3CH6A

Crystal structure of 11beta-hsd1 double mutant (l262r, f278e) complexed with (3,3-dimethylpiperidin-1-yl)(6-(3-fluoro-4-methylphenyl)pyridin-2-yl)methanone
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
264
structure length
264
Chain Sequence
EFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSRWTTLLIRNPCRKILEELYSTSYNMDRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
publication title Pyridine amides as potent and selective inhibitors of 11beta-hydroxysteroid dehydrogenase type 1
pubmed doi rcsb
source organism Homo sapiens
total genus 98
structure length 264
sequence length 264
chains with identical sequence B, D, E
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2008-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ch6A00
3ZGYA 1UDCA 4RPHA 3OQBA 3H9QA 1B15A 1S7CA 2VHXA 1PX0A 4W7HA 4DWVA 2V7PA 1F17A 3U62A 2O7SA 3V2UA 3GH3A 3M2TA 5HS6A 3A1NA 1YBVA 3RFTA 1HEUA 2J5QA 2XOXA 3GMSA 4MVJD 2EW2A 3VHRA 2NNLD 2VRCD 3ZWVA 1LU9A 3P7MA 3SJ7A 1YH3A 3TSCA 2WSBA 3L4BA 2J8ZA 4A26A 4FS3A 1UUFA 3GZNA 1DC4A 4MKRA 5IN4A 4ZD6A 1A27A 4ALNA 2BRUA 2PWZA 4I9HA 1H93A 4PVCA 2BKAA 3PIIA 5ITVA 1WZIA 5A05A 2Q49A 3GFBA 1U3WA 3DBHB 1R4NA 2GZ2A 4TRRA 4MVJF 2OZPA 4D0RA 2QYTA 3L77A 5DCWA 1K6JA 1EUDA 2FZWA 2B5WA 1H6DA 3DZIA 3TF5A 4RF5A 1R0SA 2ZB7A 1IHYA 3DAGA 2JCXA 4HV4A 1E92A 2WE7A 4P4LA 5BQFA 4JXKA 1PJTA 4HFNA 1OC4A 1ML3A 1XGKA 2Q99A 4RVGA 1XELA 1XLTA 1CDOA 1ZMOA 1ZO8A 4JBGA 1EEHA 1I30A 5IF3A 1PJLA 1ADGA 5JMPA 2NU7A 1W8DA 2PKQO 3U4CA 5EQFA 4GMFA 5GMOA 4BO6A 4BO0A 2B37A 2HDHA 1V0JA 1YXMA 1G0OA 3B70A 4BNTA 3HDJA 5HRUA 5CPBA 4FW8A 3B1FA 1IZ0A 1XG5A 1PWXA 3PJGA 4R68A 3WGQA 5FEUA 1KC3A 1HXHA 4L0QA 5DULA 4E5YA 5IJZA 2FZEA 2HK7A 1UR5A 5KJ1A 2GNAA 4I5EA 4EITA 3CKYA 2HMVA 2GZ1A 5KJEA 4IMPA 4AJLA 1LTHR 3M2PA 4UUMA 1OZAA 3MJCA 3JYLA 2DBQA 3RC9A 5U1PA 1KVRA 4NFHA 1N2SA 1ZFNA 4GX0A 3UOGA 3PQDA 1I10A 3DHNA 4B79A 2V6GA 3GUCA 4QX6A 4O63O 1WWKA 4AJPA 4RORA 1SCUA 3PHIA 4YJHB 1FDUA 1N8KA 1P74A 1ISGA 4XWYA 4OQYA 3RI3A 5A3VA 1DHTA 5JCXA 3UKOA 2JJYA 1EBFA 2WJPA 4FFLA 2DPGA 2EG9A 2Q4EA 2QX7A 3AM4A 1PZGA 4XQGA 3RASA 3RJ9A 4XYLA 1D7OA 3Q0EA 1EVYA 4OKIA 5I7VA 1H6AA 4CV0A 5TRTA 4XGKA 2OGUA 3SLGA 1MP0A 4ZQFA 4CMGA 4NBVA 4XRRA 1W73A 2AEFA 4II2A 3QRWA 4MINA 3IQDB 4LMPA 2NU6A 3QIVA 3BTSA 1NASA 4F46A 4BO5A 1NPDA 1Y8RA 2I66A 4XRGA 1NPTO 4MVJH 1DJNA 4ZHSA 3H3FA 1GD1O 1EMDA 4DPMA 3TL3A 2FRDA 1BTOA 3UCFA 3UN1A 2YV1A 3KYDA 2BGMA 4R5MA 2AQIA 1BVRA 3SC6A 3WFJA 4CLRA 2LDXA 4CM3A 4A2CA 4D3DA 2PD4A 1Q0HA 1VKNA 3AY3A 3GHHA 3L6EA 4MVJG 4YJGA 5TGDA 4BOYA 4GI2A 4L9RA 1ONOA 4BMVA 1R66A 4EUEA 3JQ9C 5A04A 4PG4A 4PGFA 3INRA 4DREA 4GVLA 4YBZA 3VPSA 4NBRA 3VH3A 3JYPA 4INAA 2NU8A 3WXBA 3RUIA 3KB6A 3DZHA 3NRCA 1Q7BA 2Q50A 2Y99A 4J1TA 4MP6A 3B1JA 4UVIA 4XJSA 5DDIP 4BNVA 5AQ1A 3GG2A 1Q0QA 4HP8A 3U49A 4AJEA 1DO8A 1KOLA 3HG7A 4B4WA 3V2GA 3RUFA 3JQ9A 1DB3A 2IEDA 2CSUA 2VRCA 3NJ8A 3F6YA 3LT0A 5EPOA 3IP3A 3JQAB 2GPTA 4NJOA 2IODA 2HMTA 4NK5A 4XA8A 3VZSA 4AICA 5IAAA 1PL7A 3DOCA 2AXQA 4IDBA 1YOVA 2XAAA 1DDOA 4DC1A 1K89A 1G1AA 1B26A 2Q2VA 4A27A 1LC3A 3TOXA 3WGHA 5DP2A 3W6UA 2VNAA 1NP3A 2BGKA 4NU5A 5I9LA 1MA0A 3JQBC 1A7KA 4MIOA 5BNFA 3U4HA 2PY6A 4I5GA 4CL8A 3S2GA 5CEFA 2AE2A 2FSVA 2XXBA 3QWBA 2ZB8A 2I3GA 3ZWCA 2X0IA 1QR6A 1PL8A 3NDJA 1EQ2A 4R01A 2VQ3A 1MC4A 1MLDA 4QSMA 1FF9A 3DZBA 1ZXBA 2VHVA 3TZHA 4O0LA 3FPCA 4GAEA 1H6CA 3SVTA 5JPIA 1I0ZA 1TT5B 3JQBA 5I7EA 2DTXA 1T2AA 1U8XX 2HO5A 3LC2O 3R1IA 4B7CA 4B8ZA 4OXYA 4DC0A 4P4GA 2Q4BA 3G3EA 4BNZA 3KOUA 4FD3A 5JW6A 3E9MA 1CWUA 1DIGA 3EDMA 4E4YA 4LSWA 1I2BA 4XR9A 3DBHA 4XYMA 3MJTA 3A14A 1XU7A 3KYBA 2VZ0A 3SJUA 1K3TA 2O50A 5G0TA 1ZK2A 2VUUA 4XZ3A 2ZQYA 4YRBA 1LDNA 1CQJA 3ETDA 1ZJYA 1ENZA 5TF4A 3WBBA 3PJFA 3ADPA 2Y1CA 3D4PA 3CE6A 3E9NA 2X5KO 3ANLA 1CEQA 1QP8A 3D3WB 1RJWA 4IMRA 5T5QA 4I08A 1W6UA 3RKRA 2FPGA 4ZQGA 4J2HA 4KMSA 1JA9A 4OKNA 1DLJA 3KV3O 5CPFA 2GN4A 3W8DA 1Y1PA 3QWHA 3UCEA 1I5RA 2GLXA 3I52A 3JQ6A 2D5AA 2G0TA 3EAGA 1V8BA 1ZEMA 5JDIC 2NV6A 4D44A 2NVWA 4CMKA 1EQUA 4B4OA 2Y1OA 4E2WA 1YO6A 3K96A 1E6EA 5JFOA 2B69A 2RHCA 3RFXA 2EV9A 3PQEA 4U0KA 2HJSA 2A94A 1DC5A 1ZIDA 3K73O 1R15A 2QZZA 3IC5A 3JQ8B 3GVXA 1ZK3A 4BNHA 5JDIA 3V2HA 3O38A 4J49A 3WGIA 1K5HA 2EJWA 2B4RO 1IZ9A 2HAEA 1LDBA 4TMFA 3I9NA 3HWRA 3K2EA 3VPGA 5KCZA 1QV6A 2Q46A 4CQMB 4NPCA 1CF2O 1N9GB 5TX7A 1E1NA 5FF9A 3ROQA 1B3RA 3AOEA 3TZQA 3UXYA 1SAYA 2EW8A 3ICPA 3PHGA 2VWGA 3M6IA 2W2KB 2IYOA 4YJHA 3PWZA 1I3MA 4RVHA 4Z9YA 3GVIA 5KVQA 4CLDA 2BELA 3CSDA 3QHAA 3I9MA 4LGVA 4CR7A 4KQXA 2YJZA 1VRWA 5CDSA 3CPSA 2PFGA 1T25A 1NFFA 4OSOA 4BGEA 3ANNA 2JD2A 5AVOA 5T8KC 4W82A 1U3UA 3ZU5A 4HFJA 3HE3A 1HZJA 2P9CA 2CVZA 3UFXA 3ZV6A 5A4DA 3RAJA 4YJFB 2IE0A 1E7RA 5KVVA 5J23A 4R5HA 1QMGA 4P8RA 2EKLA 3DBLB 3FWZA 4UAGA 4KP7A 4BNWA 1V3TA 2OHXA 1HDCA 2A35A 4RLHA 3CH6A 4PZCA 3VKVA 4WJZA 3RU7A 4D0SA 3R6DA 2WM3A 2VWPA 3DMTC 4YT5A 4CQMD 4I9NA 4EI2A 3RQSA 4Q3CA 4D79A 4BVAA 4AJNA 3F3SA 4OSPA 2CUKA 2HKIA 3I4FA 3KSUA 4XYGA 4A5OA 4DUPA 4OXNA 1NWHA 5DBFA 4BO2A 4YDRA 1NHGA 4WKGA 4NQZA 4E33A 3PYLA 3JQFA 4IGFA 3QJ5A 4RPJA 1GAEO 3DMTA 4OXKA 3VH2A 4M54A 3S2FA 