1NE2A

Crystal structure of thermoplasma acidophilum 1320 (apc5513)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
197
structure length
176
Chain Sequence
MGIKNDLEIRLQKLQQQGYPTDASTAAYFLIEIYNDGNIGGRSVIDAGTGNGILACGSYLLGAESVTAFDIDPDAIETAKRNCGGVNFMVADVSEISGKYDTWIMNPPFDRAFIDKAFETSMWIYSIGNAKARDFLRREFSARGDVFREEKVYITVPRIYRARIEAVIFGVRNHSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein ta1320
publication title Crystal Structure of Thermoplasma acidophilum 1320 (APC5513)
rcsb
source organism Thermoplasma acidophilum
total genus 56
structure length 176
sequence length 197
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06325 PrmA Ribosomal protein L11 methyltransferase (PrmA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1ne2A00
4YV0A 3T7SA 3KQYA 5LQUA 3DMFA 5E1MA 1WZNA 3TQSA 2UYHA 3B3FA 1NW5A 3GXOA 3NVMB 3TM4A 3UJCA 3EVEA 5FUBA 1XXLA 5HIIA 1KIAA 4E2WA 4PYIA 4DQ0A 1FP1D 2PWPA 4PINA 4R6XA 3BXOA 2ESRA 3EGIA 3I9FA 4CWAA 2B3TA 3KPUA 4PYLA 1L3IA 1EIZA 2AOXA 2OXTA 3S68A 3CVOA 1NW6A 1DUSA 3D2LA 3TKAA 3GRVA 2Y1WA 2XYQA 2FK8A 4X63A 1JR4A 3DULA 3DXYA 4C03A 1JSZA 3AXTA 3CJQA 4F85A 2JHAA 2WA2A 2ZLBA 1R18A 4M37A 4YUWA 3NW9A 1F38A 2HTEA 3SX0A 3OCJA 3M33A 3MGGA 4G56A 2YXEA 5CVJA 5EMJA 5FA5A 5IH3A 1YFJA 5E1DA 5KS2A 1T43A 1SQFA 2AZTA 3BKXA 3DXXA 3P9KA 4PIPA 3KU1A 1EJ6A 3IHTA 1JSXA 3ELDA 4KIGA 2CKDA 5EKUA 4ER0A 3E7PA 3HVKA 1I9GA 1SUSA 5FHRA 4GOND 5DXAA 1JG2A 2GB4A 5DWQA 2NXNA 4EKIA 1X1DA 2CMGA 4X41A 3P2IA 1YZHA 4RTRA 2F8LA 2PX2A 1VLMA 2ERCA 4EQZA 5EVJA 2IDKA 2GS9A 2G72A 2P35A 3GRUA 4XUEA 2QYOA 3LX6A 3MHTA 3KPJA 3M6WA 1FJXA 3HA3A 1BOOA 3NWEA 2JJQA 3P9IA 2JG3A 2PKWA 1N2XA 4GUAA 1VP9A 2XVMA 2ZWVA 2G70A 5GOZA 4OQDA 3OU6A 1YF3A 3I64A 2YTZA 3ER8A 3FTFA 5FQOA 3HA7A 5FTWA 5LQRA 3NTVA 3KQOA 2ZULA 1L3CA 5FADA 3UA4A 4YUZA 1IY9A 3Q7EA 3QOWA 5E1BA 5H02A 4FSDA 2NNWB 4C05A 1YB2A 4BP1A 1TPYA 1R00A 4EK9A 4EKGA 2K4MA 3AJDA 3G5LA 4AZVA 1PJZA 1QAQA 8MHTA 4IWNA 1EQAA 2ONYA 2P7HA 3P97A 4LG1A 4ER5A 2C7PA 3WSTA 5E8JA 2HV9A 3JWIA 2VP3A 3CJTA 2V7EA 1NT2A 2O07A 4CXMA 2IH5A 1WG8A 2YUIA 2EJUA 3IYLW 4MQ4A 2NP6A 4RYLA 3F4KA 2BZGA 3LKDA 5DX8A 1M0EA 4L7VA 3ELUA 2XYRA 2ZW9A 4P58A 5P8WA 2ZIFA 3HP7A 5K0GA 3BGIA 2PT6A 3DH0A 5EMMA 2AN5A 2G71A 1KHHA 1ORIA 3JWJA 3UWPA 4PWYA 2ZZNA 3LCVB 4UOEA 1ZKDA 2B2CA 3BWCA 3I5UA 2NYUA 1F3LA 2YVLA 4PYQA 1RI3A 5DRYA 3IV6A 3PT9A 4RSRA 1HMYA 3KQTA 4XUCA 3SSOA 2FRXA 5C1IA 2P1DA 3EGEA 2OYRA 2QE6A 1WY7A 1QAOA 4X1OA 2NXEA 1WXXA 1QZZA 1X1CA 2ZIGA 3M70A 4DM3A 3ANXA 3CKKA 5ICEA 2Z6AA 3UA3A 5EPEA 1G8SA 4MHTA 4V0RA 4WXHA 4WVLA 4POOA 1XCLA 2FPOA 3HVHA 4O29A 4P7GA 1BKYA 4RV9A 4YMGA 1ORHA 5EEHA 3RW9A 5K8VA 2UYOA 5DX1A 2PXCA 3Q87B 2YR0A 3DMGA 2Z6QA 5BW4A 2PV0A 9MHTA 1VQ1A 3PLAE 3KQWA 2AOWA 4QDJA 1Y8CA 2B9EA 2OO3A 4DCMA 4ATNA 2I9KA 2I62A 2FYTA 1FPQA 3O7WA 3E05A 5BW5A 3C3YA 3QV2A 4R8RA 4QQNA 1KYZA 2GH1A 4RVDA 5EIFA 2H1RA 4PCAA 4HG2A 3C6KA 3FTEA 1XDUA 3KPVA 1DCTA 5FCDA 3FTDA 2ZBPA 5CIYA 3DMHA 3GWZA 4BLWA 3A27A 3FTCA 1OR8A 3OE5A 3OPNA 3X0DA 5K03A 3BWYA 4E70A 1U2ZA 4DKJA 3THSA 3GO4A 4RTKA 2PT9A 3A7EA 5FWAA 4E2ZA 4QVGA 3HVIA 3SGLA 2GLUA 5LQKA 2G1PA 4QVKA 5EGSA 1VBFA 2PSSA 3BUSA 3BZBA 3OZSA 1X19A 4E30A 5CCBA 3LECA 3VC2A 4DA4A 3A25A 2OB1A 4B17A 3SSMA 3T7TA 1IXKA 5EC8A 4C04A 1UWVA 2O0LA 2ZVJA 3LDGA 4OBXA 4YV2A 1RI4A 3OFJA 5HOQA 3FYCA 4KVZA 4LECA 2AOTB 1VE3A 2O06A 1RI1A 1R8XA 3AXSA 2ZWAA 3OE4A 3K0BA 3UJBA 2ZCJA 3HCFA 1EG2A 3G89A 3G88A 1P1CA 3KQPA 3UFBA 4E2XA 3FPFA 2BR4A 2C7OA 2ZBRA 2UZ4A 3PB3A 3U81A 4P7KA 3FRIA 3UJDA 1N7IA 3DUWA 3MCZA 1RI5A 5GIPE 1N7JA 4GOMD 3VYWA 1TW2A 5JUWA 4GOOD 1AV6A 3GU3A 3KR2A 3LL7A 2OZVA 2UYCA 2JHCA 2OPBA 5DX0A 2G8NA 1RJEA 4PGHA 2N47A 2IH4A 1H1DA 3PTAA 2VDVE 1VIDA 3FPJA 4LWPA 3KQQA 4RVFA 5ICCA 2FK7A 5EZQA 4PNEA 1JG1A 2AR0A 3LBFA 2GPYA 1M6YA 3B89A 3CGGA 4KRGA 3LHDA 2GA9A 1KPGA 2PXXA 3NVKI 3TLJA 3DP7A 2ORED 1TW3A 2OBFA 3MERA 3DOUA 3FZGA 3MB5A 4E2YA 3H2BA 3LDUA 2ADMA 3DLCA 3EVZA 4JXJA 4CKCA 5EZSA 2IH2A 1Q0SA 1I4WA 4KDCA 5EOVA 3EMDA 2VZ9A 3GJYA 3BWMA 3TMAA 5EHGA 3GRYA 5T64A 4CKBA 4P7JA 3NJRA 3MAGA 2Y1XA 4YMHA 3KR1A 4RX1A 2HWKA 2AS0A 3R3HA 2AVNA 2YXLA 2GAFA 5DLYA 3EVGA 1NBIA 3ELWA 3LSTA 4FSXA 3K6RA 2BM8A 3OU7A 4R05A 1KYWA 4IV8A 2CMHA 5CCXA 2ZZKA 2P8JA 5GM2A 4CTKA 5FA8A 3P71T 2IFTA 5CVEA 2IBTA 4M36A 3C3PA 3FUVA 3TOSA 3GGDA 5K0LA 2IBSA 3EVBA 3M6UA 5CVVA 3C0KA 4YUVA 4MTLA 4Y2HA 3EEYA 3KHKA 1YFLA 3LCUA 1RI2A 5KQRA 2KW5A 2P3OA 2P41A 2PX5A 3UZUA 3GIWA 2R3SA 1INLA 3C6MA 2C7QA 3G2QA 3EVAA 4KW7A 3TRKA 2IGTA 4RTPA 4PONA 4Y30A 5E1OA 3BKWA 1SKMA 4RWZA 2PJDA 4FT2A 2ZSUA 2V74B 3CCFA 3FPHA 4RTLA 4MWZA 5KYGA 2A14A 3B3JA 5EKXA 5IKMA 4X61A 3PX3A 1VL5A 2ZTHA 1ZQ9A 1BC5A 3ID6C 1JQEA 2IIPA 4FGZA 5HEKA 5G02A 1ZGJA 3VC1A 5MHTA 4M38A 1NE2A 5CVDA 5JR3A 5DM4A 3DR5A 4GQBA 3UBTA 1JG3A 2O57A 4XUDA 5EQJB 4LWOA 1SQGA 3P9NA 2JH9A 4DMGA 1VPTA 4HRAA 5HZMA 1G60A 2XVAA 4HTFB 3HCAA 4MIKA 3FPEA 1O54A 4BY9E 3GRZA 3LPMA 3G2PA 4KIFA 3OU2A 4K6MA 4QTTB 4C07A 3LKZA 5GM1A 3A26A 1P1BA 2CWWA 1G38A 3SM3A 2H00A 3IEIA 4YUXA 3ME5A 3KQVA 1YUBA 5DXJA 4DCGA 4FP9A 3KPYA 2YX1A 5DM1A 3TKYA 4GEKA 5LR6A 4OX9Y 2AOTA 4PYOA 5DTMA 