3CH6A

Crystal structure of 11beta-hsd1 double mutant (l262r, f278e) complexed with (3,3-dimethylpiperidin-1-yl)(6-(3-fluoro-4-methylphenyl)pyridin-2-yl)methanone
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
264
structure length
264
Chain Sequence
EFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSRWTTLLIRNPCRKILEELYSTSYNMDRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
publication title Pyridine amides as potent and selective inhibitors of 11beta-hydroxysteroid dehydrogenase type 1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 98
structure length 264
sequence length 264
chains with identical sequence B, D, E
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2008-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ch6A00
5TF4A 5JYEA 1PJBA 3DBLA 2Q45A 2BGKA 3LT0A 1HDZA 3E82A 4Y6SA 4GWGA 1XU9A 1P3DA 4K1LA 1BDMA 3ETEA 3RU7A 5JW6A 1KERA 4FSHA 5A3JA 5KJ1A 1EUZA 1F0YA 1XLTA 3WGYA 4A2CA 4BKUA 1C1DA 1ONOA 3JQAD 1K89A 4LVUA 1JKFA 3EVNA 1ZJYA 2V65A 4W7IA 2OP0A 4WOJA 2GASA 1MP0A 3NJ8A 3RVDA 4OH1A 3TWOA 3W4JA 2E48A 5BSHA 3H65A 3HN2A 3NDIA 4BO8A 4X54A 4OXYA 2NADA 2PZLA 4YJHB 4DTIA 2VOJA 4G65A 4Z0PA 3ZWVA 5C7IO 3CZRA 5I8WA 1XCBA 1UP6A 5KOIA 1TXGA 5A04A 2AHRA 4Z6KA 4YAJA 2GF2A 4MOWA 2BFAA 2CMDA 2FZEA 3ADPA 4Y98A 1H2HA 4B8WA 3B20A 4NBUA 4B4WA 1BMDA 1RM0A 4JP2A 1HWYA 4BGIA 1JKJA 3KETA 1UP4A 1DPGA 3PQDA 4YT2A 1XELA 3JQ8B 4OOEA 1Y9AA 4XKJA 1QV7A 1DHRA 2P9CA 3G49A 1QLHA 1UDAA 1B15A 4R41A 4IJWA 2JL1A 4GX5A 3IQDB 3R1IA 1A71A 3TFOA 1U5AA 3OQ6A 4J1SA 4YJFA 1VM6A 1N8KA 1IPFA 2V7PA 3GVPA 3DBRA 3I3OA 3JQAA 1I5RA 4MIYA 1T26A 3ONFA 5CG2A 2OORA 3F46A 1ENOA 1SAYA 1HSOA 1KVQA 2J3IA 1R4MA 4JGBA 1LA2A 1W6UA 2AQHA 2J5KA 3GZNB 1ZSNA 3LT4A 4L0QA 4R4JA 2I5PO 3WFIA 4J4BA 1GUFA 3SXPA 3S55A 2QRKA 5H81A 4GPD1 4CLEA 3I9NA 3C7DB 4PLPA 4UEKA 3HQ4O 1YJQA 1A7KA 4M54A 1Z75A 5B4TA 3SJUA 2O3SA 4CR6A 2AE1A 3LQFA 4WLEA 2DT5A 2ZKLA 3PXXA 4CMAA 2A4KA 2EG9A 3ASUA 5ITWA 2B69A 2JCVA 3JCZA 4YR9A 4JBGA 1FDUA 2OOSA 4I9NA 4YJDA 3VZSA 3OQ1A 2D59A 1ZK4A 2AW5A 3L0DA 5COBA 3ZHYA 3M6IA 2IYPA 3D3WB 2C5AA 3C1OA 3H9EO 4DYDA 3P19A 4M8SA 2ZTUA 3K9QO 1PJSA 1E1MA 1WZIA 5FFFA 5MGBA 4R1TA 2Q1TA 1WPQA 4XB2A 1IB6A 2E37A 5F21A 3TF5A 3KYBA 3QW2A 1XA0A 3UN1A 3KRTA 4OL9A 1HLDA 2GUGA 4WCFA 2DFDA 1TLTA 2AG8A 1RPNA 4GX0A 1AGNA 1XYGA 5AOVA 2DBVO 3G17A 2AXQA 1P0CA 4CMJA 4IDBA 3F9IA 2V6MA 4TKLA 4J1QA 3UAGA 1HYEA 4J6FA 3ZU2A 1GQYA 2O7SA 3NT5A 1RM3A 1NYTA 1GYRA 4TWRA 4CMEC 1HTBA 1IPEA 1LDGA 1YQXA 3MEQA 2CVZA 1E92A 1F12A 3Q6IA 4CL3A 4KTTE 3QIVA 3E8XA 1MFZA 1J5PA 1OFGA 1PWZA 4MVJP 4Z0HO 5IFLA 1NFQA 3OECA 3CSDA 2X1HA 2QG4A 1U4SA 4A26A 4XA8A 2VYND 3QWBA 3LC7O 4IIUA 1W0CA 5A5EA 2LDXA 1P1RA 1A27A 2VWGA 4WNCA 3WMWA 4AG3A 1DIBA 2GO1A 4IMPA 2ZTVA 2JD1A 4EGFA 3WOHA 4CR7A 1H0KA 2PGJA 5K6AA 2I65A 4DC0A 2TMDA 1Q0HA 2X5JO 3DZIA 4H15A 4A5OA 1PJ2A 4PG8A 5ADHA 4UVIA 4CLRA 4PN3A 1RWBA 3RQSA 2IYOA 4BNHA 3QY9A 4XD2A 2A92A 3LK7A 3RJ9A 3RASA 4BB6A 2GLXA 2P5UA 5AYVA 1XSEA 1LJ8A 1HETA 2VHZA 3X2EA 4E4YA 3ROQA 1B3RA 3WNVA 3HWRA 2X0IA 1E77A 2I66A 1BW9B 4KMSA 2EGGA 1LSSA 4FFMA 1Z7EA 1DEHA 4ROSA 3M2TA 3GFGA 2PA3A 5I7FA 5IAAA 4F6LA 3V5NA 1F8GA 2FHSA 2VYNA 5KVQA 3VZQA 1TVEA 3GT0A 3H5NA 3I23A 4CMIA 1FDVA 1C0KA 1LRLA 4JQCA 2NVBA 3GVCA 4Z0TA 3PWSA 1WXDA 4E5KA 5IDQA 3OFSA 5BNIA 2CFCA 3DHYA 1G6KA 1VSUA 3NV9A 4CM1A 4PG4A 4YVFA 1K6IA 4XYMA 1G1AA 4R1UA 1E3IA 1OZAA 2HLPA 3BMNB 3KLPX 4UULA 1PZHA 3I9MA 2ZQYA 3ROKA 4NJMB 2X5KO 1LXCA 5KIAA 4RJTA 4BIIA 4XQCA 4RQUA 1LQTA 2GN8A 4RVHA 1LDMA 1QYWA 4G81A 4YAIA 3QE3A 3PZRA 4AFNA 3E1KA 2B5WA 3IKVA 1DJQA 3EZLA 3ZHZA 3UF0A 4B7UA 4BNWA 5JDCA 4BNMA 4CMGA 2YHUA 1E6WA 1U2DA 2C07A 3EC7A 4PRKA 3WGZA 4IZIA 3WNQA 4YJHA 1ZEJA 2WMDA 4DIBA 3D4PA 5LC1A 1DC5A 1A9YA 4OSPA 1VPDA 5JNLA 4XJTA 2G76A 3Q11A 1DLJA 5THQA 1ID1A 2O3TA 1R66A 2C54A 4BNLA 1B16A 1X0VA 3JQBA 1BDBA 1NFFA 3GPIA 2JAPA 5JO0A 5EMHA 4YT8A 2R6JA 4CJXA 2CVQA 3ZWCA 3PGXA 3N74A 4ZN6A 2HK8A 2DPHA 2F00A 4CM5A 4D46A 1GUYA 4FR5A 1YWGO 1KEUA 4NNJA 3ADOA 3PHIA 5G4KB 3DOJA 4R1SA 3ONEA 5T6BA 3RUFA 1NR1A 3GDOA 4B3HA 1PS9A 2CF6A 4Y6PA 4EUEA 2VWPA 3ZU4A 1ZKMA 4M89A 3OJLA 4GKBA 4BNUA 4YPOA 2B4RO 4OO3A 2CDCA 4IS2A 4BNNA 3GUYA 4PVCA 4D3FA 3AFNA 4WLFA 1BG6A 2RCYA 4JBIA 1VJ0A 3WMXA 1UP7A 3FBTA 4NMHA 3BXXA 1F06A 2UAGA 1I3NA 2PY6A 4CMKA 2HMUA 4KQXA 2O3JA 2C7VA 1HZZA 1FF9A 3QP9A 4NBWA 3RC7A 3U4IA 1JA9A 5GY7A 2BH9A 3E03A 1T24A 4XRRA 2EKPA 1YXMA 3IUSA 1KVRA 3A4VA 1G0NA 4OYRA 5DCYA 2A94A 3GQVA 4TVOA 4PLHA 1JKIA 1LSOA 2DTEA 3PYLA 5JS6A 1EUCA 2Q1WA 4ALJA 2CSUA 1TB4A 1XGKA 1MV8A 3DBVO 4XR9A 4LW8A 4Q3BA 3W1VA 5DP2A 4PFJA 2PZJA 4P22A 1C0IA 4B7CA 1IULA 3AJRA 3SLGA 5JDIA 4HFMA 1GUZA 2HK7A 1E3LA 2JHGA 1NVMB 2YV3A 1QP8A 4ND5A 3HB4X 3IOYA 2PH5A 3MTJA 4BS9A 2C82A 3H5AA 4I5FA 5I9MA 4NBTA 3ZNQA 5JY6A 3KSDO 1HYHA 3RBVA 3RUEA 4XGNA 1T2AA 1QYVA 1U9JA 1B8UA 1PQWA 4HWKA 3E6AA 4RPHA 3O38A 2FR1A 1N9GB 2DAPA 2EEZA 4L74A 4IXWA 2J6IA 4IQGA 5DZSA 4AJNA 1PS8A 3OEYA 3AU9A 3AY3A 1SOWA 4GI2A 1I3MA 1LLCA 4IQ8A 3KVOA 1C0LA 2W98A 3FBGA 3GEMA 3VZPA 1M6HA 3LF2A 2B35A 2DLDA 3U5TA 2YW9A 4I5EA 2E4AA 2VUSA 3WGHA 4IGEA 3NT4A 