3CH6A

Crystal structure of 11beta-hsd1 double mutant (l262r, f278e) complexed with (3,3-dimethylpiperidin-1-yl)(6-(3-fluoro-4-methylphenyl)pyridin-2-yl)methanone
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
264
structure length
264
Chain Sequence
EFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSRWTTLLIRNPCRKILEELYSTSYNMDRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pyridine amides as potent and selective inhibitors of 11beta-hydroxysteroid dehydrogenase type 1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
total genus 98
structure length 264
sequence length 264
chains with identical sequence B, D, E
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2008-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ch6A00
1WNTA 3NT2A 4R1TA 1NAIA 3I3OA 2PV7A 1XYGA 4RPLA 3WTBA 4GX5A 4M54A 1LDBA 3IJRA 1M2WA 4YJGA 1HDZA 4YRAA 4GLLA 3C1OA 3F3SA 3M2PA 5A4DA 1VJ0A 3H8VA 4JX8A 4UUPA 2RHRA 4QTZA 1EDZA 1GUYA 1Q0QA 1ULSA 1YKFA 3X2EA 2YFHA 2PY6A 3GK3A 2P2SA 3OQ6A 5CDYA 5AOVA 4E3ZA 3H5AA 4NFHA 5JW6A 3B1KA 1YB4A 4O63O 1D4FA 1OC4A 3WGQA 4RF3A 4FCCA 3TRIA 1GV0A 2C82A 4IJVA 4NU5A 3KSDO 1E77A 4UUMA 5DZSA 4E2YA 2NUAA 1QKIA 3EYWA 3E9QA 5AVOA 3ASUA 3QVTA 1WW8A 3FN4A 4BNKA 1KEWA 2DQ4A 3WQQA 4Z6KA 2IEDA 3GUYA 1VJTA 1ISJA 3EW7A 4CR7A 1KBZA 5I7FA 3JYNA 1DHTA 2YDXA 3TFOA 1ONNA 4WEQA 3JYLA 4WECA 1DRUA 4QX6A 2HMWA 4BKRA 4M87A 2PKQP 3WICA 4IQ8A 4EDFA 3ZHZA 3MJVA 1H9AA 1DIAA 1HDCA 2YDYA 4IZIA 5EESA 4A0SA 4HFMA 3SC6A 1PS8A 1ADFA 3TZQA 1DDOA 4BNVA 2RBEA 1WDLA 4E5MA 4GMFA 1N92A 5IXYA 2E37A 4CM3A 5L4NA 1GU7A 4K1LA 3ZNQA 4E6PA 4CQLA 1MUUA 3GZ4A 1DLIA 3QQPA 3PYLA 2C2YA 2PGLA 3LZ6A 3Q3CA 3GEDA 3RUEA 5G4KB 4FC7A 2BH9A 1LRKA 2PK3A 4E12A 2I67A 3TPCA 5EMHA 1HDRA 2Z95A 1GUFA 3KXDA 3TFQA 1IL0A 4EITA 4PLGA 5CEFA 1VSVA 4RORA 2YHIA 3WMXA 1KY5A 3GZNB 2BHLA 4ZA2A 1QG6A 4J90A 5KJ1A 4GPD1 3ZNPA 2I3GA 4RVSA 1U4OA 2Q1UA 1ENOA 2E4AA 3ROPA 2VUSA 4QUKA 1Y8RB 3DOOA 4M49A 1E7RA 4NBWA 3JQ9C 1JVBA 1P33A 2NQ8A 4MVJI 4ALMA 1PSDA 1Z6ZA 3BHIA 3HG7A 3RCBA 5CDTA 3H2ZA 4HUJA 4XB1A 3WIDA 3ZU4A 3FBGA 1ZXLA 5JYDA 4AJ2A 1VI2A 2OOSA 2GLXA 1E1MA 4Q3BA 2VN8A 1P31A 3ONFA 2DPGA 5EINA 4J7XA 1K6JA 2CUKA 2PD4A 2W8ZA 3NGXA 3GG2A 1W73A 4BNWA 2DC1A 3DEYX 1P9LA 5ER9A 4WKGA 1WMAA 3WXBA 2O3QA 4R5HA 4OL9A 1W0CA 1VLLA 1D7OA 1P1JA 3SX2A 3NDJA 3OIDA 3AY6A 4LGVA 4YPOA 5I8WA 3C24A 1YL7A 2I65A 1MC4A 3IC5A 3P7MA 1X14A 4FBGA 3TDKA 2QW8A 1DFIA 1U7HA 1HWYA 3V1TC 4FR5A 4W9NA 3RBZA 4LRSB 1GCOA 3EY4A 1LQUA 4Y8VA 1R4NA 6LDHA 4L74A 3W1VA 1AE1A 1H5QA 3RIHA 3T7CA 1ID1A 1U2GA 2BGKA 3NDRA 5ICSA 1PQUA 2AQ8A 1ISMA 2O3SA 3ZWPA 3MTGA 1DC6A 3ONEA 4B4VA 4BO5A 3RBXA 3FSRA 4CLRB 2DFDA 4B4UA 4QFDA 4CMBA 3K96A 1E3IA 1JA9A 2G5CA 2JFHA 3B6ZA 5TS3A 1JLLA 2X9NA 1EBUA 3BYZA 4D42A 3JV7A 4IDEA 1IOLA 4X54A 3TZHA 4BGVA 3I9JA 4ND1A 4NBRA 5C37A 1FK8A 1YBAA 4Q9NA 4YJHB 1E6WA 5BQFA 1NWCA 1Q0HA 1IPEA 2HK9A 1CETA 4JXKA 2XPCA 1GTMA 2YFQA 2Q2WA 3EZLA 4FW8A 4IXWA 5JSFA 4DIOA 3KETA 3VPFA 5G4LA 2A94A 3TOZA 3H9JA 3PLRA 2ZJ0A 3OH8A 4IIVA 4NI5A 3RKRA 3ANMA 1RM0A 4IUYA 1T1SA 3JD1A 3PHLA 5DP1A 3ON5A 5FI5A 2HKIA 1EE9A 3K2EA 3HN7A 4GKBA 2GO1A 5F3RA 4D7AA 1VL6A 3AUSA 1LU9A 3ETDA 4CLEA 4RV9A 4TRNA 4R9RA 1B3BA 1E92A 4WCFC 5AXBA 1O0SA 3UICA 4ALNA 2DBZA 5COAA 4EJMA 1LX6A 2G76A 2LDBA 4J3FA 4J6FA 4GQAA 1JTVA 3HWRA 4GL4A 4B8ZA 2GERA 2ZJ1A 2FWMX 4U5QA 2A4KA 1NP3A 2VHZA 3ADPA 5T57A 3CKYA 1YOVB 3B70A 3NRCA 1B8VA 1PGJA 1LUAA 5IZCC 1ZIDA 4IIUA 4LSMA 1DAOA 5I7SA 1FMCA 5HTOA 3WQSB 1BSVA 2Y99A 3WGYA 1TB4A 3PJFA 1LLCA 1Q7BA 4PG8A 5JDIC 4YAKA 1C0KA 2BI8A 3O38A 3QWFA 4XJTA 4ZD6A 3ZV4A 1GL3A 4L9RA 5A9TA 2Q46A 3Q2IA 1ZK3A 4FFRA 4L4RA 4U7WA 3K5PA 5EL0A 2BELA 4I5EA 3JQEA 5L7YA 2DT5A 1IE3A 1VPDA 2R00A 3JQCA 1MG5A 4NBTA 1MFZA 3C7CB 4R51A 2QYTA 1OZAA 3HZZA 1EE2A 1YB5A 4NPCA 1L1FA 5IF3A 5JCJD 1QYXA 3B20A 5B4UA 3Q1LA 3FCOA 4AFNA 1P1IA 4M55A 2O3RA 1MXFA 4PZCA 4BKUA 4PLYA 3ADOA 1I0ZA 2VRCA 1ZXBA 1OFGA 4OSOA 1A7AA 4XGNA 3HDQA 1E3EA 1E7WA 3BMNA 4E2WA 3NYWA 5JY6A 3EHEA 3O9ZA 2PD3A 1UXKA 1LDYA 1U3TA 3IKTA 2EW8A 3H9QA 4GSLA 3W8FA 5L4SA 4J91A 3D1LA 4OYRA 3ONDA 1C1DB 3L4BA 3CE6A 4BKQA 4BNXA 2VHWA 1UAGA 2YV2A 4LCJA 3ZGYA 2VWPA 2WD7B 1UDBA 1IULA 4CMJA 1Q1NA 2Q1TA 3DL2A 2YV3A 3D4NA 2DBRA 3GH3A 3GN1A 5KJEA 4LN1A 3H9GA 1KYQA 5JAMA 5KJ6A 3O4RA 2GGSA 1SPXA 3GAZA 3RKUA 4BO7A 5EJ2A 1R15A 1Y1PA 3TSCA 1BXGB 1BG6A 4DMMA 3TZKA 3K8ZA 4CMIB 3WYEA 1MB4A 1T25A 1K6IA 3ZHBA 3S2IA 3VPSA 4DA9A 2Q4BA 4LSWA 5COQA 5DBGA 4Z0PA 3MEQA 1GZ6A 2O4CA 4JJGA 4J9UE 3SEFA 1B8UA 2IDZA 2HJSA 3DAFA 5CAEA 1GPJA 2X58A 2OO5A 3M1AA 4U8GA 3ULKA 2TMDA 4MVJA 3DBRA 1H2HA 3Q9UA 3HFSA 3U5TA 3R0IA 1KOLA 5JDCA 5TQVA 4XGIA 1FF9A 3OJOA 1P0FA 3KLMX 4KTTE 3FR7A 3W4JA 4CMAA 3HHPA 2C7GA 1ZJZA 1BTOA 2ZKLA 2EHDA 3AOEC 2PKQO 5F5LA 3BA1A 4RF5A 3VZRA 1PL7A 5AYVA 3FHLA 3ROKA 1ZMOA 1UXIA 2Q1SA 1XSEA 1U9JA 3WG9A 4DPLA 1I8TA 3A4VA 3PJEA 1YL6A 3GOHA 4CMEA 2GSDA 4YRBA 4RVFA 3UKOA 2CVZA 1DC5A 3F1LA 4E2XA 3OEWA 5A9RA 3AOGA 1E7QA 3RU7A 1G1AA 5IG2A 4IGFA 3DMYA 1P3DA 1YDEA 1QR6A 4I8XA 3RASA 5HM8A 3UXYA 2NVBA 1KIFA 4L4SA 4J1TA 5KVVA 4B79A 4D3DA 1NPTO 1XR3A 4WLNA 1MGOA 3INTA 