4QJ3A

Structure of a fragment of human phospholipase c-beta3 delta472-559, in complex with galphaq
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
316
structure length
316
Chain Sequence
RRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPSYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanisms of phospholipase C beta 3 autoinhibition.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein/hydrolase
molecule keywords Guanine nucleotide-binding protein G(q) subunit alpha
total genus 110
structure length 316
sequence length 316
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00503 G-alpha G-protein alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.400.10 Mainly Alpha Orthogonal Bundle GI Alpha 1, domain 2-like GI Alpha 1, domain 2-like 4qj3A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qj3A01
1FFHA 3FTQA 2CCGA 5AR1A 3I32A 2D2FA 3PEYA 3DEFA 4Z1MA 2FE4A 2YWHA 5CYOA 4NYIR 2KWIA 2CL6X 4LYHA 4YXWA 2V7QA 4KLZA 1G6OA 2P0EA 1IONA 2ODWA 3TVTA 4A6XA 4Q7KA 4E03A 1G6HA 4OHZA 4M1TA 2WICA 4PPNA 5DIFA 4A0GA 2NPFA 4MRVA 4Q47A 1G5PA 3LBIA 3ZVRA 2XOKA 4BEJA 1G8PA 3PQCA 3HP1A 4QNMA 5KOYA 3MCAA 3LNCA 1ZC4A 2Q3HA 2J9RA 2VBCA 4J0QA 3J81k 3PJRA 4AKIA 2AXPA 4NKRA 4TYPA 2GDJA 2XOKD 1XEWY 2Q9BA 3C5CA 2AXNA 3RS7A 2ZRPA 4BECA 1PVOA 4HB0A 2H18A 4AK9A 4PC1A 1UBGA 5C4MA 1E2FA 4EPWA 1CJKC 1NJFA 1ZC3A 4YMVA 1SZPA 1EFRD 2E1RA 3B60A 4X8HA 4YDSA 1AKEA 2D06A 3KXIA 5TXGA 4FCVA 3FDIA 1XNJA 1QF9A 4PR0A 4FI3C 3A58B 1II8B 5DISB 4BFYA 4M1WA 2QQ0A 2Q0HA 4B3FX 4DCTA 3LD9A 3NTUA 4Z1MD 3K9HA 3RC8A 3VX4A 2H16A 4RD2A 1NLFA 1DOAA 1TUIA 1SVOA 2IHBA 2WHXA 3RS5A 4KSCA 3I62A 3AM1A 4G0NA 3GJ0A 3RVBA 2HDNB 4PPFA 2B8WA 5FOTA 4Q02A 4TN1A 2BM0A 3E5HA 4QXAA 1G3MA 2C95A 2VL7A 1W5SA 3KJEA 3SNHA 3LFUA 5F9FA 2D3WA 1LV7A 1F2TB 3P27A 2PEYA 4I81A 2GVZC 3MG9A 5M04A 4LHVA 1ZP6A 4PO9A 2CXXA 1Z0FA 2PT5A 4EJSA 3KQHA 3I5YA 3T1VA 2PLRA 2GCPA 4P0TA 5GVSA 2WBLC 1IY2A 5EXXA 4LSGA 4RD0A 3AKEA 1NSFA 2FG5A 1BS1A 1T5LA 1VMAA 2R6DA 4W5JA 3RRMA 3IHLA 1IHUA 3TR0A 2NO6A 5FTNA 5FTKA 1G18A 4O3MA 1CJVC 1E2LA 2ZJYA 3K0FA 4NHOA 2F3RA 3WYFA 1K8RA 1F2UA 2N42A 1RRPA 3PFIA 3B9PA 1T0HB 1F5NA 3UWKA 4NYIQ 4EFNA 3O8BA 3C16C 3A37A 2BEJA 2J7PA 2PCLA 5G40A 4DLSA 3ICEA 2OLKA 1L4YA 2ZRLA 1Z0KA 4D80A 2ZJOA 3U60B 1JALA 1SHZA 2V1XA 3BH0A 3BE4A 1L2TA 4WOPA 1XXHE 1OHHA 1AS0A 1VG0B 3NBZC 1W0JD 3QSYA 3AF4A 4DDWA 4M0LA 3KQKA 3GEHA 4E22A 3MSXA 5BW8A 3O47A 4LUCA 2IHYA 1P7CA 2HXSA 2YC2C 2A3RA 2GAOA 1KDTA 3P32A 1XXHA 1G4AE 3B13B 5CLQA 2RB4A 1N6HA 4GMDA 1Z63A 2H17A 2R6FA 4Q4HB 5EE9A 4JVSB 1OE0A 5G41A 3LBNA 3NDPA 3VR1A 1Z0AA 5LBIA 2O8BA 4HLUC 3VR4A 3CRRA 4JLNA 1DAEA 2KBFA 3C5HA 3EZ6A 4JBXA 2FSFA 4GOKA 1CXZA 2ZJ5A 3DZDA 4Q9IA 3L0SA 5H70A 3CRW1 2OESA 1XU4A 1QG2A 1ANKA 2ZJ8A 4ZKDA 1QHGA 4C9BA 5L3SA 3PVSA 2R8RA 4L9WA 2ATXA 1H8ED 2HYDA 1FQJA 4URXR 1E3MA 1JI0A 4LJ8A 4K46A 4NCIA 4K81B 3A4NA 4LJ7A 1NNEA 1MT0A 2JA1A 4B44A 2B8TA 4BZPA 1N25A 2EFGA 3F0TA 4CT4B 4BFVA 2WWFA 3K0AA 1MO4A 2CBZA 2J46A 3ADBA 3GFTA 1E9DA 4FINA 4KV9A 1KI4A 4QGGA 3CX8A 4JJKA 2F7SA 4TL7A 5AUQA 4ZDJA 2BMDA 4QBIA 4JBWA 2GETA 4IVQA 5TB5A 4C0HA 3SQXA 1YZTA 3RS0A 1HE8B 2A5FA 2PX0A 4D4JA 1NP6A 2HCBA 3AP3A 4JYCA 1GL9B 3LLMA 1YRBA 2VF8A 1DAIA 4LJ9A 2IS4A 3PENA 1PUJA 4FMCF 3V4FA 4FWTA 1A2KC 4U02A 4LBYA 2BJWA 2JATA 2Q6TA 5CK4A 3U7FB 4B3XA 4RJLA 2PMKA 1AGPA 4QKQA 5K8IA 4URUR 3QBTA 4YC7A 1OIWA 4IHQA 2F1IA 4LJYA 2GXSA 3A1TA 1M8PA 5C46F 4JLDA 2BIFA 1F60A 1FUKA 3N5CA 4PAOA 4KYIB 3NHBA 1KI8A 1GP2A 1OFIA 4HYYA 1NSTA 2JIZA 3K0FB 5JEDA 2BEKA 3FPAA 2PJZA 3ZGXA 1D6JA 3T5DA 4B32A 4BQSA 3U44A 1TMKA 2UZ3A 4WVFA 5FTMA 4QBGB 2CDNA 3I4LA 4HZIA 4PTLA 3A8TA 3BBPA 4UNQA 5LD2B 3SR0A 2BKEA 2C98A 5FBQB 4OJQA 2PEZA 2ZRNA 5ANRB 2QMUA 3QOFA 1US8B 3IPXA 3H2YA 4B3CA 3F8TA 4CEIB 4HUQA 4L16A 2WV9A 4AI6A 3WNBA 1KO8A 2G1JA 4G5QA 2RGNC 2RAPA 4NCKA 1EFCA 2ODNA 4ZDKA 1KDPA 4FCTA 2ZSEA 2IK8A 4TTPA 2IUUA 2VP9A 3OFNA 2JLQA 3U61B 4L15A 3FMOB 2BV3A 1WE2A 4HDCA 4MYTA 2XTZA 4HB3A 1U9IC 1D5CA 3OIYA 1I2DA 1KSFX 2H5EA 1JAIA 4D81A 2JAQA 1AN0A 3W3AA 4OHWA 3UK6A 1Z6GA 3TLXA 3SYKA 4PSKA 1NN5A 1UBEA 1Q3HA 2ZIAA 3TE6A 4C3ZA 1JQJC 1KOFA 1A2BA 3BK7A 1N5LA 3AH8A 3I92A 4HLCA 3T35A 3BORA 3OHMA 3ZD6A 4Q03A 5CJ2A 2W2XA 2GJ8A 4D0NA 1OH5A 5JCPA 1CRPA 2KE5A 2XNDD 4FD2A 4EKDA 1AQYA 3OZXA 2SHKA 5L3RA 4HI0E 3A1VA 1OH8A 1LS1A 2ZR7A 3L0OA 2DY1A 5JECA 4HDOB 2IYQA 3DL0A 3GLIE 3X1XA 3MWLA 2NIPA 4PO1A 3K09C 1P5ZB 1SVSA 1TAGA 1YR7A 3VTKA 4C0AC 3V9PA 4BLTA 1BYUA 1LS6A 3EPHA 3KKNA 2QM7A 3W6PA 3THXA 3QKSB 4GFDA 3NH6A 1Z3IX 3O8RA 4A0FA 5HCIA 1E0JA 3VR6A 3KJHA 4FN5A 4KO8A 1XBTA 1QDEA 5SZJA 2I4IA 3NIBA 1NMXA 3TKLA 2QSZA 2IWRA 3RSLA 3X1YA 3TSWA 1ZCAA 1JAHA 4CVNA 3DOEA 1DPFA 2ZVPX 4RZ3A 4JS0A 2BDTA 5JWHA 4KYUA 3TSZA 4C0LA 4DLVA 3RANA 2NG1A 2N46A 2ZI9A 3RS2A 3G0HA 2X77A 4HAYA 2RGXA 2CNWA 4F91B 2QE7D 4QBHA 1DEKA 4M8NE 1VHLA 3NBXX 1K5DA 3CX6A 1NN0A 4H9GA 3Q85A 4UXHA 4BGDA 2GZAA 3IO3A 4CGZA 1XMSA 3HWSA 3EA5A 2JDID 3TQFA 1KSGA 3Q7QA 2GKSA 4B6EA 2XZLA 1OB2A 2EWWA 1XTIA 3X2SA 1OXVA 4XJXA 1HQYE 1TQDA 2ODEA 2ZS8A 3P4YA 1CF4A 2XSZA 1D2MA 1KJWA 4XTRA 5CDFA 2GJSA 2OE2A 1BYIA 1E69A 