2JATA

Structure of deoxyadenosine kinase from m.mycoides with products dcmp and a flexible dcdp bound
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
202
structure length
190
Chain Sequence
MKIAIFGTVGAGKSTISAEISKKLGYEIFKEPVEENPYFEQYYKDLKKTVFKMQIYMLTARSKQLKQLENIIFDRTLLEDPIFMKVNYDLNNVDQTDYNTYIDFYNNVVLLSFDIVIYLRVSTKTAISRIKKRGRSEELLIGEEYWETLNKNYEEFYKQNVYDFPFFVVDAELDVKTQIELIMNKLNSIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DEOXYGUANOSINE KINASE
publication title Structure-Function Analysis of a Bacterial Deoxyadenosine Kinase Reveals the Basis for Substrate Specificity.
pubmed doi rcsb
source organism Mycoplasma mycoides subsp. mycoides sc
total genus 64
structure length 190
sequence length 202
chains with identical sequence B
ec nomenclature ec 2.7.1.113: Deoxyguanosine kinase.
pdb deposition date 2006-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2jatA00
3SR0A 1F2UB 2REOA 5H8WA 1VDZA 1P72A 3W6PA 1Z2AA 4ZCIA 2WWGA 2GJ8A 3EIHA 1DAHA 1T3LA 2QSZA 3NC1C 4WXRA 2IS1A 2P0EA 4PC2A 2VP9A 2O5VA 3BFVA 4CEJA 3CZPA 3QE0A 2ODEA 3MUFA 1E98A 2JCSA 3K0SA 1Z6XA 2PZEA 3CH4B 2ATVA 3B13B 4BLPA 2J0VA 4IDHA 4HUTA 1E2KA 3RRMA 3B1WA 1MO5A 1L7VC 4OJQA 4RZXA 2XNSA 5JZVA 1RE0A 2AK2A 2EFCB 4FWIB 4PAQA 5JWRA 1UAAA 5CK5A 1OKKA 3CX8A 4K81B 4X8OA 2W6JD 3WNDA 5JJIA 3FHCB 1NBME 4HLCA 1EWRA 3B78A 2QU8A 1XXHA 4WZAE 2H5EA 4ZDWA 1CJMA 2PEZA 2QTFA 3UXMA 2BBTA 4NH0A 3NTUA 1YZQA 4Q7LA 5M04A 3L43A 3SYLA 3DOFA 2PJRA 1R0WA 4AYXA 1AGPA 4Q1FA 3DZDA 3SS8A 4BFVA 1P2SA 5B58C 5E4FA 3V00A 5JSZB 3EA5A 1WF3A 1WA5A 1F60A 4AURA 4GZMA 1CJUC 1W48A 1R7RA 2QRNA 2GEDA 4F7WA 1OXXK 1KMQA 1U8ZA 2XXAA 2IW3A 4OYHA 4FN5A 3PUVA 1ZCAA 4KSCA 3I5XA 5LPNA 2HXYA 2IXGA 1HY3A 1QHGA 3FMPB 3GJ8A 4KYUA 1KK1A 1HEIA 2BJVA 4HYYA 4MDEA 3K8YA 3DEFA 2P3SA 4IDPA 2FDCA 1W36D 3RRZA 3ZD6A 3B6EA 2C96A 4M9ZA 3THXB 1I4LD 1AQYA 4JIMA 3A1SA 3SBDA 3EIEA 5FOXA 2QMHA 3G82C 3BD9A 2X8AA 3OHMA 2QP4A 1G8YA 