3CH6A

Crystal structure of 11beta-hsd1 double mutant (l262r, f278e) complexed with (3,3-dimethylpiperidin-1-yl)(6-(3-fluoro-4-methylphenyl)pyridin-2-yl)methanone
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
264
structure length
264
Chain Sequence
EFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSRWTTLLIRNPCRKILEELYSTSYNMDRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pyridine amides as potent and selective inhibitors of 11beta-hydroxysteroid dehydrogenase type 1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
total genus 98
structure length 264
sequence length 264
chains with identical sequence B, D, E
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2008-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ch6A00
3R6DA 2JCVA 1KVQA 4B3HA 3ZN2A 5CEJA 2GZ2A 4DTIA 1EUCA 5ICMA 3MZ0A 4OJNA 1WAMA 1Z7BA 4XQCA 3VOSA 4NZ9A 1OZAA 1O6ZA 1EEHA 4E5MA 4A10A 1E7WA 4BNVA 1X15A 1EVYA 2EJWA 2W2LA 3Q9NA 1QG6A 5F5NA 5EPOA 3VC7A 1EFKA 3SX2A 1U3VA 1EMDA 5EL0A 1SMKA 3ZGYA 1IB6A 1R15A 1SB8A 3L4SO 5F3RA 3O38A 4CQMB 5THQA 1BGVA 3I9KA 1EVIA 4KQWA 4NJOA 2CF5A 5A9SA 1BSVA 2ZYGA 3PHLA 1ZJZA 1ZNQO 3HFGA 5HM8A 3WGTA 2PZKA 2OBYA 4GWKA 3A28A 1ZXBA 3WGQA 3UFXA 4BVAA 2JHGA 4XR4A 2VYNA 4IZHA 2OL4A 1B2LA 2EP5A 2D3TA 4B7UA 2BI7A 3H65A 5KJ6A 3NKLA 4IGEA 4B4UA 1YO6A 4ITUA 3N74A 4WE3A 4AG3A 2AG5A 2GZ1A 3OH8A 3KZVA 1HYHA 1NPTO 2X5OA 1A71A 5H81A 2P5UA 3EY4A 3ZWNA 3NT5A 3AM4A 2Y66A 1E92A 2V6GA 5ENDA 5A05A 3WYCA 2QZZA 2J8ZA 1ZK2A 2JCYA 4CUKA 4E5YA 1P77A 2WYUA 1SEPA 4G65A 4LCEA 5EESA 1EQ2A 1F12A 2JFHA 4J4HA 1P74A 4C7KA 1JA9A 1BVRA 4RL6A 5DOZA 1P1JA 2G0TA 3BMOA 4FFOA 4GLOA 1DOHA 4BNKA 4J4BA 4KDEA 2QRLA 1ENZA 1NPYA 2G82A 3ETDA 1A72A 2CFCA 5C3MA 5T64A 2HK9A 2GUGA 3E5MA 4L75A 4DLLA 1EK6A 1ZSYA 3JQAA 4PLCA 3PQEA 3PXXA 4CLEA 3F9IA 4MO2A 2FR1A 4PLPA 1CYDA 3U3XA 3F5QA 2XAAA 4BO9A 4QO8A 4XX0A 3LQFA 4DMLA 4EJMA 1EK5A 2LDXA 3VPHA 3KV3O 4NJMA 3FPLA 3Q1LA 1G0NA 1H9AA 1HE3A 1NP3A 4RVHA 5I7VA 4XQ9A 2DTXA 3SXPA 4MVJF 1VM6A 1KBZA 2CZCA 3PYMA 3GEGA 2IZ0A 1DRVA 1DBVO 1H5QA 4ZQBA 4E2YA 3RBVA 2YHIB 2UDPA 1PJ3A 4L4SA 2VTEA 4XR9A 1GEGA 4BNXA 4IDBA 3EUWA 4ZHSA 3RKUA 4AJNA 1BDMA 1PS9A 4L4XA 3WGGA 1I2BA 3ZV4A 1X7DA 1KERA 2O3SA 4FB5A 5A9RA 1PL6A 5FI3A 1YGYA 5F5LA 3B1FA 2X8LA 3L77A 4M86A 2BFPA 3SLGA 1WXDA 4L8VA 5L3ZA 3VDQA 3DQPA 4M1QA 2H5LA 3OIDA 2FRDA 4RF5A 3WQQA 1EVZA 3ROPA 4GX1A 1DIGA 4D41A 3GFGA 1SPXA 4CM4B 2ZTUA 4ALLA 3FHLA 3VPSA 1DLJA 3H8VA 4TQGA 3GVHA 2GNAA 4D3SA 1Y5RA 3WG9A 4PRLA 3AFMA 1DRUA 2XOXA 2RBEA 4X54A 5AXCA 4BO4A 1IE3A 4E6PA 3F6YA 1U3WA 2GZ3A 3NTRA 5JAQA 1Z75A 1PS8A 3X2EA 3RFTA 5DBFA 3NDIA 4MVJP 3WMXA 2Y1GA 1SBYA 4E33A 5TQVA 5IDXA 1P1FA 4RPLA 1X1EA 3GN2A 1LRLA 2CDAA 1UZMA 3A9WA 3N7UA 4GQAA 3LSYA 1SAYA 4YJFA 3HDJA 3JQFA 3GR6A 2BGLA 5A3JA 1U9JA 1V3UA 1GQYA 2DTDA 1K6IA 3DZGA 1XWFA 2VZ9A 4R69A 4A7PA 3U49A 1WMBA 1TXGA 4NG5A 1IL0A 2C0CA 2PD4A 4GPD1 5GZ6A 2BFOA 5THKA 4DL9A 5HTOA 3ASVA 3WB9A 3UGKA 6ADHA 3E6AA 4A27A 1DB3A 1BG6A 1DAOA 4HXYA 5DCUA 3KSDO 4O5OA 1UH5A 2NTNA 4I9NA 3INTA 3Q0EA 4GH5A 1ADBA 4E0BA 5ICSA 3VAZA 4K6CA 3PI7A 1WVGA 3IP1A 3OA0A 1WPQA 3S2GA 2G5CA 4B8ZA 2H9IA 1NNUA 3KSZO 5MGBA 3EC7A 4BNGA 1I24A 2YV2A 3FPCA 2DPGA 1YBMA 1F17A 2Q4BA 4FFNA 1O0SA 4Y6SA 3LT1A 4DC1A 4W82A 4GL4A 3AUTA 5IDYA 1PQUA 5LDGA 1R16A 2QW8A 4D0RA 4IJUA 2X9VA 2JFFA 5T67A 2EKPA 4IQ8A 1Z82A 3KXDA 2FY8A 2O7QA 4CLHA 5FEUA 1A27A 1QV7A 2E37A 3GUYA 4MP3A 1MG5A 4P4NA 4CM7A 2FPGA 3RC7A 3RC1A 2WSBA 4CUZA 3GPDG 1SOWA 4MKZA 4I5FA 2VRCD 4WOKA 1P3DA 3VVBA 4L0QA 3VZSA 4OXNA 4UVIA 1BDBA 2NVWA 2EEZA 1D3AA 2CD9A 4E32A 2HMTA 4H16A 3ZNQA 2ZIZA 4CMEC 1P0CA 4F6CA 3RUFA 2IE0A 4RVSA 2BRUA 1ZKMA 3MJCA 1JAXA 4I8XA 4DYVA 1WDKA 3MJTA 3UKOA 4INAA 1NXQA 3F4BA 4NK5A 5JPIA 1H2HA 2O7SA 4P38A 4YBZA 1ISJA 4IJVA 2NVUB 3TWOA 4KZPA 2RIRA 4LMRA 4B7XA 2C2XA 1Y7TA 4LGVA 4BO6A 3WNQA 5EIOA 4DGSA 4PLWA 4D79A 1ULUA 2FPIA 1JWAB 1Q2XA 3WFJA 3PWSA 4E4YA 3DAFA 5JYDA 4U8GA 3ZU5A 3WDSA 3V2HA 2AHRA 4A03A 1E3EA 3G17A 3KYCB 1KVUA 4AVYA 3O8QB 1PJBA 3BMNB 2IZZA 3BHIA 4YJGB 2P5YA 1BXGB 2O48X 2HMSA 4FQ8A 2NNLD 2OGUA 4UUOA 3GG2A 2OP1A 2O2YA 4W4TA 2CSUA 2Q4EA 4YR9A 4DPMA 5CPFA 2AE1A 4OMUA 3LZ6A 5ENVA 3WQSB 4M8SA 2NU6A 1DC4A 4N18A 1TT5B 2I65A 2BELA 1V3VA 4QO7A 3T4EA 3QWIA 4KUGA 3JD3A 4B4OA 3KB6A 3D7LA 1DC6A 3DBRB 1YRLA 2HSDA 4LN1A 4OSOA 5ITWA 3EZLA 4FC7A 3JYOA 1ZCJA 3UW3A 4ZRNA 3L0DA 4BNJA 3L6DA 2P91A 5IF3A 1E6WA 4GMFA 5G4KB 4G81A 4CL3A 4CPDA 5JMWA 1U7TA 1K5HA 4YT8A 5HS4A 1P44A 2I6TA 3IMFA 3DFUA 1GAEO 4FJ1A 5A5EA 4JIGA 3IJPA 3WGYA 4BKQA 2HMVA 1ID1A 2NQ8A 3JQDA 3PIIA 5L45A 4OQYA 3C1TA 3GFBA 1F06A 1I01A 4AJEA 5EN4A 4P8RA 3TZKA 3LDHA 2B35A 5COAA 1I8TA 2C7VA 3BMCA 5TIIA 3WWYA 5I9MA 4NBRA 5EERA 4MDHA 4CM9A 1T4BA 1LNQA 2AQHA 2HMUA 3OJOA 4RPKA 5TNXA 2WYWA 3I1JA 5L40A 4JXKA 4EYEA 3I6IA 1YE3A 4IJWA 4R3WA 2PZMA 3PZRA 4PG7A 4R16A 4YRDA 4KDFA 1O8CA 2R2GA 3UCXA 1D8AA 3ABIA 3AUSA 4ZQGA 5DCYA 5KOIA 4UULA 4QFCA 1VSUA 3GNSA 3T4XA 4WLNA 3IC5A 4LMPA 4WCFB 4EZBA 4R4JA 3WLEA 3KRTA 4PGFA 5CDTA 1E1KA 4JN6B 5B4TA 4JBIA 1ISHA 3PLNA 2V7PA 4ALIA 2V65A 3GGOA 3DMTC 1NQAO 1HSZA 4RCVA 2QRKA 4HKTA 