3RIEA 1AF7A 3LBYA 10MHA 4AZSA 2I6GA 3CC8A 3JWGA 3R24A 4GOLD 5LSAA 3EVCA 3HCCA 5LQNA 2P3QA 3SXJA 5CD1A 3HCEA 3DLIA 2PLWA 4GF5A 4IV0A 1B42A 1RJGA 3CBGA 3EPPA 2PX8A 5D1HA 2EG5A 2VS1A 5K05A 5DPMA 1G55A 2CL5A 3MCTA 2HNKA 5E9WA 1BHJA 4RTQA 5E8RA 3E23A 5FULA 4C06A 2EJTA 2NXJA 2BR3A 4RVHA 1JTFA 4BP3A 4ER3A 2H11A 2PY6A 3G2MA 4KDRA 1WXWA 2HR1A 3GNLA 2NP7A 3V8VA 3FRHA 1D2GA 4RTOA 2I7CA 4ISCA 3I58A 2ZBQA 3SVZA 4GBED 1O9GA 1ZHFA 4GC5A 5K0JA 2ZFUA 2QY6A 5ICFA 2AN4A 5K0NA 4OA8A 2QM3A 1ZGAA 4IKPA 2OY0A 4OQEA 5GINE 1FBNA 3G7UA 5DRTA 3SSNA 1QYRA 2PXAA 3LCCA 4QDKA 5GWXA 3CJRA 1JG4A 3THRA 5HIKA 5K0BA 5LQJA 2B78A 2Z6UA 3NMUF 2E5WA 4H0NA 4HGYA 4RTNA 2P40A 2ONZA 5F2KA 3LGAA 5LQCA 1UIRA 5E9QA 2AN3A 3GCZA 4FZVA 3OFKA 5T6BA 3L8DA 3FYDA 4CKEA 2AVDA 5M5BA 4U7TB 1JQDA 4AZWA 1KPHA 1VP3A 3REOA 4AX8A 1X1AA 2AOVA 2PWYA 1D2CA 4OA5A 5KVAA 1RJDA 3OZRA 5ICGA 3R0QA 2AOUA 3PS9A 5E2BA 5HFJA 3TPZA 4CTJA 2BM9A 4E32A 3I53A 3DTNA 1L3BA 3G8BA 5DM2A 2HMYB 3AY0A 5CM2Z 2JH8A 3P8ZA 4F84A 2P3LA 3GDHA 3M6XA 4RTSA 2EFJA 3PFHA 4ER6A 2PBFA 3UJ8A 4ER7A 3FUWA 3LDFA 3EEOA 3E8SA 1L1EA 5CUQA 4DZRA 3P9CA 1D2HA 1P91A 3FPGA 2DPMA 5FHQA 5U4XA 3KR0A 1KXZA 2AOUB 2BH2A 2YQZA 5DSTA 4RTMA 3R6TA 3BGVA 4DF3A 3P2EA 5HILA 4AUKA 4PYJA 1NKVA 5KQSA 2IP2A 2B25A 4PYKA 2VDUE 5D1NA 4FR0A 2DULA 3HNRA 5HIJA 1V39A 3EMBA 2P7IA 3EGVA 1KP9A 4X60A 1X1BA 1L9KA 4XCXA 1NW7A 1JQ3A 2ZIEA 3KKZA 3NWBA 1G6Q1 4GC9A 2QRVA 2OKCA 3UJ9A 5FQNA 1I1NA 4E31A 4R6WA 4NECA 1UFKA 5K0CA 2ZZMA 2WA1A 1NV9A 3G5TA 3HA5A 3UJAA 3T7RA 3DXZA 3O31A 5K01A 1RJFA 4FT4A 1SUIA 3BGDA 3MTEA 3PX2A 4HGZA 7MHTA 2BR5A 1R74A 1XVAA 4PGGA 4R8SA 5CVUA 4YUYA 1Z3CA 1QANA 5BXYA 1EAMA 5C9ZA 3BWBA 1EJ0A 1XJ5A 1O9HA 3FUXA 2QRVB 5DM0A 5GP1A 1M6EX 5HIMA 1MHTA 3QOXA 3BT7A 3SR4A 3KQSA 1IM8A 1MJFA 3B5IA 5EMLA 4C08A 5EG5A 4EMSA 5K09A 1AQIA 2FHPA 4HTFA 4QTUB 5BP7A 3EVDA 1NBHA 5F2NA 3NDJA 5K0EA 1FP2A 4U7PB 4HH4A 4KWCA 4ZTBA 3VSEA 4EVIA 1XDSA 2O05A 2PGXA 4V0QA 4A6EA 5ERGB 1Q0TA 3R9XB 2PVCA 4PYNA 2C7RA 5DSXA 1QAMA 1NV8A 1WS6A 5DT2A 3HM2A 5E9JA 3M6VA 3O4FA 5DTQA 3AWIA 2FCAA 3PVCA 3TM5A 4QQKA 3SMQA 5FWDA 3JWHA 3OZTA 2EX4A 4HC4A 2JHPA 4FS8A 1SVUA 2IDJA 2LD4A 3KPWA 3M4XA 4C4AA 1XCJA 3TR6A 3ERCA 5DTRA 2Q41A 2PX4A 1YZ3A 5T67A 3UJ7A 5LQAA 3T0IA 1DL5A 1NW8A 2UYQA 3RODA 3EVFA 1P39A 2VDWA 3A7DA 1SG9A 4F86A 4P7FA 4PYMA 1NW3A 3KR9A 4RTJA 4PIMA 4AZTA 5F2OA 4E33A 3HCDA 2R6ZA 3HTXA 2WK1A 1XTPA 3MTIA 3UJ6A 1AQJA 4QPPA 3G2OA 5EIWA 2IPXA 2YXDA 3B3GA 3KQMA 3ORHA 4A6DA 1ZG3A 4PCLA 3HEMA 3TFWA 3PFGA 4Z2YA 3V97A 2XYVA 5EEGA 3HVJA 3ER9A 1PRYA 3G8AA 5C0OE 4YV1A 1R8YA 3MQ2A 5EMKA 5B1SA 4BLUA 3FUUA 5GIOE 1XDZA 3B7PA 2NXCA 3ELYA 4HSGA 3A4TA 4BLVA 3FUTA 5EHIA 3GRRA 5E2AA 5K0FA 2XBMA 4QPNA 1R6AA 3NDIA 2OB2A 1KPIA 1G8AA 1KR5A 3HCBA 1JTEA 4RVGA 3P2KA 4M7RA 4OBWA 1HNNA
chains in the Genus database with same CATH superfamily
4GX1A 3UN1A 4KLAA 4U2BA 3KQYA 4GM1A 4NU5A 3DMFA 4LXQA 1MRSA 3WXMA 4O08A 4N7RA 2BEKA 3QKUA 3WIUA 5JAIA 4QAJA 5CNJA 4BGEA 3HI6A 3WQHA 3I1IA 4L50A 2DQKA 1W34A 1H4VB 7GPBA 3HKCA 5EJ7A 1QH1B 1MOPA 5CX1A 3M82A 2EEPA 1FDVA 3AR2A 2XBUA 2I2WA 5K3FA 2HDWA 2LCIA 4JVOA 3WLTA 2P6RA 2D5LA 3JQAB 3X2FA 1ZD8A 2XVZA 4C76A 4D3ZA 1ACJA 3EWSA 1E1CB 2JAQA 3H99A 3HADA 1R4ZA 2VIIA 5KS2A 2GN1A 3AOEA 3QX7A 5CYOA 4G0OA 3W6ZA 1Q2XA 2ODNA 3ADBA 4GFDA 3C6BA 5KJCA 3GGSA 3R6WA 4Z9XA 1XEXB 1KYVA 2G67A 2WKRA 3NOXA 1IB6A 1UPAA 3CG4A 5JYCA 2PGNA 1F6DA 5EN4A 2GHIA 3MJRA 3QELB 5B3JC 3U4HA 1NF2A 1O95D 1N3IA 1Z7WA 2CUNA 2KHZA 2C3MA 2NYVA 3EDCA 3H0CA 4C4ZA 2QNIA 2G7MC 3AETB 4M1MA 3RUCA 1YT5A 2PX2A 1E2MA 2VRNA 3IO3A 4ZOCA 5BSVA 1EU1A 2H63A 1V47A 2IDKA 4NSNA 4RAQA 4WZ6A 5I8PA 4RY2A 1FQKA 4MV6A 2PNJA 2M2IA 2D0DA 1E3IA 3JVEA 2G4LA 4YXWA 3O3MB 4KOAA 5BUCA 5BWNA 2H2AA 1CR1A 1G2OA 3W6OA 4BNTA 4BX2A 4EPWA 3R8CA 3RH0A 4EL0A 2IHNA 3H2HA 3TPCA 3RNOA 1NRWA 1U4NA 3RUEA 1SUBA 4J0EA 2NX2A 3LUPA 1I4EB 5FTWA 4BJ6A 4L9RA 1GPKA 4XWGA 3GBPA 3ZJ5A 1IY9A 4UTPA 5E1BA 4A8JC 4B3TB 2EIHA 4FQ5A 2E49A 2QIPA 3S8YA 3DVAA 3EEIA 3AJDA 3MTJA 3QHQA 3H8JA 2PZEA 1QCDA 2C2BA 4I5EA 4ARBA 2ONYA 4FINA 3W9BA 1P2BA 1SM4A 4GPAA 4ZV9A 3X1XA 3HA2A 4RPCA 1Z4JA 1ZIYA 4M8SA 4DLZA 2PPVA 1PX2A 1EP1B 3QU7A 2OAEA 1NT2A 1Y9EA 3C3WA 4IUDS 1WG8A 2BGTA 5HMLA 2ZYDA 4ZYLA 4D44A 3W8FA 3NHAA 3OI7A 4L5BA 2W98A 4BNMA 5D5QA 5KX5A 1EEHA 4FQ8A 3LXXA 4A2WA 4IKEA 4ZYVA 3DH0A 3MWKA 2B7LA 4WV3A 3TS1A 1JALA 2AN5A 1K8RA 2I71A 1VBKA 3LCVB 1GNQA 1SD2A 3BTVA 3QEMB 1N2HA 1SCAA 3EZLA 5FTLA 3K9NA 1H9CA 3PF9A 4O2RA 1SQSA 2WMNB 2J5XA 1Q1AA 4HJXA 4NULA 3WGOA 4B7UA 4F0JA 1HMYA 5I9MA 3RAEC 5KOHA 1T9BA 1XTZA 3ZCUA 1MAAA 2QV7A 4M87A 4MCJA 3L1KA 4HLCA 4ON9A 2QRQA 2ADFA 5C1IA 1E6UA 5KYXB 2FKNA 2QM7A 4MW2A 5MN6A 1TB4A 4D9CA 5LNK1 2VP6A 3WK7A 1VJRA 3ANXA 1NW4A 4FX2A 1USWA 3GA5A 3RYFB 4YJ2A 3JD0A 4WXHA 1LS6A 1P7WA 5KNCH 1TJ5A 3EA4A 4ND7A 2FSHA 3DKRA 5EEHA 4GVLA 1JFSA 3RC9A 3KSBC 3KO8A 4C0JA 4V38A 4L7QA 3DT8A 1JBQA 1VQ1A 3F7OA 3VR0A 3VR3D 4M86A 2I2BA 4AAYA 4DRXA 3KOWA 1FMFA 2D7DA 5JQGB 1GNLA 5KYWA 1MW8X 1TTPB 1P45A 4IHQA 2FEAA 3ASZA 1JA0A 1HT1E 2G0AA 3IQHX 2GH1A 3KTDA 2HNAA 3N0XA 1C1DB 1JIQA 3CUKA 3FDZA 3CN9A 2Y67A 1A69A 4UUQA 3ZJUA 1XDUA 1W49A 