5JYDA 1P1KA 3P2OA 4FFOA 1NNUA 4AJ1A 4AJIA 4JBIA 1KEUA 1UJMA 1O95A 1DXYA 1EE9A 1HSZA 5T57A 3JTMA 1QYCA 4QFCA 2OOSA 1GCUA 4ND4A 4NNJA 2RCYA 3UF0A 1U7HA 3H9UA 4TZTA 4LRTB 3U9LA 3WSVA 3Q6IA 4FR5A 3DZJA 5EMHA 3C24A 4E5MA 3E48A 3KBOA 4EJMA 1XDWA 5G2OA 3F9IA 4B4UA 1LLDA 1LJ8A 1T2FA 1IOLA 1IB6A 4IGEA 2YUTA 1Z7EA 5G4KB 4JP3A 3VPHA 4DTIA 4ZRMA 3JQAA 1P33A 3OICA 2OBYA 4YJDA 3ZWNA 1GEEA 3W4JA 3RBXA 1Q0LA 1J0XO 1NXQA 2DBVO 1MFPA 1P31A 1T1RA 4GWKA 4YB8A 5EL0A 5LC1A 4OL9A 4J7UA 2ILTA 1B8VA 2WEKA 3VVCA 3I9LA 2DC1A 2F00A 2PD3A 4YR9A 2Y67A 4IQGA 1Z73A 4WNCA 4Z3KA 4N18A 1YB1A 2VTEA 4QECA 1VM6A 3LDHA 1JTVA 3OIDA 3OM9A 4B7UA 1K2WA 3V5NA 1ENPA 1UZLA 4RVSA 2PNFA 3PYXA 3CTMA 4TSKA 4TQGA 1GR0A 4NZ9A 3C1AA 1RM3A 1Z6ZA 3MWDB 4IIVA 1X13A 3BMQB 4YAJA 2X7HA 3RKUA 2VWHA 2H1SA 5EESA 1I2CA 4Y8VA 1Q2XA 3VAZA 3IIEA 5LDGA 3ZCXA 3E03A 3FD8A 1TT5A 2ZIZA 3WOHA 1HYHA 4YAGA 5A06A 4JLWA 4JIGA 3GGGA 2X22A 4BQRA 2GN6A 2FWMX 4MVJM 3GVHA 3IKVA 3WSWA 4DQVA 5TSDA 4WEOA 3AUUA 2D1YA 4RGBA 4CM6A 4HUJA 3JD2A 5AYVA 3WGZA 3LSYA 4Q39A 1V9LA 2GYYA 3SC4A 1Z82A 2OP0A 1E3LA 1YDWA 4L73A 3FN4A 2PLAA 3FPLA 1ZK1A 3VTFA 2Q1SA 1K6XA 3NT2A 1L7DA 1FXSA 2HSDA 3WWZA 1H0KA 4IDGA 4NK4A 3EHEA 4E6PA 3OJLA 1AHHA 1DEHA 1UDAA 1ENOA 2QIOA 2X1HA 1ISJA 1GYQA 1HE4A 2WE8A 4LVCA 5TT1A 5CDGA 3D3WA 1I3KA 4XJTA 5JC8A 2FN7A 3TFQA 2JAPA 4W7IA 5F5NA 3OIGA 5KKAA 3GEDA 2EIHA 4J7XA 1LX6A 1LQTA 1A4UA 1PU2A 3ZWWA 5L7WA 1PGNA 4NDNE 4WLFA 1HF3A 2ZB3A 4NJMB 1NVMB 5GZ6A 1DRVA 2ZB4A 3WNVA 1YQXA 3DZGA 5A02A 2UUPA 1UP7A 1X15A 4U0JA 3B20A 3GEGA 3P5SA 3U4DA 2ZJ0A 4XIYA 3RJ5A 1EK6A 1C0KA 1BRMA 1RM5A 3L0DA 4NI5A 5JDCC 1C14A 4PG6A 2AW5A 4GVXA 4LRSB 4NR0A 3LQFA 3JQ8A 1UZMA 1P0FA 4YT4A 5L3ZA 3ORFA 4KUEA 6LDHA 2V6MA 1CJCA 4XX0A 1XU9A 3CMMA 3FNHA 1LA2A 3V1UA 2E82A 4CQMA 4BHTA 1N9GA 3IJPA 4J16A 3ZNOA 1C1XB 1SMKA 1Y5MA 3DBVO 1RYDA 3NAQA 4BNXA 3ANMA 1HLDA 2W2KA 4EYEA 4R41A 2E6UX 2NADA 2DT5A 4LK3A 1U7TA 3I1JA 4FBGA 2C5EA 2H63A 4PLVA 1JWBB 1B14A 4MO2A 1HRDA 3RUDA 4UULA 3FR7A 4CQLB 3U3XA 4CM8B 3DMYA 4YJFA 4Y6SA 5ILGA 2Y0CA 4OMUA 4ZN6A 2DU8A 3G79A 4RPLA 4ZVVA 4AG3A 3DBLA 1EUCA 1GZ4A 4LCJA 4TRNA 3L9WA 2O23A 3MCVA 2W8ZA 2YDYA 3DR3A 1JW9B 4M87A 1I36A 2NTVA 4PZDA 1SZJG 1X7DA 4JK3A 3OJOA 3WG9A 5HBRA 5BSHA 3PJDA 1PR3A 1HWYA 5F21A 1OC2A 3MZ0A 5CEJA 2FP4A 4GX1A 1D4FA 1ZSYA 4I9UA 1A9YA 2AEMA 3OIFA 4GX5A 3TJRA 5BSFA 1N7HA 4WPGA 3H6KA 1K0UA 5H83A 2YZ7A 3AWDA 1WVGA 1LLUA 3NDIA 3WGOA 4HNGA 1EFKA 1P44A 1B3BA 2A4KA 3F46A 4BL5A 1WXDA 2VUTA 4ROSA 4D46A 4LISA 4OAQA 4E13A 1FMCA 3HFSA 3QV1A 1KVQA 3TZCA 2BH9A 1LC0A 4AVYA 4OQZA 4E3ZA 4ITUA 3ZHYA 1VL6A 1M6WA 4G81A 1B16A 3ZW9A 8ADHA 5U4QA 5THQA 4NFSA 2PA3A 1ISFA 4BNFA 1GZ6A 4DIBA 4HX5A 1P0CA 2I3AA 4IDCA 2YQ5A 1RM4A 5EERA 2ZKLA 4TWRA 4BGUA 3BTUA 5I8WA 2EXXA 2WD7B 1X14A 3EY4A 1Z7BA 5ER6A 3PPIA 1EVZA 4FJ2A 4R69A 1C0LA 1OI7A 1WW8A 1DRUA 2V6FA 3EVNA 1J4AA 3F1LA 5G4KA 5FWNA 3DFZA 4PLYA 1JKJA 3TRIA 2I99A 2O3UA 1NWCA 3C85A 3RVDA 4K6CA 3ENNA 5BNIA 1DIRA 1SC6A 4ZRNA 3N7UA 2DM6A 1ZNQO 4MPDA 4F6LA 3I4CA 1ZSNA 5ADHA 5IXYA 2I65A 3QA9A 4IDEA 1R0LA 4FN4A 3BAZA 3OF2A 5L9AA 3FNGA 1LRKA 3WWYA 2DAPA 4YQYA 2O3QA 1OFGA 1DFIA 2DFDA 2O48X 2O4CA 2X5OA 3WQRA 3G1UA 5TJ9A 2C82A 5F5LA 1L7EA 1WMBA 3Q11A 2VRBA 5G0WA 2VZ8A 4M1QA 3BMQA 3NTOA 3ST7A 3OQ1A 4ZA2A 3GAFA 1KC1A 4CLOB 1P9LA 4YVFA 2J3JA 4N54A 3IKTA 4EUFA 1DAOA 3Q2KA 4DRYA 1HDGO 2D3TA 4HKTA 1R12A 1OOEA 4NMHA 2HU2A 4BUCA 3DAFA 4DLAA 5A9SB 3H9EO 1T4DA 1I3LA 1X1EA 3GY0A 1BDMA 3KEQA 4TKLA 3A4VA 4CMHA 1V3UA 4YT8A 5C37A 2YHIB 2Y0EA 3L4SO 4IDDA 3GNTA 5CAEA 4CLHA 2X9VA 4EDFA 4MIYA 3F4LA 3TQHA 2OMEA 3K5PA 3DQPA 3AI2A 5CDTA 2O2SA 4FCCA 2Z1NA 4BB6A 3VDRA 4AJ4A 3OFSA 1WPQA 3RBVA 3S2IA 5K6AC 4QQRA 2VT2A 4XKJA 5HM8A 3KVOA 2CDAA 2I76A 4E5KA 2RH4A 3RSHA 1QSGA 3TN7A 1NHWA 4IZHA 5IG2A 3I9KA 2G1UA 5AXBA 4KDFA 1VJ0A 1GADO 1LEHA 4KWHA 3FNFA 1Y9AA 2E4AA 4NJMA 4RF4A 4X54A 1UXIA 2WTBA 3QVTA 1QYVA 4NBTA 2VNSA 1D1TA 3Q9UA 2VYND 4IQ8A 1F8FA 4IJWA 3LT2A 3LLVA 4CMJA 3KYCA 1PS9A 3RUCA 5TIIA 3UW3A 3VVBA 3K9QO 4E31A 1CQIA 1QLJA 1U5CA 2SCUA 4QUKA 1AHIA 2QRJA 3BMCB 4XQCA 1H9BA 3K2BA 3PWKA 1VE9A 2FPIA 3Q9NA 5JNLA 4RQUA 4OOEA 1I3NA 2JHGA 4I1IA 4MIEA 4WECA 4CV3A 4UEOA 4H16A 4LMRA 2C7GA 4GKBA 1SB9A 4DMMA 3EYWA 2HK9A 3L9XA 1NR1A 3IOYA 3WMWA 1PGOA 2D8AA 3MJSA 5FFFA 4CUJA 3NTRA 1P1IA 1PJSA 2IRWA 1X7HA 3DBRB 3ENKA 4WK6A 3GNQA 3TFOA 9LDTA 4DGSA 1C1XA 1GUZA 2HCTA 1GQ2A 3PXXA 1U2GA 4BNYA 1PSDA 3OECA 1ZZEA 4ND5A 3ROMA 1DC6A 3HN2A 3OQ6A 2AQ8A 2A9FA 1Q7CA 1VL0A 3I83A 1Z45A 4OJNA 4RF3A 3WJAA 4FOOA 2X9NA 3LF2A 3PGXA 2D0IA 4L8VA 1H2BA 3DL2A 1O0SA 4CV2A 4JROA 3K30A 3I6IA 5I8ZA 3NGLA 4CQLA 2VYVD 5K9ZA 4CM8A 3PWSA 2Q1WA 2O3TA 4IJUA 1EBUA 2OXIA 3IDSA 1E7MA 3GAZA 2OL4A 3PJEA 2EGGA 3CMCO 4ND1A 4PG7A 1QYWA 3HN7A 5L51A 3OETA 4KDEA 4CMEC 2EP7A 1CYDA 2V65A 3D5QA 3NKLA 4R1SA 1YE3A 1B0AA 1YS4A 3Q2IA 4Z6KA 1LI4A 1VSUA 3DZFA 2C2XA 2NVBA 2X5JO 3VC7A 1HSOA 2X86A 4CR6A 1FJHA 1QKIA 1BVUA 4MVJA 2NQTA 3VH1A 3MJ4A 5ES3A 2Y05A 4IZIA 1A7AA 3S8MA 3PP8A 4KTVE 1IL0A 3HSKA 1BSVA 2J3HA 2Y93A 3GGOA 3HQ4O 4YAEA 3JYQA 2BHLA 3ZW8A 3GDGA 3UAGA 4YQZA 1PS0A 2JD1A 4P22A 1U28A 4M89A 4QXMA 2DUUA 3VH4A 2C29D 