5G0SA 1U7HA 4R1UA 1DC5A 2J3HA 4Y6PA 4TMFA 4FDAA 4IM7A 3GG9A 2DBRA 3F46A 2E6UX 3ADPA 2Y0EA 2P4QA 3DAGA 3RVDA 4A0SA 5DOVA 1DFHA 3WGIA 3PPIA 4GX0A 2SCUA 5COQA 2HMWA 3I5MA 4E13A 4JK3A 1LA2A 4FIZA 3TQHA 4JBGA 4ZQHA 3D3WA 4BGIA 2J3KA 5AXBA 1SEVA 4K28A 4LRTB 2DFVA 3ICPA 4RPHA 3G0OA 4CLOB 2NV6A 1U4SA 3CINA 1LX6A 3CZMA 3DONA 4RF3A 1CDOA 1ZW1A 1FDTA 5IXSA 2EGHA 4NR0A 2J5QA 1EVJA 4WLFA 4WNIA 1IPEA 2NWQA 1ADCA 2YW9A 3ZWPA 4J7XA 3EZYA 3ZWXA 4NI5A 3ENKA 1OFGA 5ER6A 2VUSA 1GQQA 3DBHB 2X5KO 1KY5A 1HE5A 3GN1A 1K0UA 4ZJUA 3EAGA 4U6QA 1WMAA 1N1GA 2GASA 3L4BC 5A04A 2VYVD 5L4SA 1DIBA 1F14A 2C5AA 1A7AA 3PGJA 3EHEA 4AJIA 3JQ8B 4YXFA 3JQCA 1EUDA 4MJLA 5ITVA 2OBNA 3ZWCA 1KVTA 1S6YA 4LSWA 5EMHA 4IQ0A 5I9NA 3D4PA 3EGOA 5KCZA 1A9ZA 1L1FA 2LDBA 3KYDB 5GY7A 4WJZA 1VI2A 4OOFA 2DU8A 3PHHA 3V1YA 4WLUA 4U0KA 4PIVA 1NASA 4R68A 4RVGA 1HLDA 2I67A 4TRRA 4I5GA 1KVSA 4UVGA 1GYQA 1T24A 1H2BA 1DEHA 4GVXA 3FBTA 1E7MA 4RPGA 4BKOA 4HFNA 2C7GA 4PVDA 3R0IA 1MP0A 1GUZA 3FNFA 2EJVA 2DBQA 5G2OA 3VPFA 1VKOA 1Q7BA 5JXWA 5JSFA 3G79A 4BMNA 3WGOA 5A3VA 4GI2A 1F0YA 4HNHA 4E3ZA 2YJZA 3O03A 2C29D 5TJHA 3DOJA 2OFPA 4URFA 4YEDA 4JP3A 4JNKA 2Q46A 1SOVA 2YV1A 3DMTA 2B36A 2FZWA 5TGDA 1PGQA 4RZIA 1QORA 3FR7A 1E1MA 1TT5A 4ILKA 1NFQA 4PRKA 3ANLA 5JMPA 3WMWA 5KWEA 3GT0A 1KC1A 2RH8A 4Y98A 4OSPA 1MC5A 1U3TA 2IYOA 3NYWA 2O4UX 2BFAA 2EP7A 3AI1A 3TSCA 3GHHA 3ITKA 4MIEA 3RASA 4DREA 3LC2O 1Z7EA 5KNLA 2J5KA 1U2GA 4RZHA 4DMMA 4J16A 2X5JO 3WBBA 5A5FA 3ZDFA 1H94A 2ZKLA 4Y67A 2PNFA 1DJQA 4XGKA 1HDZA 3OBBA 3TNLA 2FSSA 1ONOA 2YDXA 5BQFA 1FXSA 5JY1A 4GMGA 2VOEA 3AY6A 3DTTA 1XQ6A 2CVQA 4CR6A 4MVJI 1TEHA 1UP4A 2D1YA 1ONPA 2F1KA 2IXAA 4ZVVA 4J1NA 4J6FA 1VLLA 4CMJA 3I4CA 4CV1A 5I8ZA 3KVOA 3PWZA 4UEJA 4J0EA 4ZQFA 1UP6A 1PR9A 4EGFA 5G4LA 4KTVE 3QV1A 3U62A 3JQAD 4YAGA 1U5CA 4U6SA 3IDSA 4DWVA 2X7HA 4BUCA 3NTOA 3LF1A 3LYLA 4TVOA 4C4OA 1GPDG 3RROA 2QX7A 1XR3A 3AOEA 3D5TA 5BT9A 2I3AA 1U3UA 4IPTA 3BAZA 4FPXA 3P19A 3WR5A 4AJKA 3WIDA 3ULKA 1DLIA 1YB5A 5JO9A 2VWGA 5EQDA 3S2EA 3JD2A 1W6UA 2GO1A 4DLBA 2J6IA 4EUHA 4CLRB 3KLMX 4HFMA 2BLLA 4IJKA 4RF4A 4GKBA 5DBIA 1B8VA 3AUUA 4ND5A 3R1IA 4WEQA 1PU2A 2I3GA 3H5NA 4RLHA 1ULSA 4AL4A 1T2EA 3OETA 1RM3A 3C85A 3QQPA 4Y9DA 3RU9A 4Z0PA 4AJ2A 3F4LA 3BA1A 3D4OA 3VH2A 4HWKA 3O4RA 3Q11A 1P33A 2EKQA 1CEQA 1WZIA 2C5EA 2B37A 3AU8A 1PR3A 4RF2A 1PWZA 4D3DA 1ISGA 2Q50A 4YA6A 3ZH2A 3JQFC 1C14A 5IDWA 3U5TA 1E0DA 4MP6A 1Q7GA 2PZLA 3UVEA 4XIJA 1N92A 1X1TA 1HDXA 5CAEA 3ZWOA 4J2OA 4HP8A 5L7YA 3DAPA 1K6XA 2ET6A 2EKLA 2AEMA 4I9UA 1GPJA 1GR0A 4AJ4A 2YFHA 1Y8QB 2FMUA 4Y6RA 1YJ8A 2POQX 2W2LD 1LEHA 1ADFA 1KEVA 1ZZEA 3BMOB 3EMKA 1O95A 3EW7A 1QYVA 3JYQA 3PDJA 3QVTA 4HNGA 4NBTA 2B0JA 3U4CA 4JX8A 1I3MA 1D1TA 1XG5A 1YQXA 3NJ8A 1AXEA 1DFIA 4GSKA 5CFZA 1GL3A 4BL5A 4CLRA 4HV4A 3HJAA 3ZNPA 1HYGA 3EVTA 3DEYX 3HUDA 2A9FA 4YJFB 1O5IA 4R01A 4GAEA 1ZMOA 1YL7A 2VWQA 4IDEA 5CDUA 2WEKA 1YH3A 4Y8VA 4AICA 2W2KA 1ZXLA 2A35A 3M6IA 4IMRA 1ISFA 1GADO 4QXMA 3GMSA 3IL2A 5DCWA 3C7DB 3WGZA 3MJ4A 3ZNOA 5CDGA 3ENNA 2C2YA 4ALMA 2X22A 1R0KA 2PD6A 1X7GA 1YB4A 1MXFA 4YYZA 3K2EA 2D4AA 2GDZA 3EVNA 3CMCO 2PD3A 1MLDA 1FDVA 2PH3A 3U4HA 3HQ4O 1N9GB 2VN8A 2O23A 3OM9A 1OOEA 1P1RA 5ES3A 4WNCA 3ROMA 4YRAA 7ADHA 3A1NA 4CL8A 1L7DA 4NBWA 1I33A 2X6TA 4KQXA 1PQWA 2RH4A 4DIBA 3BXXA 3VKVA 2DBVO 1H6BA 3NRCA 3DBRA 4WLVA 3RUHA 4R1TA 8ADHA 2Y1FA 4GGPA 3QIVA 1R4NB 3QVSA 1O94A 4J0FA 3RUIA 4RLSA 2PY6A 1VL6A 4B8WA 2C54A 1DXYA 1FDWA 1KYQA 4ESOA 5AQ1A 4IQGA 1SCUA 2W8ZA 3RQSA 3RD5A 1ZSNA 3OIFA 4Q3CA 1MUUA 4YT2A 3S55A 4BO5A 2QYSA 4ZGWA 1Y8RA 2NTJA 5CEEA 3MOIA 2XXJA 3HNPA 1QV6A 1ISMA 4PLGA 5K6AC 4R1NA 3VH4A 4PLHA 4ZQEA 2R00A 3TN7A 1GEEA 2YY7A 4BNZA 4IXWA 3L9XA 4NJMB 2IODA 3FF4A 4PCVA 1Y5MA 1WDMA 2HJRA 4GX5A 4NU5A 1A7KA 1Y6JA 4OKIA 2ZB8A 4ZRMA 1IZ0A 3I3OA 4UVEA 1LSSA 3IQDB 4D43A 3BTUA 3GY0A 1ARZA 2VQ3A 3WXBA 5JYEA 3ZWWA 4CUJA 2AEJA 5F1PA 4LISA 3JV7A 2WYVA 2O3JA 1ENOA 1U8FO 2VCYA 2Y1DA 3PJGA 1OC4A 5C7OO 1UR5A 1J49A 1OMOA 3RSHA 3L9WA 3NTQA 4BHTA 4E31A 5IFLA 3LT2A 4FCCA 3LU1A 4QECA 3W8EA 1YWGO 1Q7CA 3CKYA 3KYDA 4ZD6A 3VTFA 3GEDA 1DJNA 1FDSA 3I9MA 4BB6A 2HLPA 5DZSA 3PYLA 2D5AA 4OL9A 1GTMA 1SNYA 2HAEA 2Z95A 5U1PA 1C1DB 5IN4A 1QRRA 3AK4A 1DIHA 1TA4A 3F5SA 3TOXA 2ZQZA 4IDFA 2QIOA 1RYEA 1GFSA 3L4BA 5JBIA 2G76A 1V3TA 4UEKA 1UDBA 5JLAA 2X9NA 1XKQA 5TRTA 2VRCA 1ZVMA 3ETGA 4GLLA 3PDUA 3NAQA 1NR1A 5H83A 1RM4A 1PIWA 4OOEA 2YV3A 5JCXA 3VH3A 3ONFA 2FP4A 1XU9A 4BNLA 1J0XO 3INRA 3MOGA 1LU9A 1PSDA 5CDSA 3AUAA 1AHIA 3HSKA 5JAMA 3CXRA 3BIOA 5A4DA 1YL6A 3E5RA 3JQBC 3D5QA 3NX4A 3NDRA 4YQZA 1GZ3A 3WS7A 4MOWA 1Y9AA 1BTOA 3G3EA 6LDHA 1DHTA 3GUCA 4CM5A 3TL2A 2Q1SA 2XPCA 1X14A 3NGLA 4IDAA 3JD4A 1W0CA 3RAJA 3QWAA 4AJLA 3ZW8A 1I3LA 3KBOA 1C1DA 1ONNA 2C07A 1A4IA 4FFMA 4B4VA 2P9GA 2GCGA 4JQCA 3PHGA 4NDNE 4F45A 4NMHA 2YDYA 3S2FA 1LLQA 2Q3EA 4NBVA 3DZKA 1JU9A 4KTTE 4XZ3A 4PLZA 1B8UA 2HQ1A 4CM6A 1LSOA 3HE3A 1YJQA 4CM9D 5B4UA 2O3TA 2DTEA 1HE4A 4YJDA 3TPCA 3K6JA 1Z74A 3QY9A 3RKRA 2O50A 2X0RA 1NBOA 3P2OA 9LDBA 5I7EA 3UN1A 4DPKA 2TMDA 1GYPA 4LVCA 4XYMA 3AWDA 3D3WB 3PZBA 5IDQA 3C7CB 3FNEA 3JCZA 1HLPA 1NVTA 5I7SA 4MIYA 2BI8A 3OICA 4BGEA 