3PHLA 2X9GA 2GPTA 1C1DB 5JYDA 2WD7A 2EERA 1RM5A 2ZB7A 1VSVA 3FSRA 1I30A 1JN0A 2Y1FA 1L7EA 3DOCA 3AFMA 5U9CA 4W9NA 3V2UA 1LC3A 2FN7A 1K0UA 1Q7BA 2J3HA 4DIFA 3FR8A 3UCEA 1KBZA 4CV2A 3PHGA 4M55A 4FFNA 4NU5A 1HYGA 3RC2A 1SMKA 1QR6A 2DC1A 3JYOA 3ZWBA 5F5LA 2OZPA 3ST7A 4J91A 4QFDA 3E9MA 5F1KA 1BSVA 4HX5A 3BMOA 5HA5A 2JCYA 2FR8A 1M76A 2VNAA 3DQPA 3C3XA 1CQJA 3AUUA 5KJFA 2HMVA 4E13A 2D5CA 4J43A 4BO9A 2OP1A 3VZRA 3ZWYA 5KVCA 4RDHA 3PHJA 3IDSA 4RV9A 7ADHA 5JC1A 4W7HA 4FCCA 1KY4A 4DBVO 3LYLA 2Y0CA 5KKAA 1M6WA 2FPIA 3LC1O 2NUAA 3AI3A 1DRVA 4RZHA 3H9JA 1E1NA 4I9HA 1M2WA 3L6OO 3O26A 4O0LA 4YJFB 4Z9FA 4XGIA 4CLXA 3K73O 4R01A 2Y1EA 5C37A 1Z73A 5IZ4A 1K6XA 3JQAB 3DBRB 1UAYA 2X5OA 3UUWA 3MZ0A 4PLYA 4DBZA 1N2SA 4D3SA 4CV0A 3OA2A 4YAKA 4GVXA 1R4MB 3ZZNA 2ZYDA 5DDIP 4IS3A 4ZA2A 1MC5A 5EQDA 3GEGA 4FC7A 2I3GA 2VUUA 1HDYA 1T4DA 1E5QA 1VKNA 1ISFA 4RF2A 4MP3A 3UFXA 2TMGA 2HU2A 3L9XA 5K9ZA 3VH2A 5KTKA 4HNGA 4XJSA 3UGKA 4JP3A 4YRDA 4BNKA 4KUHA 5CDYA 4CODB 4DVJA 1HEUA 3UICA 4KTVE 2CD9A 3FNFA 3WJAA 2VWHA 1U28A 4J7XA 4QXMA 2HMSA 3NX4A 4CV3A 3AUTA 1XDWA 3BMNA 3PPIA 3WYBA 4BO7A 5L9AA 1BXGB 3TSCA 3P2OA 3ONDA 3MJSA 4GBJA 4I08A 3SLKA 3VDQA 4ND1A 4GMFA 3GVIA 2FZWA 3JQFC 4N18A 1NP3A 4K9DA 3BZUA 1DC3A 1T2EA 4BO3A 4U0JA 4MINA 3V1TC 3FWNA 1Y5RA 4AJ2A 7MDHA 3A9WA 1GD1O 3GNTA 4R5HA 5A06A 1R6DA 1R4NB 2FPGA 4WLOA 2B0JA 3JYNA 3F4LA 3ORFA 3AY7A 1GZ3A 3KTDA 4YJGA 5FWNA 1U7TA 1Z45A 3D5TA 4E0BA 3JV7A 4DYVA 4RGBA 1FDTA 5IZCA 3EVTA 3HB5X 1PZEA 1NQOA 4CM7A 4U8GA 4DLAA 4DPKA 4WCFC 5L51A 1TT7A 4OQZA 2P9EA 3RWBA 4AICA 4ZHSA 1IZ0A 5KJEA 3G3EA 2EIHA 4Y8VA 2D1YA 3OBBA 1WP4A 5GZ3A 3RUCA 5DOZA 4DPMA 4CMCA 1T2CA 3I83A 3CMMA 4KUEA 5G0UA 2HDHA 5CDGA 3F1KA 4Q3NA 4QT0A 3VHRA 4D0SA 5KKCA 4E2WA 4BGEA 4HP8A 5G0SA 2NTNA 2BELA 3WTBA 4PIVA 4JJIA 1GPDG 2EV9A 1KVSA 5KJ6A 5CG1A 4Y9DA 3GEDA 2R00A 4QQRA 3WGOA 3HFGA 5CPFA 1I33A 1VC2A 1M75A 1ISGA 3IS3A 3DBHB 1HDRA 3WG9A 2YV2A 3GR6A 1RYDA 1UJMA 4QO7A 1ISIA 5A1TA 4Z3DA 3GVXA 1CERA 3I9LA 3PDJA 1BRMA 1W73A 3CINA 4UVEA 4B4VA 5ITVA 4LVCA 4OQYA 3MCVA 1ZNQO 1GEEA 1H94A 3SEFA 1R12A 4MVJI 3VPSA 2RBEA 2O3RA 2YFQA 3H3JA 2P5YA 1PS0A 1PGPA 3DTYA 1PQPA 1YB4A 1YB5A 2DTXA 3BHIA 4BNZA 3STHA 4CLRB 4P4GA 2I3AA 3GK3A 1A7AA 5HWSA 5FYDA 4RORA 4BNJA 1CIVA 3U62A 1CETA 1SO8A 4MVJE 1ZMOA 1HDOA 2X6TA 3GDFA 3CIFA 1EMDA 4Y6RA 4FQ8A 1SNYA 1RJWA 4JN6B 3NKLA 5ENVA 1CQIA 2EJVA 2A35A 2BI8A 1P1KA 3DWFA 2X0NA 3RU9A 4WK6A 1Z7BA 3EGOA 3VAZA 1DSSG 4FC6A 3JQ9A 3ZWWA 1YL7A 4NFHA 5EIOA 3WLFA 5IDXA 5J23A 1LBEA 1OAAA 1UZNA 1N92A 4GAEA 4GX2A 1UZMA 4WEOA 3V1YA 1NQ5A 3OH8A 5FI3A 5A05A 1GYPA 3WDSA 3ZH2A 3AUAA 2X23A 3F6YA 3W6ZA 2G0TA 4BO5A 2XXBA 4EW6A 2ZCUA 1J6UA 1MGOA 4ND3A 2Q3EA 3K96A 3EHEA 4CMIB 2JD2A 2RH4A 1ISJA 2AEJA 3SX2A 5B4UA 3GNQA 3CMCO 4EJ6A 3H9QA 3ZW8A 1NPDA 1H6AA 1XU7A 5L7TA 3ULKA 3QVWA 1O0SA 2EKLA 3JQ6A 4BMNA 9LDTA 5TRTA 2ZB8A 2DUUA 3M1AA 4PLGA 4ZGWA 3BTSA 3NUGA 2IDZA 1C3VA 5DOVA 4NJOA 5BNTA 1PZFA 3KYCA 4DRYA 2X0JA 4TZKA 1U3VA 3ITDA 2ZB4A 1PGOA 2FRDA 1MG5A 3WLEA 1DOHA 1YQDA 3TRIA 5JBIA 1IHXA 4B8ZA 2FR0A 1PSDA 4CM9D 5JDCC 5BQFA 1WNTA 5CEJA 1IOLA 2ZJ1A 2EKQA 5DCUA 2RHRA 1F14A 2GSDA 3C1AA 1PWXA 1DBVO 1PR9A 2UUPA 5LDGA 1HDGO 2QYSA 4UREA 4RL6A 1E3EA 3DHNA 3SJ7A 4CUJA 1V3VA 1LLQA 1KEVA 3AW9A 4CPDA 3P2YA 3JQBC 5CFZA 4JJGA 4R5MA 3OA0A 1E5LA 4GQAA 1I3LA 3RKRA 4IQ0A 4CUKA 2XAAA 4YQZA 3TN7A 3VPFA 1PTJA 2J5RA 4YQYA 5TJ9A 1ONPA 1DIAA 4URFA 4FDAA 4E2XA 3QQPA 4A27A 3H7AA 2H5LA 2O4CA 1GY8A 3G1TA 1ZUD1 2W2KA 3CTMA 3LLVA 5JCXA 2Q1SA 2Q4EA 3DMYA 3GHHA 3ROMA 2FOIA 4D3DA 1VLLA 5I7SA 3GG2A 1C0PA 3JYLA 4WLUA 4AJEA 2OUIA 1ZSYA 2AEMA 2Q2VA 1FDWA 1LLUA 3E18A 3ENKA 5KVVA 4IDDA 5A9SB 4NBVA 4YWJA 2WSBA 6ADHA 3H3FA 2VN8A 4PLVA 3LVFO 3G1UA 5IXSA 3IC5A 4IJKA 4J7UA 3U0BA 4XQ9A 4CM9A 4ND4A 1JW9B 3Q3CA 2J8ZA 2AQIA 2D5AA 1P45A 3GY0A 3GZ4A 4CM6A 3L9WA 4IBOA 4R51A 3HDYA 2GR9A 1L1FA 4BKOA 2I6TA 2YFHA 2VNSA 4E2YA 1E0DA 3ROPA 3QVTA 4ND2A 3GGGA 4RPKA 4UVGA 3KZVA 1MB4A 2EF1A 3PGJA 1PX0A 2P9GA 5AVOA 1O8CA 4PRLA 2HRZA 1AXEA 1BXGA 2VYVD 4UEOA 4H16A 3E9QA 1R0KA 2DU8A 3U4CA 5C3MA 1VL0A 1YBAA 5IJZA 3BMCA 3T4XA 3EYWA 3B1JA 1N1GA 2ZJ0A 2DKNA 5HBRA 3VH1A 1PGJA 4RDIA 4DL9A 1P44A 3JQDA 2POQX 1WDLA 3PI7A 3PJEA 3JQCA 3RIHA 1EE9A 2HMTA 2WEKA 2X58A 1ML3A 5JDIC 3KSZO 1P31A 5JSFA 1YB1A 1NASA 1R4NA 1ZK2A 2WTBA 4O6VA 1EUDA 4I5DA 5H82A 4BKRA 4HFNA 1ZSVA 4TKMA 1LLDA 4AJJA 4Q3DA 2IXAA 3UW3A 3DHEA 4BNTA 5A02A 4BB5A 1WAMA 3DL2A 3HADA 3TZ6A 4IDFA 1H9AA 1U5CA 4FFOA 2IEBA 4UEJA 3NJ4A 1B7GO 2C29D 3VH3A 1U8FO 4YRAA 5I9NA 1V35A 3INRA 1HLPA 1P77A 4NHEA 2ZYGA 2BD0A 4D7AA 1MC4A 1HSZA 1H5QA 5G0VA 1DC4A 4J9VA 5DT9A 3FTNA 5L53A 2BKAA 5IN4A 1O5IA 1P9LA 2VYVA 3QWFA 2FWMX 2C7GA 1MX3A 3PJGA 3HHPA 3LF1A 3GFBA 1I10A 1X0XA 1AN9A 4I8XA 3O4RA 2WD7B 3KV3O 3GN1A 2Q4BA 3WS7A 3RD5A 4NR0A 1RKXA 3DBHA 4W9NC 4CV1A 1ULSA 4MO2A 3RUIA 3HN7A 3GMSA 2IXBA 5A3VA 2QRJA 4A03A 3QVSA 4ZVVA 2HAEA 3AU8A 4R16A 4MVJF 2DBZA 1H6DA 2GZ3A 4A73A 2VT2A 1HDXA 2VHXA 4E32A 2O4UX 1H9BA 3I9KA 3TZKA 3ABIA 1T4BA 3BMOB 5U4QA 4RQTA 2NLOA 4Q3AA 5L7YA 4J3FA 2YY7A 4D45A 5I9LA 1WMAA 1QXSA 1ISMA 4AJLA 3V2HA 4F46A 3TZCA 1YL5A 5DF1A 4XYGA 1M67A 