 2WKRA 2FX3A 3AUYA 3IGFA 5G3ZA 1Z0IA 3IBYA 4LX0A 3W5JA 1YZLA 3TJZA 2HT6A 4CT5A 4D6PA 4IDHA 1JALA 3U6KA 1UKVY 4MDFA 1HEIA 1H8HD 2B8TA 3BIFA 2XSZA 1QVAA 2ZRLA 5A4JA 5BN3A 4C0BA 1U0LA 1DOAA 1DBSA 4Q21A 2YOGA 1ANKA 1K8RA 2ERXA 2OBLA 4B48A 3GJ7A 2ZTSA 3E5HA 1Q1BA 2CHQA 3FGNA 4LHWA 5EXSA 4B33A 2V7QA 4EFLA 2EU8A 2BBTA 1NKSA 3KQLA 4C2TA 1G8GA 2G0NA 1XEWX 2AD1A 6Q21A 3MWLA 1XMVA 1YHNA 5EE0A 1F2TA 4Q7LA 1COWD 1K5GA 1P5ZB 5F3WB 5C4GB 4YMVA 4LHXA 3ZZTA 1XTQA 5KSZA 3D7MA 4LYFA 1FX0A 5BXQC 3THWA 2WICA 3T61A 4F4IA 4LYAA 4IJMA 5CJ2A 4ZPXA 2J0UA 2QMHA 1XP8A 1YR8A 3AVYA 2B92A 4DSNA 1T0HB 4IDNA 3OIWA 4CEHB 1VG9B 1Z5ZA 3GLIA 1OLOA 2C78A 1KO1A 2JAQA 5JI2E 1QF9A 3BFKA 1IY2A 2JCSA 3BD9A 2CL0X 1NNEA 2DFLA 1NVWQ 2VL7A 3NEJA 2A5DA 4H1VA 3WNCA 1G20E 3GFOA 2BCGY 4KV9A 4LJ6A 3PIRA 2WTUA 1IXRC 3B6EA 2O52A 3UANA 3K70C 1BS1A 3IKJA 4CZ2A 4M1MA 5EZ5A 4HAVA 4B3FX 1TADA 4C4PA 4XVQA 3QPVA 4FMCB 2ANCA 2F55A 2PJRA 2O8BB 2VP2A 4ILEA 1M1YE 1W44A 3TUJC 2CBZA 2FE4A 1DEKA 1Z2CA 3K70B 1NBMA 1ZUNB 1TQDA 1JJ7A 1GM5A 1KI6A 1IN6A 3GLGB 2LCFA 3MAAC 3PUVA 2W00A 3SDZA 4WZAE 2OCAA 3LX8A 4JT2A 1TEVA 4DLUA 3CNOA 2BKEA 4WA7A 4OK5A 1MO5A 3RAPR 1U0HC 4CEJB 1WBDA 1Q3TA 4EFNA 2ZR9A 1T3HA 2ZJ8A 3SI7A 4PHGA 3RS4A 4M9XA 3RSLA 4EQ6B 2BIFA 2FFBA 4A2PA 3RC8A 821PA 5HKKA 2BBWA 4IOJA 1U94A 4PPFA 5KYKA 5B58C 5KNCA 3H86A 1TU4A 1N6HA 1W4RA 3PUXA 1JQJC 4ZIRB 1E0SA 1R10A 1VIAA 4UXHA 2IUUA 1QZXA 1ZP6A 3M6AA 1OKKD 1U99A 3V4FA 3TH5A 4F38A 4MYUA 3JVVA 2A5JA 5C2JB 2KB0A 4PX9A 4DDUA 3AGPA 1FUUA 3QXJA 2ATXA 3EZ6A 3M4YA 3NC1C 1XRJA 3TBKA 1VIYA 3OAAA 4C7OA 2ZJBA 1OYYA 2IXFA 2J3EA 1ZCBA 4EPVA 2C98A 3CZQA 4GOKA 2ZRGA 4DDVA 4G5SA 4HEJA 5DO9A 4TSFA 5FTKA 4D0GA 5B30A 5JLJA 2P6UA 1XD8A 2WWHA 1W48A 1U2RA 1G4AE 1YQTA 5LB4A 2O8DA 3DZDA 5DYGA 1AS0A 3I5YA 3SYKA 3LBNA 5AJYA 3VR5A 1GP2A 4JSYA 2GXUA 4LJ8A 2ZSFA 4PC6A 3AM1A 3B1XA 2FFAA 1F2TB 4BGDA 1US8A 2V55B 1ZM4A 2ZITA 4OK6A 3NBYC 2J7PA 3QVVA 1XCGB 3SZRA 1FX0B 4DUGD 2FG5A 3HJNA 3AKYA 3THWB 2H16A 1EGAA 1NVXQ 3LW7A 1RFLA 2YVUA 3RS5A 4TWZA 3LAWA 2ORVA 3EPKA 3LXRA 2C9CA 5TY0A 3RRYA 1T8TA 5ELXA 4FWTA 3CF6R 1P60A 3GLIB 1A7JA 5EXTA 2XOKA 1CJVC 4X8HA 2Z0MA 4Y0AA 3N2EA 4LCBA 1NY6A 3AVPA 4MQBA 1G3QA 4BWYA 3TW8B 2WJGA 2REBA 3TR0A 3ZH9B 4PXAA 3F8TA 5A5GA 1HY3A 1S3GA 3CWQA 2VPPA 4HAZA 2HV8A 4PO9A 5CLLA 2V54A 3NHBA 2RGEA 4XSHA 2VSXA 4FD2A 4QG7A 1GVNB 2GJKA 2MSCB 3AKDA 5AJZA 1OFTA 3Q9LA 5DH9A 1LB1B 4C2UA 3PFIA 4A0FA 2OAP1 2ZRBA 4AYXA 2AK2A 1SKQA 2A9KA 4BLOA 4X8LA 1BH2A 1E1RD 4Z1MD 1KI6B 3DZ8A 5JJLA 1L8QA 5GJCA 4PQFA 2HUPA 1G17A 1QHGA 3OIUA 4TTPA 4OQNA 2JJ1A 5FBLB 3FKSA 2GTPA 1XB2A 2VHUA 4KODA 4C30A 3X1XA 5JEEA 4MUAA 2GKSA 3U2QA 4RY2A 1G5PA 1YU9A 4HB0A 5KNDA 3CUEF 1KIMA 4A15A 1IY1A 2JLVA 1TEXA 3CF0A 4A4DA 1DAMA 3NTUA 1WRBA 3FTQA 4DCTA 1VHLA 4KCGA 4AWXA 1HE1C 4G01B 3VR2A 3DL0A 2J0VA 4B76A 5SZIA 5UKDA 4DIEA 1SHZA 2G3YA 3MWKA 4B73A 4HZIA 4LI0A 5K8UA 3KQNA 1W4BA 1NMXA 1E6CA 5DE3A 4C7OB 2Q6TA 4FXPA 1XTJA 