5DT9A 3PFWO 4WCDA 3ZV3A 1WWKA 4JBHA 4EJ0A 2VYND 2DVMA 1DFGA 2Z1NA 4MINA 5GMOA 1PZGA 5U4QA 4F46A 5BNTA 2VZ8A 3PP8A 4IS2A 1GYRA 2X23A 2FOIA 3FNGA 4FS3A 1HDYA 4MKRA 2Q49A 3FTNA 5KKAA 2ZB4A 3CH6A 1AE1A 5HS6A 2CY0A 5JY6A 2BHLA 2FZEA 3BMCB 3PGXA 4Q3AA 3IOYA 2ZCUA 3Q9UA 1TI7A 1MFPA 3ZHYA 2Y1CA 3SC4A 4BKPA 2Y99A 1PJCA 5JFOA 4M55A 4ZA2A 5FF9A 4BNNA 2HCTA 3U9LA 1X7HA 5COBA 1T2CA 1XSEA 2O3RA 4Q3EA 3X2FA 4PZCA 3JYPA 2GERA 2O4CA 1ZH8A 1LSJA 3BZUA 4D7AA 2PTGA 1R37A 5A03A 5TF4A 3DC2A 2GYYA 3ZWMA 2JKVA 3K92A 4ZICA 1NWCA 2H6EA 3FRJA 3K73O 2BKAA 1MA0A 4EDFA 2X9GA 5JC8A 1M6HA 1DO8A 1LC0A 1CJCA 4CM4A 4CM1A 4FOOA 3I9NA 3RU7A 5C37A 3BMQB 4FOSA 3OJEA 1M67A 1NHWA 2O3UA 4PN3A 1QMGA 1T4DA 2EWMA 4L74A 4Z9YA 2QG4A 3E18A 4RJTA 2AQIA 2VYVA 4TRNA 1FDUA 1B8PA 1GV1A 5KIAA 1T2DA 2WD7B 2DUWA 3JD1A 4IDGA 3ZCXA 2JFGA 2V6MA 5A9TA 1Q1NA 3UUWA 4M87A 3ON5A 3PLRA 3VHRA 3PJDA 4OQZA 1RPNA 3JQGA 4BNHA 3RUCA 3IUSA 5DBGA 3RFXA 4BO3A 3OJLA 4FSHA 4N7RA 1A9YA 1GY8A 4IY1A 2ZB7A 3FNHA 3NJ4A 4RO0A 5CEFA 4CM3A 3RWBA 1OI7A 1GDHA 4FFPA 1BVUA 3CTMA 3O26A 1HE2A 5I7FA 1L7EA 2VNAA 3WSWA 3E9QA 4P4LA 3DBLB 1HF3A 1ZFNA 1XCBA 4DXHA 2ZTMA 4DPLA 1E3LA 1XEAA 3MJEA 4HFJA 3BTOA 4R1SA 4S1VA 4LSMA 2JHFA 4L76A 4UVDA 4YAIA 1N7GA 1NQ5A 3WQRA 1NAIA 3H2ZA 3W4JA 5G0VA 1E7RA 2ZB3A 3IJRA 3DHEA 2OHXA 5JC1A 3H9JA 4XKJA 4FD3A 3GDGA 3K5PA 1NR7A 1HDGO 1ZMTA 2HRBA 3D0OA 5K6AA 2CVZA 4YB8A 2JAHA 3DHNA 5TSDA 3JQ9C 3V8BA 1HKUA 4CQLA 3GQVA 4JROA 5CDYA 1OBFO 5IN5A 2VUUA 1EE9A 2D5CA 2D8AA 1YDEA 2GRAA 1NVGA 3WTBA 2TMGA 1NAHA 3KOUA 4MIOA 3VPXA 1KEPA 3CEAA 1ORRA 1GUYA 4J7UA 3IUPA 4XCVA 4TKMA 1GCUA 1OAAA 3L6EA 3W4IA 2PWZA 5KKCA 4J1QA 2EERA 3FTPA 1IOLA 3ITDA 3WJ7A 3KHUA 2Y93A 1O89A 2NTVA 3EDMA 4EW6A 1S7CA 3UICA 3ZU3A 1G0OA 1PL7A 4DBZA 2E82A 2QRJA 3OQ6A 2HUNA 4PLYA 3UOGA 2GN4A 3DMYA 3E9NA 4PLFA 2DAPA 3OF2A 3WTCA 1XLTA 3U4DA 1AHHA 3DFZA 1I30A 4XQEA 4AJJA 3QVWA 1E7QA 1HL3A 1VJTA 2RHCA 4EJ6A 3TL3A 1LRKA 3SLKA 1U1IA 3H4VA 5LCXA 4BNFA 2EIHA 2ZQYA 1CIVA 3P5SA 2X58A 2C59A 4OH1A 3KM0A 1HT0A 2GGSA 3I6QA 1W8DA 2Q45A 3W8FA 4IBOA 2YHUA 1BW9A 2ZCVA 3RJ5A 3ZZNA 1UXHA 1VJ1A 2X1HA 1SB9A 3OHSX 1DIAA 3V5NA 2Y05A 3ZWAA 1QR6A 1VL0A 3S1LA 3F3SA 3UCEA 4YAJA 1H6DA 5BR7A 3IIEA 3GNTA 4MKXA 4MVJM 4PZEA 2NUAA 1C3VA 1R12A 1IHYA 2PGLA 1MX3A 2QZ9A 1B14A 4KUHA 4DIOA 4NFSA 1ENYA 4HY3A 3TZHA 2Z5LA 1LBEA 2WDZA 3G1UA 4I5DA 1NX6A 1LLDA 1LQTA 2BGKA 4WLEA 5KJEA 1JWBB 1TB4A 3R3JA 4ND1A 3K9QO 2Y0DA 4CV3A 1WDLA 4W7IA 3DZHA 1H6AA 4BB5A 1Q0QA 3GF4A 1LDYA 2A4KA 3IKVA 4OYRA 4RQTA 4R3NA 3HG7A 4M49A 3TFQA 4RDHA 4BNUA 4L9RA 1Y9EA 1IYZA 4FBGA 4RDIA 3NT4A 2P68A 1PGJA 2GR9A 5F1KA 4AJOA 2JD1A 2OORA 4NNJA 1IY8A 1ZBQA 1HZJA 2PH5A 1KC3A 3Q2IA 1AUPA 3NUGA 3QSGA 3WBFA 1C0PA 1CERA 2CF6A 4J49A 3WOHA 1SC6A 2PGJA 2Q1TA 3AJRA 2HK7A 4L73A 1RKXA 3TDKA 3SC6A 2V6FA 1XELA 4WKGA 4ZN6A 4YJGA 1M2WA 2IDZA 4WEOA 4Z9XA 5TJ9A 4GWGA 3EYWA 1JAYA 2QQ5A 5BSHA 4W9NA 4WCFC 3VZRA 4BIIA 4QFDA 2OZPA 1NFFA 2DUUA 1FMCA 5C7LO 1A4UA 3B1JA 3SJ7A 5HBRA 5DP2A 4IINA 3K96A 4CMKA 5ILOA 4Q3NA 4KWHA 3WFIA 1Q0LA 4XYEA 4YDRA 4OIMA 3HN2A 3PJEA 2NVUA 1R4MA 5IJZA 5G0WA 1EE2A 1NM5A 3W8DA 1PTJA 4YRBA 3IKTA 1GZ4A 4IXTA 1LLCA 2J3IA 3LT4A 1DIRA 5CG2A 4HFRA 3TF5A 2WE8A 1SZJG 1LJ8A 1QYCA 2XXBA 3QRWA 4UUNA 4Z0TA 2WD8A 4XB2A 2GN9A 3H5RA 1T26A 4FC6A 4OXYA 3QW2A 3OIGA 2HK8A 1T2AA 2Y67A 1UXIA 3SJUA 1NQTA 1P0FA 1ADGA 2VTDA 4BNMA 5KVCA 3ONDA 1ZIDA 3RI3A 2DKNA 3HB5X 4DA9A 1E3IA 2PFGA 2Q2QA 3PHJA 4RPJA 2VUTA 1I0ZA 3CIFA 5G0UA 1CWUA 3GEMA 1TLTA 4N5MA 3GDFA 4WLOA 1IUKA 4CODB 5I8WA 1JDJA 2ZYAA 4BNIA 2HO5A 4J9VA 2GD1O 4KP7A 3GRPA 1B15A 3KLPX 3K31A 5GZ3A 4FW8A 5IZCA 1P9LA 2DC1A 3RBZA 1SO8A 2VWHA 3TZCA 1RJWA 5BSFA 1V6AA 1DAPA 1ZEMA 1J4AA 2CNBA 2DLDA 2F00A 2IRWA 4XD2A 1C1XA 1I2ZA 3GVIA 1EBUA 1X0VA 4QSMA 4NFHA 1EQUA 3ZV5A 1E7SA 4U7WA 4ALJA 4U0JA 1AN9A 3VTZA 3HN7A 4JJIA 3DHYA 2O2SA 4QT0A 2BF7A 2NU9A 3ZHZA 4B7CA 2P9EA 1U2DA 2AEFA 4TWRA 4D42A 5B1YA 1B3BA 1CQJA 1E1LA 5I9LA 3GAZA 3I9OA 2PGDA 4I5EA 1YL5A 4PFJA 3B70A 4EUFA 4BQRA 1F8FA 1W73A 2EGGA 5TT1A 3ZW9A 3Q6IA 5L53A 1LQUA 1Z73A 4F6LA 5ER9A 4YAKA 3KO8A 5TT0A 1R0SA 2W2KB 2E48A 1PGNA 4FJ2A 3ZWVA 4EI2A 2WJPA 3EK2A 1E3JA 4DQVA 3S2IA 5AXAA 5B37A 1V9LA 4LRSB 2JJYA 3O9ZA 1DDOA 3OQBA 4CMEA 2OOSA 3JQ8A 5F21A 3RC9A 3IAHA 3GHYA 4YTEA 1ZUD1 4NIMA 4XDZA 4OHUA 1NPDA 4Z0HO 5U9CA 2PA3A 1D7OA 1OC2A 4G5HA 3C24A 3L07A 2G17A 3HADA 4IIUA 4NHEA 5JO0A 1VC2A 5T8KA 5CP8A 1E3WA 3WWZA 4XGNA 4BQPA 3JQ9A 2I99A 1VRWA 4QX6A 2A92A 2VT2A 1E6UA 4PZDA 1YB1A 1M76A 3P7MA 3OECA 1MG0A 1Y8QA 1C1XB 4MVJG 4H15A 4W6ZA 1XYGA 1T1RA 1JW9B 2JL1A 1R0LA 3I23A 3ZI0A 1G1AA 4BKUA 1WNTA 2AA3A 3C7AA 4PVCA 4UVHA 3PEFA 3JQ6A 4IUYA 5JAIA 1E3WB 1V35A 2EF1A 2OP0A 2X86A 2YQ4A 4K26A 4D46A 3PFFA 1HXHA 3GZNA 5FYDA 4XB1A 3H2SA 5JDIA 5HRUA 3GH3A 1VJ0A 5T57A 3BHJA 5ADHA 1KS9A 4TVBA 3TJRA 5IXYA 1PX0A 3DB2A 4IIVA 5LDHA 3ZHBA 3KTDA 4MPDA 1VSVA 4OAQA 5CHEA 3KYBA 3I9LA 2EW8A 3FWNA 1PGPA 3GVPA 3SVTA 2RHRA 1E3SA 1V8BA 3GOHA 3JQEA 2J5RA 2A94A 5KJCA 3AOEC 3C3XA 1PS0A 5IZCC 1CRWG 5KVSA 1GCOA 4JP2A 5L7TA 5J23A 1UUFA 4LCJA 2FN7A 2IZ1A 1V0JA 1M66A 3AW9A 4KUEA 2EHDA 2VHXA 3GA0A 1GD1O 3STHA 1HZZA 3MTJA 