3WQSB 4TSKA 4LRTB 3UKOA 5HRUA 4Q3CA 2P4HX 1HZJA 4INAA 3NEPX 3AOEA 4NG5A 3HFSA 4FFLA 3DMTA 4RLSA 1KETA 1D3AA 1WW8A 3CZMA 3GF4A 1PJLA 4JK3A 3AOGA 3S1LA 4D41A 3GUCA 1E7RA 5JMWA 4FGWA 4WCDA 1U3WA 3K6JA 1K3TA 1PZGA 3H9GA 1ZJZA 2NVWA 1KEWA 4N54A 1K2WA 2CUKA 4UVDA 4BL5A 4XX0A 3ETDA 3OM9A 1JWAB 3TJRA 5JC8A 3BTUA 4J9UE 4ZU3A 3MOGA 4XR4A 3V8BA 3BYZA 4BGVA 3DB2A 3JQGA 2ZQZA 3D5QA 4BV8A 1PL7A 2NVUB 1YQGA 3KEQA 5AXDA 3L4SO 3E48A 5HS4A 2CDAA 3R3SA 2Y99A 1HE2A 5JLAA 2HQ1A 2PK3A 3QSGA 4YXFA 3ENNA 5EESA 1JU9A 4HFRA 4PG6A 4IDEA 3Q9UA 4HV4A 1NNUA 4R68A 3T7CA 1PU2A 2AA3A 1TT5A 1OMOA 4E5PA 2NV6A 1DDOA 5EPOA 3S8MA 3RCBA 3EY4A 3OJFA 4WECA 1ZH8A 2GCGA 3U49A 5JY1A 4E33A 4J4TA 2CZCA 1C1XA 3ITKA 3ANLA 1Z74A 4O63O 4NQZA 5HS6A 2VTDA 2NNLD 4YJGB 3VKVA 2RIRA 4F6CA 3VVBA 1SEPA 1DXYA 3PWKA 1XHLA 4K28A 3X2FA 3TOZA 3PJDA 5ICSA 2O50A 2PH3A 4Z3KA 2PZMA 2Y68A 1YDWA 4LSMA 3RBXA 2ZB3A 1PL8A 3D4OA 1NTOA 3BIOA 2GD1O 5L40A 1I2ZA 1X7DA 3DC2A 3KHUA 4BKQA 2C0CA 3A1NA 3D1LA 2W4QA 3R3JA 1H6BA 2J3JA 4L4XA 1X7HA 2HKIA 3FF4A 3OEWA 1I0ZA 3Q9NA 1CWUA 1PEDA 4KP7A 5TJHA 5A9SA 1GZ6A 1LRJA 5L4LA 3L07A 4IDAA 2FSSA 3D3EA 1UR5A 2GERA 2HJSA 3SC6A 4LCEA 3OICA 3ZCXA 5L4SA 3IJPA 3A14A 4XZ3A 2YUTA 3G0OA 4OMUA 4NPCA 1LQUA 2WJPA 1SZJG 3GAFA 2NTVA 3WQQA 2HSDA 4R3WA 4FFPA 3HJAA 1KS9A 5FI5A 3ICPA 3VDRA 3GC6A 1UDBA 1WDMA 1E6EA 4ALNA 4HXYA 1NHWA 1X7GA 2C2YA 2W2LD 4J90A 1AUPA 3GH3A 1P1JA 1Z6ZA 3K2BA 5FEUA 2H9IA 3SC4A 5B12A 2I99A 2HK9A 3A06A 3FNGA 1DLIA 1HF3A 3NRCA 5TNXA 2YZ7A 2ZTLA 3IKTA 2PD4A 4HKTA 4MDHA 1MLDA 2OL4A 4YTEA 3IIEA 3JQ9C 1E1KA 4OKNA 4R3NA 4LCJA 2W8ZA 4K6CA 1J49A 3INTA 1ADFA 3PP8A 4ZRMA 3PYMA 2GRAA 5DN9A 1LU9A 3G79A 2JKVA 4E21A 3I1JA 2BHLA 3MJCA 3NT2A 4IGFA 1IL0A 2X4GA 4NK4A 1GQQA 1NPTO 4EJMA 3KBOA 3NTOA 3WSVA 2WE8A 4R9SA 4KWHA 4LMPA 3DFUA 5EERA 2JHFA 1IZ9A 3D64A 3HDJA 3KM0A 1WDKA 1HE4A 1Y1PA 3FNEA 4NH4A 4C7JA 1YONA 1YBVA 4BNGA 2PKRA 1NXQA 4S1VA 2VZ8A 1R37A 5I7EA 3VTZA 3LZ6A 2Q49A 4ALLA 1U8XX 3JQ7A 1EK6A 3ZWXA 4DXHA 3KYCB 2W2LA 2WYVA 4FOOA 4UUMA 1KOLA 4NI5A 1A5ZA 4ZJUA 1Q7GA 3PFWO 2AEFA 2O7QA 4FW8A 1Y6JA 1P1HA 2PZKA 5DBGA 1HE5A 4RF4A 2YQ4A 4XRGA 4YDRA 3W6UA 4XQEA 4WJZA 5A03A 1UZLA 3RROA 4PLTA 2PNFA 3PYXA 4NFSA 2R2GA 3TQHA 2I9PA 4Z9XA 3MWDB 2B4QA 3DZJA 1EVJA 4BNVA 2NQ8A 4NU6A 1WLYA 5COAA 5F1PA 3JTMA 3OF2A 4XIYA 1E7QA 1HDCA 4EUFA 1I3KA 1S6YA 2DVMA 3M1LA 2HO5A 1BVRA 3FRJA 3HDHA 2P2SA 1EZ4A 5TGDA 4CQLA 3F4BA 4YYZA 3F5QA 2DFVA 1HKUA 3R0IA 3SBOA 5EL0A 1UDCA 2IE0A 1B0AA 4YT4A 3AM4A 3MJ4A 2UUOA 2NU7A 4N5NA 1QORA 3KO8A 1DIHA 2W2KB 4R54A 5G2OA 3NTQA 4IINA 4FJ0A 1AHIA 2I67A 3RUAA 3C7AA 4J2HA 2OBNA 3UCXA 4WNIA 3PRJA 3U9LA 5TT1A 3WGTA 5L95A 1A9ZA 3TOXA 3U09A 2D4AA 5L7WA 2QQ5A 3RAJA 1NFRA 1ZW1A 4RVSA 1ENYA 3LLSA 4RVGA 4AJKA 1GPJA 2Z1MA 3QA9A 3PQFA 3ANNA 2GNAA 3JYQA 1D4FA 2G82A 1EBUA 1BXZA 3AI2A 3B1FA 3RUHA 3VTFA 3WBBA 1B3BA 5LDHA 1GCUA 3D0OA 4OXKA 2NVUA 3PJFA 4R9RA 1Y8QB 1ZVMA 1ONNA 1NWCA 2V6FA 3W8DA 5K0ZA 3E5MA 8LDHA 3QHAA 5LCXA 3L6DA 4QO8A 2W90A 1P33A 4IDCA 1EDZA 1E7MA 5T67A 4BKPA 3GMDA 3LC2O 1KVUA 4AJPA 4ALMA 3BMCB 2EGHA 4TRMA 2EWMA 3PTZA 1YKFA 4II3A 4MKXA 3GOHA 4B3IA 5JCJD 1RYEA 3LT1A 3PIIA 4XYLA 1CEQA 4TQGA 3T7EA 4IXTA 4J0FA 4FD3A 1V3TA 1B14A 2NU9A 2ET6A 4CR8A 1LX6A 4OM8A 4HUJA 5KCZA 1YGYA 4LK3A 3UVEA 4YAGA 1U4OA 1SB8A 1ZFNA 3WX0A 1GL3A 3ZWAA 3COSA 3L4BA 4PZCA 1XQ6A 4U6SA 2EXXA 3ZWOA 3PK0A 3RFVA 5CDSA 2VRBA 3DEYX 4KQWA 4PLWA 4C4OA 1ZIDA 1OI7A 4UUOA 3Q1LA 4ITUA 2Z5LA 2EW8A 4O5OA 1ZBQA 4GWKA 2OO5A 3IP3A 3H2ZA 3ZU5A 3LSYA 3DZHA 1U7HA 3TFQA 4W82A 2BF7A 3OIGA 2VT3A 2RHCA 1X13A 2DPGA 5U1PA 1YE3A 3MTGA 3ZNPA 2WD8A 1KY5A 1LEHA 2Y1CA 5JCJA 2FPPA 1XG5A 4QEDA 5C5IA 4MVJG 3HNPA 4IY1A 2WM3A 1U3TA 5JPIA 1EQUA 1PJCA 3TDKA 4RVDA 1ZK3A 3NYWA 4DPLA 4OAQA 1F17A 1NX6A 2YHIA 3GA0A 5ES3A 4CQMB 1FXSA 1O6ZA 1ZZEA 3ZN2A 1VE9A 3DAFA 3NAQA 2AQKA 3D4NA 2HUNA 5IDYA 1C14A 1DIGA 5T8KA 5K6AC 2Y0DA 2JFFA 4JBHA 1EE2A 4IM7A 4ZRNA 2D3TA 3VVCA 3DZKA 2X9NA 5ICMA 1CYDA 4CM4A 1NPYA 3AY6A 4RVFA 4WPGA 4TRNA 2X7HA 5I8ZA 3EDMA 3W4KA 4DLLA 4IUYA 4N5MA 3WFJA 5BNFA 2AQ8A 4EI2A 4IZHA 4QTZA 3RBZA 5GZ1A 1BHSA 3H8VA 3GN2A 1XQ1A 3OHSX 4JROA 4NK5A 2FSVA 4PLFA 1OC4A 1ZK0A 4YAEA 4BNFA 1SB9A 3FTPA 3ZDFA 3AOEC 4FJ1A 3DMTC 2XPCA 3I5MA 3FR7A 4UAGA 4BVAA 4EYEA 5G4LA 1EFKA 4DQXA 1N7HA 1Y9EA 1V3UA 5MDHA 3QVOA 4WEQA 3NDRA 1I2CA 1P1IA 1CJCA 3I9OA 3K31A 1EVZA 1LTHR 2D2IA 2J5QA 3DOOA 1FMCA 1WVGA 2Y1DA 4LMRA 5EN4A 4W6ZA 2PWZA 4KOAA 4E5YA 4GH5A 4Q9NA 1QLJA 1ZXLA 3JSAA 4YT5A 4ZQHA 3ZW9A 1GAEO 3C8MA 2VOEA 3INGA 4JNKA 3JQGB 4KUGA 4DQUA 4XQGA 5B4VA 3KLMX 4PLZA 1EQ2A 4DWVA 1E3SA 3FHLA 4RF3A 3EZYA 3BHMA 2GN4A 2NSDA 3AI1A 4RPJA 4AVYA 4HY3A 4IIVA 5BT9A 1EEHA 3WICA 4J4HA 5THKA 4DA9A 2DBRA 4J2OA 1KVTA 1AHHA 2G17A 1UXIA 2O48X 2SCUA 2NWQA 3ZV4A 1TT5B 2X9VA 2PV7A 3WTCA 1QRRA 1PJ4A 1V9LA 3WXBA 4II2A 4ESOA 2BI7A 3LDHA 1QMGA 3V2GA 2B36A 3RUDA 3F47A 1E7YA 3O03A 2QYTA 3WGGA 3HE3A 4BGUA 4OGWA 1I2BA 2D0IA 1C1XB 4CL8A 3ZNOA 1ARZA 3DZBA 4Z9YA 5BSFA 1QG6A 4GL4A 1VRWA 1R0SA 2Y66A 2P91A 3ZNNA 2NM0A 4L8VA 2WYWA 1O9BA 1PIWA 1DRUA 2JJYA 2C5EA 3B1KA 3H6KA 4YACA 1QV6A 1D1SA 4EJ0A 3H5RA 3JD0A 3IL2A 2Z95A 1T1SA 1HXHA 