1SVSA 1ZNXA 4RSGA 1N2CE 4UXIA 5SZKB 4OQLA 3A6PC 2WV9A 3KJEA 2OILA 1OH8A 1LNZA 1W4CA 3MWJA 3H4MA 2ZE7A 4A8JB 4ZDIA 2EYQA 2ZRJA 2FN4A 2R8RA 1XTRA 2O8DB 2JLRA 3WY9A 4RZXA 1HQYE 1R8SA 3KTAA 3ASYA 2O0KA 3IQWA 4URZR 3T1OA 2NZ8A 1E2PA 2ZS8A 1E2KA 4QC2A 2SHKA 4TTRA 1US8B 1CULC 1NLYA 4QGHA 2ZI7A 4GZMA 3TLXA 2IBMA 3GQBA 3TKLA 3C4JA 3ZZUA 3RRMA 3ZVLA 1E79A 1SVIA 3B82A 3HWSA 3KFVA 3AB3A 4FWIB 1VYUA 4KBGA 2X8AA 3GLHA 5HPYB 4FIDA 1NRJB 3X1WA 2AXNA 3RVBA 5CYOA 1CBUA 1ZU4A 1TTTA 1YZNA 1NLFA 3GJXC 2I4IA 2IW3A 1HT1E 3O8BA 2HF8A 5B64A 3NDPA 2XNDA 2P5SA 3LX5A 4QRHA 2PX3A 4PPGA 3AF2A 4M22A 3TW4A 4PHTA 5FUXA 1GL7A 4CW7A 1H8HA 3A37A 1T4GA 1ZM2A 4U00A 2DB3A 1SZPA 2P3SA 2VHCA 4B6FA 3QOFA 3H2YA 2QSYA 4ZKEA 4HLUA 5LD2B 1GRQA 1JI0A 1VCNA 1KKMA 2JASA 5EXXA 4B75A 4GOXA 2QUZA 4OKSA 1VG1A 1NIPA 3MCAA 3IIJA 2RGXA 3EARA 4TYPA 2IS2A 1VCIA 4Q1DA 4BEJA 1VDZA 4V0OA 3SFZA 4DEXA 4LHZA 2ANBA 3TSOA 3QSYA 4DLTA 3WXMA 5JEDA 2Q9AA 3HU2A 5FI1B 1LF0A 1G8PA 1I2MA 2QN6A 1ZUHA 1U81A 4JLDA 4Q9LA 4LY6A 1OIVA 2IYRA 1WF3A 1MR3F 1S3SA 4WOPA 1SKYE 4MGIR 2YOFA 2WMOB 5AK0A 3VNVA 5F9FA 2QPAA 4KO8A 3C15C 3CNLA 5DIFA 4HAWA 5KNBA 4JLNA 4Q1AA 4M21A 1P61B 1EX6A 2RGCA 1ZNZA 5FPTA 3PG5A 4G5QA 1H65A 2QORA 4DSOA 5L3RA 1QHHA 1T5LA 3GJ0A 3OZXA 5FFMA 5FTLA 4QM6A 5EE5B 2ZE5A 3BH0A 3CIOA 4DHEA 1VCOA 1EESA 2ODNA 5H70A 2XJ4A 1N6NA 1TUEA 3H84A 4Q1EA 5EE3A 1UF9A 4UNNA 3X1DA 4D4MA 4EJSA 1Q21A 4XSGA 3U3MA 3CPEA 4PC2A 4D80A 4C0HA 2R6AA 4LJ5A 1AM4D 1Z08A 4RD3A 2PEYA 4XWKA 1FL9A 5E7IA 3PUZA 1TU3A 5EE9A 1G8FA 2H92A 1JR3D 1KSHA 3CWZA 3WBKA 2QP4A 2ZSDA 2Q3HA 1L7VC 4B2PA 2JGNA 2RHMA 1G64A 1Z29A 2GJ9A 1HA3A 1YZUA 1RKBA 2EWWA 4LPSA 2YWGA 3U61B 5CIQA 1QHNA 1RIFA 1CRPA 2R6DA 4TZ6A 2RCNA 3PCRB 4ABYA 3NG1A 5FUWA 3KTAB 4Q03A 1OXXK 3AKEA 1IN7A 5KUTA 2W0MA 4FINA 1II8A 1L2TA 4RD1A 3D3QA 3QKSA 4OHWA 5E7MA 3ZYCA 2WKQA 3HP1A 1E2QA 3PENA 1G19A 3REGA 2PBRA 3QF4A 3GJ4A 2ZQ5A 4LV8B 1VG0B 3RYTC 3TUIC 2HEIA 4M1TA 2V1XA 4PZYA 2GHIA 4EPWA 2RAPA 1XPUA 3GLHB 2GF9A 4D4LA 2PH1A 2HCBA 2BVNA 2ZJZA 4PHFA 3TR5A 4UNQA 2WWXA 3I4LA 4JLKA 3EIQA 3NKVA 2BC9A 4FI3C 1N0VC 4JYCA 4V03A 5JSZA 1AN0A 1DARA 4XD7D 2ZJAA 3NC0C 2OLKA 4LC1A 4M0LA 4YONB 1E96A 3DKPA 4HLUC 3VR1A 2XTNA 1TX4B 2IYVA 1WMSA 1KSGA 4OJKA 1ZUIA 4BRWA 3U7FB 3FWYA 2XXAA 1XWIA 1GKYA 4M4SA 3IHLA 2DBYA 1KMHB 1OE0A 3P4XA 2JLSA 1NJFA 2AL7A 5LPNA 3QXXA 2FPKA 1WDTA 3Q72A 4MKFA 2Q21A 1GITA 1TPZA 4JVSB 1VPLA 1UADA 1RJ9A 3K09A 3MUFA 3QPWA 3N2IA 2ZRDA 1GL6A 2ZRNA 2GEUA 1RW4A 4YMWA 1UJ2A 4TMWA 5CM8B 2PEZA 2ZJOA 4A2QA 4AYWA 5JECA 1EX7A 4RFVA 2D06A 1E1QD 1A2KC 2WJJA 4IDQA 3SBEA 4DIDA 1IXSB 4JVNA 2BBSA 2GZHA 4E09A 1FP6A 1E98A 3T1QA 4R98A 4ACAA 1S1CA 4M9QA 2CJWA 2PMKA 3BFXA 3KQUA 2CL7X 5IHPA 3PQCA 4JKIA 1G6HA 2NO0A 2JDIA 5EZ6B 2XITA 4S2EA 1UAAA 2EFGA 4JLJA 4YDSA 2GCNA 4EJSC 4B2IA 3Q7QA 3T1VA
chains in the Genus database with same CATH superfamily