3F6YA 1I3LA 2C7VA 3JQGA 2JKVA 1T2CA 2P5YA 1YQGA 3PQFA 3DZHA 4DYVA 1PU2A 1JN0A 3DFZA 3BMQB 1E6UA 3F9IA 2OFPA 4BNJA 4XIJA 1EQ2A 3VPHA 4UULA 2X22A 4ZQGA 3VHRA 1GQ2A 1VRWA 2IYPA 3OIGA 4BO4A 4CMEC 1LDMA 4BB6A 1P1KA 1IYZA 2AA3A 1QV7A 3E82A 1B8PA 1H94A 4CMCA 3M6IA 3O03A 2B4TO 2VWQA 4BS9A 3NGLA 3KVOA 1IUKA 1U3UA 4BOYA 5I9NA 1PJLA 3LC1O 2V6BA 3AUUA 3CZRA 3S55A 1NQAO 2X5KO 3KEQA 4IY1A 3EGOA 4TKLA 4UEKA 1YB1A 4AJLA 3PFFA 1NM5A 1I2CA 4YAIA 5DP2A 2ZATA 3GY0A 1RM3A 4YXFA 5JDCC 5L4LA 1EK5A 4HWKA 3VZPA 3AW9A 4NBUA 2X7HA 4FPXA 1HE2A 1NXQA 3R3JA 4CJXA 4CPDA 4NJMA 4FB5A 2E49A 4Y6RA 3JCZA 2O3TA 3DBVO 1QORA 3C1TA 3MZ0A 3V8BA 5A9SB 2C54A 5IZ4A 1A71A 4FN4A 5C3MA 3PWSA 2NU7A 3ETGA 2JFFA 4MVJF 2CDBA 2A9FA 4GI2A 1QRRA 1AXEA 3H65A 1HRDA 1JU9A 1X7HA 5ILGA 3WNQA 5BR7A 2UVDA 1LRJA 2D4AA 4MO2A 5JYEA 2P9EA 3AY3A 4J16A 4BNFA 5DCYA 3P19A 4DRYA 3DTTA 1CEQA 3KSZO 4NIMA 3ZHYA 1I30A 4EUHA 1M6WA 1N1GA 4F3YA 2ZQYA 1K0UA 1EVJA 3IL2A 2FSSA 2IZ1A 1MX3A 2E48A 4Q3NA 4TRRA 5G4KA 4L8VA 3WWZA 4XA8A 4XYEA 5B4TA 3K6JA 5L95A 2DVMA 3DWFA 4MINA 3U09A 2E6UX 2GPTA 4XWYA 1L7DA 5A03A 3ORFA 1B7GO 2PZLA 3GFGA 5C7IO 5JAQA 3UH1A 4ESOA 2RAFA 2OL4A 5ER6A 1XDWA 3ZW8A 5CDGA 3HNPA 2OZPA 1LC0A 3GPIA 3P2YA 4DYDA 1WP4A 2O2YA 5F21A 3AY7A 2J5KA 3QY9A 2CVQA 3FNEA 3ZWYA 5K6AA 4G65A 1NVMB 4CM1A 4XJSA 4D45A 3TZCA 3KSUA 2GN9A 3AU9A 4BQRA 3G0OA 1QYDA 1MFPA 1NHWA 4BNZA 3ZI0A 2H63A 3WSWA 1FJHA 3MTJA 3PRJA 1XLTA 4YTEA 3X2FA 1YO6A 4W6ZA 5THQA 3GN2A 1Y6JA 1BW9B 2YHUA 1BVUA 1JDJA 1W8DA 3LYLA 3MCVA 3AM4A 2W2LA 3K9QO 3OF2A 3OQ1A 1N1EA 1TXGA 4IDAA 3JQBC 4KZPA 1F0YA 1A9YA 1QMGA 1R0LA 2C20A 3AFNA 4PLZA 1Y8QB 2HMUA 5T8KA 5JS6A 1LDEA 1SOWA 2PTGA 2I99A 4R3WA 4HP8A 3FWZA 2QRJA 3B1FA 4OH1A 2UYYA 1LLDA 3JQAD 1EMDA 4OSPA 4FS3A 4N18A 2HCTA 2X8LA 3CINA 4KMSA 4OM8A 2CMDA 2WE7A 4AJ1A 3RJ5A 4AJIA 1TLTA 3PPIA 1QLJA 2VHVA 3W6ZA 2HJRA 4TMFA 2PWZA 4BKPA 3LT0A 4HXYA 1RPNA 2NU6A 5FF9A 1LXCA 3ZDFA 3GF4A 2C2XA 2ZYAA 4RPHA 3Q9NA 5CDSA 2BI7A 4EGFA 4JQCA 2H6EA 1WAMA 4BO1A 2OBYA 3ZNNA 1R4MB 3EVNA 1ENYA 2LDXA 1O94A 2ZK7A 1E3WB 3AK4A 4FQ8A 1DJNA 1QSGA 1U8XX 2VUTA 3C3XA 3QVOA 3BTUA 4LVCA 1WPQA 3HSKA 4WOJA 1C0PA 2NVUA 4GLOA 1P77A 1ZCJA 2RH8A 1F14A 3HDHA 3A1NA 1XHLA 2FP4A 2PZMA 2FY8A 5IN5A 3I83A 2X5OA 3NX4A 4MDHA 4FDAA 1AN9A 2AMFA 5U9CA 5DF1A 4E13A 5IXSA 4J1QA 4CMHA 3ZWAA 2Y67A 4CV1A 5ES3A 2BKAA 4R1SA 1HTBA 4CM8A 1PJBA 1U8FO 1MG0A 2NQTA 2X9VA 2G1UA 2WD8A 2VT3A 1ZK2A 5FYDA 1O5IA 1GAEO 1GCUA 4FGSA 5C7LO 4OAQA 4PRLA 4Z3DA 4BNHA 2VQ3A 3DAGA 3I52A 1UXHA 3QRWA 3QVXA 1KY4A 4IJUA 2YQ5A 1XCBA 3JQFA 3ZU2A 1I33A 3GC6A 4B3JA 4W9NC 3OHSX 5JAIA 3NEPX 4OMUA 1C1DA 4DQXA 4GBJA 5T67A 4QEDA 2VRCD 4IZHA 4OQYA 4MVJE 3WJ7A 4K6FA 3JD3A 2D8AA 2FMUA 2QRLA 2WD7A 4XGKA 2P4HX 3SVTA 4FJ1A 3WGTA 2CF6A 4CLDA 3PWZA 1FDSA 3QSGA 4JP3A 1V9LA 4PRKA 5HBRA 3PI7A 4GWGA 5G0TA 3BXXA 4MPDA 1A4UA 4WNCA 1I3MA 3C1AA 4GKVA 4CM6A 3BMNB 5ITVA 4B4OA 4QO8A 1Y7TA 3M2TA 3OA0A 4WASA 5KKAA 3WFIA 3DONA 1U4SA 4P8RA 5AQ1A 1GZ4A 2HU2A 3NTRA 2VOJA 4IMRA 4J0FA 2DUUA 3AUTA 4BNNA 4D41A 2V6GA 5BNIA 1MA0A 1GY8A 4U0KA 3DAPA 5ICMA 1YVEI 4CMGA 4CV3A 3WX0A 3AJRA 4C4OA 1I32A 3JQ9A 1DFHA 4PLCA 1GR0A 1P1HA 3C8MA 4HKTA 1DIBA 2JHFA 2ZTVA 3QHAA 2GCGA 5T8KC 1NQOA 4R5MA 2X9GA 1ISFA 3KYCB 2ZB4A 4OKNA 4R9SA 4YJFA 1GEEA 4LCEA 1FDVA 2NVWA 2EIHA 1KC1A 2Q49A 2NTVA 4A10A 4ZGWA 1V6AA 4NQZA 1EZ4A 4N7RA 4RJTA 1BDBA 5JNLA 5H81A 3KOUA 3DQPA 5T64A 4Q3CA 2HQ1A 1PGQA 3E9MA 1CQJA 1PZEA 4IM7A 1M67A 4KTVE 1LSSA 4KUEA 2P9CA 3TL2A 4HY3A 1U28A 2A35A 2FSVA 1GYPA 2H9IA 1KVSA 2EV9A 1BW9A 4E33A 5BT9A 2B37A 3WNVA 4B7XA 3DBRB 1UZNA 2ZIZA 2I6TA 3BIOA 1SBYA 5JC8A 5JE8A 1PJSA 1XEAA 3PHIA 1XQ6A 3F1KA 1F8GA 1X15A 4JCOA 3S2GA 5COBA 3PTZA 1PR3A 1VE9A 4PN3A 1DOHA 1Y8QA 2UAGA 4U6QA 4Z0HO 3VTZA 5CDUA 1LRLA 3MWDB 1Z74A 2EXXA 3GGGA 4WLEA 1W4ZA 4L75A 4ZN6A 3MJEA 1G0OA 2FPPA 1E3LA 4O5OA 4GH5A 5KNLA 3D7LA 1E7SA 4WCDA 1XG5A 3NTOA 2CNBA 3OP4A 3I9NA 3GEMA 2JD1A 3WJAA 4DPMA 4WLOA 1C14A 2FPGA 4CUKA 3L6DA 4PIVA 2PH5A 2P9GA 1XWFA 1LJ8A 4EBFA 4DC0A 1M75A 4BMNA 1YXMA 4JN6B 1WZIA 1DRVA 2PFGA 1EVYA 1ZEJA 2Q4EA 3Q11A 4IBOA 1KEVA 1NAHA 4FJ2A 2AQHA 1IY8A 4YAEA 5GZ1A 4CM4A 1JKIA 3IMFA 4AJHA 3GGPA 3OJFA 4ZQBA 2CFCA 3I4FA 1PWXA 4DXHA 1SAYA 4AJKA 1PJ3A 4I5GA 3RSHA 3L6OO 1WVGA 3NKLA 2V65A 1G6KA 4DLLA 2PGJA 1XKQA 2V6FA 3O8QA 2GN8A 3L9XA 3JQ7A 4WCFB 4NBVA 4ND5A 1B2LA 4RL6A 3DBLB 4TRJA 2C07A 5IDQA 3DB2A 4CLHA 1HKUA 1P44A 4OOFA 2OMEA 3PZRA 3UAGA 5CPBA 3WGOA 1GV1A 4DTIA 5TT1A 1PJQA 1HEUA 3TZ6A 3L0DA 5A5EA 3JTMA 5TF4A 1YS4A 1EVIA 1RKXA 3KB6A 3U3XA 2FN7A 1PGPA 5A5FA 4CL8A 1TVEA 3EUWA 4NU6A 2AQIA 4Z9YA 3COSA 3D3EA 5F1PA 3JQBA 3GDFA 4A27A 4YT2A 1TA4A 4CODB 4AJNA 3DOCA 1QYWA 4FFOA 4UREA 4XD2A 2FPIA 3ZW9A 2BFMA 4YT4A 1ZK1A 4XQGA 5FWNA 1B3RA 2W2KB 4M89A 3JD0A 4CM7A 3PK0A 5AXDA 5ITWA 1R66A 2NTJA 1FDUA 3RVDA 4YRDA 5JO9A 4WLFA 3FTNA 1EFLA 1WZEA 3NDIA 4GWKA 4PLVA 3KO8A 2QRKA 4KUGA 5JXWA 4XIYA 3WDSA 1U3VA 2Y1CA 4BIIA 3V5NA 3E48A 1EQUA 3DZJA 2VZ8A 3B1JA 4BMSA 3L4SO 3AM5A 4DIFA 2XAAA 3HUDA 3VKVA 2HK8A 4DGSA 3OBBA 2H5LA 3ZV3A 2NADA 3RUAA 2I5PO 4E0BA 4P38A 2JCXA 3SBOA 3AOEA 2C29D 1ULUA 2HRZA 1Z73A 4HNGA 2W2KA 3RC7A 3INGA 