4WK6A 2Y1EA 2W4QA 1YBAA 2I76A 4XJSA 2FSVA 4QUKA 3GPIA 3LF2A 4CM8B 4CQMD 1TVEA 2NM0A 2GLXA 1IZ9A 1HEUA 2GPTA 1UXKA 3B6ZA 5JDCC 4AJPA 1E5LA 2WWRA 4Z9FA 2I66A 4Z3KA 5EJ2A 3LLSA 3AM3A 4DIFA 4K6FA 3GAFA 3QHAA 3ETEA 2ILTA 4A73A 3Q3CA 3K8ZA 2PR2A 2B5WA 1KY4A 2DQ4A 2VHWA 4PG6A 2VOJA 2YUTA 1LLUA 1CETA 1I2CA 4D0SA 4FFRA 4DQUA 3CSDA 1R66A 3DO5A 5BSEA 2BH9A 3MWEB 4NK4A 1K89A 4DVJA 4EUEA 1T1SA 4BV8A 3WIEA 5DN9A 5A06A 5L7WA 3PHIA 3OJFA 3PIDA 2V6BA 1A5ZA 3C1AA 1QLJA 1WZEA 4OM8A 3WX0A 1BXGA 3DZJA 3QWBA 3ROQA 5BNIA 1NVMB 1F8GA 2UV8A 4BMSA 2IEDA 1IPFA 4MVJE 5AOVA 3I83A 3FSRA 5L9AA 2QHXA 2B4RO 2VHYA 3DZBA 4CMIA 1EBFA 5G0TA 3U4IA 1MFZA 1PJ4A 1H0KA 5IAAA 4TRMA 1HSOA 3DXFA 1VPDA 2C20A 3RCBA 3TFOA 4XWYA 4CM8A 1JLLA 2DM6A 4GBJA 5FI5A 1N9GA 1YKFA 3AI2A 3HB4X 2GN8A 3JQ7B 4CV0A 2YFQA 4XGIA 5DULA 1J5PA 2ZYDA 1K3TA 2JAPA 1KOLA 3IS3A 3GLQA 3VVCA 1D1SA 3B1KA 3NDJA 4GSLA 1YS4A 2PK3A 3OJ0A 1YQGA 4RQUA 2PLAA 1RWBA 1YVEI 4Q39A 5KTKA 1LDNA 3TZ6A 4WPGA 4AJ1A 1I5RA 1R4NA 3RIHA 4N54A 1NWHA 4YACA 3QJ5A 1H9BA 1KVRA 1VKNA 3CPSA 3A14A 3DTYA 3GRKA 1R4MB 4YWJA 4NU6A 4RVUA 4E5PA 2W98A 1RM0A 3A06A 3FWZA 3QWFA 4U5QA 2AW5A 5T6BA 1C0IA 1JN0A 4IDCA 5L51A 1PQPA 2WD7A 1UXGA 3ZU4A 1JKJA 4YQYA 4J2HA 1IULA 3D4NA 1BW9B 4LK3A 4EBFA 2GSDA 3GGPA 1XIVA 2VRBA 4J4TA 3ANMA 3MWDB 4A2CA 2OXIA 1I36A 2PKQP 4EITA 1GUFA 1YXMA 4ALNA 4CMGA 3MEQA 3ZWBA 1K6JA 1ENPA 3I9JA 4YPOA 3ROKA 3NT2A 2BFMA 2D0IA 5BNFA 1PGOA 4R5MA 2UVDA 3DBLA 4A26A 4I1IA 4YT5A 3T7CA 1X13A 5KJFA 1GU7A 1PJQA 3QLJA 4WUVA 1RYDA 2FHSA 3WSVA 3JQAB 3W4KA 2E4AA 1AXGA 2IXBA 1XQ1A 2JD2A 4XRRA 3D1LA 3BTSA 2PKQO 3E1KA 4RVDA 3VDRA 4B3IA 3ANNA 1YOVA 3HDQA 1DPGA 3UF0A 4NBUA 3JYLA 1TT7A 4MVJD 1GQ2A 4W9NC 4WCFA 1PEDA 2AMFA 1UDCA 2P4HX 4JLWA 4QEDA 1JQBA 2R6JA 3MJVA 3RBXA 3HDHA 3BHMA 3PYXA 4FJ0A 5K0ZA 5H82A 3ZU2A 3PWKA 1Q0HA 1HRDA 3E48A 5DDIP 1W4ZA 3A4VA 3TOZA 1PJSA 3QA9A 4ONEA 4TRJA 1QYDA 5JE8A 2I5PO 1HTBA 3DBHA 3BMQA 3KEQA 1YOVB 4R41A 1I10A 2Q2VA 4DUPA 1D4FA 2NSDA 5C5IA 5TLSA 2HDHA 3WYBA 3FCOA 1B26A 1NTOA 1UJMA 1ZK4A 4WECA 4XIYA 3DDNA 3KYCA 2YYYA 4TZTA 4J90A 3H9UA 4IS3A 4M54A 1FJHA 3HFSA 4BNWA 1M75A 1GZ6A 3JQGB 5JCJA 5L4NA 1P1KA 3C1OA 3PQFA 1IHXA 3ZNNA 2X0IA 3FI9A 4II3A 3WJAA 1LDMA 4IMPA 3FN4A 1N7HA 1BHSA 1LC3A 2O3QA 3E9MA 2NQTA 3QWHA 3QVOA 4OKNA 1WW8A 4PLVA 1DC3A 4OXKA 1Y1PA 3LVFO 5DNAA 3KEOA 3RC2A 1HYEA 3G49A 1PJLA 1B7GO 1YQDA 1CQIA 1LSUA 2W90A 1H6CA 2BMAA 3H9EO 2VHZA 3F1KA 3GC6A 3H6KA 1Y81A 4BV9A 4CJXA 4JGBA 4W99A 7MDHA 3HHPA 1HWYA 2HKIA 4GGOA 3NEPX 3RFVA 3MJSA 3E03A 3GMDA 4PG8A 3V2GA 2EXXA 4D45A 1FF9A 3NV9A 2WM3A 1LTHR 4GVLA 4YJHA 1KETA 1P31A 2D59A 2Y0CA 3M2PA 4OGWA 3VPGA 4HADA 2FR0A 5DF1A 4ND2A 5C7IO 2UUPA 2ZTVA 5JAZA 4BO1A 1UAGA 4I08A 5LC1A 1N2SA 1WLYA 1DHRA 4CLDA 1PL8A 2PV7A 1PJ2A 3G1TA 4PLTA 3DOOA 3DR3A 4NPCA 3SEFA 4TZKA 3M1LA 1LUAA 2AXQA 2VZ0A 3PJFA 1U4OA 2UUOA 3JD0A 4OO3A 4XRGA 5JNLA 3FBGA 3JTMA 1LI4A 1LRJA 1EDZA 1N1EA 1JKFA 4CR7A 3AFNA 1HDCA 3I4FA 4BNTA 5CG1A 4K1LA 4FN4A 3WLFA 1M6WA 3AOGA 1J6UA 3OEYA 2CUKA 2J3JA 4MP8A 2DT5A 1JVBA 2Q1WA 2ZJ0A 3KSUA 4DQXA 4FGSA 1ZJYA 1T2FA 4XDYA 3V1UA 4BO2A 4CR8A 1JKIA 2BGMA 4CLOA 1RM5A 3CZRA 1U28A 3UCFA 4BMVA 4DLAA 4XYLA 1Z45A 3P2YA 1EFLA 4WGGA 5JDCA 4J1TA 1LDEA 1BRMA 4BGVA 3DOCA 4HBGA 2ZATA 4F3YA 3V1TC 4Q9NA 3H9QA 2P2SA 3PK0A 1ISIA 3COSA 5F1OA 1E6EA 1JTVA 4O59O 4B79A 2HRZA 3JSAA 3UH1A 4P4GA 3QP9A 5L95A 4J3FA 3OA2A 4CQMA 2AG8A 3OEWA 1N5DA 1E77A 3GVCA 4MVJA 3ST7A 3HWRA 4JCOA 2DFDA 1BXZA 4XYGA 5MDHA 3GNQA 3OQ1A 5ILGA 4AFNA 2AE2A 2G1UA 4O63O 4XEHA 5T8KC 2NACA 5KVQA 1NQOA 5HWSA 4ALKA 5IZ4A 3VZPA 4IDDA 1T25A 4BKRA 1XU7A 3RJ9A 4N5NA 3RUEA 2CDCA 2Y1OA 3SBOA 4TROA 4YCAA 1ZSVA 3DL2A 4D3FA 4II2A 4XA8A 2DBZA 1QP8A 2RAFA 4Z3DA 1YDWA 2Y68A 1PJTA 3KUXA 1B3RA 3BTVA 2IEBA 1NHGA 9LDTA 3ZWYA 4FR5A 3D3EA 1ZEJA 1E7YA 3U0BA 5AYVA 4J91A 4ND4A 4UEOA 2JD0A 3VKUA 2R00C 3WYEA 2E49A 4CMHA 1DRWA 1VL8A 2X0JA 3ONEA 2H1SA 5G4KA 1I3KA 4J7CA 3UHAA 5JDIC 1VE9A 2D2IA 4CMIB 3LK7A 1QKIA 2GF2A 2BD0A 2RCYA 4QTZA 4BS9A 3ICCA 1XA0A 4YAEA 4E5NA 2AQKA 1NYTA 1UAYA 3F47A 2B4QA 3AY3A 4UUPA 4BOYA 4CMAA 1PWXA 2Q99A 1MC4A 1BXKA 4JJFA 1B16A 1MB4A 3W1VA 4E2ZA 1P1IA 4O0LA 5FWNA 1Z6ZA 5IG2A 5DP1A 3MCVA 3UAGA 4A5OA 1KEWA 4KWIA 3AU9A 2UYYA 2FPPA 1ZK1A 5KVVA 3GZNB 3MTGA 2JCXA 1YBVA 5BSGA 4YT4A 4O6VA 5L4LA 3OFSA 2OUIA 2Q2WA 2IYPA 1DSSG 1UP7A 1FK8A 3U09A 1MGOA 2AQ8A 4I9HA 1AGNA 1C0KA 2B5VA 1E5QA 5KJ1A 3NGXA 4NQZA 1XGKA 3LT0A 4DC0A 1HDOA 3H7AA 3GK3A 1QYWA 3ADOA 4E2XA 2C82A 4E12A 1C0LA 1K2WA 4D44A 2EV9A 4TSKA 3ORFA 1MV8A 1X0XA 2WMDA 3C8MA 3B20A 4GX2A 4EEZA 4YVFA 2UAGA 3OSUA 4AJHA 1P1HA 1HDRA 3BMNA 4H7PA 5AXDA 3AI3A 1O9BA 5A1TA 3ZV6A 4B3JA 1QXSA 4PG4A 5TC4A 4UAGA 2PZJA 2PKRA 3S8MA 1LDBA 2B4TO 4KOAA 4ND3A 2WE7A 2X0NA 2I9PA 8LDHA 4E2WA 1E1NA 3VH1A 1XHLA 2H63A 3PTZA 1XDWA 1U8XX 1N8KA 2OMEA 3AY7A 4ID9A 4J1SA 1U5AA 2OO5A 4BGUA 2Z1MA 3BYZA 5CPBA 4KMSA 3E8XA 5K9ZA 3CUKA 2Q1UA 3W6ZA 2P9CA 5FFFA 4N5LA 1BWSA 1BMDA 1PZHA 3GDOA 4YJHB 3K2BA 3Q2KA 1I32A 1EUZA 2HU2A 3LLVA 4UREA 1NFRA 1WP4A 4NH4A 1JVSA 3DZFA 1CF2O 4QQRA 2NADA 3JYNA 4R9RA 2ZK7A 3GVXA 4UUMA 2ZTLA 4DRYA 2XF8A 1PZEA 4RGBA 5TX7A 4E30A 4M89A 