4MPDA 5DULA 2H6EA 4FFRA 2OXIA 3OMLA 5KWEA 2J3KA 2NTJA 1GCOA 3W8EA 1B26A 3TPCA 3WYEA 1OBFO 4EDFA 2EP5A 4WUVA 4XWYA 1P0FA 1I24A 3I4CA 4H7PA 4J1TA 2Y93A 3ICCA 1ZCJA 3E9NA 1E1LA 1QYXA 1NVGA 3ANMA 1EVYA 2VRCD 4CLOA 4BO1A 2Q50A 2VHWA 3RFXA 1IY8A 1LNQA 3H9UA 4IPTA 1SCUA 4NIMA 4PG5A 4L75A 4EZBA 2JD0A 3EUWA 4GGOA 3DTTA 2Z1NA 4XDYA 2HMWA 2QZZA 3PWZA 1DJNA 3GGPA 4RCVA 4CMHA 4HNHA 2GN9A 1YO6A 3RC9A 1Y8QA 4ALIA 2E82A 2O2SA 5JAZA 1A4IA 5JMPA 1ADGA 5L45A 3WGQA 2D8AA 3QLJA 3GRKA 1X14A 3H4VA 3S2EA 4F45A 2NQTA 5A9RA 1U2GA 5GMOA 3QV1A 5ER6A 3BAZA 1UXHA 3K5PA 3WJ7A 1I01A 1MUUA 1TA4A 1UH5A 4AJOA 1Y5MA 2Y1OA 5T5QA 2Q2WA 1PR3A 4J49A 2RAFA 2VHVA 2Q1UA 4P38A 4BQPA 1J0XO 4A10A 4CUZA 4KWIA 2AE2A 3EK2A 3OJ0A 2OBYA 4BO6A 4CQMD 3AWDA 3BA1A 4FBGA 2GGSA 2UVDA 3VH4A 3WWYA 1NM5A 4FGSA 4DLBA 3BMQB 2CDBA 1D8AA 2UDPA 3U3XA 4TMFA 2VRCA 4GSKA 1E3WA 3UHAA 1LSUA 3WIEA 4XCVA 1UXGA 1T25A 2Y67A 1IHYA 4Q3EA 4WLVA 3JQFA 3P7MA 3GG9A 3U4DA 1VJ1A 1ZXBA 2PKQP 4GSLA 1YOVA 1P74A 3I6IA 4E30A 3CEAA 3GGOA 4KDEA 2YJZA 4EITA 4ILKA 1ENZA 1XEAA 5C7OO 4GX1A 4J7CA 3CUKA 3L77A 3CH6A 1NR7A 1V8BA 4GKVA 4R69A 4M1QA 3IUPA 5CHEA 4TRJA 3MWEB 3N58A 1E3JA 3ZV5A 4MP6A 4CLDA 4E31A 3D7LA 3ZI0A 1W4ZA 3JQ7B 1E7WA 1MG0A 2AMFA 4J1NA 1T1RA 4M86A 1MXHA 3WQRA 1B8VA 3DFZA 4M49A 2BFMA 1LDBA 2DUWA 4PZDA 4RO0A 3PZBA 1DC6A 1XIVA 2E49A 2H63A 1DRWA 2IZZA 3CKYA 4OOFA 1X1TA 3M2PA 3K30A 1K5HA 4W99A 1B8PA 5DCWA 4CQMA 5FF9A 2O3QA 3ZWMA 3ZWNA 1JDJA 1I8TA 3KB6A 1PJ3A 1CDOA 2CY0A 1Y7TA 2OMEA 2QIOA 4RPLA 1TI7A 3B70A 2QZ9A 4GMGA 3DAGA 3KYDB 3OSUA 4RVUA 4CLHA 5BSEA 3BHJA 2XOXA 4D0RA 4YB8A 4DREA 4KDFA 1R0LA 3NGXA 2BFPA 4CQLB 1OC2A 4LN1A 1Q2XA 5ILGA 3HUDA 1OOEA 4AL4A 1NQAO 4U0KA 2VTEA 1HL3A 4EUHA 1BXKA 1DB3A 4P4LA 4DIOA 3UXYA 2ZK7A 1A4UA 4ONEA 5DP1A 4BNXA 5KNLA 4U6QA 5CDTA 2YDYA 3DAPA 5EQFA 4M87A 1ADCA 2Q99A 5F3RA 4HBGA 4WKGA 4JXKA 4E3ZA 1E7SA 3QWAA 5CPBA 3GVHA 2VUTA 4UVHA 1IUKA 4FN4A 2VWQA 5COQA 5JAQA 1DFHA 3OJEA 1CRWG 3C24A 3I6QA 2BMAA 4I5GA 4MVJH 5BSGA 3DZGA 3ZHBA 1AE1A 4PCVA 1R16A 4J16A 3WIDA 3VPXA 1Y8RA 1YL6A 1UAGA 2VZ0A 1U3UA 5TSDA 1W8DA 4L4RA 5TT0A 3IAHA 1KEPA 1H6CA 4YBZA 3WSWA 4I9UA 4AJIA 3O8QA 5DNAA 3FNHA 4FB5A 3JD3A 4QSMA 3Q2KA 4DC1A 3AM3A 1PQUA 1ISHA 1QKIA 2X8LA 4FJ2A 1H93A 4RLHA 3ZHXA 2DBQA 4D42A 3UH1A 3B6ZA 3L4BC 1B2LA 1SEVA 4K6FA 1DHTA 4D44A 4YRBA 5KJCA 5IZCC 1L7DA 5BR7A 3KUXA 1X15A 3FCOA 5AXBA 1D1TA 3ASVA 4GVLA 5TQVA 1IE3A 3QWHA 4QUKA 3QVXA 4WE3A 2C2XA 1Q0LA 5A4DA 4BMVA 1SPXA 1CF2O 4RPGA 3EAGA 4N5LA 6LDHA 4D79A 3VOSA 1GR0A 4JJFA 4P4NA 1LUAA 1LDNA 4E12A 1HT0A 1YRLA 1N5DA 4JX8A 4YEDA 3PLRA 5G0TA 3WR5A 5CAEA 4L9RA 3VKUA 1Q1NA 1GDHA 4RF5A 2HJRA 2P4QA 3C1TA 3RKUA 4NZ9A 2X86A 4BUCA 2R00C 2GN6A 1O95A 2GZ1A 3QWIA 2OGUA 4ID9A 5ILOA 4EBFA 2YHIB 2BFOA 3JQ8A 4CM8B 1N1EA 3PLNA 1FDSA 2JAHA 4GLLA 5B1YA 2H1SA 2ZTMA 1DFIA 2NACA 3WWZA 4AJ4A 1V0JA 5T8KC 4BV9A 1BGVA 4OJNA 3S2IA 4B4OA 3ZU3A 5HTOA 4OSOA 3JQEA 5TS3A 4E6PA 2CNBA 3IP1A 5TIIA 5CDUA 1KIFA 4CM4B 2DM6A 3Q2IA 1UXKA 4XDZA 4LISA 5EJ2A 2UYYA 1BWSA 2RH8A 3HDQA 1O89A 1EVIA 1LRKA 2X22A 3QRWA 4OXNA 4MKRA 4E5MA 2IZ1A 3GZNA 3PVZA 2Q46A 3GRPA 2AG5A 2O2YA 4ZQFA 4ZD6A 3W8FA 4B3JA 2G1UA 4UUNA 1JLLA 2WDZA 4PG7A 1U1IA 3FWZA 2PGDA 2A9FA 1GU7A 3IMFA 3NDJA 2PLAA 4UUPA 3GPDG 4NFYA 3JD1A 5ENDA 2CVOA 2HRBA 4L73A 1EFLA 3BMQA 1VL6A 3C85A 1G0OA 4EEZA 4Q39A 5AXCA 5F5NA 3FPCA 4MKZA 2XF8A 4TVBA 1XKQA 3U4HA 2Q2QA 1ZO8A 4DUPA 2FP4A 4TROA 4BO0A 1JAXA 3S2GA 3WBFA 2HCTA 2FY8A 4PZEA 4B79A 1NHGA 4O1MA 1GFSA 4G5HA 1WWKA 3K8ZA 5JO9A 1SC6A 4BO4A 3D3WA 3OIDA 3PDUA 1WMBA 2GYYA 2O23A 4BO2A 5IG2A 4L76A 4DMLA 2Y1GA 1GEGA 5JXWA 3VPHA 4AJ1A 4DMMA 2IEDA 2JCXA 5JAIA 3JD4A 2PKQO 3L6EA 9LDBA 1KYQA 4NBRA 5A5FA 4XB1A 3MJTA 3N7UA 3Q0EA 3FN4A 1T2DA 2OFPA 1EK5A 3LT2A 3OP4A 1P1FA 1JVSA 4BMSA 8ADHA 1LI4A 3F1LA 1YS4A 2JFGA 3DBLB 3K92A 3EMKA 5IF3A 4OIMA 2NU6A 5G0WA 3PQEA 1HE3A 1VL8A 3I4FA 3SVTA 3CE6A 4QFCA 3K2EA 5H83A 4CMEA 3UOGA 1SBYA 3OJOA 5TC4A 3CPSA 2CF5A 2IODA 3AUSA 3DO5A 3GAZA 4N7RA 1BTOA 4LSWA 5F1OA 3S2FA 2VZ9A 3KYDA 2BRUA 4IJVA 3WB9A 5JFOA 2B4TO 1GV1A 1XR3A 4D43A 4BOYA 1GV0A 3KEOA 5JAMA 3MJVA 4A0SA 4XEHA 5TLSA 1HRDA 5T57A 4E5NA 5A9TA 5CEEA 1YDEA 3DR3A 1AXGA 2VCYA 4IDGA 1GTMA 1BVUA 3MOIA 3O9ZA 2PD3A 1NAIA 4R1NA 3PEFA 4G2NA 4QX6A 5L3ZA 1DO8A 3C7CB 4U7WA 2PTGA 1I32A 3HSKA 1Q0QA 1PGQA 4FOSA 1PGNA 5L4NA 2I76A 3RSHA 1K6JA 4CLOB 5IXYA 4S3MA 1DFGA 3F3SA 1ZEMA 2JFHA 1QSGA 2P68A 5TX7A 2UV8A 2WYUA 1MXFA 2BLLA 3GNSA 3I52A 5CEFA 5CP8A 1JQBA 2V6GA 1LDYA 4PVDA 2LDBA 4JCOA 2DQ4A 1RM4A 2PGLA 3VC7A 3DZFA 1KC3A 1BW9A 3I9JA 3RC1A 1KC1A 1GQ2A 4IMRA 3TZQA 5T64A 4XIJA 2YDXA 2E6UX 1TEHA 1JWBB 1R15A 2BGLA 5DBIA 2C20A 2GDZA 4CMBA 4ZQEA 3ZGYA 2Y0EA 1UXJA 3T4EA 3VPGA 1JAYA 4B7XA 4DQVA 1DAOA 4BNYA 3JYPA 5EINA 3LU1A 4ALKA 2EHDA 1ULUA 3JD2A 3GDGA 4FS3A 1D7OA 4HFJA 3V1UA 3TNLA 3FPLA 4CM3A 1LC0A 4NDNE 4Y67A 2V6BA 3KOUA 1E3WB 1S7CA 3AM5A 4OKIA 5AXAA 4NJMA 4ZQBA 3KSUA 2XXJA 4TZTA 1DAPA 3FI9A 3F5SA 3GHYA 4ZICA 1JVBA 1YBMA 1YOVB 2F1KA 1NWHA 2WE7A 3OETA 1QYCA 3ETGA 4MVJM 2ZYAA 3DDNA 3TL2A 3GLQA 4MP8A 3EW7A 1MFPA 4FIZA 5ER9A 5IN5A 2PFGA 3CXRA 2VHYA 3ZWPA 2B5VA 2O3UA 1DIRA 1EBFA 1PJTA 