2NTNA 1UDCA 3GPDG 4UUNA 2WJPA 1DAPA 1HE4A 2AEJA 3PLNA 4I9HA 1SC6A 5A02A 3RUFA 2R6JA 1QP8A 2B35A 2RHCA 3TWOA 2EGHA 2NU9A 3LSYA 3ZWXA 3NTQA 3HFGA 4RVUA 3WOHA 3U4IA 3LU1A 3ETEA 1JAXA 4J9VA 3WR5A 3DMTA 1YGYA 3D5TA 4E5NA 1ZFNA 1I3KA 4ALJA 3UCFA 3LK7A 4GVLA 1ZVMA 1HDXA 2JJYA 1YH3A 4UVIA 1ADBA 9LDBA 2CSUA 2QG4A 5DDIP 3DMTC 2HDHA 3GT0A 4XQ9A 3SJUA 3LQFA 1E1NA 4RVDA 1NR1A 4TVOA 3DR3A 4YJFB 1R4NB 5B1YA 3KYCA 1U5CA 1NTOA 1A5ZA 1BVRA 7MDHA 1ZUD1 4D3SA 4F45A 5IJZA 5A3JA 4MJLA 4H3VA 2O4UX 4PFJA 4DIBA 1BXGA 5CFZA 2XXJA 1VL0A 5JMWA 1I2ZA 1JKFA 4UVHA 2Y1OA 1F06A 4MP6A 1OAAA 3L6EA 1TT5B 1O9BA 2VTDA 2EKQA 3TQHA 1R0SA 5TJ9A 4J43A 3PJDA 5BSHA 2VYND 1RWBA 3HDJA 5B12A 1WMBA 1M76A 4BUCA 2Q3EA 4ZQHA 2EP5A 4G2NA 3DZFA 3WSVA 3BMCA 4P4NA 3RQSA 4CLRA 3RFTA 5GZ6A 3OJ0A 1AHIA 2WTBA 3F4BA 1ENPA 3STHA 1CF2O 1ZKMA 4BO6A 2OORA 1F12A 1BRMA 5IDWA 3U4CA 2QYSA 1NFRA 2HAEA 4B7UA 3DHEA 3VPXA 4DQUA 1HYEA 3F46A 1QXSA 4NH4A 4QFCA 3D4OA 3GEGA 2Y93A 4YQZA 3JYPA 1KVTA 4R4JA 2OXIA 1J0XO 3WGZA 1DEHA 4D44A 4XYLA 4ZHSA 5KTKA 2EJVA 1NPYA 5G0VA 3WYBA 1YQDA 1T24A 1YRLA 4GGPA 4ZJUA 1LI4A 5JDIA 2GASA 4XQCA 1NFFA 2BFOA 2D5AA 2JFGA 3CZMA 4GX1A 4Y98A 1JWAB 1Z7BA 3F5QA 1UAYA 1N8KA 1N5DA 1LDNA 2IXAA 2Q2QA 4CM4B 4TKMA 4Y6SA 2OUIA 2D2IA 4ITUA 4EJ6A 1ZK0A 3Q6IA 1I24A 4DC1A 3ZV6A 3WFJA 3VPGA 4EUFA 4LVUA 3WGGA 1E6EA 4CM9D 1SZJG 1SB8A 3C7AA 4CUJA 2EGGA 2UDPA 1HYHA 4D79A 2Y0EA 2EW2A 3FRJA 4DL9A 1PQWA 3JQ7B 3O8QB 2Z5LA 1VJ1A 4HADA 4YACA 4YCAA 2B0JA 1LTHR 1XELA 4BGIA 1H0KA 2PGDA 1AHHA 1LSJA 1ZNQO 4XCVA 3AU8A 2UUOA 1H9BA 3ENKA 5HWSA 1SOVA 4A2CA 4JBIA 1DPGA 5EQFA 3I9MA 4HFRA 1V3TA 3O26A 4YYZA 1KEPA 2AG5A 3CSDA 4O6VA 3PYXA 2VZ9A 5MGBA 5BNTA 1DSSG 3QWAA 2YY7A 2WSBA 5ADHA 1MXHA 3MWEB 2YJZA 4S1VA 4RZHA 1PZGA 4MKRA 5DCUA 2WWRA 3RUHA 1YOVA 4NFSA 4BNIA 1NQ5A 1C1XA 3H6KA 3RWBA 1V3UA 3AI3A 3INRA 5TSDA 1ENZA 5AXCA 3WLEA 3SC4A 2WE8A 3ICPA 4N54A 2VWHA 1NNUA 1ZJYA 3OETA 5G0UA 3WBBA 4AJEA 2Y68A 4EZBA 2G82A 1K3TA 1WXDA 3CMMA 4P4LA 5L7WA 4XDYA 3VH4A 1H6AA 5MDHA 2DM6A 3FBTA 1R37A 5GZ3A 4Z9XA 1B16A 7ADHA 4R1NA 1GDHA 1NWHA 5T5QA 1HLPA 4II2A 1E3SA 3VZSA 4CMIA 4CUZA 4N5MA 1TEHA 4Z0TA 1T4BA 4W4TA 4OIMA 1FXSA 4H15A 1Y9EA 4WUVA 5DOVA 2G0TA 3QE3A 4NK4A 4ZQFA 5KJFA 4W99A 5I9MA 4UAGA 4BO3A 1XGKA 4A5OA 4CLOA 1HSZA 2B5WA 3UCEA 2J3HA 5A3VA 2CDCA 3SJ7A 3F5SA 4II3A 1DRWA 5L7TA 4XYBA 4PZDA 4PG6A 1N7GA 2YW9A 3U0BA 3BTOA 3GAFA 4OXKA 4FFNA 4YAJA 1KVUA 3GVCA 3G49A 3FI9A 3D4PA 3AM3A 3SXPA 3U49A 4TZTA 3GGOA 4JJFA 5A05A 4CQMA 1NPDA 5U4QA 1KERA 3GDOA 1B14A 3DZIA 3JD4A 4MIYA 2J5RA 2NACA 1T2FA 3RUCA 4R16A 4YWJA 1X7DA 2A92A 5TNXA 4KQWA 3LLVA 4RLSA 5L53A 4JGBA 1OOEA 3IIEA 5CPFA 3ABIA 4DWVA 8ADHA 4ZRNA 3ROQA 1JVSA 3DHYA 5LDGA 4J4HA 1HE5A 4UVDA 3IAHA 4E32A 3NJ8A 1IB6A 3GMSA 3S8MA 4NZ9A 4BMVA 3OECA 3OA2A 4BNMA 3TNLA 3DTYA 3K92A 2V7PA 2GYYA 5CG2A 1T2DA 3GA0A 5DULA 1UUFA 3E1KA 3OQBA 3QWIA 2Z1MA 2Y1GA 2B4RO 1R0KA 1HF3A 4J7UA 3AI1A 4W82A 4XRRA 2PR2A 3DOJA 5JMPA 2Y1FA 2FOIA 3JQFC 4OXYA 1E7MA 2X86A 5JAZA 3VDRA 3MJ4A 4XKJA 2QZZA 3NAQA 4NFYA 4CV0A 1PJCA 1VSUA 5LDHA 4YAGA 3BMCB 3OIFA 3BZUA 2JHGA 2EF1A 3E5RA 5CEJA 3GVPA 4Q3AA 4Y6PA 5CG1A 4I9NA 1NVGA 1P1FA 3I6QA 2QQ5A 2O3JA 4MKXA 1E5LA 5TJHA 2DKNA 3MJCA 2AG8A 1E3JA 1Q7CA 1MP0A 2EWMA 4ZRMA 3ZU3A 3SLGA 2CVOA 3WQRA 4J49A 1HT0A 2I9PA 3I1JA 2C59A 2G17A 1CYDA 4FFPA 3T7EA 1EUZA 2Y1DA 4D0SA 2CDAA 2VNSA 4TSKA 3UFXA 4YJHA 3RD5A 4GSKA 3GRPA 2B4QA 1QYVA 3QIVA 4UVEA 2ILTA 4ALKA 2J6IA 1SO8A 4WGGA 3GFBA 2WMDA 4INAA 3FR8A 4IMPA 4CM5A 1ZMTA 2I3AA 2W90A 4UVGA 3IDSA 2ZYGA 5I8ZA 3R1IA 2VZ0A 3VZQA 1P0CA 2UUPA 2X0NA 4NJMB 5JO0A 2YUTA 1AUPA 1PS9A 3MOGA 4MKZA 3GNQA 2DBQA 2POQX 1SB9A 1Y8RA 1TI7A 1PJ2A 2CY0A 2X0RA 4WNIA 2ZCVA 3HQ4O 2B83A 3ST7A 1V0JA 1GD1O 3BTVA 1T2AA 4O1MA 3ZWBA 1K89A 4QQRA 1DIHA 3H3FA 3JYOA 3K2BA 4BNGA 1C0LA 3H4VA 4BO0A 3JSAA 2ZCUA 1YDWA 3DZKA 1ZEMA 2DUWA 3T4EA 4I9UA 1ISGA 2F00A 3EC7A 3PP8A 4YEDA 5BSFA 3P5SA 2IODA 3CMCO 4Z3KA 2GN4A 3UF0A 3GUCA 1GYRA 3KYBA 4FOSA 1B15A 3PYMA 2W2LD 1UP7A 1UJMA 4OXNA 2DTEA 4J7CA 1HE3A 2JD2A 4L73A 3E5MA 3VTFA 2IZZA 3ZNOA 3H5RA 4NHEA 1WDMA 3MJSA 1WLYA 3DZGA 2O7QA 4FJ0A 3CPSA 3R3SA 4PCVA 2YV1A 4PVDA 1M6HA 5C7OO 2XXBA 4XB2A 5TC4A 5K6AC 2DTDA 3D0OA 3JQ8B 5JC1A 3PQEA 1ISIA 4O0LA 3RUDA 4DMLA 1DC4A 1GZ3A 4WEOA 2ZB3A 3IOYA 3OJEA 4MOWA 4PZEA 5F5NA 1E7YA 5IFLA 1DXYA 4BQPA 5KVCA 4M1QA 1QYCA 1H93A 2Y0DA 3CEAA 3KUXA 1OMOA 2B36A 2GRAA 4J2OA 1KEUA 4RQUA 1K5HA 4IPTA 3VC7A 5L45A 4L0QA 4OO3A 4PGFA 1O6ZA 3DO5A 2I76A 4B7CA 4EW6A 3UOGA 3LF2A 4HFNA 5KVSA 3ZWCA 4NK5A 5J23A 1NX6A 1X1TA 1N9GB 3AI2A 3AUAA 1J5PA 3I9KA 5JCXA 3VH3A 4MIEA 4BO9A 5HS4A 3DHNA 3H7AA 1CQIA 4FIZA 4PLPA 3H2SA 1ZH8A 4LMPA 1SCUA 5TLSA 1BMDA 3JD2A 3KM0A 2O2SA 4FGWA 4LW8A 2HLPA 3DBHB 3KYDB 1PX0A 1Z45A 4DUPA 2AEMA 3A14A 2XF8A 3QWBA 5K0ZA 1U3WA 4QT0A 1B26A 3RROA 1PR9A 2V6MA 1T26A 4KQXA 2P68A 3UCXA 2X5JO 3PHGA 3KZVA 3K30A 4M8SA 4YQYA 3U4HA 3VDQA 4MVJG 1YJQA 4K6CA 2AQKA 1PGNA 2NVUB 5FEUA 4ND3A 3NUGA 4IQ0A 1WWKA 4NR0A 1RJWA 4G81A 3UW3A 3E9NA 1RYDA 1W6UA 1X7GA 3DBLA 4AICA 2X4GA 3GHYA 4R41A 5BSGA 3BMOA 3DBHA 5EIOA 1A72A 4MIOA 4E21A 4NJOA 1BXZA 4A03A 4PVCA 3R6DA 4PLTA 4WK6A 