3CH6A

Crystal structure of 11beta-hsd1 double mutant (l262r, f278e) complexed with (3,3-dimethylpiperidin-1-yl)(6-(3-fluoro-4-methylphenyl)pyridin-2-yl)methanone
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
264
structure length
264
Chain Sequence
b'EFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSRWTTLLIRNPCRKILEELYSTSYNMDRF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
publication title Pyridine amides as potent and selective inhibitors of 11beta-hydroxysteroid dehydrogenase type 1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 98
structure length 264
sequence length 264
chains with identical sequence B, D, E
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2008-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ch6A00
1SEPA 1YWGO 4WLEA 5MGBA 5DDIP 1EUDA 4CMBA 4IDFA 4XR4A 4R9RA 3CTMA 1MGOA 4FDAA 4BNXA 1Q1NA 4EEZA 1Q0LA 3GDOA 5LDHA 1YOVB 2X0RA 3ZWBA 1QR6A 4ALNA 4OXKA 4NH4A 4YBZA 1FDTA 5B4UA 1EVYA 5EJ2A 2A94A 1ZK2A 4YJFB 1C0LA 4LCJA 4CM9D 1MX3A 4UVEA 3FR7A 4AFNA 2GN4A 1NVMB 1P45A 3P5SA 1CEQA 1PJCA 4W9NC 4BNJA 5HM8A 6LDHA 4P4LA 3PZRA 1Z75A 3PZBA 3C85A 3D5QA 5COBA 2BD0A 3LLSA 2BHLA 1Y8QB 1PQWA 1Q7BA 2AE2A 2D5AA 3KSZO 3F46A 4DGSA 4D44A 3PXXA 3Q3CA 4OIMA 3W8DA 3DTTA 1IPEA 2Q1SA 4XGKA 3D0OA 4Y6SA 4BNZA 1R0KA 4BOYA 4YRDA 1WNTA 1JA9A 4YRAA 2Q45A 5LDGA 4FS3A 2OHXA 4K6FA 2DPGA 1PJLA 2PZMA 4HNGA 4CQLB 4CR8A 4NFHA 3E5RA 2X5JO 4IJUA 3ANLA 4JCOA 3MJEA 5IZCA 3TOZA 3PHIA 4B4WA 3Q0EA 3K30A 1JLLA 3FF4A 4L76A 3TZCA 1F17A 3K2EA 1BG6A 2JAPA 4RZHA 4ALLA 1EK5A 1P77A 4EI2A 5KTKA 4DPLA 2NTNA 1SB8A 1LDMA 4BHTA 3LT1A 4U0JA 2VOEA 1HZJA 2VRCA 4E5PA 2IEBA 4KTTE 1XLTA 4IS3A 1LSSA 1XU9A 3U3XA 3QRWA 2GRAA 1G6KA 2EXXA 2WE7A 4E2YA 1DC5A 1Q7CA 2NVBA 4RVFA 4KUGA 5K9ZA 5FYDA 4EDFA 2NM0A 3D1LA 3EUWA 3IC5A 3JQBC 1R16A 5G4LA 3AU9A 3UOGA 2WTBA 1PJBA 3KV3O 3PHHA 1PJQA 4ALIA 2EHDA 1GV1A 5JC1A 4X54A 2CDCA 2FZEA 2ZQZA 5K6AA 3JV7A 4RLSA 3MCVA 3PJEA 4Z9FA 4HADA 3FI9A 1GAEO 4INAA 1LNQA 1TT7A 4D0RA 2Q3EA 4W7HA 4FBGA 1HLPA 3C3XA 2VZ8A 1ADBA 4K9DA 3DTYA 4RLHA 3OICA 3KETA 2O3RA 1QXSA 4MVJA 1E1NA 4AVYA 5DCWA 2ZTUA 1A7KA 1N2SA 3CZMA 1N9GB 5DCYA 1R4MA 5KJ6A 1I30A 1O8CA 2O4UX 4Q3NA 5A3VA 1W8DA 1HETA 3PI7A 5GY7A 1EVIA 4ZQFA 1MXHA 2RHCA 3UKOA 2Q50A 4E21A 1U3WA 2I5PO 1DRWA 2WMDA 4BQRA 5IXSA 3TRIA 1EMDA 5C3MA 4BO5A 1WDLA 4GX5A 2WYUA 3ABIA 1GD1O 3PFWO 5CDSA 1A9ZA 3DQPA 3VKVA 2Q2WA 1ZXBA 3UXYA 2C2XA 2I67A 2UYYA 5ENDA 2AEMA 3C1AA 4A2CA 1ONPA 5AXBA 5L4LA 1I0ZA 3NDIA 1GQQA 3OJLA 4L4SA 2CD9A 1EE2A 4WUVA 3QWAA 4JP2A 3NDRA 4N7RA 3L6OO 3G79A 3FWZA 3T7EA 5FEUA 5JMPA 4PLCA 3CZRA 3VOSA 1GZ3A 2W8ZA 4UULA 1GY8A 2HMWA 1M66A 4RF4A 1T26A 1ZK1A 2C5EA 4RO0A 1PQPA 3M1LA 4RVGA 5I8ZA 2YV3A 5JYDA 4CLOA 3LVFO 2Z1NA 3JQAA 2VTDA 2PY6A 4IDBA 3ONEA 3TL2A 3FCOA 1NX6A 1CWUA 4HXYA 3DHEA 4AJ4A 5KVQA 5JY6A 2AHRA 1E3JA 1PZFA 4QFDA 3WBFA 4CM1A 4MVJP 4J9VA 3LZ6A 2AQIA 4MJLA 1DIBA 2UV8A 3X2EA 4ALJA 4FFLA 2ZCVA 4GMFA 2EW8A 3AJRA 3HFGA 3JQFC 3GC6A 4KOAA 3TZHA 2B4TO 4E32A 1T2DA 1T1RA 1NFFA 2XOXA 4PVCA 3NT4A 1V3VA 2B35A 3RC9A 3WSWA 5A3JA 2BF7A 3K2BA 1CJCA 3AM5A 4H15A 2JHGA 3R0IA 4IBOA 1QV7A 3O9ZA 1WZEA 5BSFA 1ZCJA 4YCAA 4BNWA 1QMGA 4D3DA 4U7WA 4F3YA 4BMNA 1HDXA 3G0OA 2VN8A 3KHUA 4XWYA 5ICMA 5DP1A 1PGPA 2WD7A 4PCVA 3WMXA 2I99A 2XXJA 1NR1A 5HS4A 4U0KA 3BMQB 3PDJA 1OAAA 4K26A 5JDIC 1NAIA 1BSVA 1BW9B 2GERA 1OFGA 1VL8A 3OEYA 3BAZA 2OXIA 2JD0A 1YL6A 1BXGA 1JWBB 2O7QA 4DQVA 4IJVA 4W82A 4L73A 4F6LA 2IDZA 4DBVO 1HE2A 3GFBA 5ER9A 2ZYGA 4URFA 2AG5A 3ZWMA 3Q1LA 1JU9A 5LCXA 3AUAA 4NK4A 4TKMA 4ZRNA 2D8AA 1UAYA 3GVIA 2OP1A 5EESA 3F3SA 3S2FA 2BI7A 2GF2A 1U4SA 2YV2A 3GUCA 3WOHA 4EUFA 3E6AA 2G1UA 4LN1A 1YVEI 3DHYA 3DZGA 4E13A 1GUYA 1UH5A 3STHA 5EMHA 4B7CA 3CPSA 1V0JA 2HQ1A 3RUDA 3WWYA 1PQUA 3GDFA 1Z73A 4J0EA 3ZWNA 4FOSA 1K6IA 3BMCB 4I1IA 1DBVO 1CQJA 3IJPA 2BFAA 1GV0A 2BGLA 1B3BA 5U9CA 3GY0A 3W6UA 2C54A 3K92A 3JYOA 3VH2A 5EIOA 5A9SB 1H9BA 1X0XA 5TT0A 2GR9A 1J49A 1DFIA 2XAAA 5IXYA 4MVJF 4E4YA 4AICA 2VHXA 1V35A 1XQ1A 1NBOA 1VJ0A 1I24A 3TQHA 1GADO 4XIJA 5BSGA 3BHJA 2I65A 5ADHA 1M6WA 1HDGO 3FTNA 4B7XA 5A4DA 5JS6A 1PZEA 1EFLA 2Y05A 2JFFA 4KWHA 3VZRA 4CLDA 3INGA 1B8VA 3E8XA 1NWHA 3N58A 4IIVA 1HWYA 4J2HA 5JDCC 5A06A 2G17A 3M6IA 1R0LA 1SNYA 3GAZA 4YJGB 1A72A 2RCYA 4R54A 3IL2A 1ZSYA 1KVRA 2DBVO 4NBVA 2NVWA 2I3AA 2X0NA 3GZNB 3O26A 3LC7O 4OMUA 4YYZA 4R1SA 3OIFA 4BO8A 4H7PA 3C1TA 1ZFNA 1KVSA 2I9PA 4NZ9A 2HO5A 5IG2A 4KQWA 5ITWA 3U09A 4LMPA 3N7UA 1LC0A 4DLLA 2WYWA 4UVIA 3ZZNA 2YDXA 3L4BC 4TRMA 2IE0A 3F9IA 3OQBA 4U8GA 3HDYA 4R3NA 1E7QA 1E7RA 5CG2A 3EZYA 1C1DA 5HWSA 4R3WA 5I9NA 4PLPA 4I5DA 4HBGA 4YJDA 2Z95A 2YYYA 4I5FA 2EG9A 5B4VA 1LSJA 2EIHA 3EMKA 3TF5A 4Q9NA 4GGPA 4J7XA 4DIFA 1SEVA 2VUSA 3JYQA 3Q11A 3U4CA 4RPHA 1EK6A 1A27A 2C82A 3COSA 2B4QA 4BNGA 1VL6A 2B83A 4XDZA 4PGFA 1U8XX 1XIVA 4CMIA 4Z9YA 3I9LA 4WNCA 4FJ1A 1VL0A 1U3TA 2AW5A 4R69A 3ENNA 1J5PA 4M8SA 3ZU5A 1GZ6A 5G4KA 2HCTA 4CPDA 5KNLA 1DJQA 3K31A 4LMRA 5C7OO 1LRKA 3AI3A 4M89A 2YV1A 4IGEA 3D3EA 2IZZA 1EBFA 2GCGA 1JKFA 1ULUA 3GEDA 5CEFA 4TKLA 1FK8A 4XRRA 4AJIA 4WCFB 2BLLA 2W2LD 1EBUA 2HMUA 3RD5A 3GQVA 