2PSFA 3WVNA 3AVXA 3HXKA 2CFRA 3KJFA 3O8OB 5FQOA 4MVWA 4OQXA 3FTEA 1Q7TA 4JT9A 5H81A 3L3BA 2IYAA 5JD4A 1ULAA 4CKCB 1C9JA 2WSSD 3N0TA 4EMBA 1W4AA 2XAUA 3CKKA 3DDCA 3HG7A 5KSOA 3HBNA 3NIBA 1F5SA 1K4YA 1BW9A 1LS6A 1Z82A 1XTIA 1ZJJA 4XWOA 1I32A 2R8PA 2D7DA 1Z5GA 2AX3A 5FKJA 4G8JA 5E7QA 1F3OA 3VJMA 1UCFA 2IJGX 4N82A 3EGIA 3ITDA 4ARVA 3N53A 1A7AA 1I4LD 2IDJA 2YJ5A 3AY3A 2P75A 2BI8A 1X3SA 5U4XA 4YLGA 1HKHA 2FOLA 5KHAA 2YY7A 3AI7A 3TIVA 1TE2A 2P41A 1PEDA 5BN1A 4DJEC 2BEUB 4K3VA 1PG2A 4NYJR 2NP7A 4N9QA 4I1OA 4XQGA 5FPHA 1LC0A 2FN9A 2WUDA 3QOWA 4MW9A 2J9FB 1Y3CE 4V24A 3PFGA 2CJYA 3HVKA 2ODEA 3QFTA 5CUQA 1NXVA 3AWIA 3GLGE 1U4SA 4Q9IA 3DLTA 1U2GC 3P0RA 4JWKA 2WMYA 3HRIA 1JA9A 1II8B 1W35A 1S2GA 2JD0A 1M75A 2Q3EA 3OZVA 4GD3Q 5GZ6A 5FA6A 5ALJA 5JARA 1XRLA 3NALA 2R11A 3QF4B 3U62A 3ZD8A 5BYKA 1ESZA 1TW3A 4QHSA 2LNDA 3VMMA 3NMUF 1KEVA 4TS9A 2BT4A 2J59A 1XEFA 4GXQA 5KDOA 1O94C 3AONB 5JCPA 3COPA 3ML1A 1NA5A 3BCSA 1K27A 1S2LA 5LNK1 1D07A 1KI4A 2FA9A 3HO6A 3DWGA 5B3JA 2XMCA 3A6EA 4JSTA 2G36A 2ZJ6A 4BO4A 1PNVA 2IYQA 1Y7PA 4HZUA 2A5FA 4XWYA 4IMJB 3W5UA 1Z16A 4IIEA 2E85A 3ZW9A 5JSZB 1Q7CA 4H4DA 1TYDE 1A2QA 1Y98A 3AV3A 4KJZA 3PVCA 4B6OA 4V1CI 1G7CA 5G0WA 1NC3A 4MWEA 1FZQA 2B7CA 3CH5A 4IDGA 2JBWA 3E9RA 4N9WA 2AOVA 2XZOA 3K09C 2NVUA 2YHIB 4I4LA 1UT5A 5JS2A 4AFNA 3A9UA 5B7QA 4IXMA 4EFKA 2YN2A 3EK2A 2HADA 3GIDA 4Q39A 4W63A 5HJ7A 1XPRA 3AR6A 3NHZA 2EWVA 3CV3A 1NUSA 1R4MA 4OFWA 2NXNA 4GEGA 5EG5A 1DCTA 4D8UA 2CVOA 3B7PA 4P08A 4MI3A 4QUBA 4H60A 1RJ9B 4O4LB 4YT5A 4LKOA 4C21A 2G9NA 3H19A 3LBFA 3NH9A 1WW8A 4EG4A 3NBMA 3B8EA 3K0AA 1OREA 1RPAA 1U7HA 3I37X 3A27A 1KYZA 2PKQP 4LA4A 4Q19A 4XJTA 1VI5A 3R76A 2NQ2C 4BIMA 3ZVKA 2G76A 1AJEA 2OVFA 2BEWA 4KDRA 5C31A 2QPTA 5BSHA 3OT1B 4NZZA 1TQHA 2RI1A 3O4IA 1VDMA 4G5OA 1JU9A 5IDYA 2DSTA 4U7GA 1QIIA 3O1LA 1OHHD 3AUUA 4PYOA 1WU7A 2TS1A 5GM1A 2R2AA 1GQSA 2CJWB 2QN9A 1DX6A 1L7QA 3O1HB 4JI6B 4EKGA 3QIVA 1R6XA 4NZOA 5DFAA 4Z6KA 5JMPA 4E46A 4XXHA 2HCTA 2OZLB 2CB0A 5ULLA 4DWJA 2FFJA 4XIIA 3USES 1RWNA 1VIVA 1M6HA 1VPDA 4P3XA 3S1AA 1U63A 1DBRA 2YBEA 1QJCA 3G1TA 1XYVA 2QAJA 3DPUA 4ZQEA 3QE3A 3K73O 3WGQA 2BUCA 1NATA 2EWMA 2JEOA 1PFYA 3DQPA 3FB1A 3L0SA 3PFCA 4MW6A 2VP4A 3HDVA 4EBFA 3DAHA 2E37A 2I6QA 2A9VA 2ZANA 1BW9B 3K2EA 4MA0A 3W5CA 5GADl 4RD4A 1RAEA 3OF5A 4QELA 4XWWA 1JEEA 2C3MA 3OO1A 4CF5A 1ZVVA 1LPPA 2GETA 3DL4A 1X1CA 2BN4A 3O2QB 4F46A 2Q8NA 4OB7A 3KE8A 1EK0A 4V0LA 3CUSA 4I5EA 2HD4A 3PYMA 2WM9B 3F6RA 2D1QA 2DY0A 2OXFA 5ALEA 5DTQA 3EA0A 1L7OA 1Y5MA 1K92A 2NYUA 4EY3A 2F3PA 3RSQA 4FDMA 4BCDA 1FCJA 1SCBA 2RGDA 4NMLA 1Y8QB 4QUEA 1A9SA 1LXCA 1Z26A 2X9QA 4OP3A 1NBME 1G21A 1FU7A 1NBWB 2AI2A 3E61A 2HK6A 3QRWA 1Q0PA 1K6XA 3IOBA 4TQUS 3E3OA 3RD5A 1NM5C 3MT0A 3QPDA 1QOZA 4E0BA 2VAPA 4EIWA 5E3IA 1RCFA 1V5IA 4EO7A 2GKGA 1NN0A 1XPOA 1SUBA 4YAOA 3ZJ4A 1YE8A 2NVOA 1N5DA 5B3JC 4HH1A 3KZOA 1VE7A 3GCWA 3GMTA 4ZO4A 5DIZA 1PNQA 3V4SA 4RKYA 4ZDJA 4WN3A 1HZZA 4REOA 2QROA 1ZNYA 4JBYA 3EZGA 4IIVA 4X1KA 5CG2A 1Z18A 4QYIA 4FM9A 5TDHA 1ZXBA 2GPYA 2J6BA 