4KFRA 5HKKD 1RW4A 3BJIC 2CCGA 3GLGB 3AVQA 5LBIA 5EP1A 1CR4A 3WHKA 4PZZA 1SXJA 2XTMA 4U02A 1TQ4A 4HDOB 3Q7PA 5F9FA 5JWHA 2NZJA 4MRVA 4KJZA 1P2UA 1DARA 3QKSA 5IHPA 2FZ4A 2GJ9A 2G0NA 2JJ8A 2DCUA 1Z6YA 3RS7A 1UBEA 4WAUA 1NLZA 4DLYA 4IXNA 1AN0A 3GMTA 2ECKA 4YMSA 1KO7A 1RC8A 5LDDC 4NCNA 1NIJA 1IN7A 4JJZA 1RPZA 2CXXA 2R8RA 5FPTA 1LS1A 5LD2B 4DLTA 1JPNA 4RSGA 4PHHA 2OHFA 1RJ9A 1NLFA 1W5TA 4FD2A 5CK4A 2OUKA 3VX4A 3ZGXA 1NY5A 3Q5DA 3U6KA 3ND8A 1I4DD 1II8B 3FFBA 5UKDA 1OHHA 3GLIB 1Z0AA 1E69A 3A8TA 4TLCA 3WMFA 3ZQJA 2WM9B 5FUXA 2F1HA 2CJWA 2W2XA 2WJYA 1JALA 3LVRE 3SEAA 2DWQA 2IS2A 1ELOA 4QBIA 4JJKA 1YRBA 3VU9A 2OAP1 2WJHA 1D8TA 3NG1A 5D3MA 2XOKD 4WBSA 1VTKA 3P20A 5FTKA 2PT7A 2RGBA 2JJ2A 1OIVA 2BM0A 4Q7JB 1BKDR 1FTNA 1Z2CA 5FUVA 3LLMA 2V1UA 2BVNA 2ZE7A 1GDDA 2NO1A 5EE5B 4FMBB 1RYHA 4WW0A 1XU4A 1P4SA 1S1CA 4Z1MA 1TF2A 1XBTA 4LPSA 2ASEA 1N5KA 5EXPA 2HXSA 2W2TA 1F2TB 2ZJ2A 2D06A 4B3XA 4QM7A 1CIPA 2CHQA 2GK7A 2Z6VA 4MRNA 4PO9A 4FMCB 1NN5A 4PHGA 1G3UA 4KBGA 4CZ2A 2O0HA 1EK0A 2F7SA 4FMDB 3EPHA 1IN8A 3CR8A 5JFGA 3CF0A 4KCGA 4TMKA 2LWIA 3WYGA 1SVSA 1Z5ZA 2RCNA 1W36C 4OQXA 3OE7A 2WZQA 1XPRA 1J90A 3LRPA 1DG3A 1NN0A 1KJYA 2JGNA 1F2UA 1FTSA 5AJZA 2J1LA 2CLCX 2LCFA 4LJ7A 2XB2A 5C4MA 2DHRA 3NHBA 3SHWA 4DIDA 5FTMA 2WSSA 4HSEA 3A6PC 2ZRBA 3AKYA 4OK5A 4AC9A 2Q3FA 5B2ZA 1EWQA 2F1JA 4G3XA 3CR7A 2FGJA 2IEYA 1YR8A 3B1VA 2V7QA 3NBZC 4RCYA 4B33A 1CR1A 2EFDB 1E99A 2ZAOA 821PA 1HT1E 2ZS7A 4FCTA 1CXZA 1ZU4A 2OLJA 1G3IA 2ZE8A 4LHZA 3UATA 1YZUA 2VSFA 2EWWA 4KYIB 4URZR 4AKHA 1M1YE 2D62A 4PTLA 1G8PA 1E0AA 4GOXA 1NRJB 4YMTA 2OBMA 1QZXA 2VSOA 3WRXC 5DE3A 2AD1A 1ZCBA 2WOOA 4UXHA 2W2VA 2IUSA 2WWWA 3CPHA 4TLEA 2WWFA 5JSZA 4JLVA 2N42A 2R6FA 1WMSA 5HZKA 2VLIA 4G5GA 3EZ9A 4XH9B 3KQLA 2OBLA 3CO5A 3CRVA 1FP7A 1ZD9A 5C18A 4L16A 5AUPB 2J59A 4B3CA 4JS0A 4HI0E 1Q22A 2D2FA 4P4SB 5FPSA 1XMJA 3NBFA 1R5BA 4PPQA 1GNRA 2W83A 3NH9A 4QXAA 4B3BA 4F92B 4Q21A 5DSZA 1KJWA 2RAPA 5JHGB 2OZEA 2E87A 