1X1EA 1NAHA 1J4AA 1ORRA 1PL6A 1GYQA 4XYEA 4MIOA 1VJTA 4FPXA 3RI3A 3PFFA 4ZQGA 5DBFA 2QX7A 4I1IA 4WCFB 4K26A 2Y05A 4BQRA 3TL3A 4IJUA 1T2FA 4WGGA 5JE8A 4H3VA 3E5RA 5B37A 2PD6A 5HM8A 4LGVA 4J0EA 4L4SA 4MJLA 1FJHA 4WLNA 4A7PA 1EDOA 1E6UA 1SOVA 4PLCA 3WYCA 4HADA 4CM8A 3RJ5A 5G4KA 2PR2A 3KXDA 2QHXA 3A28A 5C7LO 1MA0A 1NBOA 3IJRA 4KZPA 3AK4A 2G5CA 4YCAA 2IZ0A 3HG7A 5KVSA 4GLOA 1Z82A 4U5QA 4YA6A 2QW8A 1V6AA 1ENPA 5GZ6A 1YVEI 1VI2A 4C7KA 1GZ4A 1LSJA 4MVJD 3ZV3A 4GGPA 1ADBA 4E2ZA 1FK8A 2EP7A 1YJ8A 3NTRA 2DTDA 1O94A 1IYZA 1YH3A 1VKOA 4LRSB 4RZIA 4BHTA 3RFTA 2GZ2A 4PGFA 3MJEA 4XYBA 4AJHA 1NQTA 2EJWA 2NU8A 1NVTA 4WASA 4WOKA 2ILTA 3R6DA 4B4UA 1ZK1A 3OIFA 1XWFA 4DGSA 3P5SA 2B83A 2X0RA 3QJ5A 1ZMTA 1QYDA 2BGMA 3WGIA 2OHXA 2B37A 2YYYA 3ON5A 2WWRA 4TRRA 3TZHA 2EW2A 4OHUA 1Y81A 2IRWA 3HZZA 4W4TA 4XGKA 1I36A 4JLWA 4JIGA 4BNIA 3BTVA 3PIDA 1H2BA 1Y8RB 4P8RA 5I7VA 1LDEA 3DONA 4MIEA 2YQ5A 3ZV6A 3UCFA 4EEXA 5IDWA 3OQBA 4F3YA 1M66A 3W4IA 4O59O 5AQ1A 2YV1A 2C59A 2ZIZA 4MVJA 3PHHA 1GADO 2ZATA 3FD8A 1PJQA 1N7GA 1Q7CA 2ZCVA 3NGLA 3O8QB 1A72A 1N9GA 1WZEA 1UUFA 1F8FA 3BTOA 1JTVA 2VQ3A 3DXFA 2QRLA 2FMUA 3H2SA 4QECA
chains in the Genus database with same CATH superfamily
3L7YA 2WF8A 5B7PA 1WSBA 1PJBA 3DBLA 1S3SA 2Q45A 2BGKA 4JYBA 3ZI4A 2XCRB 4CZ2A 1O08A 4GWGA 2HBRA 4XW2A 5CGZA 1Z0JA 5FKJA 1VHTA 1PK8A 1KE2A 4GKAA 1TPZA 3LRTA 3C3CA 4GYJA 2BEVA 3SQOA 3W2TA 3RU7A 3VO9A 3B3AA 1KERA 4QEZA 3TH5A 4CCSA 3K2QA 3GLHE 3QYJA 4O2RA 4YP7A 3AV3A 4LMBA 2OV4A 5TS2A 1T9GS 1K89A 2OD2A 4E7PA 3EVNA 3W7BA 4D8WA 5HF5A 3EY9A 3W4JA 3ZLVA 2Y92A 1UMBA 4H1TA 2VDUE 3O8NA 2E48A 2IP1A 3F3KA 2J3DA 2X8AA 1HT3A 3VISA 1DAGA 2I71A 2YZ2A 3FHOA 3FZYA 2NADA 2PZLA 4DTIA 2EQBA 2VOJA 1AC5A 3BDVA 2BM9A 3O1LA 3HYNA 3ZWVA 2E87A 5KOIA 3PLAE 1KQOA 5CAEB 4AWAA 4Z6KA 4YAJA 1G60A 1M72A 1UBEA 1W30A 3STYA 3C0KA 3ZXSA 5JHHB 4NZNA 2BFAA 4O5AA 2JJ1D 4MQBA 1H9CA 1G21B 3OE1A 4KYTA 1YFJA 1H2HA 4M0DA 4QOFA 4NBUA 1UFQA 1GSOA 1HWYA 3SYMA 3L1JA 4WUTA 2XGMA 3SZOA 1UP4A 1DPGA 1V4VA 3A1VA 3PQDA 4QBFA 5LZ7A 1RHQA 4MV4A 2WIAA 3PD1A 2X41A 1NULA 1UMDA 1QV7A 4H6WA 4TTQA 4X84A 1LK5A 3ZXIA 5JT1A 3IKMB 2QX6A 1B15A 3ZE6A 2JG3A 4DCGA 4PHCA 2FI1A 4GX5A 2C2OA 3IQDB 3R1IA 4JDUA 1A71A 2AG0A 2NV0A 4KG7A 2Q6LA 4QDTA 5DW0A 4UNPA 3OQ6A 4HDMB 3TJMA 1N8KA 1IPFA 2I4LA 3FSGD 3PV0A 5AK0A 3RWOA 3PR1A 1WEKA 2IW3A 3G0DA 5CCBA 2D5IA 4CU5A 1DBQA 4LJYA 1SAYA 2JGIA 4P93A 2J3IA 3QX7A 4LK2A 1LA2A 1W6UA 2Q8NA 4X1OA 1JP7A 4U2GA 1SQFA 2J5KA 2QSYA 1ZSNA 2AT1A 2AB0A 2D06A 3GZNB 5F2EA 1TJ5A 4R4JA 2H7XA 3BQ9A 2I5PO 4MRAA 4W8HA 1GUFA 4N0DA 4BFZA 4LWPA 1BE1A 2R11A 5BP7A 4AF8A 1PT6A 1JLLB 3HJRA 4HDNB 4CLEA 2ZJOA 3AJDA 2YICA 2N0SA 5BORA 1GM5A 1A2OA 1NJGA 4PLPA 3K94A 3P9XA 1YJQA 1A7KA 1TVMA 1C0EA 2ATVA 2QU7A 4M7WA 4MUKA 4UBNA 3NB0A 5B4TA 2O3SA 3AZOA 4UMEA 3RK4A 3MNFA 5E6UB 3WAKA 4E08A 4EA8A 4PBTA 3H2IA 2DT5A 3AF4A 3RF6A 1PT5A 4EPRA 4QM7A 2VPQA 2A4KA 3MILA 3RFCA 4II7A 3ASUA 4MA5A 2CXRA 2B69A 3JCZA 4P6VF 5EKDA 3N1UA 3U3ZA 2Z0MA 4PTLA 1U3CA 1ZK4A 5JXIA 2VH1A 3L0DA 1E60A 2B9VA 4IO0A 4MS1B 4BVBA 1FS5A 1DC7A 2WUDA 1UDRA 4RZ3A 3P2EA 3PQ4A 3E4CA 1Z0AA 4NV0A 5FYQA 4DYDA 4E1AA 5J4HA 3DZDA 4GECA 2B8TA 2JFWA 2PANA 4RMJA 1E1MA 2QUHA 3KHKA 1WZIA 3F6PA 4QOEA 4R8KA 5FFFA 5FBVB 3EFOB 2E5FA 5ANRB 3L8GA 2QTVB 3HTXA 3LP8A 5AVUA 2ZSIA 3NM6B 1I1QB 4MRPA 1Q7EA 5HQJA 3J81A 4OL9A 4G4JA 1ZVQA 4FX5A 1A8SA 2WKSA 3ESRA 3X43A 1RPNA 3H9CA 4QHSA 1L5KA 5CB6A 1AGNA 4GM4A 1WG8A 5AOVA 1RE1A 2DBVO 3AO0B 3G17A 4UNRA 1L4EA 1KEEA 4CMJA 2H4YA 2XRMA 1A9OA 3F9IA 3UAGA 4CTOA 1XBTA 2IOQA 3WDKA 4F8YA 5MN6A 2ZI9A 1GQYA 2O7SA 5L3VA 3JWIA 1MJHA 1WEHA 1NUTA 1K3UB 1GYRA 2Z9DA 4B47A 2CFOA 1Y4ZA 2YWFA 4CMEC 1HTBA 2FLWA 1XTSA 2WPDD 1XTKA 1RLIA 1YQXA 3MEQA 1F12A 4CL3A 2N47A 2OBBA 3DLTA 4KQ9A 4KPUB 4KTTE 3F2IA 5DMHA 1MFZA 2ZETA 5ULLA 3SHVA 3OTWA 3U7HB 2VSYA 3ZDAA 3U0VA 3GL9A 1PYDA 5ADUS 1A97A 3CSDA 1GWNA 2ODQA 5DN6D 2XMCA 4TVKA 4XA8A 3Q1KA 3WY9A 4BE9A 5B3AA 2H48A 3H8JA 1W0CA 3WAGA 5A5EA 2EAUA 4JQSA 4B75A 2PSSA 4K8RB 1XXHA 2ZAIA 1Q6YA 1P1RA 1C4WA 3RADC 4WNCA 3WMWA 1TCVA 5FORA 4RABA 2C9CA 1PR4A 4U6NA 3NCTA 4KN5A 3R5JA 2HQSA 1AGYA 4H3HB 1U31A 3IJEB 1PDWA 3BGOS 3DKRA 4YRFA 2IBMA 4B6JA 4ZI5A 2HRRA 2FLKA 1H0KA 2PGJA 3EZXA 4G6ZA 5CMLA 1IJFA 3VXKA 2N3ZA 2OWEA 2X5JO 5ARCA 5TB5A 4DC0A 4EIWA 1QIDA 3FGPA 5FLKA 5ALYA 5GVSA 4Y1EA 4ENPA 1P61B 5KBYA 3PPVA 4A9AA 5I4IA 5JFGA 1GPMA 1ND5A 1UK7A 4UUAA 4W5JA 4DZTA 4PN3A 2IYOA 4Y9RA 4XWWA 1SELA 2A92A 3DBOB 1E2GA 1U7PA 3QTLA 3U7RA 4DCVA 5LVAA 3TCXB 5G02A 5AYVA 1IMJA 1E2HA 1HETA 2VHZA 3L79A 4E4YA 3ROQA 3WNVA 1KFJB 2WIBA 4K46A 1H2WA 3EEBA 5ERXA 1E77A 3E8MA 5I51A 1XZFA 2FPIB 1S96A 1LSSA 4HZUB 1FDOA 1ORIA 4YV2A 5EAIA 4FNAA 2ZSKA 5JMOA 3TE6A 5B3JA 4EJ2A 4UQOA 5CHYA 4DV1B 1TO2E 1PZMA 2Z8ZA 1H0SA 2XQJA 1F8GA 1AS3A 3G2OA 1E94E 3I23A 1Z5WA 2GHRA 5ELLA 1MJ5A 1FDVA 5EVCA 1K7YA 1C0KA 1I0LA 2NVBA 3HSSA 3GVCA 3OZIA 1CUCA 4YHHB 1S01A 2V5AA 4FE3A 2CYCA 1NI4B 2GXUA 1KFEB 4MMYB 4EZIA 1TZBA 5M29A 1ORTA 4OQDA 4JA2A 4M9SA 2CFCA 3EG9B 3I01A 3QF4A 1SKMA 3VZBA 3P9KA 3NV9A 4YVFA 9ATCA 1E0AA 2NZXA 4R1UA 5BW5A 1E3IA 2ZS8A 3BMNB 3NPAA 3QGMA 4CFZA 4DANA 