1EZ4A 1QLHA 3GZ4A 2NLOA 3E82A 2FWMX 1KEUA 1KIFA 4R51A 1UXJA 2CDBA 3I52A 3V2UA 4E5KA 3FD8A 3TZQA 1HETA 4LW8A 1QSGA 3RUDA 3ASUA 5EINA 1R6DA 5T5QA 4EEXA 1UZLA 3INGA 3R3SA 4J9UE 3PVZA 4CMCA 1QYXA 1B0AA 4WASA 3W6UA 4L4RA 3DBVO 3N58A 4IGFA 4C7JA 3H3FA 4CQLB 3FR8A 3HDYA 3M1AA 3WGHA 5JS6A 2VHVA 2X4GA 2B69A 2VT3A 4J43A 1EDOA 1I3NA 2GN6A 2ZJ1A 3JQBA 3LC1O 3QVXA 1G6KA 2B83A 3H3JA 1P45A 3H9GA 3H5AA 3WNVA 4E21A 4ZU3A 4FGWA 3O8QA 4G2NA 3IP3A 1MXHA 3CMMA 5B12A 3L6OO 4WOJA 4NFYA 3D64A 3K30A 4LVUA 4W7HA 2HJSA 4H3VA 3CE6A 3DZIA 4P22A 5JW6A 1Y8RB 4TKLA 5GZ1A 3LC7O 5TS3A 4HUJA 4Q3BA 4Z6KA 5EQFA 1LDGA 4BO0A 1LXCA 3F1LA 2CVOA 3OP4A 4XJTA 4CMBA 3KETA 1YONA 1UDAA 4RORA 3PRJA 2VNSA 2QYTA 1ZK3A 2NVBA 4K9DA 1ZK0A 4PG5A 4ROSA 2CMDA 1ML3A 3ZHXA 4B4WA 4Q3DA 3UXYA 3OMLA 2EG9A 3WICA 3DWFA 2VWPA 4RVFA 1UZNA 3PQDA 2NU7A 4S3MA 4GKVA 3HZZA 2NU8A 3RUAA 2DPHA 3M2TA 4R5HA 4JJGA 4BNYA 3TRIA 5A9SB 3VZQA 4O1MA 3JQ7A 5A02A 5JCJD 4CV2A 3QE3A 4DBVO 2YQ5A 3GGGA 5HA5A 3T7EA 4FFLA 4MVJH 2YHIA 4DYDA 4XQGA 1H93A 2FR8A 1PZFA 4BO8A 5AVOA 2YZ7A 4HX5A 5B4VA 4XYBA 4R9SA 4IZIA 3AM5A 4BO7A 2WTBA 2EW2A 1ZO8A 4CLXA 1GV0A 4RV9A 4R54A
chains in the Genus database with same CATH superfamily
4Q4DA 4U3JB 1ISSA 1ICIA 1P6QA 5K0EA 4JDPA 1KVQA 1FBNA 1DBIA 2FGJA 1WAMA 3NHYA 2QUBA 2M1ZA 1RFGE 1E6LA 3H2IA 3ZJVA 3TMAA 5I9BA 3R7BA 4BC1A 3JASA 4BIMA 1Y34E 1RCFA 3T35A 1EFAA 4A10A 1E7WA 3HCWA 4M1OA 4NG4A 4AO8A 1I2MA 4RZ3A 2WPNA 1ULZA 4BC0A 5JT1A 2W2LA 2PL5A 5E6SA 4M37A 3SG0A 5FYQA 1QG6A 4NCAA 5EE9A 1PVOA 3UAZA 2V0NA 5CLIA 4KLNA 3VC7A 3SX2A 4QRHA 1LVHA 1IB6A 4FGLA 3X1MA 4YFVA 2Z8XA 4GIBA 2IOHA 1P0QA 3CM0A 1YVDA 3O38A 2GFHA 2IIPA 3HV2A 5THQA 2Y4NA 1JYFA 1DQPA 2P3LA 3CY6A 1BGXT 2AMLA 4NJOA 2QU7A 5A9SA 1A2BA 1NW8A 2HMYB 1ZNQO 3EZGA 2XVAA 2FE1A 5E3HA 5HM8A 3M1YA 4WH0A 3R3XA 3WGQA 2VAPA 3EEYA 3UFXA 4G0NA 2VKQA 2XWBF 1Q0RA 2NVOA 5EWMB 3SEZA 2P4SA 5EXTA 5KQGA 1XDDA 3JQPA 1B2LA 1RWOA 4JUCA 2EP5A 5TEVA 4EO9A 1VL5A 2E89A 4Z51A 2C9BA 3ZYCA 3QEJA 2JIDA 1YO6A 2O14A 1ML4A 1BX1A 2AZ4A 4AG3A 3DKVA 3BZWA 3OH8A 2IQ5A 1XZFA 3BVPA 4LJ8A 1A71A 1N4DA 3WNBA 2RK4A 3BF8A 3HP1A 2VJCA 3NT5A 2V9PA 4EK9A 1C9MA 6YASA 2Y66A 1JXAA 5A0VA 2I62A 2O05A 3P2JA 4EA8A 1YZQA 2BZSA 3G6WA 5J1SB 2QZZA 2JANA 1JJBA 1ZK2A 5DEOA 3TBHA 1VMDA 1W5FA 4G1VA 4MB0A 1RHJA 3CNBA 2WYUA 2VK1A 4LCEA 4G65A 1L4MA 2PBFA 1M2EA 3L7CA 3MWEA 4LI0A 4WADA 3SS9X 5KU1A 2VRWA 5ULLA 4J4HA 1YSCA 4AB1A 3W34A 4CIDA 3E70C 1ZD9A 2V3WA 5KNCD 4H7IA 1JA9A 1BVRA 2J9RA 2IU3A 5JFGA 3KWJA 1JG3A 1YT5A 1WU8A 2FRVA 3FPKA 2VSXA 1CP3A 4GLOA 3P0RA 5ECDA 1KYXA 2DFPA 2O6HA 2Q9AA 1QGOA 1LKZA 1CX9B 2WJYA 3X1ZA 1NPYA 5C3MA 2CFCA 4N41A 3C3YA 1E2IA 1P7VA 4DMFA 4GR5A 3JQAA 4KHPB 3KSRA 2BONA 3PXXA 1DAFA 1E58A 1F1BA 2E87A 3IEIA 2LD4A 4XFKA 2WUWE 4CF5A 4KR7A 1MGPA 1QFXA 1T2NA 2TSYB 3F5QA 5D8DA 4N5HX 1G42A 2W83A 3LSTA 4BO9A 4DMLA 3BKWA 2JAWA 4EJMA 5SZIA 1RIFA 4IWYA 4IJMA 3VPHA 4UOZA 1KAGA 3HR8A 4E15A 3KV3O 4ZYXA 4ZOLF 3JWHA 5D86A 4KAXA 5FOXA 2GFQA 4M46A 4CKXA 1ZU5A 2CUNA 1MO3A 3IXQA 3VC2A 1NDUA 1ODLA 2CZCA 2JIOA 3GCDA 2LCQA 1H5QA 2Q28A 5C34B 2YHIB 1U2QA 2CEAA 3FLEA 1PJ3A 2ZIWB 4L4SA 3SHWA 2VTEA 4KRXA 4MEBA 5DXAA 3QFFA 4ZHSA 4FE3A 1GTJ1 2WHPA 5JPCA 3R9WA 1PS9A 2ECPA 4L4XA 1CUHA 5CR9A 2SBTA 1TK9A 1XLWA 3GAMA 1DAHA 1AQNA 4EY6A 1II8A 3JY6A 1X7DA 5K0SA 4DV0B 3FKSA 1DO0A 2EBHX 4MROA 2H17A 3RR2A 5A9RA 16PKA 3T3OA 2QTWB 3M6FA 2PO5A 3N2NA 1E62A 5K99A 4MW1A 1E9BA 1EG7A 2HWYA 2H2DA 3LQ1A 4O2BB 5I7OA 1AH2A 1ZS9A 1WXDA 2XYHA 5L3ZA 3DQPA 3PDIA 4QU8A 2UYOA 2YC4C 2H5LA 3FB1A 3VNBA 2HIGA 4RF5A 1N2CA 2Q21A 3VAAA 3GELA 3FSJX 4GX1A 1KXZA 3GFGA 4MV6A 1SPXA 4TN5A 3WYAA 3ZZTA 2OD9A 4CM4B 4EJSA 4X7BA 4L28A 3QU5A 2B4KA 4TQGA 5ALWA 3TG8A 5EZQA 1FJGB 5AKKA 2W22A 1UOQA 2ZBVA 3ESDA 2GM5A 1M2VA 2V5VA 1Z0SA 2B1JA 2WHRA 3RRFA 3WG9A 3AFMA 3OM0A 5EEHA 4V0LA 1WXFA 5P8WA 3WLJA 4F0JA 3PNLA 3PSAA 1T15A 1I4DD 1ORWA 4G41A 3UJ3X 4E6PA 2AUNA 2Z9BA 2AD5A 3EYAA 3F6YA 3GJ5A 4FHDA 1X1RA 1U3WA 4KK4A 4PEVA 4BV3A 4EGSA 5FPKA 3NTRA 5KC8A 1X7XB 2B3TA 2XZDA 2VP5A 3ESYA 4QRIA 3W5JA 2IEZA 1CEEA 3TO5A 1CNFA 3CLKA 5A0FA 1V39A 2WTXA 2WQZA 3ZIUA 5JBQA 1VPEA 4MVJP 1YUNA 2FPPB 3K1ZA 3M82A 4UTOA 4ETWA 1A95A 2Q4OA 4JC4A 2J5BA 4LGCA 1X1EA 2XVXA 1B8OA 1LRLA 3D3NA 3GN2A 3KHSA 4PO8A 3RRXA 1SAYA 4M4SA 4YJFA 1M73E 3W04A 3JQFA 4MYDA 2CV2A 4FMCF 1UINA 4BNDA 5A3JA 1U9JA 2DTDA 3DZGA 4LJ5A 1K6IA 1RP1A 2JIMA 3NWJA 4JJEA 4AXXA 4ZYTA 4R69A 4D1YA 5ALRA 4A7PA 4ZPXA 1TXGA 1RQRA 2SHKA 3ETJA 3BRCA 4LPKA 2GEUA 3T3NA 2R7AA 5B3AA 2JBWA 2C0CA 1XNRB 2CFIA 5BMVA 3KKZA 5FAKA 2IU0A 5HTOA 3BE5A 1VCNA 4IV5A 2PNJA 1J1ZA 2AG6A 3E6AA 4EELA 4OP1A 4HXYA 3D6VA 3KSDO 1J2RA 3O4VA 1V96A 3KAPA 4L15A 4W5RA 5FUBA 3TTTA 5DASA 2H59A 4GH5A 4OEHA 4E0BA 4YK7A 3SIRA 3VAZA 4K6CA 5DX0A 1E1DA 3OWXA 3MQ4A 4ZCRA 5BQOA 2J0SA 3OA0A 1X7XA 3BH7A 1R6AA 1SQGA 2EX1A 2J7PD 4F2PA 1RXSA 1AC5A 2AOTA 4YJ3B 1O0CA 1NNUA 4YMUA 4JT8A 1QRTA 4BCCA 3EC7A 1XRSB 1U04A 1PO7A 1Z68A 2HDWA 3E7WA 4K2HA 4QEZA 4TTQA 2IH2A 4OLBA 1JKMA 3E5HA 1FFXA 4LZJA 3LUDA 3FPCA 3NAMA 3EGXB 4W9MC 2WJ4A 1YBMA 2QYOA 1JG2A 1K98A 1UFVA 2Q4BA 3U1VA 1BVHA 3H2YA 4IAOA 4W82A 5KSOA 2YKGA 3AUTA 