1NE2A

Crystal structure of thermoplasma acidophilum 1320 (apc5513)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
197
structure length
176
Chain Sequence
MGIKNDLEIRLQKLQQQGYPTDASTAAYFLIEIYNDGNIGGRSVIDAGTGNGILACGSYLLGAESVTAFDIDPDAIETAKRNCGGVNFMVADVSEISGKYDTWIMNPPFDRAFIDKAFETSMWIYSIGNAKARDFLRREFSARGDVFREEKVYITVPRIYRARIEAVIFGVRNHSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Thermoplasma acidophilum 1320 (APC5513)
rcsb
source organism Thermoplasma acidophilum
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein ta1320
total genus 56
structure length 176
sequence length 197
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06325 PrmA Ribosomal protein L11 methyltransferase (PrmA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1ne2A00
2ONZA 4KWCA 1F38A 3UJ7A 3R9XB 3HA5A 3PFHA 3KQYA 3NW9A 5LSAA 1JG2A 1M6EX 2QRVB 4ER5A 1X1CA 5EKXA 4DKJA 2YR0A 3LPMA 5LQRA 2FK7A 5K01A 1JQEA 1X1BA 5CCXA 2EJTA 3AY0A 3KQSA 4GOLD 5DM1A 1NT2A 1EJ6A 5ICGA 4X63A 5GIOE 3GDHA 2VDWA 5K05A 3GJYA 3ER9A 3UBTA 3EVDA 4FT4A 3CVOA 1QYRA 3P71T 3GWZA 4GF5A 3NMUF 2QY6A 2ZTHA 4GBED 3THSA 2I9KA 2ZWVA 5DX1A 5DXAA 1EG2A 5C0OE 5KVAA 2I6GA 3FPGA 3MGGA 3QOWA 1T43A 2R6ZA 5E9QA 2WK1A 3PT9A 3IHTA 4P7FA 1G38A 1INLA 1JG3A 2YXEA 4CXMA 5DT2A 4AUKA 4DQ0A 3T7TA 1SKMA 3O31A 3QV2A 3HM2A 5F2OA 1WS6A 1VL5A 2QE6A 3OCJA 3NWEA 2AVNA 1RI4A 2FYTA 4FGZA 3BGDA 4OA5A 3BKWA 3G2MA 3EGIA 3L8DA 5E9WA 4WVLA 1YFLA 2V74B 2H11A 4O29A 3O4FA 5K8VA 5BXYA 3TLJA 5CIYA 1RJGA 4PGGA 4ER7A 3UA4A 3KPVA 4BLUA 2OB2A 5CCBA 3KHKA 4QDKA 2WA1A 3B7PA 1YZ3A 3JWHA 4U7TB 2IPXA 4R6XA 5EMKA 4PCAA 3K6RA 2VDUE 3BGIA 2JHPA 3DMFA 1AQIA 4YV0A 4M38A 4FP9A 1JG4A 3DULA 3E23A 3C3PA 1NW6A 3NTVA 3FUVA 4V0QA 5BP7A 2B2CA 1NBHA 3ME5A 4PYKA 5FULA 3UA3A 1MHTA 3DXXA 3P2EA 8MHTA 1SQFA 2DPMA 4OX9Y 3HA7A 2GLUA 5BW5A 2JG3A 3GXOA 1SUIA 4M7RA 2IFTA 4MWZA 1JR4A 1VBFA 5C9ZA 2YUIA 1YB2A 3MCTA 1I1NA 4CKEA 1FP2A 2XYQA 3DR5A 4FR0A 3UJBA 1QAMA 4E70A 4YUZA 2ZBPA 5K0FA 4X1OA 5HIKA 5EEGA 4LECA 3UFBA 4AZVA 3R6TA 1G8SA 3KKZA 2VZ9A 2ZFUA 3LKDA 4ISCA 3SX0A 3UJDA 3KPUA 4AZSA 3BXOA 4XCXA 5DM0A 1D2CA 3KQPA 4X60A 3AWIA 1XTPA 5F2NA 3KQOA 3PLAE 4HGYA 5EIFA 4BLWA 1RI3A 5IKMA 3UJ6A 1HNNA 3LCCA 3TR6A 1VIDA 4QTTB 4C06A 5CD1A 2IH2A 1OR8A 4KIGA 1YUBA 5E8JA 4OBXA 5CM2Z 1KPHA 1TW3A 4AZWA 3RIEA 1H1DA 1RI1A 5EOVA 3B3FA 2AN5A 1NE2A 2JHAA 3KQVA 4KIFA 4C4AA 5K0GA 5FTWA 3I64A 3OU2A 3HVIA 3DXYA 5FCDA 4RTJA 2EJUA 2FK8A 4QDJA 5FQOA 4LG1A 2A14A 2G70A 3I9FA 4RX1A 3K0BA 1KYWA 1JQ3A 3KR1A 4PYJA 2CMGA 3S68A 4K6MA 3LSTA 1FJXA 1QANA 2O0LA 2P3QA 4X61A 1P1BA 3HVJA 5DRTA 5EZQA 2CKDA 5JUWA 4RTMA 4RTKA 4RVDA 3KPJA 2HNKA 2G71A 5LQNA 4PINA 2ZVJA 2ZULA 3G8BA 3LECA 2LD4A 1X1AA 5DLYA 3ER8A 3BT7A 1L3CA 3B3JA 3FTDA 2PJDA 5CVDA 2ZIFA 4A6DA 5HOQA 2Q41A 3H2BA 3TM4A 4E30A 4QPPA 3R0QA 5E9JA 4LWPA 3PFGA 4PYLA 3TQSA 2Z6AA 2B25A 1VPTA 5FQNA 2ZW9A 2P3LA 5CVEA 1JSXA 4EMSA 3LKZA 4PCLA 2IIPA 2IP2A 5E1BA 3NVKI 2ZZNA 2IBTA 3HNRA 2UYOA 3EVFA 5K0LA 4CWAA 3E7PA 5EC8A 2IDJA 1XXLA 1L1EA 4DMGA 4XUDA 2IH4A 4GOMD 4YMHA 3KPWA 1N2XA 1BKYA 5T64A 3UZUA 1NW3A 3BKXA 2EX4A 5FA5A 3VC1A 4EVIA 2O06A 3P2KA 4RVFA 5ICCA 1WZNA 3D2LA 3UJAA 2WA2A 3GRYA 1O54A 4HH4A 4P58A 3V97A 2P8JA 1KIAA 2B9EA 3DUWA 3M6VA 2ZIGA 4GQBA 2PWYA 3OPNA 4GUAA 4PNEA 4PYNA 4R6WA 4IV8A 2JJQA 3SSNA 3EMDA 2O07A 4P7KA 2BR3A 5DM2A 5P8WA 2GH1A 5LQJA 3HVHA 3GU3A 1B42A 1JTEA 3FUWA 3KQTA 5EIWA 2K4MA 5FWDA 3GGDA 3AJDA 2P7HA 4V0RA 3GRRA 3OU7A 1N7JA 3OZSA 1NW8A 3A7DA 3B89A 2NXEA 4HSGA 5DX8A 2P41A 2NXJA 2AZTA 2C7RA 4CTJA 2PX4A 2ZBRA 2AOUA 4RTPA 1Q0SA 5ICEA 3FUUA 3CC8A 1BOOA 1NBIA 2NP6A 3CJTA 1G60A 1I9GA 5GOZA 2PX2A 5CVUA 1IY9A 2BH2A 3GIWA 1KR5A 5C1IA 5EQJB 3I5UA 3FRIA 3UJ9A 4FSXA 5DX0A 3FPFA 3SSMA 3VC2A 1HMYA 3HTXA 4FS8A 5K0JA 3M6WA 1X1DA 5EPEA 3T7RA 3FTEA 5EEHA 3DP7A 5HILA 3M4XA 5DTQA 2AOTB 5GP1A 3RODA 3V8VA 2V7EA 1JSZA 1ORIA 2NXNA 2FHPA 3HCAA 3LBFA 1QAQA 5EZSA 2ONYA 5HFJA 3FUTA 10MHA 3GNLA 4ER3A 4G56A 5CUQA 1I4WA 2BM8A 1RJDA 3EGVA 5GIPE 5LQKA 1R6AA 1PRYA 5DSXA 4GOOD 5EG5A 5ERGB 5BW4A 3A25A 4RVHA 3FTFA 4RVGA 3FUXA 5HEKA 5HIJA 3B3GA 3RW9A 3PB3A 2OO3A 1G55A 2P1DA 2PSSA 1WY7A 4KDRA 4F86A 2XYVA 4UOEA 3TFWA 2UYQA 3PTAA 4E2YA 4YUYA 3ID6C 1XCJA 3HCEA 1RI2A 3OU6A 1TPYA 2OB1A 2ZWAA 2KW5A 4KVZA 7MHTA 4C03A 2I7CA 2DULA 2PXAA 3C0KA 2ADMA 1P91A 3C3YA 2OBFA 3CCFA 1M6YA 3MAGA 3LBYA 1KHHA 2ESRA 4M37A 4OBWA 2PXCA 4DM3A 1RJFA 5T6BA 4RSRA 3FTCA 3HCBA 3CJQA 3FYDA 2XVMA 4GC9A 2O57A 2YXDA 2H00A 2IGTA 4C05A 5EKUA 3LDFA 5KQRA 3HA3A 1PJZA 2G8NA 2OZVA 1YZHA 1VP3A 3FPEA 4Y2HA 2PBFA 4E31A 2FPOA 4EKIA 2GPYA 1FBNA 3ELWA 4RTRA 5T67A 4B17A 3MCZA 2PGXA 3G2QA 5E2BA 3ELUA 3DXZA 2PV0A 3EVAA 2HR1A 4BY9E 3U81A 3G89A 3EVEA 1R00A 3P9CA 1DL5A 3I58A 1BC5A 3P9NA 3P97A 2GA9A 5H02A 3P2IA 5HIMA 2VP3A 3ELYA 1JQDA 4YV1A 5FUBA 4HRAA 1QAOA 3NWBA 2YX1A 2PWPA 1VLMA 5M5BA 3JWJA 3FYCA 4H0NA 4MQ4A 2JH8A 4X41A 3KR2A 5E1DA 1G6Q1 5IH3A 3T7SA 3THRA 3TPZA 4DCGA 5KQSA 3EEOA 1R8YA 1O9GA 2NYUA 4OA8A 2PX5A 2OKCA 3LCVB 3OZTA 4C04A 3FRHA 2HV9A 2OPBA 5EMMA 2AOXA 1SUSA 2R3SA 2ZLBA 3DH0A 2AOWA 3FPHA 3HP7A 3R24A 4YMGA 3G2OA 3BWYA 3LX6A 2PKWA 2XVAA 5EMJA 