3QVUA 1G8FA 1R5NA 1FMJA 2CLCX 1E2MA 2EFHB 1ZBDA 2WJYA 4WZAE 1Z6AA 1ZUIA 2WM9B 1N6PA 3KX2A 3Q5EA 4B2PA 4DT1A 3GLHB 1G21E 5FPHA 2IBMA 1CIPA 1TEVA 4IEEA 4Q4JA 1DAFA 3HR7A 4LCBA 3CPJB 2XXAB 4MQBA 2X1VA 4NDZA 4XH9B 4F93B 1OXXK 3QKRA 4GRAA 3A4MA 4BFZA 1FQKA 1MO6A 1Z47A 2RKOA 4HAUA 1XCMA 3AVPA 2B92A 2FFBA 4L4UA 3RS4A 1NI3A 4Q01A 5CM8B 3W8RA 3WRYC 4B6FA 3AUYA 1PV4A 3IKJA 4RKEA 2O8CA 4A82A 1KMQA 2F43B 4JL5A 4UXJA 1LTQA 3HU2A 5J4YA 1CJMA 3K9NA 1UDWA 2D2EA 3GJ4A 1P2SA 3SEAA 3KQLA 1MRNA 2ZI4A 5H1YA 1HUQA 4AC9A 1KI6B 3B6EA 4Q4LA 4BEBA 5KNCA 4IDQA 4UNSA 1JJVA 2RHDA 2WJGA 4LJAA 3NHAA 2QAGA 3WHKA 1GG2A 4EQ6B 2QBYB 3M1IA 4JBYA 4GP7A 4GDFA 2YKGA 5J4LA 5JI3E 4WBSA 2OT3B 3W5JA 3C8UA 1H8EA 4URZR 1JPNA 2C03A 1OT3A 4HAVA 2C8VA 2YOHA 3CUEF 2HLDA 1IJFA 2QAGB 4EQ6A 1GNQA 2XZPA 5EJEA 4IVRA 5H8WA 4KLNA 2WWIA 1TF2A 2O8FA 2OV2A 2J41A 1R0WA 2PZFA 2RGDA 3CRQA 3CZPA 1E9AA 4DCNA 3K70C 3OEHA 5BYKA 4ZCMA 1T4GA 2F9MA 4Q4AA 3ZQJA 2JGNA 5AUNB 3LW8A 4HB4A 5K8UA 3NBYC 4A1FA 3EPKA 1VHTA 3DVLA 3PV0A 1P60A 1G19A 1ZAKA 5J40A 4S2EA 4I1VA 2ZSAA 2OXRA 3DHWC 1E1RA 3T1QA 4Q9HA 1GNRA 1KAOA 2ZR0A 4P31A 5KDDA 4BWYA 1ZU5A 821PA 1XTRA 1JBKA 4KCGA 1JXMA 5FL7A 2FZ4A 1AS3A 1E2EA 1Z0IA 3WMEA 1DVRA 2HV8A 2WIBA 1FMLA 3WY9A 1N6LA 1DS6A 1BO6A 4RD3A 1L7VC 3LXRA 1QVRA 1HT2E 1XZQA 1OXSC 1XZPA 1H65A 4NCHA 2AR7A 3CM0A 3MUFA 3O8DA 1HY3A 1CR1A 1W36C 4C7OB 1YRAA 3GFPA 4TQAA 3LVRE 3IHWA 5AK0A 2IYZA 4AIIA 4IOLA 4PHTA 2XAUA 4EPRA 2RCNA 2XSZD 4O2RA 5JWRA 2CHVA 1GM5A 3MFYA 3GQBA 2KJQA 1OYWA 4G3XA 4MDFA 1NG9A 4Y0AA 3SZRA 3QEOA 3SE0A 2WWXA 1VKJA 4A2QA 4Z51A 2IT1A 1UKEA 4IFBA 4PZLA 2DFTA 2IF2A 1UKVY 2H92A 3OF5A 4U7DA 1CBUA 4D2IA 3QE0A 1SVMA 3W6NA 2GAAA 1T8TA 1ZCBA 2OBNA 5FOUA 1S8FA 1KDRA 2GCOB 3KKQA 2JLVA 4LPKA 3TNFA 3WP1B 3AF1A 1RFLA 4X8LA 1WDTA 3VU9B 3ASYA 4LBZA 2ANBA 5FTJA 4ARZA 4HAWA 3GLFE 4H1UA 2BMFA 4BFUA 2V7QD 3PR1A 2PL3A 1K5GA 2J0UB 2WJHA 2KBEA 5KO2A 3ZZTA 1UBCA 1WP9A 4PAQA 5TV2A 4V02A 2W00A 3EPLA 4BPBA 2XXAA 1CULC 2GF9A 4M4SA 3THXB 3TAUA 1CTQA 2WKRA 1M74A 4JKYA 4GT1A 5FOXA 2V3CC 1D9XA 2GBLA 3I1FA 4UXIA 5JSZB 4QGHA 5KDOA 1KK1A 3OE7A 4B73A 1RJ9B 1AK2A 1W1WA 2ZUDA 4AG6A 2PZEA 3LW7A 4OI2A 3LQQA 5A0FA 4XWKA 3BRWD 3IIMA 2IEYA 4YXWD 4ESVA 1EFRA 1EX6A 4MKGA 3BIFA 3R8CA 4OQFA 4C2UA 2JJ1A 3N2IA 4TLEA 4AYWA 2P6RA 2GK6A 1M7HA 2JCSA 2JEOA 3OAAD 1HA3A 4F4CA 2H1LA 3KKOA 2QSYA 4OHYA 3UMRA 4R9UC 4IFEA 1U0LA 1MO5A 4OHXA 5LPNA 5EQTA 4XTCS 1I4DD 1IBRA 1A82A 3QPVA 2AKYA 1ZNZA 5BXQC 5KSPA 1H8HA 5TMPA 2ONJA 4OYHA 4DVGA 4EUNA 3FWYA 1Z83A 2ZRFA 3AKYA 4H1VA 2ZTSA 2D7CA 2JLYA 1VTKA 1IN7A 4Q1FA 1JECA 4PFSA 3GMTA 3AQ4A 3O8CA 5K8LA 3A6PC 1Q1QA 3CB4A 4KVGA 5FR1A 3IQXA 5AUPB 2KSQA 2FV8A 2G6BA 1S0UA 4Q9LA 3QXHA 1XEFA 3D6TB 3AF3A 2QORA 3AP2A 4NCNA 3EA0A 4A0HA 5HZHA 1F3OA 4LYJA 2CL7X 4Q66C 1VG1A 1Z8FA 4ERNA 1IY0A 4DSNA 4JLMA 3IQWA 4DBLC 4ACBA 3VNUA 4M9QA 4Q48A 3DO6A 1WF3A 1OSNA 1BOFA 1TU4A 2ERXA 2ZJAA 4DWJA 4EPYA 2IYUA 1R4AA 3FFBA 2FN4A 4PC7A 3H4MA 5E95A 1S1MA 3KQNA 3L8ZA 1OXUA 4OK5A 4CEHA 4POAA 4WZ6A 1NLZA 1PUIA 3SS8A 1N6NA 2IYTA 2WJJA 4B2IA 4I99A 2UKDA 1N0VC 5DSZA 4RFSB 3SQWA 1UEJA 2ZRHA 2FNAA 1KZGB 2ZEJA 2OAP1 4JL6A 2B6HA 1KIMA 3KFVA 2OLJA 2EW1A 2RGBA 2V4ZA 4N0EA 5FL7D 1N0WA 2GHIA 4P4UA 2RMKA 2C9YA 4KODA 3TSOA 2VP4A 4DLUA 2R6CA 4M1KA 2K5UA 1E1RD 1X1SA 3U7EB 1QZXA 1G3QA 3NEYA 4OKSA 1JPJA 2J0SA 1NKSA 1E9CA 4DDTA 3K70D 4L5BA 3C7KA 3KL4A 4M53A 5JCZA 1CEEA 1EXMA 1VYTA 3E1SA 3ZLJA 2AD1A 4LJ5A 1KMHA 3DMDA 1COWD 2QENA 3B8HA 2NOAA 3B1YA 3DKPA 2QEQA 1ZUHA 1MKYA 2QTVB 2C2HA 3CW2A 2I1QA 4WW0A 3ZS8A 4C7OA 2IWHA 1FL9A 3B1ZA 2EFEB 5JJLA 4LHWA 2AWNA 1UDXA 2F1JA 2ZU6A 2ANCA 3A36A 1G7TA 2DWOA 1UFQA 2PJRA 2QP4A 5FI1B 3REGA 2HJGA 2G3YA 2O8DA 4JL8A 1XTQA 1W46A 3THWA 3C41J 4PZZA 4PXAA 5HZKA 4D4LA 2R65A 4PHGA 3W3ZB 3NC0C 1KI2A 2P6UA 1BMFD 4V0MA 1WCV1 2O8EA 2CMKA 1Q57A 2P67A 3FMFA 2GILA 1YVDA 2G1KA 2GXQA 2V6IA 1CR4A 4CIDA 2DPXA 3R8FA 1M1YE 1QHXA 1QVAA 4BRUA 1OYYA 1G3IA 3LY5A 4FMDF 5FR2A 2REXB 1Z0DA 4U00A 4WXPA 2WVJA 3TMKA 1SVWA 1EFUA 2F1RA 2R6AA 3NWJA 1DAMA 3LLUA 1NMZA 3AVWA 1PLLA 4DUGD 2VRWA 1KI1A 4W9MC 4Y0VA 2XZOA 3GLFA 4V03A 3VQTA 2YINC 4XWAA 3U3OA 4URWR 4KBGA 2XEXA 3RWOA 1J2JA 2CE7A 4JVMA 2XNSA 1YZQA 5G3ZA 1RW4A 2ZE5A 4OQMA 2FMXA 4KI0A 3HYTA 1UF9A 1KY2A 3IEUA 3U5ZB 3ZDQA 2J5XA 2W0MA 2R9VA 1DG3A 5FOSA 4ESHA 4B3DA 1U94A 2WWHA 2RGAA 2OZEA 2CCJA 4QOSA 1P3JA 3RLFA 1GITA 3ZQ6A 4D0GA 4YMTA 4TYNA 3T5GA 5AWFC 5B57C 4HAXA 4WA7A 1RJ9A 2YVUA 4OL0A 3EIHA 5D3QA 2JLZA 1KK0A 2FDCA 1V5WA 3FHCB 3OEED 1W4CA 4LBVA 3W6OA 3LRPA 3EARA 5FH9A 4LK2A 2W6IA 2GJAA 2A5JA 2VHJA 3X1DA 4DIEA 2JLXA 5JHGB 3H86A 5CLLA 3AB3A 1W48A 2WIAA 2B7CA 4TMKA 3I3SR 5EE5B 3VNVA 4QC2A 5HE8A 2ZYTX 5DGXA 3Q8XB 4BUJA 1IY1A 2LKDA 2ZRKA 3I73A 4D4MA 3OESA 1GL6A 1XWIA 3T06B 3CNNA 3W8NA 1GNPA 1W44A 3TBKA 2HXYA 2NTYC 3SC3A 1M7BA 3DOFA 4C0JA 3K1JA 4JLVA 2AN9A 2XTNA 4QGFA 4PO8A 5HE9A 3VU9A 1E9RA 1ZD8A 2IX3A 5FTLA 4MGKR 1ODFA 2XJ4A 4RZ2A 1KI9A 2CHQA 2G0NA 5CIQA 4IOJA 2WOJA 5DYGA 3QI2A 4ZI3A 2JJ2A 3W9YA 1TQ6A 1PLKA 1KSHA 5GJVC 4Z54A 2IYLD 2DWQA 1SQ5A 3ADKA 5LD2C 1OH6A 1W4BA 2Z4SA 4DEYA 1JB1A 1ZM7A 1KI6A 1NVWQ 2QG6A 3PEWA 2OBMA 1G64A 1Q21A 2ZSDA 