3E48A 4N5MA 2DKNA 3F4BA 4FFRA 4WLVA 2J6IA 4EITA 3LSYA 1RPNA 4M54A 5DOZA 2Z1MA 3JQDA 3UUWA 4XB1A 1H5QA 4FC6A 3GRKA 4RVSA 2ZTMA 1TXGA 1T2EA 3TFOA 1JN0A 3PLRA 3U9LA 4OOEA 5ITVA 1EQ2A 4NIMA 3GVPA 4TSKA 3QVOA 4GMGA 1CYDA 4XB2A 4FW8A 5AXAA 1YO6A 2HLPA 2HU2A 4AG3A 3FRJA 3DHNA 2Q4BA 3VPFA 4MKXA 3V1UA 2CY0A 5JAZA 3KM0A 3ZDFA 2NU8A 5JY1A 1KY4A 3QWFA 4IUYA 4E2WA 1C3VA 1U2DA 1A4UA 4BKQA 1QORA 1V8BA 2PZJA 4GVLA 4RGBA 3WDSA 1J4AA 2NADA 1K0UA 3KYCB 4RORA 3ZW9A 4OOFA 4OXNA 3FN4A 5DULA 2PGJA 4YT8A 3LF2A 1I2BA 1PIWA 1PL6A 2IYOA 2NTVA 3Q9UA 1GR0A 1UP4A 2NV6A 4JK3A 2HAEA 1C0PA 1CF2O 3GMDA 3JQ7B 3PDUA 3L4SO 2FPGA 4J43A 4IMPA 5BQFA 3HNPA 1A7AA 1EVJA 4WCDA 5KOIA 3ZU3A 1OC2A 4OSOA 3U49A 4OHUA 1A4IA 1VM6A 2W2KB 1FDUA 4GBJA 2E37A 2WE8A 4WCFC 3S55A 4QO8A 5L4NA 1DC4A 1LDNA 1PGQA 1T2FA 4TQGA 3AM4A 3FD8A 1M76A 2Q1TA 3AM3A 2ZYDA 1PZGA 1SOVA 3L6EA 1ISHA 4PLVA 3EC7A 3MOGA 4FIZA 3NRCA 1FMCA 4NJMA 3UH1A 4FJ2A 2HMSA 2LDBA 3RI3A 1U5AA 3JYNA 2HK7A 4ND4A 3V5NA 4YXFA 3PFFA 3GFGA 2BELA 4XR9A 1H6AA 1P1FA 2DVMA 2JCXA 3GDGA 3K9QO 3DZKA 4L4XA 2FRDA 4XYEA 3ROPA 3DEYX 4P4NA 4FGSA 1VI2A 3QY9A 4YT5A 1NPYA 1S6YA 3UCXA 1PJ3A 1PGOA 4Z0TA 2X58A 2YJZA 3IOYA 2DBZA 2FR1A 1NQOA 4A27A 3NKLA 3AOEA 3T7CA 4MVJD 4J0FA 1XDWA 3W4IA 3E03A 1LSOA 2EJVA 2NSDA 2C59A 4DIOA 3HZZA 3PJGA 3A1NA 4H3VA 4G65A 5T6BA 2FWMX 4NU5A 4I9UA 4DRYA 2OUIA 1DIGA 4J90A 4XKJA 1U7HA 4E6PA 1GFSA 2YQ4A 5KKCA 3H4VA 3KSUA 3HFSA 3SLGA 3DDNA 1XQ6A 1BHSA 4E30A 3KLPX 4IDDA 3MJ4A 1RKXA 3NV9A 3HDHA 4ZA2A 3RCBA 2H5LA 4ZQBA 1H2HA 1X1TA 4DPMA 2O3SA 2FR8A 2Y0CA 2D5CA 2X22A 2DUUA 3KBOA 5GZ1A 4J3FA 5ES3A 4R1NA 3MWEB 4RJTA 4BO2A 2GYYA 1IULA 2Y1GA 2EW2A 4QX6A 1TT5B 4R51A 3RFVA 3ROQA 4BV8A 4PG8A 3H2SA 3WYBA 5CDTA 4CLXA 2J3KA 1QLJA 5MDHA 2VWQA 4E2XA 3EYWA 1XWFA 4UEOA 1VSVA 3W4KA 1MB4A 3W1VA 3DZFA 2X5KO 5B12A 2AG8A 3ETGA 3DOOA 3QV1A 4IDCA 1QP8A 1ISGA 1WWKA 3S2EA 5CAEA 4IINA 5F1PA 1B2LA 1DLJA 1KBZA 1W6UA 1YBVA 3HQ4O 3I3OA 4RQUA 5G0WA 3W8FA 1AXGA 1H94A 1SBYA 5HA5A 2X9GA 2D3TA 3F47A 4LISA 3OP4A 3LK7A 4Y8VA 3C8MA 5I7FA 3IKTA 3F1LA 4MOWA 2X9VA 2YHIB 1I36A 4ESOA 4FPXA 4YJHA 1HSOA 2O2YA 2BKAA 4UUMA 4CLRA 5GZ3A 5KJ1A 2EGGA 3FNGA 3WXBA 1GCOA 4WECA 4OKNA 3H9GA 2FPPA 5U1PA 4A10A 2Y0DA 2J3JA 3PP8A 1I3NA 5H82A 5CG1A 4CV0A 3RC7A 4EJ0A 1HL3A 3FSRA 5TX7A 4CMCA 4TWRA 2RH4A 3RC1A 1NWCA 2BGMA 4ZGWA 1YB4A 1BVUA 1Z74A 2PGDA 3E9NA 3GZ4A 3PVZA 4OSPA 1ISIA 2EF1A 3F1KA 4RPGA 3U5TA 1R66A 2XF8A 1H93A 5TQVA 1DDOA 5A9RA 3ZH2A 3KYBA 1LC3A 3PQEA 2V6MA 1MC4A 1EFKA 4GWGA 4PZDA 3LC2O 1O5IA 3V1YA 4CL3A 4MDHA 4E12A 5F1KA 3ADPA 3GK3A 3CSDA 3GNQA 1DAOA 4J7CA 4JBHA 3KZVA 2VUUA 1OBFO 4UVDA 3ZWYA 4AJKA 4TRNA 2NWQA 4M49A 1C14A 2CF5A 4BV9A 2O50A 2BGKA 3CXRA 4NJOA 4XGIA 4BB5A 4M1QA 2O7SA 3GLQA 4GQAA 4OO3A 5I7EA 1XELA 3GG9A 4IZHA 4LSWA 1E5QA 4YAIA 3HB5X 3HWRA 3WSVA 2O23A 1E7SA 2FY8A 3PLNA 4IJKA 3JTMA 1V6AA 3OHSX 3L9XA 3HDJA 3RUFA 3G17A 3DZBA 1BGVA 1JTVA 1UDBA 1X7DA 3HJAA 1Z6ZA 4ND1A 4D46A 4KUEA 2V65A 4MKZA 3BMNA 2BI8A 4DYVA 3N74A 2ZB7A 3I6IA 2EKQA 5JNLA 5KWEA 4BL5A 1IZ0A 3ZNOA 1ZKMA 4DTIA 1LQTA 2O3QA 3NGLA 3OEWA 1N7HA 3INRA 5ILGA 1DPGA 2J5RA 2IXBA 3C24A 3S2IA 1C0IA 4I9HA 3IS3A 3VDRA 5LC1A 1HDZA 1LDGA 3DBRB 1NQ5A 4RPJA 5JFOA 3UGKA 1JAXA 2E49A 1UJMA 2I6TA 2Y99A 3D4OA 3RQSA 1DLIA 3QQPA 4NBUA 4B79A 4O63O 1XR3A 3T4XA 1U2GA 3D3WB 4DMLA 1IHYA 2GLXA 3HN7A 3VC7A 1JVBA 2BFOA 2VRBA 1SZJG 4ZQHA 1E3WA 5G0SA 2YHUA 3GUYA 3UFXA 1UUFA 2BFPA 4JLWA 4YQZA 5BNTA 2OMEA 4G2NA 1BXKA 2X6TA 4GI2A 4IM7A 5G0UA 1Y8RA 5JLAA 1NVGA 3NGXA 3EVNA 3K5PA 1HXHA 3S8MA 1FDVA 2JAHA 4J49A 2PD6A 4B3HA 2IODA 1ZMOA 5T64A 4E5NA 2GNAA 3AFMA 5G2OA 4CM7A 3PJFA 4ND5A 5CEJA 3FPLA 4II2A 4B3JA 5I7VA 3BHIA 3FBGA 5HTOA 1YXMA 2JJYA 1ZSNA 3GHYA 3BA1A 5GMOA 3I9JA 4Z0HO 5KVVA 3JQ8B 1E6EA 3D64A 4CM3A 4R68A 3IIEA 5EQFA 2DTXA 4UREA 4RZIA 2D0IA 2PH3A 2PKQP 3IJRA 3ONDA 4XDYA 1ISFA 3DOCA 3IMFA 3GPIA 2YDYA 3DZJA 1W4ZA 4MPDA 2Q99A 3VTZA 3FWNA 3RU9A 2HJRA 3OA0A 2O3JA 3ULKA 1MV8A 1HE5A 3G1TA 4AJLA 1YH3A 4NG5A 2VZ9A 3HE3A 2CFCA 2WM3A 2VT2A 4UUOA 2VNSA 4U6QA 1OZAA 3QVXA 5AXDA 5THKA 4A7PA 4B4UA 4L74A 3IUPA 4CMIB 3G49A 1Y5RA 5DN9A 2D4AA 3JD0A 1NASA 4CV1A 1WDKA 5IN4A 3OH8A 2X4GA 2ZJ0A 3DO5A 4JROA 4NBWA 3AI2A 1R4NA 3JQGB 4PG4A 4Q3AA 2R00A 3ITKA 4S3MA 1OMOA 2CSUA 4D3SA 1NNUA 3NJ8A 3PYMA 3ICPA 4I08A 1LDBA 2C20A 4LGVA 1PL8A 3AOGA 2B36A 5I9LA 4ILKA 3LQFA 2ET6A 3NJ4A 5ER6A 3S2GA 3P2YA 2GN8A 3MJVA 4J2OA 5IF3A 3QVWA 4BKOA 2GZ2A 4YWJA 5DCUA 4CM8B 3PJDA 3Q6IA 1DRVA 3AUUA 5FF9A 3OJFA 4BNUA 4WKGA 4CMHA 4ND2A 1QLHA 4G5HA 1N5DA 3OMLA 3DBHA 1NQTA 4WEQA 3AW9A 3Q2KA 3VPHA 2DBRA 1MUUA 4RQTA 3ONFA 4RV9A 2EEZA 3JQ9C 4J6FA 3SBOA 2GO1A 1MP0A 1KEUA 4R16A 3TZQA 1I5RA 3DXFA 2IEDA 3ZU2A 3WB9A 4YR9A 4CQMA 5TNXA 1K2WA 2EV9A 2Y1OA 2B69A 1U3UA 4BNVA 3BMOB 2ZYAA 3DBLB 1Y9EA 2NVUB 5U4QA 2OFPA 1XU7A 3B1FA 1BWSA 4CR7A 3DMTC 2YUTA 3BIOA 3V8BA 1Z45A 1LLCA 1Z82A 4ZN6A 5AYVA 4UAGA 4I5EA 4MVJE 1BVRA 1DIAA 1UP6A 2VWHA 2ZK7A 2PNFA 1RM3A 2PR2A 1SB9A 3JYPA 2EKPA 2JCVA 1U1IA 1DFGA 4XYBA 2X5OA 1QYCA 1YL5A 2NQTA 3NYWA 3OSUA 4ITUA 2E82A 4YEDA 2PTGA 5T67A 3IP1A 5JCJD 2H9IA 4Q3BA 3RBZA 4NFSA 1C1XA 1NFRA 5EPOA 4NI5A 3QVTA 4W9NA 