3KDPA 3N0RA 4XSVA 1NUUA 1NQVA 1PZNA 2WTBA 1QQ7A 2QWXA 4LTDA 4Q1VA 3TLZA 4B9EA 1A8SA 1WPGA 4FUTA 1M74A 4HZUB 5AESA 2WILA 2WNSA 1UXHA 3UIEA 2OC9A 1LS1A 2ZPUA 3P2IA 3SNHA 3WL3A 4EYKA 3UG6A 5JSFA 4NMMA 2IYFA 2Q0HA 1YRAA 2QAIA 1MBZA 4CMGA 2CZCA 4PTZA 4TSKA 3R7BA 2XVXA 5I9IA 2ZUVA 3NNSA 4MW7A 3U7QA 2FH5B 2XLCA 3WK7A 4P33A 3IELA 1UBTS 2NVUB 4YUXA 4B3RB 5CH3A 3TAHA 4OJTA 3BKXA 1MEJA 4OOEA 5CLFA 3K4QA 4FMBB 4QAJA 1KR2A 3LNCA 1RAIA 4JC0A 3EZ2A 1R4MB 1F38A 4XGRA 4ZQIA 1WZCA 1TD1A 4NH0A 3W9YA 1KY2A 3HKCA 4Q4AA 3HWX1 2GCPA 2JD1A 4MVJM 1K6EA 2BJWA 5KIAA 3EPHA 3ASUA 5EGSA 1ZIPA 4E2WA 3SG0A 4CYMA 4BGUA 1EVYA 2ZW9A 3K0AB 2OECA 1FJ2A 3FBWA 4IO0A 5IT9A 3MILA 2RBEA 4QHTA 1IZ9A 2J5RA 1ILEA 4DDMA 3SSAA 2G83A 2W6ID 4NBRA 4ETIA 4BMCA 2D2EA 5ICCA 5BVHA 2R0QC 4AK9A 3DZGA 4MULA 4EMTA 1EFRD 5A4MS 4YCSA 3II6X 4PWZA 5CEEA 4HGYA 2PMEA 3S2IA 2GK7A 1D5CA 1YRBA 1KVTA 2HQ1A 2CMKA 2RK3A 1XZAA 4PZUA 1HDEA 5KJ1A 4PFSA 1WQ1R 4L51A 1RJGA 2X6QA 4DQ0A 3B89A 1ZU5A 3S1AB 1WG8A 2HNAA 4IGKA 4KQ2A 3GXBA 1G63A 3QU5A 4XRRA 4CMEA 4GWGA 1D0VA 3ROPA 4JI7B 4V1CA 5K3CA 1CUSA 1YFKA 1KE1A 4A8JA 3ZCUA 5HZMA 1I4WA 1FUKA 4R81A 4FYHA 2HDNB 3ZKWA 2EDAA 4YUZA 2I22A 4LZNA 5C1BA 5T64A 5DI9A 1RMYA 3CZ9A 2O1WA 1E3JA 4IVQA 3I3SR 4D0NA 1MQSA 1TA4A 1MOZA 2PZFA 2V6MA 2OM2A 1TYAE 4BZWA 5IKXA 4UKDA 3SHQA 1ZMTA 3FYDA 2D7JA 3I2GA 4UM8B 3NEPX 5IVHA 5JAMA 1T0PA 3UMJA 2W0SA 2H9IA 4GPAA 4U6QA 1NRWA 4MVJI 4TGLA 3BH6A 7YASA 5MHTA 2E4AA 4AJ4A 4LFBB 3N6RA 2R44A 1U5BA 1G21B 2MOKA 1IY0A 1V8FA 4FGWA 3DC2A 4B32A 4MRSA 4RJ2A 3AERA 4Q7EA 2ZCUA 3E0QA 3M70A 4UVGA 3RIEA 4BFWA 3HVUA 5JISA 1HZZC 2AKEA 5LZ4A 4D79A 3CKMA 3ONEA 3WLLA 4BZPA 1XQYA 5L4NA 4ND5A 1DKQA 1A69A 3BXHA 2RBGA 2LCQA 1T13A 4ZU3A 1MO3A 3F90A 3U16A 4UUAA 1OAOA 3KZXA 5JYEA 3N9IA 2Y1EA 5J63A 4PN7A 3QP9A 1ECJA 5EJ5A 4TYQA 5IW8A 5IT0A 1Q77A 2ZYGA 3JD0A 2A8YA 2BHLA 2PL9A 5FTJA 4CTMA 1FFBA 4G41A 1N6PA 4DXAA 4L08A 3T9FA 2BEJA 4Y2JA 2DFKB 2J0UB 3D43A 3AHHA 1YKSA 1PI3A 2ZSBA 2C95A 3EXHC 5H0IA 1H6BA 3LVRE 4JC4A 4ND3A 4ZAZA 3Q98A 1GCAA 2NGRA 2ZREA 5CB4A 1VCHA 3TM5A 4NBSA 2YYZA 3TJRA 1S6YA 2QUIA 2CC2A 4J0CA 1K63A 2Y1FA 3KR9A 3U7QB 4UCQA 1Z3IX 3GEIA 3EA4A 4QZVA 2FU5C 5M04A 1W9HA 4KXXA 1W7AA 4DLYA 4AUKA 1PD1A 3JV7A 1KC3A 4UNPA 5DHQA 5CA0A 4F04A 4DAEA 2NUTA 2A58A 2B99A 3SY8A 1RNLA 1YS7A 5AWFC 3UK7A 4U2GA 3RH0A 5JRJA 4YR7A 1PL6A 1PJAA 3DWIA 4KDFA 3M2PA 1MAAA 3VOBA 3HKCB 1PV1A 1R0XA 1YJCA 1OXVA 1XC7A 4Q4AB 3X2FA 2PIDA 1CR6A 3MA0A 4RQBA 4NX2A 4FT2A 2Y05A 1EQ2A 5AXAA 3NBQA 2H2GA 3V4RA 3M6LA 1XJQA 3A1FA 3MJSA 1D8AA 3PIDA 4MV4A 2YIDA 1CQWA 4OXXA 3SX4A 3KB6A 4IH9A 2H29A 3PJFA 1H1LA 1KA9H 2DY1A 1YCDA 3ET5A 5CFPA 1M66A 4NCIA 4R9RA 2FX2A 1LA2A 4JMPA 2GN1A 3ZGYA 5GVRA 3FRHA 2ZSUA 2R1ZA 3FF1A 2VPWA 4HQNA 4B74A 1BJTA 3DW3X 3UG7A 1NVUQ 2PZKA 3T54A 3WMGA 4CMEC 3BBLA 3CF4A 2P0AA 1G8JA 2CLDX 3OETA 4EENA 3ESXA 2PU7A 4YROA 4JENA 4A8JC 4I3FA 3FVTA 3TVYA 3NKFA 4YQYA 1VJGA 4D0LB 1A50B 1ENYA 3HXOA 4PG8A 1DQPA 