2HUNA 3RC1A 4IINA 3PHHA 1D1TA 3ITDA 1G0NA 2PLAA 2EP7A 4WPGA 2UV8A 4J1SA 4HBGA 1DLJA 4BVAA 4MVJH 2QX7A 1VL8A 3L9WA 1ZSVA 3KTDA 1UDAA 3HADA 2J3KA 4BGUA 1LA2A 2J3JA 1XU7A 1ZBQA 4TROA 5FI3A 4BHTA 1LDGA 1YJ8A 2GF2A 2YYYA 3DZBA 4ND4A 4EEZA 5JPIA 4TQGA 3IP1A 3RFVA 4RPGA 4FFMA 4M86A 4MVJM 3ZWMA 4BB5A 4ALLA 2IZ0A 1Z7EA 3G3EA 2NSDA 1BGVA 4WLVA 4E2ZA 4KWHA 2VHYA 2ET6A 2X23A 4F6LA 3CH6A 5EPOA 1IHXA 2O3UA 2Q2VA 1UR5A 1ADGA 2EKLA 3KHUA 4MP8A 3GVIA 1U1IA 1CWUA 1H6DA 3PEFA 1L7EA 1Z75A 3ITKA 4YA6A 1UH5A 2BFAA 2W4QA 1QV6A 4CLOB 1NFQA 1GADO 2TMGA 3G17A 3GDGA 3ZHXA 2VOEA 1U5AA 3LVFO 3PZBA 3U9LA 1PTJA 2F1KA 4MVJD 3ENNA 1EUDA 1A7KA 3UN1A 1HSOA 1R16A 1BWSA 4Z9FA 1YBVA 3KBOA 5G2OA 3ICCA 4DLBA 5ILOA 3A28A 3UHAA 3K31A 3I23A 3GHHA 3UGKA 3P2OA 5DNAA 2VTEA 4ROSA 2BMAA 4YB8A 1YBMA 2I66A 1LSOA 5TT0A 3FNFA 3ZWNA 1HDYA 1UXGA 4H16A 1HXHA 2P5UA 3IUSA 1T1RA 2NV6A 4KOAA 4R01A 3ZWOA 1KVRA 2GD1O 4FC6A 4GAEA 4L76A 1NBOA 1PJTA 1PZFA 1RYEA 2O23A 2ZYDA 3RC2A 5I7VA 4IQGA 4OHUA 5A04A 5JCJA 1LC3A 2PZJA 2WDZA 2YZ7A 2PD6A 5DT9A 3ANNA 3FD8A 2Y05A 3G79A 1I3NA 4IS3A 5DBIA 2NWQA 1IHYA 1C0IA 5L40A 4OOEA 5DOZA 3OMLA 4LK3A 2HK7A 2HMTA 5IDYA 1K6XA 1T2EA 4Q39A 4Q3EA 1GYQA 1I5RA 1R12A 3LF1A 2JL1A 2QHXA 1PIWA 3LLSA 4AG3A 1A4IA 3I5MA 4BNYA 3C85A 3L4BC 4RO0A 5L9AA 2VYVD 4JK3A 4ND2A 4NDNE 3WB9A 5GMOA 3V2GA 4D43A 5DN9A 4AJJA 1UZMA 3GR6A 1ORRA 1DHRA 4Q3DA 4RPJA 3RU9A 1OI7A 4I08A 2D3TA 4CL3A 5A06A 3JQ8A 4BO2A 4D0RA 4J4TA 2PNFA 3QVWA 1LBEA 4J2HA 1NVTA 2CF5A 2GN6A 3H5NA 3Q2KA 4PG7A 3VH2A 1M66A 5L3ZA 2E82A 4DQVA 4PLHA 3GNSA 1MLDA 2VUUA 4F6CA 2GZ1A 2X0IA 3IS3A 4JBHA 1MC5A 1Y9AA 3ZN2A 4RF4A 4BO8A 2VRBA 1R6DA 3BMOB 4RVGA 5THKA 4C7KA 5B37A 1I01A 4DBZA 4E30A 3C7DB 2B5VA 1X13A 3OICA 1E3WA 3PIDA 2NLOA 4E4YA 2R00C 4CR8A 3L77A 4E5YA 1PWZA 1N9GA 3PDJA 3ANLA 1ARZA 2QIOA 2B69A 2GR9A 1S7CA 1XQ1A 1SMKA 1X0XA 4WE3A 3V2HA 4LRTB 2O50A 4GX2A 2DBVO 2HMSA 1O89A 5KIAA 3JYQA 2O7SA 3UVEA 5IZCA 3AWDA 3WYCA 3PVZA 4B4WA 2EERA 4H7PA 2VYVA 3GMDA 3TL3A 4L4XA 4IXTA 4IDDA 4XRGA 4FOOA 3TN7A 4D3FA 5A1TA 5HRUA 1NHGA 3HJAA 1DJQA 4XYGA 5JLAA 1MV8A 3JQGB 1UXJA 4A73A 2C5EA 3E03A 5L51A 5H83A 2WM3A 3QV1A 3QJ5A 4WCFA 2JD0A 4YJGB 4PG5A 5JFOA 1SEPA 2H1SA 2Y0CA 1LEHA 4ZQEA 3QW2A 4I5FA 3WGHA 4URFA 3NJ4A 3L07A 1I36A 5IAAA 4IDGA 1D8AA 5TX7A 3JQ6A 1PZHA 2BFPA 4PG4A 2WYWA 3WTCA 3OEYA 1HDOA 1ZZEA 2BF7A 4K9DA 4JP2A 4I1IA 3WLFA 1XU9A 3V1UA 4GVXA 1V8BA 2DLDA 2DPHA 1GQQA 4JIGA 3VOSA 5H82A 4TVBA 1EEHA 1Y5RA 2OBNA 3WIEA 1E0DA 2Z1NA 5HA5A 4OGWA 3I9OA 2Q50A 1VKNA 2AE1A 1KC3A 3BMQA 4J4BA 3GG9A 3S2FA 4NG5A 1BHSA 5G0WA 3DDNA 5TRTA 4KUHA 4W7HA 2NU8A 1NR7A 4E5PA 4RPKA 4JLWA 4OQZA 4XZ3A 2AEFA 3Q0EA 3GVHA 4PLWA 4TRMA 2JCVA 3N58A 3ZH2A 1PL8A 3V1YA 2VWGA 3EK2A 3FNHA 4EI2A 2HMVA 5A9SA 2BGLA 2OP1A 4DBVO 3ZZNA 4EUEA 3N74A 3JQDA 4FFLA 4ID9A 3PXXA 1JWBB 1EDOA 1EUCA 1UZLA 4AJPA 5GY7A 3HB5X 2R2GA 2JAPA 3RI3A 1ONOA 2OHXA 4O59O 3ZV5A 1IPFA 5BSEA 4RVHA 1OBFO 3IKVA 1GUZA 2X0JA 4CLXA 3PJGA 1B0AA 3PGXA 3VVCA 5CHEA 3CUKA 1Q0LA 1EBFA 4AVYA 1PS0A 3W8EA 1C1XB 4K28A 2ZTMA 2AHRA 2DTXA 2AE2A 4A26A 1ZO8A 2D59A 2BRUA 1PEDA 1ML3A 3LT4A 2X6TA 4ZVVA 3DXFA 4GX0A 4R68A 3M1LA 4B3IA 1HZZA 1Z82A 5JBIA 3MOIA 4WLUA 2ZB8A 4G5HA 3GRKA 3N7UA 3VKUA 1RM4A 2YHIB 2BGMA 3D3WA 3HDYA 4CMKA 3GZNA 4N5NA 4GGOA 2HRBA 3EMKA 2FR0A 2GNAA 1N2SA 3V2UA 2X1HA 4CQMD 4F46A 1JAYA 3QWHA 1GFSA 3FF4A 3RJ9A 3LDHA 4CR6A 3OFSA 4JBGA 3H9UA 1DC3A 4IJKA 3IP3A 1A9ZA 4CQMB 3GLQA 3EDMA 2DAPA 3E18A 4QECA 2P91A 1PQPA 1DBVO 1NASA 3U62A 4Y67A 3NV9A 4MVJP 3TOXA 3RUIA 4Y9DA 4N5LA 3A9WA 4HFJA 4S3MA 5I9LA 1N7HA 4TWRA 1BXKA 2CZCA 1O8CA 1J49A 2Y1EA 3E8XA 2C0CA 4IDBA 3KRTA 4MP3A 5K9ZA 3KYDA 1ZSNA 3WS7A 4KDEA 3D5QA 2NNLD 3I6IA 3JQAA 1GPDG 1V35A 1A27A 2HO5A 4FSHA 1HDGO 4ZU3A 2D1YA 2JCYA 1LLUA 2NM0A 3LC7O 3QA9A 1E1LA 2YQ4A 3TJRA 3NT5A 2PKRA 9LDTA 1ISHA 4U0JA 1FDWA 4YVFA 2DFVA 4R69A 3RAJA 2ZTLA 1IZ0A 2Q45A 3ZWVA 3LT2A 3OJLA 2PH3A 5EQDA 4BNUA 4LISA 2VYNA 2GUGA 1XA0A 1UP4A 3A06A 5TGDA 2VCYA 2BD0A 4XYMA 2IXBA 1PL6A 2ZTUA 4I5DA 3OSUA 4CM9A 4ILKA 4HV4A 1H6BA 1CRWG 4RGBA 4EJ0A 5KOIA 4J1NA 1Y81A 3EVTA 1J4AA 3QLJA 3LC2O 3FNGA 1QLHA 4JNKA 5CP8A 1HZJA 2PA3A 3H9EO 1F8FA 4KWIA 3AFMA 4AJ4A 4YT8A 2VNAA 4DLAA 4E5KA 4LMRA 1XIVA 2CD9A 6ADHA 3G1UA 3IJPA 2RH4A 5ENDA 1NQTA 5EN4A 3W8DA 3W6UA 2GZ2A 1I10A 4R54A 2FHSA 1Q2XA 2HSDA 4BL5A 5LCXA 4JROA 3PIIA 2AXQA 1FDTA 1HLDA 1P74A 4R1UA 3ZCXA 3F4LA 4YJDA 1JW9B 3BTSA 5FFFA 2J3IA 5KVQA 1KVQA 3U4DA 1VC2A 3CTMA 1LQTA 3PGJA 4RZIA 3IUPA 2XOXA 3LT1A 1K2WA 3F47A 2DU8A 3CIFA 2EKPA 4EEXA 1DFGA 3EZYA 4XQEA 1P45A 2FZEA 4IGEA 4XR4A 4ZICA 4AL4A 3PFWO 3E6AA 4PLFA 3UUWA 5JY1A 1EK6A 4CQLB 1DIRA 5I7EA 4HNHA 5KJCA 4E31A 3PHJA 4XX0A 3RBVA 4P22A 1YQXA 1LLQA 2ZQZA 4FD3A 4IJWA 2D5CA 3QVSA 1F17A 2FR1A 2IRWA 3KV3O 4RDHA 4RLHA 2WYVA 1LNQA 4GMGA 2FZWA 5G0SA 4U6SA 4BNTA 4CM8B 2FR8A 1PJ4A 3BHJA 2WEKA 1D3AA 1DIGA 1D1SA 1HL3A 3TF5A 5IN4A 5KWEA 3BAZA 5LC1A 3SLKA 1JKJA 1EVZA 5DBFA 3VVBA 1VKOA 1VM6A 2J5QA 2OP0A 5DCWA 1CERA 2IEBA 8LDHA 5F1OA 3VAZA 5B4VA 5BNFA 2RIRA 2Q1WA 3S2EA 1RM5A 4AJOA 1TT7A 1U7TA 1SEVA 1O95A 1YL5A 2RCYA 3T4XA 1NYTA 3VH1A 3BHMA 3OM9A 5IDXA 2W98A 3ZU5A 3G1TA 