5KJFA 3QWHA 1WLYA 4CUZA 2FZWA 2CZCA 2GDZA 1F06A 1HRDA 1B8PA 1B16A 4XCVA 4Y6PA 1WP4A 2RAFA 4TROA 2QRLA 5A1TA 4PLYA 1XEAA 3WG9A 1O9BA 1Y9AA 3ST7A 4BNKA 4FQ8A 4BKRA 2X23A 2AQKA 1D8AA 2VHZA 1SAYA 3O8QB 3RKUA 3RJ5A 3RBVA 3I4CA 3EK2A 4UVHA 3ETEA 1NPTO 2OO5A 4CODB 3C7CB 1U8FO 3ZV6A 2OZPA 4CM9A 5HRUA 1E7YA 3JCZA 1O0SA 3PWZA 3B20A 4BUCA 3DC2A 2EKLA 1N92A 2A9FA 2POQX 2VHWA 4CM4A 1B3RA 3WJAA 3EHEA 4PFJA 1HKUA 5KVSA 1DRUA 1OI7A 5G0VA 2EWMA 1E7MA 3HSKA 1I2ZA 1O95A 5JC8A 1YOVA 2SCUA 3JD3A 4HFNA 1LBEA 4K28A 4WNIA 2QX7A 4DXHA 1R12A 3WQSB 3WNQA 5KVCA 2O48X 1ISMA 3GR6A 4OH1A 4AJ1A 4YJFA 1CETA 3OJEA 4MP3A 4Q3CA 3ZHXA 2HMVA 2YQ5A 5JO9A 4DMMA 4PLGA 1MFZA 4ROSA 1GU7A 1H2BA 3W4JA 3KYDB 1L7DA 2NUAA 3WGYA 1UXKA 5BNIA 5IFLA 1TB4A 5T8KC 3EY4A 3RFXA 4R01A 3VDQA 4TVOA 1Y8QA 2VUTA 3NAQA 3AFNA 3U4HA 4FR5A 1KIFA 4KQXA 4OJNA 4GAEA 1BXZA 1KVUA 2GPTA 2Q1UA 2FN7A 5KCZA 1RM0A 4UUNA 4PLTA 5IDYA 1XCBA 4KTVE 2NQ8A 4CMEC 4IDEA 1GTMA 1EDOA 4R5HA 2VYVD 1NHGA 1DHRA 4CQLA 4HNHA 2BFMA 1DIHA 3FNFA 4BNHA 4HY3A 1VPDA 3ENKA 1H0KA 4N5LA 3INTA 3PHLA 5TJ9A 4R5MA 1NAHA 2V7PA 4O5OA 2Y66A 1ZEMA 2NNLD 3PHGA 5FWNA 1ZIDA 5EN4A 3ASUA 3KTDA 4PVDA 5TF4A 4IPTA 3UICA 4EYEA 1Z7BA 4D42A 1YQXA 1X13A 3F6YA 3BTSA 1MG5A 3WGGA 3ON5A 3ZNQA 4DBZA 1DB3A 4OGWA 4JBIA 1SO8A 1R37A 3MZ0A 4TZKA 1VJ1A 1DHTA 1I3LA 1X7GA 2QRKA 1WZIA 4WOJA 2ZKLA 2I76A 4MIYA 1HLDA 1I32A 1LRJA 4ZVVA 3TFQA 4MO2A 3ZGYA 4ALMA 1LXCA 1GEEA 4RF2A 3E9MA 5A5FA 3H5AA 4DPKA 3OA2A 4MP6A 1DIRA 3ORFA 4OQZA 4BNIA 1HZZA 3MEQA 2QG4A 4CL8A 4FGWA 1B14A 2Z5LA 2D59A 1U3VA 3RUIA 2NTJA 4XQEA 4B4VA 3ZN2A 1D1TA 3WIEA 3SEFA 5F21A 3KUXA 1PR3A 3IQDB 1HDOA 1TA4A 3A06A 3EZLA 5DBFA 4CUKA 4DREA 1ENPA 1K5HA 2OBNA 4Y9DA 3P19A 3M2PA 4LVCA 3I83A 4Y6RA 1GQ2A 3WR5A 4W7IA 2PLAA 2D1YA 1N9GA 4B8ZA 2Q2QA 3H9EO 2GSDA 1C0KA 4R1TA 1AE1A 1GYPA 3SLKA 5JE8A 4NBRA 3JQCA 3TZ6A 4OM8A 3Q9NA 1JAYA 4IQ0A 1A71A 3V2HA 5DF1A 4J1TA 2W90A 2WD8A 4GGOA 1U5CA 3RSHA 4YPOA 4Z3DA 4ALKA 4EW6A 1IHXA 3DL2A 5G0TA 3DAPA 1HYEA 2HRZA 3H65A 3TWOA 1QYDA 4AJJA 5JW6A 1LA2A 1UXIA 4HFJA 3KOUA 1I33A 1VJTA 4EUEA 3HUDA 3WGHA 4CUJA 4PN3A 3PIDA 4Z0PA 3UW3A 4EJMA 3UN1A 5JDIA 4Q39A 1IE3A 1Y5MA 3B1KA 3QP9A 4DWVA 1T24A 3DAGA 3JYLA 1NYTA 4FOOA 4BO4A 1P9LA 2FOIA 4WOKA 4YTEA 1DOHA 4TRJA 3TNLA 3H9UA 3GRPA 2BH9A 3ADOA 3TPCA 3WQQA 2XXBA 2ZIZA 1DC6A 2HJSA 3EW7A 2DM6A 4LVUA 3BXXA 4J1QA 3ZV4A 3LDHA 4IS2A 5JBIA 1BMDA 4PG5A 2X0JA 3GVHA 4XYGA 2HK9A 2C7GA 1ONOA 2B0JA 5IDXA 2Q2VA 1XHLA 3DZHA 4EGFA 1I2CA 4BGUA 2BRUA 5K0ZA 3WQRA 2AXQA 4KDEA 3HB4X 2AE1A 3QE3A 4GWKA 4A26A 3H5RA 5L53A 2Y67A 1ZH8A 3MTJA 4GLOA 4RVHA 1BDMA 1W73A 2Y1CA 4BO3A 2CNBA 4GPD1 4OL9A 4D79A 3H8VA 1L1FA 4P4GA 1KC1A 4Z9XA 4A03A 2YFHA 2NU6A 2Q49A 1IPFA 1UP7A 2VRCD 2ZB4A 4GKBA 3WYCA 1UZLA 1KOLA 2C29D 3OETA 4WLNA 3BMQA 4L0QA 2A92A 3WBBA 1BW9A 2BMAA 1R4MB 1HYGA 1IY8A 2A4KA 1P31A 4WLFA 2CVQA 3JQEA 3BZUA 4B7UA 3WICA 2G5CA 5BR7A 2CDBA 2DPHA 2OBYA 1JWAB 1UXJA 5IZCC 1DFHA 2H1SA 2ZTVA 2AEJA 5L9AA 5EL0A 3VPGA 2R2GA 3HG7A 4JNKA 1WVGA 1D1SA 4FFPA 5JDCA 2JHFA 4GH5A 3KEOA 3GG2A 1U7TA 4HP8A 4A73A 2VHVA 4J16A 2HMTA 3M1AA 1HYHA 3NT2A 1YQGA 3TJRA 1PZHA 1MLDA 3WGZA 2QYSA 2DFDA 4QT0A 2F00A 1YBMA 2DTDA 2FPIA 3H2ZA 3BYZA 3VH1A 4B8WA 1ARZA 4O59O 3CUKA 4NR0A 2ZJ1A 1H6BA 3RBXA 1PX0A 4AJ2A 4C7JA 4WLUA 4WJZA 2QRJA 1F8FA 3BMCA 4FN4A 2B5WA 4K1LA 2EGHA 1NFQA 3OIGA 1K6JA 5K6AC 4CLOB 3QLJA 3JQAB 4MVJG 1LRLA 3JD2A 1LU9A 3SXPA 5A9SA 5C37A 2B5VA 5C7IO 3WLEA 3DBVO 5A9TA 1DJNA 3ANNA 5TIIA 1ORRA 3OECA 4JJFA 2QZ9A 4QFCA 4TZTA 2WJPA 3MOIA 3O03A 1V9LA 2X8LA 4YDRA 3RKRA 3FR8A 5BSHA 3Q2IA 1KY5A 4IMRA 1PS0A 3E82A 1VSUA 4GSLA 4XRGA 4D43A 3DMYA 1E3SA 4CMAA 2WYVA 4IDAA 3RAJA 4E2ZA 3JQAD 3MJCA 1MA0A 4ZU3A 2UVDA 3F5QA 2B4RO 1VLLA 2H63A 4YJGA 2ILTA 1R15A 1T2CA 1U28A 4XYLA 1HDRA 3OIDA 2R00C 2WD7B 2DT5A 1EUCA 1PU2A 5KIAA 2PZKA 3GZNA 1P0FA 4JIGA 3I52A 4FSHA 5DBIA 4ZQEA 3TN7A 4ZHSA 4C7KA 5A05A 3AY6A 1GYRA 1WMAA 1PL7A 3HDQA 2AQ8A 1BXGB 4F46A 1DXYA 3ASVA 4NMHA 1KC3A 5F3RA 4D41A 2QZZA 2PKRA 3WMWA 2IXAA 1VRWA 1KVQA 1Q0QA 2PZLA 3I4FA 4FC7A 3TZKA 1R6DA 1WAMA 2IRWA 3PGJA 4HX5A 4QTZA 2WEKA 3U0BA 4H16A 4ZJUA 4BNLA 1YGYA 3JD4A 1E5LA 3CEAA 2Y1DA 1AHHA 4BO1A 7MDHA 1DAPA 1NQAO 3DB2A 4ZQGA 1T4BA 1QYWA 1ZW1A 2RHRA 3GNSA 1FJHA 3OJ0A 3LU1A 5T5QA 5DP2A 2YW9A 1ID1A 4BO9A 1ZZEA 4IQGA 2JCYA 2JKVA 3H6KA 3LYLA 4PG7A 1Q0HA 1I01A 3UAGA 3ROMA 2RH8A 1ADGA 5JXWA 3L9WA 1ZXLA 4O1MA 5DZSA 3IKVA 4HFRA 1B15A 1J6UA 3ZW8A 3UF0A 1ZEJA 2JD2A 5B37A 4Q3EA 8ADHA 3R3JA 2W2LA 5COAA 1CIVA 4CJXA 3PIIA 1GPDG 2C5AA 2UUPA 4IQ8A 1EZ4A 4CMKA 4MIEA 4BVAA 4CM5A 2JD1A 4Z3KA 2GN9A 4LCEA 5ICSA 3UVEA 4P22A 4J7UA 2V6GA 2FR0A 4PLWA 2P68A 4JJGA 5GZ6A 3ZNPA 3VH4A 4BNYA 4M87A 2PH5A 4W99A 4JXKA 4PIVA 1JKJA 5F5NA 4A0SA 5JMWA 3WGIA 5A5EA 2CVZA 4D0SA 4GVXA 4W4TA 4J4HA 2P91A 4EEXA 5EERA 4I5GA 4XJTA 4TMFA 1LLQA 4CMJA 3K96A 4WCFA 3GGPA 3WS7A 4BMVA 5I9MA 3PGXA 4PLHA 3K8ZA 2OGUA 1QYVA 4S1VA 1W0CA 3F5SA 1KEPA 1JKIA 1PWZA 4XQ9A 1GEGA 2C07A 3I6QA 4NPCA 3OQ1A 3HN2A 3QW2A 3RFTA 4GSKA 2P5UA 5CHEA 3KXDA 4FFNA 3CMMA 2FSVA 1T4DA 1AGNA 3GOHA 5FI3A 5HS6A 1P1IA 3U4DA 4RDHA 2VCYA 1M2WA 1YJ8A 1ZK0A 4FFOA 2ZB8A 3FNHA 5CFZA 