3K9GA 1EFHA 1VDZA 5FL3A 1YZUA 3JVUA 3NKVA 2Z83A 1QHYA 2ZE6A 1S3GA 3R9XA 4MYHA 5EZ6B 2X8AA 1M6NA 2WSSD 3U3JA 3R9WA 3LAWA 3NC1C 4V0KA 3T12A 1F2UB 2MSCB 1E0KA 3TR5A 5CYPA 2BBSA 1YZLA 2IYWA 1YR9A 1LFDB 3CPEA 2D74A 2IYRA 4F38A 2VO1A 3BOSA 1P73A 1U98A 4JIMA 3AF2A 4C0SA 3CIOA 1IN8A 2GRJA 4JLPA 1E79A 1Q1BA 3AVXA 2ZQ5A 3TRFA 4CRWB 1CKEA 3KKMA 3VR5A 4MH0R 5L3SB 1W7AA 3BH6A 4MDEA 3TGPA 1OH7A 4DB2A 3RDPA 1G3UA 2D62A 1E2JA 1RRGA 2RGGA 2BCGY 1RIFA 1VPLA 3EX7C 1HT1E 2UVQA 4X8MA 1Z29A 2P5SA 3FHOA 2JLWA 2ORWA 2AL7A 4ILEA 2GCOA 1XDBA 3VR3A 4C2TA 2O8BB 1XP8A 3G5UA 5GJCA 1FNNA 1KKLA 5G3YA 1S9HA 3VKHA 4I1OA 2Q9AA 4JVLA 4TMWA 1NL3A 3B1VA 1M2OB 1N5JA 4TLCA 4IW3B 1TQ4A 1TQ2A 2XB4A 3BJIC 2YWGA 3GLIB 5DHAA 1SVKA 1Z22A 3L0PA 4TLAA 4DC9A 2GXAA 4LV8B 4GI7A 5DH9A 2IXFA 2ORVA 1P2TA 3KB2A 3QENA 5EZ5A 1G8YA 3RRZA 2QUZA 4Q1CA 1M34E 2VA8A 3QUSA 1XCGB 2BJVA 5KUTA 2QBYA 4V0ME 1ZNYA 3G82C 1FTNA 1QG4A 1U0JA 2XNDA 2QU8A 5EE1A 4BLOA 5JFGA 4IDHA 5GJWC 1VCMA 2MSEB 1Q12A 1FUUA 3OIWA 2DBYA 5FOVA 4DCUA 4DLZA 3SFZA 3KXLA 3ND8A 1RYHA 1WMSA 1QHIA 3L43A 1W47A 2G9NA 3EXAA 6Q21A 3QKSA 2ZRCA 1JEDA 3BB3A 2VHQA 3D3QA 4PC6A 2BM1A 3A4LA 4GSYA 2GJKA 5HPYB 1R2QA 3Q3JB 4KAXA 4BE7B 1ESMA 1E4VA 3PEVA 1FX0B 3LV8A 3AVVA 1T8UA 5FBWB 3IUYA 5FOWA 2ZJBA 4IDPA 5JRJA 4IOMA 2NQ2C 4Z8XA 1BKDR 2H8KA 3EG5A 4UNRA 5EP1A 1ZM3A 1HEIA 2DYKA 4TTQA 4UJ3A 4ITRC 1J8YF 1UKYA 4KFRA 2UZIR 4LJ4A 1G291 4G5OA 1R8QA 2GEVA 1XEXB 2ZITA 4R7ZA 2MMGA 3FKSA 1R8SA 1X8KA 3IIKA 2EQBA 4E07A 3C14C 1KSJA 4UKDA 1N5KA 3Q5DA 4Q5IA 3KXKA 4M9ZA 5EE3A 1GVNB 2CK3D 2WZQA 4DLRA 1AKYA 521PA 2AD5A 1TNDA 1Z6XA 1Z6TA 3GLFB 1KI3A 3RRYA 4IVPA 2RHMA 1HYQA 4PQFA 1LF0A 3DM5A 4P4SA 4FMCB 4MUAA 3QEJA 2VSOA 4OK6A 1E2PA 3NXSA 4KJZA 2O52A 1KYIA 2YOFA 4PHFA 5EP4A 2ZJZA 4B75A 1SULA 4XWOA 2OSBA 1DTSA 2H57A 5E7MA 2GEDA 2O0KA 5FPSA 1DO0A 4MRSA 3VFDA 2ZRAA 1XMJA 1KAGA 3CH4B 3NDBB 2G77B 2LKCA 1AIPA 2J0QA 2VP2A 5D3MA 5DI9A 2QNRA 4CEHB 1YR6A 2GK7A 4D25A 2O8EB 2BVNA 1UKZA 4M22A 3EZ2A 5IK2A 4QGAA 3EWSA 3SJZA 4NMMA 4JLAA 4QL3A 3BB4A 5JZVA 1FX0A 4WAUA 4YMUA 1P2UA 1HV8A 2HT6A 5C4GB 5KSZA 1F6BA 3PUWA 3KJGA 4HSEA 3GLHA 5SZKB 4RD4A 5DI3B 4M9XA 1F48A 1Q44A 3CRMA 3MWKA 4B71A 4O0MA 1GFIA 4CZ2A 3QXJA 2HT1A 2WAYA 3CKLA 5FBRB 3ZH9B 4D82A 1AJEA 1FP7A 2ZPTX 1Y63A 1KMHB 3PUZA 5CK5A 4P32A 4DB4A 1P2VA 2C9OA 1E99A 4QHSA 4NPHA 4PC2A 1T9HA 2V54A 4P4SB 4LBWA 1EWRA 1XMVA 2QT1A 4US2R 1G7CA 3JZMA 4DSOA 1UAAA 2QPOA 4UQOA 4LHXA 2ZRIA 2VSXA 1FW6A 2ASEA 2GBLC 2HUPA 1G7RA 4PSVA 3IIJA 2NO0A 1MOZA 3K0CC 5DNYB 1S4QA 4YMWA 3C15C 5EUQB 2KI5A 3X1ZA 4QNRA 4DLWA 4FWIB 4RZXA 1HTWA 3UG6A 2X19A 1OXTA 4A4DA 1R0ZA 1T3HA 2ZVQX 2FFAA 3L8YA 1ONBA 2CLDX 4O25A 2VQSA 2W0SA 2ZJ2A 2FWRA 1Q0UA 1AS2A 3KZ1E 2EFDB 5ELXA 1J8MF 3B1WA 3EPJA 5FUVA 4E5UA 1XX6A 1OKKA 1Z06A 2XITA 1QBKC 3AGQA 4YLGA 3TW8B 4C0KA 4QHYA 1HQCA 3D31A 5L3QA 3QG1A 4EPXA 1II0A 4B3BA 1YKSA 2QMOA 4Q9KA 3T15A 1P72A 4UNPA 4A6PA 4R2HA 1ZYUA 2DFNA 3RHFA 4NZYA 4K8OA 4LI0A 4ZDIA 3AKDA 4HZUA 4V0OA 3EASA 2JLRA 3LO5A 3NVAA 1KHTA 4I1SA 4PSAA 5EP2A 4AYTA 5C18A 4PAMA 4QJ3A 3OFND 2ZRDA 1E9FA 1C1YA 2IYXA 1NBMD 4B76A 2IUTA 3E2IA 3KUCA 2AFIE 3ICQB 1FNMA 2O8FB 3BXZA 1MV5A 3BH7A 3LX8A 4LWZA 5F3WB 8OHMA 2RH5A 1E0SA 2ZYVX 1RZ3A 4NYJR 1XF9A 4TMZA 4MKIA 3FB4A 1UADA 1ZVQA 4TYYA 1GL7A 3BD9A 1P62B 5TARA 3AP1A 1RRCA 2GVDC 1N6IA 3SU8A 3PG5A 3V4RA 2BHRA 3VHLB 1W5TA 2G83A 2AHOA 1VYVA 1DBSA 2QRZA 2DCUA 2FGKA 1D8TA 4GMXA 4Q7LA 3ONWA 5UKDA 4A36A 1X8JA 1G7SA 4OQXA 1KNQA 4EDHA 1ZM9A 2ZREA 3EAQA 1IXZA 5J4KA 1KZ7B 3THYA 3FGNA 3MAAC 4M1SA 3HPRA 2ZRJA 4TSFA 1TUEA 3FKQA 2I1VB 5EXSA 1YE8A 2FU5C 4Q7JB 1GRQA 4HAZA 2HF8A 3B9QA 3OE7D 4NU0A 3W34A 4RVCA 1KNXA 5JSZA 1OPXA 2J59A 3WBJA 5J47A 2WMOB 4YQFA 4HLUA 4NBSA 4TQ9A 1DELA 2FA9A 4GL2A 3GJ8A 4S35A 2VEDA 4QJ4A 1ZM4A 2V6JA 1HE1C 1LB1B 1R6BX 3M6AA 1L8QA 3ZZUA 2VHCA 1ZD9A 4G5RA 2GF0A 5GADl 1B23P 2CEAA 2QT0A 1KO4A 5JLJA 3BERA 2Z6VA 2ZYUX 2BOVA 3GCGA 3OEEA 3PIRA 2WTUA 3B2EA 3BAFA 1U9IA 3DM9B 4QHTA 4DHEA 1X3SA 1NBME 1F2TA 4TWZA 4KU4A 4NTZA 2IS6A 5DHFA 2GEUA 1V43A 1W4AA 1ZUNB 2NO7A 2FSGA 5CM9C 2EWVA 4AKHA 4QM6A 2FPMA 1OB5A 2ZE7A 2ZYWX 3C4JA 1NKTA 3ZS9A 1Z08A 4A2PA 3BFXA 2HEIA 4JLOA 2ZRGA 3QVVA 1JR3D 3EZ9A 1KK2A 1NG1A 1WXQA 1VCIA 2YWEA 5J4HA 1KO1A 1XXHB 2G0TA 4XVQA 1E1QD 3UG7A 2OCBA 2DB3A 2V55B 4LRWA 5JEEA 3AVYA 4HATA 3B1XA 3ZVLA 5EXPA 2ZSBA 4TLDA 3V00A 5AUOB 5IF9A 3GJ7A 3GP8A 3U4QB 1JEEA 4GZLA 4NONA 4U5XA 3PUXA 2WAXA 5F2EA 1NIJA 3VKWA 2FFQA 2GZHA 2O0JA 5SZHB 1SKQA 2QRNA 2Q9CA 3KKPA 3SJAA 1UBFA 1LF5A 3SBEA 2L0XA 4EPVA 3B7GA 4LOAA 4C4PA 1WBBA 1IXSB 1G17A 4LYAA 4EAQA 1Q3TA 3GJXC 5BN5A 5L8VA 3K0CA 3FYHA 1N2CE 2IUSA 4NYMQ 3AV0B 4AY2A 1CJTC 2QA5A 2O8CB 4A8JB 2D4HA 1I2MA 4D26A 4ZIRB 1XPOA 4CT5A 2ZANA 3TH5A 3WXMA 2REBA 4XD7D 4Q21A 1UM8A 2PMDA 1R7RA 5DN6A 4DZZA 2JIZD 5IRCD 1OHHD 4DSUA 4LX0A 2BMEA 4Q4AB 3SFVA 2OCPA 2J7KA 5TVKA 3LA6A 4LV5B 2BWJA 2VF7A 2IW3A 3CLVA 1XEWX 3MRSA 1LW7A 2IXEA 4Q1AA 1G16A 2OHFA 2ZXUA 3BWDD 2ZR9A 1E2HA 2AK2A 3GLHE 1WA5A 4TMXA 4DXAA 3OIUA 3CONA 3CF6R 5KYKA 1SXJA 1AZSC 2PH1A 3S1AB 3TUZC 3FMPB 4R2IA 3BC1A 1O3YA 2FF7A 4N1AA 4TT3D 1HH4A 4V0NA 1GTVA 2FZLA 2W58A 4GOJA 2V1UA 2R62A 