1ADCA 2VT2A 5CEEA 2PZKA 2BLLA 1E5QA 3CXRA 1V3VA 1ZW1A 2GDZA 3GQVA 5EERA 4EYEA 5F1KA 4DPKA 2Y66A 2SCUA 4CV2A 2ZB7A 2EJWA 4NMHA 4QO7A 1KS9A 4BV8A 5AXAA 4K26A 4DREA 4XEHA 1Q7GA 3GNTA 1AXGA 2IE0A 3ROMA 1H6CA 3QP9A 1TT5A 5U1PA 1H2BA 3WGIA 1CJCA 3PWKA 1S6YA 2WYUA 4XDZA 4XR9A 4OJNA 4DVJA 4BGEA 3WWYA 4B3HA 2GZ3A 1YWGO 3FPCA 1CIVA 5T6BA 4R3NA 1T4DA 1GQYA 4OKIA 1HYGA 1UP6A 1ONPA 2QZ9A 3ASVA 3FTPA 3I9LA 3NT4A 4QXMA 4B8WA 4IS2A 1YONA 2J8ZA 1E1KA 3I4CA 2C5AA 3K73O 1PGOA 1X0VA 2IYOA 4W7IA 4P4GA 5ENVA 1OC2A 3IQDB 1WDKA 4WJZA 1JQBA 3PQDA 1X1EA 3D3WB 1BDMA 1Y5MA 4YDRA 1P1RA 3HB4X 3WBFA 4BV9A 4IDFA 1CDOA 4UEOA 4BKOA 3KEOA 4KP7A 2P4QA 1I2BA 1YE3A 2VHXA 2FRDA 3GVXA 3ZWWA 2O48X 3RC9A 4RQTA 3MJTA 3PDUA 3EAGA 3RFXA 4YR9A 3KLPX 4J0EA 4RF2A 1DB3A 2JAHA 2Q99A 4YBZA 5KKCA 3H3JA 1HETA 1KETA 3DC2A 2OGUA 3FWNA 5C5IA 3FPLA 1IZ9A 5KCZA 5TIIA 2EG9A 4ONEA 4UEJA 4A7PA 1C3VA 3W4IA 4RDIA 3S1LA 4BNLA 1J6UA 2EEZA 4D46A 4KDFA 1SNYA 3D64A 1ZSYA 2AW5A 3HE3A 4YT5A 1AGNA 1ZK4A 3W4KA 2D0IA 4ALIA 4RCVA 3WMWA 3HN2A 4QSMA 4TZKA 4UUOA 3DFUA 1LSUA 3JQAB 4WOKA 5HS6A 1EFKA 4HX5A 4JJIA 1R4MA 4C7JA 1DO8A 4NNJA 4IDCA 1U2DA 1GEGA
chains in the Genus database with same CATH superfamily
1NW4A 2C2BA 5FBVB 3E7XA 4PR0A 3VKGA 2NXJA 2PV7A 1JLHA 1NP6A 2BCJQ 4MZDA 1II8A 1XYGA 1M83A 2ZRKA 1LDBA 3EZFA 1XK7A 2XLBA 3BK2A 4WBXC 1RWWA 1OXTA 3EEIA 4EFNA 4JX8A 3DDWA 3E0QA 3U3MA 3C6KA 3G2OA 5JS7A 1B8NA 4YRLA 4HYTA 1TAGA 5BURA 3G2QA 5FOTA 3EGWA 1Z39A 1R9JA 1ICEA 4PZPA 5CDYA 5IUJC 1KYTA 1FOEB 4K2HA 4MTLA 4NFHA 2Y1LA 3E27A 5JW6A 3B1KA 4LY3A 3DKRA 2CZQA 3WGQA 3WRYA 2M32A 1RYMA 4INPA 2VXBA 4XIGS 3SZUA 4I99A 3TRIA 5KYYA 1GV0A 2ZSJA 3RK0A 2J87A 1WUKS 2HSZA 3E2IA 1ILEA 3PCXA 2ZEJA 4R2JA 3MS4A 2GYVA 2C2HA 1S8FA 1E63A 1U99A 1VZ2A 4XOUA 2BGNA 4G1BA 1XNQB 2VJDA 1H3FA 1Z5OA 3CKKA 2F43B 3QVTA 3NDBB 2QYOA 3VU9A 1RWOA 1T6XA 3IALA 4UMDA 1Y63A 4BNKA 5HOEA 3K70C 1KEWA 2DQ4A 4R7ZA 4CW7A 5JUWA 3GUYA 1QGOA 1ISJA 3WYFA 3E84A 3IXLA 4CR7A 3AHFA 1DHTA 1OBVA 1V1JA 4WXMA 1FLNA 3JYLA 1ID8A 2MSWA 4KVZA 2IOHA 2NO9A 1R3UA 2MOKA 2NT4A 1ZN7A 4LQCA 3AH8A 2YHSA 2X5NA 1MABB 1O97D 4IQ8A 2BMDA 4M87A 5AW0A 1H9AA 2E4UA 3LY8A 4H0FA 4JLVA 3UWSA 3VAYA 5K0BA 5D5PA 2QP4A 2IS2A 3LKDA 4QTUB 2INGX 2Q3FA 2BKLA 2HJVA 2AFRA 2PKYX 4HEA1 3ROGA 1PS8A 1E3QA 2KWIA 1BQ4A 3LCMA 4WZ6A 4X97A 3SC6A 2X77A 1XCJA 1IZ8A 1WSBA 2J4DA 2QMZA 1O77A 2IGBA 3IP9A 1J8MF 1E2QA 3EPKA 2JIQA 4PC2A 4GMFA 1N92A 5D86A 1FVXA 2VUHB 3TSOA 1GU7A 3KB2A 3KEFA 3CX7A 3Q85A 4QFBA 3PEEA 3YASA 5KDOA 2JLAA 1OLUB 5B7NA 1QVVA 3PYLA 2CHQA 2EGUA 3T1YB 4NCIA 1IBMB 1J2EA 4L5CA 1TGYA 1KJ9A 3GEDA 3TW4A 3X1JA 1R4AA 4FSXA 1QRUA 3BE5A 2C3OA 2BH9A 1LRKA 3M6WA 4FC7A 3FPSA 4RJ2A 2EG5A 4J3NA 1BS2A 4DW8A 4D4KA 4F5WA 3UHJA 3A1VA 5E6UA 4REQB 1RC8A 3A4YA 1YZFA 5FPTA 2QGNA 1NIPA 4GVPA 5AK6A 3D6TB 1VSVA 4K2AA 4OBXA 2WNHA 1PE0A 5LUAA 1KY5A 4ZA2A 5KJ1A 1WG8A 4LQ4A 2NU9B 2QJFA 1JFRA 4BLWA 2BMEA 1BKDR 1U4OA 1XZCA 2OZKA 4M1WA 2VUSA 3S99A 2OBMA 1Y8RB 3DOOA 3QUBA 2DFTA 4M49A 2LCIA 2BEUB 5FUYA 3ETJA 1CRPA 2OXTA 1UJBA 1D2NA 4HDSA 1JVBA 4MVJI 4NBWA 3WRXC 5AHRA 3BHIA 3HG7A 2HRCA 3EXG1 5FUQA 5ED4A 3FPFA 1G3QA 1T2VA 4QIHA 3BPSA 1XZ8A 4QHSA 3MUNA 3PIRA 4HUJA 3G5LA 2OE2A 2RBKA 1X7WA 2A9JA 2JCSA 2JB9A 3MERA 4Q66C 4O29A 1GVNB 4RIEA 2WZCA 4TTJA 3WGNA 2GLXA 2H2AA 1U2PA 1PX2A 2VN8A 1FQWA 4MMZB 2RGNA 2GOYA 2XYRA 4I6JA 4Q3BA 4ZAWA 4RJKA 3FOWA 1GUBA 2CLCX 1GGFA 2G1JA 1W1UA 3EEYA 2GHTA 4JYBA 5J1TB 3RVPA 4C7MA 1KEZA 3KV1A 1OH6A 3VVMA 3SDBA 1KFCB 1A98A 4PTZA 3REOA 1TADA 1JFFB 4RJIA 3Q2OA 4DLWA 1YRYE 2NZ8A 3A9VA 4JJAA 1P9LA 1CG6A 5ECYA 2HQSA 1PFUA 4Y2QA 4CF3A 1G7RA 3WXBA 4YMGA 2O3QA 3DOUA 2HWWA 5DYTA 3SX2A 4QDJA 3C70A 3G88A 4LGVA 3OKPA 4C29A 2PFSA 5I8WA 5I45A 4QEZA 4JLJA 1MC4A 3AEQB 3G2LA 3IC5A 3P7MA 4URWR 4WKBA 2QW8A 1U7HA 2QTGA 1O5OA 1HWYA 5KI6A 3UMSA 4D9HA 2MSLA 3PE4A 3QKRA 4AECA 2MYTA 3L1HA 3MWFA 2HRRA 1LQUA 3EY4A 4GI1A 4L74A 4G1CA 1MW9X 1WRBA 5CW2A 1JJIA 3RIHA 4EG1A 2AI2A 2C9YA 2PT9A 3IEVA 1PT7A 2C9CA 2ZSEA 5D51S 4H7DA 4LJRA 1T9ZA 3PXUA 1ISMA 1FXWA 3I6ZA 1DC6A 3QI7A 3P52A 3T3DA 1DDGA 3UYKA 1Y6GA 2GMWA 4TS4A 2QT0A 1V43A 3B1VA 1XDDA 3NRJA 3DF7A 2I2FA 3ZI4A 4XW2A 4UHBA 2Z8XA 2RB4A 3EUEA 3K1YA 1E3IA 1HGXA 4MA4A 2G5CA 2TYSB 4P4TA 3TQFA 2GKGA 4PTLA 3OLQA 3ZKWA 1AJEA 4EYGA 1EINA 5LYJA 2X9NA 3ED5A 4ZZ1A 3SKXA 2XTNA 3JV7A 2YZMA 4IDEA 1EHYA 1IOLA 1ZCZA 4QGFA 1L4EA 1LBTA 3LPNA 4ND1A 3TZHA 2NP6A 1YU6A 1TYDE 4HI0E 4JKIA 5DRTA 1IUNA 2CB0A 1IPEA 4IIDA 4DANA 3OF5A 3KOMA 3P5BA 2JIOA 4X24A 2Q2WA 3CNLA 5JSFA 1XJQA 2WJ3A 5G4LA 3QXSA 2HA4A 4R2XA 1EM8B 4C87A 3H9JA 3PLRA 5KWIA 1PK8A 3HXKA 2VSOA 1WV0A 2DZDA 3ANMA 2QN3A 3DMHA 4C4SA 4IUYA 1W36D 3PKZA 4PNHA 1ORVA 3RYIB 2YXDA 1A9SA 3THYA 3PHLA 5DP1A 2CWWA 1ZQ9A 2VQSA 1FRQA 3HN7A 1JKJB 4LUCA 2HADA 4HO1X 4ERXA 2VF2A 1GKIA 4TRNA 3OZFA 1E92A 4WCFC 3DB1A 3D8UA 1CFZA 2C99A 4QSHA 1QPBA 4LS3A 2DBZA 2QRMA 3R8CA 1LX6A 2ARKA 4J3FA 4J6FA 3AR9A 4F3NA 1JTVA 2XE6A 4OHRA 3BQNB 3HWRA 3AF0A 1XZQA 4GL4A 4HH4A 4GM1A 4C78A 5K8IA 5KBYA 3LPDA 2A5FA 4NZOA 3T9BA 4O2AF 3AB8A 3CKYA 5LOVB 1M2KA 3B70A 2PWAA 2Z2JA 3S1SA 1C4XA 1ZIDA 1C50A 4JVSB 2YMPA 1NYQA 3WQSB 5M7EA 