4UQOA 1A82A 1UDXA 3I92A 2RB4A 1QG2A 4LYHA 3P4XA 3F5FA 1E2DA 3CBQA 4EPYA 2OXCA 4OQNA 5DO9A 3EWAA 3OIWA 2XNDD 2VP5A 3R7WB 4JLBA 3GLGA 4A36A 3AEZA 4II7A 5C4GB 2ZSDA 3UWOA 3K70C 4IKEA 1G1MA 5K8IA 5P21A 4E07A 4US1R 3TW8B 4OI2A 4IVPA 2ZRKA 1Z22A 3L0PA 4DUGD 2XJ4A 2JLZA 2Q9BA 4GNKA 1WRBA 1NJFA 3Q72A 4L9WA 4X8HA 4DVGA 1AKYA 5B64A 5KNCA 2BCGY 3PUWA 4LSGA 1T4GA 4LHVA 5ELXA 1E2FA 2DY1A 4O25A 1S9HA 2X1VA 3GLHB 4HDCA 2WWHA 4S2EA 3HJNA 4PHFA 4PR0A 4FWTA 1LVGA 1QHHB 4QJ4A 3U3MA 1P62B 1NIPA 2EU8A 2J5XA 3NBXX 2F43B 1Z47A 2ZRAA 1I2DA 2HJGA 3AF2A 3PV0A 2NGRA 2OLKA 4RCZA 3OEEA 1UBFA 2WOJA 2H16A 3GJ0A 3GLIA 2IC5A 1IXRC 2IYYA 1SULA 2QGNA 3Q8XB 4L8GA 2HEIA 1FNMA 4HLUA 2QA5A 3IEVA 3LBHA 3VTKA 4WZBE 5HR5A 1ZUNB 1W7AA 1YR6A 1CJTC 3QPUA 4B6EA 3AVPA 1M7BA 3QJYA 2B6HA 2XITA 4UNPA 4Q5IA 4URYR 1KYIA 3U60B 3LW7A 2BEKA 4DZZA 3D3QA 2GXAA 2IYTA 4XWOA 1G5RA 2R2AA 1HE8B 4LDJA 4RFVA 3AUXA 4Z1MD 1YKSA 1UKVY 2GDJA 3M0EA 4ACBA 2Q3MA 3C7KA 1VYTA 1DO2A 2ZRIA 3LXRA 4JLMA 4YMWA 5H68A 4QBHA 1FW6A 4NZYA 3WNCA 1OF1A 3W9YA 4LJ9A 4F4IA 3KXKA 4HB2A 3HU2A 3EPKA 4BGDA 1NKTA 2H8KA 2A5FA 4BRWA 4PQFA 4LI0A 2IYQA 1VYUA 4DDTA 4PANA 4NP6A 1W46A 1SVOA 4CYMA 2XZLA 1XCPA 1P2TA 3CNNA 4MYUA 2VSXA 3KTAB 3T12A 5TMPA 4OQLA 3QVVA 4WIAA 2EVWX 5FPYA 1ZIPA 2F9MA 2KBFA 3OE7D 4O2RA 3THYA 2A5JA 4OI4A 3AF0A 3B9QA 3IIKA 2ZI5A 5JS8A 1Q1ZA 5GVSA 3LVQE 4Q48A 2TMKA 4LPKA 4GL2A 3JZMA 5CDFA 2RGAA 4TZ6A 1IM2A 3L2OB 3RS2A 4C4PA 4BASA 1C9KA 1II9A 1EFHA 4Q1AA 1SXJC 3BRWD 4MKGA 2RMKA 4NCIA 5KU1A 3U7GA 4JVNA 5EXXA 2JJ1A 1N0UA 2QY9A 3IIJA 1G8GA 3DKVA 2ZRGA 4GBMA 5AJYA 3LBIA 3BIFA 4TL8A 4Q01A 3DVLA 5FOTA 5DNYB 2H17A 2YINC 2QQEA 2OSBA 1RRCA 2GILA 1RIFA 2ZI6A 3WYAA 2O8BB 5EUMA 3QG1A 3SJAA 3W5IA 3VKHA 2J0SA 4V02A 3T35A 2PCJA 2ZR7A 3EIQA 3BGWA 4BZXA 3EW9A 4KODA 5A0FA 3BFKA 1OW3B 1Q57A 2QPAA 1QHNA 1CJVC 4MA4A 5TY0A 3P32A 1BS1A 5TV2A 2V9PA 1E79D 3NWJA 3CX6A 3MJHA 2VF7A 5HTKA 4NCJA 4O0MA 4BZPA 3MAAC 3K0EA 1IY0A 3UMSA 