2P5TB 3QXCA 2OFWA 5FI0B 1SXJB 3WNDA 1Q22A 1K6MA 1TTTA 4HUQB 2OAQ1 2X2EA 2A5YB 1E6CA 2Z4RA 2A5GA 2A78A 2VYFA 3H0KA 1L4UA 4BRWA 4ZCIA 5HR5A 1XEXA 2GJ9A 2IYYA 3EC1A 4NYJQ 2NZ8A 3OIVA 4P4TA 4W5HA 3W5IA 3QF7A 2VLIA 3ECCA 4B33A 1PLJA 4LZZA 3JVVA 5JBQA 3U44B 3PUVA 2QROA 4OI4A 1D2NA 3FFAA 2VP5A 4CW7A 3ZVMA 3HPQA 4B35A 4AD8A 4B48A 4BFXA 3IEVA 4XD7A 4LC0A 3P1JA 5KPJA 1GUAA 1Q1EA 4C0QC 3IILA 3QKRB 1D2EA 2WWGA 4TT3A 2EYUA 1G4UR 5DO9A 1HURA 3ZVNA 1LY1A 3NEJA 4Q1DA 1P61B 3Q7PA 1YJ5A 1Z2AA 3CR8A 4B74A 5LDDC 4OI0A 2ZRMA 4XIGS 3B78A 4XVUA 1D9ZA 2V8OA 4AYXA 3WMFA 4OK3A 4OQNA 3R7WA 4D4KA 1GKIA 2W83A 4IXMA 4CYMA 1BH2A 4YMSA 3PXGA 3L0IB 2OO7A 4DLTA 1W4RA 1Z2CA 4B3GA 3CNLA 4MYUA 4IDNA 2AX4A 2MMCA 2DFLA 1NVVQ 2NO1A 4HEJA 3F5FA 4G5GA 1AA9A 1U0HC 2RGNA 3ND9A 3QJYA 1A4RA 2EYQA 3CX7A 2ZUBA 1N3BA 2J3EA 3S1AA 3U3MA 4MYCA 3HJNA 2WKQA 1ZNXA 1C9KA 1TEXA 3AEZA 1R5BA 4BLQA 2FH5B 2J87A 3UKDA 2BKUA 2QPAA 1SVIA 4A2WA 3K0EA 4IJMA 2ODBA 3K0AB 3RSOA 3P4XA 5KSYA 5J5CA 3RS3A 3GD7A 3RYTC 2JLUA 4RD6A 4ZKEA 4NE2A 4NP6A 5EE0A 3VX3A 2AWOA 2J0VA 2AFHE 2C96A 421PA 2ECKA 1YZKA 3QXSA 1IXRC 1J90A 3EZ7A 4CEIA 3LQRA 3QPUA 1P4SA 2QZ4A 1OIVA 3P26A 4RFVA 3ZIAA 4Q19A 2IYVA 2EU8A 4LY6A 4PPQA 4DKXA 4ZIRA 1G9XA 4Z8YA 1G41A 4A8JA 2ZM5A 3DMNA 3MD0A 5FUWA 4LPSA 2W2TA 3QKUA 4A15A 1JNYA 4TL6A 4C30A 3FHTA 2FPKA 3PCRB 1AM4D 4QM7A 4URYR 1JR3A 1XRJA 4GZMA 3QQ5A 5H68A 1GKUB 2QAJA 4MGYR 5GVRA 1XTJA 1RC8A 2J0UA 2GA8A 1YHNA 1SKYE 2F6RA 3Q72A 5JRZA 2F3TA 4OJKA 3R9IA 4BFWA 2QAGC 3PEUA 4UNNA 1E2DA 4F4IA 3TJZA 3QNUA 1KI7A 1NBMA 4ABYA 1MH1A 5GJBA 3SHWA 1JR3E 1H8HD 1TPZA 2Z43A 4MRRA 4PANA 4D0LB 3WHLA 3JZAA 2W2VA 3B82A 4LHYA 4YDHB 3ZJYA 4AWXA 5HKKD 4B43A 5HKKA 1TL7C 3BB1A 4QBFA 1E32A 1E2IA 3T61A 1JR6A 4F7WA 2BBOA 1OV4A 4ZCLA 5C2JB 2EVWX 4OBEA 2JJ1D 3M0EA 2WWWA 2YWFA 1ZINA 1LNZA 3LBHA 1Y3AA 4MRPA 2ZAMA 2XJ9A 3U6KA 5FPYA 1KDOA 4TQUS 1MO3A 4Q18A 3QBVA 3CRVA 3CF0A 5A5GA 2FJUA 3FOZA 1NVVR 1OW3B 4GP6A 3WMGA 5E3HA 4XSGA 1WQ1R 2ZROA 3UMFA 1GSIA 4PPGA 3CF2A 3I8SA 1EK0A 3SJCA 5TY0A 2XTMA 4JJZA 4MITA 2CE2X 1S96A 1VCOA 2W6JD 4M9SA 4EJSB 3K70B 1E96A 1CJUC 4QJ5A 3UMSA 5AJVB 1Q20A 1NLYA 1XJ0A 4JYBA 4LHZA 3VAAA 1IN4A 4IRUB 5JHHB 4GOXA 5EP3A 1G8HA 3MWJA 4IDOA 1RKBA 4FIDA 2VH5R 4IXNA 1GIAA 2YZ2A 3KJIA 3I5XA 3A1SA 2D7DA 3AKCA 4RSGA 3HDTA 1X1RA 4DCVA 1I4LD 2PZGA 1W0KD 3GPLA 3EW9A 4IOKA 1GDDA 2HLDD 3MGCA 1S2MA 2GXUA 2MSDB 2QN6A 2C5LA 4CDGA 4TMTA 1XJCA 3AVUA 2FSIA 2CJWA 1P9RA 4AKGA 2NMVA 3RAPR 1EESA 1VIAA 2H7VA 1KO5A 4OI1A 4AURA 1VCNA 5B2ZA 1GAJA 1GZSA 1IJEA 2QGZA 2VSFA 4Q9JA 2AK3A 5AJWA 1IM2A 3W90A 3WYGA 4P3YA 1TF7A 2QPTA 2J45A 3X1WA 3ADDA 2YNMA 4OQLA 2HF9A 1OLOA 4CF7A 2HJVA 3K8YA 121PA 1ZIPA 5KHOC 2PBRA 1B0UA 2X2FA 3KUDA 3RABA 1E4YA 2C99A 5CDFE 5DI3A 1XMIA 2ZI6A 2WMNB 3VMFA 3BGWA 5CB8A 5B64A 1FP6A 2B7BA 2YC4C 2ZU0C 1SKYB 4KHZA 2QQEA 4JT4A 2N1BA 3HU3A 5L3QB 4PZYA 3U3KA 2ORIA 4BFTA 2JLSA 4XOIA 4GPTA 1TADA 3CWZA 4KFUA 5J4VA 1T6NA 1A7JA 1E2NA 1ZM2A 2VP6A 5D3MB 3IO5A 1CLUA 4KFSA 1CU1A 4OHVA 1P75A 4HDQB 1IAQA 2CVFA 3MLEA 4DT1B 4TZ6A 2QP9X 2FX3A 1C4OA 1EWQA 1X8LA 1X6VA 3CR7A 2ZUCA 3TUJC 3QIAA 1P9NA 2Q3MA 2ONKA 3QF4B 3HYRA 3SI7A 4DCSA 4P33A 2IXGA 4Q1BA 3TVDA 3AUXA 2NPIA 4BZQA 5BN3A 3HU1A 2IA5A 1SGWA 2IC5A 3CNOA 4WXRA 2A9KA 4DLYA 4HLQB 1MR3F 2CVHA 3QXXA 5E7IA 3MJHA 3WRXC 3K0SA 4PQYA 1LVGA 2ZRBA 2Q3FA 3PITA 1OFHA 2I3BA 4JSTA 1DE0A 5IK2D 5IHPA 1IN6A 1SXJD 1S3SA 2OCYC 1I4TD 2PCJA 3D7MA 2BCJQ 4TTRA 5FUYA 4DDVA 1W0KA 3ZZ0A 1OFTA 3B85A 2A5DA 4MKFA 2NGRA 5F9HA 4RD1A 1DAHA 5B58C 4RZUA 1KY3A 2PLFA 3OEHD 4Q7MB 2F1HA 4URVR 5KPDA 2GNOA 2OUKA 1II9A 1ZD1A 3L2OB 5JS7A 1J7KA 4TL9A 4ZO4A 2F43A 1QHNA 4KSBA 5BQ5A 4E09A 1OFUX 4A0RA 1J99A 2GTPA 4N3NA 1VYUA 3I8XA 4JVNA 1NN3A 5KDLA 2TMKA 4L8GA 4XVRA 2OCAA 2IF0A 3F3YA 2RGCA 2C78A 2RGEA 3Q9LA 1IOZA 1TX4B 3U7HB 5FPKA 3CZQA 3RRNA 4EFLA 1E2KA 4WZBE 1E2GA 2IS1A 3TW4A 4N0DA 1ZNWA 5KSOA 4DRZA 2HYIC 4LV6A 2CNWD 3GJ5A 3SJBA 3FKSD 4I1UA 4KXFB 4PHHA 4MUBA 2QI9C 4PQRA 2NZJA 4Q00A 4V0LA 1Z5ZA 5FBLB 4WIAA 2FEMA 2FFHA 1NN1A 4FW9A 2ZAOA 5BN4A 1T0JB 4KVAA 2CLSA 1VECA 4ACAA 4ZI2A 4ASUD 1DAGA 2QTFA 5BYJA 1KO7A 1KJZA 1J70A 5F98A 4M2LA 3KB1A 4UJ5A 1OJLA 2G88A 4NYMR 2P65A 1O87A 4Q1EA 1SXJE 4JSYA 2R6GA 4II7A 3IBYA 1MABB 2Y8EA 3T34A 3NH9A 5BWMA 3GEEA 1II8A 4JT2A 1A5TA 1U90A 2QE7A 3LXXA 3P20A 4R71A 1ESNA 4FMDB 5FBVB 2VHTA 3FVQA 4MGIR 4LJ6A 5DE3A 3ADCA 4JKIA 1U8ZA 5FFMA 3TIFA 3GEIA 1KGDA 3U2QA 3I61A 2A2ZA 5KTYA 3DDCA 2HCJB 4KBFA 3LVQE 2BBTA 2C77A 1E98A 1Z6YA 1ZMXA 4PC3A 4LGMA 2JDIA 2YOGA 3FMIA 3K9LA 4DLXA 2YJTD 3U3RA 1XCPA 2YHSA 3ZIAD 1E94E 3I72A 3QG5A 3SOPA 1CR0A 5IT5A 3AGPA 1EG7A 3AVTA 5B30A 5DYIA 1YU9A 2VPPA 1CRQA 3EIEA 4DDUA 5IDVA 2VP0A 3FE2A 3VKGA 2BMJA 3AVOA 1TF5A 1N5IA 3MJRA 2WKPA 2ZI3A 5L3VA 1RYFA 3DZ8A 2B21A 1WBDA 3SN6A 2C04A 2WJIA 1ZU4A 2FPLA 4RY2A 1VIYA 1E9EA 3QKTA 1XD9A 1ZRHA 3MMPA 4G5SA 4G01B 5AJXA 2FSHA 1XTSA 4EIWA 2OG2A 3GLIA 3IDQA 2Z5FA 1DG1G 2F55A 4FMBB 1P6XA 1NY6A 1YZNA 5G53C 2WJVA 3UXMA 1ZIOA 1DARA 2ZE8A 3LWNA 1QHHB 1MRSA 4ON9A 1NIPA 4HB2A 3CH5A 2R2AA 2DWPA 1QRAA 4R98A 3CBQA 4D6PA 4EJSC 1XD8A 1T3LA 4A9AA 1RE0A 1U8AA 2CHGA 3ZD7A 3AVQA 1US8A 4TZ0A 2WSSA 