4DNQA 2Z4TA 3PJFA 3C3PA 1Q7BA 4KXUA 1ZUNA 2CK3D 3KKOA 3VU3A 1Z6AA 3W5JA 5K3OA 4YDSA 4QDOA 3UO8B 4XJTA 1WCV1 1WHTB 3FYUB 4NJEB 1KZGB 5A9TA 4FFRA 3KFXA 2ZVJA 3RODA 4FHEA 2BELA 3C3YA 3JQEA 4I5EA 5L7YA 4GXRA 4UM7A 3UK2A 2R00A 1UBLS 2ZS9A 1QAOA 3C3KA 3O3MB 2G07A 4H1HA 1R0CA 3MJRA 2DQYA 3C7CB 4Q34A 4EHLA 5LLDA 3K0SA 5FUMA 2QYTA 3LHSA 4NPCA 4LJ8A 4PPNA 2O2IA 5B4UA 5BQPA 1JHVA 4ER3A 4BNDA 3DD5A 1P1IA 2B2NA 1D1PA 3TCNA 4JUIA 1MXFA 2DPLA 2BUCA 4BKUA 2LP4Y 4QHTA 4S24A 5L3SB 3ADOA 1ZXBA 3M4XA 3KKKA 2PSHA 4MYDA 3SX4A 2ZBRA 4J8PA 4MKFA 4XGNA 1J5XA 1E3EA 1FC0A 3TLGA 5JY6A 1FFCA 1J0CA 4YAWA 4ZV7A 1UXKA 4QNNA 1U3TA 4MB2A 4GP9A 1X42A 1AC5A 2W5UA 3FKQA 3OAAA 5LZ9A 4OL0A 3SHTA 5L4SA 4J91A 3T54A 4D96A 3NHLA 3ONDA 2FG5A 4G85A 4ZCMA 2WP0A 4BKQA 1RYZA 2VHWA 5DHRA 4LCJA 3RSZA 2DERA 4IIGA 1OUMA 3S5UA 4M2LA 1WUHS 1UC8A 2L19A 3NVAA 2REQB 3I39X 1Q57A 4UCFA 2UYOA 1CVRA 3HU5A 4QRHA 2K4MA 2X42A 4EUSA 3AGQA 2ZRQA 3EGXA 1TZBA 4KXMA 3EA5A 3H9GA 3DE4X 3MK31 3MSCA 4HZUB 3SHFA 2H1WA 3O4RA 2GGSA 4LDQA 1SPXA 4ZEXA 2EBHX 2YHAA 3RKUA 1Y8ZA 4BO7A 4C7OB 5EJ2A 3TSCA 4B8YA 4PNZA 4YHHB 3TZKA 1EDEA 1EX7A 4HDNB 4KN5A 4BJ1A 1KFJB 1T25A 4CIYA 4P5DA 3STVA 3UWKA 3HEMA 5IK2D 4LSWA 4Z0PA 3T7AA 3LWBA 3MEQA 2O4CA 4JJGA 3WE7A 1B8UA 3KXPA 2IDZA 2O1XA 1SVUA 1LB1B 4DBLC 1A8HA 4XFKA 1E5XA 2JVJA 3DAFA 1AKWA 3GEPA 2HPHA 7GPBA 2YMQA 3KFVA 3P9NA 3FCEA 2OO5A 1TCBA 3EXHC 3M1AA 2TMDA 1C4OA 1Z0DA 3DBRA 2B1QA 2V98A 3CZ4A 3FPAA 3MA0A 3NCHA 4ZOQI 1D4AA 1PT9A 3FNBA 3TPFA 1BQ3A 1KOLA 2WWYA 5BYAA 2WD9A 2AXEA 3MT9A 4MH0R 3O84A 4Q48A 3U9TA 4A6XA 1BMFD 2C77A 2ZT6A 2G80A 4MWEA 3DAYA 1E8MA 5C51B 3EPLA 4C6SA 4F2WA 2AFHB 3LUHA 1J56A 3QKTA 2O5VA 5JOQA 1JR3E 2EHDA 3AOEC 3IDAA 2PKQO 1P7WA 5KYYB 3J80A 2HCRA 3FPHA 4RF5A 4B75A 1CUXA 1PL7A 2XUPA 3FHLA 3NBZC 5F7JA 3T95A 1UXIA 2Q1SA 1VJDA 3U1VA 3WG9A 3E4CA 3A4VA 3PJEA 2DLCX 1YL6A 3FLMA 3GOHA 4CMEA 1NVKA 2ODPA 2F4NA 3U7HB 2RHGB 2P6OA 4GWLA 2KM1A 4JP1A 4L0CA 3ZBUA 1SPBS 1NVVR 2F1OA 2Q29A 3B48A 4O2BB 1EJBA 4URYR 2DSTA 4WN3A 3RU7A 4BGDA 2I6SA 3NBMA 1RXUA 3G89A 4YC7A 4AY3A 3B85A 3R3WA 2F55A 1IK4A 1YDEA 2BYTA 3LVQE 1UMBA 2WKRA 2R8EA 5EUMA 3EZ7A 1L5QA 5HM8A 1SUBA 5KVVA 4L4SA 4J1TA 1CF4A 3LDAA 4HQ6A 4B79A 1Y82A 1MGOA 3Q9LA 3MBKA 1RJ9A 2ZBPA 5IKOA 3UA3A 4IZOA 2NO6A 2JLVA 1K1EA 4X6LA 3IAEA 2GD2A 2AH5A 3MGAA 1RWXA 6REQB 4IGAA 5AHXA 1IIBA 3C5VA 4Y3UA 3MWGA 4DYVA 1N2ZA 5IAJA 4C30A 4GLJA 1DAEA 3BXPA 3KHSA 2OFPA 5E2IA 3PF8A 5TEWA 5MN5A 4UULA 2X22A 2YBDA 2IT1A 2X7JA 5KS2A 3I5XA 1ZN9A 1VRWA 1ZU5A 1Y3AA 2IYPA 4KGVA 2LUOA 4CMEC 1U94A 3BRWD 3GGDA 1I6WA 4L1KA 4S1NA 4CDRA 2AA3A 1QV7A 4OHZA 4MWDA 1B8PA 2Q3DA 3Q98A 4FN5A 3IEPA 2B4TO 3MT0A 1URPA 3ANXA 3MHTA 2VRWA 3DT6A 3KWMA 3LKVA 3NGLA 4MWCA 4C2AA 4BS9A 5CLHA 4ZFNA 4DCJA 4LX0A 1UMBB 3T9DA 3X1DA 1NN5A 2WHRA 2Y2UA 2BJWA 3CZRA 1VE1A 3IPLA 4Q4JA 2X1LA 3C97A 3EGOA 3OX3A 1Q7EA 1NM5A 1I2CA 3O1HB 4DG5A 4YAIA 5I51A 2Q6OA 2CL5A 5DLQC 2J9FA 2WMNB 5SZHB 1EK5A 1UF9A 3K1AA 3X43A 1CB0A 3ZHSA 4BQOA 3ZJTA 1OXXK 3LRXA 1CRLA 1CS0A 1KI9A 2OO5C 3I2GA 5FCDA 4CJXA 3VO1A 3NVMB 4JYPA 1SQGA 1Z3IX 2QSZA 4KYUA 4NJMA 4OUKX 3LUKA 5FYQA 3W34A 1YZKA 2P11A 5G40A 4ZV4A 4OEHA 2C54A 3AKCA 2HC9A 4FN4A 3M6LA 5BSVA 1XQWA 3BIXA 1GPYA 2NU7A 2JFFA 2AN1A 2UXBB 1MPXA 1CVLA 2FWBA 3AT1A 3PRKE 4ZDIA 5JYBA 4N7JA 5KQRA 2GBFA 3H65A 2IIBA 1OWPA 2R0QC 1YBHA 1IY0A 1IBKB 1H5NA 2ZRDA 3CUVA 3HPRA 1XFAA 1XRJA 3T1NA 3T12A 4RKQA 4LI3X 4BNFA 4OLAA 4G1UC 4W7SA 1JIKA 1VHJA 3L41A 2NZUG 3GBSA 5JJCA 3DTTA 3JQPA 3TIGA 1FQKA 2GESA 3AHIA 5JS1A 1I30A 1XAJA 1XWWA 1Y9ZA 3AO0B 1AZTA 1XZDA 2ZPTX 1GXSA 3IAM6 1KYWA 2PT6A 3FIJA 1MX3A 1NC3A 3HDTA 1TVCA 2E48A 2I4MA 4TRRA 4IIJA 4UMFA 1LVHA 1Z4IA 1QS0B 1QM5A 2AJ8A 2DVMA 3DWFA 4XA8A 4I4TA 2EJUA 3QYJA 1W9MA 1S2IA 5LBUA 5CD1A 3JZIA 4GMDA 3I0NA 1X80B 4XWYA 4PYLA 3IT2A 3MW8A 4PQEA 3TLJA 2J30A 1B7GO 2G1AA 2JIPA 5C7IO 3UH1A 1FB5A 1GCIA 3LNTA 1J8QA 1C9DB 2XMSA 5ER6A 5LBIA 5CDGA 1RHKA 1FYDA 2MYNA 2OZPA 3WLSA 4TLEA 4DYDA 5MN4A 3WXMA 1AMUA 2J5KA 4MRMB 2AN5A 1OQAA 3V6MA 2VLBA 4GE0A 4XJSA 4YPVA 3OQJA 4RIIA 4GT1A 3DLBA 1BE6A 1IHDA 1S89A 5JQWA 3HJFA 3H8SA 1YDMA 3HCEA 3FPGA 3GPCA 2VJNA 4GS5A 4D2IA 2BSQA 4KACA 3ZI0A 1E18A 2P78A 1NVAA 1GNPA 3AEUA 3X2FA 2DHCA 4IDNA 5T3UA 1E0JA 5THQA 1Y6JA 3T0GA 3FMPB 5JS8A 2X41A 3MCVA 2HDNB 4B09A 2W2LA 2G4VA 2CDRA 4AZWA 4AD8A 2P8SA 4NAUA 2JKYA 5C9ZA 1QNLA 1B8OA 1RWPA 3NH6A 2J9RA 2UZ1B 3OUTA 4KZPA 5EP1A 2JFZA 3H2YA 3HKBA 1H9CA 3GEEA 1F0YA 3U3ZA 2H00A 5F9FA 3RAGA 2G5PA 1NSYA 1XTBA 4IX9A 5F51A 3T1OA 3EGDA 1ODKA 4BWGA 3AFNA 4PLZA 5T8KA 2ZUCA 4RTKA 5B1SA 1JLSA 3ZTTA 1QVZA 2HD4A 3ZLBA 4F4UA 4ZHQB 5I01A 4NYMR 2I99A 1KSHA 3ESDA 3O4IA 4HCJA 4HH0A 2G7ZA 2WC1A 2WWHA 4QARA 4WD3A 3UNXA 3D81A 2C1ZA 3ODPA 1DNPA 3B1FA 2P6PA 3PENA 4M1OA 3W3AA 5AJWA 1MHPA 4R7GA 5HYVA 2C92A 3KCQA 2X8LA 1YS7A 3KUKA 5ALMA 3O8RA 4LFAB 1L3BA 4U2BA 2YASA 1GG9A 2AYZA 4OM8A 1EI9A 3DVQX 4P3OA 5DT2A 4QXOA 4LDPA 1Q0RA 1GQSA 4AP5A 4JVLA 2CHVA 3ASZA 4QU8A 1N75A 5FF9A 2H2HA 1XL0A 1SKYB 1Y6FA 1F4PA 2C96A 4L3OA 1JPJA 2ZYAA 5DBOA 3G2NA 3WGJA 4AG5A 4D6XA 1T3TA 2CFSA 2J32A 2TMYA 3ECAA 3Q9NA 4WOPA 3Q8XB 3V1LA 1EUYA 2AFHA 2ATVA 4NAVA 