1NAIA 5KJCA 1VLLA 3RIHA 1NM5A 3BHJA 3D64A 2HLPA 3UCXA 5KKCA 5KVCA 4PG5A 1HZZA 4PRKA 2WYWA 2WD7A 3PFFA 1AE1A 4LCEA 1GU7A 3KTDA 4Y98A 2W2LD 5A03A 4YCAA 4A73A 3EGOA 5G0UA 4R3NA 4XDYA 2IYPA 3KUXA 4CPDA 2H9IA 1U4SA 4OO3A 5H81A 3S2EA 4J1QA 4K26A 5JCJD 4JJIA 1GTMA 1HETA 1VC2A 5L4LA 2Q45A 3VKUA 4D7AA 2DBRA 1G0NA 2B36A 3GHYA 1DLIA 2ZYAA 4B3HA 5TT0A 5KIAA 2JCVA 1O5IA 3GOHA 2ZATA 3GQVA 1LXCA 1T1SA 4J9UE 5AOVA 3RC7A 1SEVA 1ZMTA 3SBOA 3E82A 4DA9A 4E5NA 5GY7A 3OBBA 4FOSA 3DTTA 4E12A 1L1FA 3JD3A 1PJ2A 5B4UA 3DOJA 2NVUB 2V6BA 4KQWA 4CM5A 4OYRA 3ZHXA 4RF2A 3GRPA 4CUZA 2BFMA 3BXXA 3BIOA 5L7YA 1E3IA 3WTCA 2PGJA 4CLOA 3GLQA 2C59A 2FPPA 1KERA 1EUZA 2UV8A 3CEAA 1Y81A 1KYQA 4P4NA 3HZZA 1GCOA 4NBUA 4BO7A 1I01A 4TVBA 5A5EA 2TMDA 2W90A 3LLSA 4Q3DA 5DBIA 5A9SA 3DO5A 4OHUA 1NQTA 4WASA 5B12A 5ICSA 3DEYX 1PGPA 2YYYA 2GF2A 4ONEA 4WCFC 1ULUA 3GC6A 3EW7A 4PRLA 1ADBA 4R16A 4BKOA 3FTNA 3ON5A 1NVTA 2YHIA 3PGJA 3JQCA 5HTOA 3F47A 2VYNA 4WE3A 5B37A 3AUAA 3HDYA 4E5PA 3KM0A 1LDYA 2EKPA 1ISIA 2BI7A 2IZ1A 4BO4A 4A03A 5DF1A 1E3EA 4ZICA 1E3WB 4Z0HO 7ADHA 5KNLA 1U5AA 3AM3A 5K0ZA 2HRZA 1H6BA 3T7EA 4XQ9A 4R1NA 1GYRA 1LUAA 5CG1A 2G76A 2P4QA 3FSRA 4E21A 3GDFA 3PFWO 1XA0A 4AJOA 5LDHA 4DIFA 1KETA 2HRBA 3STHA 1PJQA 3LT4A 3H8VA 2OUIA 1YKFA 1I8TA 4J0EA 1YB5A 3W8FA 5FI3A 4K6FA 3G1TA 3ZNPA 1SOWA 1E3SA 5T6BA 2HMUA 3HJAA 3WIDA 1HDXA 3ROKA 5A9RA 2EP5A 2HQ1A 1X1TA 3FTPA 2Z95A 3W6ZA 4BGVA 1H5QA 3ZHBA 3V1YA 3E9QA 1E7SA 3BMCA 3ZV5A 2AQHA 2UUOA 4JCOA 3ICCA 2VYVA 4ZGWA 5JO0A 3H5NA 1T4BA 3CZMA 1MFZA 4B3JA 1PJCA 4BNMA 4D42A 3IUSA 4KWIA 2VUSA 3RUHA 5EN4A 1P1RA 3DBRA 1T24A 1LSSA 3BHMA 4ZQHA 3NV9A 1PJBA 1PR9A 3PLRA 2ET6A 5T8KA 5IZCC 1E5QA 3FWNA 4TVOA 1XR3A 1JLLA 4J7CA 5HWSA 1PWZA 2PKRA 4E30A 4NU6A 3W1VA 1VJTA 1X0VA 1P45A 3PZRA 3ITKA 2W98A 1A72A 1HE5A 2CVQA 1AUPA 3G17A 3O8QB 2PKQP 5DZSA 4J43A 1LSUA 5ILOA 3WGGA 5ENVA 1GQYA 4ZJUA 1JN0A 4A0SA 3AK4A 2P68A 4L74A 1JQBA 4J90A 3OJFA 2DVMA 2UDPA 4Q3EA 1ONPA 3B1KA 3GDOA 1FDWA 4RLSA 2HK8A 4BNUA 3JD0A 3OJEA 4FFRA 4QFDA 5TQVA 1LDGA 1GV1A 2GASA 5JY1A 1HE2A 1F12A 4CMIA 5L40A 2EJVA 5L95A 2JHFA 1ISMA 4EJ6A 4GMGA 4IBOA 1IY8A 1NX6A 1NQAO 1XEAA 1E7WA 2E48A 2W2LA 3O03A 4KTTE 4PG8A 2WWRA 3QP9A 3S1LA 3ULKA 3WLEA 3GT0A 1BWSA 1LRJA 1ZK0A 7MDHA 2PZJA 5JCJA 1GDHA 1LRLA 1N5DA 1YJ8A 2Q2QA 4FC6A 3IL2A 2CFCA 4DXHA 2VN8A 4MKZA 3A28A 3RFVA 1DIAA 2BF7A 4EGFA 2PZLA 1VL8A 1ADCA 5MDHA 4FFNA 1YWGO 1UDBA 2IXBA 3INGA 2BFOA 2DTDA 1ISHA 4IDFA 3HDHA 3IJRA 1PZEA 3G49A 2DFVA 3NX4A 5F1PA 4RZIA 2ZTUA 3KHUA 1PEDA 2ZCVA 3E5RA 2CF5A 4BNJA 5H82A 1JAYA 9LDBA 1QYDA 2E37A 1VSVA 2QG4A 2EKQA 1GYPA 3KSZO 1S6YA 3HNPA 3O9ZA 1YQDA 4Q3NA 3ZWXA 1C3VA 4CM1A 4OGWA 4D45A 3QSGA 1C1DB 1LLQA 1HDYA 1UZNA 1R16A 5JE8A 1HLPA 1YRLA 5JY6A 4R9SA 3UGKA 5CG2A 3BYZA 3DB2A 1SBYA 3D0OA 4QO8A 4Y6RA 2YFQA 2NACA 3LU1A 3BMOB 3AUSA 3JSAA 3PRJA 3C7AA 2ZTMA 2EEZA 5F1KA 1IULA 2PD6A 3KETA 5C3MA 1N1EA 5CDUA 1MG5A 3WDSA 3PEFA 4DMLA 4URFA 2J5RA 4KUHA 4JN6B 5BNTA 4MVJP 3WFIA 1ZBQA 1B7GO 2Y1FA 3LC7O 2NVUA 1AGNA 4TROA 1EVJA 1GY8A 4DLBA 4RV9A 3NT5A 1J49A 3FF4A 3ONDA 3N58A 3ROPA 4CMBA 2CZCA 1V35A 5JBIA 1ARZA 1K6IA 1SNYA 3NJ4A 4TRJA 3M1LA 5KTKA 5DOVA 3WGYA 3SLKA 3VZPA 3OJ0A 4IS3A 3C1TA 4FFMA 3L07A 4B3IA 4WLNA 3JQ7B 1IUKA 1UXGA 2PH3A 3WS7A 5IDXA 1E7YA 5L4NA 2FOIA 1ZXLA 4ND2A 1FK8A 1JDJA 4GQAA 3KZVA 3KYCB 2IZ0A 3ONFA 4I5FA 4PLHA 2P91A 4RPKA 3NTQA 5C5IA 3TPCA 3CINA 4KZPA 2PGLA 3F5QA 3GF4A 4I8XA 1E3WA 3QW2A 1KY5A 1PQWA 1U9JA 1MGOA 5C7IO 1A5ZA 5HA5A 4PVDA 2B0JA 1KIFA 5CFZA 2JAHA 4DPLA 2VHWA 2B4QA 3D3EA 1A71A 4PIVA 2QYSA 1GV0A 4W99A 2Q3EA 4BNNA 3FCOA 2X8LA 3H2SA 1ZVMA 4G2NA 4TKMA 4Z3DA 3WYCA 5L53A 2G5CA 2IDZA 2LDBA 3FNEA 5JDCA 3OA0A 3QWIA 4ILKA 2B4TO 1Q7GA 1E1LA 1PTJA 3R3SA 1E5LA 2J5KA 4PLFA 4ZQEA 5JSFA 3DXFA 2H6EA 4YYZA 1JAXA 2O3RA 5G0VA 3SEFA 3WBFA 4XGNA 4A10A 3C7CB 2P9GA 3UUWA 2HMSA 1B8UA 1DHRA 1WAMA 3OH8A 4GH5A 2DQ4A 2GERA 3TZ6A 4RVFA 5DN9A 3ZH2A 4JBHA 3AOGA 3O26A 2E49A 3ZZNA 5CHEA 1M75A 3DWFA 3L6OO 4GSKA 4S3MA 5IDYA 4F6CA 3AU9A 5DP1A 2QW8A 3WYEA 3PI7A 5COBA 5ENDA 4NHEA 1BG6A 4Z0TA 3WJ7A 4DLLA 5GZ3A 4HNHA 3TOZA 2X0RA 5EJ2A 1TLTA 4J1SA 4ALMA 5BSEA 2I6TA 4O5OA 4D3FA 1FDTA 1OAAA 2FSSA 3JYOA 2O3SA 4U8GA 4BB5A 3O8QA 3I5MA 1XHLA 4ALJA 2D4AA 1O8CA 1HKUA 1QLHA 3INTA 3FI9A 4YA6A 1LNQA 4RZHA 5DNAA 4RO0A 4HFRA 5THKA 2D5CA 1SB8A 4CM4B 1I2ZA 2C20A 1XQ6A 1TT7A 4W6ZA 1YL6A 4EW6A 2FY8A 1GL3A 4BO3A 3GN2A 3KRTA 3MJVA 4UEJA 3IS3A 4BV9A 1JU9A 4J4HA 1JWAB 1XKQA 3KLPX 4QTZA 5DT9A 4G5HA 4IINA 1XWFA 2CVOA 2FR1A 1G6KA 1NQ5A 3OP4A 2JCYA 3R3JA 3WNQA 3FHLA 3TZKA 5KVSA 2HJRA 3GNSA 4YRAA 1U8FO 4Q3BA 1O6ZA 2G82A 1J5PA 3PHLA 3OEYA 2GUGA 1PQPA 1TEHA 1EZ4A 3H4VA 1H94A 3UICA 3V1TC 5ER9A 4BKQA 3IP1A 4BO1A 1RKXA 2ZCUA 3E5MA 3S55A 4C4OA 4CMCA 4B7XA 2C54A 2ZYGA 4LSMA 4ALKA 1JVSA 2TMGA 1E3JA 5L45A 3L4BC 1AN9A 1ORRA 3ZV3A 3ZN2A 2GN8A 2WYVA 3FBGA 3JD4A 1DC3A 4CV1A 5T64A 3JQGB 3KEOA 1PIWA 3E8XA 1DFHA 2RHRA 2Y1EA 4FQ8A 4WOKA 1PGQA 4WLEA 4GGOA 3MWEB 1I24A 4RJTA 1A9ZA 2YFHA 4BNKA 4YPOA 4GSLA 2CNBA 2GR9A 3UVEA 2AE1A 4IQ0A 4UVDA 3VOSA 3H5AA 5JAQA 3NEPX 3EK2A 2I67A 5JAIA 4HADA 1C1DA 4PFJA 4J1NA 4DPKA 1QV7A 1E7QA 1O94A 