2AG6A 4J7UA 4CFYA 4ISBA 3CO5A 5E3JA 5AUNB 1EA5A 3X0DA 3MWGA 4OAPA 4FIDA 4L5JA 4AI6A 4P08A 1HZZC 3GFQA 5FWAA 3PC8C 3K0CC 4CUJA 4Z2AA 3VHXA 5F9MA 4N9WA 1VBFA 5EXTA 3OZSA 4MZDA 2BJVA 4MWGA 3CLVA 3DAOA 1GTG1 2ZVPX 2EFCB 1OFUA 3ANLA 5KNBD 4KMMA 1KFCB 2IC5A 1L7OA 2JCBA 1U0EA 4MULA 4G81A 3P0EA 2B69A 4MPRA 3OEED 4OFBA 3UMBA 4DCUA 3D6HA 4BLSA 1VPEA 2VYQA 2C8JA 4G0ZA 1C0PA 2YS7A 1LQUA 3ESZA 4JJ8A 4IIFA 4ZXPA 4Z6KA 5AXAA 2G0NA 4FI3C 4TN5A 3DZDA 8GPBA 2QUZA 5E2IA 4M8KA 4D8VA 1RWMA 5B3JA 2J59A 2Q3DA 2QG6A 3QWAA 3KD3A 1UDAA 5CB6A 4ETMA 2BKUA 1GDHA 3OQHA 1M6VB 3CUYA 5YASA 4KSYA 1AGNA 3WYGA 2H3EA 1SCBA 1UKZA 1DRWA 2R47A 2X9NA 1IOVA 1W5AA 2YJ4A 5L51A 4LFBB 1TTHA 4CCAA 1ISJA 2IUFA 2FWPA 1M1ZA 2SCUB 2XIQA 3ASUA 4EHFA 2IL1A 3A05A 4GP7A 5IDYA 1AK1A 2IWRA 1Q0ZA 2I2XB 2YVUA 3BXZA 3G1TA 3G9ZA 3ONFA 1LDEA 2UUAB 4LQCA 1PF7E 2EKPA 2P3SA 4A8JA 1O87A 3LDUA 4H0FA 1ZN2A 4WK4B 1I2ZA 3NHBA 4R2LA 5JTUA 2ZYWX 2W48A 2ZUDA 3C6ZA 4KDCA 4XEHA 1NVFA 2NZ8A 3I23A 2A9PA 3EMDA 4RH1A 3IEMA 4KZPA 4RJJA 3AH8A 1OFHA 1N7HA 2XMSA 3D4LA 4U2DA 4ZVRA 3WX0A 1DPGA 1I0ZA 4Y6OA 5DP2A 3D2AA 3GG2A 3L8MA 5AK5A 1YQEA 1PUXA 1UXIA 1ZQ1A 2Q6VA 4WDRA 4MRPA 5CA0A 1VDMA 5K0SA 2HQRA 4QL3A 1BDMA 1FJGB 1ZCAA 3CRQA 2I4RA 3H05A 5AI5A 5KZMB 1T9GR 2CLMB 5EIEA 3DZKA 2A4MA 4MUXA 4UXIA 2F9LA 3LWZA 2OCLA 2A9QA 1X38A 4ENSA 3EZYA 2FWIA 4OXXA 2GAJA 2VJKA 2AC2A 3WYNA 3CLTC 2C4MA 3KXIA 2JFBA 3KVYA 2EFDB 3M6UA 5HG0A 3SNHA 4MTLA 3TW8A 3T5CA 2QPAA 2ZTVA 3NNDA 2BKXA 2KW5A 2AE2A 3GH3A 1QHHA 2B0JA 3X2SA 3GIWA 4B7AA 5GTDA 1UMBB 1YC2A 2C57A 3EIEA 5CLLA 1YIOA 4KO8A 2B5VA 1SGWA 3CZRA 8OHMA 4AICA 2JI6A 1GYPA 1QGDA 1D5CA 2QVYX 2RGUA 3H3XA 4INZA 5L53A 3MTGA 3PIRA 2PJDA 4UDXX 3HP1A 1Z0UA 3LMKA 3UKOA 4D9FA 2DLDA 2H6EA 3CZ5A 3SAJA 1PNRA 1BQ4A 3U3OA 3L8CA 4RADA 4W5OA 5LDHA 4MWZA 2F67A 1BGWA 1GGKA 5FWNA 3RRNA 3PX3A 1ZRSA 2D2XA 4H7HA 2WBLC 4KFRA 1OFTA 1XU9A 5KMGB 1NVUQ 4IG9A 1BGVA 4PC2A 3IKTA 1FQJA 3BIXA 2RHOA 3KM0A 3QBVA 2PZAA 2FMUA 1XLTC 2O50A 3D4PA 2YFQA 1PJ3A 3FWZA 3W05A 3SHQA 3ZNNA 1ZP6A 5AVYA 1T4GA 3AX6A 4RD3A 4DXDA 4QHTA 4Q02A 3QPBA 1FC0A 3PC8A 5TF0A 5BSFA 4D0GA 2HO4A 2LNDA 3K0CA 4QFMA 2TS1A 1GZ6A 3LKZA 1JA9A 4GPIB 1NBMA 3ILHA 2YBEA 3BFXA 3LKBA 3GEBA 4ZCPA 1V35A 5BT9A 1T8YA 3AR8A 1M2WA 4C7KA 5FUWA 2QRUA 3PUVA 2A84A 4HP8A 2IE8A 4ACBA 3BA1A 1RIIA 3OO0A 1ZGCA 1Z6QA 4Y3UA 4B6JA 1AF7A 1EPUA 2QLJA 3ZU5A 1FCJA 4ZI5A 1MBZA 1SXJE 4HB2A 5FF9A 2GPTA 1D07A 3L1UA 4XSVA 3CPSA 2O1WA 4KE7A 4JI6B 1GFZA 2CW5A 2ODAA 2XB8A 4WK2B 3SC6A 4F3CA 4GF5A 4IW3B 3OPQA 1J5EB 2FLWA 2DP4E 4BBAA 1L5HA 2XNKA 3NU1A 4MLCA 3S2SA 1BHJA 4DIDA 4U0JA 3C3KA 1WZCA 4XIYA 3DUFA 4RSMA 5IZCC 3CIOA 2D5CA 4E1VA 3VKGA 5IT9A 1R88A 1ISFA 3EAGA 4WCVA 1H5NA 4RTOA 3M5PA 5B7QA 1FUYB 1ICEA 2I7CA 4UMEA 5KKAA 9GPBA 3B2EA 3J7AC 4B4DA 4Q03A 1DQNA 1JEYB 3PNPA 1AUXA 1Q95A 3A1TA 2CGEA 2VJQA 4YREA 3OZAA 4F5YA 1FX0B 2QL7A 1ZOIA 2XODA 4EVQA 3C16C 4M0EA 5TSDA 5HZGA 5DKFA 5J43A 1G7CA 4EI7A 5AVSA 2OBLA 4DOMA 1CHDA 4B84A 2HK7A 1GFIA 2YMMA 1SOWA 3GCZA 1Z26A 4YCNA 3EWNA 3HS3A 3BMXA 4LZLA 2PQ6A 3MYYA 5I9TA 1TQ6A 3P9PA 4UAJA 1NBOA 1AHIA 2HQ1A 4NPHA 8AT1A 5LKAA 3DDZX 3TQQA 1XP8A 4B6OA 2TMDA 4DREA 3D4IA 4WIAA 3NCTA 4E32A 3GEPA 3GXBA 1ES9A 5LA6A 3KEFA 2B4AA 1TAHA 4GRIA 1CJKC 3A58B 2VF5X 4V1CI 3P8ZA 2P3LA 1KZYC 4R3NA 3L0OA 4PTZA 2PVPA 1TK2A 1D9ZA 3WHKA 2XY4A 4TKVB 1WV0A 3HKCB 2NAFA 3QE4A 5CX1B 1HUQA 3CRZA 1XZEA 4JT2A 3TZKA 4CV2A 1PNTA 4R1LA 2BGKA 3FBTA 3L1HA 5AKXA 4D9HA 4DCCA 3K09C 1TEZA 3I9KA 1U11A 3B3QA 1KVTA 2ODEA 2GYWA 3AKCA 1ZK1A 4PYKA 4OFWA 4FR0A 4CL0A 2QRJA 1A1SA 1RXIA 3EMBA 4IZIA 1GKKA 3D7MA 1D9XA 4NH0A 2X0DA 1NW7A 5TE9A 2HMAA 3V48A 3AYXB 5AVRA 4E31A 2Z5GA 2ZZMA 3M89A 1L4YA 4YCJA 4X54A 1D1SA 1B26A 3MCUA 1JQJC 1T34A 5I3ZA 2VCHA 3R2JA 4N8DA 5BSTA 4XCVA 4PC1A 5JAHA 2PSEA 4C43A 3QNMA 1XVAA 1W4AA 3FMIA 1IRXA 1KMIY 1VXRA 2WP0A 4POAA 4QREA 1W73A 3AW8A 5LB2A 3RIHA 1EFAA 2KM1A 1EZZA 1JIIA 2CVQA 2J09A 2Z3WA 3HYNA 2GFHA 2XTZA 5HZHA 1XJ5A 3DV0B 1XLTA 4QOIA 3RHZA 1A9OA 2I6TA 2VPPA 5GVSA 4Z7QB 3DL4A 4NXNB 4I6JA 1M2OA 2GCEA 2DE0X 3G68A 3PDWA 2IKSA 1T10A 2OG1A 3GJ8A 4ME6A 4D1YA 3ZGVA 3RGGA 4E5YA 1WSBA 2CZGA 2G06A 1U28C 3L92A 1DX4A 2BEUA 4IVNA 4ZAFA 1UIMA 2MIIA 3VPHA 4XPZA 1FDUA 4A23A 3IUEA 1W2WB 3JPYA 3EB9A 3EJWA 3PDHA 5JNLA 4TRJA 3MWDB 4EB3A 2GASA 2GLXA 3DVAB 1EUCB 2ZJYA 1O6CA 4RE6A 1C7RA 1GCGA 1T0PA 1LEHA 1G8FA 4QUGA 1YB7A 4HC4A 2ISSD 2JHPA 1MO5A 3OIYA 3M4XA 2YWCA 3RV4A 1XCJA 1G2IA 4YCAA 1SN7A 5KNCD 4NU8X 4BX3A 4D3YA 3NYRA 2HWWA 1O89A 3THWB 3F5MA 4IQ4A 2ECQA 2VDWA 4ZALA 1QIJA 2AEFA 2XX3A 4MVJE 1SBYA 5AVOA 4CM4A 4JJIA 1G20A 5EJ5A 3HDTA 1GL3A 3T99A 2LWIA 5AJTA 4E33A 2ID4A 3T4PA 1BFKA 1DX9A 1SH7A 2DHQA 4U7GA 1W5BA 5JCJA 4BKRA 1GNPA 1M2HA 4D8XA 5IMSA 3EWIA 1P2FA 2RAPA 1RJ9A 3L4BA 4J4TA 5LDDC 4HKTA 3SVTA 3B78A 2CB0A 3PEWA 3RUPA 1AKNA 2E4XA 2GZ3A 4WCDA 5SZJA 2POCA 3FZEA 3SZOA 4YCCA 3VKHA 2EVWX 3PITA 1Z28A 1H6DA 4CQMB 4OQXA 2G1JA 5LZ5A 2HB6A 4DDMA 2MMCA 3QFHA 2BTEA 4C0AC 1FVFA 5ITZB 2GZRA 1UDRA 2A88A 2EJWA 3OETA 3RRMA 3QVJA 4BAUA 2XPCA 5DNUA 4QPNA 4M83A 4TT3D 5IN5A 3TX2A 4YT5A 2C3YA 2X1VA 4MW9A 5D85A 5D7NA 5GONF 4MK4A 3VRHA 3D5QA 1GZ7A 