4KR0A 4KYUA 4KSCA 3AJAA 3V6MA 2V9PA 2OQRA 3H42B 3ROKA 2EZ4A 3DMDA 4NJMB 4OHFA 3FZNA 1LXCA 5KIAA 3UH0A 2FDRA 4HGOA 3NC1C 2VSNA 1PE0A 1DX6A 2G07A 3P52A 1ZU4A 4ZARA 2O7RA 3O7MA 4UD6A 2C5GA 3Q8MA 4LDPA 2B5WA 4B71A 4LDAA 2OXRA 5LB4A 1DJQA 3EZLA 5LZ8A 4DQLA 2NP7A 4CI0B 2PCLA 4C2BA 2ODTX 4BNMA 2A33A 3AMVA 3OF3A 4CMGA 1TRHA 3PQCA 1FY2A 3EC7A 4IIBA 4UNNA 1JA1A 4IZIA 2OO5C 3MJFA 3OFJA 4LQDA 1EDDA 1YI0A 1T0UA 1FMFA 2XADA 2NT4A 1DC5A 3A6LA 3B5IA 4DIUA 1XL0A 4OSPA 1L5ZA 5JNLA 3QOFA 4WACA 2G76A 4PE5B 4XJTA 2TRSB 3OIWA 1J1ZA 4B09A 3PC8A 3LBNA 2ON6A 3L1UA 4DUZB 2QN2A 3JQBA 1A9PA 5EMHA 5AHXA 3R5HA 3EZ9A 4A0FA 4YT8A 4ZN6A 1XCJA 2CVQA 3HYCA 5E3IA 3MHPA 2DHRA 2ZYVX 3EFEA 3T94A 4MWBA 2HD4A 1YWGO 1E9DA 1BOOA 4W5RA 3FPKA 4I7EA 3AVPA 4FHEA 4Q7JB 3G88A 2ZBQA 3K4HA 5SV2A 2UZ0A 1Z5ZA 1PS9A 4Y6PA 4B3HA 2QGZA 4X7MA 2YWCA 2VWPA 1WJGA 2ZE7A 4M89A 1A50B 4BNUA 1OHHD 1KKUA 4BNNA 3EVDA 4ZO9A 3N76A 2PMEA 3TGPA 4Q05A 4YCNA 4P3XA 5HP4A 3OCCA 5GPBA 4PVCA 1I4LD 1X8XA 3K6SA 4OUDA 2W2OA 3LCCA 4A0RA 2C2KA 5K45A 4J07A 3E27A 4N8EA 4XASA 4PZZA 3HJBA 4QGAA 5LBIA 3FOZA 2IKQA 3PE3A 4JBIA 4Q9HA 1Q0TA 1LZLA 3NETA 1JHZA 3QY0A 4MQ6A 4NMHA 4IQ4A 4B3TB 1F06A 2ZM6B 1OBOA 4Q4HB 1L7OA 1TLFA 4OP1A 5CUQA 2A6PA 2UVPA 2PVPA 1T5TA 4Q1AA 2OCBA 5E0KB 4DRXB 2YNMA 3K1AA 1SG9A 4XAQA 1TUIA 2HMUA 2GT1A 2PUVA 4AN4A 3JX9A 5J2TA 3QP9A 4NBWA 2WQ6A 3U4IA 3ZJYA 1M8FA 5GY7A 1OLXB 2IV7A 3E03A 1J56A 1NMXA 2FFAA 1K27A 2GVZC 3N0RA 2K7FA 4XRRA 1U2TA 3A4VA 3VSEA 3RRFA 3VMMA 5EFZA 2IH4A 4IMJB 2CL7X 1C8LA 1RXWA 1JKIA 1LSOA 4AMUA 5KNCD 2FMFA 2LD4A 3PYLA 3PUVA 2OZKA 3UG7A 1DAEA 3K20A 3EQ9A 2W7TA 1NXVA 1XGKA 1A8QA 2HF2A 2WKRA 2VSQA 1Z7WA 3DBVO 5EP2A 1D2GA 3C70A 3W1VA 2CJFA 2BFBA 3NHZA 4PFJA 1C0IA 2EX1A 4B7CA 4C6HA 4QEKA 4IR7A 3CGGA 4ZV7A 3SLGA 3BRQA 3CZ4A 3L0BA 1XA3A 5DX0A 2QU8A 1NVMB 4EY8A 5BW4A 4REQA 2P2GA 4ND5A 5KHOC 2PH5A 3NVAA 2QQFA 2RGNC 4FNMA 4V03A 2B61A 1X1RA 2VHTA 4AUEA 4B3XA 2PUCA 4M0EA 5KUTA 4FT2A 2YRWA 4OXXA 4PR0A 3PRHA 4NZPA 5I9MA 2MU1A 1VECA 4NBTA 3WHLA 2H06A 2IPMA 3HZRA 2JCBA 2YHAA 1HTWA 3NPMA 1VLMA 1QYVA 5CNKA 1PQWA 4L5IA 3UK2A 1TM2A 3KL2A 4RPHA 1E4VA 1ZCBA 1JTFA 3O38A 3DL4A 3OOWA 1G3MA 1VI5A 3HWWA 3T9EA 1W75A 2F2TA 2XX3A 1SUSA 3EGIA 3KX2A 4D3YA 3AY3A 3KFLA 5HF9A 3V4FA 2F1OA 3VKGA 1I3MA 2V58A 2HSEA 4JVMA 2JATA 3KVOA 1ODIA 5BW6B 3GEMA 1U0OC 4U7PB 3E0QA 1QKKA 1RLMA 2DLDA 1T8PA 2YW9A 4HPXB 4I5EA 4WL0A 2XB9A 4MAMA 3VC3A 2E4AA 3VX3A 3BL5A 3IDOA 5TMBA 3ZIUA 3PX2A 4IIJB 3NT4A 1G3RA 3C48A 2A0FA 3PHLA 3RS8A 5ED4A 2BTEA 2D5LA 3AB7A 1SVSA 3BWCA 1XZNA 1C1DB 1GJRA 3M33A 3ZD8A 3OM8A 4BYGA 1Z13A 5CFMA 4XTRA 2Q41A 2ZB7A 3ZHSA 1VSVA 1I30A 3QKRA 3HGQA 2VRNA 2Y1FA 3CS3A 2OSVA 1L7EA 3I05A 3DOCA 3V2UA 4D99A 3ZC3A 1EDEA 5JJIA 1K0UA 2C5FA 4ZV4A 3NOOA 3PNMA 1DT5A 4BAGA 2BMEA 3QK7A 3PHGA 4DM3A 2XUDA 2GK6A 3GJXC 3C8DA 4BC1A 2GVDC 1SMKA 2J33A 2BKUA 5F5LA 1KDTA 1X2EA 2OZPA 3DUFB 1J2YA 4RYDA 3ST7A 4DWOA 5FAKA 4L5AA 4J91A 4QFDA 4FMBB 2JVIA 1BWRA 4ENUA 5AOBA 2M9MA 1OXKB 1ZMBA 4O4HF 4H7EA 2JIBA 3AEYA 1Y89A 3MIZA 4M2LA 1U0HC 3VR6D 1JKJB 3TZBA 3V4SA 1CQJA 3TTSA 4AZWA 4E13A 2YX1A 1JH9A 1ZGGA 3PX7A 3VZRA 3WKEA 5FTMA 2A0UA 5EJ8A 2HR1A 3ZWYA 2JAQA 2AFIE 3LOQA 3ZR4B 4YGYA 5JC1A 3SZMA 1FVXA 1EK0A 1Y37A 4G2TA 4KIJA 4DBVO 3DPSA 1G8SA 1C3LA 1E99A 1XEWY 2NW6A 1FNNA 2Y0CA 4BLOA 5FTLA 2EZUA 4X66B 1Y8ZA 1DRVA 2VF2A 4QC2A 3G0IA 1E1NA 1M2WA 3L6OO 5TQJA 3O26A 5LUBA 4LQLA 2VPYA 4NICA 5D1HA 5H3HA 1K06A 1QG0A 1Z73A 5TE9A 5T4HA 3QEMB 2YWBA 4DIDA 4CIWA 1JEQA 3L0OA 1RXIA 3BKWA 4DBZA 1N2SA 2PRIA 4D3SA 4YAKA 1HI9A 3ZZNA 5EJ5A 5LDDC 5I9IA 1RIIA 2J9YB 3Q72A 3ZLBA 4C2UA 1NOKA 1PJRA 2P40A 1RLUA 4Z1OA 2YASA 1KO8A 2QM0A 2XNDD 1BS1A 5EQDA 4FFBB 2VUUA 2CKMA 1U8YA 1VKNA 5ALPA 2Q21A 3CH4B 3G5MA 4C4AA 4DDKA 1OLSB 3QE0A 4KVFA 1GLGA 4HNGA 1KJYA 3U39A 3GLSA 1MO5A 1RRPA 3UGKA 3WWDA 4BNKA 4X1IA 1WXXA 3UICA 1XWIA 1GL7A 3HWSA 2V6JA 4MI9A 4QXMA 4WKOA 4CV3A 3AB3A 2XDQB 1VCHA 3ICWA 1PT9A 4CTKA 4OQNA 1IHDA 3TSCA 5JBQA 5HTKA 4V1CI 1KSJA 4GT1A 4I08A 4JFAA 4YRQA 4GMFA 2Z4RA 2FZWA 3MAJA 1GCAA 5AI6A 4U2CA 4N76A 1DC3A 2VPXA 4WKNA 1DQYA 1JG7A 1ZI9A 2Z4TA 4V0ME 1NW7A 1S2MA 3EQ6A 2FB9A 3DXYA 4K2AA 4PC1A 4ZO8A 1H3NA 3S1AB 3AHDA 3ABSB 4HAYA 3K9WA 4X41A 4JB2A 2P8SA 1R6DA 1EVKA 2MSCB 4MQUA 3LFTA 1P7ZA 3TEJA 2JJ2A 2HJWA 4HZGA 1RAIA 4XXHA 2X42A 3OQIB 1D0VA 1NUSA 2B0JA 1GL9B 3JYNA 2WINI 4KN8A 1DRKA 3QFTA 3F4LA 1X39A 4LXXA 1GZ3A 3PUXA 4YJGA 4EKGA 2IIBA 3V97A 4ITRC 1U7TA 3C6MA 4D0GA 1UODA 1Z45A 3D5TA 3JZFA 5DHSA 5BN1A 3K0KA 4DYVA 3WLLA 1HQDA 1FDTA 2PRYA 5IZCA 3W77A 4FMPA 3K4PA 1YKSA 3HB5X 4DLAA 1NQOA 3GYGA 4U8GA 1I7DA 3DVSX 4WCFC 2D1SA 2QPLA 1TT7A 4P80A 5CVEA 4YRCA 1U63A 4OQZA 3VU8A 1U0BB 3W05A 1RFLA 5I7AA 1K88A 1ZPDA 2CE7A 2HNKA 2V0CA 5GZ3A 3ZCVA 4ZVRA 3RUCA 4DPMA 3UWMA 2HSJA 5IX8A 2QRZA 2ZE8A 4X7RA 4CQJA 1NW8A 4PYQA 4ARZA 2EYQA 2QUJA 2BGRA 3I83A 4KUEA 3PWTA 3O75A 4OIFA 5G0UA 4CF6A 2HDHA 1UQUA 1UT5A 3F1KA 4Q3NA 5CDGA 5KNBA 1XDDA 4LFAB 1Y4AE 7REQA 4HNRA 5G0SA 2Q5OA 4JI1B 3AHFA 3U4AA 5IH7A 1U7UA 2XRYA 2VF7A 4PIVA 4U2DA 4JJIA 3FJ1A 1U2ZA 4L1KA 5KJ6A 3O5AA 3S4YA 4RY8A 4UZSA 4Y9DA 2NNWB 2R00A 5A3RA 2P62A 1CQXA 2F55A 5K8JB 