1X7GA 4Z9FA 2GSDA 1DSSG 3I23A 2O3JA 4IJKA 4MVJE 4Q9NA 3X2FA 1FDSA 4XB1A 1WNTA 2ZJ1A 3BMOA 1IE3A 2VCYA 1TA4A 3I9JA 1GPDG 3IUPA 1HYGA 4J0FA 2C7VA 1F8GA 4RQTA 4U6SA 4AFNA 3I9OA 3QVSA 3HFGA 4CL3A 5TLSA 3CZRA 1OMOA 4WLVA 1Q1NA 1SPXA 5T67A 5IXSA 5BR7A 1CRWG 2XF8A 4WCFB 1NAHA 1WLYA 4IXTA 4HWKA 4L4RA 4E32A 5C7OO 3OSUA 3RC2A 3WQQA 4DYVA 4YXFA 2EGHA 2IZZA 3CIFA 2QHXA 5IN5A 1GPJA 2VWQA 4XEHA 3AI3A 2XPCA 2QQ5A 4UVHA 1I33A 3AI1A 3JQ7A 1GUYA 3ASVA 3HADA 4PLTA 4DQUA 4XD2A 4MP8A 1NYTA 4YACA 3F1KA 4P38A 1SOVA 3MEQA 3LT1A 5JYEA 3Q3CA 4BKUA 4WUVA 3VPXA 5K6AA 4BO8A 3ZWOA 4JP2A 3ONEA 1ZEJA 4IIUA 3VZRA 1F0YA 1U2DA 3EVTA 4BO9A 2DTEA 3NUGA 3O4RA 4E2YA 2UAGA 3PDJA 4WLOA 1Y7TA 3OMLA 2VHYA 3WB9A 2R00C 2JFHA 4B8WA 3U0BA 4U7WA 1EVIA 1NPYA 3TNLA 3H3JA 1BXGB 4RCVA 3D1LA 1BXKA 5LCXA 4BNGA 4XIJA 3HDQA 4R1UA 4IUYA 4PZEA 4MJLA 4Z0PA 4HY3A 4AJ2A 3RUEA 3AFNA 2R00A 4XDZA 4D43A 1ZCJA 1XIVA 2ZTLA 4I5DA 3A06A 2OFPA 3GEMA 1E77A 2NTNA 3HHPA 4K9DA 3CUKA 1UP6A 2Y1GA 3DOOA 1YDEA 4S1VA 3AM5A 4R54A 5CEEA 4GPD1 4RPGA 5CDYA 4FJ1A 4RDIA 5TC4A 5JAMA 3B6ZA 3L6DA 1KBZA 3QVOA 1HDZA 1V3VA 3DONA 3NT4A 4GLLA 3T4XA 1YBAA 2ZTVA 1M66A 4H15A 1QXSA 3PK0A 4IJVA 1U3VA 4OM8A 2WDZA 4BMSA 3MOIA 3BZUA 2Z5LA 3QWFA 1PQUA 3LF1A 3TWOA 4CMIB 3WMXA 4CM9D 1NBOA 2BMAA 3PTZA 4BKPA 3GPDG 4UVEA 3LC1O 3QVXA 3H5RA 4GL4A 8LDHA 1XSEA 1IHXA 1DAPA 5TJHA 3ZU2A 3ASUA 2Y68A 1KEWA 3N74A 2XXJA 4LW8A 3ZHZA 3RROA 4BIIA 1MXFA 2O4UX 5KJFA 4K28A 5EIOA 2J3IA 4WGGA 3RC1A 4A7PA 1UAGA 2HMWA 3WR5A 4WCDA 4L76A 4DL9A 4CMEA 2R6JA 3SXPA 1GZ3A 2DKNA 1Z74A 1M2WA 1QORA 4CM4A 4DIOA 3MTGA 3DAPA 3WTBA 2YV3A 3VTZA 1KVSA 4GWGA 1Y5RA 4C7JA 1ZK4A 1LBEA 2P5UA 2WMDA 2B83A 1VKOA 2VTDA 3GK3A 2O7QA 3H9JA 4EBFA 4IDAA 2J6IA 2YQ4A 2UVDA 1RWBA 1PGJA 3W8EA 2RIRA 3JYNA 4M8SA 1MG0A 2EHDA 3ZWPA 4UUPA 3NDRA 2RH8A 3IMFA 4ALLA 2O2YA 3PDUA 4XCVA 2P2SA 1DIHA 4FFPA 2FR0A 1HL3A 4DBZA 1P3DA 3WLFA 2F1KA 1LSJA 3VPFA 1LLCA 2X0JA 4CR8A 1WP4A 4DYDA 2Y66A 2H5LA 4OH1A 3ZNNA 2GDZA 3JQGA 5B4VA 3ZWBA 4ND3A 2Q1TA 1DFGA 2QRLA 4BGIA 2NUAA 3MJEA 3ZWMA 4NIMA 2Q2WA 2PK3A 4N7RA 2GGSA 3WYBA 3JQAD 2ZQZA 2NU9A 3AY6A 4F3YA 5A3JA 5COQA 5IZ4A 3NYWA 3QY9A 1T2EA 3RWBA 3LVFO 2EWMA 2JKVA 2BD0A 3PQFA 5GZ1A 2RBEA 2DLDA 4WEQA 3C1OA 2NSDA 4YEDA 1ZUD1 2EF1A 3DFUA 2YDXA 4UUOA 3I3OA 4U5QA 4Q3AA 2W4QA 4YT2A 1EK5A 2C2YA 4E2ZA 3GRKA 1MXHA 1E6UA 1IYZA 1YL5A 2WD8A 1YGYA 3UHAA 5JMWA 4NG5A 4XQEA 1BMDA 5MGBA 4IM7A 2OORA 4N5NA 3JD1A 4FSHA 3BTOA 2JFGA 4MKXA 2YY7A 1PJ3A 1YBMA 3GGPA 1M67A 4XYEA 3V8BA 3BHIA 1N92A 4FB5A 2CDCA 3OEWA 1W0CA 4R9RA 3ZU4A 4WCFA 4YWJA 4PLCA 1CIVA 3KXDA 3C3XA 5F3RA 1D8AA 3QQPA 2AHRA 2X4GA 4O1MA 1FDVA 4YRDA 5FI5A 4MP3A 4YAKA 2X0NA 1A4IA 3EZYA 2JD0A 4IS2A 4J4BA 3JCZA 4PLWA 1P77A 2PH5A 3EZLA 2BLLA 4RDHA 3QE3A 1PZFA 4GGPA 1DIBA 2FHSA 3D5TA 2DBZA 1X0XA 1BW9B 1Y8QB 4ZQBA 2A92A 2PZMA 3NGXA 1IPFA 2J3KA 1GFSA 1VI2A 3AOEC 2BGLA 4LVUA 4Y9DA 4DBVO 1ONNA 4DQXA 1ZW1A 4XGIA 3ZI0A 3P2YA 1JKFA 2Z1MA 4J2OA 2D2IA 4FJ0A 1DJQA 1NQOA 4OOFA 3BMNB 4PLPA 4RVDA 1BXGA 5I9NA 2X9GA 4WNIA 4KUGA 1R6DA 4UVGA 2X6TA 3ITDA 5DBGA 3H2ZA 3KSDO 2CD9A 4ESOA 4CM9A 1T2DA 2HUNA 2P5YA 2OP1A 4MVJI 3WICA 3WGTA 1DPGA 4CMAA 3BA1A 3VZQA 5IDWA 3IAHA 3JV7A 3PHHA 4FGWA 5B4TA 2GRAA 2X23A 4C7KA 1R4MB 1EE2A 1H9AA 1HE3A 2P4HX 3K6JA 3PYMA 3RU9A 1WDLA 3D7LA 3EC7A 4LN1A 5C7LO 3W4IA 4RL6A 1HT0A 5HS4A 3QLJA 5L4SA 1GQQA 1HYEA 5COAA 3ZWAA 3ZV4A 1MC5A 2DUWA 3C7DB 5IZCA 1T2CA 1WDMA 3JQFC 3JQEA 4UUNA 4FC7A 3SX2A 3ZDFA 3PLNA 2VT3A 4M86A 3HUDA 3QVWA 3OHSX 3TDKA 1BGVA 4QO7A 1M76A 1DOHA 1OBFO 1YL7A 2POQX 3AJRA 5JXWA 2P9EA 2IEBA 3DTYA 4FGSA 5CP8A 2PR2A 1I32A 4BMNA 3HB5X 3DZKA 4D3SA 3WQSB 4JJFA 2CDBA 1E1KA 2R2GA 5BSGA 2DPHA 1HTBA 4BNIA 1KVUA 2PV7A 3C8MA 3T4EA 1HDOA 4J9VA 1TB4A 4B4VA 5A1TA 5I7SA 3GVPA 1C0IA 2G17A 4L75A 3FBTA 1H2HA 2C0CA 3I6QA 1KVTA 1ZSVA 1F14A 5IFLA 2OO5A 1EFLA 3DHYA 3E18A 3UH1A 2Y1DA 4E0BA 1DRWA 1NFQA 1WZEA 1CETA 4IY1A 2UYYA 4Y67A 4YTEA 1PZHA 2AQKA 4FDAA 4O6VA 3ABIA 3Q1LA 4JJGA 4OIMA 4EEZA 2CF6A 5A5FA 2NM0A 2PTGA 1T26A 2AEJA 2PGDA 3GUYA 3BTVA 3GG9A 5JLAA 4AJJA 4PCVA 3FRJA 4BNLA 3LK7A 5JO9A 4IPTA 1WMAA 1QRRA 4EZBA 5KWEA 1Z75A 3GZNB 1NFRA 4FIZA 2CY0A 2GN9A 3GVCA 1IPEA 2YHUA 3LZ6A 2AMFA 3VDQA 3GN1A 3D4NA 3AUTA 1E6WA 1JVBA 5G4LA 3RD5A 1R4NB 3HB4X 1GUFA 3ETEA 1JKIA 4UREA 2I9PA 1YJQA 1SO8A 2Y0DA 4D41A 5DCYA 5I9MA 4N5MA 2GO1A 4AL4A 3E6AA 1D1SA 2JFFA 3DC2A 2FMUA 3RBZA 1PS8A 1GEGA 5DOZA 5JC1A 1B8PA 4PLGA 2QRKA 2ZK7A 5EQDA 3MOGA 3PVZA 1U1IA 4U6QA 1ENYA 1ID1A 3AFMA 4J4TA 1Y6JA 4L4SA 4JGBA 5I7FA 1XQ1A 2NQ8A 1XCBA 2PZKA 3K92A 5ITWA 1P1HA 2YV2A 4WLUA 2X58A 4YAIA 1LDMA 3KLMX 3MTJA 3OA2A 1AXEA 2BFAA 1UAYA 5AXCA 1YONA 3CXRA 3H7AA 1C0PA 3U5TA 1F06A 4XYBA 3U4IA 4II3A 3PHJA 3D4OA 4HBGA 3ZWYA 1N1GA 1O89A 2B5VA 4ID9A 2YW9A 5AXDA 4Y6PA 3AY7A 1E1MA 4QEDA 2WYUA 2VHZA 4L4XA 1UXJA 1KS9A 1UXKA 1RPNA 2D59A 4R4JA 5FYDA 2RAFA 4MOWA 4TRMA 1RYEA 4R3WA 1M6HA 5ICMA 2C5AA 3EMKA 5EINA 2B35A 3F5SA 3H65A 3LYLA 1U4OA 3RUAA 5JS6A 4HXYA 4DVJA 4GX2A 3W4KA 3QWAA 1DBVO 4G65A 2I5PO 4KOAA 2AA3A 3DHEA 5B1YA 4BS9A 3COSA 1KEVA 2NLOA 1P1JA 3ZNQA 4QT0A 1BXZA 3E1KA 2EERA 4CJXA 3AW9A 1BDBA 4F45A 2NTJA 1W4ZA 4M49A 