3PC6A 2XT9A 5KYWB 4YV0A 4LXXA 2XE4A 3FIUA 3IP1A 3NDPA 3FF4A 3T6KA 3HRHA 3TEJA 4QECA 4K9LA 3FNQA 3MCVA 3FDZB 4XWAA 2FPPA 4MMZB 4TS1A 1PK9A 1O08A 2QMHA 4LJ8A 4BFZA 4PYLA 4IJQA 4F8YA 2H06A 2Q8QA 2R7MA 3GFBA 4FYVA 1NW6A 3MUFA 5ALJA 3AEUA 2HWYA 2RH5A 1J2TA 1KY2A 4PZZA 4F11A 1U6KA 3W2GA 2IYRA 1CDDA 4HDCA 3CZ9A 4J2OA 5G3ZA 3C98A 5CA1F 1Y4ZA 3K09A 3VHXB 4BTLA 5C5CA 1BSVA 1SJ9A 1LVGA 1Z62A 2R5FA 3B1VA 4YUWA 7AT1A 3D3WA 4UHKA 1KETA 4K81B 3QBDA 4LF8B 3H9UA 3DXXA 2Q3HA 1KAOA 2P90A 3SFVA 4OMFG 4CI0B 3EGWA 5FL3A 4P34A 4WXYB 3PEYA 1DWUA 3PC3A 3W0LB 3WLNA 4REQB 3GCWA 1Y9AA 3LQYA 1I9GA 1DC6A 1LX6A 1MORA 1PWYE 2A9VA 1XTRA 2JJYA 2QRZA 2VNAA 1FDOA 1T4BA 4RCYA 3GLVA 3KCNA 4RMIA 3HG7A 3WMXA 5TVKA 4YPOA 1YQQA 1QU3A 1CFZA 3I01A 4ZXFA 3NTLA 4BQNA 1LB1B 3B9PA 4IQFA 1PNQA 3N9IA 1EVLA 3FNIA 3FOAA 1MVOA 1ENZA 3TEMA 4ALJA 3FKJA 1W19A 1NOKA 3KEMA 5EESA 4ALMA 4WNYA 1M2JA 2NMVA 2WQ7A 1K6XA 2JI4A 4HMPA 1AD2A 3EQ9A 3O74A 1FRFS 4ALLA 1FMJA 5GOZA 1MGOA 3WSVA 2BLLA 1I3CA 1U28A 4MA5A 1E1QA 3F90A 3E2IA 4RGVA 4XJXA 3LW8A 1G3IA 4KN9S 2AEEA 5AXCA 4R5HA 4BO2A 1L3CA 4QODA 5AW6A 5I5GA 4AC9A 2H4JA 2C9OA 2ACVA 3EVNA 4A8JB 5I48A 1VLZA 4FDVA 1RHJA 4DIFA 1UPXA 3IALA 4JJGA 2VSYA 4WCFC 3M4ZA 2W00A 2YN0A 4QJIA 3D4OA 5K45A 1JU9A 5FFFA 4HH1A 1P3DA 3VOBA 2GM5A 5CTAA 4P22A 2Q4TA 4OB7A 4KXWA 3B1ZA 3U39A 2XYHA 1T8UA 3A1NA 3NXSA 1IBKB 4F4CA 3CHYA 3O0DA 2HA0A 3L7BA 5CA0B 1T5TA 3PCTA 4ZCLA 5GPBA 3SDSA 3PUHA 4BQQA 5DFAA 2L69A 5AXBA 1XDGA 4R5MA 1HX7A 2PSJA 4EJ2A 3HQ4O 3BXPA 3VVLA 4IIGA 2YIMA 3RVQA 3MUEA 5CLJA 4G89A 3TE7A 4B31A 1SBQA 2INGX 1RZVA 5DASA 5JSYA 5C18A 1V3UA 4GXNA 4FDMA 3QU2A 1KQ3A 3BZUA 3T34A 5JVDA 4HADA 1KTVA 4IDDA 4D25A 4P3NA 1YQGA 2ATCA 1OMOA 3CZ4A 3TSYA 3HDYA 4MGHA 1QQ7A 2ZSFA 4U9IS 5ADVA 5DTJA 5EIOA 2UZ1A 3OHSX 5FI0B 5AKKA 3QMMA 4BZQA 3RW9A 5LDGA 1KGSA 2JFOA 3V00A 3GVIA 4QRHA 2OD2A 1GL7A 4EB8A 2OHJA 1HG0A 1T5DX 2GLTA 3U37A 5KYYA 2B4TO 4WACA 2G4CA 1CIPA 1GU0A 4IBOA 4NVRA 4BGUA 1H05A 1Z7YA 2I9KA 2FYTA 1YBHA 1B8PA 1YJAA 1YTLA 3MK31 3QK7A 3UG7A 1IEXA 2IRWA 2N75A 1Z37A 3IDAA 4D9JA 3ZGXA 4Y9SA 2ZRGA 1YZVA 1EJBA 3TOVA 3RKSA 2UXBB 4MV4A 2V6JA 5C5DA 2ZI4A 2QN3A 1ZGBA 2X19A 3FTDA 4ML3A 4Q3EA 3TFQA 1YE5A 2Q7DA 3HKBA 4KEAA 3W5CA 2HA3A 3HEAA 2C3UA 1SZDA 3ILXA 1YUNA 1H6CA 4INAA 4HRVA 3NBUA 2GLUA 1CLUA 2GSWA 1YIDA 3EFBA 4R81A 2Q1TA 1FDRA 3DMTC 3L82B 4E4RA 3G9XA 3L79A 3UATA 4B3BA 3WMGA 3CE6A 2DRIA 4FLMA 1NQVA 5A5GA 3K3PA 4DCVA 3U44A 3LCRA 1RI4A 4JU9A 3C5VA 3VNRA 1BROA 2PO7A 4S1PA 3GD7A 1MOQA 1RKBA 4JMLA 5KYUA 3DC7A 3IHLA 5D6OA 1V41E 1RQ2A 4JBLA 5L4NA 1KKMA 1LBTA 3AR6A 4G5QA 3IQXA 4PZ0A 1MJGM 4IHAA 1NY6A 3LM8A 4EM6A 3GP8A 5AVUA 2PZ8A 3OIVA 2OKGA 5JSUA 2B4KA 5B55A 3L01A 1G3RA 1MENA 1S5PA 2A9FA 1OKKA 1OCEA 2XOKA 3BN3A 4J49A 1N7IA 3RSSA 2QV0A 3RVOA 4BWGA 5ALOA 1XMIA 3A37A 3BGWA 4I9FA 2GA8A 4QBHA 4CCYA 1VYVA 3KR2A 4EQ6B 5DX0A 3CVYA 3VTFA 2A4KA 1CUDA 1C1YA 1I33A 2PS3A 4PLWA 3IQIX 1SHTX 5IZ4A 1YB6A 2HBQA 2RK3A 3OLZA 1VG1A 4QX6A 4EKDA 1ECJA 2YXPX 1UUFA 1MAWA 1FK8A 2WF6A 3H9BA 2FK7A 5HRAA 3D7KA 1Q14A 4YAUA 3D2CA 3K0SA 4I9NA 3BD8A 4K6FA 3SJBA 5BYKA 3LHDA 1AKVA 2VH1A 3K9WA 4LQLA 2OBBA 1OT5A 3BHJA 3EPLA 1X86B 3DE0X 1COWA 4II2A 1V37A 4YRLA 1TLLA 3GX1A 4WCFA 5BV7A 3QVXA 4L4XA 1B3RA 5JHGB 2BMAA 3DHVA 3TAUA 2VEOA 2VYVA 5TJ9A 2ECOA 3N0RA 1Y33E 2Q4RA 3DT6A 4MDEA 5C80A 4K0KB 2JEZA 2JFXA 5DDIP 5E0KB 4Q1CA 4QEKA 5LFAA 2ZB2A 4BKQA 2ID9A 2PH5A 4JMPA 4P7JA 5JDCC 3O2SB 5I01A 5LA6B 5TPZD 5CB4B 1CQZA 2YJ5A 1E0SA 1Q7CA 1D2EA 4FOTA 2H9YA 4G1VA 2Y1CA 4GGOA 1UJ2A 2AZMA 4OJYA 5IKEA 1JS1X 2BM8A 4QPJC 2EARA 4BUZA 1PNVA 1QK4A 1T2FA 2WYWA 3JPWA 3OE1A 3ITNA 1FZTA 3FFXA 4JLJA 2W4MA 4CLOA 3PHIA 4RPLA 3K16A 4WXMA 1UJNA 3K73O 3MS2A 4HNUA 4LQ4A 2YN4A 2LVBA 2JLYA 1YK1A 2IBTA 4TS9A 1QH9A 1XLUA 5HKLA 1FDWA 2I6SA 5IWAB 3OM1A 4EHNA 3JW8A 2ZPUA 3I6ZA 3A6ZA 3VSCA 1YVRA 2X86A 5FOWA 4YDQA 1VHDA 3HFRA 2IEYA 3N0TA 3K9LA 3UZUA 1NWHA 4F38A 1JFFB 4ZCRA 5LKRA 3CLRC 3EMVA 1MXHA 1EGHA 3IQDB 4RMNA 5FUXA 2OM6A 1E4VA 3EZ2A 3IMKA 3L0DA 4KQWA 5KO2A 2L19A 4HB4A 4YI3A 1UZNA 4KMRA 4MX8A 3WA6A 4QBTA 4PGMA 3RPEA 3MJCA 4G85A 3IUPA 2FPLA 4Q4CA 1BC5A 4G23A 4UOZA 3ZZTA 4WOJA 1JLHA 2Q7XA 2ETXA 2X2FA 4PHCA 3ZG6A 3DQZA 5CVDA 1M74A 3G5AA 3PP8A 1E9VA 2W6CX 1B8UA 1TC2A 2P1ZA 4IMRA 1SCUA 4DBLC 1J70A 3DJFA 3GP5A 1RQ7A 2J3EA 3VU0A 1NI3A 1XMXA 3P9NA 5BNWA 3UHPA 5IH7A 4JSYA 1IM5A 1OX4B 2DUJA 2X6RA 3GRZA 3H1BA 4JP3A 1JQKA 1FU8A 4YAFA 2XUIA 3DMTA 3TD2A 2ZIXB 5HS6A 3UFXA 1FFXB 1XZQA 2WHYA 4X1IA 3RVDA 4BCDA 4M0FA 5IXSA 3NX4A 3HYSA 2I80A 3PNMA 2F3UA 2DSNA 2RFLA 3DOOA 1E4EB 4LYYA 3UMSA 3VDXA 4BGDA 6AT1A 4IIVA 2GO7A 3AL2A 2Z58A 3INGA 1KEWA 3R5TA 2Q28A 4ZQBA 4WFQA 3SU8A 4DLNA 10MHA 4BEJA 1ZPDA 1Q1EA 1GUFA 1EE1A 4P31A 1PI3A 3OTOB 1UEJA 4DPKA 1SCDA 1DDOA 1IULA 1VPWA 1SCKA 2QT9A 1SY7A 3AR5A 5J4KA 5KSWB 2NYRA 4XOUA 3EPPA 4LWZA 5ESDA 2XCIA 3MCTA 3ZDRA 4AXBA 4YH1A 4RVHA 1II8A 4KCGA 2YY7A 1HZJA 1G20B 1N5OX 1PYGA 4OHOA 3TLAA 4B2IA 2V65A 3OLCX 2A59A 2Q5JA 1VXOA 4KZKA 4EX7A 3GEHA 2EKZA 1U8EA 2ZTMA 2ZI5A 1QV6A 5T5QA 1POWA 4G4IA 1FMLA 3AVUA 3P9XA 3ICVA 4EFDA 4U5XA 5K8LA 1A27A 4PG8A 3OOEA 2A78A 4MYTA 4L4SA 3NGMA 5IT0A 4XYEA 