1DO2A 3GLGA 2OBLA 1GOTA 3QF4A 1XTKA 1EGAA 3EZFA 3L82B 3THOA 1SVLA 3ETLA 3NBFA 5FUXA 4BLSA 1U2RA 1KJYA 1G5RA 3GJ3A 3H84A 5JWOA 3T1TA 4LDJA 3UANA 1JJ7A 1G8GA 2YYZA 3BFVA 1N6OA 3K53A 2QP3A 3TUIC 3KTAA 5SZIA 3RC3A 1GKYA 4GNKA 5EXTA 5JJKA 2QGNA 1E0AA 4I4LA 2ZETA 4US1R 1E79D 2FOLA 2W6ID 1FTSA 2JJ2D 1CR2A 5AJZA 1WRBA 3TK1A 5KNBA 3T1OA 3WNCA 1VG8A 4B47A 2QL6A 3N70A 4DUGA 4ASUA 2WPDA 1OKKD 1ELOA 5DLQC 2REOA 4ARZB 1RRFA 1S1CA 4US0R 4AKEA 4LC1A 2A7QA 4MRNA 1DAKA 3IPYA 4MA4A 4QRHA 1XD2A 1NVUQ 1UJ2A 3TAHA 1JXOA 1G1MA 3IBGA 4M21A 2VHUA 3LDAA 3SYNA 1W49A 4A8JC 3GJ6A 4HLDA 5LB4A 1NY5A 3DPUA 4B34A 2O5VA 3NG1A 4HUTA 1SHKA 4TYQA 3SDZA 4RCZA 3DKVA 1AQUA 1ZJ6A 2Z0MA 3CO5A 3KFXA 4TLBA 4X8OA 3GLGE 3U4QA 4CEJA 5JJIA 3BS4A 4CEJB 3EC2A 1FPMA 5JS8A 4QFMA 1QHSA 3ASZA 5FPTA 1W0JA 2CJWB 1PJRA 2GWHA 4MGZR 1U81A 2OFOA 4RCYA 2KB0A 1UEIA 2V9PA 4BFSA 5JI2E 2QMHA 1YQTA 1RPZA 3UPUA 2IS2A 4FCWA 5A4JA 4W7SA 4F92B 3SBDA 4LYFA 4AG5A 1YR8A 2IEZA 5AJYA 1KTVA 1Z07A 3EIQA 2OEPA 3M4YA 4EFMA 1R0XA 3PUYA 1GILA 2ZI5A 2QY9A 1EFTA 4TL8A 4BLPA 4QG7A 2P6NA 4DSTA 3A1WA 5E7JA 1IN5A 2GCNA 2P2LA 4JMPA 5P21A 4JLBA 3AF0A 1FOEB 1DADA 3B5JA 1R10A 3UIEA 5CB6A 4B2LA 2OM2A 1SXJC 1OF1A 1GWNA 2CL0X 4JZKA 4PX9A 3ZYCA 1N6RA 2ERYA 4JLJA 3THWB 2LCFA 3LX5A 2F9LA 2O8DB 2J1LA 4FXPA 3KTAB 4Q4JB 4NCJA 2DR3A 1N6KA 2FGJA 1R5OA 4A92A 2P3SA 2OILA 1G20E 4JLKA 1BIFA 2O0HA 1CS4C 1X86B 1OIXA 3GFOA 1E9BA 1N0UA 5E4FA 1NJGA 3U7GA 4IEIA 4Q4HA 2JASA 2R44A 4F4JA 2EFCB 2BBWA 5HCNA 4DJTA 2A30A 2DFKB 4GBMA 2GESA 4MKHA 2IYSA 4BLRA 2PT7A 1ETUA 2E9SA 3VHXA 1WB9A 1A1VA 1VG9B 5DN6D 2XGJA 2BC9A 4KITB 4ZPXA 3THYB 4M1OA 1NMYA 1G3RA 1RVDA 2ATVA 1ZW6A 3K09A 4M1MA 1P9WA 5CITA 5TDHA 1IQPA 4IKEA 4TMVA 3SYLA 3WBKA 1XPUA 3SHFA 3CWQA 1E1QA 5EUMA 3WYAA 1KK3A 1U8YA 4W5WA 1E9SA 4ZDWA 2WOOA 2CK3A 1TU3A 4DEXA 4KFTA 1XJQA 5LB2A 2IL1A 1YZGA 2OXCA 3BFKA 5KU1A 3H1TA 1XD2B 4L9SA 3A1UA 2QMEA 2NO9A 2ZS7A 3N2EA 3R7WB 4RFSA 3KQUA 1NVXQ 2XB2A 3TQCA 1AGRA 1E2QA 1UPTA 1FZQA 4ZV4A 1XPRA 3WP0A 1W36B 1COWA 2Q21A 2WPDD 4BASA 2ZI7A 3MWYW 2AKAB 2WWYA 2WSMA 1KKMA 4EPTA 3QY0A 4NL4H 3E70C 5K8TA 5CJPA 1BMFA 3EWAA 2LWIA 2XX3A 4G1UC 1Z0JA 3U6BA 4HZUB 2VIIA 5KNDA 1AZTA 1U99A 5CIWA 3REFA 621PA 3OAAA 4O2LA 1S9DA 2YV5A 1NF3A 4RKFA 2E87A 3UWOA 3KDSE 3CPHA 2VTKA 2ZSFA 3LH5A 2QM8A 1T3SA 1G5TA 1T91A 3RNLA 4YONB 4C0BA 5JMTA 3GLGB 1W2GA 3HR8A 3UATA 1NRJB 1T5IA 1CP2A 2FEOA 2JJ8A 4TSFD 2J7PD 1W36D 221PA 4M1YA 2PX3A 1M7GA 1Z28A 5HTKA 2DHRA 3RWMB 1Q1ZA 2QTHA 3R20A 2GZDA 4BZXA 2C9CA 3QPWA 1QHHA 5C1BA 1GRNA 1GRRA 1W2HA 4TYWA 3IGFA 1EX7A 2CCKA 4XSHA 3D8BA 2W6JA 1JQLB 1MABA 1XB2A 721PA 1R0YA 2OFXA 2ZS9A 4DIDA 4NH0A 1PZNA 3VR2A 1XFAA
chains in the Genus database with same CATH superfamily
1K0FA 5AKKA 3ICWA 5LU8A 2P9JA 2FMTA 5AR1A 3HADA 5AQEA 2D2FA 2HMSA 2DHCA 4FFMA 3DF9A 5F7XA 4NYIR 1EWKA 3RSQA 1EJ2A 4F2WA 1RYBA 2QTTA 4KLZA 1G6OA 2P0EA 3TVTA 4A6XA 1NFFA 3FUTA 1TRKA 3I0ZA 2O2XA 3MCZA 2ECFA 3EGOA 4K6KA 2YZMA 1QWOA 2WU4A 4DTIA 3HBFA 1HWYA 4PPNA 4NFLA 4ZZ2A 5DIFA 2Z2KA 3PQ5A 2OYCA 4NRDA 4L78A 1G21A 2H1HA 2OORA 1G8PA 3PQCA 4W7HA 1QFZA 1IUOA 4QNMA 4KN5A 3FOWA 4OMDA 1MW8X 2YN0A 4FDUA 5DT9A 5E9AA 1ZC4A 4UDYX 1PT9A 1P1JA 1YR1A 4GMKA 3PJRA 1VBFA 2B2XA 2Q1TA 3BD6A 1X8XA 4TXJA 2GDJA 1U6JA 2JH8A 2H7YA 1DWOA 2Q9BA 2ZUFA 3RS7A 4BECA 2ZRPA 4MJXA 1UZLA 1IM8A 4PC1A 4ZHQB 1CJKC 4ITUA 1X1EA 1CRZA 1SZPA 2E1RA 3JALB 3L8HA 4WJKB 3L1UA 1VE1A 1Z4QA 3JAKA 3I9JA 4UTNA 3MGGA 3KXIA 3L4EA 4FCVA 4FJ2A 2G4VA 3I1JA 4YT5A 5D1NA 5TS3A 3A58B 4M1WA 2QQ0A 4XKJA 4ZQFA 3LD9A 2XXJA 1T9ZA 3GJSA 3HGMA 3I9OA 3ML1A 1PJZA 4HAOA 2OL4A 3QKWA 1JG1A 1XWFA 4RAOA 4LFAB 1SVOA 1HDEA 3EDYA 4G24A 4AF7A 1K3UB 1PNTA 1NWHA 1V96A 3RC9A 4IL5A 3O5AA 4TROA 2A9OA 4BE4A 4DGQA 4H7FA 2HDNB 1Y33E 2B8WA 4P36A 3PCTA 2VDRB 2Y1CA 4Q02A 1HG1A 1JDZA 2ZATA 4P3NA 1UDBA 3QLUC 3NGMA 4J16A 3NAQA 1OXKB 3V1UA 1PUXA 1Z2EA 1OWOA 4JXXA 1T1IA 1K75A 1B2LA 4MW5A 3P0IA 1F2TB 4D3XA 2CFSA 2XUOA 3P27A 5HW0A 4ZQBA 2V3VA 2QX6A 4F72A 1ZP6A 2UVPB 2CXXA 2PT5A 2JFZA 3MJ4A 4PO9A 1KQGA 4LEIA 3T1VA 3EOBI 1LUAA 1VHQA 4ZAYA 4P0TA 2YR0A 3AETA 5JVDB 3MYYA 5EXXA 4JNCA 3QPBA 2D1QA 2QK4A 2FG5A 2I3AA 2R6DA 4W5JA 3PCXA 3MMZA 5JDCA 5DHRA 5HRUA 1LDYA 3I8OA 3OFJA 4IJQA 4OHCA 1F2UA 4KPGA 4DDKA 4D9GA 1QB7A 3PFIA 3NHYA 4J03A 1YCHA 4CLHA 3C3JA 2EL9A 4YRJA 1NBIA 1TUBA 5E3IA 4DMRA 4IX9A 3LECA 3M5CA 4YRBA 2H31A 2Z6QA 3R9XB 3C16C 4KXQA 3HYLA 4F46A 4W5RA 2OLKA 5E4TA 3PPWA 2HFJA 1OGIA 4JUFA 4QFBA 4RZSA 1VFPA 2QGFA 3G3EA 2RG7A 3G23A 3NBMA 1YS4A 1M8JA 4OFZA 2ZJOA 5IARA 5C34B 2WDPA 3OKFA 2FN8A 1JALA 4HS9A 3BH0A 4P54A 3IAM1 3TXXA 1JWBB 1C7IA 1WY5A 2CWWA 3BSYA 4B3SB 3QX3A 4EA7A 1JQDA 4PNPA 3UGQA 1AS0A 3QSYA 4R40A 1U0NA 1AURA 3KL2A 3O7MA 3MUNA 3VPXA 1VIVA 1SD1A 2NSHA 2B1RA 4MR7A 1U0OC 2Q8PA 2YQ5A 3MSXA 3GGOA 2FRXA 1DIRA 3T0GA 2DBQA 5BSRA 3QW2A 2ZIEA 4ZYUA 3LGXA 5IJWA 1EWYA 5AJUA 4Z49A 3FI9A 2O1EA 2DUJA 2IHYA 3E61A 4L6AA 4OG2A 3HZRA 4KQ2A 3ABIA 4WKCA 1BU8A 1ZEMA 1XJ5A 2AG1A 2IQIA 5KNCD 5CLQA 3WIBA 1Z63A 3IV6A 4Q4HB 5BPFA 5B3AA 2C1ZA 5FO1A 2Q49A 3IEPA 2FCRA 5G41A 3LBNA 1V5FA 3PR2B 5LBIA 1R9MA 3QLJA 2IP4A 3BMNB 1RP1A 4HLUC 3WK9A 2Z3VA 1ULZA 3L04A 