1U0JA 4PC7A 3A1TA 4QGHA 3TVTA 3AKDA 4P4SA 4BUJA 6Q21A 1KI8A 3KUDA 3ZVLA 4XJXA 4TQAA 5KSOA 3UMRA 1AZTA 1MH1A 2QE7A 1O87A 2Q3HA 4HAZA 1NSFA 4BFSA 3T1TA 2WWIA 4Q19A 4QBGB 3MWLA 4Q02A 1A2BA 4UKDA 4KLZA 5JI3E 3TLXA 4J0QA 2CMKA 2DFKB 4ZKDA 3VFDA 4DHEA 1OH5A 4YXWA 5DGXA 3ZD7A 1KI4A 3R7WA 4B32A 2IYVA 4C0LA 1Z29A 2JDIA 1LY1A 3QPWA 2WJJA 2CBZA 3MSXA 2RGGA 1T3HA 1JAIA 3ZJYA 1FUKA 4JKYA 4C0QC 3I72A 2YWEA 1TUIA 3BC1A 1E9AA 1OXTA 4Z8XA 1MRNA 2OCAA 1AGRA 1XEWY 3WHLA 1QDEA 1KDRA 3OF5A 3PFIA 1P6XA 1GNQA 2KWIA 3GLHA 2VH5R 1R0ZA 2BC9A 3CWZA 3KB1A 2ZROA 1ESNA 1QHHA 2R6CA 4B44A 1US8B 4TYWA 2ORWA 4GMDA 3H4MA 4JBYA 3UANA 4AI6A 2F43A 2B7CA 4P0TA 1XD2B 4PQRA 1VG9B 3B85A 3K53A 2I1VB 2D7CA 3DM9B 4WOPA 3B2EA 4C30A 5HE8A 1R8QA 2ZXUA 2MMGA 2JLYA 1Z63A 4UJ5A 2QBYB 1GVNB 4G5SA 4KI0A 3EZ2A 2JLWA 2ZREA 3GP8A 1KSJA 1NSTA 1YE8A 2J7KA 2XTNA 4GOJA 1M7HA 3BH0A 4EIWA 1G4AE 1W4BA 4M1KA 5EQTA 5TXGA 3VAAA 3NH6A 1SQ5A 2X2FA 1W5SA 3KJGA 1W47A 4QGAA 1DAIA 2VHQA 3H86A 5HE9A 3UMFA 4B3GA 1BH2A 4JLNA 1G21E 2ZM5A 1K5GA 1B23P 3H2YA 3ZQ6A 4GT1A 1XMIA 3J81k 2HYIC 4HLQB 1TQ6A 5DN6D 1S0UA 2A9KA 3F0TA 2ZUCA 4KLNA 4D4KA 1FQKA 3TRFA 1OYWA 1VCOA 2FFBA 2H57A 3DDCA 3D8BA 2OBNA 3C15C 4YMVA 1JXMA 3I62A 1KMHB 3TUIC 1QRAA 4LHYA 2ANBA 3CUEF 3FB4A 3RHFA 2QM7A 2KB0A 5FOSA 1Z0KA 1U2RA 4IEEA 2ZI7A 3SFZA 2ZYWX 3KTAA 3PJRA 2GWHA 5KSPA 3SN6A 4CT4B 1N5LA 4MYHA 1YU9A 1E0JA 2ERXA 4B35A 3IIMA 5EP2A 3BXZA 4W9MC 4JVLA 1XTRA 3FTQA 4B48A 4ZI3A 3I73A 1XTJA 3B1ZA 4PO8A 2QTHA 2ZRJA 2CLDX 3GFTA 4O2LA 3THOA 2XSZD 1T3SA 3NDBB 2OT3B 3QEJA 1Z0DA 2GXUA 3IGFA 1KAOA 1UKYA 3A4MA 3MWJA 4IW3B 2QUZA 3IILA 4R7ZA 4DBLC 3PIRA 1N0WA 1M74A 2B21A 2JJ1D 3B1XA 3GD7A 1KO4A 4ACAA 5BXQC 1T8TA 4NHOA 4V0ME 2FOLA 1Y3AA 4B73A 1LNZA 2O8BA 4H1UA 4MUBA 1P3JA 2YHSA 1KDPA 3WYFA 2ZQ5A 2Q9CA 5BQ5A 1CR2A 2YC2C 5E3HA 4ZI2A 4MH0R 3CLVA 2W58A 2I1QA 2N1BA 2NO0A 3K09A 3OIUA 4BWYA 3MWYW 3Q5EA 4BPBA 2AXNA 4HAUA 2JIZD 5KUTA 3WRYC 3TGPA 4M9XA 2CHGA 1U8AA 