1JG4A 2W6MA 4LZNA 3H5LA 1W30A 4AJHA 1PWHA 3KRTA 3G6KA 4F12A 2JZOA 1OI2A 3A70A 2ZUCA 3PR2B 2G07A 3E03A 1XB2A 1WABA 3OFKA 3Q3IA 3B13B 4FZVA 4UKDA 4UUNA 2H1WA 5IAAA 5JZSA 1YZUA 4LOLA 3F7NA 4QUKA 1F8XA 1V2HE 2BHNA 3DE5X 3O73A 3PQEA 3OTWA 3S29A 1ZSNA 3PXDA 3WV5A 4AZWA 2JLBA 4OA5A 3HM9A 2PA3A 3R75A 1W29A 3NHPA 3PS9A 5E2BA 2JKYA 3OPVA 2VAXA 1C4XA 5K8CA 1VSBA 4DRZA 5JDCA 3YASA 2XZPA 1L3BA 2DHEA 3M4NA 4G1MB 4B4VA 5E7MA 1D0IA 4J9VA 1WOYA 4O2AA 4FB5A 1ZUNA 2I91A 3L7IA 2FPPB 2PJZA 3VU3A 2MINA 1HURA 3IR6A 4WLEA 3AV3A 1Z0IA 2DFLA 3F9CA 3HWWA 4KMOA 4GE3A 2VAVA 1D2HA 3ZDZB 3LDAA 1I6KA 1NVXQ 1QMPA 2FX2A 2X0EA 4JVLA 5CDFA 4S1NA 3T7DA 5DSTA 1OYWA 1I0IA 5C8DA 4F6CA 2GERA 3PE3A 2OHGA 4ESVA 2GJ4A 2QR3A 1OYOA 5B7GA 1ZJ5A 3EGVA 2EBWA 4BEWA 1CDOA 1Q6YA 1SCQA 4C7JA 1IPHA 5CDTA 2C2XA 3IDZA 4KK4A 4LJ5A 3VU9A 5HOEA 3P52A 1UFKA 4U4AA 3NS7A 1OAOA 2GGSA 3LGXA 5J2TA 1TTTA 1NYLA 2O7VA 3D31A 4HN9A 2BY4A 1J7JA 2H5IA 2JFUA 2XAUA 3PVZA 1YR6A 2VSQA 5EFZA 2WKPA 2HHCA 3QVTA 4JLNA 4ROTA 3I61A 1DG1G 2ZQZA 4Q47A 1R74A 5JXHA 1ZUD1 2Y6VA 4ES6A 1B2LA 3O6VA 1H69A 1QRAA 4WKNA 4DB2A 1L2TA 4ND4A 1AG9A 1UC4B 3KOYA 3FUXA 4PSDA 5DM0A 2DUMA 4HNVA 1MJHA 4HFRA 5BW6B 4BLTA 1DIAA 1P2SA 4IXMA 4PLYA 4KR9A 1T0BA 2M6KA 4DMUB 1CT9A 2RHRA 3E5HA 3TL2A 4AMZA 5CFRA 1RMTA 1FL9A 2VDKB 2Z5FA 3Q12A 3G8YA 4U7PB 4HH4A 3H2ZA 2O2ZA 3QA3E 4RPIA 4OKSA 1F9EA 1IZZA 1E79D 1YFKA 3IDFA 3VM6A 4KR3A 2ZUTA 2NO9A 1VHLA 4NZMA 3NI2A 3G6WA 3GA0A 1M8FA 1Y8QA 4P80A 5A6SA 1F0YA 3ETDA 2C98A 1JHVA 1QYCA 3UGJA 3I1JA 2C2OA 3GJRA 5IP5A 2HK9A 1UDXA 2WIBA 4LYGA 5BOSB 2TYSB 1WF6A 4HAZA 7ADHA 1NJ5A 2WINI 1GNRA 4ZV7A 1WCXA 2CNDA 1IJKA 1XCMA 3A1WA 5D87A 1H2RS 1MXFA 3Q2OA 3EASA 4AF6A 4GX2A 5BQOA 3H84A 3KT3A 2E4UA 5EWLB 2OA0A 3Q2IA 4ECEA 5IBCA 3U5TA 4RBNA 2AA3A 3ZQUA 3O8CA 1EEXB 5JANA 4ND3A 4U7JA 1QVZA 1BVYF 4BV8A 4YACA 2R6ZA 1FUIA 1VJCA 5KOIA 4IF6A 3T7KA 5CXSA 3ESCA 2B34A 3BEDA 1G9XA 3UKDA 3RYCB 1RYDA 3I30X 3TWOA 2G9RA 2FEMA 1O97D 3GH1A 3NHWA 5HF9A 2NSLA 4JIMA 2XZOA 5A3VA 1TU3A 3U6KA 1F0PA 3ZHTA 2FQYA 4DTIA 1P1RA 2C5SA 1J5XA 2HPVA 1NLMA 4K0RA 5FBWB 3P2OA 2BFEB 3WL8A 4PIVA 1WBJB 2AR7A 1ML4A 1PDVA 1S1CA 2FP4A 2VDJA 2VNSA 3GJ6A 3INRA 3K5WA 5DI3A 4KWEA 4JLVA 3VR5H 2IOHA 1RWXA 3NT5A 3NALA 4XXHA 4KAJA 3SQDA 1DHRA 3Q6NA 4PZDA 1ND6A 5TGDA 3L7LA 4O02B 5EIBD 4KOEC 3RLIA 4AF8A 2JKZA 3O1IC 5TX7A 4U2CA 2R65A 1N57A 1O96A 4AX4A 4B7CA 1GRNA 2RGYA 3PA8A 1XD2A 1ZY2A 3U4QA 4LJKA 4PYIA 3BXOA 3M6FA 1V9SA 4MQEA 4TM8A 5ELLA 4O4HF 2PX6A 1BXGB 1M76A 1ZI6A 1PJTA 2IZZA 1L3IA 2O0KA 1EGQA 3KPUA 2FTKE 3DMYA 4MTCA 2Q9BA 2QRNA 3PR1A 3VOAA 2FK8A 3GJ3A 3E48A 5E4JA 4ZT4A 1S3FA 2CDBA 5TJHA 5JW6A 3O1HB 4FBMA 5DYWA 3L49A 2W2OA 2PDAA 4KNVA 4K9QA 1L4HA 2VUHB 3ZVKA 1MIHA 1WDKA 4TPKA 3LIPA 1J42A 3HO6A 3RM3A 4E03A 2IS1A 1ZM7A 3ED5A 1LPAB 1LI7A 4R83A 1V8OA 2CDAA 1XT6A 6ABPA 2BFCA 2AD5A 4MRNA 1NRIA 5DN6D 2YKGA 3H18A 3H2YA 3G2HA 3CIFA 4P2BA 1W8IA 5CFZA 1QF6A 5AW1A 4BO4A 5DEIA 4NK4A 1J2EA 2V4MA 3BBLA 3KB6A 4KSCA 2R8YA 3TZBA 1JSCA 3GBVA 2X0KA 2VHXA 3MINB 3CN7A 3U16A 2R25B 3SWWA 1BFDA 2VDLB 3VYRB 4V0MA 1A50B 5EVJA 4U3JB 1L8AA 3ZD8A 5CLFA 3L6CA 4FEEA 3GAFA 1SUCA 4CCYB 3PT5A 1A77A 5BQ5A 5KC9A 4WWHA 3NLLA 4IIYA 4RZXA 1BS1A 4U2FA 4Q9IA 1FJXA 1IEWA 1UF9A 3ZDQA 4B73A 3PD0A 2E87A 2FDCA 4C2UA 3SC4A 1JPNA 2DKFA 2FPWA 3M6AA 4R16A 4NHEA 5IPFA 3JVIA 4CBVA 3O4JA 2AZDA 2ZREA 3NFRA 1K5PA 3NETA 3W2EA 3O38A 1WNTA 1R3UA 2WWFA 4YUZA 1ADBA 2O3JA 3G9TA 2NNWB 4EEKA 1PQUA 4NQRA 4DLPA 1CYEA 4WCFB 3G8DA 1HTWA 2EQAA 1EX7A 4MUEA 1I51A 4HNRA 2WF7A 4KMSA 3WKAA 2P7HA 1BRTA 4IZOA 3TRFA 2GZ1A 2X8LA 1JHRA 3WDSA 1W9HA 4XYLA 1C50A 4X44A 1M33A 2NVWA 4LEIA 1G21B 2H31A 2PL9A 4KIJA 2OORC 3LKDA 3CF4G 3DDUA 5CGZA 5DHAA 4UNSA 4A92A 4P58A 4CM3A 1WMBA 2ZJBA 3LLMA 3PLRA 3OZWA 4JCCA 3JQGA 3EGXB 2G7ZA 1KHHA 4MKFA 4L57A 4OK5A 5ALYA 4A0SA 3D3EA 2LE0A 1G5RA 4W5TA 1MC8A 2RJ3A 4YRFA 3AR9A 3F6YA 3O8OA 4AD8A 3T3PB 3A2NA 3GGGA 4XUCA 3FSGA 1ZW6A 2WJWA 4UTXA 3DHNA 2EAUA 1M1UA 1AKWA 1ZHHA 1QAOA 2CV1A 4MVJP 1X70A 1U3FA 3M70A 4XVQA 1OT3A 4ZN6A 2I78A 2PWAA 4I19A 2PMDA 2G8LA 1FNBA 4ARCA 1M8JA 1Q7EA 4RHYA 4YMGA 1K9SA 2F1OA 2OGWA 4O3FA 3UHAA 2B99A 2C92A 2Y0CA 5EKTA 2IHZA 1Z5NA 4KE9A 1LX7A 1M7HA 2YR0A 4HD8A 4L73A 3BB3A 4MJ3A 4N6NA 4EKYA 4EATA 3OY7A 2ZJ6A 3SYTA 2C8KA 1YBMA 3ZHVA 1NVVR 4MP3A 4URFA 3GNQA 1IC6A 4ATNA 2VHVA 1EK6A 2V3VA 3VZBA 1CRQA 1NVDA 3ZE8A 1JV2B 3QXSA 4NMMA 1AXGA 5I3CA 5MN5A 2EKQA 3WLJA 2DLCX 5E95A 3D4BA 4RIFA 2WFMA 1C7FA 1J6UA 4UBLA 1QJ4A 4EY8A 1FP7A 1EA7A 1WB6A 1M7BA 1RC0A 3KALA 4GM4A 1NYQA 1SCUB 3LQ2A 4B3FX 1U0JA 4V3CA 1NVKA 4DKJA 1OZHA 1VE6A 4NEGA 1ECPA 3RU7A 4U5QA 4RTKA 2PZGA 2Q4DA 5EE9A 3QF7A 3DF9A 4IIXA 1YB4A 2WZDA 2PLAA 4LXIA 1AT1A 5AD1A 3UFXB 1JDJA 2HREA 1JXAA 1GTMA 4X1IB 4EKNB 3A25A 1UZMA 4LVOA 2RKWA 4HZUA 4NI5A 2H17A 3O2NA 5HF5A 5J4YA 3DE6X 5HOQA 5CLHA 4OATA 4N03A 3U31A 2J33A 2PGIA 3KXPA 4W9RA 4IHKA 5ES3A 4OXQA 2EZUA 1T1GA 3RUDA 3BWVA 2ZYSA 2DT5A 2NUTB 5COBA 2VATA 1V8DA 4KQHA 4U9HS 3DV2A 2HJ9A 3EFEA 2PZLA 4NV0A 2V7XA 3IAEA 1T6BY 2G5PA 1RLIA 4JFRA 5H81A 2ILTA 3HB1A 2F90A 3DO6A 4JELA 5E6UB 4ZGGA 3BIFA 3U4CA 2PZMA 4Q6WA 3OKCA 4J0IA 4PPGA 3QFCA 1SOAA 