5I7SA 4R4JA 5EQDA 3GVCA 3F4LA 3PK0A 1QRRA 3B6ZA 3O4RA 6ADHA 1HT0A 3I9MA 3KO8A 4A5OA 2ZTLA 1IYZA 2OL4A 1G0NA 4KDFA 4TVBA 2P9CA 3KYCA 3VHRA 2FHSA 3HHPA 3GGGA 1ZVMA 1C1DB 2R6JA 1E3EA 4ZRMA 3DONA 2J5KA 1WDMA 1EQUA 1O89A 2B37A 1DEHA 1CRWG 1GCUA 1KS9A 1PJTA 2O3UA 3C7DB 3E9QA 4HUJA 4LRSB 5DOVA 3V2UA 1ZK3A 3JQ7A 4UUPA 4BNFA 1Q2XA 4CR6A 5H81A 5TT1A 3D4PA 1B7GO 2VWGA 1UDCA 4P38A 4BQPA 3OBBA 5L7WA 1S7CA 3LF1A 5JO0A 5L95A 4BO6A 2W2KA 4IDGA 3WFIA 4XJSA 1ULSA 3DFUA 3A9WA 4MIOA 5TJHA 1K3TA 4RPLA 5AXCA 1B26A 1D4FA 3FHLA 1UAGA 4JX8A 2HK8A 4AJNA 2J3IA 1VC2A 1WXDA 2GZ1A 1ZJZA 1PSDA 4JQCA 1LLDA 1A9YA 4M55A 5IDQA 3GN2A 1YDWA 1PR9A 4OKIA 2E6UX 4AJEA 4WASA 2PGLA 5G4KB 5TSDA 1KEWA 2CMDA 4PRLA 5TGDA 1P74A 2DLDA 4IIUA 1YBAA 4W6ZA 1ENOA 5JAIA 3GNTA 1PS9A 3PWSA 2VHYA 3VPXA 2EERA 5DBGA 5BNFA 2FP4A 2Y68A 1N7GA 3KEQA 2D2IA 1AXEA 1GL3A 3K73O 5JPIA 3GN1A 1I3MA 2VYNA 3KRTA 3W6ZA 3E18A 4KMSA 4IY1A 3S1LA 1NM5A 5IDWA 1B0AA 2X7HA 2ZCUA 3DZIA 1EE9A 3QA9A 2WWRA 3RJ9A 5COQA 3L07A 4UEJA 1E1KA 1XKQA 3R6DA 4R41A 4WGGA 2RBEA 2UUOA 4BB6A 1H6DA 5TRTA 5CDYA 4L75A 2DTEA 3VKUA 1U4OA 3PYLA 3ETDA 3PEFA 4NFYA 3C7AA 1YKFA 1T25A 1M6HA 4FFMA 3IDSA 4GX1A 4JJIA 4MKRA 5EINA 4D45A 3ZV3A 1Q7GA 2VQ3A 1NPDA 1RM4A 2X1HA 5C7LO 3I9OA 3BTUA 1E77A 4YACA 5IJZA 3GEGA 3I23A 2ZATA 1TT5A 2W98A 4ID9A 4OQYA 4XYMA 4YVFA 4DC0A 1TI7A 4UVGA 3KLMX 1RWBA 3KVOA 4YAKA 5JSFA 3SJUA 5CDGA 3ANMA 4FD3A 1TVEA 4J9UE 3SC4A 1L7EA 3H7AA 3WNVA 3NTQA 4ZD6A 1YS4A 4RVDA 1HDYA 3C1OA 4J91A 4YT4A 4LW8A 3QHAA 1RYEA 1QG6A 1YJQA 1O94A 4QO7A 4OAQA 4B3IA 5CDUA 2QIOA 3P7MA 1E6WA 3WTBA 2P9EA 4NBTA 5AVOA 5CEEA 3PQFA 4XQCA 1P44A 3ZV5A 2YHIA 3VZQA 2LDXA 1SPXA 3P2OA 4U6SA 4L4RA 1LDEA 4QUKA 4PLZA 4J1SA 4JN6B 1LQUA 3DR3A 3VTFA 1EEHA 1NHWA 2DFVA 1ISJA 3CIFA 2E48A 2DU8A 5ENVA 3GT0A 4GLLA 4TRRA 4NJMB 5HBRA 4E3ZA 2GZ3A 1ADFA 1WW8A 4QQRA 3GVXA 5JAQA 4AJOA 3I1JA 4NHEA 1R0SA 1RJWA 1IB6A 1XA0A 4IJWA 1I8TA 1ZBQA 7ADHA 1PTJA 3DFZA 3WX0A 1DSSG 1P1KA 1MG0A 2GASA 4I8XA 3GAFA 4XX0A 1LUAA 2NU9A 2X86A 1Y7TA 1P3DA 1X7HA 1HDCA 1ZMTA 4UEKA 4WPGA 2AQHA 4PLFA 4B4OA 1FDSA 3G3EA 2OORA 4BGEA 2YZ7A 1IZ9A 1XGKA 1CQIA 4YQYA 4E5MA 2DBQA 2QQ5A 2PKQO 1ENYA 2Y1EA 2WSBA 3GH3A 2DAPA 4YA6A 1IUKA 1GUFA 3AY3A 1EDZA 4E0BA 1EVZA 2IYPA 3X2FA 4J1NA 4AJHA 3IUSA 3JQBA 4FCCA 2PA3A 2F1KA 4PZCA 2O3TA 1MXFA 1E3LA 4ZICA 3QJ5A 3ZWPA 3LC1O 4WK6A 4WEOA 1PGNA 4BKPA 4HFMA 3ZHYA 2Q4EA 2FSSA 2IZ1A 2DC1A 1ZUD1 4F45A 4MVJH 1XG5A 1Y6JA 3SVTA 2HSDA 3T4EA 4LRTB 3QSGA 1MC5A 5L45A 3JSAA 4AL4A 5TLSA 3GMSA 2O2SA 4DL9A 3NTOA 4R1UA 3RVDA 1D3AA 3DBRA 3VH3A 3KSDO 3R3SA 1AUPA 4BNNA 2P2SA 3FTPA 3LT4A 4Z6KA 3RC2A 3CMCO 3D3WA 3AOEC 1T1SA 2ZB3A 4PRKA 3VVCA 5FFFA 5AOVA 4JBGA 2JFHA 5IN5A 4YJHB 3ZWWA 5B1YA 4CLRB 1F14A 2PFGA 4CLHA 1GZ4A 1Z7EA 4GX2A 3GEMA 3VZPA 3LT0A 3WFJA 2GGSA 1CERA 4PZEA 2C2YA 2G82A 3L6DA 3WLFA 3AU8A 4OYRA 2IZ0A 3SJ7A 1F12A 5DNAA 1UDAA 3TSCA 1H9AA 3WTCA 5AQ1A 3AK4A 5A04A 4XGNA 3BHMA 3OFSA 3AY7A 4GKVA 1NVTA 4XQGA 1QKIA 1QYXA 3MJSA 4JP3A 1X1EA 3PRJA 3RIHA 3JQ8A 4CLEA 1FF9A 1LLUA 1X14A 1UZNA 4BMSA 2VTEA 1UXGA 2VWPA 4IGFA 4HV4A 1X15A 2X9NA 4ND3A 1LEHA 4BO0A 5L51A 3AWDA 3RROA 2CVOA 1IOLA 4DQUA 1BTOA 4J4TA 1V3TA 4II3A 3JQ9A 3SX2A 4PG6A 3RWBA 3GPDG 3A28A 4IZIA 5JAMA 3BTVA 1TLTA 3MWDB 2QYTA 3OQ6A 4Q3DA 3QIVA 3ZWVA 4DLAA 4EZBA 5H83A 2Q46A 3HADA 1KETA 4N54A 4GX0A 5KJCA 1P33A 3ZNNA 1P1HA 1K89A 1SOWA 2O4CA 3JQFA 3RASA 5L7TA 1LI4A 1O6ZA 4G81A 4Y98A 3EAGA 3GF4A 4KZPA 1OOEA 2P5YA 4BGIA 3G1UA 4LK3A 1ZJYA 4CMGA 2PWZA 2V6FA 1MFPA 5A03A 2GD1O 2HDHA 1LJ8A 2CF6A 2YY7A 3DMTA 3WYEA 1LX6A 4YB8A 4YT2A 4MVJI 3JQGA 3QWIA 4RDIA 3UCEA 4DVJA 4BNTA 3UCFA 3BMNB 4XA8A 1E1LA 2AA3A 1F8GA 3EVTA 1B8UA 1RM5A 1Y81A 2XPCA 1KEVA 4O6VA 1WPQA 1YONA 3RUAA 1UZMA 4DUPA 1GQYA 3I9KA 5KKAA 2G76A 1DO8A 1PEDA 5L40A 1ZK4A 3H5NA 4CV2A 8LDHA 1LTHR 4BKUA 2JL1A 3OJOA 1I3KA 1SCUA 1A5ZA 2DQ4A 1VE9A 2C0CA 2UDPA 3QVSA 4CM8A 5F5LA 2YFQA 3AI1A 3H9JA 4L9RA 1YQDA 4E33A 2GUGA 5L3ZA 3H9QA 3L77A 4R9SA 2HKIA 3M2TA 1E3WB 1ENZA 4RCVA 1YB5A 4HKTA 5JCXA 4JGBA 2GN6A 2P4QA 4XEHA 1Y8RB 3NT5A 4XD2A 5L7YA 4LSMA 3FBTA 3OF2A 4FB5A 1T2AA 3V2GA 2HUNA 1WMBA 1G0OA 1SC6A 4C4OA 4NU6A 2Y0EA 3CKYA 1HTBA 4GL4A 1JDJA 1XYGA 4N5NA 3WGTA 4NQZA 5JCJA 3VAZA 3OM9A 4DC1A 3BMOA 2AEFA 3DBLA 1RYDA 3AUTA 1PJSA 2NVUA 3R1IA 2VT3A 1E6UA 4WE3A 4MINA 3GHHA 2Q1WA 3SC6A 1ZSVA 3RU7A 4IXTA 4P8RA 2JFGA 2I3GA 3U4IA 1GPJA 1JW9B 1HSZA 3NTRA 4DIBA 3GA0A 3WJ7A 3WGQA 5A02A 4YAJA 3RUHA 3E1KA 2DUWA 4NDNE 1K6XA 1ZO8A 5TS3A 1HEUA 3IP3A 3ZU4A 4CV3A 3DWFA 1NTOA 1HE3A 2C7VA 3NEPX 3AUSA 4U5QA 3ICCA 3ZHBA 5IZ4A 1G1AA 4QEDA 3VPSA 4E31A 1PS8A 2X0IA 1XSEA 3PWKA 4QXMA 4YAEA 4IXWA 3VZSA 4O0LA 3PHJA 4BNMA 2J3HA 4D7AA 3TOXA 1ADCA 1U9JA 1M67A 3PTZA 1LDYA 1P1RA 1EUZA 5T8KA 3CH6A 3IAHA 1DC3A 1ZNQO 5TC4A 5F1OA 1D7OA 4M86A 4EUHA 2PD4A 3PYXA 1R4NB 5CPFA 3NUGA 1HE4A 3ZWOA 1NR7A 3L0DA 3JD1A 3UHAA 3H3JA 2P9GA 1AHIA 5FI5A 4CMEA 3O8QA 5BT9A 4DYDA 1YRLA 4E5YA 1X0VA 4YRBA 3B1JA 3LT2A 1PJ4A 4RF5A 4WLOA 2WDZA 1JVSA 1YL7A 5I8WA 5CP8A 3H3FA 1GYQA 1E7WA 5T57A 3CE6A 4BO7A 3K6JA 4RVUA 3TDKA 5IAAA 2QHXA 4RL6A 1QSGA 3PPIA 4MP8A 3L4BA 1NXQA 5ILOA 4ONEA 4FJ0A 4RF3A 2QW8A 