1PFUA 1DC3A 1UK8A 2V3CC 3M9LA 1K7EB 2MSDB 3W5SA 3PGJA 2YJGA 2D3WA 1P7WA 4KR3A 3D7SA 2WPDA 1TKCA 1T9ZA 4MKZA 3RUPA 3RC9A 3PJEA 4H7DA 2X5XA 4XLLA 4V1CB 3JZAA 5L3SA 2IWRA 4A8JB 1O9HA 3A36A 3VYRB 3ZKWB 4FW8A 1CF2O 4YJ2A 3A4LA 1PZFA 4B6RA 2NM0A 2HDWA 2CNWA 2JIPA 3ORSA 1CYEA 2XT9A 2VC2B 4D6YA 1H8EA 4W5HA 2OO3A 1SCAA 3MZ0A 1XQVA 4O2AF 1MOSA 4X8OA 2BMWA 3OPQA 4QUKA 4IIJF 2FGKA 5CXUA 4HDAA 3AVTA 1MPTA 1TYEB 1SGWA 1U5BB 1VLMA 2QGNA 4HNQA 3A6KA 2PX4A 4G5FA 4EHLA 2PQ6A 1OHHA 2QTNA 2YWHA 3AERB 3D3EA 1KIFA 3AG6A 3L40A 4IX9A 4LYEA 4XGQA 1B6TA 4DA6A 5KHLB 4PX2A 2GEVA 2GNAA 1T2UA 1KQFA 1MW8X 5EQDA 4D9NA 3TLAA 4TLAA 1MZPA 3PHJA 1KSJA 1RWXA 1CUDA 4MXDA 4IOKA 4P9NA 2FQXA 3KSRA 2QMZA 3L0BA 3M1AA 1SXPA 2O6LA 3EWAA 4LXQA 3PUHA 2OFWA 3D7NA 1RACA 4QOJA 4WXPA 2YWBA 1FFGA 1XF1A 3K3PA 1Q17A 3UCEA 2V58A 3E8SA 1KETA 3L0YA 4K8OA 2PZLA 1JIQA 2QYHA 3FUXA 4R31A 1WUTA 2DBVO 2C2XA 3I6MA 3LPAA 4JB2A 4FOTA 2JIOA 2OM6A 3GVXA 2DG2A 3E22A 4XVHA 2OB1A 3GGOA 4K9LA 3WLMA 3C6BA 2PUTA 4CR6A 4DSUA 5CB4B 1OX4A 1HYBA 2NU6A 2FSFA 4YJ3A 1G9TA 4K6KA 5BSFA 3U09A 3GPLA 4UVDA 3H5RA 4EUHA 2FF7A 4GQIA 2Q1YA 2XKAA 2I33A 4K6CA 1DCFA 2VJYA 4MGHA 4BVJA 3SVTA 4Q7KA 1QHFA 2QD2A 4HNVA 3P96A 3R2JA 1ISMA 4CM7A 2Q9BA 4ESHA 1IAQA 2GEDA 2NUTB 4DNOA 5B57C 3U80A 4IF4A 2DT8A 4GI3A 4E30A 1EJ2A 4Y1RA 1EFUA 1MX5A 2O57A 3Q5DA 3BTOA 2B69A 3BMXA 5HVNA 4W1PA 2NYVA 1EXMA 5AI6A 5AKZA 3SHTA 3LBHA 3OPMA 1JQ5A 4FHDA 1CERA 2JKVA 4U02A 5IJAA 2CXPA 2NXWA 3OKAA 1JHVA 1YI0A 1ZC3A 3PRYA 5C32A 5IUNC 2J87A 3Q7EA 1XLTA 4PM4A 4EL0A 4TVSA 3SOZA 1QK5A 3S70A 1H1LB 3GRVA 1QTNA 4CM5A 1GZ3A 3WGIA 5E3JA 5JBNA 2HPHA 4WNIA 1NG9A 2FZVA 1JHDA 1UXIA 1XTVA 2Q3FA 1ZIDA 2NX2A 1RWMA 2BUAA 5EP2A 4F4DA 2I6GA 5EWJA 4Z7JA 5JAZA 3DHVA 1CB0A 1SVUA 3OFSA 4JYMA 1O87A 4DZTA 2R79A 2CV0A 5F2KA 3W2IA 1L5GB 1M1XB 4A0RA 1FSPA 4UJ5A 3EGOA 2Y76A 5FYQA 1PUJA 4TTTS 2GAOA 4BNYA 4D74A 3TZHA 4IW3B 4AWBA 1DO8A 4PSVA 1UBSB 3EVTA 1YZTA 4GYJA 3FFTA 2GNOA 2BJHA 4R71A 5JY1A 1XELA 2AOUA 2PV7A 1L4BA 2Q6LA 4G2NA 1BZYA 2PMWB 5FPYA 4BO5A 4W8OA 1FSFA 4DYVA 2JHAA 3PC7A 4X3CA 1ADFA 2J7KA 5L3SB 1EK5A 1N8SA 4OQZA 4ENTA 3ENQA 4GWKA 4I5FA 5ER9A 5DYIA 3LUKA 5KPDA 3FWHA 4Q9KA 4YJ2B 3S2FA 4DBLC 5BP7A 5J2UF 1GZVA 3I92A 1IHPA 4MWCA 3FUWA 3LCCA 4F2DA 3BORA 4JUIA 5DOZA 2EARA 4JI1B 3N8GA 2C4MA 2C4WA 1LDYA 2HY7A 1FYVA 1C9YA 1LJUA 3ENKA 4CG2A 2NO4A 3BF8A 4ZOEA 4E94A 3GFBA 1RPTA 4WY8A 1DVRA 1U7UA 3UB2A 1Y7IA 1I5RA 3Q7RA 3K30A 4ZOQI 3ORFA 3WK4A 2J5QA 1N1GA 1WVMA 4PC3A 1P9LA 3TQIA 3UMYA 4IJQA 1EFRA 3R8FA 3IVXA 5BWNA 2Q1XA 1TL7C 5EHXA 2D2FA 1YOVA 4P4NA 5T8KA 4BFXA 3HWWA 4J0KA 1E5XA 1D1QA 1S96A 1XTPA 1JSRA 3KEOA 4CMKA 3GOQA 4X71A 4A6DA 1EMDA 4ZU1X 2CUKA 1TO6A 4EHBA 5GV7A 2AHOA 4IJUA 2VHJA 3T4XA 1J2JA 1KZ9A 3SJZA 4RF3A 2OWEA 1PR2A 4P82A 1DEOA 5DMXA 4F12A 2ZYDA 5CLJA 1UDAA 4X8MA 4MUFA 1T9BA 1AK9A 2DWUA 2YHAA 3I2KA 5CYPA 5DNDA 1FRVA 2VTDA 3W0LB 4DC0A 2JANA 2ZUWA 4IFEA 5CCBA 4G4IA 2BGNA 1U2QA 1R66A 4M60A 