3AM5A 4FFRA 1OJLA 2FW7A 3S27A 5EJ6A 3FPLA 4DCOA 1TT5A 2QUAA 2IEBA 3V4OA 4A91A 1R5JA 2I29A 1QO9A 2WT9A 4Y9DA 2ECKA 5JNVA 5DMXA 4FZ3A 1RACA 1S7GA 3PZRA 2D1FA 4KODA 4BVJA 3MEQA 2PYZA 2G83A 2R6AA 3IQGX 4K26A 4UPEA 2J6HA 2GPYA 2QM8A 2O5VA 2V55B 3JARA 5CFQA 2FOIA 4KV9A 1I7SB 2Z2KA 3H5TA 4EABA 2G88A 4LHWA 3CKMA 1OW3B 4E5UA 1TW3A 4JQOA 4EARA 1N5IA 3KXDA 4Y1RA 1FDTA 1VSQA 1E62A 2YOFA 4QNMA 5ALQA 3S7TA 2EF1A 5D5PA 2VTBB 2R8PA 2R60A 1HY3A 5ECGC 5F7ZA 4DFDA 2PUCA 2DGDA 3OF5A 3HBJA 4H4DA 4JLBA 2XDQB 2HJVA 4ND2A 3FDJA 1XHEA 1Y5LA 2HMUA 3G9QA 4XEUA 5DCWA 3ZNOA 3WGVA 5A0VA 3A6PC 2KWIA 3CCCA 1TADA 3LH5A 1JMYA 1AUPA 5T64A 4CKBA 2GTPA 4YFVA 4MQ6A 1W6UA 2ANBA 2OORA 2ORVA 5L4LA 3GNSA 4J0DA 5D6NA 3ZWYA 2XQFA 2FG5A 3HUEA 2F3PA 4OEHA 3Q7IA 1X9HA 1YQUA 3KLBA 3JZDA 4O2AB 3STHA 3R3HA 4HVTA 1ZUNB 3EVGA 5JI2E 4FSXA 3IE1A 1KJJA 5HQJA 2E1PA 2RCNA 1DV1A 4RVOA 1G5IA 5JZ9A 5ARBA 4OHRA 2JFQA 2ZUUA 2OC9A 4X3OA 1EZ4A 5MFPA 4JL6A 5GM2A 3QU4A 3VPXA 3IV9A 5FA8A 4E2FA 1XZ8A 3BH0A 4M0KA 1X8KA 2JLVA 5JSKA 1XI2A 3EXEA 1RJWA 3K5IA 3TQHA 1KJIA 2ZB3A 2QD3A 3DQQA 4PAQA 1YMQA 2C29D 1YFLA 3LCUA 4R40A 4YI5A 4N5HX 3D64A 4GI2A 4WXRA 4HL6A 4DDKA 1Z6GA 4F5WA 3QV1A 1EXDA 1INLA 4V0OA 1XA0A 3SXPA 1H6BA 4FOOA 4G0YA 3ZV3A 1QIMA 4B48A 4CJXA 3JX9A 4D97A 4IJUA 3ZWDA 5F98A 3RS7A 5AW2A 5J2TB 1LK5A 1LLDA 4HXGA 4FT2A 3UVEA 4M6WB 1FUUA 2XQIA 4BMPB 2ZG6A 4XFDA 4BRZA 4YQFA 1Y5IA 3KKPA 2CEKA 1YQ9A 2IZ1A 1VYTA 3VZCA 5IKMA 1U80A 4KKXB 4OJQA 3FW1A 5C4IA 1BHO1 4DQLA 2LTAA 3RS9A 2Q2QA 2A5DA 2OV4A 4PBRA 1ZCBA 1K8QA 1W4CA 4R1NA 1W75A 5K4HA 3RTAA 2Q5QA 4DA8A 3H19A 3OWHA 2R85A 4YJ3F 4P2GA 5AM1A 1C8VB 3F5FA 1SQGA 5ALGA 4TQGA 1K0FA 3FD8A 4MIKA 1DV2A 3U3RA 4WA8A 3G2PA 3AESB 4FYYA 4GEGA 5GM1A 5AW9A 1MX3A 2CBXA 4FNOA 4LK3A 2GJ9A 3I8SA 3L46A 3R7AA 3A6LA 5E3HA 5LP1A 2PNFA 3QKSA 4ZODA 5T8KA 3X1YA 3U60B 5IABA 1Y8QB 3DLPX 5A6SB 2IYSA 4JITA 2MMGA 4LJ4A 2QLBA 1C9EA 4JI2B 2AOTA 2WWWA 3GZNA 4PYOA 1R66A 3WIEA 3ZEAA 4DSUA 2CY0A 3U1TA 2YRFA 2EBHX 2WSSA 5DCYA 5LQNA 1YDWA 3SICE 5EWMA 3SXJA 3EXFB 1KK3A 3M2PA 1XKQA 2WIDA 4I7EA 1O0CA 3LO5A 2HGZA 3IVMA 4IJKA 5IW8A 1K5HA 1RAAA 1G55A 4BE7B 3JQRA 1O5OA 5AI6A 3VR5D 2DVMA 4C06A 3SC3A 3PRJA 2XTMA 1PJRA 2OENG 3C5HA 3N0VA 2PRSA 2H11A 4QIHA 4YJHB 2OVBA 1Q1NA 3JQ8B 3FRHA 4NQZA 1D2GA 5KVVA 4R2KA 3HWX1 3KC2A 4IZ6A 1XEAA 1YNSA 4ISCA 1U4OA 4AMYA 4BQOA 3R0XA 1MH9A 2GVDC 2OFPA 2OXRA 2GD6A 1E7WA 4GAEA 4KQCA 4XM0A 1SHZA 5DJ5A 4W6ZA 3IBFA 1OTHA 2AN4A 2Q46A 3WMEA 3AUFA 4ZCQA 4YIHA 1RKUA 5GINE 3PDIB 2OTCA 3SSNA 2PXAA 2Z6UA 5LQJA 1MEJA 1RBMA 2B78A 2RGWA 1A76A 3N8GA 2VPWA 3AEKB 3IVXA 2N42A 2P40A 3TZ6A 4RTNA 4XAQA 2V97A 1JL3A 2WU3A 3ON5A 3LQ4A 1J20A 2ZANA 3FYDA 1M75A 3ZDYB 3EDOA 4GMKA 2ZP1A 4U7TB 1KBQA 1KPHA 2XE7A 5DU2A 1MTZA 1UM9A 1KRWA 1QGUA 1D7AA 4E6PA 1RJDA 2H4XA 5KNLA 4F6RB 3ZDEA 3OLQA 4RSGA 3RHSA 2IYTA 1C7ZA 1BS2A 2VNJA 1O96B 3SP1A 3JS5A 3G8BA 2H3HA 4OK6A 4OJMX 1XD2B 1Z45A 4QD3A 2GILA 3TVDA 2VDOB 4B32A 3R7WA 4LFCB 1CJUC 1EM6A 3RG8A 3LBAA 3ITDA 1E89A 2FDRA 3EEOA 1THTA 2B4YA 3I32A 1KOFA 1YWGO 4FNGA 4FXOA 3GPIA 4EUEA 5LU9A 2I5PO 5BN3A 2FUG6 2CKMA 3AM4A 3PHGA 4JJFA 3TQTA 2OXEA 4MUGA 2W2KB 3VKUA 4N7JA 5HBRA 5FEMA 3FCUB 4BNLA 1QNLA 2Z1NA 5JS8A 1XNHA 4UTZA 2CFSA 2A9RA 3IURA 4K6HA 4P4SA 4YHBA 4B33A 2OV8A 2HDOA 4WUTA 3UV7A 2HWUA 3AVYA 1X1BA 2CZQA 3L0PA 2BFCB 1I0LA 1G6Q1 5JSZA 4Q1FA 1I1NA 4R6WA 4J4BA 4LRQA 2BEWA 2G82A 4NCAA 4U7HA 1VJDA 1CRLA 2X1MA 2ZR7A 3AB7A 1GGEA 4U6QA 3UM9A 5IK2D 3FNGA 3IAS1 1BE0A 2AZXA 3LHIA 1LRKA 3DR3A 3H2KA 1JQLB 4OAQA 4L6CA 4M9SA 3U9LA 4KN8A 4YJ3B 2QNBA 3PX2A 4HGZA 4F4FA 4QUIA 4EZIA 5HYVA 2J46A 2FF7A 3ZW9A 3AL0C 1C9DB 1NUHA 3SMVA 4AJPA 1JECA 5WRFA 3VUEA 3SIXA 5DW0A 4X65B 2F8SA 2X2EA 4ASUA 1VHQA 3Q6IA 1FYFA 2FR0A 5TV2A 4PZCA 1XQXA 3AHIA 4K7JA 5EMLA 2Q5EA 2QUBA 1PR3A 3A9RA 3DNFA 3O90A 5F2NA 2Q1YA 3LJKA 3VAYA 4MYDA 3DDOA 1MH1A 1O94D 3LZ6A 3CR8A 3TDNA 4A6EA 5AQ1A 4G4SP 3WK9A 1CZHA 3ZPXA 1MJNA 4GPEA 2C7RA 3QLUC 1OFVA 1P80A 5DT2A 3HM2A 4JOBA 3SKVA 3UUFA 4LNAA 2CMDA 1ZITA 3PVCA 4TV8B 1CEYA 3PXAA 1Z8HA 4C30A 5CVTA 5IKXA 2FF5A 4YMVA 4F2HA 2C4WA 2HA6A 2YASA 5H9WA 3FCAA 2GSDA 2QA5A 2WWHA 1JMKC 2HXYA 3HO8A 1OXSC 2B20A 1SKBA 2P2ZA 2SBTA 4PO9A 3WADA 1MJ5A 4WJZA 4LY3A 1XDDA 2I4OA 4Z99A 4M3NA 1LQ2A 5JD3A 5KI6A 2WSYB 1NXWA 1Y89A 1SG9A 2HRCA 2SECE 3B36A 4QBGB 2V7WA 3RIYA 4ZCIA 1UL1X 3QEBZ 1FA9A 3AP2A 3MZ0A 3WI7A 4RORA 3NBMA 1SQ5A 4CLXA 3KHSA 4OTZA 4HS9A 3O8OB 4H7DA 1G9TA 5G0VA 1XTPA 3MTIA 3NRCA 4R1QA 1KZ7B 4EFLA 4F96A 1SUFA 5A03A 1U94A 2BSAA 1CUZA 1NYTA 1QR2A 1UBOS 3C74A 2QPLA 3G5UA 4FIZA 1LK7A 2FE4A 4PCLA 4MI3A 1K7EB 1GR1A 4YB8A 1KS2A 4DVGA 3ZKWB 1U1FA 3EISA 3G8AA 3QF4B 4X9XA 4QXOA 2DTDA 5K0ZA 1LK0A 2R6HA 1YRAA 4I2NA 2HF7A 3FUUA 1PK7A 2IUUA 1P4HA 2JFFA 3IAM1 4GD3Q 3RTGA 4LBZA 3FCOA 2DBVO 2Q4OA 3T0GA 1ISRA 1F6BA 2V7BA 4LJSA 4NICA 4B2PA 2HYIC 1KEVA 1VCIA 1T6ZA 3K05A 3B9BA 4DY6A 3AILA 2O8CA 2RHHA 3K94A 1Z4QA 3QYPA 1KH1A 2D62A 4LZOA 3H1PA 3KKMA 4RKRA 2IEGA 2RONA 1I5EA 1X1RA 4KVGA 2MDTA 4UNQA 5BYBA 4M7RA 4OI1A 3RVSA 5CEEA 2QSYA 2C42A 5ALHA 3DZIA 4ZOAA 1N32B 3LX4A 3LL4A 2DERA 2BHLA 1RZUA 5M04A 5FUBA 4ZHSA 2P9CA 2B9VA 2PWPA 1Z6XA 