4OXYA 3WWZA 1TEHA 1BRMA 3DBHB 3I9NA 4BGVA 3PQDA 2ZQYA 3DAFA 3FNEA 2EP5A 3CINA 1SMKA 1FDWA 2AMFA 1YE3A 4NK5A 9LDTA 1PGJA 3D7LA 4MVJM 2I66A 5CPBA 1E1MA 3D4NA 4D3FA 1VKNA 2VNAA 3DOJA 1HF3A 1E0DA 2VYVA 4RPKA 1E3IA 2A35A 2J5QA 3WIDA 1VKOA 2VYND 5J23A 4CQMB 4K6CA 1GUZA 2OP0A 2CDAA 2H6EA 3KYDA 1GDHA 2V6BA 1H6CA 2PD3A 3A14A 2PV7A 3E5MA 4L8VA 2VOJA 3EDMA 1Y1PA 1E92A 1YDEA 4DLBA 5BSEA 4NNJA 1F0YA 2NACA 4XIYA 3RUEA 1CDOA 2OOSA 9LDBA 2UAGA 4J4BA 1BDBA 3ZI0A 4EJ6A 3QWBA 1YB1A 3ZWAA 1N8KA 2HRBA 1QV6A 1ML3A 2PK3A 4EBFA 1UR5A 3V1TC 5C5IA 1PWXA 4DQXA 2NU7A 4QSMA 3MJTA 3TL3A 4CM6A 2Y1FA 4CQMD 2W4QA 3NX4A 1N1EA 1P0CA 3JQ6A 1FXSA 1M75A 1V3UA 3FPCA 4Y67A 3VVBA 1OC4A 1C1XB 1JQBA 3GGOA 1KVTA 2RIRA 3A4VA 1PJ2A 4I9NA 1ONNA 4BS9A 2FMUA 3ITDA 1LSUA 2CUKA 1KYQA 4XZ3A 4YAGA 4KUHA 2TMGA 3O38A 2J8ZA 2TMDA 5B4TA 4E5KA 4DA9A 1N1GA 2EP7A 3ROKA 3D5TA 3EGOA 2EJWA 1J0XO 1IL0A 1P1JA 3BTOA 4AJPA 5THQA 3ZWXA 3NDJA 4BIIA 2E4AA 3ZWCA 2VZ0A 3MTGA 3KB6A 5KJEA 4KP7A 4F6CA 3ZHZA 3WGOA 3U62A 3RUCA 4QECA 2NLOA 1I10A 4KWIA 3ZCXA 4HWKA 3LLVA 3I5MA 1NP3A 2P4HX 1AN9A 3W8EA 4CM4B 2G0TA 3B70A 5L4SA 1UXHA 1KERA 5DT9A 2Y93A 5JYEA 4N18A
chains in the Genus database with same CATH superfamily
1SEPA 1YWGO 4CCSA 2O5RA 5SZJA 1M8KA 2FLWA 5CCBA 2ZZMA 5MGBA 3O84A 4TV9A 1XNRB 2GAAA 2OWEA 4GMXA 4XR4A 4R9RA 2PXXA 2P90A 4BNXA 5HX7A 5LDHA 1RW4A 4E15A 1Q0LA 1TQHA 2QLTA 3DULA 2X0RA 3GYGA 1WCWA 4EK9A 4UQPA 1UMCA 4F9GA 1KZYC 6REQB 1C7QA 2LGJA 4I4TB 3GAAA 4TS1A 1OF1A 1TIBA 5MHTA 4YP5A 4NH4A 1NNSA 4YBZA 4EKIA 4M0KA 3SM9A 1YRQA 1Z3IX 5B4UA 1UBMS 4CG3A 1TVKB 2GLTA 2CE2X 1RQRA 4ZVNA 2V3WA 2XUHA 2NPOA 1MX3A 2FUCA 4O1IA 2G8NA 4BX3A 4PAGA 5IAEA 1MNQA 1X7YB 4D4LA 3W77A 1Z63A 1LB1B 5GONF 1DBPA 1KYZA 4MLPA 4BNJA 2EBFX 2GPAA 1A0OA 1CZKA 1WY5A 4ARZB 2C7RA 2GWRA 3C85A 2PUCA 3STWA 3TKLA 4OHPA 3LNTA 1OAOA 1GPLA 1Q7BA 2AE2A 3MRSA 5LB4A 3Q3CA 4ENQA 4OIMA 3DTTA 2Q1SA 3MBKA 4GECA 2ZAOA 1JTFA 1RHQA 2V1UA 3TB4A 4I4IA 1XOIA 2AX3A 2DH6A 2EWWA 1WNTA 1UKVY 1KAEA 4YRDA 5A3QA 4F11A 3U1VA 3FYUB 3E7WA 3OT1B 3PENA 2DPGA 2GRJA 2R48A 4HNGA 4YMUA 1NSYA 1NJ8A 3IOEA 2BOVA 2DZDA 2OO5C 2Q3FA 2HRQA 2X5JO 2ZIFA 3E5RA 4H18A 4WZBA 3MJEA 4QBIA 4YCLA 2YMQA 3A4YA 4M53A 5F78A 2AMYA 2I1VB 1KEZA 2IV7A 4ZCQA 4PHGA 5IRCD 2IHTA 4BFXA 4WH0A 3EIWA 3OE7D 5EJIA 1K97A 3AYXB 4OKSA 3TZCA 4LZZA 5CB8A 3EARA 4TKVB 1BG6A 2I7VA 3PUKA 1JIVA 1WNFA 4RZHA 2Z6AA 3T38A 3ESRA 4ARAA 5CVCA 1G41A 1SB8A 2IYEA 4AXBA 1XZGA 4PGGA 4O4LB 3DE1X 3EVBA 2VRCA 2H51A 3NWEA 1TCAA 2QPAA 4YASA 4CEHA 1NOKA 4I4NA 3SP1A 2GDJA 2XNDA 3PDIB 2DGDA 3DM9B 1G6KA 1T9CA 1CRLA 1UOPA 1VXOA 2EXXA 2NVBA 3BIFA 4G56A 1QIFA 1XQWA 4KUGA 3RQIA 1VL2A 4EDFA 3ASYA 5BN5B 3LY7A 4ZODA 1TQ6A 4CDMA 2FSFA 2ZP1A 1TQ8A 3UOGA 3AU9A 4XUEA 2WTBA 4R1LA 4MEBA 3S1SA 1WHSA 1WSWA 3UQYS 2EHDA 1C3XA 1J2TA 2O0JA 1GV1A 3DYIA 3DDSA 3L7LA 3C4QA 4WL0A 5C4IA 1UBHS 2FZEA 2CLOB 2YR0A 3JV7A 1NT2A 4GYWA 3DE5X 3L6BA 3PJEA 4Z9FA 3A1FA 3V48A 4ESEA 4INAA 1LNQA 3WLJA 3ZVMA 4AY6A 2F8MA 4FBGA 3OEHA 3QGMA 1JV2B 1EIZA 4K9DA 4RFVA 2SKCA 5J63A 4JP8A 3PF9A 5DT2A 2PL9A 1YMQA 3KETA 3HMQA 1Z29A 3F6BX 4MVJA 4AVYA 1L8QA 1VBMA 1ZLXA 2P2CA 4HN4B 5IT4A 3NRJA 1N1DA 2XE7A 1YIOA 3CZMA 3ZV7A 5DCYA 1R4MA 1FP6A 1Z8FA 5ECYA 4YRTA 2VJDA 2KX7A 3UHFA 1TQ4A 1XJ0A 2A0KA 4Q3NA 1V1MB 1UCFA 3HKEB 4C20A 1FDOA 5EP2A 3WJ2A 1NJ1A 2X4LA 3UOWA 4JLBA 2ZAIA 2Z3ZA 3E70C 3OU2A 1OAKA 4OU4A 3I4LA 3ZDRA 4PSDA 5BYAA 3MHPA 1U3WA 5GGXA 4C21A 1TA9A 5BPHA 5IXSA 5LWQA 1EMDA 1EXDA 4ZI7B 1JR3E 4JC5A 2QZPA 4HF7A 2J48A 3FMVA 4FNAA 4GX5A 3JWEA 3N2IA 4L2IA 3LIIA 4QYIA 3HYRA 3EBPA 3B52X 4X7BA 1WB4A 1A9ZA 2IYXA 2FB9A 2P9QA 2J7PA 3L1KA 3UUFA 3IE1A 4MR8B 1CE8B 2JH8A 4C2UA 1TUIA 4P5DA 1JIUA 4O2RA 4O2BF 2IYAA 5CEJA 5ENDA 3BPSA 1D04A 4JI2B 3CX3A 1NBHA 2FW1A 1XO1A 4A2CA 1QONA 1ONPA 4EKNB 3MXTA 3TH5A 3GRCA 5DHPA 4AP6A 2C3YA 3OJLA 3PPXA 1ZS9A 4RC9A 1B23P 5AI8A 3HBAA 4CE6A 2R1UA 3NDRA 2OK7A 2Z58A 1QOPB 1T8SA 3P9ZA 4U9HS 1NW4A 2HTEA 1ESNA 4X3CA 2R47A 3VOSA 1GGFA 3LXXA 3K0CC 2W8ZA 4JWKA 2XDQA 3GPCA 3H4MA 5I5GA 8ADHA 3QJGA 5EWMA 4RF4A 2C5EA 3A3KA 3NO4A 1PQPA 3NHRA 1OWLA 5I8ZA 5JYDA 3ZZ0A 3LVFO 5FBZA 5EC8A 1C1HA 2XUKA 3PV0A 4L0DA 5BQ5A 1ZN2A 2AOVA 4PAOA 2PBRA 2XB6A 4BXOA 2ZSEA 4MS1A 1W19A 3AUXA 1VIVA 3ZDEA 4AJ4A 5JY6A 2AHRA 1E3JA 1VG9B 2H1VA 4MW1A 1JFVA 4L1KA 3BD6A 2V98A 4QFDA 4IF4A 4ROTA 1N6KA 1OIVA 1OJLA 2LR0A 3TIFA 1FZTA 4IF6A 4MVJP 5C1DA 1C4KA 1CXZA 2H2AA 2X42A 1B8NA 2XGSA 1V48A 1P18A 4GMFA 2EW8A 1F2UB 4RTLA 3EZ6A 2QD4A 2HWXA 4WFQA 3GC6A 4IHJF 1KZ4A 1ZONA 3VYVA 4O4JB 5FWXA 1VHQA 4KOAA 4KPUB 4NHOA 3TZHA 4E32A 2WFLB 3VJMA 4PVCA 2XOXA 5BORA 2WJWA 4N3AA 3RC9A 2FZ4A 2BONA 3CN7A 3WSWA 3DLPX 1LLFA 2ZRHA 3WGUA 5J2UF 1SPBS 3U3ZA 1O1YA 2JI6A 1PJRA 3VA7A 1N0WA 2OESA 1J0AA 4GI3A 4JR1A 4LYJA 5K45A 1ZCJA 3B8HA 4YCAA 1KAGA 2NU6B 4IIXA 4BNWA 2C1ZA 4F3YA 4F3KA 2W70A 3FDXA 3KHUA 5ICMA 4JQZA 2WD7A 4MRMA 2G7MC 2IYWA 5KNBA 1KMIY 2GPYA 4MTLA 1SCBA 4U0KA 3O73A 3L8DA 2HBYA 3PQ5A 3D43A 1BSVA 3EF1A 4IG4A 2Q5CA 3WLOA 1N1MA 5CYFA 1BVYF 2GVNA 1TJ4A 2B99A 4YY3B 1IXSB 4RTQA 2JD0A 2K4MA 2FUG6 3JAKA 3S1AA 1KK0A 4H1HA 3TO5A 4BLRA 7ABPA 3HJNA 2H4XA 1ZGBA 2P6NA 4EF5A 