3VR4A 2KBFA 3C5HA 2FN7A 3VVCA 5T7BA 1A97A 1G9TA 4HP8A 1ZVJA 3DZDA 2ODAA 5H70A 1MHPA 4DWVA 3NNNA 2ZJ8A 1QG2A 1ANKA 4J3FA 4XEUA 4ZKDA 2FN3A 2BH2A 4B3JA 5I4KA 1Q3KA 4UFPA 4L9WA 4G5HA 2N9UA 2D54A 2FDXA 1LC0A 3UCFA 4BGIA 4CXMA 4URXR 3FJYA 4LJ8A 3CUKA 1NX9A 1UBKS 3OJ0A 4K46A 4YN3A 3V8QA 3ZDFA 3U7HB 4QUBA 1SC9A 2X41A 1WMBA 1L7OA 2Y6UA 4S1WA 5H83A 4FDLA 4B44A 3QVSA 1T2NA 4BVHA 1N25A 3VOBA 1XZFA 1NRXA 5LXTB 3MS4A 4KWCA 3LI2A 3RRBA 3SMVA 1JLKA 4N3GA 4UAUA 5F1KA 3TXYA 3MTIA 2PL9A 5JSHA 5IDYA 2IITA 2J46A 1PV4A 3LY9A 2VJKA 1GPUA 5DGDA 2JGJA 2HCTA 1HFKA 1E9DA 5CB4A 5GV8A 4NOKA 1KI4A 4QGGA 3CX8A 3L05A 3TCKA 4D7AA 4ENWA 5LYJF 2F7SA 3R3UA 3WLIA 2GETA 4IVQA 2ZSIA 5TB5A 4EF4A 1Y4DE 4C0HA 3CVYA 4QE3A 3RIEA 3WWPA 3RS0A 5M04A 2A5FA 2PIAA 4UTOA 3AEXA 3N3AC 3B5IA 4MR7B 4WKBA 5CVJA 1POWA 4U9UA 4D4JA 1F7VA 1GL9B 1NVFA 4KO1S 1DTWB 1VM6A 5EIWA 4FMCF 3E22A 4FWTA 4CKWA 4U02A 2VPTA 4ZEXA 4NATA 5BURA 1ZI8A 1XMXA 4B3XA 2P6MA 4JJ7A 4UM7A 5ED0A 4EHAA 2PMKA 2R4QA 1R16A 1DWUA 3QBTA 2JBAB 4ZYXA 2R66A 4KAAA 3T5TA 3CNEA 4JVOA 2F1IA 2A14A 4LJYA 2GXSA 5SYMA 2FW6A 5C46F 5LYJA 1F60A 2WIKA 2ECPA 3CWCA 3KIPA 3Q11A 2RFLA 4MV1A 5JQGB 4FEYA 4FFLA 1UP6A 4A3SA 1KI8A 3F3SA 3OBBA 4NBNA 3T7TA 3WL6A 4RTKA 4PZPA 1OFIA 1E1CB 1IEWA 1NSTA 2F64A 1QC5B 2HMYB 2VT6A 2ENUA 2H6EA 2BEKA 3NO4A 4DMGA 4D0RA 1YMQA 1ZHOA 4MQ4A 2IUFA 2J9FA 1ABBA 4HRAA 1YQGA 3VH4A 2ECOA 1U7OA 4B32A 2FWIA 1CD5A 4BEWA 4BQSA 2DLCX 3U44A 5A4AA 3I4LA 2QVBA 3ISJA 4CTOA 5HQ3A 4FFNA 4HZIA 3TBFA 1W88A 1CB0A 3LL7A 3RF6A 4JYPA 3WTBA 1UANA 1V5EA 3SEFA 1RYMA 4FOLA 3W5HA 1YIOA 4HNVA 5LD2B 5DBFA 1XRPA 3WC4A 1IHDA 3TSYA 4OJQA 1FDRA 2OHVA 3P9IA 1OT5A 2QTVA 1MC8A 2ZRNA 1FFXB 2PKQO 1NXQA 2I3GA 4JR2A 4TWIA 2RARA 1U1CA 1HG0A 1XAHA 3WNBA 3KDAA 1KO8A 2G1JA 4C4RA 1C0LA 1U31A 2H1CA 2IEAA 5G4KA 4CMEA 1EFCA 2CJPA 1X7XA 4J29A 3OJLA 1BEUB 1M0SA 1W9HA 2XMQA 4KLRA 1L3CA 5A4KA 1M9NA 4HMQA 4RGBA 5J5VA 1M1ZA 3P9KA 4F9GA 1JR4A 2EATA 3FMOB 3IX7A 3Q3IA 3P7MA 2GN1A 4L07A 4M9RA 2OXIA 1H1LA 2I5PO 3ABSB 3NOOA 3IP1A 4OBXA 3ABZA 4HTAA 4MW0A 4BV2A 4DXHA 3W3AA 1L1QA 3L7MA 4OHWA 1D03A 3IMGA 3BJEA 3TLXA 2WU3A 3U48A 3IP7A 5A02A 3T3NA 3ZWAA 1Z6ZA 1JQJC 2F8LA 4IGKA 3UK7A 3HVHA 1QO0D 3I92A 2RGUA 4D3FA 4M49A 1QG6A 2WINI 3U5TA 2HWUA 3FTNA 4IJ6A 4L5JA 2W2XA 5JFTA 1X1TA 2GJ8A 4WZBB 1XRSB 1ABFA 3ROQA 4ER7A 16PKA 4FD2A 1QIGA 4H16A 1N7HA 4EKDA 1YVRA 3CQ9A 1AQYA 3EQ6A 1NJSA 2SHKA 3NETA 3OZXA 4IUCS 4MVXA 4PTZA 1MEOA 4MW1A 2EWMA 3L0OA 1P18A 2DY1A 1I6LA 4BNTA 3PYXA 5AM0A 5LP6A 3N86A 4O02B 4TV9F 1T9GS 3ZWBA 3OPNA 1YR7A 4Q24A 3K2IA 4RY8A 3VTKA 2XUPA 3V9PA 3Q2KA 4BLTA 4LWPA 3F71A 1USGA 2V6FA 2E4YA 2YJ4A 5CNMA 4OHKA 3KKNA 4BUCA 3SKYA 5EL0A 3QKSB 3CT6A 4IP0A 1A9TA 4GFDA 2FSSA 5FHRA 3ISTA 2E48A 3AIOA 1E18A 1P29A 2XQIA 5HCIA 2GWRA 2BFFA 3KJHA 1C3EA 3B53X 1R74A 1PWZA 5SZJA 3OPYB 5ADVA 3TKLA 3CG0A 4RTNA 3X1JA 3RSLA 3UNXA 1K7EB 3H5OA 1E1CA 5TVGA 2QF7A 3KHKA 1OBHA 3WLLA 5JWHA 5I7UA 2PGNA 3OWXA 4KYUA 1U4SA 2CXPA 4W8OA 5DULA 3RRFA 1CP3A 1FTGA 2QVXX 3KEQA 3ENKA 1ZH6A 5CHYA 1FJXA 2N46A 2C7VA 2RHRA 1BGVA 3AJRA 4I8IA 4P5DA 3EEBA 4R1TA 3T5CA 1NKVA 2CNWA 2DFVA 3FX2A 3RVRA 4F91B 1DEKA 1YRQA 1VHLA 1K5DA 3CX6A 1IM5A 1PQWA 4K7JA 4LJSA 4U7JA 2GZAA 4ABTA 1O03A 2YRWA 5HMLA 3L79A 1MQAA 1RJWA 4CGZA 3H17A 2G28A 2P79A 3P9NA 3UWMA 1JYSA 2HTEA 4FYYA 3EA5A 4O5OA 3WQQA 3ZNQA 2CV1A 1QBGA 2A58A 1J8QA 1KSGA 1TVKA 3RAEC 3DKKA 2O19A 5F73A 2LUOA 5ALEA 3RADC 5CYFA 3CURA 3ZKAA 2GARA 1TQDA 4KXVA 2ODEA 3FH0A 2FPRA 1CF4A 1Q0QA 1V11B 2GLXA 2HNKA 2VJNA 4KX5A 3UJDA 4LW8A 3WLNA 2V7PA 1F0KA 3F2VA 2X22A 1E69A 1QGOA 3QVUA 4NEHB 1G8FA 5HG0A 3IAAA 1P4JA 2CLCX 2NVWA 4K88A 1ZBDA 4WZAE 3ONDA 3ZWYA 1Z6AA 4B2PA 3HB1A 3T52A 3ZCRA 1F8XA 1ECBA 2GPWA 2GUGA 3T95A 1CIPA 3OE4A 1SUSA 1EDDA 1XVTA 4P6VF 1DAFA 3P9ZA 1JH8A 4KNYA 3FDFA 1BXRA 1VL8A 2Q6VA 3FYUA 3HA3A 3HYCA 5IN5A 4ZTUB 2VHVA 2VZEA 3FMVA 3CCBA 5LZ9A 3ZCUA 4MLZA 4ARBA 4YUVA 1BAPA 1Z47A 2RKOA 4LZWA 3H5IA 5HQTA 3AVPA 2B92A 1FQWA 1OLSB 2IXBA 3TZEA 1S8AA 4L4UA 3PNOA 1F38A 1NI3A 1PE0A 3P2YA 4XFJA 3RS4A 3IC5A 3WRYC 3IKJA 4RKEA 2O8CA 4FGZA 4RMJA 5IBRA 2R1VA 3K6RA 4HDSA 4JAVC 2C9ZA 2R8XA 3OU2A 1LTQA 4JB0A 1ZA1A 3TKAA 3G2JA 5J4YA 3WS7A 4GQIA 2D2EA 2NUAB 1EVZA 1P2SA 2Z8ZA 3EOZA 4CLRA 3KQLA 2CNLA 1R6UA 2ZW9A 4G1CA 2R8PA 1IZYA 2WUGA 3NGXA 4MRMB 1KI6B 3B6EA 4EENA 5EI5A 3H5WA 3EQ8A 1UIMA 2WT9A 3OQIB 2RHDA 5K3FA 1OZHA 3M1IA 1ADGA 1PR2A 2MSKA 3C2QA 4J7UA 3B1JA 4JBYA 4TRJA 3RS8A 1RXEA 1MJ5A 1E3QA 1RYZA 1Y5MA 2OT3B 3C48A 3CT4A 3W5JA 3WK8A 3LSTA 5IX8A 5TLSA 1FFEA 1PJ4A 2E4UA 4F9EA 4HAVA 4MMXB 4AO6A 1CEXA 4E5DA 1DJMA 4J4BA 2PYDA 1WXIA 2HLDA 3HG7A 3M6LA 3RIGA 5A7FA 5BP7A 1NOIA 2XZPA 4P7BA 4QXMA 5ESDA 1AUOA 3PHJA 1P2BA 4RC9A 1T26A 3SSAA 2WWIA 4UDXX 3WOVA 3EEOA 2J41A 3DJFA 4NULA 3R6LA 1EVKA 1FYXA 3OBIA 5IUJC 3PBKA 2OV1A 3UAYA 4IO0A 3K70C 3ZV3A 1YTUA 4JKOA 3OX3A 4JP3A 4YDRA 5EZYB 4ZCMA 1ZN8A 2F9MA 3PDWA 4GEGA 4ZAFA 1SO8A 3VH3A 3LW8A 4A2CA 2H4FA 1JSCA 5AUNB 5K8UA 3UK0A 1P60A 4DMFA 1QIHA 2K7ZA 3HTXA 1QV7A 2ZSAA 2A0UA 3DHWC 2RG1A 2Z2IA 1KAOA 1H1TA 2V3WA 1BMTA 3EHDA 3G8DA 2OCLA 4P31A 1ZU5A 5EYPB 1XTRA 3UVEA 4AQDA 5CDTA 1T35A 821PA 5FL7A 1R64A 4MUNA 