5FA5A 1E2JA 2W6CX 3KWMA 3NWPA 4OD0A 1V8PA 5CNKA 5ALDA 4E5SA 2OUKA 4L1KA 1X80A 2YWDA 4OHCA 1HDRA 3R6GA 4LMRA 4DREA 1RHJA 4YP5A 4WHMA 1OKKA 2HRDA 3HZRA 4LGVA 1E6UA 3RVQA 2VUSA 4QQRA 1OX4B 1JQAA 1M5TA 2NU6B 2JGMA 4KMOA 4X6LA 4YJ3B 3UYLA 1ZFNA 5HWSA 4KK4A 3VSEA 5CDYA 3ZDZB 5IJ9A 4YV7A 3HCWA 1H05A 3KYBA 2BH2A 3ONWA 1JG7A 1FFHA 3H3XA 5CXSA 1PJTA 4BGVA 3LYHA 2DUJA 5KSWB 5ADUS 1RC1A 4JC5A 1Z4QA 3DYIA 2EP7A 3NM5A 5DHSA 2P78A 5JCXA 1J8FA 1DBIA 5BPHA 3ND8A 4Y1RB 1XLTC 4MJ7A 4O25A 4RJJA 5CDFA 1JDUA 3DE7X 2XQKA 1GFIA 4YUWA 3OVMA 2QW1A 1D6JA 4OL0A 4QXOA 4RVCA 4G4SP 2RK4A 3SYRA 2AEMA 5F7JA 1RZRA 3ED5A 4NZMA 4RTNA 4C5CA 2A0FA 3MMNA 3VR3A 1AE1A 2XGGA 5A1JA 3GL9A 1UPUA 3RVPA 2JFOA 2CLKB 1V7QA 1GUBA 1X7DA 4S04A 4P35A 3T0FA 5AM1A 2MCFA 5CRIA 2PSDA 2V4UA 2GM9A 3PC4A 4U1RA 2XZLA 1OMOA 4DUGA 4BMYA 3R7DA 3SIXA 1VBKA 2B5OA 5EWJB 3TIXB 4RY8A 1FNDA 2JBAA 3FYSA 1K0FA 4FGKA 4C0XA 1RVDA 4GMXA 3I72A 4ZGWA 3ZE9A 1YVEI 2PLNA 3JU3A 4OHOA 3S44A 4NU0A 1Q11A 3F96A 4O2LA 1IIBA 2YQ5A 1GN9A 3AEKA 4KLZA 4CKXA 4F11A 5GY7A 2A59A 3OQHA 2AOUB 5AK5A 3BXOA 3QGMA 4QAQA 4HAUA 3AUTA 4M9RA 4LTNA 1J20A 3G1WA 3B2EA 4I5GA 4BV2A 5I8WA 1HO3A 1AZTA 2QUBA 2WOJA 4LNHA 1DDIA 4M0DA 2B21A 3V5NA 2AYXA 4MS4B 1YVPA 4INZA 2F1HA 1G6OA 3MGGA 2Q5HA 3HB5X 5EJ9A 3HPRA 4K6FA 1VLLA 5IYZF 4P0QB 3UMCA 5EIXA 4IR7A 3EF1A 3PVSA 4UE3S 3WZMA 1SBYA 4LC0A 4IGFA 1AB6A 2WIFA 1V11A 3QLVA 3DP9A 4MVJG 4I14A 5T8KC 1DAKA 3OM0A 5J5CA 5IXYA 5FUQA 1ST2A 2AFHA 2QM0A 2J3DA 4HMQA 2JHGA 2R62A 2OO5A 1XLWA 5A4AA 4H7PA 3MQ2A 4MYSA 4WLVA 1QNFA 1KRXA 4YDQA 2BD0A 3MPUA 4L9WA 3C6KA 4CVNA 1AHPA 3PTAA 3UT0A 1VKJA 1JFRA 1GA1A 4PYJA 2B0JA 4ND8A 2V8BA 1W1UA 3U9LA 1GTMA 2CCKA 2CNNA 4V0ME 1GLVA 4LJYA 3RDPA 3VVCA 3USZA 4ON9A 3PVZA 1ETHA 3CINA 1B0UA 3JQ8A 4N1AA 2BUBA 2IHTA 4N8SA 4Y6GB 5E1MA 2C5GA 2Z6VA 3DOFA 4NOLA 3DT6A 3IUNA 3N2LA 2CFTA 1GNSA 2FPSA 4WNYA 3WWCA 3ZU2A 3THXA 2ZYVX 1DUIA 1GAJA 4IF6A 2W22A 3CSUA 4X90A 3OU6A 4PLCA 2IOFK 1WSBA 1JVNA 3D4BA 4QVGA 3WADA 1X80B 4MIYA 3RHSA 2YWFA 4RPKA 4ZMSA 3SJ7A 2XNCA 4PZCA 4PBSA 3L4EA 5K4AA 1A5TA 2JB9A 4KLAA 4N3NA 3EGVA 2AX4A 4P80A 4BNFA 5JCJD 1VKRA 5E1OA 1D2EA 3F9IA 5AUPB 5IJ9B 1NKTA 3TQFA 2O6HA 3C5CA 3WQHA 2BE9A 4I55F 4L07A 4KQ9A 1SBZA 1ZDMA 5AM4A 2P2ZA 4TVKA 2B36A 4UHEA 2V7EA 3B9QA 4J0HA 5JXWA 2O20A 3QVLA 4WXMA 2UUCB 1J99A 2DHEA 1G7RA 1FRZA 2LDXA 1XK6A 3FKSD 5K20A 4HYEA 1IBSA 1YS6A 4EI2A 1FRQA 2VDNB 1B7GO 4KHPB 2PZGA 2OBXA 4ONEA 4QEZA 5COAA 1UDBA 5IXSA 3IKLA 2EG9A 2C77A 3T7DA 1TQ2A 4D3SA 4FKZA 3CR3C 1RYBA 3J80A 3THOA 1TCBA 4KWEA 3MGAA 1NQTA 2HF9A 4KXUA 2ZJYA 4DLXA 4Z0HO 5GGYA 2QG4A 2FK8A 4G0ZA 3TTVA 3FXAA 1JFFA 2Q6IA 4OMDA 3I1IA 3OLVA 3D3WB 2OOSA 3GUCA 1JFTA 2AFRA 4HS4A 2NPFA 4IV5A 4WOCA 3D8SA 1F4VA 1SC1A 3GR6A 4J4BA 5K05A 2DQKA 1KAHA 2QU8A 3DM9B 2EATA 3AEKB 5ICFA 4NFSA 1OFVA 3AJAA 5DM2A 2AUTA 1ZGGA 3GEGA 3OJOA 4HP8A 1SHKA 2ACEA 4X6XA 1M7HA 3QIAA 2VLIA 3U0BA 2VF4X 4UPEA 1K8XB 5LL6P 4OXQA 1V1RA 2XGOA 3QX8A 1ZL0A 