5AI6A 1A9PA 4GYYA 3SHOA 3D6TB 5H9WA 1ZD2P 4BJ1A 4FGKA 3IUMA 1HE2A 1L5KA 4AUKA 3FRHA 2DXIA 1UT8A 1K75A 2AG5A 3FTDA 4MH0R 3ZWMA 2IIBA 3KHTA 2J0EA 3AUAA 3PUJA 4BLSA 3EODA 1RAGA 3EAFA 3K9NA 5BMVF 2PKWA 5BYJA 5CXQA 3M1IA 4ZRNA 1SUDA 3GVIA 3IO5A 3N87A 3F71A 4IRMA 2ATVA 3F3SA 1CLEA 1NXTA 1T1JA 1X87A 2ODWA 4KQIA 4YUVA 5LMUB 4EHHA 1QHSA 1AO3A 3SHFA 2MSWA 3N5KA 5CVJA 3WOHA 1K27A 4L78A 2EBWA 2AR9A 1G6Q1 1M2KA 1Q0PA 5GVRA 4I19A 1YVEI 2FPIB 4G0ZA 4D3ZA 2GMWA 3HUTA 3S81A 3NU1A 2X6RA 1RC0A 2QQFA 2YHAA 4ZI3A 4FZJA 2I7XA 3CLHA 1PQUA 4J0EA 1RZUA 1Z73A 4K9LA 2XV1A 5CNJA 4EPYA 2HMYB 2QVLA 1K6IA 3U61B 3GP3A 4BJ6A 2F62A 2H8KA 4GICA 1NW5A 3QEBZ 1KYIA 4LUCA 3DA8A 1B3BA 5U9CA 4MQLA 1VFNA 2WVJA 3G9QA 3IH5A 5EMKA 1CU1A 3D4IA 2HIAA 3VH2A 3VXKA 3EUAA 3TIVA 3GCGA 2GR9A 2WSSA 1THMA 3M9XA 2BR5A 3LYHA 3U6BA 5IXYA 5LQRA 4RADA 1M1YB 3AHFA 2IOHA 4R0MA 2QY9A 4AICA 4XJXA 5J5VA 4YV0A 1W0KD 3UMYA 2WI8A 5B3KA 2ZEJA 1JDZA 3N0WA 1IBSA 3C8UA 4HDNB 1FFHA 1NI5A 1UPCA 2O1EA 4P7FA 3CW8X 4KVGA 4Q1BA 4RWZA 1NBOA 2V59A 3N7TA 5HQTA 1SCIA 2IGBA 2BCGY 3MT7A 3PCRB 1AA6A 1EGHA 1SZPA 4XIJA 5A4KA 5BSGA 4N5DA 3BHJA 3WKDA 3OF5A 5ADHA 2VA8A 3NBYC 4ID3A 2CC2A 3R09A 1PEAA 2ZSBA 4M38A 1PZEA 5JS6A 10MHA 3WDLA 3F78A 1KZ6A 2Y05A 5CTJA 4J0KA 5HZMA 2CBZA 4XVRA 2C2KA 2QN8A 3TR5A 4C01A 1B8VA 2Z8XA 3E8XA 1NWHA 2O0MA 1K68A 1HWYA 4J2HA 4LBYA 5J40A 3ZEAA 3ZTYA 1NW8A 1H2WA 1R0LA 2AEEA 3LWBA 1A72A 1K7CA 3P32A 5L3RA 3PEYA 4MB6A 4WY2A 2DBVO 4HYQA 1KO4A 1Q16A 2JI9A 4E08A 2DRIA 2I3AA 3GZNB 3O26A 4OMUA 1RIFA 3NYRA 3SQMA 4YYZA 1I4OA 1ZGAA 4R1SA 4BO8A 5J47A 4H7PA 2ZU0C 3Q0TA 1KVSA 1PD1A 1VI6A 3H17A 5JG7A 2C9ZA 1DXQA 3HL4A 2C3PA 3L5KA 4NZ9A 1CZUA 4N9WA 2IEAA 3QVVA 1R5JA 4P84A 5IG2A 1EXMA 5KINB 5ITWA 1KZGB 1M2OB 1XNJA 1CUHA 2FQXA 2ZIGA 4OEHA 3WK7A 3RAPR 4DW8A 4KPEC 2PZAA 1G9TA 4K3UA 4RD2A 3UJ8A 3IMKA 2ATCA 4DLLA 4UVIA 3NZEA 3WMFA 4DLTA 1WU7A 2HQSA 5JQGB 1U3GA 2Q5HA 5JRJA 5GJCA 3OQBA 5CA1B 6ABPA 5K1ZA 2FSGA 3LHIA 4YUWA 1VE3A 5KBYA 3R3VA 3CLSD 3ZE0B 1JNXX 2W2QA 3CXUA 1E7RA 5IDVA 4JC4A 2XCUA 3JPWA 1UKZA 1OV6A 1QNFA 4R3WA 5FRDA 4PLPA 1P7VA 2PVCA 4B48A 4C06A 5LMNB 5DTEA 4HBGA 4YJDA 2Z95A 2B0CA 1Q2UA 1D6MA 1W47A 1WMDA 3K1ZA 2POCA 1EX9A 4MV7A 4QNRA 4DJ5X 1P6UA 1LSJA 1L7XA 1TM4E 3N5CA 4ZCIA 2FEKA 2YASA 3Q11A 1WUIS 2JG3A 5GQSA 3LPMA 1A27A 4MWEA 4BNGA 3LK6A 4B7ZA 5D5PA 4TT3A 4YRKA 4MDYA 2WC1A 4Z9YA 1DT5A 2ZSUA 4FJ1A 2PTHA 4NJEB 2IIPA 4R69A 1JHZA 1BEUB 2XNSA 4GOKA 3CLSC 4WADA 3ZU5A 4XVCA 1RMYA 2GESA 2B34A 1Y4AE 4PSVA 5B1DA 4X66B 2JVJA 4G0NA 4N41A 2JLCA 5KNLA 1TOAA 1E2PA 3PDHA 2X2EA 1BGWA 4FZ5A 1O03A 3AG6A 2BDUA 4EW3A 2IUSA 3GROA 1IJEA 1DO0A 1JKJB 3KUKA 3MFQA 4X90A 2CFTA 2ZWOA 3FPHA 3CZQA 3QTBA 1XZHA 3AG5A 1PJZA 1SXJD 3GLSA 2FGKA 5TPZA 4XRRA 1NXXA 1U0FA 4RL4A 1E20A 4WCFB 5AW5A 1EBUA 2IOYA 2H1CA 3RD5A 2ZOSA 1E8NA 3GQVA 3W79A 3UAWA 5KZMB 2IC5A 5TF0A 3VR4H 2I1LA 1DOAA 4WLVA 5DM4A 3X1DA 3G5LA 1Z18A 3LSYA 4M54A 2QNIA 2Z1MA 2QYOA 3JQDA 3UUWA 3P2EA 5FOSA 1ZC4A 3GRKA 4RVSA 4ER3A 2ZTMA 5EJ8A 4JXXA 1DZIA 1T2EA 4NVRA 3U7QA 1JN0A 4C05A 4OOEA 3WISA 3GARA 2GEBA 3VJKA 1Z0AA 2YICA 2HM7A 1CYDA 3WC4A 4P4SB 2P2LA 5AXAA 1YO6A 2HLPA 3MS7A 3QU4A 2N42A 3OVMA 5EZ5A 2PL1A 5JZOA 1MB0A 3VPFA 4UMFA 1TJ3A 3SMVA 1N6OA 3CURA 4YJ3B 1Z5OA 5JY1A 4DLWA 2IYZA 3C5WP 3G85A 4LAFA 1NVVR 1SXJC 4PY2A 1C3VA 1IM8A 2WKQA 1GPAA 4TTTS 4JU9A 2YRWA 4BFVA 4BKQA 1I6MA 1V8BA 4RGBA 2KSQA 2VAVA 4GVLA 5DLDA 4D92A 3PX7A 1E2BA 1J4AA 2NADA 1K0UA 3FMFA 4YRFA 4N8SA 5I9BA 4OXNA 3TTYA 3ZW9A 1J2YA 5DULA 3DL4A 5BVHA 2WJ6A 3N0XA 1JI0A 3LF2A 1S7GA 1PIWA 1PL6A 1M10A 1IJFA 3JR3A 3KIPA 3KUUA 4K9NA 2NV6A 4RIFA 1CUAA 4UHKA 2W2NA 1MW9X 3M70A 2QOEA 3NEJA 4UD2A 2OD9A 4OFBA 1IHOA 4FXPA 6Q21A 4HH0A 2C5SA 4IDPA 3O5AA 3I3SR 4IMPA 4U9UA 4B3FX 1A7AA 1EDDA 1Y4ZA 4WCDA 2Q4TA 3CLRC 4G25A 5FNVA 3T9FA 2A5DA 3E2PA 3JASB 1JF8A 4OHUA 4WKCA 4CZ2A 4F4DA 3OZVA 1FDUA 4GBJA 2WE8A 3BF8A 3S55A 1O77A 4JLPA 1SCDA 3I2KA 1DC4A 1EK2A 1T2FA 4DHEA 1JPUA 1W85B 5AUPB 1E5XA 3DTVD 3R8XA 2ZYDA 1NZFA 2CLFB 1KO8A 3H99A 2R84A 1MQAA 3QMWA 2OPHA 3MOGA 3KQKA 1MB9A 2PBFA 4MDEA 4C7OB 1T3LA 8OHMA 3H8JA 3NRCA 2EP8A 3QLVA 4LJYA 1X1DA 4LXIA 5JXJA 5DWQA 4RTOA 3BCUA 4HLQB 1MIHA 1OXSC 4UU0A 5EZYF 3SFVA 4C03A 5K99A 4Y2XA 2HUPA 3Q9LA 2ZANA 4BVEA 3GOQA 2HJGA 5F51A 5IYZB 1TFUA 4N12A 3SR0A 2DVMA 4M8NE 3A0RB 2FP4B 2WHPB 1W49A 3DZKA 4KAXA 3HXKA 4YJ2B 4PC6A 3UYKA 4MV3A 2GFQA 3K8QA 1G7TA 3UFBA 1PFWA 4JI1B 1S6YA 1FMLA 4GPBA 2B6NA 5CX1B 4Z0TA 1XN1A 5DBHX 1G8HA 3IOYA 2DBZA 2FR1A 1XJQA 3EQZA 4A27A 4ETIA 2QX8A 4DDTA 3E27A 4FYYA 3ZHTA 4YMLA 3AOEA 3D8TA 1EZ1A 3BS4A 1UBNA 2ZVJA 1QHEA 4MYRA 1OX4B 4ARUA 1LSOA 2DY0A 3KJEA 1N32B 3SG0A 3GUHA 3RYIA 5DNUA 4AZVA 1GCIA 4FILA 5K0EA 5DM1A 3L8ZA 4NLLA 5T6BA 1THTA 3LC0A 4I9UA 3N6VA 1I1QB 4MWCA 3QQ5A 4U2FA 3ZDYB 3AINA 2CEAA 1BXRA 1U7HA 5HKAA 4EJ2A 4FP9A 1HYQA 2PAFA 3P0RA 5KKCA 1YTUA 2JKYA 2YWCA 2P3LA 2RGBA 4X20B 3Q5DA 3SHTA 4IDDA 1OZHA 4RBNA 1TK3A 1A5SB 5AVTA 5KNDD 3NV9A 1FVXA 2Z4TA 1HH4A 2IA5A 3N28A 4ZMSA 2WG0A 3MLBA 5B30A 2R0QC 3FY4A 2Y0CA 4HVTA 1II9A 2X22A 3FYHA 3NGMA 4ZCPA 5GZ1A 2PT7A 5ES3A 4R1NA 3LIPA 3MWEB 4RJTA 3W2IA 3I1IA 4RGVA 2GYYA 1RBMA 