2I55A 4JLBA 3A6GA 3GBSA 5DSZA 4CF5A 3AINA 3AESB 3D8BA 1UJMA 1FTYA 2AZDA 4QO7A 3RQIA 1XPJA 4FYIA 3C6XA 1KDOA 3I8OA 1E8DA 3GVXA 3ICOA 4BVKA 5EIFA 4C04A 4NH0A 4OQYA 2WWHA 3AUXA 3DT6A 1OH5A 3SEFA 1R12A 1TVKA 4MVJI 4WN9B 1AKRA 4EP1A 2Q5HA 1JHOA 3TK1A 1PS0A 3G5AA 3DTYA 4NZMA 2CFRA 5E7QA 3TMAA 4HLNA 3STHA 4CLRB 4P4GA 3UJBA 3L8EA 5B64A 1JJIA 2Q6KA 3UPUA 1E1YA 1A7AA 5HWSA 4BNJA 4A3SA 5ENZA 3U62A 4Y2HA 4TWAA 1VMAA 4OJTA 4F72A 2X6TA 5I45A 2QMUA 4XVQA 3OX2A 2F43B 1E79A 1SNYA 1RJWA 1ZXXA 3IKLA 4FQ8A 5AP9A 1V9CA 5B30A 2A35A 1YMUA 3QUCA 4HJXA 1P1KA 3DWFA 4JP8A 4N12A 1NTRA 2PVCA 3RU9A 3WK6A 4EB0A 1XCOA 4MPTA 2CXSA 1Z7BA 2MSNA 5FPSA 2IHNA 1T13A 3JQ9A 3HO1A 5FV4A 1YL7A 5J23A 1M6NA 5EE0A 3VR4D 3GRYA 1H1LB 2JIDA 4FCVA 1UZNA 3AGPA 3G2LA 4L8FA 2FG6C 1RYMA 2ZXUA 4DR4B 2P6UA 1GIAA 2WA1A 3NORA 4RSGA 5U4XA 4QREA 4CEHB 1TEZA 4C4ZA 1LTKA 2QRPA 4A8JA 4BUZA 1MGOA 3GXBA 1NLZA 4CMIB 3Q7RA 3LYUA 2OLEA 1UQRA 2VR1A 3QX8A 3SF8A 3GNQA 1I5EA 3B9RA 3I37X 1MAWA 2AFVA 2R7NA 3CMCO 4JEMA 5C9ZA 2IZ5A 1KL7A 3VZDA 2HWYA 5K0BA 2W83A 1Y1RA 2WFZA 4XM2A 1TCBA 1O5TA 4ZCSA 3I04A 2W6OA 4HDKB 4O4JB 3ULKA 5L7TA 2X9LA 3PC3A 3KQMA 3LX5A 3AFHA 3HUFA 2BMDA 3ZHQA 1FX1A 2JI6A 1KSGA 3LRPA 2HXYA 5TRTA 2DUUA 3THSA 4PLGA 3TI9A 3C4VA 4ZGWA 3CG0A 2XYRA 3ZQKA 1HYQA 1S3FA 2D62A 2V5VA 1PZNA 2XV1A 5DOVA 1PZFA 4LBWA 3JVEA 3Q4GA 1E2LA 5KNDH 2X0JA 4ZTBA 2C3MA 4LJ9A 1YJXA 3FOAA 2EFYA 3B3FA 1NYLA 1ZIPA 4NYMR 5BN5B 1DOHA 1VJGA 3IDZA 2VF4X 4MLDA 3L7LA 3T1VA 1CB7A 3TRIA 4AYWA 1XP5A 4PX5A 4BJ1A 5JBIA 4LYFA 3A6DA 5JDCC 1UWVA 1V7QA 1F8XA 4U4AA 3TOCA 2FFRA 4D98A 1KAGA 4Q7LA 4HQKA 5AVSA 2ZI3A 5TQ2B 3PEWA 5DCUA 1FXWF 2VNHA 3N8DA 4L78A 1PN3A 3QKSA 4DKXA 4RH0A 3KZKA 1N2GA 5E2BA 3D6VA 4X63A 5EHXA 3KT8A 3U7JA 5LDGA 3UJ6A 3D8UA 3QEOA 4FB4A 1E1RA 4UREA 1MEEA 2GFIA 1B0PA 3DHNA 3H8WA 4FXOA 5ITZA 4C0XA 3MTEA 5EUCA 3KWLA 3P2YA 1Y9ZA 1Y6GA 1H3FA 3ZXYA 3OA0A 1E5LA 4GQAA 4KK3A 3RKRA 4IQ0A 5AVQA 3A10A 3E2IA 3JAMA 3VPFA 2J5RA 5TJ9A 3OE5A 4YQYA 4URFA 3ONVA 3QQPA 2GYWA 4A27A 1M0TA 1YQEA 3G1TA 2VVTA 3KQSA 2A7XA 3WRXA 5CFPA 2Q1SA 2QOEA 3DMYA 4Y2YA 3ROMA 2W4IA 1KTIA 3QENA 4NU8X 2B8EA 1DQZA 1H0HA 2OUIA 2Q2VA 3E18A 5KVVA 3C3MA 1J07A 4RHCA 3CVXA 3F9CA 2WM8A 5AVYA 1WB9A 2AMJA 4EHJA 5A9SB 1F7UA 3H19A 3ZE7A 1BDJA 4I4CA 5A5DA 1Z28A 4M0CA 5IVPA 1QO9A 4E4TA 2B21A 3H3FA 3ZCRA 1WX1A 3WGLA 2ODNA 2ZTHA 3G1UA 3AL3A 4HL6A 5FV7A 3L93A 4TQUS 4XQ9A 2C4MA 4YPVA 1JW9B 3G5LA 4DILA 2D5AA 3B53X 1LFDB 4HDSB 3B6KA 3GY0A 3NIWA 1PNVA 2CC2A 3D2AA 1YS2X 1X8KA 2K6GA 4GWLA 3HDYA 1L1FA 3ZKWB 4NU0A 4FEGA 4HDAA 4Y1FA 2VNSA 4JT9A 1W48A 4E2YA 1JJBA 1E0DA 1KHTA 1R0WA 3Q0TA 4EX6A 4ND2A 5JYEA 4UVGA 3KZVA 1MB4A 4QOSA 4FOLA 1IWBB 1ZHFA 3ETJA 4GNKA 4HGQA 5FPPA 4EL0A 4PRLA 3BCRA 4G09A 1C7ZA 1BXGA 3FCSB 4IUCS 2GZRA 3C14C 1N8SA 3DT8A 3IBGA 1R0KA 1RCUA 2WA2A 1IZ7A 2GRUA 5CM2Z 3BMCA 3AEQA 2ECKA 1N1GA 1YBFA 1UJ4A 2DKNA 2OT3B 4HQOA 4M6WA 1WDLA 3PQ8A 5DTEA 3IQWA 4H1VA 2WICA 1JFFA 3PCTA 1NP7A 1W4CA 1FFEA 1R88A 2G6TA 3KSZO 2PZGA 3M6UA 2F8LA 3M9XA 2HQBA 3TE7A 3GAMA 1R4NA 4DNXA 5K0TA 2DULA 2J9GA 3I76A 1NBMD 3QG1A 2F48A 4O6VA 2PUWA 1B76A 1P19A 2PQ6A 2Q5JA 4Q15A 5H82A 3VGJA 3WK5A 4G5YA 5JS8A 5DHAA 5AJXA 4Q3DA 1JX6A 1EXWA 4XH9B 3DHEA 3MG9A 5AI5A 4YDQA 4DSTA 1IJEA 3BFXA 4UCFA 1F0PA 2OYRA 1C30B 5AD1A 3S81A 3D43A 1XCGB 4DJDC 1H5NA 4KEAA 5TY0A 3GQBB 2XMSA 5A0FA 4L22A 4MUJA 3NHWA 3G9UA 3INRA 3AM1A 3GI1A 2P1RA 3HCPA 4H6PA 3K72B 1GFZA 4WXRA 2GSWA 2KLHA 2SHKA 1J97A 4XSVA 4ACAA 4IHAA 2BKAA 4BBAA 1QIIA 1JLMA 3VR2D 3U6KA 5IARA 1P9LA 1FVFA 2H7VA 1A8IA 2PMBA 2QTCA 3PL1A 4B3RB 3HHPA 4F3KA 3UK7A 1HOXA 1I10A 1KIAA 1KZ9A 1OROA 2B6HA 2XMPA 1X7YB 13PKA 5BSTA 1ZOLA 1DTWA 2O1WA 1VKRA 1T5DX 2W2TA 3D6UA 5DLPA 3MT8A 3O4RA 3RS2A 3ZJVA 3GN1A 2X9QA 1VIVA 2VP0A 3FG9A 3QPVA 4P84A 5J2UA 3NBYC 3SCZA 1CUEA 1WUJS 1QK4A 2GN1A 2J3EA 4NR0A 3DBHA 3PE6A 4CV1A 2UXCB 3HN7A 2P2LA 2XQFA 1NIJA 5F7XA 4GM0A 3BF8A 2Y9PB 4PWZA 1CS0A 5BWMA 4ZVVA 5LP1A 2HAEA 3AU8A 3QVJA 3A2KA 3IAUA 4R16A 4V02A 4G1FA 5EWJB 1IM5A 4WN3A 3SS9X 1BVYF 3QE9Y 3I3SR 2J7KA 3K0HA 3IEKA 3Q9SA 2REOA 3VJLA 2WFLA 4CT4B 1DE0A 5U4QA 3MSCA 2J30A 4LV6A 3ZK7A 5EJ9A 1AMUA 1L5MA 2G63A 1S89A 3L92A 2FEAA 4GLFA 4O2BA 3DFMA 5KYVA 5AW1A 1U8UA 2RK3A 4BX8A 2Q8QA 1TIPA 4LHSA 4MEBA 2ST1A 4DMGA 2XAUA 4MV9A 1NDUA 2AOUB 2RGCA 4C06A 3WQSB 1KI8A 3H18A 2NU7B 1L3IA 4IIJF 3Q8XB 1HZJA 3USES 4J0CA 4LRQA 4WA8A 4QGSA 4B34A 2H51A 3HFSA 3KBBA 5B1IA 1MT0A 1KETA 4M9UA 1X8LA 1AX9A 4N4AA 1SR8A 2X6RA 3RSOA 2Z57A 3GF4A 1PJLA 2CJWA 3AOGA 3HP7A 3KU4A 1YR7A 4Y2RA 3S1LA 5JMWA 3OEHA 3TBFA 1CR6A 2AOXA 3QEKA 1ZJZA 2NVWA 3IBCA 2ZI5A 3SICE 3KTOA 4E22A 1NYQA 3NMUF 3KEMA 3VI4B 1N2OA 1GNLA 2RI6A 4PQRA 2OV6A 2JBWA 5LB2A 1WZ2A 1SQGA 2V1XA 2FP3A 4LJ4A 4BLUA 2UYCA 3UFXB 4RDCA 1Q91A 3WLSA 1C1YA 1QGOA 2ZQZA 4M7PA 5KPDA 4BV8A 2R65A 1PL7A 2Q3BA 3KEQA 4FQ5A 1I2MA 4JZKA 5AXDA 3L4SO 3RVNA 4CDNA 4JB3A 2HRQA 4ZVQA 1BMFD 4V2IA 5IDVA 3U3DA 3U4MA 3I64A 4DTCA 4EHDA 1D2RA 1SD5A 2IDMA 4G0NA 3R41A 2J0QA 2XSZA 5G3ZA 3H5WA 3QNUA 1JU9A 4PG6A 4XX1A 4IG9A 3G13A 1NNUA 3JASA 3QVKA 4R68A 4WNAA 3TDMA 4HB2A 3ZG6A 4DZRA 3GW8A 5HM6A 1YASA 1ODTC 5LQKA 5C53B 2QVGA 4NPHA 4JL5A 