2GD1O 3WLNA 3T38A 4AKSA 5TC4A 3FNGA 2A4MA 2BFOA 3FPEA 2ZB8A 3DO8A 3GRZA 1DFIA 3VR0A 1UQUA 4AUEA 3UGQA 3FHJA 4GYKA 3CWCA 1QIEA 2OO5C 2IGTA 4KQFA 4HBZA 5I5GA 3OF3A 1AK1A 2CNDA 1STOA 3UFBA 3EASA 1RU3A 3H8WA 5KVQA 5I48A 2R1VA 3QKTA 1PQYA 2QR5A 1V11B 1CUWA 3STTA 3KQPA 1MN6A 2FW7A 2OGSA 1RRFA 4ZCMA 2AFHB 1SCKA 2H0QA 5FP0A 1BMDA 1XZDA 2QY9A 1XD2A 3JWIA 1O2DA 3VO9A 3EMDA 4FWBA 3VSDA 4C14A 5KMGA 2EW2A 3EUWA 2ADMA 4CCSA 1SQ6A 1R3DA 1ZEMA 4OP1A 1G42A 2QHXA 3LDAA 5EJMA 2E4WA 1YMUA 5TQVA 3B6ZA 3R23A 5J1TB 2AN3A 1ZK3A 1YB4A 3FBTA 3OG9A 4ND8B 3DE5X 4BB0A 5JBQA 2O8EA 2DBRA 3MWYW 5JZSA 2CE7A 2DQSA 5I9BA 1I7DA 1HORA 4LHEA 1U8ZA 3K9NA 3K35A 1PR3A 3JQ8B 4B2LA 2JI6A 3IE1A 4BVHA 3B1ZA 3B9RA 4KAXA 4A6EA 4M8IA 1ZXLA 4HLDA 5AHWA 2IOFA 3T4PA 3AVUA 5JYBA 1MPXA 3EODA 5DBEX 3THXB 4R1TA 5KNCH 3Q2KA 4RVGA 4QM7A 5DLYA 2WUGA 2VJDA 4A6XA 1V8DA 1L5YA 2XEXA 1SUFA 2NZJA 4R01A 2E4YA 1QWSA 2IP2A 1I2DA 3B1VA 4BQPA 1KYTA 2WT8A 4LBWA 2CFCA 2EQBA 3WKCA 3DWFA 1G4UR 1SQFA 5F98A 2HRCA 1JR3A 3NC4A 4R16A 1UDWA 3A31A 1J1ZA 2PGNA 1IDOA 2I2DA 2Z95A 3DOIA 3K0FB 3CB2A 4IG9A 4LRSB 1F8GA 5L51A 3D1VA 1N7GA 2N47A 2WKWA 1JDPA 3CZ4A 1GYQA 2BOVA 3D64A 5A04A 3I9KA 1KH2A 2V0CA 4PONA 1Z06A 1OBOA 3JQFA 3E7WA 5FBVB 1QGOA 3K53A 5PNTA 3LY9A 1EI9A 5FPPA 2XE7A 3SX2A 3V2GA 1C0KA 4U7HA 2IPAB 3GLRA 1A97A 2WSBA 4WSOA 4JN6B 3OZUA 5JJIA 5C8DA 1NOIA 2JCXA 2QW0X 1Y3AA 1VA4A 4IFTA 2JLWA 2J8ZA 3K0BA 4CQMD 3H16A 2ID4A 2R65A 2ZKLA 4NFYA 3TF5A 3LPNA 4XDZA 2VJAA 3E3AA 3O3OB 2DWCA 4X61A 5FTMA 4ZV7A 5T41A 4JELA 3RJ5A 2YV3A 3ZYZA 3LLMA 1X7YA 1WSAA 2IEIA 1E1NA 4EPXA 3DTVA 2EZUA 5L7WA 3CTMA 4FGZA 4GH5A 3DMDA 3WLAA 3UAXA 1J2RA 1J23A 2X9GA 4LWQA 1JFFB 1BCSA 1NRIA 2EFYA 4NSNA 3ST7A 3G85A 2OB2A 1T43A 3PEWA 1UBKS 3K8YA 3CUTA 3IR7A 1PT7A 1EDEA 1U2TA 2Z2YA 5BV8A 4YJDA 1H2BA 4AIRA 2ACWA 4DMCA 3T52A 4YFVA 4BRSA 1U1IA 2GA9A 4D57A 3LFUA 2BL4A 5L3VA 3MGKA 3TSCA 3WYEA 1YNSA 1G8SA 1YIDA 8GPBA 1H85A 2ZE6A 3C7CB 2VKTA 2ZTUA 5DISB 1HV8A 2D4HA 4HNGA 3QUBA 6LDHA 4EYGA 1Z22A 3FRIA 1U8FO 3HXPA 1GTZA 1V1RB 4NAHA 7MDHA 5L9AA 2QLBA 1W2GA 2ZRKA 3KKEA 1VE1A 4P3NA 4RU1A 1ZG3A 2I76A 1AV7A 1P7ZA 1WSDA 2OBNA 5FR1A 3OZTA 3PNYA 1USIA 4OBEA 2B2NA 2I8LA 1JEQA 1N7IA 1ODFA 1U11A 1DIHA 3NHFA 3TSAA 5DB4A 1EWTA 5FWYA 1HURA 1J2UA 2R1VB 1EINA 3LMKA 2ZRMA 4KAJA 2NUAA 5JSHA 1DB3A 1ESDA 1NR5A 2GR9A 4N3GA 4B5LA 5FOXA 2I67A 2FQ1A 3E3MA 1ZWLA 1H2YA 5DP1A 4D9HA 1E1QA 1XD2B 1ZR2A 3THYA 4WN9A 5KMGB 4RNDB 3UWKA 2XQIA 4GI7A 1K8YB 4NBWA 3JQ9C 4TV8F 1WXWA 3G82C 3ANSA 4H31A 4UHBA 4E07A 4R0MA 5H8WA 1Z8DA 1IDN1 2R00A 2XB4A 1KOLA 3VU3A 4ZRMA 2XADA 4ZWNA 2VQFB 1GTSA 4O1HA 1HEYA 1TNDA 4Q4CA 2O8EB 4OL9A 2ZIUB 3VZDA 2RB4A 4FHZA 3WOHA 2WJHA 1R6UA 1N2BA 2PUWA 4CLXA 4YT2A 2BFWA 2BCEA 4I99A 1Q12A 1MIOA 2GASA 4G85A 4UHKA 1XRNA 3QUQA 1UEJA 5DLDA 2WIKA 3SSOA 5IK2D 4G0VA 1H4VB 2PL3A 3H17A 2WTMA 3FSGD 3CO0S 4JDUA 3BCUA 3PDHA 4FQ8A 4IQ8A 1DMSA 2DSNA 1R2QA 2B61A 3EC2A 2XTMA 3LKZA 1Q6ZA 3KL4A 2FNAA 