1SBIA 4G4GA 3U4QB 2O8BB 1YHYA 2ZREA 4MA0A 1IZ7A 3OJWA 5JZVA 1U81A 3N5KA 5IJ0A 1ENYA 3ABRB 4NCJA 5GONF 3ZHOA 3OQIB 2EIXA 2OXFA 3PXBA 2VUTA 1Q1BA 4F4HA 3QVOA 3BTUA 3ER6A 5EJIA 3K9GA 4WOJA 2VJYA 1FYFA 2NVUA 3LWZA 3N2ZB 7AT1A 1ZCJA 3CWCA 3TXYA 4DEYA 3A1NA 2FP4A 4Q1VA 1KNXA 2X5OA 4MDHA 5E7IA 4FDAA 5E1DA 3NMUF 2H51A 2AI3A 2NV2B 3QK7A 3D02A 1XTZA 4OK5A 3GROA 4M3NA 2VYQA 3ZWAA 2AYYA 5DXJA 3EEBA 2VBGA 4PAWA 4WMLA 5K2OA 4GEKA 3VM6A 1SD1A 2CKMA 2NQ2C 1L7NA 1L5YA 1HTBA 3FUWA 4R1SA 5DEIA 3WK6A 1PJBA 4CM8A 3QFRA 1E6MA 2BE9A 3NKFA 4DT1B 2BL4A 5LYJF 3V1NA 1JXQA 1T8TA 5IT0A 2FEOA 1GAEO 1E9CA 2H06A 1QQTA 3HXTA 1G3IA 1Z25A 3FYUA 1HNNA 4JC4A 1TD9A 2CXNA 3DV0A 1JJAA 4OAQA 4PRLA 2VQ3A 1PFKA 2VF4X 1UXHA 4IJUA 4LPSA 4Q01A 1OFHA 3SMQA 4BFWA 5BN3B 3EVFA 4G97A 3NPAA 2Z56A 4RCYA 1ZN2A 4W9NC 4WTOA 3NEPX 3TIFA 3GFFA 5LIPA 1QC5B 3RYHB 1FFBA 1RAGA 1XJ0A 3EFOA 1W96A 4MVJE 1X1CA 1NVFA 5ALJA 2I7XA 4K6FA 3EQZA 1PL0A 4G8DA 4KI0A 5EKTA 2X0FA 3RTBA 4D9BA 5FXMA 3OQVA 3SVTA 1RQGA 4QPCA 2QM3A 4EELA 1FDSA 4C4ZA 1V9LA 5HBRA 4EF6A 1X6VA 1GDTA 5H4GA 1EFVB 4D6YA 1HNZB 4WNCA 3C1AA 1COWD 4CM6A 1EAYA 1KFKB 4CZ2A 4GO1A 1Y7TA 2CHUA 2Z2IA 1ZUIA 3A2NA 3OA0A 3ISJA 4WASA 5KKAA 4BB9A 2QD1A 4QXRA 2RGNC 2I87A 2O0HA 1LPOA 3I9V1 2JBWA 3AUTA 2W8BB 1TVKA 1GKKA 3CJRA 5IJXA 3UJCA 3NXKA 1MA0A 5GJVC 3HPQA 1XRRA 2NO1A 3RU3A 5LFAA 1W29A 5B3LA 3OP1A 4Z9BA 3GFQA 4AZ0B 5KHOC 1RT9A 3OLYA 1ZA2A 3L4EA 3VPAA 4A0QA 1M7BA 1UJ2A 4DJEC 5JAHA 3OWHA 3RB8A 3AJRA 3FOEC 1TQ6A 2K2QB 3LCJA 3R6GA 1C9JA 1P1HA 3B36A 3GJTA 5FQNA 2CLSA 3ENQA 3Q10A 3UJBA 2ZTVA 2H4XA 1NJ6A 3CLUD 3HZHA 3JAMA 1NQOA 2L17A 4ZCRA 1CE8A 1NRXA 3LCUA 3EWSA 3FROA 2XEDA 2BGIA 4E5UA 1ZH0A 5FDFA 1E8NA 2ASEA 1GEEA 2CB9A 2G77B 4LCEA 4DZZA 4JI4B 3BSWA 1EFRD 3OZAA 4N03A 2QM7A 3SM9A 4CHGA 2BEVA 2NTVA 2YS6A 4A10A 4GC5A 4LWZA 4Y2TA 1RJEA 5H81A 1Z2DA 3KOUA 5EC8A 1VI6A 5IEBA 3R7WB 4Z8XA 4AQYB 3TMKA 3E9MA 4M76B 1G5FA 1YR1A 4EHKA 1RBMA 2HNKA 3WDMA 2BMWA 1SBTA 1XK6A 4RZSA 3CNBA 3TEFA 1VKHA 3EHDA 1Q12A 1M6YA 4MUKA 3TL2A 3S68A 3E70C 5LDDC 4HY3A 1UJNA 3KIPA 1U28A 2A35A 4WNAB 1N57A 3BH6A 4HL6A 1YDGA 2EV9A 1X1SA 5E4JA 3I53A 1Q1ZA 1Z0UA 1U8AA 5IVHA 1A7JA 3V48A 4E11A 4LQLA 1KQ3A 3DBRB 1UZNA 2ZIZA 4IOJA 4Y1RB 1JILA 3QTTA 1SBYA 4FYJA 4BMYA 1FFSA 2Q5JA 4LNUA 5EP3A 5JE8A 5TPWA 1AX9A 1H2FA 4US2R 1XQ6A 5ARDA 3S2GA 5E6SB 5B3JC 3DTVA 3DLCA 1LK0A 3J81k 1XJ5A 5CB8A 4M1ZA 5LQAA 2OOKA 3I64A 1P91A 1DOHA 3TTYA 5LL6P 4AURA 4Z0HO 3VTZA 5CDUA 2AOTA 3MS7A 1RYNA 4XSGA 1IG0A 5IKXA 4JFRA 3MJEA 4M83A 3D7LA 1YFZA 2J7PD 3K1JA 3HCFA 3NTOA 4WCDA 1CY1A 2CNBA 3I9NA 5P8WA 4X8OA 2R87A 3GEMA 2JD1A 2JI9A 3WJAA 4BVJA 1PG0A 1IHPA 1VSBA 2XT6A 2FFJA 2IBSA 2NG1A 2PH5A 3TTXA 4TTPA 5HF5A 5MN6A 1XWFA 2BGTA 4BBAA 4EHAA 5J47A 5MFPA 5ITZB 2XRZA 4J16C 4CYMA 5B55A 4ABTA 1T9AA 1JZTA 1S3SA 3CVJA 3IVMA 2Q4EA 2F1JA 4Y2XA 2BMFA 3U2QA 2FKAA 4HSEA 4Z1MD 1KEVA 3C7TA 5D01A 3GDHA 4OJKA 5FWDA 3TRFA 1JKIA 5KDDA 1EHIA 5JQGB 1FFEA 2MYUA 2RC5A 2WJWA 3C8ZA 3E4DA 3M34A 2CFCA 4JEUA 2D1SA 4MR8B 1SAYA 1PJ3A 2FF5A 4RTMA 2J45A 1A2BA 1T3SA 1QV9A 1WVGA 1XNGA 2DR3A 2E5FA 2XTAA 4TLBA 1W36B 2M9MA 5I5EA 1KZ4A 2PGJA 3LIIA 4O4JB 2PBRA 4TXNA 1XKQA 2DR0A 4CNQA 2JLQA 2BHNA 2VPYA 3E9RA 2QDKA 2GN8A 3P0IA 3JQ7A 5IC4A 3NC4A 5G1PA 5EVCA 4EZEA 4MJ7A 1YC2A 1GQFA 3A6LA 3DB2A 4IAOA 5HKKA 1B93A 3Q3JB 3HXOA 1FU7A 1Y7PA 2X8WA 3VR2A 4I1YA 1U8UA 3FA2A 3JWIA 1MA3A 1PJQA 3LIPA 1HEUA 2P9QA 2VKTA 3L0DA 2LKCA 4UTPA 3K9FC 4CCWA 4BP1A 1E2HA 1CZHA 2W4IA 4WUTA 1CKEA 1EVIA 2A0FA 3U3XA 2RJNA 2GN2A 4RM3A 1OPRA 2FN7A 2IZ5A 2QY9A 2OVFA 3ONNA 3CNNA 3NWJA 3AHHA 4BQSA 1GRVA 2AQIA 2H31A 4Z9YA 2RKOA 3OBIA 4D8VA 2FWAA 2YXNA 1OPXA 3COSA 3PE3A 2RARA 3H13A 3JQBA 5AK4A 5F1PA 5LYJB 1MVLA 2JDIA 1PFQA 1NBAA 2PLNA 2XMDA 4K46A 4UPDA 3QIAA 3FWHA 2HRQA 4V0MA 1GXSB 1K3UB 3DOCA 4FFOA 2WAOA 1QO0D 4GYJA 4Q3LA 2EEPA 4GPTA 5DJ5A 2BFEB 1X9GA 2C5LA 4JUFA 2PX4A 2W2KB 2O8VA 4QHYA 4BVHA 1L6IA 1IZYA 3P97A 2R6GA 4YUWA 1R66A 1ZWLA 2W7TA 5CB0A 3OTOB 4R9VA 3RVDA 2C2WA 4YRDA 5LNK6 3QG1A 4WLFA 1OA1A 4RPCA 1EFLA 1UKZA 2HFJA 4JV5B 3PQ6A 4GWKA 1OGJA 5J3JA 4RTPA 1P1CA 4PLVA 4MGYR 2O6LA 1TK3A 3TCXB 4DLRA 5BOSA 1EFCA 2OC4A 2ZI3A 3PPXA 3WFZA 1FVHA 1U3VA 2Y1CA 4FT2A 1R6TA 2HNBA 1VIMA 5EXPA 2N47A 1N6RA 3O0TA 4BMSA 1IY2A 4NPHA 4TYWA 2BGJA 3VTAA 5K03A 4CL0A 1T6NA 3ZBQA 2IYSA 4WDRA 2WWIA 3BWVA 2VP4A 3VKVA 1OI2A 1CT9A 2CDNA 2HK8A 4D4IA 5JALA 4KL8S 5LVAA 4IIXA 3UMCA 1B1AA 3F97A 3CVWA 1CUGA 1ULUA 4BPRA 2IYNA 2W2KA 3T3GA 3RC7A 2BPOA 2NTNA 3IRVA 4KGXA 2X76A 1PVDA 4HWOA 2GM9A 4NX2A 4UBNA 4UUNA 4FGLA 3UYLA 4P0QB 2YV4A 1KO5A 1NVBA 2RGRA 2LRHA 3TIXB 3QF7A 1A2OA 4MEBA 2AC2A 2R6JA 4V39A 4P3NA 4HXGA 2GVZC 3TWOA 1KJJA 5JBIA 3CONA 2RGYA 4PGHA 2I91A 3IELA 1EYZA 4P3YA 3KYJB 2YJ4A 1PD0A 1W94A 1Y7IA 3QTBA 2QTFA 2DULA 5JAUA 4UM9D 3MRXA 3RWOA 4HAYA 3ETEA 4MUXA 2PGOA 2V7TA 4J9VA 3WR5A 3HKEA 1QGUB 2A59A 1NNSA 3E35A 4RESA 4YV1A 3D5TA 5AVUA 2VPQA 4NL4H 4TL7A 4XIFA 2R7KA 1BWQA 1J42A 1U6IA 4IXDA 3UCFA 2I2WA 3UAXA 4ZMRA 1YZ3A 3P96A 2JJYA 1MEOA 9LDBA 1MJFA 4FLMA 1SK8A 1LQ2A 4CCAA 4ENQA 5JHHB 3DWGA 4XQ9A 4XJVA 3VO2A 1DCTA 4BNDB 3AM1A 1U9IC 3LQFA 3KQTA 3H2IA 4N0PA 1E1NA 