4Q7KA 1PQUA 3ZIAA 1BYUA 2FPXA 2I6QA 1R16A 3RS2A 3T9BA 4D0RA 3OPYI 1G7SA 2QNBA 1OH6A 5T67A 1ZD3A 5DNWA 4C22A 4IQ8A 3OCUA 3KXDA 1GZ7A 4JOBA 3QVVA 1QV7A 4YLYA 4P4NA 1Z4LA 4A82A 1KZ4A 4JKIA 2Z9CA 1SOWA 3AONB 1FFGA 2VRCD 1P3DA 1Z0AA 3PL5A 2JLVA 4RD2A 4OXIA 4M83A 4ENRA 4RTNA 3GO4A 1V7ZA 1ANKA 3B13B 5KQPA 5I47A 3BF7A 4MLZA 4OF4A 1VGQA 2N47A 4Q12A 3ANYB 1VP3A 1LWOA 1LZKA 3BE8A 3BQNB 3KHKA 4Y2TA 3X0DA 2XRFA 2GPNA 1IJEA 3IH5A 1GG5A 3Q85A 4RVSA 1ONBA 1ZKMA 2FXIA 2YASA 4I8XA 4NJEB 4RFLA 2R86A 3WZLA 4DLUA 3QKSB 4HB3A 5SY6A 3K1AA 4HK4A 4LYEA 4DLSA 1Z2DA 4ER6A 1X7ZB 2Y9PB 1G18A 3WGVA 1ISJA 1M8GA 2ZUUA 3IURA 2JZOA 2Q5CA 1S2GA 5ALFA 1FRVA 2CK3D 1ISPA 4KZPA 4NXMB 1FYWA 1FU7A 3FPEA 6REQA 3E7PA 4MH0R 4NX2A 3SYLA 2SKDA 2C2XA 4JEMA 1XNGA 5JVDB 5DTIA 1NXWA 1KJNA 3WNQA 4DGSA 5JHHB 2L18A 1D6MA 1C7QA 3F8TA 3UW1A 1OAOC 4PO3X 1I6LA 3RABA 5I51A 3HVIA 1IC6A 3DAFA 3SAJA 3QV2A 3ZU5A 1YJCA 4DZZA 1TVCA 2JHPA 1ICEA 1J2JA 1K27A 1PBTA 4L9WA 3O6VA 4X66B 2ZUBA 2HCFA 2VNKA 3M6LA 1Z4NA 4EY4A 3GPCA 3BMNB 3O91A 5LLDA 2N0SA 2HRCA 2P5YA 4ATNA 5JALA 1HLGA 2B94A 2O48X 4FQ8A 4XWKA 2B2XA 2WKPA 5EGSA 1WJGA 6AT1A 1N3LA 3EC2A 4QAJA 4ZZIA 3WP1B 4UUOA 1JEYA 1KYIA 3O9MA 2PX0A 3HJGA 1BX0A 4LYAA 2GFIA 2CSUA 1T6NA 4TWAA 4W4TA 5GGYA 3T7IA 4IICA 5EWLB 2ZR7A 4NCKA 3U37A 4AWBA 4OMUA 4KIWA 3VSCA 4DB2A 5A1JA 1KP3A 1FXWF 5KOHA 2VJNA 1VLHA 1KO5A 4IHAA 1GPH1 2Z5VA 4DILA 5FLKA 4MQUA 1VE1A 3FWHA 2QUAA 4U2BA 2YVLA 1TQ2A 3FPJA 4JVNA 3SFVA 5ITSA 4EWLA 2CYBA 4UM9D 5GV7A 1B23P 2IIVA 2AZDA 1V3VA 2RGYA 3BIXA 1OIWA 1TF7A 2J59A 3E1SA 4JP8A 4QO7A 5EZYB 3V97A 5AUNB 4O08A 5I3CA 3ELBA 1V9CA 4KUGA 3A6DA 3KV1A 5IMSA 2ILVA 3L40A 5J3JA 3D7LA 3GW8A 4A9AA 1L5YA 4JBWA 3EZLA 4FC7A 4JWKA 1WDWB 4I50F 4IXMA 3UW3A 5EIBC 3UOAB 1WETA 3FOBA 3L6DA 5IF3A 2YTZA 4GMFA 5G4KB 3WRYA 4DG8A 5DRTA 2WLSA 4P92A 4R1PA 3R8XA 5A7FA 3KTAB 4Y1RB 1T5TA 3D6NB 4YRLA 2W58A 3IMFA 4ZIRA 4DEYA 1MX1A 4C4ZA 5A5EA 4ZK6A 3ZDQA 3IJPA 4BKQA 2W43A 5L45A 2AHOA 3L7BA 1U3CA 4QLOA 1JDPA 3JVEA 3C1TA 1P80A 2V9CA 3GFBA 3KVRA 4ZV9A 3SXUA 4EG6A 5EN4A 1I1HA 1W48A 4PYIA 4P8RA 2BJVA 1G4HA 3OM8A 3LDHA 1JFSA 2B35A 5HCIA 1KI3A 2IBSA 2DHRA 3EUFA 1FSGA 5DE3A 4YX9A 5TIIA 1ZU4A 2CUZA 4H6PA 5A5DA 4NBRA 1C3OB 1EIWA 1UOOA 2X1LA 1FDOA 3HU1A 1Q7TA 4HB0A 3I61A 3KQLA 3HY6A 2CVPA 3HFJA 1RBYA 3GDHA 3I1JA 4EYEA 3ICEA 2OCKA 1XJCA 3I6IA 3HI6A 4L5CA 3PZRA 1PJ8A 2P7HA 1JEEA 4R16A 2CL7X 1YCGA 1RYMA 4YRDA 4D8WA 4DZTA 1OFIA 1UBEA 1NBWB 3UCXA 4QBKA 5CCEA 3HL4A 1OVGA 3LVRE 4ABYA 1CIJA 4UULA 4FLEA 1VSUA 2HSJA 1YDHA 3GNSA 4N3BA 5C4GB 3L0ZA 5FOSA 5JWHA 3G02A 5EJMA 1KZ9A 1SUEA 3A1FA 3G8CA 3JZMA 1JWLA 4PGFA 3BFXA 3S29A 2ZS9A 3N75A 1BA2A 1FXWA 2GWRA 3PLNA 4PSAA 4Y30A 1LBTA 2V7PA 4ALIA 1QP4A 4X20A 5K7SA 3DE4X 4QC2A 2BGTA 5AHRA 4WBXC 3THXB 2ZIXB 2BWJA 3QX8A 4RCVA 4BQSA 2QRKA 1C9JA 3R3WA 1U7HA 3PFCA 4HKTA 3GRVA 4RESA 5G0SA 4R1UA 5T4HA 5K5EA 3AVVA 1T5BA 3UQYS 1UIMA 3ZLVA 2ZZMA 4OBWA 1JZSA 4IHJF 3ADPA 2NU8B 2X4DA 3LQYA 1M1NA 4HMPA 5F76A 5HZHA 5D3MB 1K8RA 1SXJE 1KP9A 2SCUA 3PIRA 1GRRA 2XQVA 3O1IC 4JK3A 5COQA 1F6BA 2F1HA 4AMZA 4EHFA 1B93A 3JAKB 3UB4A 4N76A 1WF3A 3DG9A 2R6GA 2X1MA 5B64A 4F2GA 3AF0A 3HZOA 3C1UA 5D5QA 1IVSA 3G7NA 4QYSA 1N2CB 5AT1A 2VHCA 4FGZA 5B1DA 5IS2A 1CDOA 3EQZA 1K3FA 2JJ8A 2X6QA 3FUCA 4KSBA 3VNQA 4JFAA 1H4SA 3PS9A 4NU8X 4BTLA 4BLRA 2IEAA 5FADA 2MSEB 4NMMA 4XD7D 1XA4A 2WWFA 1UT8A 5CLGA 5EYPA 2OM6A 3ENKA 4C05A 2Q3FA 4GXTA 3DBHB 2QD1A 2P9QA 1CRZA 2V03A 4EG4A 2P35A 1LK0A 1XQ9A 2OYSA 2WFAA 4M9XA 4ZJUA 4KPGA 4U6QA 2JBAB 4CKBA 3AHJA 2GXAA 2VYVD 3IEUA 1O77A 1Y6GA 5L4SA 1F3OA 2PHZA 3BWCA 1RI3A 3M6MD 1HOTA 1F60A 5AO9A 4D57A 3PGJA 1T6YA 1A7AA 3PDCA 3JQ8B 5ALMA 2RSLA 4O4HB 4AU1A 4YXFA 1A04A 4JAVC 5K8IA 2XYVA 3T9EA 1Z25A 1SUDA 1E2DA 2FFRA 1S6YA 1MV5A 3ZY2A 2OGSA 3BIWA 3CRMA 4IQ0A 1ZP6A 1A5SB 4LOIA 3M70A 4KPFC 1WB6A 1L1FA 3ZC3A 4BMCA 4LOJA 5GY7A 1JHQA 2VHQA 2YY5A 1VI2A 4WJZA 5D5HA 2DU8A 3IMGA 3H05A 3PHHA 1H2WA 3EPRA 4CI9A 1L7RA 3LIPA 3JU3A 4WLUA 3V1YA 4WKCA 5AW7A 4F4FA 4I0WB 4RZSA 3U7QA 3U44A 4Q0MA 3GBSA 4KXNA 5EXDA 2JGNA 1SUIA 2PGXA 4NNPA 3VYUB 1XZIA 2FFQA 4LXHA 3TQIA 1E7MA 1CC1S 2ID4A 4I8IA 1E6CA 2B8NA 2IL1A 1UKVY 2Y92A 3S70A 3TX2A 2GPWA 1N5RA 1AZTA 2GVNA 2LVBA 1MP0A 3AYZB 1E9AA 4JENA 3TTVA 1GUZA 2JFNA 1JR3A 3VV2A 3SR0A 4ARVA 3TEMA 5CDFE 1A97A 2OLJA 3GWZA 3NYQA 1ETUA 2FUG6 4FVTA 4F3NA 1JQ5A 5JSFA 3FKSD 1N3IA 2B4YA 1T1IA 1I7DA 4OHYA 3U7GA 4E3ZA 2FB9A 4FYPA 3HACA 3O03A 1PNOA 1M1UA 3LPLA 4URFA 5FUWA 2GAJA 2WUDA 3N2LA 4G6ZA 1BHQ1 2JIBA 1AKUA 4LGMA 4YEDA 2FSIA 3ZCVA 2W6ZA 4CCWA 4F97A 1SOVA 3TSWA 2GF9A 4MZXA 2JG3A 1PGQA 4RZIA 5IT0A 1YHYA 3KXIA 1KSFX 4PQEA 1TFUA 3K9GA 4HDSB 1Z0UA 3TW6A 2O8EB 2PLRA 2H3HA 2FEKA 3ODGA 3STYA 5BRJA 4PRKA 1KI6A 2OLKA 3E7FA 1UKAA 4NS4A 2IKSA 3NUQA 4LECA 1FFEA 2YHAA 4OSPA 4WACA 1NRWA 3FMVA 4ZT6A 2YWXA 3BB4A 1OLSB 2O4UX 4L6CA 4ARZB 2BFAA 5KYXB 1UK9A 3LWNA 1UJ6A 1L8LA 2NPOA 5LP6C 4EFNA 3RASA 3K8QA 4DREA 4TMWA 2XHZA 1CR1A 2WJIA 3NIGB 2GHIA 4M0MA 1S2DA 4DMMA 2CZGA 2X5JO 3U3MA 2J3MA 1M6VB 1XKLA 3OLCX 5F33A 1WW3A 4QOGA 4TUYF 3TQRA 3WBBA 3ZDFA 4XVUA 3HY4A 4Y67A 1JLSA 2QRQA 4KMOA 4KG7A 3CA8A 1Q6YA 2XQGA 1WSDA 