2UYHA 1ZKDA 2P3OA 4PGHA 5DPMA 2PXXA 3I53A 3NDIA 3GRZA 4EK9A 2FCAA 2YTZA 3A27A 3HCCA 3BWMA 1MJFA 3OE4A 1ZGJA 5JR3A 5E8RA 5G02A 3SMQA 3MTIA 2PT6A 4FT2A 5KS2A 2CWWA 2O05A 5EMLA 4WXHA 1P39A 3G8AA 5K0CA 1EIZA 4HTFB 3ELDA 1AQJA 3HCFA 4GOND 4PYIA 5U4XA 3PX3A 3HVKA 4PWYA 3TKYA 2ZIEA 3UWPA 2BM9A 3VYWA 2FRXA 4AX8A 4E33A 4E32A 4BLVA 1VE3A 3IEIA 3DLIA 5EHGA 4KRGA 5GWXA 3BZBA 1R74A 1UWVA 2AOVA 2NNWB 2B3TA 1NW7A 1Y8CA 2PVCA 1RI5A 4PIMA 1IM8A 4DCMA 2E5WA 3GRVA 3CJRA 2Z6QA 1JTFA 2ZCJA 1FPQA 3BWBA 2ERCA 3CGGA 1IXKA 4CKCA 5D1NA 5E1OA 5F2KA 2GB4A 5HZMA 2UYCA 3GO4A 2C7QA 2Z6UA 3LCUA 3E05A 3MTEA 3G5LA 1YF3A 3KPYA 1ZG3A 4C07A 1KPGA 4GEKA 5DTMA 3G2PA 4E2ZA 2JHCA 4IV0A 4MTLA 4Y30A 2VDVE 3OZRA 1X19A 2BR4A 3BWCA 4XUEA 3Q87B 5CVVA 3EPPA 2P40A 3SVZA 3CBGA 3UJCA 4RTQA 5FADA 3SM3A 2C7OA 2NP7A 3FZGA 2QYOA 4PYMA 4RV9A 4A6EA 4BP1A 2ZZMA 2EG5A 2Y1WA 1WXXA 3NDJA 5GINE 5FHQA 1XJ5A 1DCTA 4IKPA 5LQCA 2CL5A 1D2GA 2XYRA 3TRKA 3A26A 3LDUA 1VP9A 2N47A 2IH5A 3O7WA 4DZRA 2AN4A 1JG1A 1ZHFA 4M36A 2VS1A 3BUSA 4ER6A 3TMAA 3KR9A 4RYLA 1FP1D 4PYQA 5E1MA 3LHDA 4OQEA 3SGLA 4POOA 3P8ZA 5DTRA 3SSOA 4QQNA 3KQWA 1EQAA 2CMHA 2P35A 3M6XA 4RWZA 2P7IA 4PYOA 4BP3A 4HC4A 4LWOA 5B1SA 2PY6A 1RJEA 4DF3A 3T0IA 5ICFA 3OFKA 1KPIA 2AS0A 2HTEA 1XDSA 4QTUB 4YUWA 3MHTA 5K0BA 4RTLA 3EEYA 4RTOA 1O9HA 1R18A 2JH9A 4HGZA 3MB5A 3AXTA 4P7JA 5GM1A 2PLWA 4QVGA 5HIIA 3HEMA 3GRUA 4DA4A 2OXTA 1G8AA 4R8RA 3TKAA 3NJRA 1SQGA 4ATNA 3REOA 1UFKA 3KQMA 3JWGA 4U7PB 1TW2A 2IBSA 3JWIA 5EHIA 1UIRA 1ORHA 1NW5A 2G72A 2ZBQA 1Q0TA 4MHTA 3A7EA 3DOUA 1F3LA 2C7PA 4HTFA 2I62A 3C6MA 4FZVA 3DLCA 2YQZA 3FPJA 4JXJA 3LDGA 3PVCA 1YFJA 1BHJA 3ERCA 5FA8A 1WXWA 5DXJA 4PONA 5EGSA 4ER0A 4P7GA 1M0EA 3BGVA 3LL7A 4RTSA 4RTNA 3P9KA 3OE5A 1DUSA 3A4TA 4R05A 2GAFA 5FWAA 4AZTA 2NXCA 3EVCA 3G5TA 5K03A 4R8SA 1D2HA 3DMHA 4E2XA 2BR5A 3MERA 3IYLW 2H1RA 2F8LA 2IDKA 3EGEA 3G7UA 3P9IA 4F84A 5KYGA 3PS9A 2B78A 5EVJA 4OQDA 1VQ1A 1KXZA 3QOXA 3PX2A 4QQKA 3DTNA 4YUVA 2YXLA 4IWNA 5D1HA 2EFJA 2ZSUA 3EMBA 3EVZA 2YVLA 3HCDA 1XDUA 3CKKA 4GC5A 5K0EA 5LQUA 4L7VA 2ORED 2AR0A 3EVGA 5LR6A 2GS9A 3R3HA 5GM2A 3DMGA 2BZGA 4E2WA 1L3IA 9MHTA 1Z3CA 3NVMB 1KP9A 5E2AA 4CKBA 4ZTBA 4MIKA 2QM3A 5CVJA 4F85A 3B5IA 3MQ2A 3C6KA 3EVBA 5K0NA 2XBMA 4EQZA 1KYZA 1V39A 3SR4A 4PIPA 1L9KA 4HG2A 1R8XA 1SVUA 1XCLA 1ZGAA 3IV6A 4XUCA 2PT9A 4QVKA 1ZQ9A 4YUXA 3KQQA 2HMYB 1EAMA 3KR0A 2AOTA 3F4KA 3M70A 1NV8A 1QZZA 5DSTA 1NKVA 4KW7A 4YV2A 2QRVA 3GCZA 3LGAA 3ORHA 3Q7EA 3WSTA 3OFJA 1N7IA 5MHTA 4EKGA 3E8SA 3TM5A 5LQAA 4FSDA 2PX8A 3AXSA 3UJ8A 3VSEA 4C08A 2UZ4A 1L3BA 2G1PA 4KDCA 5DRYA 1AV6A 5DM4A 4QPNA 5FHRA 2AN3A 2AVDA 2OYRA 5K09A 2ZZKA 3M6UA 1U2ZA 1AF7A 1WG8A 1XVAA 2HWKA 3M33A 3SXJA 4NECA 1NV9A 4CTKA 2OY0A 3KU1A 1XDZA 3X0DA 1P1CA 3G88A 3TOSA 3ANXA 2Y1XA 1SG9A 4Z2YA 2AOUB 5DWQA 1EJ0A
chains in the Genus database with same CATH superfamily
2XGMA 4KACA 1MIHA 5I7OA 4W1PA 2ID9A 5AD1A 1GNSA 1T6BY 1L6RA 2GVZC 2C3PA 2AT1A 2PV7A 2QRVB 1R8QA 2V7UA 3AUXA 4IOKA 2R6DA 1A95A 4LN1A 2OV8A 3V1TC 1ODKA 1KBOA 3H5TA 2I99A 1F0KA 4ZU6X 1KNQA 2X1MA 3CLSD 3E3OA 4FT4A 2JIBA 5CW2A 1OFIA 1HLPA 2GPNA 3DEJA 1RMYA 1YRQA 5DBIA 3TZHA 4MR9A 4BMNA 1N4AA 4MQEA 3EH1A 1KJQA 1LVGA 2I5PO 4G9BA 2LTAA 1EFVB 1SFRA 4IINA 3AR2A 2LCFA 4DYHA 2QL7A 1UCFA 5H5JA 2XOEA 3DF7A 4E5DA 1C3LA 3M3DA 1Q11A 1XEXB 4MYHA 3S27A 4XSHA 2P9TA 3OKFA 3V8NA 3OCJA 2NZWA 1JDBB 3HU2A 3B6KA 3E5RA 4GZ6A 1NVUQ 3JQ7B 1IULA 2ZYSA 2YOFA 3E3MA 3FMOB 1I7LA 3MF4A 4WVLA 1RJWA 1HXHA 5AP9A 3EDQA 3DQZA 3QELA 3QBJA 3MHPA 2WOJA 4ZMRA 5H9WA 1A4IA 5CCBA 4FOTA 4BV2A 1XGKA 1DJPA 3ZYCA 2QX8A 3KQLA 1A9OA 2UXCB 3B20A 3C4JA 1BWQA 1XRMA 3VHLB 3NOVA 5JZSA 4P3NA 2N75A 4U0JA 4E15A 5E2IA 2I6TA 3H8SA 1TRHA 5AI8A 1X9GA 2H92A 3SYKA 3RVNA 4M8SA 3JQ8B 2JCXA 3CUYA 2JLRA 4UQPA 1GRVA 2CLDX 5IEBA 1P5ZB 4PX2A 4YREA 4DWJA 4Q48A 1KVUA 1YZLA 4LOLA 2YV1A 5DNVA 1GLGA 2P1ZA 5BW5A 5BW6B 1E1CA 3WLAA 421PA 2CUKA 5DHSA 1KIFA 2JJ8A 2ODEA 3VPCA 4MWZA 4WJKB 5I9BA 3OBBA 2P0AA 3TW8A 3ZDXB 1W93A 3MCTA 2M6RA 3OBIA 2CVOA 1Y80A 2GZMA 3DT9A 3GZJA 4XGKA 5H70A 5H83A 2WWVD 5I4BA 4X1OA 2QM0A 5MF6A 4XR9A 3SQXA 4PX3A 1TVKA 5J4HA 1JHAA 5HTKA 4BJ1A 4AZSA 2BFMA 3A6DA 4JQZA 5IYZF 4XCXA 1WKBA 1D2CA 3UENA 5F2NA 4WD3A 5KYTA 3KSBC 3D6TB 4QPDA 2XUDA 3IQHX 5L3SA 4LRYA 1A5AB 5D6OA 3PE6A 1KEZA 1UBNA 1GZVA 3IPLA 4H7EA 2OE2A 1H1DA 3K2QA 3F6RA 4E08A 2W2PA 3QYPA 5F76A 4DOMA 5I4KA 2G0AA 4C4AA 4DGSA 4DXAA 5JC1A 1XVUA 2OK7A 3R5FA 4JI8B 2EJUA 2SCUA 4IV5A 2QPLA 1NOIA 5IDXA 2XCSB 4K9RA 1RP1A 3QJYA 3TJRA 2P11A 1EDZA 3U80A 5JD6A 3F9IA 2G70A 2WT9A 3GFOA 4D9HA 1OE0A 2YJNA 1B0ZA 1AKTA 3R4VA 3LSTA 3RV4A 4D6YA 3B9QA 4X61A 2MDTA 1F4PA 4RZSA 3JXEA 1R3DA 2FPMA 4QDOA 4EFKA 3L0IB 1UEIA 4ZCTA 1A7AA 2EZTA 5IVDA 4UAJA 3TGLA 1J5EB 3X1KA 4F1JA 4NDAA 4MVJE 3P9PA 4J16A 1R6XA 2Y2UA 5TMPA 2XRYA 1XE3A 2PX3A 5LLSA 5BWMA 3DE2X 1QBKC 4FMPA 4DV4B 1ILWA 2HHLA 1O6FA 2PMBA 1T2AA 3E03A 3A9RA 2RHHA 3UMSA 4GPIB 5AM5A 4ZIRB 3BPSA 1D9XA 3GRPA 1DJNA 3DMPA 2R1VA 3HUFA 3WYCA 3FPBA 4MW9A 2JAWA 4PANA 3TQSA 4AMZA 4WADA 1FDSA 1YR8A 2VZLA 1JL3A 3HMQA 3MLAA 4MINA 1JJFA 5IUKC 1I4DD 4II2A 5CFOA 4I9GA 3OZCA 3NONA 4GWGA 3MJRA 4L15A 1WE2A 