3SF8B 1QJ4A 3ZTYA 4NONA 4TVOA 3DR3A 4L28A 3PITA 1R4NB 2C7PA 4C7XA 2PYIA 1U5CA 3VGPA 3ETNA 1NTOA 1T0IA 1UL1X 4DCOA 1QPGA 1Q5PA 4GKAA 4F45A 3BERA 5IJZA 1RQPA 3EGDB 1EU1A 4HMPA 4RFLA 3LDUA 2ANBA 3BB4A 4G0MA 1EVEA 4RKEA 1P60A 2IS6A 3L0CA 4E12A 3K5IA 2XXJA 4B3GA 5JMWA 2RCNA 1KL7A 4YMWA 2Y1OA 1BEEA 4JJ6A 1OAAA 2BFCA 1LNZA 2JBHA 3LQYA 3AR8A 2AWNA 5E7QA 3HGTA 1GKUB 1KR5A 4PHCA 1LNSA 5TJ9A 3V8MA 1KI2A 3GQBB 3T5AA 1XZEA 2OECA 4RSGA 4PZ9A 4DJFC 2XUZA 5B12A 1YIAA 1ZX1A 4CG1A 4O2AB 2WHPB 2BHSA 3D6AA 4Q1EA 4LOHA 3DZFA 5HIMA 4MQ6A 3WSVA 2P4UA 3PDIB 4AT1A 1P1BA 4Q21A 3UKJA 3ZYCA 4CLRA 4N8EA 5GZ6A 3OJ0A 5TQ2A 2HW8A 1MN6A 4MV0A 5I9TA 5HFNA 1YV9A 2OORA 2PIAA 5FL7A 3MTDA 1QIDA 1F12A 1BRMA 2F3PA 3FTFA 1UJ5A 2QYSA 2E1PA 2ZU0C 3AETB 3K09C 1HYEA 4LY0A 3A1WA 1QXSA 3LCCA 1I1HA 3ICOA 5FLYA 2IW3A 1TU3A 4UHHA 1JU3A 2I1VB 3NOVA 1FJGB 3KHTA 4B3FX 2CNWD 4EUNA 3ZVKA 3D4OA 1HL7A 2V7VA 3GEGA 3SOPA 3SBXA 1ZNXA 3FFTA 3KPJA 5FLKA 3SMVA 4M88A 1ORHA 4ZHSA 2QAGC 1DEHA 5E6RA 3AVWA 1MAAA 2EJVA 5ALIA 2QUZA 3L3BA 1G7TA 1ESCA 1T24A 2GLTA 3SICE 4EY3A 4EL0A 5TPZD 3ZS8A 4M1SA 2FEPA 2GASA 3RSOA 1NFFA 2R65A 2D5AA 3CZMA 1SCUB 2NXNA 4ZTBA 4MUIA 4Y98A 4DQLA 2DETA 2SBTA 4RHUA 1U02A 4Y0VA 3U60B 2X0DA 5JCOC 3F5QA 3S29A 3OZDA 1M1YA 4HNSA 2C2GA 2Q2QA 4RKFA 4Y30A 5ALZA 2EJCA 5GM2A 5JNSA 3GGSA 3QGMA 2CJFA 4S1PA 5JLJA 1ZK0A 2YNMC 3HMQA 4GDMA 4WJKB 3RYTC 1I24A 5LLSA 2WJVA 3C6QA 3VPGA 4EUFA 4JJ8A 4LVUA 4O08A 2DE0X 1AKNA 1QNFA 3CH7A 3RK4A 2TMKA 4CM9D 4IH9A 4ISBA 2QTLA 4HEQA 1E94E 2ZIXB 4BFVA 4WDQA 4CUJA 3EVAA 4RTLA 5ALQA 5DN6D 3EXAA 2FSHA 1BCRA 2UDPA 3DOEA 5EEHA 5BN3A 5L3QA 4K8RB 3EODA 1PQWA 3NBAA 3LUJA 2VZEA 1BJRE 1YZTA 1TPZA 4PU0A 2P3OA 4EK9A 2B0JA 3R76A 2G09A 3BKWA 1NJGA 1U5BA 2QLFA 2L18A 5JMTA 1LTHR 5IF9A 2ZBVA 3IO5A 4GW3A 2WIJA 3L8ZA 3K0AA 1LSJA 3EULA 4V1CI 3ZXYA 3AU8A 1R6XA 1H9BA 5J59A 1G3MA 4KWEA 1SBQA 1DPGA 1KP3A 1MV5A 2B2XA 2GKSA 2GRUA 3AONB 3JQQA 3CBGA 4HFRA 4WY2A 5EQFA 1BGWA 3LPMA 2ZW9A 3JARB 4ZIRB 3LY9A 4PC7A 2AMYA 4PBSA 4KNWA 4DSZA 1JA1A 4OM7A 5LZ5A 3QWAA 3RKSA 4DWWA 3HNRA 1NUPA 2YY7A 4DJDC 3EGEA 3BBPA 2WSBA 4DXAA 1AHPA 4BLVA 1XAHA 1X3LA 4D3ZA 2Y2VA 1FP6A 4NECA 1X8XA 1Y4SA 3ANSA 4KYTA 2XCTB 4UBIA 4FE3A 4R2WA 4S1VA 3KQKA 2G67A 4RZHA 4JT9A 4BMXA 2V5AA 5D87A 3RUHA 1G3RA 1W2WB 1NQ5A 1CUJA 4NFSA 2Q62A 3S7TA 1GQOA 5AW7A 3AI3A 5KYWB 3PR3A 4QNMA 4HAXA 4MLDA 1ENZA 2FMFA 3FH0A 3UWMA 1TC1A 3A6KA 4W1QA 2J9GA 3A0UA 3S40A 3IEIA 1IQ0A 3WLEA 2JLBA 1NNUA 2VWHA 4TT3A 4AJEA 2Y68A 1GA4A 2D0DA 3CMMA 4H6VA 3IEKA 2QX4A 1OR8A 2CFIA 4XDYA 4D9FA 4QUEA 1Y7LA 1R3DA 1SVNA 3N86A 2N3ZA 3OHMA 3IEUA 4Z9XA 1UC9A 4IWXA 3T3IA 1VLMA 4D82A 5EIXA 2J5BA 2VO1A 2X8BA 2R11A 3KR0A 5T5QA 1M33A 3I2KA 4G1EB 4DDWA 2UYQA 2VJOA 1E0KA 3FWKA 1UC5B 2BMJA 3VZSA 2A67A 2WSYB 4CUZA 4N5MA 1TEHA 2PU5A 3HBFA 2RAUA 4FMCF 1U11A 3QE3A 3OPXA 5SZIA 4YP9A 4KOEC 2AUMA 1N5MA 4CLOA 3HJGA 1BHJA 4HG2A 4J75A 1I1NA 2G4CA 4ATNA 1QHIA 5F3WB 4RS3A 1D0IA 1BNCA 2AXPA 1J2UA 4G89A 3F5SA 3SJ7A 3WP1B 4ROTA 3ZGNA 5I7WA 1TQ4A 3TO5A 5BSUA 3R41A 4KIWA 4FI3C 5EY5B 3OKFA 3GAFA 2FLWA 2QPLA 3G49A 2H7VA 1YC5A 3FI9A 4GI3A 1R50A 1SU8A 4TZTA 1Z8NA 3ENZA 1ZXXA 5K2MA 4Y1FA 3C4VA 2WJJA 3RM3A 3EG5A 1B14A 3GDOA 2WT8A 3GLGE 4IF4A 2J5RA 2NACA 1I6KA 1RBQA 5A62A 4ZOLA 1K7EB 1X7DA 1QS0A 3P9ZA 4OHCA 5DKFA 2CV2A 1SVWA 4JGBA 3RRXA 3IIEA 4MW4A 3VPCA 4DWVA 4Z1OA 1HQYE 2VJLA 4ZRNA 3ROQA 4F9TA 8ADHA 1QTRA 2NSYA 3HGMA 4N82A 5LJLA 3LJKA 3DHYA 1OZ0A 4KFSA 1D6MA 2KQUA 3DMPA 4WKNA 2J85A 1XDGA 1RFGE 4D99A 2VAXA 1H4QA 5EG5A 2VCHA 1IB6A 2ABWA 3LS2A 4HYQA 4NZ9A 3UW1A 1L5HA 1PUJA 3OA2A 3OECA 4BMVA 3TNLA 2DT8A 4KU4A 4KW7A 2QOEA 3ZC3A 2GYYA 5CG2A 4LFBB 1T2DA 3ZE0B 2G1PA 1QGZA 2QB5A 4KC0A 1W5BA 2YJ6A 1RDFA 1LV8A 3GRRA 4K88A 1R0KA 4J7UA 4Q1BA 3AEUB 2XSZA 2JIMA 5DM4A 1P0MA 3KLNA 2PR2A 3BSSA 3DOJA 5JMPA 2Y1FA 1UKEA 1VA4A 3HEAA 1Z3CA 4DRXB 3FMFA 1KYVA 3N70A 1FDRA 3AUYA 3NWPA 1E7MA 2X86A 3FLAA 3GRCA 4JD5A 1J2RA 1OV4A 2BTOA 3AHGA 3UFXB 2Z5FA 3MJ4A 4LYDA 5JAZA 2PA0A 2R6FA 4H31A 1U7OA 4DN6A 4RE5A 4YAGA 3W2FA 1RCUA 2JZNA 5KZMB 2JG3A 2Z30A 2JHGA 1LW7A 2ONJA 4Y6PA 4IOLA 5CH8A 4BV3A 2GRJA 3TK1A 4C6TA 4I9NA 1BQEA 5CNJA 4GKJB 5KOHB 2HR1A 5EPEA 4M38A 2O3JA 2ZAYA 2XX3A 3U4QA 2AG8A 3I6YA 1S3FA 3VR5A 3WQRA 4X8LA 3UEOA 5BWLA 1RRKA 2OSVA 4NWIA 2G17A 3TNDA 1CYDA 1Z35A 4FFPA 5ESRA 5T7BA 4LC1A 2ZLBA 3HY4A 2O8FA 4YLGA 1FVFA 4D4HA 4I55A 1QH8B 1GGKA 2UVQA 4TYPA 1SCQA 1V9CA 4PX3A 4ZAFA 1Z29A 5J2UF 3IA2A 1C1YA 1U6KA 1Z0FA 1OYVA 4YJHA 4HNVA 1J0DA 5I7UA 3ZHRA 1CZRA 1G8GA 4JOQA 2B4QA 1Y6ZA 3DCIA 4KPFC 1E2MA 1IG3A 1VBMA 2ILTA 4ALKA 3WLMA 4QU9A 1H8HD 3ABSB 3SYMA 4UQLA 1U4NA 3TQOA 4AX8A 3B5IA 4EJ2A 3KPVA 4BLPA 4UUBA 3DEIA 2XV1A 4REQA 3I4LA 5P21A 1T0JB 2W90A 4KGDA 3WLHA 1VJ5A 3HJUA 3IDSA 2ZYGA 3P4XA 5I8ZA 1ZJJA 1UPCA 2VZ0A 3QBEA 1KMNA 3BD8A 4RWEA 2CJWA 2RHOA 4ENSA 4Z7NB 1G8SA 2X0NA 3OO1A 1NVDA 1I1OA 2IUYA 4F8EA 2R7AA 1N4DA 3MOGA 5JMOA 3M6FA 2IXFA 2PZ8A 5DB4A 2POQX 4PW0A 1Y8RA 1V48A 3Q15C 1TI7A 3RYHA 3UH0A 4C6RA 3A37A 1LPMA 4B6EA 3H5LA 2X0RA 2D7JA 1V8PA 1OX5A 2ZCVA 2VPWA 3HQ4O 3PC8C 4FWBA 2N9UA 2B83A 3ST7A 3UM9A 4P6VF 5EE1A 1DIHA 5A71A 2F9FA 2HBYA 2XVYA 4BNGA