1XDUA 2ZU0C 4UXJA 4YAOA 1GKLA 5T41A 5K05A 2WFMA 4BRZA 1MJ5A 1QCCA 1VG9B 2FWRA 3F6BX 1FW6A 1WA5A 1HNXB 5BSVA 1W581 4D81A 1XQ6A 1A1SA 1ZH4A 3NHMA 1TD1A 3W5SA 4ZTBA 4EUNA 3CZCA 4TM7A 2CUTA 3AJAA 4IVNA 1RYBA 2QZ4A 2AKAB 1L8OA 1GGNA 5FTMA 1GSHA 4AZSA 2YJGA 1D07A 3V7YA 2JJMA 1C29B 1GAWA 1RP7A 2JHCA 3F6EX 4U7FA 3SN6A 3U62A 1U5CA 3E9CA 1CCWA 1TVKA 4BUCA 4DWVA 2WM9B 3H6HA 3NTOA 5FPYA 5IVKA 2DUNA 3HKEB 1KYWA 3DL7A 5IP5A 1UKZA 4LKRA 1GPDG 4MUEA 2XDWA 3RROA 4AMBA 3P97A 5AKJA 3AOEA 2VPWA 3D5TA 4OGFA 2I3AA 1Y3IA 3CRQA 4Z4HA 1ZRNA 4AJKA 1M2FA 4BWGA 3P52A 4HOYA 2Q3HA 4Q4AB 3ULKA 1FA9A 5AW4A 4NY1A 5JO9A 3II6X 4QG7A 3RWMB 2VWGA 3B12A 2GHQA 2AOWA 4M1ZA 5EQDA 3S2EA 4BV2A 2G9VA 4QPCA 1CRPA 2WTNA 4X6LA 1TYAE 1ECGA 4AAYA 1NATA 3VV3A 3AO0B 4EUHA 1N5OX 3HJUA 2AD1A 1V5IA 1B8VA 2WJAA 5DBIA 2YS7A 3TGPA 1DS6A 3KQTA 1BCRB 2I3GA 3H5NA 3IAM1 4OM7A 2JGEA 4WEQA 5CAEB 2PPLA 4V0RA 4OL0A 1JXMA 1L5OA 3C85A 3MB8A 2YMQA 4Y9DA 1XTQA 2VL7A 4NWIA 3HDTA 3RU9A 1VLZA 4AJ2A 3BA1A 3VH2A 5CXXA 3GRRA 1RHUA 3K1TA 4O4HA 5E7MA 2ISSD 3Q11A 1CDDA 4I6GA 4BZZA 2H2AA 2NTEA 1JI3A 3JVUA 3AU8A 4G0WA 2ZRGA 3SVZA 3AVWA 2CWDA 5AKIA 4D3DA 3GEBA 3A7EA 3A9VA 3P4UA 3IODA 3HRKA 4NV0A 5H16A 3NAZA 2OGTA 2P2ZA 4N65A 4YBRA 5MFZA 4C07A 1E0DA 5DN6D 4Y0AA 5ECWA 4WRRA 1FMTA 3O95A 3UVEA 1X1TA 2Q0SA 1HDXA 2XMBA 3KOYA 3PX3A 5FI0B 1SXQA 4J2OA 3EMVA 4S1OA 4JOSA 5CXQA 1FSZA 3O8CA 2H18A 3LTNC 1ZQ9A 4Y2PA 5DTEA 2MSNA 2BTQA 2DT8A 2JLAA 3JRWA 1GPJA 2CHEA 4J16C 4TGLA 4ZO8A 2GD2A 3AY0A 3LGXA 3PUJA 2FMUA 7MHTA 3C6MA 3JARA 3UJNA 4W9RA 2ZWMA 1TYBE 1JR4A 3EN0A 1ADFA 1KEVA 1D0VA 4BFXA 1FQKA 1IVNA 1PR0A 1QYVA 2RAPA 3PDJA 3QVTA 2HBRA 5E0OA 3LVBA 2RGUA 2Q3BA 4IIBA 2C7PA 1XL0A 2A0KA 3ZX5A 4YUXA 4LTNA 3F3MA 4RY8A 2B4AA 2F2TA 1F38A 4NZNA 3SYTA 3WE7A 4DJAA 1DFIA 4GSKA 5CFZA 3R40A 2HT1A 3IULA 4IIEA 2WIFA 4ARUA 2CFOA 4XM1A 5WRFA 2F90A 3DEYX 2C5LA 3HUDA 5B30A 2DXIA 1E32A 3KZKA 1ZW6A 2WRZA 3KDSE 3AB8A 2J7KA 3RYCB 4RY0A 4GAEA 1YL7A 1B0ZA 2VWQA 2WEKA 3DDWA 4UM7A 4Y8VA 2W2KA 4HMQA 3SM9A 3OQMA 3LT5A 1KGSA 1VJRA 4ANFA 5EHXA 3RAEC 1SIOA 3UAVA 2OV8A 5AM3A 4C7VA 4OAPA 3MJ4A 3VQTA 3B6MA 4GPEA 3ZNOA 1XI2A 3CNOA 3U7QB 2C2YA 1NMZA 3DZ8A 2F43B 1KYTA 2X22A 3QK7A 1XHFA 2IFTA 3SKVA 3JWGA 4TWZA 3W0LB 1IXSB 3DAYA 1UFRA 2D1FA 1Q0PA 3VOBA 3EZNA 3K2EA 3K3PA 3EVNA 2NO0A 2XEDA 4FDMA 3E9ZA 1MLDA 3EXHC 4O4IF 5KQSA 2O2ZA 3ETLA 5ES3A 1OOEA 3KJEA 4UHBA 2JFQA 4YRAA 3MTEA 3QFHA 2BVNA 3A1NA 4X91A 3SQLA 3HY3A 1AK9A 2RAVA 1EFTA 1V5EA 2X6TA 1G3QA 3NB0A 4RA6A 1FE8A 4DIBA 3H1EA 4ZVSA 1KOFA 721PA 4RMJA 4B3RB 1LBQA 3BXXA 5JOQA 3FFTA 1H6BA 3X43A 3RUHA 2AS0A 1MORA 5I01A 2GBLC 4R1TA 1P7WA 1NI4A 4P84A 1T36B 1N8TA 3MCTA 2G4LA 1ULHA 2CCGA 3CXUA 4LQDA 1MT0A 3C7TA 3DMNA 1JI0A 4RLSA 1BX3A 4L02A 3X1KA 1XCOA 4B8WA 3MC1A 3TTUA 5ECYA 4IQGA 3GJ8A 3MPUA 4JWTA 1CJTC 4EYSA 3OCXA 1L4BA 2X8AA 2PCLA 3URKA 1JHYA 2QD4A 5DM70 4YT2A 1ZSNA 1KFEB 2L69A 1F51E 1YA6A 3I2JA 1T10A 1M6NA 1X8XA 2QN3A 4UAVA 3HYRA 1Y8RA 1ZIXA 3LX6A 6CHYA 5LJIA 4AKIA 2NTJA 4CJXA 3IKJA 1Y63A 4UTZA 1PK7A 4E4TA 4AZ3A 2MU1A 2UVQA 1Z39A 3DWEX 4R1NA 3VH4A 2R00A 3RNOA 1GEEA 3C43A 4JI1B 4QULA 3RSQA 3P8ZA 5FTJA 2KX7A 2AXPA 1O95C 4W5HA 1L3IA 1U3FA 3O2JA 3B7WA 4NJMB 3TJZA 4BBPA 5KQRA 2IODA 3AFHA 4IOMA 4MUAA 1MQAA 1Y5MA 1GZVA 1WDMA 2HJRA 2Z2IA 4U6NA 1EESA 5ARBA 1TEZA 4YRGA 2ZB8A 3GLGA 4N8DA 1OI4A 2V7GA 4ZRMA 1HT3A 1D4OA 2VP3A 4KCGA 4XLZA 3K4HA 3QXSA 1P0PA 2G06A 3M4XA 4G24A 1P3Y1 3IQDB 3WXBA 1N75A 4FKBA 4F92B 5FPSA 3F9RA 2AFIE 3KOZA 2IYZA 3BCUA 2PX2A 2AEJA 2J87A 1Y9JA 4EL5A 5GIPE 4PONA 4RAQA 1VPWA 1JMYA 1G4AE 1N2GA 4LISA 1N7IA 1PN3A 4GVPA 3WAKA 1LD3A 5FL3A 1ENOA 2JI9A 3OCWA 3QVGA 4V3CA 5EHNA 3KKEA 4J1TC 4O4IA 4GC9A 1OC4A 4MQMA 3SZ3A 1RI4A 3M34A 4KR6A 4KW7A 3LAWA 2VPZA 2JPDA 4QT4A 3LU1A 3OQPA 2IITA 4BLPA 3W8EA 1H65A 2VK8A 3AR7A 2A67A 5EJ8A 4KI7A 3GEDA 2GM4A 1DJNA 1NLMA 3UZUA 2A1UB 3C3EA 3M81A 4BB6A 3DDZX 2HLPA 1U0RA 2FW1A 4P2BA 1RWXA 1L6RA 1W85B 5U1PA 4R2XA 2HAEA 2Z95A 1RJEA 2VH5R 5ESRA 3A2LA 3AK4A 3F5SA 3TVTA 3CLRD 2B1IA 2H29A 4OYHA 5G1PA 4IDFA 5TPZD 2GZHA 1U9CA 4S2EA 1RYEA 3LCJA 4N0DA 1MQ8B 3PFGA 2JLUA 2G76A 1Y0BA 1V3TA 2X9NA 5IW8A 2X6RA 5JTUA 3U7HB 5JNRA 1ZVMA 2OGWA 2ST1A 2Q5IA 3DEKA 4OHZA 1UBRS 4XFDA 1Q3KA 3NAQA 3NH6A 4M21A 4LZNA 4L8YA 1UBOS 1W4CA 1PIWA 1JFFA 3KLBA 4Y6QA 1JALA 5JCXA 4ZVOA 4PSCA 4ABTA 1P0MA 4LV6A 2J09A 3QFSA 4P7BA 1KRWA 2FP4A 1XU9A 3AP3A 1W19A 4YRRA 2E1RA 1LU9A 2ZBDA 2ZRIA 2R8RA 3AT1A 1L7XA 4HDCA 4S0XA 1BN7A 1QUFA 1AHIA 1M34E 1SKMA 1R0RE 1CQPA 1QFJA 1RT9A 3CXRA 3BIOA 2ZW9A 2OO5C 4WIAA 3V8MA 4G5QA 4YQZA 1GZ3A 3E9RA 1BTOA 4KWCA 3U13A 3DUWA 3GUCA 4CM5A 2KB0A 2XPCA 1QHGA 4HEQA 1ISRA 4IZOA 1VZ2A 4IVRA 3RAJA 2XTAA 1IXKA 1K9VF 3SLRA 4LF9B 4PE5B 3OG9A 5K2MA 1KBOA 4ER7A 1UM9B 1SN7A 3KBOA 3CX8A 2ZRQA 5F3DA 3FHJA 2CNOA 2FU5C 4WCVA 2GCGA 3PHGA 3H04A 3LX4A 5DNCA 2XUAA 3K0FB 2VH1A 3OU7A 4XVCA 2Q3EA 3PUKA 4XZ3A 4QIHA 1F2TB 1KMQA 1DVRA 2JAOA 3HE3A 3CH4B 3Q7QA 2Y1XA 4WZ6A 1QDEA 4X1IB 5DX1A 3FDZB 3T3HA 4P81A 1X8LA 3HH8A 4IKEA 1II0A 4N40A 1A9XA 221PA 3K6JA 3S7TA 3QY9A 2O50A 4TL6A 4YP6A 3K5HA 3I01M 1QMPA 1M2NA 3HKCB 4US0R 4DPKA 4D9NA 2ZIVB 1GYPA 5GP1A 3KPUA 