1JPJA 3PQCA 2YWFA 1ZNWA 4KV9A 2XEXA 3H0KA 4C2TA 1W2HA 1TNDA 2AR7A 2ZRPA 1E2IA 4IRUB 4LJ8A 2UZ3A 5CLLA 4HB0A 4HLUC 1VHLA 5J4KA 4ON9A 1EX6A 1COWD 3OAAD 2AX4A 1KI1A 1CU1A 1CLUA 4IVRA 1OT3A 2GRJA 2ZVPX 3QOFA 1EG7A 2QE7D 3HP1A 4MKHA 2WKQA 1Z0FA 1C1YA 2G0TA 4PSVA 4DEXA 1NF3A 1HT2E 3R9IA 1OFHA 2C03A 3AB3A 4U5XA 4ERNA 5BN4A 4YXWD 5LB2A 4DLWA 4JVMA 2IYRA 1E9FA 2IYZA 1E2HA 2ZR9A 5JRZA 2DWOA 4DDWA 2JDID 3ASZA 5GADl 2ORVA 4K8OA 2J9RA 1AM4D 2VHCA 1Z6AA 5IK2A 3SOPA 3QNUA 1GITA 2C99A 4OKSA 1QHSA 3VR5A 1JR3D 1G18A 1T8UA 4L5BA 3IKJA 4AWXA 2WJGA 4RY2A 2QG6A 4A15A 1XB2A 2QP3A 1PJRA 5CB6A 1MR3F 3JZAA 5AWFC 2IYSA 5J4LA 2HYDA 2JAQA 2OFWA 2V4ZA 1US8A 2ZU0C 4TLAA 2IL1A 4RFSA 3MCAA 2FU5C 2BMJA 1I2MA 4Q18A 1XD2A 3OIYA 3K9NA 3E2IA 3THWA 1YR9A 5CYOA 1D2MA 2FV8A 3TE6A 1ZM7A 3TJZA 2JEOA 1JQJC 1UKZA 2QBYA 3EPLA 4NONA 1ZM9A 1IN5A 4PC3A 1SZPA 3CRW1 5KO2A 1E9CA 4HZIA 3DZ8A 3R9XA 2J45A 3LA6A 4DSOA 4NDZA 1E9BA 1R0YA 2V55B 4EPVA 1H8ED 4KAXA 4AKGA 2ZI3A 3ONWA 3G5UA 2VA8A 2ZSBA 3RS0A 2XNDA 4FW9A 4Q00A 2GVZC 3TVDA 2WAXA 3U4QB 3X1DA 5JI2E 1GL9B 1N2CE 2XTZA 4QHSA 3PITA 1V43A 1KKLA 4G5QA 3TKLA 3UWKA 2BJWA 3O47A 4MUAA 4P32A 4B43A 1OH7A 4DUGA 2IUUA 1OH8A 4DKXA 3GLFB 4I81A 5CM9C 1N6IA 3A37A 4D4LA 5L3QB 2NZ8A 2C77A 4QOSA 1MT0A 3ZZ0A 3TQFA 4B2IA 2C8VA 2QT0A 1U8YA 2ZU6A 2H7VA 3IEUA 1F48A 1SKYB 1XX6A 3TQCA 5J4VA 4MGKR 1L4YA 3GEEA 3BAFA 3T5GA 1KMHA 1T5IA 1D2EA 3QKTA 4ABYA 1Z07A 3AVWA 1QBKC 4HLDA 4Y0AA 1XXHE 1TEVA 3IO3A 3R8CA 2QQ0A 1WQ1R 3U3JA 3K9HA 1F6BA 3W6OA 1E2NA 2DPXA 1J8YF 2ZRLA 3L8YA 4PX9A 4Q1EA 2HF8A 4LJ5A 1X8KA 3QIAA 2NTYC 2PBRA 4LV8B 4G0NA 3OEHD 4D82A 2WV9A 2BKEA 1TF7A 2JATA 5KTYA 2ZRMA 1DADA 2MSEB 3N2IA 4RKEA 4R98A 2PH1A 2P5TB 1IJFA 2QEQA 2FN4A 2YWHA 4AY2A 3KKNA 1J99A 3A1VA 3SYKA 1UPTA 3CF6R 1IAQA 3BS4A 4OL0A 3U7HB 5SZKB 3CB4A 2ZUBA 4HUQB 3B9PA 2CEAA 3C5CA 3P27A 4I1OA 2ZI4A 1ZW6A 4EPTA 4NYJQ 4AKIA 2QENA 3CONA 3EC2A 1PUIA 1V5WA 2BEJA 2RGNC 4AG5A 1G20E 1TAGA 2RGXA 1IXZA 