3K8ZA 3JQDA 4J6FA 1B2LA 1KY4A 4CUKA 3R0IA 3GZ4A 1UP4A 1Y9EA 3FR8A 4NH4A 1YVEI 4HFMA 2FR8A 1J6UA 2NWQA 1RM0A 4WOJA 1BW9A 1Y8QA 4GBJA 2VOJA 1MUUA 1N7GA 3WIEA 1AXGA 2CMDA 4PLZA 3PIDA 4M55A 4ALIA 2C07A 5DCUA 5IDQA 4RVUA 2ZYDA 1V6AA 3U09A 1YB4A 2IXAA 3BMNA 3EUWA 1NTOA 4W4TA 4XB2A 1D3AA 1MX3A 4JQCA 6ADHA 2BI8A 1PJ4A 5F1OA 1TXGA 1LQUA 1Y8RB 4N5LA 5KJ6A 1NVGA 4MDHA 5KOIA 3G0OA 1LDEA 1KEPA 4UEKA 4H3VA 5L7TA 5JAZA 4E2XA 1UH5A 1CERA 4R1TA 3X2EA 4IXWA 4BKRA 3KYDB 1O9BA 1ZKMA 4JNKA 4GLOA 3GMDA 3GA0A 1NR7A 1R4MA 3DDNA 2VOEA 3GFGA 3KO8A 4Z9XA 1QYXA 1P1FA 4CLRB 2GCGA 2GZ3A 2VZ9A 4GKVA 2QZ9A 4YJGB 1E0DA 4NBWA 4AJKA 3ETGA 3T7CA 4CLXA 4W9NC 1LSOA 1EDZA 1R0KA 1PL6A 3GR6A 1VJ1A 1VPDA 1ZH8A 3A9WA 4J3FA 2Q1UA 3RCBA 4J91A 1TI7A 3H9GA 5BT9A 1HDRA 1EDOA 4XR4A 5G0SA 5U9CA 1UXHA 3WX0A 4PN3A 3TL2A 2GD1O 1SEPA 1ZJZA 1XYGA 1ADFA 1YQGA 3AU8A 4CLEA 4R51A 3P19A 5AXAA 2AG8A 4FPXA 1MB4A 4W9NA 3GPIA 4CODB 4EUHA 4TZKA 3ADOA 5A9TA 4EEXA 4ZU3A 3M1AA 1YOVB 4EJ0A 1MV8A 4H7PA 3ZU3A 3K31A 4BV8A 3PZBA 5TS3A 1R37A 4NFYA 1TVEA 5TNXA 2BFPA 4AJHA 1WDKA 1BHSA 1U3TA 2JL1A 2OBNA 4BQPA 4CM7A 2AG5A 4K1LA 1QG6A 4O59O 3F4BA 1ULSA 4JX8A
chains in the Genus database with same CATH superfamily
1XD8A 1Y4SA 4U7FA 4K6GA 4RPHA 4W1RA 2G3YA 5C5EA 2H4ZA 3FOAA 1FJXA 2C98A 1SBHA 3H3XA 3IE2A 3PDIA 4W7HA 4C3OB 4CGZA 4U2DA 2O7SA 2QMUA 1DXQA 3V2UA 4BMXA 3FH0A 5CXQA 3C3YA 1YBVA 6GPBA 1HNZB 3L43A 4FFBA 1XPOA 2J5QA 4GI7A 5F23A 1X1DA 2DFPA 3SU8A 3VHRA 2NNLD 2WWGA 3NAZA 3ZWVA 3ZVMA 3P7MA 1GFIA 1V96A 4WUTA 5H80A 1XMVA 3NKFA 4BBPA 4UXHA 1KAHA 4G1VA 2RAPA 1DC4A 3MTQA 4TXMA 3LUBA 4JI1B 3DAYA 1GSIA 1KJ8A 3UA3A 4P84A 3ZOKA 5H4GA 4ALNA 1EDDA 2UZ1B 1YRHA 4RHUA 3P5BA 4UTRA 4WXRA 5K51A 2ZIEA 1Z33A 5A05A 3RS7A 1U3WA 1R4NA 4EY7A 3QOFA 3TLKA 1V45E 2B30A 2GZ2A 3FLBA 4H1WA 4DRZA 4MW4A 1M2NA 4QOJA 5A4FS 1NZDA 3DEIA 4IIXA 4PQGA 4IV8A 3ZKAA 1K6JA 2GAIA 1SZCA 2X2EA 4KLZA 3COJA 2B5WA 1TLFA 1H6DA 2G5TA 5B3AA 3KQSA 1URPA 2NAPA 4DM7A 1YE5A 1JQJC 5A71A 2YN0A 2PX6A 3EAFA 3FW1A 4NZYA 4POAA 1V26A 1I7NA 3G9ZA 3WBJA 4C6TA 1BNCA 4DTCA 1NKSA 2JCXA 5BWOA 1SUIA 4N39A 2CKDA 3FPAA 4D4KA 1XLTA 4Q4HB 1JQDA 1WVMA 2WMYA 2D0OB 1PJLA 5JMPA 2ZWPA 4PWZA 1SBZA 4EB6A 3ODGA 5GMOA 1VG8A 3R0XA 2A67A 4GMFA 1E1CB 2HDHA 3ZY4A 1YXMA 2D1SA 2VTVA 3HDJA 3N2KB 2NOAA 3NR2A 3HCEA 4I2VA 4DZZA 3EDYA 4ZT2A 2WF9A 1KH3A 3H0EA 2Q5FA 2VSXA 3IP7A 3OZEA 3QU7A 4IYRA 4KL8S 3PJGA 3PPXA 4IHAA 4ZHQF 4DSOA 1KC3A 1HXHA 3ACBA 3HB7A 1KMIY 3C6KA 4BCDA 1YIDA 2PMKA 1VHWA 3DLPX 3MYYA 5EG5A 4PAGA 1WMSA 4E1VA 3M6VA 2FZEA 2GFIA 1Z0FA 2CNKA 2HK7A 2R2AA 4QODA 5GJVC 4NYIR 2GNAA 5JXJA 1P0MA 3EULA 4RESA 3CKYA 1W4CA 2GZ1A 2HMVA 3E15A 5KJEA 3T0GA 2ZSJA 1LTHR 4TM7A 3X1XA 2XGSA 2Z5GA 5AVVA 3MJCA 3HU3A 5JQWA 3AEKA 3JYLA 1KZ9A 3PUHA 5KTYA 1VQ1A 1G21B 3RC9A 3LUAA 1P61B 5HW0A 3O82A 4QNRA 3VDMA 3HL0A 1SQSA 1FMTA 3CRNA 1NW9B 2J48A 3U3KA 4CG2A 5CA0B 3KELA 4NSNA 2UZ3A 2I4TA 4P5DA 3AX6A 4XH9B 2E4XA 2NW6A 3MAGA 2PZ8A 4YJHB 3EZFA 4BFUA 4U2CA 1DTWB 4OQYA 2SKEA 5EKUA 5KPDA 1GPYA 2B92A 1GDDA 2JI4A 4FSXA 4OPMA 1EJ6A 2R8YA 3MS2A 4FFLA 1V25A 4F4DA 5TF0A 4AM8A 1UMBB 1PJAA 5C46F 3BVPA 3HKDB 3RASA 4G37A 5LXTA 1XMSA 3HP1A 3HJCA 4RJJA 1Z2CA 1EVYA 4JYCA 3NEYA 2JHCA 4K9KA 4EPWA 2PXHA 4CF5A 5ITZA 4CV0A 5IAEA 2QF7A 3M9WA 3K2QA 3NETA 5F78A 3GJ6A 3SLGA 1MP0A 3B12A 4BB0A 4CMGA 2VP5A 1KK2A 3EGDB 1OFIA 2DQKA 4G89A 1UQRA 2AEFA 4UBNA 4X60A 6YASA 3B3GA 5K0TA 4QARA 4EMSA 3IQDB 3HBMA 2H3HA 2NU6A 4E09A 1HNNA 1UBRS 4UTPA 1NASA 1K6MA 1NPDA 4BO5A 3ZGVA 4XRGA 2WI8A 4ZOBA 1MABA 5HPYB 2XUJA 1VPWA 3HPRA 1DJNA 5KYKA 2DPMA 1JDSA 3HBAA 3S4YA 3G82C 4B2YA 3TZLA 4D5EA 2P3SA 3KE8A 4QKQA 3T61A 3CLSD 1QHIA 3UCFA 3BBLA 2YV1A 1ESEA 2BUAA 1N2CA 3VO2A 3JQEA 1DCMA 4R5MA 3TW8A 1JZTA 1YZNA 2AQIA 3AGQA 3SC6A 3RYCA 2LDXA 5CT5A 4CM3A 1IY2A 1NN0A 2Z4TA 3DTVB 3H1FA 3I2YX 1VKNA 3L6EA 4D3DA 1ZOOA 2PPLA 3VMFA 4JEUA 4FEGA 1A9XB 4QLOA 5CA0F 3RLFA 1ZMBA 1R66A 4BJ3A 1EQAA 2QJFA 3CBGA 3Q6MA 4HAWA 4NBRA 3U7QA 3JYPA 3F74A 4INAA 3S70A 5KNCD 5LJIA 4MMYB 2W2OA 3CWQA 4ZOCA 4NAUA 4J1TA 4K9OA 1XEXB 4BNVA 1X9GA 5EI5A 1PNRA 5ILQA 4GYWA 2BONA 1DG1G 1I4LD 1Q0QA 4Y18A 2EHJA 1JEAA 3IBTA 3U49A 3LFUA 1IBLB 4DMCA 1ZOLA 5AHKA 4B4WA 4B3GA 5HSGA 1RRCA 2PLRA 4Z8YA 2R86A 5DIZA 3RUFA 1QS0A 1DB3A 3CH7A 3F6YA 1XC7A 3LT0A 3JQAB 4LX8A 4NJOA 5IAAA 2ZSFA 3UBTA 4IFEA 4DG5A 2EL7A 2AXQA 4EG1A 4UAVA 1DDOA 3TK1A 2CLOB 5KTMA 1QH8B 4N3AA 3ZR4B 4K9NA 4RD3A 1H1LA 5E6RB 4EHBA 2ATXA 2VNAA 4PS0A 5CK5A 1NP3A 1OT3A 4C89A 2Y9PB 1HG0A 4C4AA 4NU5A 1XT6A 4QTTB 5I9LA 4D26A 4M53A 5BW5A 1P29A 4HH3C 4CL8A 4MJ3A 3S2GA 4GZMA 2XZLA 2Z8XA 1JHRA 3QWBA 2ZB8A 1E0SA 1GPLA 2I3GA 4JFAA 3W2GA 3ZWCA 1RPZA 3BM5A 1ZRNA 3EUAA 1G7SA 1Z4OA 3NDJA 1PZXA 3A2NA 4R01A 4X6UA 1BMFD 4QSMA 3ZBQA 4JQOA 1JEEA 3M34A 3PHCA 5H1YA 4ARZB 5AVJA 5K0SA 2BKVA 3FPCA 3QTBA 1H6CA 1YOBA 3Q7SA 4URUR 4F4IA 1KQFA 3CEMA 4RCYA 1EB8A 2DTXA 4KODA 5FTJA 5LDDC 1T2AA 1TFUA 2HO5A 3IIMA 1FPQA 4NBNA 3LC2O 3R1IA 1XROA 3L7LA 4ZI7B 1J8FA 4EFDA 3LDGA 4V0LA 5FB3A 2DF8A 3WLAA 1ZKDA 2GAJA 2Q4BA 2TRSB 4ZREA 3AB3A 1BH2A 2PRJA 2UZ1A 2PDAA 5JW6A 3JZFA 1I4EB 3EDMA 4XR9A 2J07A 5FPQA 5JYBA 4YCSA 1FZTA 3FVQA 