1UEXC 4K6OA 1CTQA 1EX6A 1N2XA 2AYYA 3KPWA 5EERA 3U7FB 2FXVA 3KLOA 4V38A 1QHNA 5DYWA 3BKXA 5SZIA 3TR0A 3UZUA 5AJXA 3UPUA 1UK8A 2GBLC 4IJMA 3WAKA 4RVFA 2RGDA 4NDZA 4YJ2B 2IYPA 4IHQA 3FOCA 3GLRA 2J3HA 2NMVA 3M1LA 5EE5B 5FLXA 2ODNA 3U37A 4XVQA 1TLFA 1XEFA 2B9EA 3OZAA 4F1WA 1NGSA 3IA7A 3KB8A 4GQBA 3CF4G 4WKNA 5ALNA 2CB9A 2PN1A 1SR8A 5DYGA 1L7RA 3WRXA 4B0PA 2JAHA 3R5JA 1NPYA 2YN0A 2XR1A 1M1YB 2FWIA 3EVTA 1QFJA 3TQOA 4EFLA 2C4MA 3W5DA 4CIVA 2CCGA 2QG9A 3FDZA 2X23A 3MINB 3T0FA 4E22A 3UUEA 3EISA 2HU8A 4JEIA 4UVEA 4JLPA 4Z8XA 3UV6A 4TN1A 1T0IA 3G85A 2W43A 1RWWA 3AUUA 4KX5A 4OHWA 1JVNA 4C7OA 2QD5A 2NXJA 1CJMA 5IP5A 2HV8A 2W2KB 1ZNQO 3A2KA 3G5UA 3OE7A 1J99A 1SHZA 1MIOA 3LVBA 4AS2A 4F9EA 2YWHA 3BJMA 4QOEA 2I6QA 5DBOA 1MR3F 5CDUA 1R8JA 4XOIA 4BKRA 4DRXA 1UZUA 4ND2A 4QUKA 5JDCA 1XJQA 3DKRA 5CLIA 3DG9A 5F2EA 1M6WA 4MGKR 1Z6QA 2AE2A 3G2KA 2FEPA 3K9LA 4G25A 1YS6A 4Q19A 3S6JA 1EFPB 1TT5B 1RWKA 1M2VA 3M6WA 2YJ4A 3RABA 2VT6A 3ZBQA 3VYTB 3ZD6A 2B4TO 4AKTA 3PDCA 4NOLA 4NFLA 1H1LB 4UTXA 1ZLXA 2AD5A 1DV1A 5HFNA 4QAJA 5HFJA 4ZYTA 3OFND 2VZ0A 2FY8A 1N92A 1WUKS 2YZNA 1LS1A 5A5DA 4MR8A 4QG3A 3D4PA 4FGJA 1R6AA 3DLAA 2JLQA 3ZHCA 3FTFA 8ATCA 1ATIA 4MS3B 3BB3A 3BGOS 4RJIA 3CLTD 3GVXA 4G5GA 4G4JA 3SIWA 2Q1YA 1RSZA 3E9EA 4MO9A 4KOAA 3LT5A 2YFKA 1D4ZA 5LB2A 3Q0TA 4B3GA 1VPWA 2HRQA 2EKQA 3O9MA 4B6RA 1K9SA 3FJ1A 3DZCA 4JWTA 2YFQA 821PA 4RY2A 1KZ1A 4C03A 1JU4A 4J8PA 4M0LA 2WV7A 4BKQA 4NE9A 1Y3IA 2NACA 2HA0A 4DM3A 3QEBZ 1J2YA 2FPXA 4W5RA 5JBIA 3KKOA 4EGFA 3HDHA 2XVMA 2C9CA 3BSYA 3PUHA 4LJSA 1JS1X 1Z07A 1O58A 1O94C 4HR7A 4QYWA 1NLUA 5KQLA 3FPEA 4LCEA 4S1OA 3WAJA 2NZ2A 2VQ6A 2WI8A 3QIVA 1U9YA 4L9SA 4PLCA 1PU2A 2F4NA 5J9FA 2O8EB 1B73A 1X7XB 3BORA 3KBOA 2A94A 4A27A 4B17A 5JAUA 3VYSB 2CLEB 3G2QA 2W2OA 3RROA 4DLZA 5B1YA 5HXAA 5IN4A 1N7HA 1UOOA 2M9MA 3ELUA 3R09A 2GJ8A 3BGWA 3ILXA 2JFHA 3K09A 4YJFA 1AUPA 1OX4A 3P9NA 4NCJA 5MN4A 4PZPA 5JNSA 3DZGA 2CBGA 3P32A 4FMBB 1VE7A 4J43A 1RCTE 1ZIDA 4IJQA 1R6BX 1LPNA 3U7HB 4TYQA 2QWXA 1PQPA 3CNNA 4FGKA 4GYWA 2FDXA 4LV5B 3S7TA 3VKVA 4EL5A 3DW3X 2VJKA 3HDVA 3ITNA 1O5IA 1SD5A 3SXPA 1EK0A 3E5MA 3FLAA 1QV7A 4QXAA 3RS7A 2Y2VA 4DANA 1V3QE 1VG8A 2VXYA 1O9GA 3PNSA 1KI3A 2PX5A 1EHCA 1UP6A 1KBQA 2QTBA 5HDQA 3FRHA 1BH6A 4TV8A 2R3SA 1SUSA 2W6JD 2ZI7A 3QBEA 4KK3A 1ZVMA 4C0BA 2RHMA 4UM9B 1IXYA 1FFGA 2PMDA 4V0LA 2ZBVA 3CF2A 4NZNA 4R2KA 2PEYA 1UAAA 3EZ6A 2W6QA 2RGAA 3DOHA 4RZXA 4C22A 1YB1A 1DG1G 3FX2A 3HJNA 3S2UA 1PL8A 2XNSA 5AK3A 4A0GA 1EXWA 3WGKA 2MYUA 2HT6A 3AM5A 1MJFA 4TPKA 1V25A 3FNIA 1GRCA 3SMQA 3ANYB 4QXPA 2QQ0A 3W6ZA 4ZHQA 1MEJA 5KSYA 3PIRA 1BO6A 4NARA 4BX0A 1XU9A 5FPHA 1WCWA 1JPNA 1U9IC 4UBIA 2R1TB 4PLTA 2ACVA 4KWIA 1H9AA 4MUXA 2OCIA 2H7CA 1MW8X 2XNDA 5D01A 1GFWA 3HVKA 4UVHA 2EF1A 1XD8A 2FMXA 3JYLA 4NOJA 1NRIA 4TRRA 5J5CA 5TQ0A 4NLLA 3TTUA 1OA0A 2P62A 4P92A 1ZD8A 3OFSA 3GZNA 2HLPA 1JAYA 3AFHA 4JYZA 1KOJA 1Z2OX 4C5CA 5AM3A 1R0KA 3CB2A 3LRXA 4MNTA 4WNYA 3R75A 2WWFA 3O91A 1OZFA 4FKMA 2PS0A 2XYPA 2ATIA 4O4IF 2UUAB 4OM8A 5AM4A 2IHBA 1F4LA 2G6TA 3TD2A 4O3MA 4MQLA 4Z9FA 1N32B 1P1KA 1AGXA 1KYXA 2QMEA 3RVRA 4P5PA 4DRZA 2YDXA 2EIHA 1XTZA 2NSHA 3FN4A 4LKOA 2C5EA 3BIXA 4OYHA 4QRIA 5FWYB 3MYRA 1DTWA 2J7PD 1JKXA 1XK6A 3FOAA 2VHQA 4OGLA 1A8HA 1OKKA 4E2ZA 4IV0A 4LJLA 5HP4A 1NG1A 4LHXA 4L57A 1W36D 1DG3A 2SKEA 2ADOA 3GJ7A 3EQ6A 2ZSBA 4U5QA 3AHJA 4B80A 2PZ8A 1GPBA 2WVGA 4WN9B 1YRBA 5C34B 1CUXA 2XE6A 5FADA 1P9OA 3RANA 3N75A 4F8JA 1ZVJA 3QKIA 5ALYA 3SAJA 4F4CA 2H2GA 4G5QA 2Y1WA 4CQLB 3H1EA 1Z33A 2Q0QA 2Z58A 3L0BA 3PDWA 1S5PA 4BQNA 2WJVA 3V6MA 1JAZA 2HSWA 1XFAA 2RGGA 2Q62A 3LDUA 4YP6A 2I2CA 5HBRA 2ZXUA 4BHTA 3SQDA 3GGGA 2VTBB 2P6PA 4ER6A 3NYIA 5E1MA 2IF2A 3MCWA 5EIBC 1DIRA 1RW4A 4GKBA 1XVIA 2WYIA 1NMQA 1JR3A 2OUKA 3IMCA 2BI7A 5B1DA 3QF7A 3U3OA 2HL6A 4HC4A 4ZAZA 1JEYB 1B1AA 3I32A 3I52A 1T8TA 3NFRA 4IO1A 5B1SA 4F3KA 1OLUB 1AZTA 1Q0RA 2CJXA 3OFKA 3ZLBA 2QL5A 1AGRA 4YI3A 2HB6A 1CR0A 1MG5A 2CXXA 4A8HA 1O9HA 2GEJA 2J3DA 4U7HA 1PV1A 4A73A 3JAMA 3FZQA 1M9NA 4AIIA 2C96A 1QYDA 1BU5A 4QUAA 1Y6JA 4RUKA 4ZYZA 1A4UA 4FYJA 3T34A 1J9GA 1UFKA 3BMCB 3ZDRA 2F3UA 4LDNA 3WADA 1QIEA 1L4BA 1KRXA 3PC8A 2ZBQA 2DFVA 1F1BA 4NXNB 2C2XA 1NASA 2KE5A 3ROZA 1U8YA 1VIVA 4JJKA 4ML3A 2J3QA 4Q47A 3C3MA 2ZETA 3FJOA 4UHFA 4ZRDA 5HS4A 2O0KA 2HCFA 2IYFA 1FEZA 5IF3A 2Y1GA 4QARA 5EGSA 5IXYA 5JSYA 4EM6A 4WNAB 4AJLA 1DJMA 4IXNA 1OSNA 4L2IB 5AESA 1SUFA 1LK7A 3H0CA 4HYEA 2XZDA 3FLEA 4ZCQA 1XLTA 2IOFA 3W05A 3I1JA 1ZGCA 1OAOC 2HJRA 3IP1A 4RDHA 4IMRA 3C85A 2WYHA 3DZFA 3NC0C 4O4IA 3SBXA 3TRIA 1H0KA 2BMVA 3LP6A 1D4FA 1KXZA 4IPTA 1ZH6A 2PS9A 3JPYA 4UDNA 4EKDA 5JHGB 3QE3A 4PN7A 3DHWC 4MIEA 2OZLB 4O33A 2Q5EA 2GAIA 2ORED 3M0EA 1KY2A 3VH2A 1PT6A 3PU6A 5L53A 1AQLA 2R4UA 2JJ2A 3CW8X 5JYEA 3L6RA 3AZOA 2BFOA 4HGPA 1HM5A 2VPPA 5JQGB 5LMCA 3B5IA 3CNOA 4YRDA 3GLIE 1MB3A 2EFDB 5FTLA 3SEZA 5HQJA 4O63O 3ZD9A 1A5ZA 2Z2XA 4P7BA 5FI5A 1GU7A 1RTTA 3FVTA 1RU3A 1R8SA 5NLLA 2O6LA 2YWRA 1E5LA 4EG4A 3MT8A 3VR6D 4KPYA 2XUIA 2CHEA 4GX1A 2V8BA 2BE9A 4LA4A 1QYXA 3KFVA 4EO4A 2IIQA 3GGJA 2CHQA 3KAPA 2FW1A 4C89A 1VA4A 2CL7X 5PNTA 3EODA 4UTRA 4O6VA 2VRCA 2E3JA 5FHRA 4TV9F 3U5TA 