3H1AA 1NJGA 2J4CA 4UBMA 3FMOB 4LUCA 4QFBA 4ZTUB 1SU6A 1YI1A 2WSMA 2R6FA 4ARIA 2HPAA 1LBQA 2WG2A 3OQOA 2CJPA 1NXPA 4YC7A 1E2HA 2IV2X 2ODPA 3FAKA 2VBIA 2R87A 3IAXA 2LGJA 1COZA 2I1WA 4AY2A 3OJOA 1JILA 1HDIA 1XVIA 2AHOA 2OYSA 1WD5A 3MM4A 2IYQA 3NHFA 4UD2A 4UHEA 4W1SA 4X85A 1T43A 4R84A 3S7ZA 1OX6A 1QH0A 2X7XA 3ZJ4A 1JQBA 1FS4A 2ZE6A 3ZWBA 2GPJA 5FL7D 2CHVA 1RT9A 5CX4A 1AUOA 5ALLA 3EX7C 5IC4A 3WLEA 3F96A 1NIPA 3IPRA 1SUSA 4YP0A 3U9SA 3HU5A 3LHSA 1H94A 2GB4A 5KWJA 3U3DA 1Q0LA 2EFEB 5J5VA 3UXYA 1CDZA 3FOZA 4M7OA 1P1JA 3QVUA 5H5JA 1IHDA 2MSDB 1S4QA 4C3VA 4AULA 3VA7A 1O0BA 1TK9A 1M1YA 3GOQA 4TYYA 2CFRA 1PIWA 4UTOA 2P69A 3JQFA 3FY4A 3ONVA 5JYBA 5CDYA 1FSSA 1YH3A 5CD9A 2ZYGA 3GZ4A 4UJ3A 2C31A 4ZOLA 1FW8A 1MDFA 3JARB 4DSZA 1S2DA 3KQOA 5I4BA 1OHHA 1E4YA 2VTKA 4LCEA 3D8TA 2QI9F 4F9EA 2Y2VA 3I1YA 2HOQA 2XHEA 3QLUA 4K9NA 4Y1RB 1AQUA 2COEA 2D0OB 3KU4A 2XKJE 3WL5A 3QJ5A 4MLPA 2AKYA 2POQX 1QH8A 5HE9A 4HH0A 2NGRA 3CYFA 3E1KA 2WQ6A 1IXZA 4BMSA 1PCXA 4JJ4A 4AUMA 3COPA 3JWIA 3PGXA 4FMDB 3B12A 5MFZA 5KUTA 3NNSA 4PN7A 4G1UC 4CKBB 1ZHOA 3TSCA 2GNAA 2HHAA 3MN1A 4BX8A 3F4KA 4CGZA 5AKHA 1C7QA 4RHUA 4O1MA 3CVUA 4YAGA 2ZITA 2PS9A 1D0VA 2QRGA 3P9YA 4WASA 1KKLA 3BGIA 3R4CA 4FCVA 4UNNA 3UMJA 3UWPA 4QGGA 1GA4A 4I0WB 1NJ6A 2PGAA 3GJQA 4L3OA 5KPJA 3HHPA 3BWCA 1AM4D 3PVSA 3OQBA 4K1XA 4MPPA 4MVJF 4RPJA 2EFYA 1IMOA 4XZ3A 4L2IB 4OU5A 4LNUA 3ZV6A 2I8LA 5IAJA 1JP7A 3B20A 3BG5A 2B4QA 3KQTA 3PUXA 3PG5A 2ATEA 3U5ZB 3EW7A 5CLGA 2OYRA 4J3JA 3EXEB 1PGNA 1GUZA 4L0CA 4WA7A 4CQLA 3F1KA 3UXHA 4FX5A 3IFSA 3G2KA 1NUQA 2FGKA 1XPRA 2YCLA 4ZMSA 1V95A 4S12A 2CHFA 3UOWA 1JLRA 3OEHD 4P7GA 5HQ3B 1U2TA 4TSFA 2ZS9A 1XWWA 1X3SA 2ONCA 5KB3A 1B74A 5FAXA 2IYWA 2PXCA 3I45A 4A5OA 5IT4A 3BCUA 1W85A 3KKEA 4MHSA 4E5PA 4ENPA 3LCMA 2CCGA 2CZCA 2GBCA 2NNLD 2XA9A 1DOHA 3V80A 4LOIA 3WBBA 4RETA 4MUJA 1K7XB 1XEFA 2AXNA 2DBYA 3B70A 5C34B 4JYZA 4HB0A 2CK3A 2GX6A 4N54A 1GGFA 4Q7MB 4WT7A 5BW5A 3WKBA 4V02A 1UXJA 1R15A 3DKPA 4MMXB 1KYZA 4ZICA 3A9UA 2AW5A 4RK0A 3DE4X 2BGRA 4DDVA 1NVWQ 4JEIA 3WK8A 1L7QA 1R6UA 5BMVF 3VMFA 3GD5A 2ZBPA 4TS4A 1TOAA 2CYAA 2QZZA 4FOPA 4RMHA 2PK3A 1ISMA 2SKEA 1JF8A 1YRYE 3E3MA 1RQGA 2FWAA 4Y1EA 1TXGA 4X1YB 4HJRA 5BRJA 2FWRA 3UXEA 4TXHA 4QVKA 4DCNA 4CG2A 3IUQA 2G9VA 3CNHA 1J5PA 1JAXA 1QRRA 2HIAA 2QY9A 3GMSA 3I9LA 4GXQA 2IU0A 1KHTA 4GRAA 2YHAA 4EELA 1UWVA 2O0LA 1IM2A 1JLLA 2J6CA 4JASB 3HZRA 3Q98A 5JBQA 3GZTB 4FN4A 4O0MA 1AO0A 4N47A 2AOTB 1IOZA 1EMDA 2W5UA 2WD7A 1KVSA 1R8XA 2EF0A 1Q7BA 3ZVMA 1ZIPA 3B8HA 4FSHA 4WBSA 2P5UA 4YJ2F 3T94A 2KE5A 5EWMB 1P1CA 4IXNA 2ORIA 4DS3A 4EFNA 1G5TA 1V11A 4UTRA 4G63A 1GNTA 3O9ZA 3FTQA 1P2VA 1Z4LA 3CO0S 3WLLA 4BFLA 3U1BA 5ERXA 2W6JD 4LHSA 3W7VA 1SB8A 2OXCA 1JT9A 2XCUA 4MRAA 5DOZA 4DEXA 2M6RA 1KP3A 2I4LA 4BLQA 2QPTA 3FZQA 1IE3A 3P0RA 4Y1FA 4XJSA 3A06A 4DYDA 1SKAA 2I34A 2G09A 2JRCA 2VOJA 1CF2O 1K8XB 1WE2A 1ZUHA 2H54A 2GDJA 3A4IA 3C3AA 3UMMA 1SOVA 4MEJA 1N2SA 3K0KA 4UAVA 2ZT5A 1EE2A 2VI5A 4EEZA 4DANA 1KZ1A 3DFUA 2VP0A 5BNFA 1IY0A 1DRVA 1XRJA 3C3DA 1UBJS 3PQ5A 5B1EA 3MOGA 4DGQA 3LCJA 1Z47A 3P9SA 4YAOA 1RBQA 5CEFA 4WLNA 1MJGA 2B4RO 1EFTA 3ILSA 4L85A 1VL2A 3A1UA 1EFVA 2PRJA 4FYJA 5ALFA 4X8HA 3VPDA 4MIOA 1ITZA 1Q91A 3T4XA 2AG1A 4W5NA 5EI5A 1UOOA 1UM9B 4KXQA 4QUJA 3FNBA 4H60A 4XWOA 3PJFA 4XGRA 1SIOA 4PLVA 1WCIA 5TT0A 1QGZA 4XUGB 4D3SA 4CM7A 2HWKA 4ETWA 4MLDA 5GZ3A 2YHSA 2IUTA 2ZI6A 2PQMA 3JZMA 2H7CA 3S8MA 4C3ZA 5KEIA 621PA 2C59A 4YRBA 2JATA 2ETVA 1TFUA 2B21A 4UHDA 1CR2A 1ODJA 1R0XA 2CLDX 2HEGA 4QNRA 1XN1A 4BFYA 1E6MA 1RRGA 2MT9A 2OPHA 2RI1A 1KBZA 2JF0A 1Z0SA 4RK7A 1Z8NA 5ENZA 2D5IA 4I4TF 4P4SB 2X2PA 4XR4A 2FW6A 2F9MA 3BULA 1RCTE 4YRTA 3RU3A 3WZMA 2P41A 2PRZA 2FP3A 4C4XA 1WQ4A 3M6MD 2H1HA 2CYCA 4JP2A 5TQ0A 5JYEA 1R0LA 1HH4A 3EIXA 1W6RA 5AIAA 1GZDA 1KJWA 3ROQA 1E18A 5J4HA 1K66A 1WW2A 2BEWB 3MMSA 4AYTA 3KUKA 4HAWA 4J94A 3NYQA 1HYQA 2CEAA 1PZMA 1V6AA 2WAOA 3JY6A 5JXGA 2QRHA 2ZSUA 4RF2A 5E4FA 1T6XA 1X2EA 7MDHA 5BMVB 1TE2A 4L95C 5EIXA 4PZUA 3BK2A 1UR5A 2ZKLA 2HIGA 2VCEA 1U0OC 3L0ZA 1F48A 3SQXA 1SBNE 3UGKA 5AJUA 2CD9A 4O4IA 3R5HA 3HK2A 3SX0A 4AF7A 1A2KC 1E2JA 1E0KA 2BFBA 2B8EA 3FOCA 1NE2A 3HKDB 3HYLA 3T8YA 1FP4A 5JROA 5GQSA 3AKDA 4YYEA 3E8XA 4JT9A 1N2GA 1VRWA 2EZ9A 3PXEA 4GQBA 3UBTA 1C29B 1YE8A 2GNPA 4D26A 2VJPA 3X1DA 4S05A 1CKEA 1N9KA 4QDZA 521PA 1YKFA 3IO5A 1JR3D 1MB4A 3CXUA 2HU7A 3V7FA 3KLOA 3OOSA 5CNMA 4MGIR 3AJAA 3DGEC 4GDMA 2IV3A 4ZHQA 2A9KA 3SM3A 1CEEA 1DC7A 1OB2A 2I66A 4J7AA 4B4OA 2GZHA 3BJZA 4EIWA 4DEVA 1M1NB 2C96A 1L5MA 2GN0A 1AZTA 2F59A 1P4SA 5KYTA 4NU6A 3WAKA 5DW3A 821PA 1FIUA 4GOLD 1S2OA 2P3QA 2P5TB 4I4CA 1ZEMA 4MI6A 2QRPA 2X8AA 4GNRA 1BDJA 2IEDA 1VKRA 2PLWA 1R0KA 1B42A 2R751 3DLIA 4IV0A 1UJ4A 2PX8A 4PGFA 5JYDA 5AJZA 1RMQA 2RAUA 3MJVA 3COVA 3PQ7A 2DUWA 2IIVA 2JCXA 3MF4A 2NXJA 1J0CA 3AF1A 1RQXA 2MSKA 1JLMA 2HFKA 3NC1C 3V8VA 2MSLA 5L7TA 2M6LA 3CTPA 5DP1A 2BFFA 1N92A 2VHEA 1NXXA 2IS4A 1W35A 4WN3A 5JTTA 4ZDKA 2OOSA 3OTIA 4LDQA 3MA0A 3ZXYA 2CXHA 3WE7A 1RNLA 2AMJA 1TO1E 2WHRA 1THMA 4IKPA 4LJYA 1DNPA 1Z0ZA 4OQEA 1FBNA 1LVHA 4CNQA 1A4XA 2E2WA 1WU7A 2PXHA 3NO4A 4GWGA 3ZWPA 4PWZA 2OD7A 2HH9A 4RXUA 2EATA 