2Y1GA 4OLHA 1N75A 3O8OA 5F5XA 4DB2A 4PG8A 3PX3A 1U9IC 3OPYB 3K35A 4YQEA 3IMEA 3ZZ1A 1GZHB 1TF7A 2O8NA 3KVRA 3REGA 3O3NB 1GUBA 4UEOA 3AEKB 1Y7PA 2W43A 1MB4A 1W4RA 2NNWB 1VE6A 1GA4A 5KX5F 1NU6A 1M2FA 2ZYHA 3DOOA 4LNAA 3C6XA 1ISGA 1R9MA 1KH2A 1YMUA 4XUDA 5BQPA 1WWKA 1T4CB 5T41A 1UZUA 1GZVA 5F1PA 2LTAA 1DUIA 1PZMA 4X3PA 5GPBA 1B2LA 1YBVA 4CBVA 1PNOA 1AXGA 1QGZA 2ZJ5A 1I6WA 2D3TA 3AX6A 3T15A 3X1JA 1UQUA 3HR8A 2DG2A 1FNMA 3KHKA 1O9GA 2IQ5A 4MUYA 3WO1A 4LX8A 2X9VA 4K6GA 1DINA 2YHIB 3SVZA 1ID8A 4XTRA 3BXHA 4X44A 2VDKB 2BE9A 2I6GA 3M4JA 4UPVA 5K2MA 3KOZA 2E5FA 4G5OA 1UL1X 3WXBA 1DJMA 2CMHA 1N4DA 2B78A 5I7OA 1WXGA 3JX9A 1GCOA 2OBFA 2QQ0A 1MOPA 3O6VA 2CNDA 1RRFA 1DOZA 3KKMA 3SZMA 5U1PA 4C6TB 1BN6A 2J3JA 4QT4A 5H82A 4MEAA 4F4FA 4B2LA 4KPGA 3EUEA 4HEA1 5T4HA 2HY7A 5TX7A 3U9SA 2VDWB 5JAUA 3RC1A 1KS2A 1ILEA 4ZGWA 5ERXA 2J59A 1Z8DA 2PS3A 3HV0A 1Z74A 3AILA 3LGXA 1FSGA 1E2KA 1SBTA 3E9NA 4TV8B 4V0NA 5BSMA 1K2VN 3L2OB 4RPGA 1R66A 3H86A 1CJVC 4LI0A 2FSUA 4D81A 5TQVA 1MZPA 4BRZA 3RT1A 1VJ5A 2PBZA 3KOOA 3NBKA 4F85A 4CIDA 5EMLA 2IXTA 4DZRA 2P0EA 2V6MA 2J3EA 2YYSA 1MC4A 4U7HA 1CQIB 4HLDA 1OLOA 1E4VA 4AZ0B 4MDHA 1LKZA 5GM2A 1UBJS 4Y2YA 3AEQB 1T6BY 4L22A 2Q0XA 1KFJB 1LFAA 3GNQA 1NG9A 2CZGA 4Q4AB 4JBHA 1ZD1A 3WNCA 4GE0A 3OI7A 3WHLA 2YZGA 4UVDA 2VBFA 1VLQA 3S28A 2QTMA 3CA8A 1D5WA 1IRIA 4BV9A 3JQPA 2O50A 3CVVA 1G17A 4KXFB 5H1YA 1HPLA 1S3GA 2QGFA 3FGOA 1QGUB 2D2EA 5DX8A 4GC9A 1G4AE 4HEJA 4FFWA 4ZC8A 3HJTA 2PWPA 4XWAA 1XELA 4LSWA 5I6DA 1F6BA 2XA1A 3IRVA 3UPDA 4YAIA 4PONA 1M33A 4MJ7A 2R62A 3SF8A 3OE5A 1VOTA 3PHBE 3PLNA 4IJKA 3JTMA 3OZGA 2V8OA 3OHSX 3L9XA 3MYYA 4KLCA 4LZLA 1E89A 2FG7C 3C1UA 2CV0A 4TZ6A 1NF9A 2NMVA 2EFCB 3NWOA 2QL5A 4GPEA 1DKUA 1AF4A 1C9JA 2EFEB 2V65A 3IBTA 1KEEB 3BT7A 5K3DA 4MKZA 5HUHA 3MUEA 4FEGA 5KU7A 3DAHA 4PZUA 2WAOA 3I6IA 2EKQA 2WU4A 1SUSA 4BP3A 5KWEA 4QUHA 4KQHA 2R1VA 4B6SA 4EFMA 4DTIA 3H7IA 3PR2B 8MHTA 3ENVA 4IIYA 3DNMA 1G8KA 2WHXA 5AKZA 1B41A 3VUEA 2JI8A 3VYTB 4US2R 1RLIA 3C24A 1P4HA 3ODPA 1U2RA 1VE1A 5DGCA 2OGSA 1HDZA 1LDGA 5FUWA 1NQ5A 4ZAGA 3RVPA 1CKEA 1JAXA 2E49A 3KOWA 4Z3OA 2Y99A 3D4OA 1AM4D 1FSZA 1OLSA 2QP3A 4NBUA 5H68A 3RQSA 4B79A 3AKZA 3P26A 2WTMA 3DS8A 3FGNA 3LX5A 2OORC 3HN7A 2QMEA 3DG9A 5HR5A 1ZI9A 3A2MA 2VF8A 5A7HA 4HI0E 3CG4A 3TQFA 4DSOA 3G8AA 2BFPA 1Y4UA 2WF7A 4JLWA 1JHQA 3RYHA 2A3NA 4IM7A 4GI2A 4ML3A 1IONA 3CONA 2KWIA 1YJCA 1NVGA 2FF7A 3ENWA 4LXXA 4CNQA 2HHAA 3SX0A 1HXHA 5FOWA 3UUGA 2H59A 3QFRA 1X70A 1WETA 2JIDA 1SUPA 1ZMOA 3QI2A 3K5WA 5AI9A 5H4GA 1QZTA 1A2OA 1JE1A 2E5LB 2B3TA 2ZU6A 3RH0A 2YH2A 4KMRA 3RARA 1AK9A 1J9EA 2OHHA 2W6ID 3BHIA 3FBGA 2ZUTA 4E5VA 4G5FA 5HTOA 1CJBA 2V0GA 1EWYA 3ZCVA 2GT1A 2I4OA 1QQBA 5AVQA 3JQ8B 4RZ2A 3D64A 4JLOA 2WZDA 2ZT7A 1OXTA 1TMYA 4EL5A 4PPGA 2ABWA 3SAJA 4ZDJA 4HWGA 4LDPA 2DTXA 5ETJA 4HMQA 2J9ZB 4RZIA 1N6PA 3BIWA 4W1RA 5CYGA 2D0IA 4H6PA 4XDYA 5LBIA 3ONDA 4IDQA 2HJWA 4XI9A 2W6CX 4D8YA 2JFBA 1OXXK 2A0FA 2CXUA 3W9BA 4C0HA 1W4ZA 3A1EA 2ZI4A 3EF3A 8AT1A 1OI4A 3FWNA 1QZ3A 2HJRA 4ZREA 1ZY2A 1DWQA 4A0HA 3TCXB 5AFSA 3X1ZA 2N3ZA 2XWPA 3BK2A 1YH3A 2A5YB 2C3OA 2PWAA 3O21A 5D85A 2CK3D 2GTPA 3H87A 4LJ6A 2ZE6A 3E35A 4UUOA 2PRSA 3TOVA 3W1EA 1DKNA 3AT1A 3ZZMA 1UBUS 1S2NA 3T9CA 4A7PA 1OLXA 2ESRA 2P8SA 2VJNA 1W1UA 3G2QA 3G49A 3L8MA 4G85A 5TMDA 5JVDA 4OMCA 3GCDA 1CNFA 3UIEA 4CV1A 1EFCA 4BN0A 1LF5A 3OH8A 3R0QA 3QE4A 4MQEA 2F1JA 2AFIB 2WP8J 1F6DA 5ARDA 2QR3A 1FXWA 3EQ7A 1C7FA 4JYPA 4MI6A 3LX4A 1WXIA 1GTRA 5AO9A 3ITKA 4S3MA 1M5UA 3NJ8A 3PYMA 4RIHA 1LDBA 2OFFA 3WFZA 1S8OA 3LDUA 9MHTA 3CUYA 4NU0A 4YRQA 2YL2A 3TE7A 2P9BA 1U1DA 3OIUA 5DXAA 3OZIA 2AJBA 1FFGA 3CTPA 5K0LA 1ZM2A 4WZBE 4XWTA 3QY0A 4ENWA 4NOLA 4AQYB 1U2EA 3O4GA 4FFVA 1CD5A 2Y1WA 3GU3A 2DFPA 3EIHA 2OEPA 4JIMA 3UJDA 5JFGA 2YC2C 3LL7A 3QENA 3G2KA 3QBDA 5TMPA 3NIBA 4IKOA 4Z5XA 2XD4A 1AKTA 2ODBA 5ALNA 2YXEA 2I71A 5LQUA 3TRJA 4BASA 2W6JD 3NANA 1NP6A 3OJFA 4FE4A 2O5EA 5C52B 3D3JA 4BNUA 4WKGA 4ND2A 1QLHA 1UC9A 2V7BA 2PGXA 4OG2A 4UTPA 3DOFA 3OMLA 3QNUA 4QBHA 4C4TA 3AW9A 3M6LA 1RYZA 2EYQA 4ZEVA 1PDVA 2PYIA 3ONFA 4KO4S 3SBOA 5KYXA 1ODSA 3TDMA 4HDRA 1HG0A 1K08A 1VCMA 4A1FA 3I2YX 1OWNA 3SC2B 1XAJA 3TZQA 1WPGA 3C5HA 2OGTA 3FE2A 1I6LA 5F33A 1JEYB 2GHTA 4XIGS 3GLIA 4E2FA 2IEDA 3CG0A 2ZREA 2BFCB 1KA9H 2PCJA 1JXMA 2OHGA 4I55B 2H2FA 2GXQA 4Q1AA 3WSTA 4BECA 1GGEA 3CS3A 3LHSA 4UJ5A 3ORQA 4AC9A 4M7OA 1KJNA 1TYZA 4MV9A 5C35A 1M2JA 3OTGA 1XZIA 4AY4A 5AT1A 1Y9EA 5I51A 4OM7A 2NVUB 1O6BA 4DSNA 4UBOA 3RFCA 1R1DA 2MWMA 1XU7A 1DAKA 4MUGA 3B53X 4AY3A 4CR7A 1ESDA 5DH9A 3PA6A 1KE2A 5J4KA 1Z45A 3UUEA 1J8FA 1JIQA 4BFYA 2PMEA 1MC8A 1Z82A 5FA8A 3GX1A 4UAGA 4MVJE 4Q9LA 4BLQA 3MN1A 1T9GR 2PNFA 1A2BA 1OE0A 3H1BA 3JYPA 4M3NA 3IP9A 2B4KA 3WK8A 5FDFA 1GO2A 4L9SA 4XYBA 4XVQA 4C4AA 1MJNA 2B2CA 4ITUA 4RD3A 4YEDA 4EMUA 1QC5B 1RKBA 2PPLA 3IAS6 1U1FA 3IP1A 1ZJ6A 4MWSA 4TMTA 3KJQA 1N33B 1FDRA 4LE1A 3RBZA 4G0QA 2VEOA 1C1XA 1QAMA 3HA7A 3FH0A 4UE6A 1P7YA 4G1BA 4A23A 2ZB2A 3VR4A 1ZR4A 2QRZA 1O08A 2K87A 4MHSA 4KK4A 4OGFA 2V45A 1S2IA 4ND7A 5JSYA 2E4XA 4DV3B 2CZCA 2HADA 3F96A 3RW9A 1J23A 3LCJA 4LC9A 3GXBA 3TVDA 4Y6PA 4XCVA 3L02A 4L8LA 5DMXA 1WP4A 