3LBAA 1QK3A 1YTLA 4OHVA 2RGXA 2W2PA 4HC4A 2ZUBA 3LPAA 4WECA 4EMBA 5A7GA 4ZJYA 5B5SA 5JJBA 2GCGA 3C43A 5GM1A 1HMPA 3IO3A 3IHKA 4XFKA 1MIOA 4OK3A 4C9BA 3HXOA 3X1YA 4J4TA 2FPGB 4R0NA 2COKA 1ESZA 1V4BA 4XGQA 5HS6A 5A4JA 1J0CA 4RQBA 1PP4A 1K4YA 3C15C 4DIMA 3USZA 2VTDA 3O4GA 4U2FA 1YZQA 2YNMD 1BQ3A 2JBHA 2V7BA 5J5CA 4B4KA 3ZWKA 3AIOA 4XDGA 4NEGA 1SEPA 3PSAA 4MI3A 4FBMA 3LPCA 2DCMA 4MYCA 1P3Y1 4JFRA 4KXFB 3X2FA 3T9FA 1GNRA 5JPDA 5ICSA 1LVUA 2O50A 2PR7A 2UZ1B 4FEEA 3VYUB 4KNYA 1XTJA 2Y68A 3RBXA 3F6SA 1U9IC 2W8BB 4CFSA 1PL8A 2ZSEA 3QI2A 4Q9LA 2F8SA 4C7OA 1IXRC 3I28A 1R6BX 5KHAA 5CK5A 4BUJA 4XJVA 1DGQA 3ESBA 1X7DA 4BKQA 3KHUA 4J0HA 3D1LA 3VRHA 3ZH9B 4WVFA 1Z6TA 1KDYA 3CVYA 1JQAA 4YNBA 3OIVA 4DLPA 1O97C 4TZ0A 2Q3DA 3FF4A 2NPOA 2A3RA 1ZMRA 1K5GA 2QTWB 4Y6GB 5HF6A 3TLZA 3WFZA 3OFND 4G1CA 1MEOA 4F60A 3TUIC 4KP7A 4TKUA 3TZLA 1WMFA 1I2DA 1PR6A 3EQ2A 3R9XA 3UAXA 1AZLA 3E9EA 1GNQA 4H9GA 4NZOA 1HEIA 3D3EA 2Q5IA 1V25A 1T29A 5FQOA 4B1FA 2OHFA 1UR5A 4RKFA 3WMFA 2VDLB 5AW5A 2W0SA 1G64A 4TMZA 1C3EA 5CH3A 3WLJA 1KMHA 1QNFA 4WXPA 3VMFA 5L4SA 5AKEA 3U44A 3H9BA 1QVRA 1CZOA 3EGVA 3AVOA 2YVQA 3IR6A 4GZ5A 1Z0DA 3G0OA 1JF8A 3I6YA 4NPCA 2HHJA 2EKZA 4FMCF 2NTVA 2Z56A 4R3WA 4H18A 4M1TA 1ADYA 2IU6A 4XIGS 4MUAA 3NTVA 2ATEA 3GC6A 4CKCA 1THGA 2Z6VA 4R1LA 3MWGA 5EXEA 1E6EA 1LV8A 4ALNA 3T34A 1UFOA 1FYFA 1US8B 4IKEA 2Q5CA 2VATA 4EKIA 2W2LD 3HGTA 1M34A 2JRLA 1QUEA 1L7QA 3K9CA 1J8QA 1RSZA 4KRXA 4RVCA 3CONA 2V4UA 1KJQA 1SU8A 3D8SA 2H9IA 3SC4A 5B12A 3A06A 2W00A 4LBYA 3M3DA 4CKZA 1CQIB 1VCIA 3Q3VA 1ZD4A 3ODGA 1C9YA 4JASB 4MDHA 4NVRA 4TTVA 2XB4A 4AY2A 3IIEA 2VNJA 3BRWD 4OKNA 4C5BA 1OI2A 2JLWA 2PT5A 1T9DA 4GOXA 4LCJA 3OZEA 2PSFA 4OLAA 3PP8A 3EVZA 3USCS 2CEAA 4HNTA 4OB8A 3GEBA 4YRLA 1F38A 1NJ8A 2QN1A 3G79A 2JIMA 3H2YA 3NM5A 4HB4A 1L7AA 1UOQA 2OK8A 2JKVA 1KH3A 3D1JA 3MJCA 4IGFA 1JXOA 4MWZA 4ENWA 1VXOA 2D1QA 3CRRA 2WP0A 4ZI7A 2IXTA 3P4YA 3S5UA 4TV9F 4AZSA 5IPFA 3X3HA 4HRAA 1PJ8A 3H5OA 3KUUA 5EXDA 3VU1A 3WSVA 2CHEA 2ZBFA 4R9SA 4KWHA 3WISA 2H65A 4LMPA 4Y2XA 5EZ5A 5HIAA 4FINA 4QJ4A 4TYNA 2JHFA 2P0EA 3D64A 1WDKA 4IDHA 5BSKA 4B6EA 1YONA 5KYWB 5C8YA 4PM4A 5DGCA 3E2PA 2WNIA 4UOEA 2F6RA 2VZ8A 4IVQA 3RRJA 2J85A 4D4LA 5CYGA 1UBNA 4QM6A 1EK6A 3COZA 3GRFA 4IIHA 4FOOA 1RIFA 1ZC4A 2G6BA 4UUMA 1C7FA 3IULA 4K86A 4NCBA 5F9FA 4IV0A 3R7WA 3UXEA 3A3KA 1QX4A 3DXXA 3N7AA 4FW8A 1UBFA 5LIRA 1KQNA 2PS3A 5DBGA 5GAJA 5JSHA 1W29A 2WTXA 2A2ZA 1I0IA 4KODA 4DV0B 4O2AB 1Z4JA 4JDPA 1PSWA 2VDNB 1OJ7A 3T52A 2UUBB 4WJZA 2Y71A 2MYUA 5A03A 3NHAA 5LKAA 4S1TA 4FT4A 4PLTA 5DI3A 2BEUB 1RT9A 2PNFA 5SZIA 2XWPA 3KFXA 4YRGA 3KJXA 3TQHA 4ZCRA 2I9PA 2WB4A 3OMWA 4LE1A 1TNDA 3QPDA 4NESA 1MC8A 1OLOA 2BUCA 1Q5PA 5F1PA 3JTMA 4XIYA 1E7QA 1K08A 1G16A 4DLUA 4EUFA 4YMHA 4US1R 1ECBA 3VBEA 1EXMA 2XWSA 4P4UA 1BVRA 2I7XA 4AKIA 2WVJA 3RYIA 5FADA 3ROEA 3HDHA 3ND8A 2IYEA 4F96A 1O0CA 4KO4S 5TGDA 1PTJC 3F4BA 4CQLA 4K9PA 1RQ7A 2C8VA 4JYCA 4TV8B 4V0OA 3R0IA 5HE8A 1C9NA 2O8CA 1FRNA 1UDCA 2R4TA 1K63A 1GRCA 2IE0A 3DOUA 1P9NA 2H11A 3NFRA 3AM4A 3MJ4A 4RM2A 5IYZF 4BMXA 2QA5A 4BZZA 4YT4A 3IEVA 1DIHA 2CHUA 5G2OA 1OVGA 1GL6A 4FI3C 2AJCA 4FJ0A 3VO8A 4GLJA 5I7OA 4D4GA 1T0BA 3ZW7A 4IOJA 1NMQA 3C7AA 3QYFA 4WNIA 1M6VB 4MLPA 1V47A 5L95A 1DQPA 3EG5A 2HGSA 2JGMA 4NYJQ 2QQ5A 2W6CX 4QWWA 2ZRHA 1HDEA 3LLSA 4C7VA 4EPYA 3JALA 2IY9A 2QRMA 1MQSA 2FWIA 4QLOA 1L5SA 3RLFA 3AVWA 3KPWA 1Z4NA 3JYQA 1RXSA 5HJ5A 2WAAA 1SG6A 2G82A 3K16A 3WBBA 4F4IA 2MSLA 1B3BA 3BWBA 4HD8A 1GCUA 4INZA 4MX8A 2NVUA 4EHFA 5JSZA 2Q3MA 4HO1X 1Y8QB 3DPUA 2ZDHA 4YJ3B 3F78A 3V8RA 3OCUA 5E4FA 1DUIA 1NIPA 3UA3A 1UM9B 1FUKA 3O0DA 3L6DA 3TSAA 3Q98A 5IASA 5KNBD 3E7XA 1P18A 1EDZA 1E7MA 5T67A 2DUJA 2ZT7A 2NUPB 4GYKA 1YCGA 5ALWA 2IWRA 3UJHA 2JLRA 4KQ6A 1YJBA 2Z2KA 4RK7A 4Y1RB 3KOOA 4LF8B 3OQVA 2Q28A 5DX8A 1L5NA 3LT1A 1CUIA 4EG3A 4XYLA 3IE0A 4P2GA 1SKQA 4TQGA 3T7EA 4OHOA 4PRYA 4R7TA 4UE3S 4FD3A 1QQBA 3BZWA 1VLQA 3H86A 3M6MD 1B14A 4Z7QB 2ET6A 4CR8A 5JJCA 3GFRA 4MUMA 2KE5A 2ZU6A 2GWHA 2QXUA 1L8LA 5KCZA 1TO6A 2O8VA 2XCOA 1CHDA 5GOTA 1YS7A 2BM0A 1SB8A 5AK4A 4B6OA 1ZFNA 2I4TA 4LWOA 3WE7A 1GL3A 1X77A 1KA9H 3ZWAA 3CWZA 2PKXA 4L9WA 2RGAA 3KD3A 4QWMA 3A6FA 5JZ9A 2G40A 3ME5A 1VTKA 2C3OA 1YK1A 5H7XA 3U3JA 3ZVKA 3PK0A 3RFVA 4JV5B 4BDTA 2WYOA 2VRBA 3QXXA 4YCDA 1H2ZA 2YS7A 5SZHB 1USIA 2EC5A 2HU8A 1UEJA 4YK7A 2IUYA 4Z4FA 2PX5A 1IBSA 1AQUA 4O5OA 4QXQA 3MWFA 4XSHA 4GC9A 5FIUA 1GTRA 1XA4A 1VL1A 3A1TA 3CTPA 1RFGE 3BL6A 3LSYA 1KXJA 3KAJA 4J7AA 4S0ZA 3TVYA 5KU7A 2YXPX 3DZHA 4UAUA 4UNSA 4CCAA 3HCBA 1ZUIA 1KQPA 1YIOA 2IYZA 2RHCA 2DPGA 3OIGA 3U9TA 5C46F 2ZJBA 3C74A 2ZJFA 3MTGA 1Z25A 3IERA 1KY5A 1O6FA 3HVIA 8AT1A 2Y1CA 1KGDA 4JA0A 3BB4A 4L08A 4OU5A 1XG5A 3E23A 4N01A 4M0MA 3UNXA 1QBKC 1U3TA 2OO7A 3U4GA 2GZSA 4OA5A 4L6AA 3RNLA 3KPYA 1ZK3A 2BZ1A 2DQYA 1UPXA 4WESA 4KO1S 4AWXA 1I4DD 3W1EA 5FLYA 1AQNA 3G68A 2QRVA 5HKOA 3P4UA 4YJ2B 2W6QA 1VE9A 1GAQA 4C4XA 1X74A 1C4KA 1E1CA 2GAIA 3I8XA 2HUNA 1XD8A 4KVZA 5DJ5A 1J90A 1S3IA 2E9SA 2XZTA 5K6AC 2Y0DA 1JUDA 5EXTA 5TGZA 2JLXA 4YRJA 4BXOB 1EE2A 2G77B 1YDGA 5DHRA 4OJKA 3QPCA 2X9NA 5BQPA 1CYDA 1MC1A 1CVIA 4DDVA 3JWHA 5LBTA 2CB0A