4OLHA 1J21A 4U7GA 2YMMA 5KYWA 4BXOB 3QHAA 3CKMA 1OIVA 1NA5A 1KAGA 2H29A 2XXBA 5EMNA 5ER9A 2NGRA 2Q21A 1UMCA 1H9BA 1ZUWA 2WHPB 1JDZA 1N5MA 2XUHA 3ANXA 4YBRA 4EHIA 1A2KC 4HLUA 3JY6A 4XQEA 5EPUA 3RYCA 1U90A 3QUAA 4BNKA 3PKIA 3PNMA 3AI7A 1CLUA 4ZQHA 3HJCA 4CM6A 2YR0A 1RRPA 3LT4A 2FFAA 3WYDA 1TQ4A 2HRCA 4EHDA 2E6KA 2XE7A 1H8EA 1VCIA 3GH1A 4RKEA 3WGTA 4CETA 2OFPA 5IFKA 1V5EA 3DDZX 4GQAA 4BKOA 1GILA 5D85A 5K05A 3KQUA 5K6AC 3K6SA 1S3GA 1Y3BE 2H1LA 1AZWA 5FOUA 2I2WA 1WCXA 1QYRA 1KZ7B 2HRDA 2YIMA 3UC9A 1V43A 5E4FA 3WVNA 1GIAA 3A0RB 1RRFA 3DBRA 3EY4A 4UU7A 5KVAA 1M2VB 2V7PA 5EJMA 2VQSA 1AS2A 1X1SA 2FQ1A 2TMGA 1E7SA 3ASYA 5JT1A 1LTQA 1DWOA 3THYA 1BOFA 1PNTA 4N7MA 5DT2A 1CEQA 2H2FA 2IPMA 3RBZA 3E53A 3T3HA 4AT1A 4C7XA 1GM5A 3RC3A 3T7TA 1SKMA 4CIAA 3WBFA 5JZMA 2DTDA 3UXMA 5F2OA 1WS6A 2QE6A 4JUFA 3L6EA 3QXXA 3KFXA 3BB1A 1JRLA 4QTZA 2AW5A 2YNMA 4RH3A 2GPSA 3OHPA 3QVTA 1YHZA 2C29D 4JJ8A 4UMDA 4IILA 4NVRA 2UU9B 2ZAYA 3ZEAA 4ER7A 4YR9A 3HFJA 4GX2A 1WMEA 3JWHA 2OWDA 3F7OA 2GXAA 4H18A 2D5LA 4O4JB 4R6XA 1H0RA 2I71A 2F7SA 3K6RA 2Q5JA 3KS9A 3IRVA 1Y37A 5TPZA 3WIDA 1ULZA 2ZGVA 1AQIA 3K0CC 1RJ9B 1NOKA 1V0JA 4A8PA 3E61A 4J0GA 3AVTA 1M1YA 1GAJA 4XX0A 4E7OA 4LFCB 1N9ZA 1ZRHA 4O2AF 1LH0A 2WEKA 4LE2A 2ZRBA 1PZFA 5F23A 3MXTA 2ZSFA 1TQ6A 2FLKA 1FFWA 3EQ9A 4GOXA 2BTEA 1A4XA 4JKOA 2J0UB 4GXNA 1JQ5A 2GBGA 2F64A 4OHMA 4E5PA 1HSOA 2FSUA 3RFUA 1ZL2A 2BSXA 4IW3B 4O5AA 3OIDA 3E82A 1DKQA 1N9GA 1ZVQA 2LCIA 3PFCA 3E0XA 3Q3VA 3UFBA 4CL8A 2F48A 4WOBA 1G3UA 1A76A 4IRUB 2XBUA 2LDBA 3ICQB 3ILHA 2QKYA 3PI7A 4KE6A 4PSAA 5DM0A 4EHJA 1AMUA 4LRUA 5KVQA 3FNHA 2AR9A 4PHTA 3RYFA 3P1JA 3W1WA 4A8JA 5KDDA 2OMEA 1NVTA 3O9VA 1GNRA 4MYCA 1HNNA 3IMFA 4D0SA 1DEHA 1ZIXA 4ZIRA 2ETVA 1R0YA 3T54A 4CM1A 3EFEA 4NOMA 2DLDA 4HFJA 3GJ8A 1N6KA 3B3FA 1XRQA 5H68A 3KLNA 5JDIC 5JATA 3TLCA 2FR8A 3INYA 3OU2A 1LV8A 2ZUCA 3GJ4A 1OXKB 4TWBA 5AOCA 2QAGC 3ZQ4A 3PRJA 4GSYA 1NP6A 1NJSA 2A14A 3UJPA 2IHVA 4AG6A 4CM3A 5L8VA 1IBSA 1KNXA 3LYHA 2PCLA 3R7AA 3PP8A 4WOKA 2GFQA 2QAGA 3N8KA 1N2ZA 4MV8A 1T24A 3KD2A 1FSGA 2W48A 1FJXA 4QQRA 1ZD4A 3DF9A 3RUPA 4LJRA 3QFFA 4REQB 4BAUA 4GNKA 4H1HA 5BYKA 2D1SA 1U3TA 2B0JA 1JLMA 4AY5A 1QYIA 3ITDA 2RI6A 4HH0A 1Q17A 3DEAA 3EIUA 3OJWA 4F2GA 2BFCA 1KVTA 4HY3A 4DNFA 5E9JA 4L6IA 2CLHB 4A2WA 5BNTA 1RAFA 1A4RA 3C6QA 3Q72A 2L0XA 4ODIA 4JSTA 1WRBA 1CUHA 2DPGA 1T2CA 1IG3A 3JYQA 3N2GB 1EZZA 3OWOA 2IP2A 4LHSA 4DG5A 3NVKI 2X8WA 5E6SA 3S5JA 3F49S 1IJKA 5AI5A 4JT8A 3RC8A 4U39A 1E62A 1PJBA 5AKEA 1MW9X 3GG9A 1EWKA 1MDFA 1P74A 1U31A 3COVA 4GX0A 4KUEA 4OPMA 1G9TA 5ALUA 5EJFA 4NH4A 1UKAA 1TD1A 2EX4A 1N78A 3AJAA 4MGYR 5DN9A 3ETDA 1P0IA 4XM0A 2H1VA 1K6JA 1SKUA 4MPPA 2UXDB 3P0EA 3RTEA 1KMQA 5BN3A 3KJXA 2JL1A 2DHRA 4KK4A 1DQZA 4P36A 2C42A 1NR7A 3U1BA 4YJFB 2I76A 2B5OA 2ZUFA 2IGBA 4HAZA 1D03A 4P7KA 3ZHOA 1U8TA 5P8WA 1YCHA 2ZYDA 2P2DA 1Z4KA 1Y6QA 5ARDA 3ANLA 3N05A 3LT0A 1U11A 5JCOA 1BHQ1 4BO5A 2P7HA 3BQ9A 1G2OA 1P3JA 1SZJG 1Z13A 2NU9A 3GRRA 3PXBA 4WZAA 1BE8A 1FDUA 2KBFA 1NW8A 2QAJA 3CWQA 1VFPA 1ZWLA 3WWEA 4DNXA 5IBCA 4KREA 5TT1A 1SCQA 4ZEXA 4G6ZA 3C87A 5IYZA 2LE0A 5HUQA 2I0FA 4DB4A 4WH0A 3WK5A 1PYDA 1U2GC 2P0YA 4D79A 2GEBA 4TVBA 1MZVA 5E6RB 3W2TA 3OTWA 4P9NA 2OHGA 1Z7EA 1L5VA 2VHXA 3T95A 2W5UA 3G8DA 3GIWA 5BO5A 4A26A 1XZMA 3D6UA 5C1IA 3GJRA 5CDFE 3IDAA 4DR1B 1DJLA 1GD1O 1GLVA 3IUEA 1E20A 4LHYA 3VR3A 4DIBA 4JYAB 5I3CA 2D3TA 1R16A 4MZDA 1P0QA 4BC1A 4NZYA 5EPEA 2JAPA 2ZRMA 4CCYA 1POWA 4MUKA 2CC2A 1CE8B 1JSZA 3HCAA 3M6MD 1VMAA 2JI6A 4KE7A 4RY8A 5BSKA 1JALA 1DIAA 2JFBA 4MUEA 10MHA 1R0ZA 1NBMA 4AUNA 2JCSA 3G7NA 1BD3A 3VVLA 4GOOD 4B85A 3L1VA 1B0AA 4WOPA 5HEKA 4EJFA 1MO3A 2NSJA 1E0JA 1PJ2A 3B1WA 4QNNA 4KDRA 2TMYA 4QOJA 1GPLA 4YMLA 1F12A 3ID6C 2PL1A 3PHHA 4TYWA 3NS7A 3DD5A 2KW5A 4GHWA 1DTEA 1WSDA 5C5CA 1M6YA 2RH9B 5B5SA 1O7JA 2VJMB 2VUIB 1T3TA 5LBTA 5BQXA 1I01A 3HL4A 3UM9A 5KJEA 3H99A 1YZFA 1PFVA 1IQUA 2BMAA 4IVNA 5AKJA 5JS1A 4MUHA 1EFRD 5HJ5A 1XQ6A 2ZRGA 4FFLA 2OZVA 3R3UA 1YZHA 3RNLA 4CCSA 2CXTA 4JXKA 4RLFA 3DDWA 3CF0A 5DP1A 5FPKA 1YQGA 1XXHE 2J07A 3FZEA 3IUPA 4QREA 1FMLA 1GZDA 1KY4A 3IXMA 3T3PB 3B7GA 3DOIA 4N3GA 4MLCA 4F6RA 4BY9E 3G89A 4NHOA 1FXSA 3ZD7A 3CLVA 2Q6TA 1MT3A 2FSPA 2GEVA 4ZAXA 3P2IA 4B9AA 2VP3A 1AK2A 1RRVA 3I9MA 5CLLA 2BEKA 1VYHA 4J0EA 1XPOA 3U26A 1ZBQA 4JX8A 2X1VA 3FYCA 4DVGA 3KR2A 2MHCA 4U8GA 1HDIA 3K8OE 1AC5A 3L6CA 4YVFA 3QENA 3AVPA 4OA8A 1YQTA 1Y3CE 3AHGA 4HNQA 3ESZA 1H8HA 4IGAA 7MDHA 3K0SA 3WB0A 3L6DA 2XKKA 4Z4GA 2AG8A 2AJLI 1XUOA 5JNTA 3K9WA 3BWYA 1RLUA 1Y9ZA 4NG4A 4NU0A 2WU1A 2Y92A 3PTZA 3UT5A 3MHTA 4PGHA 3FTNA 4ZA2A 1VKOA 1XDDA 2GZ3A 1EE2A 3MJDA 4HQ0A 3AKYA 3VUEA 1RLJA 3HCCA 1EXDA 1F06A 1K8XB 4KOEC 2NVOA 1Y5LA 1PR3A 1JF8A 2GNPA 5AHWA 5AVKA 3CUSA 1C29B 1LSSA 5KYUB 1FY2A 3C5CA 4BAGA 1C0LA 1LBEA 2P9CA 3GCGA 3I05A 2V7XA 3I2GA 4OGWA 1THGA 2FZVA 3HCFA 3OZDA 4WBNA 4Q3NA 2OXIA 2BF4A 4PS0A 5KQPA 1S3SA 1BG6A 1RVV1 4BZQA 3ZJ5A 1H5NA 3OTGA 2FSSA 1J2UA 2AJBA 2ROQA 3ZWQA 4N3BA 1ZONA 4KRGA 2FZ4A 1PR2A 1R5NA 4EYEA 4ASUD 1T5HX 2X3FA 2ZT5A 2M6LA 1EA7A 3WWCA 1OASA 1YVEI 1UFQA 2GLXA 3V8BA 2QMQA 3CW9A 5KQGA 2VDNB 3E8MA 1UZAA 1QYVA 3U7RA 1DC6A 1TGVA 