1PK7A 1AS3A 1D8AA 5F2KA 3WMEA 2YQ4A 4PN7A 1Q77A 3M89A 1TJPB 1J06A 3B9RA 4KVFA 4XCQA 2JGEA 1FNCA 4A5OA 1JDTA 3BWCA 1L7VC 2JCYA 3CISA 3GLQA 2BSQA 3AXTA 4ND7A 3HCAA 1M2FA 3L6RA 1OXSC 1XZPA 5ALGA 4FONA 4NCHA 2AR7A 2IUEA 4LXIA 3SSMA 1UMDB 3DW3X 5LQSA 2Y3IA 5K6TA 3MQ2A 4IWNA 1J0DA 1UZNA 1XU7A 3IHWA 3PXBA 1YI0A 2IYZA 2PGAA 4KNVA 1H93A 2FPGB 5JNWA 1Z2PX 3TEFA 2RCNA 4O2RA 1GM5A 1A2QA 1SVUA 1U0GA 2CHVA 2X8JA 3QITA 1CK4A 3GQBA 3EDMA 1NATA 1B8PA 2FQ1A 2CSUA 1MENA 1ADCA 2H2GA 3K2EA 3QEOA 2JZOA 2WZBA 4R01A 3ZDCA 4BP1A 4Z51A 1OI3A 4PZLA 2ZVDA 4RVOA 3IKTA 2IF2A 3A1FA 1YVPA 4H15A 4D2IA 4K9QA 5EIBC 2HB6A 3W6NA 3UAZA 1GPJA 1Z7EA 2CLOB 1ZCBA 1ONNA 2OBNA 1O7JA 1OU0A 1JWAB 1S8FA 2HBZA 2GBPA 3QA3E 1TC2A 1GZVA 2X9NA 1JBQA 4HAIA 3VBEA 2JLVA 4LPKA 2QDXA 3WP1B 1KEEB 3NALA 4F04A 3F8SA 1J25A 1WDTA 4JQCA 4FXOA 5ENVA 5C35A 4LBZA 1GNVA 1QKKA 2ANBA 4OGKA 3VPFA 2QLTA 5K4HA 3VJRA 4QU8A 5BV0A 4BFUA 2YY5A 4TPKA 4EZEA 2V7QD 1LDEA 5BOSB 2AE2A 1CJBA 1UPUA 2PL3A 3LHSA 3PR1A 1Q15A 3P4UA 5CB0A 1EX9A 1K5GA 4I14A 1M72A 4IS3A 4K9LA 3SC4A 4QO8A 4ZHQA 4MQMA 1UBCA 3D4NA 2I2FA 1WP9A 3C3YA 3WZ2A 1IQUA 1E60A 1SIUA 2F2TA 4NBVA 3VNSA 5AOVA 3WZMA 3OQJA 5TV2A 4V02A 3GH3A 2B9VA 3HNRA 3ENVA 4M4SA 1EINA 5ALRA 4FU0A 2Z9DA 4GQBA 4FP9A 4I6JA 1YRLA 1ZZEA 4JKYA 3VPSA 3RJ5A 2XMSA 4GPEA 1E5DA 1Y9AA 4IJWA 3FYCA 4EF5A 2QX4A 3FSRA 3H2GA 5LDHA 2D4AA 4GWKA 4PX5A 4YHBA 3PR3A 2PD6A 4B4OA 1MQSA 4GPIB 3CYFA 1U5AA 3AYXB 1AK2A 1W1WA 3H0CA 3TL6A 4AG6A 1NAHA 4RMNA 1GZ6A 3EVZA 3BZUA 3LQQA 3OWHA 3AL0C 2BR5A 4YXWD 1K98A 4E5MA 2C7OA 3WWEA 4CM7A 4H6XA 3ES9A 4LCJA 1YC5A 3OD5A 4HWGA 2CFOA 1EK6A 4IQFA 4NH4A 1QP0A 1PQYA 4YK7A 3VUEA 2W37A 1GGNA 2BL4A 4UZSA 2GK6A 3TTUA 4DQKA 4CM1A 1HA3A 1OTXA 2UZ1B 4F4CA 2H1LA 1HRKA 1A69A 3HQ4O 3KKOA 4MHSA 3EDOA 5CFMA 4GX2A 4LJRA 1ZN2A 1PQPA 4NJOA 3V2IA 5EQTA 2EKDA 1IBRA 1A82A 1PFUA 4Y6OA 2EARA 2C0PA 5TF0A 2YXPX 2I7TA 3UV7A 2OAGA 4D74A 2QMQA 4MAMA 5BXQC 1H8HA 2IKQA 2WF8A 2QTMA 2R7MA 1MTOA 1NFRA 3L9WA 2EJBA 5K0EA 1IN7A 1WUKS 1E3WB 3SOZA 3GMTA 1DEHA 1NW3A 3GEPA 4LWOA 3N59A 2OGZA 4R9SA 3WSWA 4EW6A 1Q1QA 3CB4A 5K8LA 3O8CA 3IQXA 1J07A 2Q4EA 4OXNA 1OREA 2GNAA 2G6BA 3CH6A 1S0UA 3WK5A 1SHUX 2QORA 1AB6A 3I2GA 4P4LA 4OUKX 2TECE 2FSPA 3HEBA 4KOAA 3TZCA 1NXPA 2PBFA 4W1RA 2J48A 1IC6A 1Z8FA 4ERNA 1IY0A 2IY8A 3G17A 2I4LA 3LDHA 2YJ6A 5IEJA 1MC1A 1JHRA 1NUHA 4NLLA 4BBAA 3VNUA 2CNOA 3DO6A 5ENZA 1KJIA 4D4IA 4H7JA 1OSNA 1PK9A 1BOFA 4JITA 4L6CA 1TU4A 2ZJAA 1Z4NA 4EPYA 1M2HA 4HWRA 1JHUA 2YBDA 4YRQA 8ADHA 3QTLA 3P52A 1I9CA 4BO3A 2FN4A 2JJYA 3A9CA 1BCRA 3H4MA 5HF9A 1K6EA 3IVAA 5EFZA 3T1YB 1XAGA 3KQNA 4OK5A 3JD0A 5LXTF 3UMVA 5B6IA 4CEHA 3PC7A 3QX8A 1NLZA 1PUIA 3IAUA 1N6NA 3GNSA 1NQXA 1VE6A 4B2IA 3UMGA 4I99A 2JS7A 1SQ0A 1Z62A 5DNEA 5J63A 2QYTA 5B58C 3LIIA 1NC1A 5F5NA 1Y6QA 3Q3CA 3RT1A 3KO8A 5IH3A 4QX6A 2L82A 4FM9A 4DXDA 2B6HA 4WZZA 2OBFA 4JLUA 4BBZA 1BFUA 2OLJA 2RGBA 2AVDA 3V32A 3GA0A 2V4ZA 2YIDA 4U6SA 4EJFA 5BUQA 3L6DA 1X42A 2FQXA 3HMKA 3I01M 4UMEA 4WL0A 3ROFA 1NUAA 5JC8A 4KODA 2W2PA 2C57A 4MV5A 3RJ9A 5JAZA 4KXUA 2R6CA 2ZR8A 4W82A 5JZ9A 3OI7A 1FK8A 4C01A 1KQPA 1X1SA 1RI4A 4X64B 2GBIA 4OKSA 3RG8A 4B0OA 4M89A 3OUTA 5ER6A 3UUEA 3K70D 1MU0A 3U17A 2DGDA 3ZLJA 2AD1A 2DETA 4R2XA 1COWD 2QENA 5DBOA 3FD8A 4CODB 4D9NA 1X7WB 3DKPA 1CQZA 3ICPA 4H7IA 1WXXA 2FWPA 3BWEA 3CW2A 1Q50A 3ICVA 3NUZA 4NICA 4Y6RA 4G4IA 2IWHA 2GBGA 1KH2A 4LTMA 1IEVA 3WTCA 1RWMA 4LHWA 3NHSA 2VUUA 2PKEA 1BD3A 3ST7A 4L73A 3UT0A 2PJRA 4DG5A 1XMOB 3REGA 3HL4A 3TOZA 2G3YA 4R8RA 3K6JA 4N5MA 3ZU6A 4PWZA 1XTQA 2GYUA 2Y1WA 3DBRA 5GZ3A 3C41J 3WQSB 3CZ5A 1ZR4A 3CKMA 4D4LA 2VNAA 3GLVA 3NC0C 1KI2A 1LBEA 1SUIA 2VHYA 4PHGA 4YUAA 1WCV1 3P9PA 3BIOA 3H5RA 2WHRA 2LP4Y 3N8GA 4Z9YA 3VPDA 2BFDB 1Q57A 2P67A 2AFIB 1GZ7A 1DX4A 3JPWA 1UCFA 2GILA 4PYQA 4BQFA 1V9CA 4EY3A 5KREA 3AUSA 4OAOA 5E6RB 3VA7A 3ECSA 5C9ZA 3RAJA 3R8FA 2IOFA 1BFKA 3PJFA 1UR5A 3AUAA 1N75A 1WCXA 2Q1XA 1QHXA 1SPBS 1MW9X 2W2OA 4NQRA 1MAAA 4EG3A 5IF3A 1FFAA 4RJKA 2OTCA 2B6NA 3WDSA 4QSHA 1L7PA 1QIIA 1Z0DA 4WXPA 3WO0A 5KQLA 1HYBA 2WVJA 1M0EA 3EW7A 4F1JA 3CJQA 1QGZA 3E2PA 3LPNA 4HQOA 3AVWA 2BP7B 1ZONA 4L75A 1JDNA 3WLQA 3ZC3A 2I4NA 3RYHB 4W9MC 1MJFA 3DEJA 3KYCB 4H1HA 2GYWA 2YINC 3VQTA 3BPSA 2CSXA 2FZ5A 1Y89A 1BE1A 1U9JA 3U3OA 4KBGA 4AO8A 1J2JA 2CE7A 2QD4A 5FWXA 2FZGA 2HRCA 2IHNA 2W8BA 2V65A 3K3PA 1KQOA 4K2HA 2QYSA 4DG8A 3BMQB 3CRNA 3IEUA 1H0SA 2FEWB 2QLJA 1RCUA 4G37A 1A4XA 2JCGA 4OKIA 2J5XA 3WL7A 4KPEC 1NZFA 2AFHA 1YDEA 2FMUA 2KW5A 4HGZA 4B7ZA 4NMHA 3FTCA 5FOSA 4COKA 1RD4A 3T7JA 1ZA2A 3OKCA 2OZEA 3DEZA 1Z2NX 1WCYA 3GCDA 4QOSA 1P1IA 1E20A 3RLFA 2XGSA 2O2DA 2PRSA 3DDNA 5D3QA 3UCXA 1RJ9A 3NW9A 4KXYA 4ZYZA 1KK0A 3BWVA 1BSVA 2D5LA 1HMPA 4KMMA 5ALNA 4B5LA 2FQYA 3FHCB 4WWHA 4LBVA 3IJPA 1P81A 4DADA 2A5JA 4J3JA 2C1XA 4RM2A 4D6YA 1G38A 1JU3A 1K88A 3H86A 5CLLA 1M2GA 2RGWA 4Z0TA 1A1SA 2WIAA 4FFPA 3SC2A 1POXA 2PKQP 4TMKA 2NT3A 4JBNA 4RXUA 4DCMA 3ZJTA 2BF4A 4Z4CA 2V0GA 1E3EA 2WFAA 3OCJA 5T4FA 4G63A 3DG9A 1RWKA 1USVA 3I73A 1DWQA 1XWIA 3C87A 3GMIA 3JCZA 1CQPA 1GNPA 1DC6A 3O2QB 1FSFA 5JJCA 1SZJG 2NTYC 4DC1A 3H9QA 1L3IA 2FTKE 4DV4B 3K1JA 3IS3A 2VJAA 1O6FA 2C00A 1H4TA 