4LVCA 3D3WB 1TPYA 1WHTA 3PZBA 5IDQA 3EEOA 1AUQA 1B6TA 4PAQA 3OICA 4V03A 3FNQA 3S28A 4HH3C 1PFUA 2RHWA 3QNUA 2IY7A 5E2IA 4CGYA 3PE6A 3NM6B 2HPZA 4EW1A 5JASA 4GKJB 1OX4B 3QU4A 4OSEA 4EJ0A 2VYND 2DVMA 3AR5A 5ALHA 5GMOA 5U4QA 1PZGA 4F46A 5CEEA 2WQ6A 1ZJ6A 3PP8A 3MBIA 1JAHA 1TZBA 3RVQA 4GPBA 4HVLA 3IT1A 5EZ6B 3E3LA 5HF8A 5L3VA 1XTZA 1SQ6A 3RVOA 2Q49A 2XWQA 5KKAA 2I3BA 2J0UA 2ZB4A 2I3DA 3CH6A 4O8ZA 5HS6A 1GZHB 3OCZA 2V6IA 4OKSA 3KR0A 3BE6A 3TRDA 5MF6A 2OKCA 5ELXA 2DBYA 5CW1A 1MX9A 5AH0A 2PUGA 3KB2A 1M1YA 2GB4A 4UXHA 4Q3AA 4TTVA 2ZI4A 1IG3A 2QX8A 2R84A 1WE2A 5JFOA 3HR4A 2PLNA 5FF9A 1MAAA 2PANA 2VDVE 3A11A 4BNNA 3U9LA 3TTXA 2JRCA 1PFWA 2G83A 2O3RA 4UOQA 1E2FA 2ZUEA 1F9AA 2H0RA 5FIUA 3VJLA 3PPYA 2C8LA 2O19A 5LA6B 1POXA 3F7TA 4X1IA 2PTGA 3R6WA 1CKEA 4MWZA 5GJCA 4BFCA 2HQRA 3DC2A 3KOWA 3K92A 3W6OA 5ICCA 3FRJA 5K20A 3LXMA 4J0KA 3MUOA 4X44A 3WRXA 1YJAA 2EBWA 1FJ2A 2YJ5A 3B60A 3L46A 4Y7DA 4CM4A 2WJ3A 2IHZA 4RULA 4FOOA 3EZXA 2Y9MB 3OZUA 4FOSA 1NHWA 4K6MA 4N03A 4EB8A 4PN3A 5H3HA 1T4DA 2QG4A 4JL8A 1O87A 4RJTA 2E7ZA 3AP1A 2AQIA 3U7RA 2I1WA 5KIAA 1GRCA 1T2DA 2C2KA 3KELA 4UDYX 1J22A 2DUWA 2QTVB 5EFOA 3JD1A 3REGA 1RMYA 1LTKA 3ZE7A 3N87A 3HDVA 4DCGA 5ALYA 2HA2A 2FEXA 4IGIA 5CA0B 3PLRA 4TV9B 2R1UA 4OQZA 5AKXA 3L8YA 1N6RA 5C8YA 4YMIA 1PT6A 3RFXA 1Y1RA 2C9ZA 4AMYA 3CPJB 4FSHA 3AESA 4N7RA 1GY8A 3HCNA 1IJKA 2C84A 3UJAA 2ZB7A 2ZJBA 3G9UA 1QAOA 3QMPA 3D5EA 1ZICA 2X2OA 3ESZA 3L3BA 2FQ1A 3VISA 1RRCA 2HW8A 1WCXA 1SKBA 3Q9LA 3Q3VA 4DR7B 1GDHA 4XGRA 3PT5A 3H17A 3SOPA 2VNAA 4QPZA 5DHSA 4AM8A 2F9MA 5D85A 5GAJA 1PR2A 2JKYA 2XDQA 4RD6A 4DF3A 1XCBA 1OLUB 4DXHA 4DPLA 1KPHA 1E3LA 1I7LA 1IDN1 1K8XB 2OENG 1G20B 2Q3MA 4UTVA 1WBDA 4HFJA 3C3KA 3P9ZA 4UVDA 1VLVA 3QEOA 2A4MA 1DUIA 3O2SB 3UJ9A 2YVQA 1GSOA 3DOHA 4KL8S 4NEQA 4TV8A 3VR5H 2ZB3A 3IJRA 1KEZA 2AXNA 3H9JA 2PMWB 2Q5FA 1SUFA 1ODSA 3BEDA 4KLRA 1XRJA 1SELA 2NNWB 3GDGA 5FV4A 1HDGO 1CQJB 1EWKA 4L5AA 4PXAA 5K6AA 4YB8A 1JR6A 5FJIA 2FPRA 3KT0A 3QLVC 4A4DA 3DHNA 4P9NA 1H85A 4CQLA 1GM5A 1O3YA 1ILWA 3LY7A 3OOHA 3K1JA 3UG6A 2D5CA 4DY6A 1GILA 1SCKA 1XEXA 3DVRX 1NVGA 3OUUA 4MHSA 4ZU1X 1PWEA 2FWNA 4MIOA 2JDIA 5CA0A 4F71A 1W5SA 3CEAA 2Z8ZA 5KOHB 1YMVA 2Z30A 1R0ZA 1VJDA 1ORRA 1GUYA 3DT8A 1YU6A 1KKUA 5IJ0B 4EF6A 4TKMA 3KPYA 5D7BA 4PYRA 1GIAA 1VSBA 5BR8B 2DB3A 1PFGA 1T0JB 2I7VA 1GGJA 2QR5A 3UHFA 3L1IA 4BX9A 5KKCA 4A36A 3LXXA 4ENPA 2DKOA 3FTPA 4C2AA 5FLXA 1TYZA 3ITDA 1DBQA 1ES9A 1GKYA 2BBSA 5TQJA 2VC2B 3SFZA 1ZKDA 3HM9A 3OT4A 4TV8B 2O2XA 3GP5A 4M0UA 4EW6A 4HF7A 2I54A 1Z5NA 2DPYA 3OQ6A 2HUNA 2GUWA 2GN4A 2ZIFA 1A9RA 4QODA 3GP8A 2A0FA 4TLBA 1TJ3A 3ICQB 2NN3C 2QN9A 2VDPB 3GD5A 1QGUA 4Q9HA 4FCTA 3R3YA 3IP8A 4XQEA 3UYLA 3K0HA 3EXHA 5EXEA 2IT1A 1HL3A 2RHCA 5E1MA 4I1UA 1GT91 3SLKA 4OQFA 2QM7A 1U1IA 4G25A 4RTKA 3H4VA 2YXPX 3L43A 3FOEC 2Q6TA 3OVMA 1PDOA 2X58A 4YXWA 1L1QA 1D4ZA 1TO2E 2A5DA 2GGSA 2PT6A 3OPXA 1L4HA 5TS2A 3WLLA 4DIUA 1Z2CA 4P82A 2QNRA 4M1SA 1LW6E 1M7GA 2H11A 2C98A 3NKFA 4S1NA 2PJRA 4D25A 3ZZNA 1J5EB 4IOJA 2R6ZA 3BB1A 3IV9A 3EZ9A 5EI5A 2Q3JA 3TCKA 1S3SA 2YCLA 4O2RA 1YZGA 5BUSA 1KJ9A 1IWPB 1MC1A 2VG8A 3HPQA 1VL0A 3OOJA 2FMHA 5D2CA 4YONB 3ZWAA 4FYYA 5BR7A 3GNTA 4LE2A 2BZGA 4KAAA 1C8LA 4MVJM 4X60A 4PZEA 1DKQA 1QK5A 2ZYTX 2G1AA 1C3VA 3OU6A 4LY6A 4AX8A 2QZ9A 4DIOA 2GRUA 4OD0A 1Y1KE 1R3DA 2Z5LA 3TZHA 1ZGBA 2GPSA 3OPNA 4K6HA 3CO5A 1XPUA 2CV0A 1DJLA 3G1UA 5DYGA 3L0IB 5EMKA 3V42A 1BKDR 2PUTA 3B89A 2CC2A 5KJEA 1JWBB 1TB4A 1L5NA 1D2CA 1HQYE 2Y0DA 3BRWD 3K9QO 3OF5A 3PNVA 4W7IA 3DZHA 3OCJA 4BUZA 1E2EA 2C0QA 3DVAB 1FRFS 3OX4A 4QU9A 4YR7A 1Q0QA 4RQTA 2A4KA 1F8YA 3IKVA 4JQSA 4OYRA 1RBQA 1G8PA 3DNMA 1G5PA 1ZI6A 2WVAA 3HG7A 3LS2A 4RKRA 4Y6OA 3TFQA 2IUTA 2BE9A 2CBZA 2P30A 4LC0A 1XAGA 2XRMA 4BYGA 4L9RA 2FFHA 2QUZA 3KD3A 4B80A 1PGJA 3KQVA 1MMFB 1DAGA 3CRW1 4MUHA 4KRYA 2OORA 4QNNA 1W1UA 4AJOA 4HQ6A 1HZJA 3Q2IA 4WZZA 5LMZA 2HF9A 3WBFA 3S99A 1EFCA 1MW9X 4AKHA 1FNCA 4J49A 4C2TA 2PGJA 2QB5A 2Q1TA 4XOUA 2HK7A 1Y42X 4RQBA 5KCZA 1YR2A 1Z6XA 2M1XA 4QL3A 2I2AA 1R8YA 4ZN6A 4U5XA 3EIWA 1I13A 4Z9XA 3W90A 3NHRA 1FFWA 3EYWA 2LKDA 1JAYA 2QQ5A 5BSHA 4WCFC 1Q83A 4NMXB 4RMIA 2PGAA 4QFDA 5DYTA 4MV9A 2WY2D 4QG3A 3HXKA 5KDDA 2I8AA 1A4UA 3MFQA 3OO1A 2X2EA 1HG1A 2WYHA 4RHEA 5LZ4A 4ADSG 1WXEA 4RCYA 1IVYA 2I6FA 3M5CA 3K96A 4CMKA 1KO4A 4OBEA 3LQ2A 4Q3NA 4B74A 1Z83A 1ESNA 1U8UA 4KWHA 3ES9A 3BZBA 5JJ5A 4ZAYA 3I32A 1NTRA 4XYEA 4D4HA 3HN2A 3PJEA 4HO1X 3N7TA 3IT3A 5HZGA 5IJZA 1V7PC 2ONKA 1QANA 3KT6A 4FT2A 1GGFA 3PV0A 1C41A 2VCEA 4B35A 3I76A 4JC8A 1LQ2A 3TF5A 2FQQA 3PC8C 2WE8A 4JLBA 3RS8A 3VR6D 5LL6P 2VQEB 4LDNA 1QYCA 3QRWA 1AKWA 2WFZA 2WD8A 3F96A 4DG9A 2GN9A 3A6PC 1FS4A 4PGHA 3IQZA 2ZR0A 3TK1A 1IQRA 1DQNA 3LUGA 3WZ2A 3FWKA 3G9ZA 2HK8A 1T2AA 4HUQA 1UXIA 4QXRA 1GXSA 1NQTA 4M60A 2UXCB 1ADGA 4BNMA 3RI3A 4NH0A 2DKNA 1A2KC 5LFAA 1HR0B 1Y6QA 3IQEA 4GLFA 1Y4DE 3I58A 1XVUA 4FNOA 1W59A 3GEMA 2BEKA 4WLOA 4EG3A 4JLPA 4MV7A 4B9AA 5JSZB 3M3PA 1JDJA 4WNYA 2FMFA 2N1BA 2HO5A 2A5LA 4TSRA 2Z56A 1ZCFA 4JZKA 4MV8A 4N0EA 4BZPA 1XVAA 3LLUA 3PXGA 5TARA 1P2DA 3FGPA 4MQFB 1JG1A 5AI0A 3T5DA 4AI6A 3W8NA 3A3NA 3ED1A 5H59A 3TZCA 3VVMA 1RJWA