2FZVA 3CNBA 4XYMA 5I7WA 4N8DA 3W6OA 1T1GA 3SYTA 2WJAA 3KYBA 2WBLC 3TOCA 5G0TA 4KIFA 2MSEB 5C8XA 2YXEA 3VZDA 1YJ5A 2FZKA 1C3XA 1JAIA 4UHKA 2CHQA 4D92A 4YRBA 4YUAA 4EWLA 3P52A 3K0CA 2ZYWX 4IOJA 1KTVA 2V97A 3ETDA 4HS9A 2D2XA 4LYJA 4HZUB 2FUNB 4MV1A 2B25A 4DILA 4BVFA 4Q3OA 3KZNA 1NX9A 2FMIA 2JGEA 3ZQKA 2Y1CA 3OZAA 3ZHVA 2AD1A 2NYAA 2MSCB 3NWOA 2VDMB 3MLBA 2Y77A 1RJWA 2PMBA 3BORA 3CSSA 1S4QA 4FMCF 5T5QA 4KYVA 3VV3A 3QEOA 4Q4HA 5DYYA 3QYAA 4P4TA 3G5AA 2ZULA 1QIFA 2JHPA 5T4BA 4G0QA 3WSTA 4BBAA 1AX9A 5CPFA 2O7NA 5IKOA 1JFFB 3VGPA 3W8DA 1QP7A 4JMLA 1C4WA 1Y1PA 5HUQA 1FVFA 1E1CA 1G7RA 1I5RA 2GLXA 2H8KA 2QXYA 3I52A 3N2KA 2D5AA 3ZCSA 3EFHA 3EAGA 4S05A 4KHPB 1ZEMA 3TLCA 4GPEA 2XQIA 4D44A 3NDBB 3AVUA 1DP4A 2QRUA 5DYWA 4B4OA 1FE8A 2VNKA 4ZAWA 3H05A 1DAIA 2PEZA 2H7XA 2B21A 2B69A 1QRSA 3M6AA 4ER7A 2DOKA 1OFVA 2I33A 1WTAA 3M6UA 4ZI7F 1V8ZA 3G7SA 4MDYA 4O8ZA 4X7PA 5BW8A 2AMVA 1EFAA 2QZZA 3JQ8B 3GVXA 2Y2UA 2C99A 1RXEA 3V2HA 1GPAA 2HSWA 1U2TA 1K5HA 4NBSA 2A0WA 4CI9A 4NZOA 4FYWA 4TMFA 2O5EA 1YS2X 3I9NA 1G21A 1Z12A 3BDAA 1Y48E 3CLSC 4YRPA 4WBNB 4Y7CA 3F0TA 1JFTA 2MJLA 2VSNA 1NMQA 2OCBA 4PRZA 4NEQA 4EQ6B 2CFTA 5ALKA 5AM1A 3RIMA 5TX7A 1B8NA 1CUFA 5HKLA 2UVPB 5CA0A 2WPNA 4XB6B 1B3RA 1R18A 4NEHB 4WINA 2V7XA 3UV7A 3D43A 2VDLB 3WYDA 2BEVB 3SX0A 3M6IA 3KJFA 1B73A 1INLA 4YJHA 5B1DA 2FJPA 3QXSA 4MQUA 4RVHA 1DTWA 3AEXA 1BOFA 4X1OA 2CXNA 3WISA 3AMVA 4ERXA 2VC2B 3CSDA 3F3MA 5HIJA 3ZC3A 3M83A 4PWYA 1SUBA 3CPSA 3KKQA 1Z0IA 4UJ3A 5CRIA 3SZLA 4BNHA 3ANNA 4PQYA 1ZD9A 1N9ZA 1J0AA 1UMBA 1I3OA 3FKSA 4TTQA 1EIZA 3QU2A 1OWPA 2CVZA 3ZV6A 4QM6A 1CG6A 3HKDA 3NBQA 1N0HA 4HVTA 3RAJA 3QFSA 5KVVA 2C77A 3RFFA 2CZGA 2J59A 1QMGA 3EISA 5GONB 1VDMA 2EKLA 1EUCB 2EJUA 2IFTA 1V3TA 2YMMA 2ILVA 1HDCA 4FHDA 4PZCA 2IYSA 5ALEA 3CW8X 2QV0A 3EGDA 4WJZA 4D0SA 1RFLA 3R6DA 2QM8A 3DMTC 4YP9A 1GNPA 4I9NA 4CQMD 3I0ZA 1OHHD 2XVMA 2Z3WA 3MHPA 4BVAA 4AJNA 3D6FA 3QBDA 2CUKA 2HKIA 3P9KA 3DUWA 3BWXA 2APJA 1J23A 2VJBA 3WIBA 1LBTA 3LTNC 4FKZA 2ZXUA 3FOZA 1HE8B 4S0XA 2VXCA 5DBFA 3EUEA 2FB9A 4YDRA 2W58A 3AR4A 3FNRA 1R8SA 4WKGA 1KY3A 2A57A 3ZCQA 2GJKA 1QOPB 1TGVA 1YJAA 3PYLA 4XTCS 5ERYA 1EAMA 4RPJA 3TIIA 1CJUC 1TYDE 4YP6A 1PHRA 4GPIB 2E5WA 3R6LA 1XMOB 3VH2A 4JBYA 3GL9A 3T5BA 5JYDA 4F56A 2C9ZA 3UG7A 2ZAOA 5HZKA 4MK4A 2ZGVA 1JR3D 3DTVA 2MIIA 5KYNA 5JS1A 1KEUA 1A9XA 1LPNA 3W2EA 1EE9A 2I1WA 5MHTA 3JTMA 3WL8A 3CISA 3A4IA 1XRSB 2QRHA 1GCUA 3H5TA 4QDZA 4FILA 3SZMA 2GPWA 2G40A 5EUQB 2JLXA 1R6XA 2RCYA 3O47A 1XBTA 1XK7A 4RV4A 4RMJA 2PCJA 1F9EA 2I7DA 1OVMA 1CEEA 3U9LA 4DR4B 2X41A 2RONA 5G40A 5FH9A 5E0OA 1XEXA 4LHEA 3GJYA 3KALA 4UNSA 3E48A 1E62A 1T36B 2I6GA 5G2OA 1QC5B 2ZUFA 1ILEA 1M5RA 3PRYA 1IOLA 1UT6A 5DLYA 5DISB 1EEXB 1E5DA 2C3OA 2NTYC 2YUTA 4K86A 1XYYA 4NABA 5G4KB 3NYRA 3VPHA 5GONF 3JQAA 3HJGA 5DVZA 1OTHA 1WB6A 1R5OA 1P3Y1 1SHUX 1L7NA 3CZ9A 2C9MA 3OICA 4QU5A 4Y9RA 1M6YA 4AULA 4DG9A 1WZ2A 2A0KA 4QOFA 4C30A 3W4JA 3RBXA 1QH8A 1XZLA 1Z47A 2Z9BA 4O5AA 2XHEA 2QN9A 1MFPA 1T1RA 3GFTA 5LC1A 1T6BY 4K2HA 4OL9A 1WXFA 2XADA 4J7UA 2CLLB 4QOEA 1B8VA 1D8TA 1TMGE 2G4CA 2IEGA 2C83A 1AGPA 1Q20A 2PU7A 3ESAA 4BLQA 4YR9A 3K70C 2XMQA 4OP2A 1NW5A 1YB1A 2NO4A 2VTEA 3OIDA 4BC0A 1TAUA 1T5LA 4EBBA 4L8FA 4PFQA 3ERCA 4JODA 4TSKA 3WLPA 1E2PA 1SKUA 2W6JD 3WK7A 4B45A 4Q1FA 1FLNA 3VYWA 3OFNA 1DEKA 4L2IB 3EFBA 1SN7A 2P2CA 2X0DA 4CCAA 1ZLXA 2C9DA 2ZI4A 3BXOA 3L6UA 4YAJA 1E58A 3RKUA 2VWHA 3NVDA 3CVYA 4L5CA 4XWKA 4ARZA 2ZDHA 1I2CA 2IHUA 3NEAA 1Q2XA 5F76A 3VAZA 1TTHA 2O2ZA 2ACKA 2IEIA 1N6LA 4GOLD 2CXXA 3QKRB 4Q3LA 2QPLA 3IQHX 1SIUA 4JLWA 1NRXA 1E4OA 4ZI7A 3GLRA 2FWMX 2G6BA 3HCNA 2BH2A 1RHQA 2GXUA 3QUQA 4G0NA 5EJGA 4DQVA 4WEOA 3AUUA 5BYAA 2NP6A 4KU4A 4C0LA 2ECKA 5AYVA 1BC5A 5ALPA 3P20A 4C14A 3MVEA 4WN9B 5C5DA 2VYFA 3P2JA 1JJ7A 1JJFA 1JV2B 1V9LA 2JEZA 2Q2NA 2FSIA 1NUAA 1TQDA 2GYYA 2OP0A 2W6ID 3OPQA 3L7OA 3RTBA 3SC4A 4B3SB 2X3YA 2RAVA 4L73A 1I7SB 3FPLA 4IXDA 2Z2YA 4PYOA 3IPXA 3RODA 5KTPA 1A97A 2ZRPA 3JYHA 3NT2A 1TZJA 2VBCA 5EUMA 5F2EA 3MUOA 1L7DA 5JPCA 2XUHA 1XI2A 3ROXA 3WWZA 5CLJA 3NHZA 4UHFA 3RJZA 3UHPA 4E6PA 2B8EA 4HGQA 2OM6A 4HZUA 4HGOA 3BQNB 4LTDA 5CM9C 3O8CA 4XWAA 3FPFA 4BQQA 3DZDA 5C1IA 1AOXA 4JI0B 4LVCA 1JJVA 5BP7A 4BWVA 4QATA 1MD9A 5D5HA 3AV0B 1I3KA 3FHOA 4KOEC 4DIUA 4EG4A 5CVDA 3T12A 3AUYA 1RZRA 5REQB 2FN7A 3UXMA 5F5NA 2KWIA 2QT9A 2WC1A 3OIGA 1IK6A 1FFWA 2IYZA 1BAPA 3GEDA 4I1YA 5KKAA 1DT3A 4FINA 4EKNB 5L7WA 1JFFA 1A4UA 3NYQA 4INPA 1PGNA 1LJUA 1N3YA 3EE6A 3KJNA 1NVMB 5GZ6A 1DRVA 2ZYUX 3BDVA 1A8SA 2V7BA 2ZB4A 3WNVA 4NQRA 1P4AA 3TXYA 3DZGA 5A02A 2UUPA 1UP7A 4DJJA 1RE1A 1BE1A 4U0JA 4KBGA 3P5SA 3I09A 4RIFA 3BB4A 3IQWA 2I8LA 4H6PA 4RAOA 5EYPB 4YV0A 4WKBA 2JATA 4CIVA 2SCUB 1JQKA 3FF1A 1JH9A 1WABA 1LLFA 1P9NA 3LQYA 4R2XA 2W5UA 1ESDA 2AW5A 3R7WB 2QLJA 2JJ2A 3JQ8A 3A4TA 2Z08A 4DCMA 1P0FA 3EH1A 1Z83A 2ZQ5A 3AT1A 4X20B 4ZT7A 5L3ZA 1MDFA 3D0RA 3SHQA 1D4ZA 2Q41A 1K66A 1LH0A 1JR4A 3U9SA 3D2BA 3TM5A 3VJMA 2V0CA 4S0ZA 3TNFA 3CMMA 2Y4OA 4WBNA 3DMGA 3KZCA 3FNHA 3LGAA 1KJNA 3O8LA 4DZRA 4LSGA 2H08A 3V1UA 2ZAIA 1ST3A 1EXDA 4RZXA 2V4MA 4P7KA 3NHUA 4PC3A 2R8OA 1FTYA 2UVPA 3E9RA 3IJEB 4TSFA 4OP1A 