2WJYA 4A0QA 1UDCA 2FLKA 5JT1A 1EBBA 5E9QA 2NACA 3LNTA 3AIMA 4Q9DA 2O8CB 3DBLB 3BAFA 3G3EA 1MRNA 3PNSA 4ESHA 1JFRA 4FZ5A 2IYEA 2ZSEA 3IDQA 3O7MA 1VP3A 4YMIA 1X1AA 3IIKA 4UUAA 2I6XA 3KJNA 2E4AA 4KXUA 1U8AA 3WLOA 4ADSG 5J58A 1OAKA 2HIMA 4KUEA 2ZIAA 4QDXA 4Q9LA 1GP2A 1NMZA 2IYVA 2V8BA 2VKQA 1R0BA 3HBLA 4NE7A 2J0VA 4X5OA 1H0KA 3TNYA 3Q8WA 1D2AA 1RXSA 2P4EA 1SRRA 2YV2A 3BCHA 5A3QA 5EE1A 2HRQA 3M6XA 4A0HA 2RGRA 1DQZA 4TUYA 1VOTA 1MU0A 2VQDA 2P2CA 5FIUA 2WAXA 2EFHB 4YMLA 3TG2A 2WB2A 4V2IA 4I1PA 1NUUA 1N1GA 3IQFA 4UNPA 1OASA 3M9XA 1GQFA 2ZAGA 3BRWA 3P26A 4NTZA 2HLHA 1W9MA 3CVVA 1GTSA 2EOAA 1ONOA 3T1VA 3OHMA 4RF4A 4PY2A 1WQ1R 4EF4A 3DXFA 5D1NA 4O5OA 5FPYA 5LUAA 3JZFA 4X3CA 3F6RA 4UARA 3LWDA 2DHCA 2FVXA 1R50A 4PAGA 4TWZA 3F97A 3KLNA 2WVJA 5K3BA 3AI7A 3UV3A 3ZD6A 1ZOOA 2ZYTX 2R8OA 3LX5A 4KU4A 1BKSB 3BDIA 4NDAA 4U8GA 4X8LA 1NV9A 4LK2A 4HXEB 4F1WA 1C5KA 4M0LA 4DRYA 2EQBA 3KBBA 3RROA 3H1GA 1RWVA 3S0JA 1KZGB 1NAIA 1NQTA 4PGGA 3AFHA 3TI7A 1HDXA 2PBLA 4D5GA 3PICA 4R01A 5A5VA 5BXYA 4V1CA 1EP9A 1V3TA 3NQ41 1JUDA 1M1YB 1JDSA 2B0CA 1RPAA 1YACA 2QRVB 4TL8A 4MO9A 4MGYR 4PO1A 3I4CA 5L4SA 3OP4A 1XZIA 2ZJOA 4F7WA 1ICIA 5EHQA 4NABA 5AOAA 4JB3A 1P8JA 2H85A 2ZATA 3E9ZA 3S5JA 1T3HA 1Z5UA 3VZPA 5BV1A 1BRMA 2NM0A 2G76A 4G26A 1CV2A 1TCBA 4XX1A 3W7AA 3ZU3A 3LW7A 1WUIS 4R1SA 5AM0A 2MYTA 3NOOA 3MAAC 3OZFA 2BCGY 2C0QA 4EGAA 5DZSA 5B6PA 1ZINA 2CNLA 4C01A 3SFTA 4EYGA 5LZ4A 4J0CA 3SMQA 1GAXA 2Y66A 4W4TA 2A5YB 2JCVA 4W63A 4FS8A 1YBFA 4EJFA 4C20A 2C4HA 1RU3A 3VAAA 1HFJA 1DJNA 1Z9BA 2LD4A 3KPWA 4NE2A 5AM5A 2WR8A 2W0SA 2Y1GA 1KNXA 1PDWA 1V5GA 1Y7TA 1I01A 1ZNYA 3E9RA 3KZMA 4LDZA 4MP8A 3WLPA 3HXMA 4ONEA 5DLQC 3TIFA 2UDPA 4GMGA 4Q3OA 2Z98A 2ZUVA 4DA6A 1MT0A 4FYPA 1DUVG 1F2UA 1KEUA 4NFLA 1XIVA 2VRWA 3QTLA 1FYDA 3SZMA 2QD4A 3PE6A 1E6WA 2GXSA 3ZHOA 5EUCA 3NUQA 3I1FA 4B8WA 4NJMA 4LNUB 5BNIA 2GCOB 3HRKA 4R0MA 4QPPA 1NNUA 1P5FA 1QOZA 1N6NA 3G2OA 3T5GA 5A4JA 5EZYA 2DSTA 3ORHA 3LC1O 3QXGA 5C8XA 3QPCA 3AHCA 1AHPA 1JI3A 2WWTA 2NPIA 3HL0A 1RRVA 1C0IA 4YV1A 5AHXA 4FC7A 4K2HA 2FDXA 3KB1A 2BTOA 1VFPA 2FFBA 2OD9A 4RV4A 1KWKA 3GJZA 1RWOA 3LTNC 4MWOA 1RXWA 1OIVA 3UW1A 5IAKA 5JAPA 1XELA 1X42A 2BFNA 4F7DA 3UPUA 2HFJA 4OHUA 2REQB 2HRZA 4CEJB 3STTA 1ZC3A 3KQUA 1KAEA 2RI6A 3C5CA 1JQAA 2GPAA 2AYZA 3SZ3A 4I1IA 3E84A 4QO7A 3TTWA 1K27A 2IP4A 3H87A 4MAMA 3O95A 3P2KA 4YJFB 1CS4C 1ZM4A 3TKYA 3NCHA 5DYYA 4E88A 3JWGA 3MOIA 1KI1A 2JB9A 3GHHA 1U5CA 3GQVA 5CPFA 2PSHA 4KBFA 3SJ7A 2OVFA 3OH8A 1Q0UA 1I94B 1Z6YA 5FBZA 1NXSA 3EUFA 1KO1A 1FP1D 1LPPA 4S1TA 1X7GA 2GN4A 5EGNA 5DO9A 1WTAA 2A1TS 2QJWA 4JOSA 1RLJA 1QHYA 2OXTA 3S68A 3PTLA 3S2GA 3ZGZA 4B47A 3UT6A 4WL0A 4FILA 4JODA 1M9NA 3QMWA 4M53A 3G0IA 3AI2A 4BO0A 1GUDA 1GPH1 1GEGA 4LXYA 4WZZA 1VCOA 1Y3BE 5ANRB 3I6MA 4E4YA 1WA5A 4BC1A 3VNBA 1F38A 1WZIA 4UE2A 3OCUA 4D46A 1T8TA 3MGGA 5JC8A 5B3AA 3PNVA 1I3LA 3E3AA 5E1DA 4WZBE 1WB5A 1GPMA 4HRXA 5KTMA 1GXSA 4B6FA 1JLLB 1U0FA 2AB0A 3N07A 4GOXA 3JVDA 2ORWA 3GDFA 4JD5A 4NCNA 5D7BA 5BNZA 1BVUA 1KERA 3CF6R 1ISGA 1MO2A 2KB0A 2WD7B 4H1VA 4JP5A 4YALA 4WSOA 1Y1SA 4RJTA 4HGNA 2C0PA 5FBKA 5I4CA 2H2DA 3ANSA 3OZDA 4Q9AA 4OHPA 5D01A 2ZB4A 4WBXC 4C1NA 1U3DA 3OMWA 1P7CA 5TS2A 1XAIA 4Q12A 3F78A 2CMGA 2JD2A 3IAS6 1N6PA 3U7QB 3WDKA 3LE8A 3TZCA 3RF7A 2FQ1A 4BFTA 3VYTB 5LD2C 1IN8A 3LK7A 1KI7A 2Y0DA 3B1WA 3CONA 5CP8A 8ATCA 2J0UB 4Z51A 3LFHA 3EPKA 5SYMA 4L1KA 1IBMB 5BWLA 2X9GA 4II7A 2GK4A 4K9RA 3STVA 1A9RA 3WLSA 3K70C 4FKMA 2WTEA 5I9LA 4YP9A 3WMFA 3ML1A 1H8ED 3TN7A 3RRJA 2P4SA 3TQIA 4B6SA 1BVRA 3VZRA 2XF8A 5JXIA 1EJ2A 1XPJA 3I64A 4BFUA 3I8XA 3NTUA 1TIKA 1CZLA 3H16A 3NTVA 5LYJA 5A9SA 1ZL2A 3H97A 4LMPA 4TLMB 4XPIA 5COAA 3DTYA 2VBFA 4HNHA 4QU5A 1W1WA 4BP1A 4CDGA 4C4TA 2BGMA 5ALTA 4AZVA 1G17A 5H68A 2NO0A 3GCXA 1EH5A 1EFVB 4XRRA 2W4IA 3HZOA 3AKEA 1Z4PX 5C8VA 2HV9A 1RPJA 3B6EA 3BMOA 1PGPA 2YUIA 4EL5A 3RFCA 2P77A 2ZPTX 1G4UR 3DMNA 3GNTA 1HDOA 4FGKA 3NHLA 1WCIB 2Z9CA 5AHOA 2OHOA 4EI8A 2ZBGA 4RHXA 1NBAA 5JNUA 2VOEA 1RC1A 5KVQA 1ETHA 1RKQA 1R0WA 4JC5A 2H0QA 6GPBA 3PTAA 1JEAA 1TLFA 3BQ9A 3RAPR 2J1LA 3IJRA 3IV6A 5B3LA 4IFBA 4RESA 4BZXA 2ZCUA 2BL4A 1OXXK 2JFVA 5C8YF 1N2JA 3EZGA 3HJFA 2JJMA 4NBWA 4IXDA 2FW1A 4K2AA 5KAMA 1TEXA 6NULA 5JFOA 2RAVA 1NULA 1G8SA 1QLJA 1B0AA 1Q0HA 3D8NA 4RZ2A 1X1EA 4TWAA 1XCLA 2FR1A 3VNQA 3W3AA 1AMNA 2EKDA 2XZLA 2HF8A 5EXPA 5TQ0B 3PPXA 1D8TA 5ICSA 2VWPA 1J4AA 3F6PA 5CFMA 3S1AB 5F35A 3FDXA 1DJOA 3KX2A 2FMFA 3U09A 3GFTA 4NBLA 2WJ6A 4IFTA 4B6QA 4CF5A 1AQYA 4D0NA 1HGXA 2IYZA 2WLSA 1V1MA 2TMGA 2YMLA 4UHFA 1T1EA 3OY2A 5DHTA 2I2DA 3WMWA 2IZOA 4Q16A 1PK8A 1TVCA 1UQRA 4O4IB 4KQ2A 4OI0A 1I6WA 2AI3A 4EY7A 2BFBB 2ZRIA 2PBZA 1H22A 1RYMA 5HCUA 3ZWVA 1DCTA 2GBFA 5CIYA 5BR1A 2G5TA 2AT1A 4BWFB 4HNQA 3DPUA 2F9FA 5A3SA 2XUKA 4HVAA 5EJGA 4BIIA 5ALPA 1IXSB 1DPFA 2XNSA 3D5TA 4QBFA 4QVGA 2GD1O 4TMYA 1L9XA 3SDZA 4OLAA 4N5NA 1JKIA 5DNCA 1Z7BA 1ZJYA 3HB0A 2QT0A 4JDUA 4RU1A 3WO1A 4ZHQB 3R74A 3H42B 3LXUX 5DTEA 3SSMA 1N6RA 3TLGA 1XYYA 3PNBA 5FH9A 5JVDF 3FWYA 5A7HA 1U1DA 1HEYA 2CF6A 3PBKA 3VV3A 4BFWA 1K88A 1ZRMA 3KJFA 3SYRA 3TLEA 2A86A 4F06A 3G0GA 1E92A 3GEDA 3V1MA 1O5TA 1PLJA 1I36A 3BE8A 2AUNA