1XMOB 3LHSA 2ZCJA 1VL6A 3X1YA 2HK6A 2ZZNA 1IXKA 4PFJA 4RC9A 4J4HA 4BLSA 5GZ1A 1CJTC 1NNI1 3IQFA 1N2OA 3UK6A 4YXWA 1XNHA 2IXDA 3ILYA 1D7OA 2CNNA 1P3Y1 4GBMA 4JYBA 4L8WB 4Z4IA 2PYZA 1U1GA 1NLZA 4LQ4A 3GGOA 3M89A 3T7JA 3EXHA 1MEEA 4IIJB 1CVLA 4XFKA 4N41A 4ZI7F 1SCAA 2IZ7A 3NLLA 4Y7CA 2R96A 2ZBGA 3F2IA 3VU3A 3OZRA 4K9NA 4RW0A 1GL7A 2XVYA 4U2KA 5GPBA 3FVWA 4FYIA 5CB0A 2NUTB 2FVXA 3ZBUA 3V7NA 5AUQA 3NEJA 4NP6A 4RU1A 5FNVB 2FQWA 4E11A 2FMKA 4NFYA 3X3HA 3IUMA 5FHQA 1S3IA 5THXA 4I5FA 5AFSA 4TZ0A 2Z1DA 2R97A 5WRFA 2CL5A 3HNOA 3HB5X 1C3OA 2Y67A 2Q46A 1L5HB 1U7OA 1BCRA 3R5SA 2V1UA 2YQ5A 3Q3CA 4G81A 1UPUA 5J58A 2XMCA 3RKRA 3PX7A 4CV1A 2XB8A 4YQYA 3U3MA 3IP3A 3DOEA 1DINA 3IIEA 4W5NA 4C6SA 1N6HA 3UT5B 3MTBA 8GPBA 2CJWA 4IFIA 1LLDA 4QTUB 1T2DA 1Y89A 2HT1A 2A8YA 2XNKA 1AM4D 2JH9A 4PZ9A 1GLNA 1FYXA 2DUNA 3EMVA 1H5QA 1RHUA 4P7JA 1GG8A 4ID9A 3A04A 3GMTA 4B7UA 4OYRA 1E2MA 3OO0A 3OKCA 3WB9A 3CXRA 2H85A 2HXSA 4PBSA 5AK4A 1DKRA 2BWJA 3JWGA 5TQ2A 3MBKA 1W36B 2WF8A 1MJGA 4E46A 4N12A 5I47A 3H75A 3R7WA 1H3EA 1S01A 3F46A 5DB4A 5ES4B 1A5SB 3TIFA 4I1VA 5IJXA 1K1EA 1N2JA 1X7HA 2OQIA 3I8XA 3OFNA 1EUCB 1BQ3A 1IBLB 1QXSA 4NNOA 1ECCA 4JXJA 2ZYHA 4UE6A 1AKEA 3SZLA 1QKKA 2BMJA 1ULHA 1PJLA 1TF2A 1YR9A 1WXWA 2C3UA 1RYMA 2Z2JA 1T10A 3AR4A 5EUCA 4ZCSA 3WJ7A 1M0EA 3D4LA 1EHIA 1UMDA 1Z6GA 1RFLA 4J2TA 1CUUA 2G4CA 4N48A 5K03A 1D2HA 2Y66A 5F3RA 2WIAA 1YB7A 4N39A 4BNWA 4YHBA 3EXIB 5CHEA 2FI1A 4B1FA 3OUZA 3QIAA 4R84A 3RU3A 5AKYA 1FC0A 1GVHA 1CEXA 3B1JA 4MB2A 4U6QA 4F1KA 4EJ6A 4ZTUB 1ZUNB 3NIGB 4OX9B 4N5HX 1N2SA 2B92A 1N57A 1A5TA 4M49A 5F1KA 3SG0A 3VH3A 4DDTA 4D4IA 4KXYA 1EG7A 1PSZA 3A6ZA 3WTBA 2X0IA 2CB0A 2P9YA 4WY8A 4LZZA 4RXTA 3HVRA 1T3HA 4OKSA 3A1UA 5BPHA 1U9IA 1GJRA 3IUQA 4G8JA 1RXEA 2QS9A 4I6JA 5EI5A 1JKJB 2J6IA 2BSAA 1Z28A 2GZSA 5FEMA 1SUEA 4RCVA 3SC2B 4E5VA 3PUYA 1NVWQ 2R65A 2WD9A 3HUDA 3LUCA 3QPAA 4IEIA 3LYAA 2K7FA 3PEEA 4N5LA 3RRJA 1GA1A 5EE0A 3N59A 2I8CA 4Y6RA 3K96A 1YE8A 2X3UA 3OURA 1EAMA 1Y8RA 2FGKA 1GITA 3VKGA 1Q15A 4R40A 1Z68A 1NKVA 4XVCA 4KSYA 2JLVA 3Q7EA 3BL6A 5EKDA 5JWHA 1N7IA 1OTHA 2C7VA 1O0BA 3SJUA 1G21A 2DFTA 5AI9A 1GG2A 3VSEA 1HYHA 1TYAE 3AU9A 4RHEA 3BFXA 3CRVA 2AZXA 2AN3A 4MJ7A 4BO7A 1KWKA 2DVMA 2E4YA 2HWKA 5A1TA 1A50B 1JPVA 1NV9A 1M3SA 4CTKA 1ZAYA 4GOJA 5ICMA 1LPAB 3KZCA 4C0XA 2ZYWX 3CX4A 4H4EA 3VU9A 4HZUA 1XWIA 4LVOA 4NCKA 4GPTA 5C4IA 1PWZA 4EF5A 4RTRA 1PT5A 1E59A 1TMOA 1Z5UA 4CIDA 2F1KA 3VNUA 1M76A 1C0PA 1NN3A 3QPDA 1LJ8A 2D2IA 1A5BB 1EWTA 3VJMA 1X1CA 2ECKA 3AUTA 1X7WB 4DBZA 1CY7A 1M83A 4L6CA 2A6PA 2EKDA 4YJ3B 1EJ6A 2O0JA 5KINB 4TSFA 4UBJA 3L0OA 1GKYA 1KI9A 1O0SA 3O1IC 1POXA 1NR5A 2KBEA 2Y0EA 4V3BA 3UBTA 5AVOA 3EOZA 5AXCA 1J1ZA 2QY6A 2VUHB 3L8MA 2NYRA 1D2EA 2I9KA 1QH8B 5BV7A 4IGIA 3J7TA 3ZV5A 4NJEA 3MGGA 2J3LA 4X71A 1A97A 1C7EA 2R6ZA 1SUCA 1XCOA 1BXZA 3JWEA 3VDQA 4KPEC 2FX5A 5C7IO 1G38A 3MUOA 2WB4A 1K2WA 2WWXA 1MGPA 2HW8A 3KJZA 3PQ6A 4L74A 1G5IA 3KZXA 4ZRNA 3AERB 2YIJA 1D1TA 1E1YA 1MV5A 1DAPA 4I4IA 3IERA 3QVLA 4V0MA 3G2MA 1AY0A 2EC5A 1ECPA 4FHFA 2BEUA 4RF2A 4X44A 3I61A 3N2GA 3O4FA 3AFMA 1ISRA 1FS5A 1V9CA 4BO3A 1OCEA 5KCMA 2BGWA 2WPDD 3OZFA 3UO8B 3O4JA 5L3QB 3CNQS 3V4SA 4Z0PA 4ZQCB 4J7XA 4CM8B 5C1DA 5C8DA 2CMDA 2V6JA 4NAVA 2J09A 3W3AH 2JGAA 4CLRA 3TLKA 1CD5A 1U9ZA 2KX7A 3L7MA 3K7EA 3NHKA 3QOFA 3PDIB 4V2UA 3D02A 3KSUA 4BECA 4MROA 3QJGA 3U6KA 2CL6X 4QC2A 1H3FA 2R7KA 1BE1A 2RGWA 1A71A 2W2XA 4CMAA 3R6DA 2WAOA 5FNZA 4JZKA 2IV7A 4EG0A 1IPFA 1FQOA 1WQ4A 1XDWA 2ZQYA 2FOLA 3FFBA 3QSGA 3NHRA 4K9QA 1B14A 1Z7GA 3NB0A 3K8QA 2UVQA 4TMWA 1U2DA 1W2GA 1VBFA 3JARA 4CHGA 1GTRA 5EHXA 1L7XA 3CSDA 3PJGA 4UQLA 1QAMA 5L3VA 2WC1A 3BQNB 1SXHA 3BE8A 3E35A 1NX6A 3L4BC 3MJSA 3HJUA 4LC9A 4PZAA 1NJ1A 4EGAA 1NM5A 3H8JA 4YWJA 3DFFA 3HNPA 4J0DA 3ORQA 1C1XB 1XF9A 2PE5A 4MI1A 3B2EA 4ZT2A 1GEGA 2WMDA 4JLSA 2EWMA 3II6X 3KQOA 2XI4A 2A1IA 3MGCA 5EIFA 5ALZA 4CLOA 5JZOA 4D9NA 3M9LA 1H66A 2IY9A 2WWRA 1WJGA 1IN4A 3RE1A 1ZRNA 2BFNA 4OBXA 5IDVA 1KBZA 2XCQA 3ZGVA 3AKZA 1KIMA 5D5HA 3VMMA 1Z83A 5JRDS 2Z1NA 4YMTA 2PIAA 3DZDA 4CFZA 1UC8A 5I5EA 1ZHOA 2ZT7A 4YCMA 2I67A 1L0BA 2P9QA 3RSSA 1D7AA 1T13A 3L4KA 1IDOA 1NI4B 4C87A 1O6BA 4YRPA 2J0UA 3IQIX 3BMNB 3LC1O 4W4TA 2AEFA 2PSEA 5F4ZA 1DAMA 3S68A 2F3SA 4BX3A 2F9LA 2ADFA 2VLIA 4PE5B 2NZ8A 3GEPA 4DXHA 1U28C 1UKCA 3KZVA 4EAQA 4C3UA 4CEJB 1A9TA 1PJ8A 2IXAA 2G5TA 2EWVA 1ANKA 3GHHA 1MHPA 3LQFA 2I8LA 1B0UA 1NHGA 2RHGB 3KELA 4E4YA 1CRPA 4PEVA 4XFDA 5HCIA 3W7VA 5KAMA 5KVCA 3CM0A 1R1DA 3BH0A 2O2XA 4QVIA 5HM6A 3MRVA 4QYTA 3CLTC 5HA5A 2HF7A 5CVEA 3WKCA 3EYWA 4GPD1 3K72B 4YP1A 3RFXA 3ZE6A 4FGSA 2QJFA 3E7PA 5FEUA 4OGFA 1L5OA 2QY9A 4C4YA 4MTCA 2W6ID 4BQOA 2IH4A 3QEJA 1L1RA 1Y6RA 3LT2A 4JGGA 3TMKA 1P0FA 1XPRA 1NQAO 3BIJA 1T8WA 1PT8A 1NW3A 4D92A 4PHHA 5CLQA 4ADSG 4BIIA 2CJFA 1U3UA 2JGRA 3H05A 3MMSA 2JJ2D 5G40A 3N7UA 1QG2A 5TGZA 2C4UA 2HEGA 1FTYA 1YULA 2EZ9A 2NADA 4A0FA 4EVRA 4YQFA 5COAA 5FI0B 2PSDA 1OKKD 3N28A 3CUVA 4MGIR 1Z36A 4NYMQ 4NMLA 5A5GA 3T9EA 3L6UA 4CQJA 1NVAA 2QR3A 3R23A 2IS2A 4D8XA 4UEOA 1U3CA 4Q3KA 1FW6A 3O26A 1JTEA 3SEFA 2X0JA 1F2TA 1CJCA 2OFXA 1KO7A 3F7TA 3RVJA 3AEQB 2OG1A 2ZRJA 3F5FA 3TE6A 