5AUQA 4AYXA 4UQLA 5K6TA 2IDKA 3ANMA 2VJNA 3P0HA 3K7EA 2BEVA 3SNKA 2ZRQA 1F3OA 3FYUB 1M8JA 4AQDA 3O8RA 3ZVNA 4M0LA 3OJWA 5M7EA 4R41A 1Q0UA 2E2WA 2NADA 1J2UA 4IKEA 4EUSA 2XSZD 2J31A 1V7ZA 4LK3A 3L8ZA 1A88A 1TYAE 4G07A 1JWBB 2DHCA 4D4LA 1IVYA 1HRDA 3EZ6A 1NF9A 2C2OA 4MO2A 4LZJA 4MV6A 4BAZA 1IXSB 4UULA 2WWYA 3FR7A 3OE7A 1KR2A 4JI3B 4CQLB 4AQ7A 1U3DA 1S0UA 3DMYA 2GBLC 4Y6SA 2WNSA 2BLNA 2PLFA 2GILA 5GONA 1EUCA 1GZ4A 1LZKA 3KS9A 4LCJA 5EXTA 5G1PA 3MCVA 1NBAA 2W8ZA 4AIIA 1PZNA 4WRRA 1P2BA 3UT5B 2GHIA 2WJIA 1H4TA 4HJXA 5LZ5A 1R27A 1VXRA 1Z18A 2A0UA 4C5AA 2PZFA 1CB0A 1P5FA 3ETCA 3ID6C 2KSQA 5H16A 1OI3A 3TJRA 2OM2A 3VR0A 1JI3A 4QDJA 5GM2A 4MS1B 3BICA 4Q9LA 2YZ7A 2BJHA 3NDIA 4MV8A 3RRFA 1AUOA 4N3BA 4BL5A 1Y42X 2FQYA 1Y1QA 3SHOA 2QG6A 4ROSA 3O8OB 2GM9A 2QDXA 3A1WA 4LISA 4OAQA 4E13A 5EP3A 1I2DA 1K3UB 2BH9A 3EA4A 2XB8A 4OQZA 2IELA 2ONYA 3K0KA 4E3ZA 2CJFA 1R6VA 2Z9DA 4G81A 4N65A 5U4QA 3LOUA 3IUJA 2XNKA 4QQNA 2B34A 2ASVA 1ISFA 4AUNA 5TQ0B 4YO7A 5F4BA 4DIBA 5CGQB 2VRNA 3MCWA 3EZ9A 4YMGA 2DLCX 4RIHA 3ND9A 1VLZA 1D03A 3AXTA 3BGDA 3I8SA 3F9CA 2A9OA 2JGDB 2DFLA 3BWDD 4FHFA 4LJAA 2QV7A 4HDMB 5AICA 3ZTWA 4D4GA 5IANA 4JI4B 3AM1A 4X8OA 1Y5NA 5T6MA 4MQ6A 3UWKA 5ER6A 2WT9A 4Y0VA 4OK5A 4H7JA 1M8KA 1T36A 3MCTA 3IQXA 4E3WA 1QC5A 2IT1A 1XVUA 4ZK2A 1YU9A 1WW8A 5DNEA 4JU8A 1J4AA 3PQ5A 3LWNA 5G4KA 2OHVA 5FLEX 1Y8AA 3AZQA 4Y2TA 8MHTA 3TRIA 5EHNA 4WK4B 5KQMA 3I01A 2J4FA 4LC0A 1XKTA 4Q19A 4NENB 3SYMA 2KB0A 5AWFC 4ZVMA 2DM6A 1T6NA 4DR2B 4W1SA 2IEAA 1C8KA 5ADHA 1TADA 2BKXA 4JOSA 5D1NA 2XJ9A 1BZYA 1J39A 3D4LA 4AD8A 3S29A 1M2JA 1ZY2A 2RB5A 1XMIA 4FN4A 5L9AA 2ZM5A 5K3CA 3BWCA 4JJ4A 1U3FA 3ZQ4A 2VBGA 1FP2A 2DAPA 3WWYA 1OT5A 2O4CA 5LP6C 1ZI8A 1N6HA 1SHJA 3M1YA 4O33A 1C1HA 5TJ9A 1X9IA 2HHHB 4RY9A 4L2IA 5DIFA 3HGTA 4J0KA 2VRBA 4BEVA 2VZ8A 1GQOA 3CCCA 2GTIA 2PLWA 2Q3LA 1OAOC 1B6SA 2OCKA 4A92A 4XUEA 1KC1A 4MSUA 3V8PA 1YB2A 1NJ8A 2AT1A 2YHAA 4LDJA 4N54A 1L0BA 3QKRA 2DCUA 2ERYA 5EJ5A 1DAOA 1VRCA 3Q2KA 4GPBA 5DWDA 1L4NA 5GPBA 1OOEA 1EHYA 2HU2A 3QTTA 5F64A 4DQKA 3AVTA 4P2GA 2VNIA 3H9EO 3P0FA 1T4DA 3RBAA 1XZNA 1ZN7A 3GY0A 2WVGA 3DULA 2QNIA 1RVDA 1BDMA 3MRVA 3R3VA 4B0PA 4MB6A 1YZ3A 4WN9A 4OHRA 3HCOA 4QXOA 4ZO7A 2OV6A 5F52A 1P5JA 1R4AA 2X15A 4PPYA 3S1AB 4J8PA 1GGHA 3QY0A 5KKNB 1ZHFA 2OZLB 2BT4A 4KXNA 3FIJA 3ME5A 4DUYB 1GNTA 1C4KA 2VJKA 3CKMA 5E4JA 1RRFA 2VLIA 3AI2A 5LLTA 4EUEA 5CDTA 2VJDA 3O0DA 2RHOA 1EH5A 1T35A 4X8MA 1ZD4A 1AB6A 3OOJA 4KPYA 3F9RA 1E1RD 4HC4A 4ZT3A 4LF6B 3S2IA 2ZUDA 4EG0A 5TS2A 4R1PA 2OC9A 1NJ2A 3ZIUA 5CB4B 1X1RA 2VT2A 2NT3A 4EA8A 3KVOA 2CDAA 2VBIA 5HM8A 2OCPA 4DDMA 2BCJQ 5E7MA 4EPYA 4FDMA 2J9YB 2QE7D 2XWBF 3PL1A 5REQA 5BV1A 2UYCA 1QJ4A 3TN7A 1H2FA 2A30A 4A8JC 3I9KA 2FRXA 1PYOA 5AXBA 1FTQA 5FTLA 4JLSA 5E9WA 3U16A 1UT8A 4CCSA 3FNFA 1Y9AA 4RF4A 4X54A 1UXIA 4QU8A 1E0AA 2WTBA 3QVTA 5CJ2A 3DW1X 1DWOA 3RYTC 4Z1MD 3M6WA 1ADYA 3LLVA 1PS9A 2IDMA 1GLVA 3R9XB 3EIOA 2QR2A 1IN6A 1RLJA 3D59A 3JWGA 1AHNA 1VMAA 5EYPA 3UW3A 4E31A 3K9QO 1RHRA 3ILYA 4W8GA 2SCUA 4QUKA 1VLVA 3QOWA 1M2EA 4LX0A 1AHIA 2QRJA 1NG9A 4XQCA 1ZD3A 1U7WA 2R79A 3K2BA 4K46A 1W30A 2ZJAA 5LBTA 1FL9A 3REGA 4BLPA 3IAXA 3R7WA 3Q3EA 5JNLA 2WINI 2ZUCA 3INYA 4RQUA 4L3WA 4Z7JA 1EB9A 1Q6YA 3V1MA 4X20A 5IK2D 3C98A 4LF7B 1TL7C 5EUCA 1YQTA 1Y5LA 1SB9A 1F2VA 1RNLA 2OVFA 4GKBA 3UH0A 4ZGGA 5B6IA 2X6QA 3OWXA 1NR1A 3WMWA 1PGOA 1AURA 1UBKS 2HOQA 3M82A 1PJSA 2IRWA 3DBRB 3FM9A 4KQ1A 4WK6A 5DYNA 4DWOA 3GNQA 2H17A 1IVNA 2R62A 1JDBB 2ASEA 2C7BA 3TFOA 5FBHA 5GIPE 1JLLB 1DKUA 3AJDA 1PX2A 2GHQA 2QG9A 2QLBA 1Q1EA 1SXGA 1VB3A 2HPHA 3AP3A 2ZP1A 3FYUA 2FPLA 2Q29A 3DT6A 1ZZEA 3FETA 4R0VA 3ROMA 1RE0A 1TO6A 3LLCA 2D74A 1X87A 1P6QA 2V5AA 1TW3A 3I83A 1WMDA 3G2NA 4QPNA 4ZOLF 4RF3A 4FOOA 4IAOA 4M0MA 2EJBA 3N5KA 3PGXA 1TF7A 3FUWA 3GARA 4LGYA 1DAGA 1NSYA 3DL2A 4LXXA 4CV2A 3U7EB 4H1UA 3B7WA 4JROA 5CT4A 4BDSA 4CQLA 3KEMA 3PWSA 1W1UA 3PVCA 5HF5A 1MEOA 1WM1A 2Q5QA 2OXIA 1TRHA 2Q8QA 2V7QA 1OBHA 4YBRA 2JAWA 1LTKA 3M5PA 3EWAA 3UT5A 2DGDA 3FCXA 4GD3Q 1KFCB 2Q7DA 5LL6P 3OPXA 2BDEA 3N8NA 4GQIA 4MUEA 2FF7A 4UFNA 4AP6A 3LQQA 3V7YA 4R71A 2ZREA 2WKRA 4GU5A 3ADDA 1YZUA 1YBHA 4U7HA 3Q2IA 1HM5A 5K4AA 1LI4A 4N7JA 3ETNA 2XZOA 4MS1A 1U28C 4CR6A 3UGJA 3DDOA 3S68A 1ORHA 2O1XA 5AJWA 2GARA 4KJZA 4MVJA 2VPPA 3V4FA 1N36B 2QTNA 2ZBUA 2ZBRA 5CURA 5C8DA 3O8OA 3JVEA 1MX5A 1SUFA 1BFUA 3WGOA 1IL0A 1FSZA 1BSVA 1JSLA 1UF9A 3GGOA 3HQ4O 3HSKA 3HUTA 3MBOA 3NI2A 3FOWA 1LFDB 1SHZA 1CV2A 4LOIA 2VPYA 1IJKA 1B1AA 3UAGA 3L92A 3CF0A 4BP3A 1QU2A 1FPMA 1PS0A 4S2UA 2FWAA 4L4YA 2IYXA 4M89A 4GZ6A 4Q7JB 2DUUA 2IYUA 2XZPA 1G4UR 2HX1A 3C5EA 4QXMA 5TQ0A 4URVR 5DM2A 3UMBA 2A58A 3C5VA 5FOSA 3R9KA 2YV5A 1NM5A 4LEIA 4ZC1A 5HTKA 4C43A 5KKCA 1AS0A 3FHTA 4R05A 4ZAZA 1NYQA 2JGDA 2YCLA 2P0EA 4HDMA 1N3IA 1HZZA 4KI7A 4UW9A 4DIEA 4MS3B 4EW3A 1UPCA 2B4AA 1X38A 1IXKA 1TF5A 1ZGBA 2WYWA 4QGBA 2ODWA 3HY4A 2QD5A 4LCEA 1MVOA 4Y98A 2C95A 2EZ8A 4YCAA 1EDEA 2JA2A 3EGOA 2C1ZA 3EVDA 2AC2A 1G5RA 1SUWA 4XDYA 4BRZA 4LOJA 2IYPA 2C4UA 4HZIA 4JQSA 1TCUA 4CPDA 2C61A 3S2EA 3OOWA 3L05A 3VVLA 4LNUB 5LWHA 4BTEA 1TDJA 4K26A 5I4BA 2BGUA 5CJJA 2AYZA 1JR6A 1HETA 4MCJA 4OCZA 