5HE9A 3VU9A 5AVJA 1E9RA 1UBSB 4ZVMA 1VSBA 2Z5VA 3K0KA 3G8YA 1ACJA 5DM2A 1JNXX 2E2WA 4OH1A 3QI2A 4XQEA 2JJ2A 2DUUA 3R6DA 2WK1A 1TQ6A 2BF7A 1DSSG 3FWKA 5GJVC 4Z54A 5HWSA 1SQ5A 1H05A 4DEYA 2Z4SA 1AMUA 1JB1A 3HXMA 2BTOA 4U3JA 1MAHA 1KTIA 4IHAA 2R85A 3K9GA 1UBJS 3TOSA 1LDGA 2WT8A 3O8QA 5E38A 5FL3A 5FWYB 5H3CA 1V7ZA 1R00A 3BVPA 1NZDA 3NKVA 4KZPA 3SQNA 2C29D 4MUKA 5E1BA 4RDXA 5H5JA 1ODIA 4GLLA 1PT8A 2P6PA 3LAWA 4V0KA 3S2YA 4OF4A 2ATCA 2B34A 3TOVA 3R5XA 1QOZA 1M2NA 2MSCB 5C5DA 3L3BA 4QEZA 5CYPA 3W1WA 2BBSA 2WWTA 2Q3DA 1R0LA 2HK8A 5JVDF 3UGTA 3COJA 2IYRA 2VO1A 3BOSA 3O7WA 4CKBA 4E5NA 3NM4A 4Q9NA 1CYEA 4DNFA 1IN8A 1EDEA 2HIMA 5D84A 2GHRA 4WGGA 5K0FA 4N8EA 4RYDA 3R0ZA 3PVCA 3ZEIA 3TRFA 4CRWB 4QYTA 4W8HA 4BYGA 1XHFA 2Y76A 3DFFA 3NEAA 2WE7A 1T4DA 1V47A 4MW9A 2OLEA 2YHBA 4UE3S 1SEVA 1GR1A 3VR5A 3ZHTA 4AWBA 1XQXA 2YJGA 1OH7A 1X7WA 4NECA 3RDPA 4DB2A 1EB8A 2AR9A 3RUFA 4PCLA 1ORDA 2BCGY 2FHPA 3HXPA 5THKA 4C87A 2UVQA 3DT6A 4E6EA 2ZULA 2ZXEA 2AOTA 2P5SA 3FHOA 1IPFA 3FLEA 4ND2A 2JLWA 4ILEA 3WXBA 1NULA 1XDBA 2J6CA 3WGZA 1AZWA 4Q3OA 4XYBA 4MWTA 5GJCA 5EIOA 3EZNA 5E6SB 5G3YA 5BSEA 1P0IA 4TV8F 3ROGA 1XQYA 1J0CA 1Q92A 3F4BA 1LQTA 4WCFA 4BV9A 5I45A 5KTOA 4ZYTA 1M2OB 3JASA 5GY7A 3LHKA 4IW3B 2XB4A 4BNUA 3BJIC 2YWGA 3DD1A 5DHAA 1SVKA 1NGSA 1Z22A 2XA1A 3L0PA 1TCCA 2HPZA 4AMVA 1XC7A 5TPWB 7AT1A 5DH9A 2IXFA 1PWHA 1L7RA 1U7XA 1P2TA 3OX4A 4M55A 4MKRA 2IGTA 5J9FA 5EMJA 5FWXB 2NW6A 3QENA 4E6PA 5BORA 4HQLA 2Y1EA 1SELA 2R3SA 3DO8A 4Q1CA 4TKLA 2OPHA 5C52B 4F3YA 3RYHA 5CT6A 3KJFA 3ROZA 3WL5A 3K30A 3PZRA 4IINA 1ZL2A 3EGXA 2H5LA 1XTPA 3KYIB 1W35A 4FX5A 5AK6A 1ZNYA 4QZVA 3BSSA 4BLOA 4WY5A 4FFSA 3NYRA 3IH5A 1KDZA 4BO8A 4RPIA 5YASA 5KTPA 1G5HA 1VCMA 3MSCA 4DCUA 1Q12A 3OIWA 2DBYA 1D6SA 1RRVA 1T6ZA 4JI8B 2ZYIA 4J1TA 1WMSA 1UXOA 4PGHA 1GTSA 4JQZA 1W47A 3H8WA 1MZVA 4E5KA 2ZRCA 3CVVA 3DL2A 4ARIA 1JEDA 3D3QA 2VHQA 4IGEA 4PC6A 1OPRA 2OXFA 1WZEA 1R2QA 1LV8A 3DC7A 5KTRA 1TD9A 1GAXA 2VG8A 1KFCB 2BRUC 2G5PA 5GINE 3N53A 2I1LA 4IMJB 1T8UA 2YX1A 3C3EA 4RL4A 3ZTYA 2F1KA 2W4MA 2LIVA 2YWBA 4Z0HO 2G5GX 1BKDR 4MYDA 4YBZA 1L4KA 4NNJA 4BRSA 1IHOA 4L57A 5IT0A 5KVQA 2JFUA 4UTPA 2DYKA 1WX1A 2KPOA 4MS4B 3S28A 5CEFA 5EIHA 3TNDA 2WV7A 2XRMA 4ITRC 1J8YF 1UKYA 2QS9A 4UJ3A 5IP5A 4E88A 1GT6A 1CDDA 4FGKA 3TLEA 1UOEA 1CZUA 1IY9A 2ZITA 3DLBA 4PIVA 4ARUA 1LSJA 4LN1A 5ILQA 1DKMA 3LUJA 2G9RA 1BDHA 3B7WA 1X8KA 3IIKA 4P7KA 1T36A 3BICA 1IRXA 3ZGNA 4HRYA 4UKDA 1N5KA 3Q5DA 3ITDA 4CMIB 4M9ZA 1C0KA 2WZQA 2GB4A 1XCOA 1XDWA 4HN2A 1AKYA 4FT2A 8GPBA 2PWPA 1Z5VA 4EA6A 5JXJA 5CW2A 1Z6XA 3UJ7A 3GPDG 3RRYA 5MDHA 1Z2OX 2VJBA 1JFFA 2HLHA 4FMCB 4PZDA 3QEJA 1E5TA 2HA7A 5BO5A 4D57A 1E2PA 3G49A 1ZJ4A 3ABOB 2Z6UA 3ZY5A 1KYIA 4WK2B 2BFOA 4PHFA 1SK9A 4XE5A 4CM5A 3IQEA 2VWGA 3PHIA 5JYEA 1TZMA 2JK1A 3EFEA 4J0EA 4CLRB 3MWGA 3AI7A 1A9XA 4ARAA 4BKPA 2O0KA 3B5EA 1YBFA 1CQIB 4A8TA 2IOQA 5C5EA 1DO0A 1JQBA 3FR7A 3NDBB 1QYDA 1V4VA 4P3KA 5DTRA 3OH8A 4CEHB 4NZOA 2GK7A 3NEPX 2X7HA 5CD1A 2YZ7A 1LI4A 4F71A 4BQIA 2VSQA 4QGAA 3EWSA 4JBLA 3VSCA 4NARA 2NU8B 3SD7A 2WG2A 2B0CA 4QL3A 1X19A 4DY6A 5JZVA 4OL9A 3AMVA 1BXRB 3IRUA 5SYAA 4YMUA 3U3DA 2HT6A 3H42B 2QTCA 4G26A 1GKLA 1YBAA 1XVIA 1DAPA 4JBIA 5IW8A 3U3ZA 5KQPA 4P4GA 3HDQA 1KH3A 3UYKA 1AF4A 2Q2WA 5SZKB 1CB7A 2Z3WA 1AY0A 3H13A 1EP3B 1Q44A 3MWKA 3L7LA 3OE5A 4R1NA 2BFEA 4B71A 4EELA 5IJ0A 2JBHA 2W8ZA 2WUFA 2W7TA 1JJFA 4CMCA 5FBRB 5JMOA 4JMLA 2BSXA 1FP7A 3BXFA 1ISHA 5HGXA 4BS9A 5CK5A 2VI5A 3E9YA 2BD0A 3HFGA 2VDWA 2YFHA 1PFGA 1V11A 2WHPA 1P2VA 4RY9A 5JARA 3L01A 1IVSA 5F7ZA 3PD1A 5BV7A 4LBWA 1EWRA 2P35A 4R5HA 3ZK9A 1G7CA 2CXHA 3LXMA 2QPOA 4UQOA 4DEVA 4QATA 3U4MA 2A9PA 3G5TA 1VXOA 3FLMA 1FW6A 2ASEA 2HGSA 1P1FA 4K86A 4UCWA 3SBXA 3DMTA 4LZAA 4IIYA 3AWIA 4YRMA 2UAGA 3WAKA 2DQSA 2WUEA 4Z3KA 1KBOA 4OA8A 2C59A 4GI2A 5LWHA 4GMFA 3PC8C 3LZ6A 5JZBA 4O33A 4ZWNA 4WNCA 4JGBA 1I0IA 2HRDA 2X19A 3FF4A 4C3VA 4ED9A 4EEXA 4EG4A 2GPYA 4Z4EA 3M4XA 1UWKA 4EG8A 3VV2A 4BNFA 2OD7A 3L8YA 1ONBA 4XIYA 1ZI6A 1QUEA 4KQEA 1EFDN 3L4SO 4ZOLB 3E18A 3EISA 3AILA 2JRCA 2VTBB 2V9ZA 3TL3A 4DJJA 1AS2A 1K89A 2G07A 5B2FA 1JH9A 2EG9A 3FYDA 4YR9A 1FLAA 2R6JA 4KFCA 1XJWA 4E5UA 4WADA 1XX6A 2VJOA 3NTXA 3TX6A 1QBKC 4OD0A 3E35A 4C20A 1NUPA 1CNEA 3QG1A 2DTXA 1HC7A 4BQRA 3DMRA 3N8DA 1YKSA 4B3BA 1JSRA 1P72A 5E0OA 4BV8A 4W99A 2MHCA 1Z36A 3T4PA 1XTZA 3UY4A 3A3YA 4HC4A 5LBUA 1D0IA 3V4LA 3LO5A 1MV8A 4PSAA 4AYTA 5DWQA 5C18A 2Y67A 4H31A 1IMJA 4F6RA 4PAMA 1L6RA 1E9FA 3RHZA 3I39X 2IUTA 3KUCA 2ECQA 2AFIE 2VYND 4AJPA 1VKRA 4B76A 5IH7A 3K92A 2O5EA 1JHYA 2HF7A 2YHUA 1XSEA 2H5IA 5GMOA 4EGSA 5F3WB 2RH5A 1ULBA 4HVLA 1QO7A 4AY4A 2JGAA 2PBZA 3OMLA 1XF9A 1OAOC 4TMZA 3BWMA 1LJ8A 3FB4A 3FI0A 4P98A 1X7ZB 1ZVQA 4ZVKA 1GL7A 4D3SA 2VT7A 4WKNA 1P62B 2IJGX 3JWGA 2W6MA 3Q8KA 3AP1A 3PXAA 1FNBA 1N6IA 1BGXT 1ZN7A 3PRYA 4JJ4A 3S27A 3VHLB 3TFOA 4FYKA 4MB6A 1QGED 2QRZA 2WJ6A 4PBRA 1V37A 2L17A 3MPOA 4TGLA 1KP2A 5B6JA 1HSZA 3N2GB 1RHUA 2AG8A 3MS7A 1QTIA 4Q7LA 4KQJA 5C8XA 4ALLA 3L8CA 5SY9A 1JFSA 5EZSA 5IPFA 1M0WA 1WMFA 1ARZA 3WI7A 1O4VA 1ZN9A 2DQYA 3EAQA 2H1RA 1KR2A 4GVLA 2VZ8A 3THYA 3FGNA 3I4CA 4TN5A 1F4PA 4BCCA 5JNRA 1F0NA 5FV4A