1HT0A 1RM3A 2GN6A 1QH1B 3GRFA 2BKVA 2NXEA 4ZYLA 3KSRA 2NVWA 1XQXA 1DKNA 2XCRB 2QGZA 3TLGB 5IH7A 4D4GA 4TL7A 5CA0F 1YTLA 3BDAA 5FFFA 1V71A 1AT1A 2XMPA 2GTIA 4DLXA 4LQCA 1BOOA 1K4YA 4G85A 1R5BA 4TTIA 3D6HA 3LUGA 3THXA 1OYWA 2CE2X 3ZE1B 3W6UA 1E5DA 3CNHA 1I9GA 5HJ7A 2EOAA 3O8RA 5CHYA 3LCRA 1XRSB 5EWMA 5EQJB 3MLEA 3CKYA 2GN9A 4BFZA 1KI1A 1VHWA 3VC2A 2E5FA 2G9NA 5FORA 1SCBA 4TKLA 1T4MA 2A0WA 1SG6A 2L19A 3K9GA 4EUEA 1KSJA 2WU8A 1HG1A 4YAOA 3V4VB 2Z8YM 4BB5A 1GL6A 1WMBA 3ISJA 4LYFA 2NXNA 1ZJWA 1I6LA 4V2IA 3AESA 4ZCPA 3L0SA 3UQZA 4YLYA 1YDFA 2PR7A 1U7UA 3FOWA 3UUGA 3VR6H 1WTAA 1FFXB 3A58B 5LN1A 2D1RA 5LZ9A 2QNIA 2CW5A 3S7ZA 1ZXLA 4D3DA 1L4GA 3VC3A 3H5WA 4IDQA 4X6UA 3SY8A 3BIOA 3SI7A 4AI6A 2B20A 4U9HS 3RT9A 1XQYA 1V7CA 1YA4A 1P80A 3OJCA 4XM2A 4JEMA 3PQDA 2R6JA 4X1YA 2WJ6A 3FYUA 3HUUA 1Z2CA 1VB3A 3AOGA 5A6SA 1DOZA 5IWCA 1XCGB 4J0FA 3TK1A 3WLRA 2P68A 1QG4A 4QULA 1KH2A 2PYIA 1MNQA 1SBIA 2YJTD 1QF9A 3VTAA 4CMIA 2PXAA 2NIPA 2ZRKA 1E63A 3I2FA 1EA5A 3IO5A 4AY2A 2CXUA 1CY8A 2DFLA 1XQ9A 2KPOA 3I72A 4KQGA 5F5NA 1SA0B 3PC8C 4RSRA 2N46A 4PU0A 1R4AA 1JE0A 4WE3A 1OBVA 3EN0A 4BRWA 3DE0X 3EXFB 4Q00A 1XEAA 4BJ5A 1QK4A 1ZAKA 4QJIA 2AN1A 1WD7A 2AHRA 5KMGA 2HLHA 1GARA 4BNFA 2BHTA 4QYSA 2V97A 2VJPA 3Q9SA 3S1AA 3WISA 4YAGA 1PLLA 3MCZA 4G5YA 2Y99A 4Q01A 1H2YA 3A3YA 3TE7A 2YWXA 4MLZA 4UHEA 4M87A 4KQWA 3NIFB 4NBSA 5H02A 1NNEA 3CX7A 3L4BA 4EDHA 1EWVA 4IXTA 4D02A 1G18A 1SBZA 1X7YA 2A9OA 3IBFA 2BJHA 2N1BA 3QSYA 2JFFA 4IRXA 5DMXA 1XTBA 3UMGA 4TXHA 1KDTA 3AP1A 5HF5A 1VJ0A 2CVHA 3WI7A 4DDWA 1YONA 3FWKA 2Q8NA 1X42A 4RMJA 3DH0A 2POCA 2WYVA 4YUAA 2ZAGA 3AUJB 3DAYA 3FMPB 1QG6A 2HMAA 1JEYA 3LUKA 2ATXA 2ZB2A 3I53A 3QNUA 4YCLA 4NS4A 3ZDDA 3KLBA 4IDNA 1NAHA 2FCAA 3FRJA 2VUSA 3C3EA 1XR3A 4FE4A 4RPJA 3BWMA 5DVZA 2QPAA 3CVVA 2NZYA 3PGMA 1AB6A 2WHRA 3QV1A 4FYHA 3G9TA 4JIGA 5ILGA 3ZU2A 4D0GA 1NI5A 4UM5A 3WRYC 2Q4OA 3HG7A 2B82A 5CH3A 1P18A 4TMKA 4ZEVA 1BWPA 2A9RA 2NQ8A 4N65A 3W2GA 2DR3A 4GL4A 1Z2DA 2OECA 2QLNA 2QR2A 2Z83A 1YZUA 3KVRA 4IJUA 5ENZA 4BWVA 1FU7A 3FNBA 3WRXC 1H2HA 5DNUA 4MOWA 4Y1RB 4X6LA 4HWGA 3U19A 4K81B 4R0NA 4FN4A 4MVJF 1L2TA 3ZV3A 4FWTA 4N9WA 1ZDMA 1XVTA 4K3UA 3COYA 4WN9A 1COZA 1JQJC 4KPUB 3IV9A 4KQJA 4DUZB 2IYUA 1FRFS 3SBDA 1OH6A 3PFWO 1V11B 2PIDA 3COPA 1I3KA 3F47A 5EUBA 2AIRA 1COWD 1WDTA 4NJMA 4NFHA 5JI3E 3UJNA 5I9TA 1CUIA 3GRVA 5FWYA 2W93A 4HNSA 3BG5A 4O3FA 3U3XA 2DY0A 1AKQA 1TKRA 3BWBA 5K51A 3ZH9B 1YBFA 1DQPA 2OP1A 3DJFA 4FE7A 3OTOB 1UXKA 2UYCA 1YJBA 3PNBA 2J31A 4RQBA 2QTTA 5TSDA 2FZGA 1KI6A 2I80A 3E84A 3IAUA 4JB3A 4Y0AA 3TWOA 4CNQA 2OZEA 3IALA 1OTXA 3WRWA 1TDJA 1T1EA 2FPWA 1X19A 2W8BA 5I7RA 6NULA 5JG7A 5EIXA 1QRUA 4JI2B 1Q1NA 1BYIA 3OX3A 5SICE 4HLCA 1AKNA 5CDYA 4UUAA 3ROPA 5BR7A 1E66A 4W5QA 4WUTA 1ES9A 3QPVA 4YK7A 3G2HA 2VYVD 2IZZA 4BNDB 1CW2B 4BGEA 3IBSA 3LLUA 4JJIA 1NN1A 3CHYA 5GJWC 4G89A 3SHVA 3ZU5A 5JS6A 4MV7A 1UDAA 1IY1A 3R77A 2VK2A 1KJJA 3L84A 5E4YA 4N18A 4IOLA 1C7FA 3GLHB 1FXWA 4G0PA 4QOFA 1CDDA 1L5KA 1Z5WA 5LMUB 3EEBA 3TMAA 1OYOA 1TX4B 4OQEA 1Y1LA 1YL5A 3JQBA 5K3CA 5L3QA 3A6PC 2YXNA 2RI1A 1XHEA 3FZNA 1MVLA 1L7BA 3Q11A 2PMKA 2HO4A 2H7VA 4OXQA 1LW7A 4UPEA 5JNRA 3UGTA 1A9PA 2B1GA 3SYMA 3V1KA 3O8OA 4FINA 5IRCD 2HXYA 1CZLA 1ML3A 2YWFA 3EEYA 1EYZA 3D4NA 5E4JA 3W3ZB 3PKJA 3L1UA 4G0OA 3EOBI 4HAOA 1SXJB 2CV2A 5A4FS 4HDRB 2X8JA 3I04M 4IXMA 5IT4A 4GPBA 2W0SA 4TKVA 3V7FA 1C0KA 4XW2A 3ESQA 3NC1C 1J20A 1GV0A 1JWBB 4JUBA 3WIEA 1D8TA 2IXBA 1PGPA 3ZTYA 5KSOA 2AC7A 4I3FA 1C81A 1X94A 3DONA 4UAGA 4CVNA 4P80A 3TQIA 1JYFA 2RONA 3OX1A 2X6QA 2AFHE 5I9NA 2C0CA 1X9HA 4BCBA 2PRIA 4K9PA 1E6WA 1QCYA 2H08A 4DNOA 4GGOA 1E7QA 4KL8S 4PAWA 2NZVG 3EDYA 4WLNA 3RS5A 1MMFB 5TMBA 1UPCA 4F4HA 2RHRA 1W52X 2H6EA 4GKJB 3UUWA 2P4HX 3DAGA 1X7XA 3DJYA 2WVAA 3L7DA 2Q3BA 4MRMB 2E6UX 3IHKA 1LEHA 2XEDA 1IATA 4NPAA 2WUGA 4AZTA 4DJJA 4XVHA 1IPEA 2OOSA 1DXHA 4CG1A 4HH3C 4DEXA 1W88A 1W87A 3FGZA 2XDAA 3QKRA 3DKVA 4LC1A 1R4MB 3IIIA 3U7QB 3PS9A 2UDPA 5I8PA 5KYGA 3AB3A 1N3BA 4X45A 3H5VA 1LW6E 4UHKA 3QBVA 3PNKA 3RYIB 4GGPA 4URVR 1MPTA 5D1HA 4AO6A 1BKDR 2YVLA 3Q7PA 4JP2A 3FSEA 3DM5A 4KUHA 5K0EA 2G07A 3QKSA 4Z53A 2HPVA 3MWKA 1L4YA 1Z8HA 2NV0A 3JATB 4RY0A 1JIJA 4PAOA 1AO0A 4CLXA 4J7CA 3DVSX 1RPJA 4MIKA 3OPYB 3UB2A 1E2HA 2C95A 2IYQA 1QQBA 2HWXA 4JL6A 2J6CA 1E9VA 2J3EA 1Z0JA 4ZO9A 1O1YA 3UJ3X 1CUEA 2CHUA 2MSNA 3MTGA 2GBLA 3LTEA 2B2NA 3NTUA 4F3YA 1MKYA 3T9AA 3P7MA 3IV6A 4QFCA 5J2TF 3ZR4B 2Y05A 1IOZA 3UOGA 5HJEA 1DRJA 3K70B 3Q8XB 4W5JA 3D64A 1H1LA 1YIOA 3MWDA 3F4KA 4YDQA 1T4CB 1FP6A 3HPRA 5DSTA 3AF6A 2ICAA 1ECFA 1LA2A 4F4FA 3PWSA 3AR9A 3QLEA 2FLWA 4OGGA 3OFJA 1X70A 3TIXB 3A1SA 3TR5A 4J29A 2PZKA 1VRVA 1XKQA 2GM9A 1VIAA 2H2DA 4MDHA 5B3LA 5BRAA 3AVWA 1AV6A 4QPNA 1H05A 1PJSA 5KX5B 1WG8A 1F20A 4M9RA 5J40A 4JITA 2DHCA 1XDZA 3VZPA 1BDMA 2PZJA 1ZVVA 3ND7A 4FZJA 3F5SA 3ZLJA 1GFSA 1LFAA 1O8BA 2O20A 3A06A 1W0JD 2XZPA 5LYYA 1X39A 1DRUA 3HPQA 4KN8A 2DZDA 3HC7A 3PGXA 3SLRA 4IP0A 3C8ZA 3O7MA 3O0TA 3TI9A 1GDDA 1BEZA 3T5PA 3IQGX 3C7AA 1JQEA 4ANFA 2GN4A 1J9EA 4AUEA 3HBAA 4GYYA 1E0SA 4HEQA 4OJQA 3IFSA 2ZDHA 2V6GA 3CUUA 2AH5A 3KYCA 3EVDA 1CUDA 1CYEA 4WZBE 4TLAA 2P69A 