1V16B 4NENA 4BQIA 4CW7A 2IUTA 2B1GA 2CBGA 3WRWA 2C8KA 4H1HA 3CUUA 5D85A 3M6MD 4B3HA 3W5AA 1XVIA 1O4WA 5JFGA 1O5IA 3GOHA 1IN8A 2AGVA 2ZATA 3GQVA 3IMKA 4PHTA 3I5YA 1EGMB 3AUJB 1ZMTA 1W93A 1J9GA 3HV0A 3O4GA 2R6GA 3E82A 3FAZA 3M0EA 3MW8A 4E46A 5K8UA 1HH4A 4GXTA 4NE9A 3PNLA 3DTTA 1L1FA 3JD3A 4F84A 4JR2A 5B4UA 2CBZA 3LXXA 3R7AA 3CC8A 2NZVG 1TMKA 4JHLA 4MQMA 4CUZA 1N6IA 1YU6A 3BIOA 5I3CA 1W4BA 1W46A 4B6QA 4HB2A 2Q4OA 3D9QX 3O84A 3WP1B 2A9PA 4D6PA 3KKEA 2R6FA 3CEAA 1L5KA 4MUIA 1T9KA 1XCLA 2PWAA 3HZZA 4MRSA 2WQ7A 3OQVA 2HPZA 4FHZA 3KJIA 1OFUX 2WSYB 4EL5A 2VYQA 4GLJA 2VT6A 4JGGA 3H18A 1FU8A 3DO5A 4HN2A 3CE9A 3UJ6A 2IWHA 3UAYA 1BEZA 1P7WA 5B12A 3NM4A 5ICSA 2YYYA 2LKCA 721PA 3DL7A 1ULUA 3CTPA 5AKYA 1ADBA 3QENA 3F6EX 5ALYA 2YJNA 3X1WA 1Y3IA 2IOQA 2H0QA 2Z9CA 5BVHB 2J87A 1HA3A 1NVTA 1FFEA 2LRHA 3JQCA 5FUXA 3S1AA 1KIMA 2CV0A 1P73A 3AUAA 1CRZA 4FZ3A 3T3EA 2OZLA 4OHFA 4FBLA 2EKPA 2JLWA 1XTIA 5GV8A 4PNPA 1KJQA 1ISIA 4YRRA 2JDIA 4NARA 4Z86A 4PX2A 2ICAA 2PSJA 4ZICA 3V55A 4Z0HO 1R7RA 3PQ7A 4JLUA 1U5AA 4N47A 1H2EA 2HRZA 1DJLA 2R8RA 3CX8A 4M1SA 4QPCA 4R1NA 4XQ9A 3VNAA 3B5EA 4EIWA 4FWBA 1OA1A 2XI4A 2XNCA 1A5BB 3OTHA 1H42A 2QL5A 5CB4A 5L6LB 3P4UA 4B3TB 5IAGA 1YBFA 3K32A 4U7GA 4UTZA 3UHFA 4DIFA 5I9IA 1V2GA 3STHA 4YIKA 1QP4A 1J06A 3QI2A 4Q1BA 4F8EA 4RM2A 4XGQA 1WF3A 2YWDA 3H8VA 2OUIA 3W78A 3KZKA 2DJ5A 1YB5A 1Z28A 2EX1A 3W8FA 4K6FA 4CF7A 2E7ZA 2IPAB 2EVWX 4TTSA 2Q0HA 1YE8A 3VJKA 1Y1KE 2HMUA 4KMMA 4EW1A 2VKQA 3O2NA 2C2GA 3FFAA 2PMCA 4QYSA 3IQIX 1HT1E 2G9RA 3ROKA 2OZKA 3STYA 4BQNA 4E1BA 4UQPA 5A9RA 2EP5A 5EIBD 3R9XA 5FFMA 4OQNA 1OXTA 2XCIA 2IS1A 2DMRA 1JSZA 3GUUA 4KFRA 4OHMA 3W6ZA 3ZHBA 4TMXA 4NMXB 4MZXA 1DQYA 2VSOA 3UANA 1I6MA 3C3EA 2AQHA 2GPSA 2AUTA 2Y1LA 3BD8A 3ICCA 5CCEA 5JO0A 1S3FA 1G66A 1TQ6A 2FEMA 4BVGA 1T4BA 3CZMA 1GILA 3UAXA 1P2FA 1SCQA 1PJCA 4B3JA 4QYTA 3T0FA 4QBTA 2PUFA 3CYFA 1CDEA 3F5MA 4OHPA 4PNHA 5FNVF 1CJBA 4KWIA 3WLMA 5HZMA 5BOSB 2V98A 2WU4A 4MYHA 3DBRA 1T24A 3BHMA 4ZQHA 5EWLB 1PR9A 2QN8A 4Q0MA 2C2HA 2GK3A 2PBRA 5GADl 3FYHA 2BGWA 1JLLA 5HWSA 3ORQA 3TX6A 2WLSA 3HRKA 3W5JA 4QPZA 4HI0E 1CZHA 1E66A 2Y9MB 2IIBA 3QU5A 1X0VA 1P45A 3PZRA 3ITKA 4JBXA 3N6RA 2NZXA 4QUGA 2XCQA 5C1BA 2C5LA 3O31A 2FVXA 4PZUA 5ILOA 3WGGA 1GQYA 1EUYA 2OBXA 3K09C 1N2HA 3EDRA 2P68A 3KQVA 5LYYA 3MTBA 1ULZA 2UDPA 4X7RA 1MAUA 1ESMA 1ONPA 2H59A 2PWBA 3TD6A 4BNUA 3JD0A 4QFDA 5TQVA 1SOAA 4I99A 2O1WA 3LL7A 4IIYA 5DSXA 4Q47A 5JY1A 2FOLA 3CLTC 4R1OA 1J9ZA 4CMIA 2X40A 2WJ4A 4JUCA 5A5VA 3A1DA 2YOGA 3K5HA 4DV2B 5KNDD 1ZGCA 4HQLA 3SEAA 1VSQA 2EFEB 3IPRA 4F9TA 4MJXA 1ODIA 4JYBA 1GGEA 1HOXA 4ZARA 1J97A 3UUEA 1OW3B 5FUBA 2H2IA 1J2RA 3PUIA 4KTTE 2W2LA 5AVXA 2O8EB 3THSA 3ZDRA 3R5FA 2FW1A 2NZ2A 3KZ1E 4IJ6A 2WYHA 3EDQA 3FGOA 5A7GA 5FFNA 1RWQA 4YCJA 3U3RA 2XITA 3W2TA 1UEJA 3GT0A 1BWSA 2UYGA 1LRJA 4M6WB 1NDHA 2OLJA 4MS4B 1E4EB 2XKAA 3Q0IA 4JELA 1GDHA 3L0YA 4X41A 2JIBA 3GP8A 2DY1A 4PGMA 3R23A 1EX9A 3VOTA 3IL2A 4WGFA 4DCJA 1C8BA 2HWWA 3Q7EA 5CFRA 4DUGA 3RFVA 3S27A 5K01A 4F86A 2BF7A 3AHEA 1T8PA 1ADCA 4FOPA 2AN3A 4KX3A 4N0QA 3U17A 4DABA 4FFNA 3BDIA 1UDBA 1VGQA 1KORA 4HWGA 5H4HA 1XZIA 1ISHA 4LFCB 1W36D 4IDFA 5I4CA 1EP9A 3IJRA 3G8AA 2JGMA 4RZIA 2ZTUA 4EENA 5KUTA 1P7ZA 2Y2VA 3A70A 3N3AC 2F6RA 1G8MA 2C4NA 2HU7A 3EIHA 2IOFA 3PS9A 3Q88A 2ZCVA 5JJBA 4C1BA 1BYIA 1I51A 4QM7A 1UAAA 2XVYA 4QYXA 4WL0A 5H82A 1IXZA 3E9EA 1VSVA 3HCPA 1S6YA 3HNPA 4EG6A 3HZOA 2VF2A 1QGED 4DEYA 4UE2A 1C1DB 1UZNA 3HKEB 4LNUA 5JY6A 1XPUA 3A0RB 3W77A 4UM9D 4ZZ2A 3ZZMA 1SBYA 3OAAD 4QO8A 1V16A 3EVAA 1IDOA 2NACA 3LU1A 3PNQA 4WKNA 3BMOB 5HZHA 1YFJA 3IP8A 2Y0PA 4CI0B 1T3TA 4PO9A 5AM2A 3R7BA 2EEZA 3EIQA 1IULA 5B64A 5AFSA 5BUCA 2HHCA 4MCHA 5EJ9A 2ZROA 4X44A 1XKLA 2HEGA 2JGAA 3BB3A 3WDSA 5E38A 1L5SA 3CJQA 3FHCB 3JZMA 3S7ZA 1D9XA 5SY4A 4MVJP 5BPHA 2ZBVA 4KKVA 2GEDA 4R9NA 5BNWA 1B7GO 4JDUA 3ISJA 2RGWA 3B48A 5HOEA 4DMFA 3NBMA 2B8TA 1WUYA 4RV9A 1HNWB 1NQWA 1YZYA 2NO5A 5BMVB 1THTA 2QLTA 5KC9A 3EIEA 4BQEA 1GPNA 4JBWA 4FMDB 2G1JA 2I4IA 4CMBA 2BVNA 1F9AA 2WT8A 2KPOA 1TCBA 4QYIB 4GICA 1S1MA 4GQBA 3ZDEA 4YCCA 1XP8A 2VL7A 5DOVA 1NF3A 3SP1A 4N5DA 2AS0A 1ODJA 3T1TA 3F78A 2R6R1 3L07A 3W90A 4X94A 5EMLA 1SXPA 3Q41A 1J56A 2QKYA 5G41A 1E7YA 3FTCA 4EQ6A 5BVHA 2CBXA 4V0QA 4BFSA 2QPOA 1RTTA 4KAFA 3Q8MA 1ZXLA 2O0LA 1VI6A 2OCIA 5I47A 4BY9E 3VSCA 3KYCB 4BQFA 4DQLA 1SHKA 3RTDA 2IQIA 3RHSA 5B55A 3C8UA 3JW8A 3TPCA 1J1UA 3CINA 3KD3A 4HB3A 3GF4A 4WY8A 4OXQA 3VYRB 1PQWA 3N2NA 3UOAB 2FR8C 4AXXA 5HA5A 2OFWA 1YA4A 4DR6B 2B0JA 3E4DA 2JAHA 4DPLA 1N2GA 3C6YA 1FTNA 1PBTA 3SS7X 1CD5A 3E1SA 5FWDA 4BNNA 1GJRA 3FCOA 1ZVMA 1AS3A 2RSLA 2V7TA 3FKJA 4TKMA 1CZNA 2QP3A 3ESDA 3DJYA 3OEHA 1PYGA 2YXNA 5EWJB 3E9CA 2V59A 4YJ2F 3OA0A 1DRJA 3M4XA 1XAIA 3OPYI 3QWIA 1E1LA 1PTJA 2VHEA 4UD6A 4ZQEA 3U56A 2H6EA 2CFRA 1HX7A 1OXBB 2O3RA 1RD4A 4JI6B 3WBFA 2IXGA 2ZFUA 4XGNA 3AJ8A 2ZRHA 5BMVF 3C3KA 1V8OA 4TUYB 3C7CB 1L7PA 4FMDF 4EP1A 3Q72A 1NI5A 3HO6A 1K7SN 5HCIA 4FI3F 1SD2A 3PRHA 3G0IA 2DQ4A 2GERA 2XB9A 2I29A 1WSAA 4NNOA 3ROFA 1GAQA 4AWBA 3CNOA 1NLUA 5I45A 3SYNA 5LA6F 1TM1E 2QRVB 1E69A 2WHPB 3O26A 4UMFA 1AQJA 2NN3C 3ZDXB 1MC8A 5ICGA