1D03A 2QN2A 1AGYA 1F60A 3GLFE 1KMMA 2RHOA 1TMKA 2JLAA 4MQ6A 4FFLA 5HM6A 4Z4EA 2OHXA 4KWIA 1U0BB 1M1YA 3VPAA 4KZKA 3JQFC 5JCOA 4A23A 4DR5B 2GYYA 3DZCA 4Z5XA 2DTEA 4B6GA 1GUAA 4HB3A 2DTXA 2WWGA 3ZHRA 1RKXA 4XCXA 5F1PA 4I4TA 3K6SA 2IU0A 3FR7A 1E0KA 4KE6A 5L7TA 2VZ8A 3IPCA 1E2GA 4WKBA 4BGIA 4J16A 3V8MA 1F5NA 3JQAD 1NHGA 2XYVA 5HS6A 4I3HA 4Z3KA 1XKTA 1E5VA 3P4YA 4HN2A 4QTTB 4Z49A 2A9QA 3T3EA 2OZVA 2QD4A 3N2ZB 3PFWO 3R5JA 1NVMB 2Y0DA 2VDKB 3SQDA 1XYGA 2PZJA 3IEXA 3O9MA 5JQWA 1LY1A 3QYFA 2O05A 3HBLA 4HC4A 5GZ3A 2C5AA 4TMKA 1E32A 4F96A 3LE8A 1B1CA 3IAAA 4AB1A 5G4LA 4ZI3A 2ODWA 3CHYA 3ELBA 4WLFA 3NPMA 1TRHA 4GSKA 3OEYA 1X7YB 2HHLA 2XMDA 1KKLA 3DTVB 3TS1A 4L16A 3VPXA 3N86A 3RNOA 4LJ7A 4DQDA 2HKIA 4IDPA 2GJ4A 2VR1A 2B37A 3GLHE 4BJHB 1ZZEA 3AL3A 3CR8A 1BCSB 2ZKIA 4S1OA 1A5SB 1LJ8A 3E9QA 1VKOA 2ZIZA 1HQDA 1L3IA 4J1TA 5SY6A 2PUCA 3NM6B 9ABPA 2X7HA 4L9AA 2O0JA 4IWNA 4GOLD 4L5AA 4PZLA 4B2YA 5CNJA 5JCJA 1NTRA 4LHSA 1W47A 3L0PA 1X9IA 3DGFC 4NBTA 4KR2A 3VAYA 3FGPA 1YB7A 2IUEA 3GEHA 3PT9A 4FYPA 2I87A 2QV7A 3G7SA 3GJ8A 4R9SA 2WJVA 3U7EB 3WJ7A 2CXNA 3IAM6 3PUYA 4UJ3A 4CKZA 5LLDA 3FZQA 4EP1A 1BMFD 4Z4HA 5MGNA 3K9HA 4Y9UA 1P1RA 4ARAA 3UUGA 3OMLA 3ZWWA 1Y4UA 2PFGA 2PBZA 1JEQB 3OQMA 4BNKA 2PT9A 4BDTA 1NPYA 5DRTA 2I8AA 1DQZA 1TC2A 1YSCA 2GN8A 3G23A 1MVLA 1Z2AA 1U90A 1DBPA 2EZTA 4AG6A 2NUAB 2IYTA 4DLKA 1F9EA 4JYBA 3OCZA 3NTOA 2R00C 5CJPA 3L7MA 5EYPA 2HZBA 1YAHA 3OY7A 1E1DA 5COQA 1R5JA 4BUJA 1CPYA 5DYTA 5E9JA 3HDGA 1YBAA 2BV3A 3K32A 3THYB 3EBLA 2VPIA 4WN9B 1EXWA 1TT7A 3V1YA 1KNXA 1ODLA 1R4NA 4C01A 2VUTA 3CXUA 4XKJA 3VSAA 3ZIAD 3MLEA 3GLKA 4H3HB 2PH3A 3W6PA 3GLVA 2RDMA 2DFNA 2C82A 1M6NA 1MO4A 1U5AA 3DZHA 3HNRA 3ILVA 3O4HA 1V4NA 4N6NA 4MIOA 3KT8A 5EP4A 3BWDD 4B6PA 4H08A 1EJBA 4FR2A 2P0EA 3PUWA 1JYFA 2G25A 4NVRA 1MIOB 2ZTLA 3RTBA 2ZUEA 3DE1X 3ZGNA 1SKMA 3AW8A 5CNMA 4DXDA 1ZN7A 2QTWB 3JVDA 1IUKA 3R0VA 3MTDA 3RKRA 1EP9A 1MHPA 3G9XA 3BXGA 1NMYA 2QZ9A 4LC9A 1U6KA 2GX6A 3NJ4A 5JCOC 1QQTA 3G2IA 1AIPA 3M83A 4ARCA 1DQSA 4B6QA 3A4MA 4EG7A 3WRWA 1GNRA 4L57A 3SQNA 2WC1A 3VKHA 3UFXA 3E2MA 2IHBA 1M1YB 4R9NA 4ENQA 4J16C 1ZMXA 4Z99A 2ZWMA 3IS3A 5FUVA 3OEWA 2AXEA 1HLGA 3A1SA 4N3BA 1CNFA 3VJKA 2YMQA 3S40A 3GUUA 2VJNA 3EWSA 7GPBA 3F3YA 4EYQA 4I4TB 3K6SB 2EX1A 3HNOA 3KKKA 4YUYA 2CT8A 4RGBA 1FQJA 1I3LA 4C88A 2PYDA 3HYTA 3TIIA 1KERA 2ZR0A 1LI7A 1L4YA 2HO5A 1I4TD 3LGXA 3IAHA 1ABFA 4Z8XA 5IXJA 1MGOA 1FDIA 5FLXA 1N36B 4LDJA 2HA7A 3TNYA 5A7GA 1BWRA 1M67A 3CPSA 4LYDA 4R68A 3HXLA 3DLBA 1IPEA 2G8NA 3PGXA 4KKXB 5DGIA 4DJFC 3PR3A 3VQTA 4C2AA 3L7JA 4LPKA 4BMXA 1VMIA 3ODPA 4X3OA 3UWDA 1DC6A 1M2GA 2X22A 4P22A 3IILA 5IM4A 1AQIA 1MCZA 3CO5A 2VIIA 1IY8A 3HV2A 2AT1A 3LYLA 4BO7A 4Y0NA 3HRKA 2QRKA 4WZBE 4EG3A 1CDZA 1GT91 2GCOA 4HQFA 5CT9A 4CEIA 2WUEA 4YBRA 2QY6A 2WA1A 1T25A 4AY3A 2Q29A 1OBFO 1J9GA 1OY1A 1QWOA 2XSZD 2QTGA 4FZ5A 2DP4E 1WHSA 1XWFA 2CL6X 5ELMA 5BRNA 5KKCA 1SRQA 1JKMA 4YXWD 5J43A 2FQQA 1R4ZA 1Q22A 2O7Q