1PV4A 3TIIA 1HC7A 1DDOA 4GBED 4HX2A 4JDPA 4O5OA 5BSUA 1G9SA 3EA5A 4EUSA 3FMIA 3NYRA 3WAGA 3QVWA 1WUYA 1ZNWA 1T43A 1XK7A 5KNCD 3IMKA 2CDRA 2XHZA 2BRUA 4G0ZA 5E7MA 3ZXIA 2YXEA 1WSWA 3H16A 3K9CA 3T7CA 3G49A 3AJRA 2PU5A 5TJ9A 3FDXA 4ZQEA 1PLJA 3ETLA 1R9NA 3EYAA 1XRNA 3ZY3A 4KH0A 3ZW8A 3GT3A 3KD3A 1WZEA 2OFFA 1FFDA 1AO3A 2JI4A 2XMRA 3HDYA 5CJPA 1PG5A 3N2LA 3HP1A 1XQWA 3OKAA 3F4LA 4IXDA 1U2GA 1XDGA 3AONB 4QSHA 1QR2A 3PJEA 2R6R1 4J0IA 2A3RA 5EKTA 4QZVA 5IJ0A 1N0VC 1ZD1A 1ZUD1 2SNIE 3IT3A 4XQ9A 3U5ZB 3PK0A 3CG0A 4KR3A 3C24A 3COJA 1F48A 3PUKA 1CEYA 4EMTA 3WB2A 3DDHA 3MILA 3EFHA 4M0CA 4W8OA 5DF1A 1BCRB 1DQYA 2J59A 2AFIE 1Z25A 4YFYA 3RHFA 3L82B 3WLFA 1UBUS 5K8JB 3T5BA 2PLAA 3C3PA 3VPBA 3GQBB 1WCIA 2H3EA 2VDKB 3SM9A 4AMYA 5BR8B 3BEDA 1UADA 3MWEB 4MMZB 3KVNA 2OBLA 4Q7JB 1LC3A 2NTJA 3PVZA 4L8GA 3LX8A 1ZN7A 5CYFA 2FJUA 4B81A 3SDBA 2BI8A 5C9ZA 3RUEA 1FCJA 4EEXA 3RUDA 3UK2A 2XVXA 1DBQA 1T8YA 3QVJA 1T0BA 1EFAA 1IEWA 2XMQA 3P20A 6CHYA 1TI7A 3A1NA 3EXHB 1G8SA 3QBTA 4NQRA 4GM0A 3I3OA 3UEOA 4C1BA 3CLUC 4K9KA 4X60A 1XTPA 4JOSA 5I3ZA 1KERA 1WB5A 4D81A 1W46A 2F67A 3YASA 3ZHUA 3I6YA 1V48A 4ETMA 3ORRA 4V1CA 2D2VA 4TS4A 5AO9A 1OWOA 4ZGBA 3B60A 1I1HA 1MAAA 2AI2A 1AN9A 3RT7A 1Z22A 3Q8KA 1E9AA 4LZAA 3JSXA 3OCXA 3I5XA 3BJRA 2EX0A 1EGAA 4D44A 3FCCA 3KWJA 4C0SA 4CIBA 1QHFA 1L9XA 3O94A 1MJNA 3DGFC 1XRPA 4RTJA 2XJ4A 5FCDA 2DSTA 1WKVA 2FK8A 2HC9A 4INZA 1IN5A 3CNBA 1L8QA 2I4OA 4BRUA 1P4RA 2PO5A 4NBWA 4DLBA 2A5DA 4NZ9A 4QGGA 4RM2A 1F2UA 1YJAA 2IW1A 3I9FA 2AWNA 2IZOA 3CB4A 3K0BA 3KR1A 1TK2A 4QGFA 4RDIA 5ALQA 4L8YA 4JL8A 2YHSA 3SC3A 2C2BA 1EBUA 3P9YA 4W5TA 4WCFB 2PKYX 1K6MA 5JUWA 5FUWA 1U8CB 5REQA 4O4LA 4PZYA 3NKLA 1O2DA 2QMYA 5IKPA 2CVQA 3OX2A 2ZB4A 4MX8A 3DQQA 4TX1A 4UEJA 4TVKA 4CU5A 4JN6B 4TOIA 1NLFA 3UF0A 4CR7A 1VMEA 2JGKA 1KEEA 2CE7A 3C5EA 2WIKA 4D3YA 4CE6A 3BX1A 2C98A 1A1VA 1OLSA 1M1NB 3GEHA 4GG1A 4LJ8A 3WLTA 3F6EX 4JVMA 2WU0A 4JCOA 4Y1EA 2XW6A 1QIKA 5JSZB 2NPIA 3PFGA 2EFGA 1BGXT 1OLXA 5IKOA 1DUVG 2NOAA 1BE6A 2V1XA 2F62A 3R7FA 4GOKA 4MYUA 5EZ6B 2DQYA 2JCBA 5B3JC 3EVFA 4L16A 5LXTF 5DN6D 2H1OA 3C8UA 1CJUC 2AI3A 4R9NA 2VNKA 4BJ3A 4XARA 4ILKA 1NP7A 3DV0B 4ES6A 1I7SB 4LW8A 3M4YA 1XTKA 1Q20A 3GY0A 4S1VA 2W37A 4ALIA 3K1TA 1MG0A 1UJCA 3A36A 3EG9A 1DKUA 1GSIA 1K8QA 1QQ7A 2HCBA 3D54D 3FBGA 4UBLA 5ULLA 2P9JA 3C4VA 4DIOA 3R20A 5JIBA 4QBTA 4U6SA 1I94B 3KKKA 4KXWA 3G0HA 4AG5A 2IS1A 4RS4A 3TDKA 2ZRPA 4Z7QB 3DVAA 3IV7A 1LBHA 2Q50A 4PNHA 3D3KA 3JQEA 3LA6A 3AHFA 4MVJG 4GUAA 4IAOA 2WICA 2DKOA 3CEJA 3RVSA 4V0RA 2B9VA 1Z8FA 3EMDA 1KDYA 3BH6A 3INRA 1CXZA 2GH1A 2HA2A 2WUWE 4G1MB 2VCYA 3KOUA 1LPOA 5EZYF 3GU3A 3H11B 3RSHA 1DHRA 3GF4A 3GQVA 3SPXA 2DE0X 4CHTA 1V7ZA 4DUGA 2YFYA 4Q9DA 4URZR 2AUNA 3PHLA 4BMZA 5HZHA 2QRHA 3NM5A 2ZBDA 1IB6A 3A7DA 3GVCA 4PX5A 3FNQA 4QT0A 5LCXA 1IFXA 2HHCA 1GADO 2X13A 4MS4B 3EMKA 4RFSA 4DS3A 4FDTA 1GTZA 3Q8MA 4UD6A 1SGWA 3EBOA 3KU4A 4Q66C 5F1YA 2RHCA 5BNFA 2VH5R 5AHOA 3ILSA 4CNBA 3N58A 1Y4AE 2ORYA 4OHKA 2ONJA 3RFCA 2O8CB 2QRZA 3QVGA 4FBLA 1ULAA 5KX5A 3D8RA 3RK0A 2XSZA 3UJ9A 2P78A 1NOJA 2RHOA 4OH1A 2BL4A 2QL9A 1XKXA 1EVJA 1Q3TA 4FS8A 2AC4A 2CUTA 2R00C 3I30X 3AUKA 3ZZ0A 1XZCA 3D4OA 4QT4A 5TXGA 1ZUIA 2AOTB 3O8CA 3C1UA 1G1MA 4KE8A 1K3TA 1KEKA 1TF5A 3ZE0B 4M1KA 3S55A 4RGBA 2C8LA 4ER3A 3RAFC 1PHPA 3H6GA 3FCAA 5CUQA 1MFZA 2O5CA 4OJKA 2PANA 4YDSA 1YB5A 2VHVA 5SV2A 2PJRA 2W2VA 4UVGA 1RYEA 1AQ6A 2I78A 3N1UA 5KZMB 4FFOA 1XRRA 1YR1A 1G7TA 1Y3FE 3JZMA 3FUXA 4RVGA 4G1FA 4EJSB 3LHIA 4OG2A 5IDQA 3ADKA 3FWNA 3AEZA 4WASA 3PB3A 4KWTA 2P1DA 4R1MA 2R8EA 4Z7NB 1SKYE 4IDDA 3DAFA 4KQ6A 4YUYA 5B7QA 4D3XA 2O5EA 1HL7A 1TPYA 2XITA 3MIIA 1ZR2A 5DYNA 1HEYA 3KE9A 4R7ZA 2FWJA 3A10A 4GOLD 2GXSA 1QH0A 3ENKA 3KAJA 3NVAA 4OXRA 3G68A 1GQYA 4PZEA 3SHQA 1FRNA 2RFLA 2IH5A 4J0CA 3TSWA 1TM4E 1V35A 2H2WA 5IAKA 1ZM3A 3FCSB 4NHEA 3U7EB 4I8DA 2O57A 5HF8A 2VK8A 2H00A 3K15A 1XZPA 3H2YA 1WR8A 2NU9B 1D0VA 3HA3A 1PJZA 3KYDB 1P5HA 1NVMB 3EUFA 3K9BA 3PC7A 1SUBA 3UH0A 4O02B 1JR3D 1H2RS 1D4AA 3KQKA 3VR4D 3OZEA 1SURA 2P6RA 3DE3X 3FHJA 1ZC3A 2F55A 4LRWA 4MA5A 1Y48E 4HDMA 1KZ9A 3KVOA 1E3EA 3RYHA 4KNWA 1GGNA 3ENNA 3I58A 1DHTA 3L8EA 1UK7A 3CVYA 1XTUA 1EP9A 1Y3DE 4NBLA 4OHPA 4FFBB 4NMMA 1C3EA 4XLZA 5A7FA 4A23A 3EC2A 1RTKA 2R4QA 1DEKA 4G0VA 1KR2A 3DL4A 2DX7A 3OZ7A 4OUDA 2HWYA 2QUZA 3GEIA 3OPXA 4LDQA 1CJKC 5A0FA 4B8YA 1CRZA 1SXJA 2YMLA 3WP0A 3NHLA 3ICPA 3UMYA 5EMMA 1QMPA 2ZLBA 2LKDA 4B6JA 3GEMA 2PKWA 4HWOA 2BF7A 2A1TS 5C3MA 1XTRA 2E87A 3EZFA 4Y2XA 1AGYA 7REQB 1IPHA 3HI4A 5HWSA 3VO2A 5CD9A 1FVFA 1W5TA 2PSHA 3QU5A 2GYVA 1ZSVA 3RASA 3GLSA 2HGZA 1EFDN 2IQ5A 2GCGA 4JP5A 3PD1A 3OOEA 4ZEWA 3S3TA 2BGGA 3STYA 3A3NA 1G7CA 3AUYA 2NV6A 1LDNA 4RV4A 5FFMA 1XBTA 3VZQA 1NBEA 2W6ZA 1AQJA 2WILA 1PL0A 1IN8A 3KT0A 4NZOA 4Q4AA 4PYIA 3FGNA 2OYCA 3UWPA 1RADA 2J9RA 2Y1LA 3FDIA 3HZZA 4TV9B 3SC4A 4E33A 5GTDA 4QX6A 4WFJA 1L4NA 2QJOA 2GYYA 2ZR9A 2FPGA 4Q6WA 2IZ1A 5K8UA 1N2BA 4KN6A 4IG4A 1D1QA 1DBWA 4K6HA 5C4GB 3C70A 1GPMA 2G80A 4ONEA 4BQPA 1MGOA 3ENVA 3LWNA 4EJ0A 2XQJA 3MSXA 4ENRA 3HLYA 1XTTA 1ZCZA 3PE4A 4I4TB 4DLVA 1J1UA 3KO8A 1P4GA 2QZJA 3A31A 3P0FA 2GB4A 5G0UA 4D6XA 3OQBA 1X7DA 