2OFWA 2QTFA 3IUEA 2QRLA 4FINA 4F04A 4F8YA 1JUDA 1WRBA 4KNVA 3UT6A 5A1TA 1IRXA 1GZDA 2GFIA 4D3XA 1MVOA 1A96A 2O8CA 4IV5A 2WF8A 5FPTA 1QKJA 4ON9A 2PN1A 5J5CA 2JW5A 4E51A 2FZKA 1C4WA 1E4OA 1SWWA 3NETA 4GLJA 2AQKA 2E89A 3RKUA 1G8GA 5LZ5A 2OG1A 1E2NA 2D00A 3EK2A 5JNVA 2OO5A 3ZV6A 1OXVA 1US8A 2JZOA 3EVCA 1U2DC 2IUYA 2O5VA 3HXPA 4IFIA 3JCZA 4E46A 4DUZB 1O0SA 4PWZA 2XMSA 1XCJA 1S2DA 1ANKA 1Z6AA 3K0FA 5IAKA 2W6MA 4DMRA 2Q5JA 4IICA 2XIJA 1N92A 3JRWA 4EO9A 3MWJA 1LD3A 1JS1X 3HBLA 4HLCA 5EKUA 5K0FA 1RDFA 1JEAA 1E2IA 1HKUA 2GK3A 5FLKA 1EFVB 3W9YA 1OI7A 3SDBA 3ASZA 1CJUC 4OBWA 1G8JA 1IN5A 1E7MA 3HCCA 3LUKA 3QXGA 1RWOA 4RMHA 3NOXA 3T7RA 5JC8A 3KWMA 1YOVA 2PHZA 2ZXUA 5H8WA 3DC7A 2YN0A 1KNXA 3G0IA 4K28A 4HFNA 4OUKX 3SFZA 1KDTA 4G1CA 2QX7A 5EVJA 4DXHA 2Q5FA 4HL6A 2NZVG 1UWCA 1WCV1 4H6XA 1UZAA 3TLJA 2DFLA 5KVCA 1GXSB 1ISMA 2O48X 3DBOB 3GR6A 4AJ1A 1CETA 1W29A 1X1BA 3OJEA 4Q3CA 3T1NA 2B61A 2HMVA 2YQ5A 2QZJA 1L4BA 4DMMA 5BSRA 4JNCA 4KQ9A 4ROSA 1D09A 3SHQA 2W2XA 1EWRA 4Y7CA 1GU7A 3W4JA 1L7DA 1MKYA 4AKHA 1UXKA 5BNIA 2H0AA 4LYFA 4R8LA 3HFRA 4WSOA 5IFLA 3OE7A 4GU5A 1J7KA 1DQRA 4ZIRB 3RFXA 1EUQA 4TVOA 1OCEA 1Y8QA 2COKA 3HEAA 1OPXA 3U4HA 4CKCA 4AQDA 5K3OA 3CQ9A 2FQYA 4XSGA 2G63A 4HNSA 4GQIA 3EXIA 2Q1UA 3DYVA 3NM4A 5KCZA 4S1NA 4M7PA 1UOOA 4MITA 1ORVA 3B6KA 1PP4A 3DQZA 3GJ8A 5CLHA 2QAGC 3OLXA 4IDEA 2HBQA 5AJZA 4UU7A 1NI3A 7GPBA 4R5HA 5ADVA 4HNHA 2Y4OA 1DIHA 4QXOA 5IFKA 2F90A 1SCJA 4HY3A 4BP1A 4D9KA 5ELLA 2E7ZA 4Q15A 2N0SA 4EA8A 1RWKA 3DOHA 2BZ0A 3C6ZA 3P0JA 4X1KA 5TJ9A 3S40A 3ZU6A 1F2VA 4EGSA 4DSAA 4WAUA 2V7PA 4D56A 1LK7A 1M8GA 3PHGA 2NNLD 3T5CA 1V5FA 3IP5A 3P20A 3JY6A 2QE7D 5KNDH 2UZ3A 4B3RB 3ZKWA 4CVNA 3BWXA 3N9IA 4Z99A 2V7TA 4UU1A 3EGDA 2VPIA 5JSZA 1PV4A 1FE8A 3QG5A 1EA7A 4OCZA 1RI1A 3MILA 4L50A 3ZNQA 4BB0A 1WLSA 4OGWA 4GNRA 3CZ4A 4EEKA 4JBIA 5JV5A 1J0DA 5EOVA 2NYUA 1E32A 2CVPA 4UM8B 1DHTA 4S1WA 1I3LA 2PT9A 2X8WA 2QRKA 3TLXA 5BOVA 2YWFA 4JB2A 7MHTA 1KGSA 3KJZA 1HLDA 2W2MA 4LYDA 2R6FA 3JZIA 5FUYA 4ZVVA 3ZGYA 2GZMA 3F8SA 3CGGA 4NFLA 3R4VA 2QRVB 1GEEA 3E9MA 3J7TA 2TMKA 5A5FA 4XGRA 4DPKA 5T3YA 4J03A 3ORFA 3UW1A 4ZTUB 1G7CA 2EZ9A 3HYTA 3MEQA 3AUJB 2Z5LA 2H5IA 3TVTA 4B4VA 3KTAB 4UPDA 4F7DA 1PNQA 3LUJA 3QU9A 5LOVF 1XTBA 3D7NA 3WIEA 4XWWA 3SEFA 1T0UA 1YDHA 1XD8A 2DOKA 3REOA 3T5AA 3EZLA 1Y4DE 4DREA 3OG9A 4JJ6A 1K5HA 2OBNA 3COJA 1I0IA 1GRNA 2F2TA 5C46F 4M76B 3P19A 2QP9X 3BE6A 4TV9B 4ARCA 1N2GA 1NF8A 4LEIA 2MOKA 2PM8A 1GQ2A 2GTHA 3WR5A 4YS6A 3MUFA 2AC4A 4S1OA 3P4UA 4NP6A 1DKOA 1WKVA 2GSDA 5HHTA 5KEIA 4MHTA 1Z36A 4QICA 1WZ2A 1QF7A 2QRPA 1XI2A 3FI0A 2KE5A 2MSEB 3IERA 1Z47A 2J0UA 2YN4A 3JQCA 1I4TD 2CHVA 3EIUA 1SCKA 2WSLA 3HEMA 3HJRA 4WNAA 3DHVA 4PR0A 2WD8A 3N2ZB 3RSHA 1U5CA 4C88A 4QVIA 5LNK6 1FU8A 1QKKA 4ALKA 4EW6A 1IHXA 4ZI5A 3ILVA 3V34A 4AJJA 1H2EA 3FDFA 3WAGA 1ZVJA 2BKLA 4UBLA 4DFDA 1KU0A 1VB5A 5JWOA 3T7SA 4EUEA 1GCAA 3FHOA 2P9JA 4Q3OA 4AKTA 1A8SA 4N0DA 1RCUA 4Q4JA 3RFUA 3WGHA 4B45A 5ICEA 3DW3X 2ZDGA 4Z0PA 4EJMA 2BGRA 4R83A 3SBDA 3TR6A 1BWQA 1RRMA 2NO0A 3R3UA 2YV4A 2A9VA 1HQDA 1Y5MA 2VDRB 5EJ4A 1RJ9A 4RTJA 1Q22A 3IIKA 3QKUA 3BJZA 5D2CA 1L7AA 1SHJA 4WZBB 4YRLA 1XPUA 1DOHA 4TRJA 521PA 3TNLA 3H9UA 4R0VA 5HYVA 1W36D 4N3BA 3X1YA 2EJBA 2BH9A 2OUKA 3PBKA 3X1WA 2ZIZA 1DC6A 2HJSA 2XKJE 2RIPA 4ZDWA 4LVUA 4MJ3A 2ODTX 1NVXQ 3SKVA 5JBIA 1FSSA 4I0WB 2PO7A 2C7GA 4G89A 1ONOA 1SVOA 3JZAA 2B0JA 3U0VA 1NVBA 1TKBA 3Q98A 4XPIA 3ELDA 4CEHB 3F4KA 3ITEA 1I2CA 2Q6KA 4BGUA 5K0ZA 4W9MC 1P2BA 4CFSA 4KOEC 2IU0A 2O06A 4KDEA 1K7XB 4ODIA 3LECA 3U4QA 2WYHA 2VP9A 3R6LA 3U9TA 4AIRA 4JYMA 3UWMA 1I4EB 2XWQA 3AUYA 5AUNB 5BY2A 3OZWA 5L53A 4FKBA 2XVAA 2H2IA 4LS3A 2ZPTX 3IALA 1RHJA 3HJCA 4GZ5A 1BDMA 1HEYA 1WHSB 3HL0A 4N7MA 3LNCA 3MQ4A 4PYOA 4QVGA 3V6MA 4CGZA 3ZE2B 1W36C 4GPD1 2NSJA 3H8VA 1L1FA 1E9SA 1K8QA 1GDTA 4Z9XA 4URXR 3A58B 2Q49A 3B2NA 3Q6MA 3ZCSA 1KK3A 3R0ZA 2WA2A 1L8OA 3L7CA 1UP7A 4RGQA 1I7LA 3O8DA 4NEHB 1JYFA 2QN9A 3A10A 3B3GA 2XHEA 3MMNA 2FH5B 4IVPA 4U2EA 1KOLA 4ZVLA 2PGIA 5BSTA 5ENZA 3PQ7A 2D62A 3OAAD 3ZE7A 4D8TA 3URKA 2FN4A 4P3XA 1BW9A 2WWWA 2KB0A 1IXYA 1ZGHA 1EAYA 1NXSA 1R4MB 3I0NA 2A4KA 2FWAA 3X2SA 2CDRA 4RZUA 3SXUA 2CVQA 2R87A 3JQEA 3BZUA 1UF9A 4ABYA 1JWAB 1UXJA 2MSLA 5IZCC 1L4EA 2I54A 5HXAA 1WPXA 2DCMA 4IZ6A 4UM7A 5F52A 1ORDA 1EE1A 1OZGA 4EHBA 1RXSA 3VPGA 2QL9A 5GONA 2R2GA 3REQA 3HG7A 2QEQA 1QG0A 2GOYA 4DWJA 1JR6A 2JHFA 4L2IB 2B6HA 2R7NA 3EXEA 2D2XA 3ECSA 4PU0A 4QYIB 1EGVB 3TX2A 3H0EA 3M1AA 3NT2A 3TJRA 4OA5A 3WBKA 2VVTA 1S5PA 1YIAA 2WW8A 1KZ7B 3WGZA 4LXGA 1W0KA 3L4EA 3L92A 3K94A 1OU4A 1PBTA 2R7AA 5EJ7A 1Z68A 3EH2A 1QAOA 5KWSA 3MK31 2YWRA 3H2ZA 3BYZA 1YZGA 1GUAA 4DXDA 4B8WA 5DGTA 1JI3A 3PD1A 3V46A 2ZJ1A 2DFTA 3N1UA 1PX0A 3NWBA 4HPXB 2XDQB 4F5YA 5FPKA 5EWMB 2QSZA 2QRJA 3W06A 1T5TA 3MAGA 4K1LA 1HE8B 4AD8A 4TLEA 2W71A 4TWAA 2RC5A 2AYYA 2C2BA 3QXHA 1P5FA 3SXPA 2B5VA 5ITZA 3DBVO 4QPCA 2VDNB 4BXOB 1DJNA 1RQ2A 2I2DA 4MS1B 3LHFA 1ORRA 1SD1A 1T8RA 3S99A 2JANA 2QZ9A 3HB1A 5FTKA 5ICFA 3RKRA 5BSHA 1V9LA 2WVAA 4F8JA 1O2DA 4C6RA 5ADUS 5JZBA 4E4RA 3I9V6 3E82A 1SVSA 1OXMA 3OU6A 4IH1A 5AOBA 3STTA 1VZ3A 3OQOA 3D8BA 3NIFB 4RAOA 1EX1A