3LCUA 5A1JA 1QGZA 1HETA 4C07A 2C31A 5FR2A 3QFCA 3VTKA 1KPGA 4NJMB 4HEA1 4RVCA 3ZJVA 1KEEB 1XAHA 3G2PA 2C4VA 3I9V6 2I3AA 1TUGA 4LOIA 4RXUA 1GUAA 3K0AB 3V33A 5L3ZA 4MPJA 3ADCA 2FTKE 3G0CA 2C2OA 4RV5A 1BIFA 2AW3A 1NSFA 4EB6B 1U2TA 4LJ4A 1OYYA 4N0PA 4UE3S 4Z9YA 1I13A 2QYOA 1NBWB 1BVRA 4CG3A 3ZDQA 4L7QA 2ZZMA 1PFKA 1JILA 1ZINA 1XWWA 2EG5A 4OQPA 5EJ7A 4FDLA 4X1KA 3D9QX 4O0LA 3WLOA 4E5MA 4QJBA 4B6SA 3JYOA 5IHPA 3LUJA 2R1UA 2AV6A 3A26A 2JKYA 1N0UA 1PR1A 1YU6A 5DOVA 5EUMA 2AN4A 4DCUA 5K0ZA 1JI0A 4TYPA 5IVIA 1YTUA 1FP1D 3GJ6A 4NBRA 3T52A 1RABA 1UJ4A 3PGKA 3I62A 3KQWA 1GGFA 2GHTA 1AA9A 5BY2A 3IL2A 1CRWG 1JHPA 1FUYB 1HZZA 3UKOA 5LKAA 5FRDA 3O4GA 4IFBA 4MA4A 1RJEA 4DF3A 2Z56A 3R1IA 2UUCB 2AQ8A 1JU9A 2Q1SA 3OZVA 4XFJA 4A2CA 1Z56C 1NVDA 2GHIA 1MORA 4KBGA 2VAVA 3FFTA 4Y0VA 4Z7OB 2XXAA 1MRNA 1R18A 1CQIB 2DJIA 2JLSA 4G63A 3PDUA 1YOVB 2MMGA 3HGTA 1CRLA 1J0XO 2RKBA 4MV5A 4F93B 1UPBA 1DPFA 5KJFA 1PJ4A 3EJWA 1FE8A 1TW2A 1AG9A 3NUZA 4TT8A 1Z8DA 1MB2A 3KOOA 3OQIA 3RTDA 5T7BA 2BP7A 3LPNA 2EQAA 1L6IA 5EJ9A 2NAFA 3W8NA 4UOZA 3IQXA 3RWOA 5C52B 3KQHA 4BMPB 3PQ2A 4QASA 4JROA 3HZHA 2ZRNA 1AKVA 3UPDA 1VRCA 2PL3A 3LDGA 2YH2A 3OF5A 1ZD5A 5SY9A 5JBQA 1EGQA 2WYWA 3QFRA 1ZMBA 2JZNA 1TECE 2PH3A 5FAKA 1U6JA 5I48A 1KY3A 3UK1A 3SZGA 5JXJA 1CF4A 4BFTA 5JDCC 2IEDA 2GN2A 4B32A 3F96A 2BMWA 1MRSA 2GRUA 3L7OA 4CDRA 1C30A 3GHYA 1FZTA 4HB2A 3BMOB 3P9IA 2VG8A 2BKAA 2YC4C 2OHIA 5K3OA 3WFJA 1PR5A 4PO3X 1EINA 2RHBA 2X5OA 4P4SB 4YUVA 1YBVA 5JADA 1UQRA 4TL8A 5FL7A 5DIFA 2ECPA 3NXKA 4ALMA 3RRXA 4E3WA 4ZOQI 5KYWB 3TD6A 1SKYB 4YRQA 3R3HA 2JDID 4X1YB 4B6QA 1WV0A 5E4TA 4RSMA 4B6GA 1WMAA 1Y1QA 2AN9A 3MBOA 4I08A 1C41A 2OUIA 4MWOA 3RB8A 5JAMA 1J00A 1Z45A 2DH6A 4E6EA 1W76A 3H1GA 5EMHA 4BNLA 3EVBA 1JA9A 4L72A 1OBFO 1FFXA 4W5HA 1ESNA 1AUQA 1O6GA 2GCEA 3EGDB 3GFVA 4M99A 2HBYA 1E79D 1P4HA 2E55A 1T0HB 3JD0A 5KTMA 5M04A 5IFLA 4F5ZA 1RXVA 2CK3D 1O6CA 2O2GA 4YAKA 2F9FA 1GQQA 4HGQA 3EHDA 5EJGA 4F6CA 2BUAA 1GGVA 1HPLA 1WVIA 3LA8A 5INTA 4PG5A 2QRQA 5MHTA 4C0JA 1KDOA 1TO6A 1TMYA 3GAAA 1YC2A 2ZIAA 5KYVA 4LE1A 3UJ8A 3VNVA 4HPXB 3IPRA 3DZBA 5K09A 5C53B 3QUCA 3L7YA 3LQRA 4LISA 5ERYA 1AKWA 2Q6KA 4LSZA 2VNJA 2PGIA 3WZ2A 3DGEC 1NMZA 2Q3EA 1NKSA 5LD2C 3JD3A 4KWCA 2ZREA 4EJSC 1EX1A 2CYAA 2FNAA 1DC4A 2YY7A 4LXQA 1FFCA 1YZKA 1IHPA 3NW9A 1WOMA 3HB7A 5FLKA 1WW3A 3LO8A 4GECA 4CF7A 1T4CA 3O8LA 4LOKA 4K6CA 5CBPA 2JPDA 1WEKA 1A2OA 3S2ZA 3PJRA 4YT8A 3A9VA 1SVOA 3GMIA 2C07A 3LOPA 3TRJA 1YSCA 5IK2D 4JY7A 1UDRA 4KMOA 4ARZB 1UXIA 2RJNA 4KMSA 3NMUF 5IN5A 2CZGA 4ZALA 1N2EA 2JCVA 4DJEC 5B6IA 4OHFA 4FHGA 3FVRA 2OZPA 1GAEO 3ZPXA 2H8KA 3NHAA 4U2CA 4Y2QA 4NV3A 4DLNA 1FYEA 4L08A 3ADOA 4ACBA 5E7JA 4KR6A 2BRUC 1TO1E 3DZIA 5D7NA 4EYQA 4KHPB 1U0NA 3G2IA 1VKRA 4ND8A 2P65A 5IW8A 2X7JA 3RHSA 5DK6A 2BDTA 2JIQA 1C1YA 2GBCA 4E4RA 1N1GA 3KTOA 1QZXA 3K5HA 3NRCA 1YVDA 4B4VA 2PKQP 2VHWA 2VXOA 4GM4A 4CDMA 2BFEB 5BRNA 2IUYA 3G0OA 4MJXA 5DCYA 2FZKA 5JXHA 1T3SA 5DHAA 2PH1A 3OPVA 2JHPA 4QJ3A 4HUQA 3HADA 3DHEA 4A0SA 4JOQA 1LQTA 4ITUA 5F4BA 3TLAA 5LJLA 3HKCA 1JLRA 4FLEA 5JASA 5KPDA 4GDFA 2V7BA 3NAZA 3NTVA 2Z2ZA 3UXEA 5LU8A 3TUJC 1ZVKA 2QXUA 3I2JA 4IJWA 4KYIB 1I7PA 5K3FA 4CQLA 4GR9A 1V5FA 5AVSA 4C2TA 4ON9A 1J97A 1ZL0A 4HX9A 4UFNA 1P6QA 1ULBA 4R54A 1E64A 1L5NA 1L4HA 1QKJA 2O50A 6REQB 2IFTA 1JR4A 3X2FA 3MMXA 4Y2PA 3UJBA 4R2JA 5HIKA 3LUDA 2AQHA 5K5EA 5KEIA 5LBUA 3K09C 3P2YA 4QLAA 4TLLB 2PR2A 3VHRA 4M1SA 2P67A 5ANRB 5KNBH 5K3DA 3RS8A 4BVEA 5AM0A 2X77A 3O2SB 3LCCA 5G0SA 2BAGA 3TR6A 4N0QA 1AS0A 4JASB 1Q6YA 4UHBA 4LPSA 3IEXA 4EECA 1R5OA 1V95A 3LPLA 4AJ2A 3W6NA 3NP9A 2JHAA 4HSEA 4I1OA 1YV9A 5D3MB 3QA3E 4K46A 4UUOA 1ZGBA 2E4XA 2ZSIA 1MVNA 2HF9A 4QLBA 3S40A 4ZK6A 3RFTA 5B57C 3GNQA 4D0NA 5JAPA 4RX1A 1GP2A 2LZ0A 4BEBA 3F97A 4EHFA 5L45A 3ZGZA 3R7BA 3BN3A 1C50A 1QS0A 1WY5A 3CUTA 3FPCA 2O0LA 4MGEA 1VZ2A 4TWZA 4OLAA 5EZQA 2Z08A 3NBMA 1QGAA 1SC6A 1UH5A 2HJHA 3R4CA 2HJ9A 2HNKA 3ETHA 4FXOA 4TTTS 4YAWA 2ZVJA 2VJBA 2W8BB 3HP4A 5T6MA 2QVLA 3H83A 4HRVA 2VQDA 3ER8A 3BT7A 1VSVA 1NAIA 1RHQA 5CVDA 2AG6A 1KRWA 4MW7A 5F52A 2G04A 2G6BA 3CCBA 1HT1E 2O7VA 2Z98A 3FSJX 2W90A 3DMNA 4US2R 1JMVA 1PZEA 3E0QA 3X1WA 2GZDA 3UN1A 1I6WA 4RPIA 1NN5A 1O08A 4WFQA 5LZ7A 3LW8A 1L1QA 4G4IA 1QVRA 2UYOA 2WTNA 1T8PA 1ZBDA 2HPAA 3FPKA 3SD7A 3STHA 4Q3AA 4CWAA 4M7OA 1T9CA 2FA9A 4C5BA 1PGOA 1I5EA 3BTUA 5BURA 4A03A 5T8KC 2SBTA 2HWUA 1IVNA 1J8MF 1H4TA 4MB6A 2O52A 4IJVA 3WXBA 2F1OA 4AL4A 4QFMA 2ZUDA 1EESA 3I73A 5T8KA 2DCUA 1W49A 2A88A 2FZ5A 2HCTA 4FC6A 4IQ8A 2KLBA 1TYDE 3SZMA 1O54A 3ZXUB 5JW6A 5B37A 3DQPA 4D8TA 2VYVA 3DOOA 4Y1RA 1H2FA 5LA6A 5B58C 3QKWA 3GROA 4R6WA 4YMIA 3WHLA 3HK2A 5E6UA 5JS8A 3ZW7A 3KQTA 4HRXA 5EIWA 1M66A 4N0DA 2AYXA 1MF7A 1N6PA 1B16A 5DN6A 2X5JO 1U7PA 1LTHR 3N8GA 3PC3A 4P81A 5ALGA 4MICA 4CTJA 1UOEA 3E7DA 3LLCA 3NHPA 1DU4A 4MQFA 3HDJA 2RD2A 2UYYA 2HQRA 3IB6A 3ZJTA 1V16A 2Z5VA 2QX7A 2FSGA 3A6KA 3BHNA 5GGXA 5HMLA 5IJ9A 4GKKB 3DWGA 2FG5A 4BOYA 2WRZA 1H5UA 1HO3A 2H0QA 4MZXA 4OL0A 5LP6F 2IYLD 2MCFA 3ZCPA 1QFXA 3H9GA 3EGWA 1YCFA 2GZ2A 3I5UA 4J75A 1KAEA 1UK6A 4PHFA 3SSMA 1FLVA 1ORTA 2RHJA 1V2HE 1E99A 2P4EA 3BERA 1UOPA 4KX3A 3K5PA