2W6ID 1ZAKA 4QFMA 2QRZA 2FG5A 5JECA 4OHYA 2WPDA 1KK2A 1P9RA 1LS6A 3GFPA 1KSHA 3SI7A 4D81A 1RVDA 2DFNA 2O8CB 2ERYA 3D7MA 5FOVA 2ZR0A 1X86B 4JLAA 1SXJE 2ZJBA 1NVVQ 4PC1A 3L82B 3QEOA 3UKDA 3NIBA 4RD0A 4W5WA 4FXPA 4ARZB 4AYTA 4DT1B 5AUNB 3MWKA 4A0GA 1EFTA 1DEKA 4DB4A 4BE7B 5FTJA 2GJSA 4JT2A 1WE2A 5AJXA 3QBVA 3F3YA 1FUUA 5E95A 3W5JA 1DG1G 1Q1QA 2WSMA 1ZU5A 3HDTA 3B82A 3LX5A 1G5TA 3SC3A 4EUNA 3R9WA 1BOFA 3M6AA 1KI6B 4I99A 4LYJA 4DIEA 5CJPA 1GL7A 2ZEJA 3BH6A 3A4LA 2YWGA 4LUCA 4Q9HA 3HR8A 3OZXA 2C2HA 4I1UA 2QM8A 3X1WA 4Q9IA 1T6NA 1VPLA 2MMCA 3NEJA 2QAGB 2WBLC 3I32A 2QAJA 1G17A 2ZJAA 4E5UA 4TLBA 4X8MA 4JBWA 2ZJYA 1II0A 4MGIR 1XPOA 4C0JA 1Z06A 4ZKEA 5GJVC 1AQUA 3PUZA 2ZYUX 4V0LA 3MFYA 1UBGA 3OFND 4X8LA 1M7GA 1IOZA 1LF0A 4EJSB 4BEBA 4YQFA 5IK2D 2BIFA 2GZAA 4LHXA 5E7JA 2J87A 2R6DA 1DAEA 3UIEA 3HPQA 3V9PA 2QORA 1XJQA 1J8MF 2REBA 3DMDA 1E79A 3QY0A 4KVGA 1SHKA 1TQ2A 2FNAA 3HU3A 1DVRA 4L15A 4TL7A 3LDAA 5KDOA 2JLXA 4U7DA 1DTSA 4M21A 2C9OA 1TQDA 5L3RA 4PPFA 4GMXA 4YC7A 2GCOB 3X1ZA 1IBRA 5DIFA 2NPFA 4BLOA 1VYVA 4WZ6A 2LKDA 4FMDF 3GFOA 3SJZA 4BLSA 1SVKA 2Q9AA 1R5OA 2FSIA 2RGCA 4CVNA 1A1VA 4UNRA 4RVCA 4KBFA 5BN3A 3AQ4A 4Z54A 2EWVA 3THXA 2FFAA 1CJKC 1BIFA 1N6LA 5DYGA 3CX7A 5EXTA 1G4UR 1ODFA 1XFAA 1NMXA 4EFLA 4P3YA 4KFSA 4PPNA 4EDHA 4NKRA 3U4QA 2XX3A 4TQ9A 3AP3A 3SJBA 1EXMA 1PVOA 3SU8A 1G41A 3K09C 3MRSA 1BYIA 5FBQB 4D0GA 2K5UA 2Z4SA 1E2JA 3B8HA 1R2QA 4M8NE 4UXJA 5AK0A 4JKIA 3DOEA 3WBJA 3GLFA 5CIQA 3AVUA 5L3QA 2WKPA 3QXHA 1NG9A 1EX7A 2VRWA 4LY6A 4DXAA 1LB1B 4IDOA 5SZHB 2ZI9A 3LW8A 5JMTA 2Q6TA 1S3SA 2OXRA 1N6KA 1S3GA 3GJ7A 1HUQA 2DYKA 1DAKA 2OFOA 1OSNA 2WKRA 2ZRDA 2GTPA 4D4MA 4PSKA 4M9SA 2PJZA 3PVSA 4RD2A 1N6HA 2AXPA 1G64A 1A5TA 2OV2A 4B3DA 4PZLA 1KNQA 4Q4AB 1XZPA 2XZPA 2QGZA 1KO5A 1CF4A 2W00A 3KXIA 3AF4A 4OHXA 3F8TA 1W4AA 2A5GA 4E03A 1YHNA 1II8A 3M4YA 2PMDA 1W44A 2GAAA 2YNMA 4MRRA 2HLDD 4XD7D 4BZQA 4ESVA 4LV5B 4DDUA 1HQCA 1CS4C 2BCJQ 1R8SA 4O3MA 2GXSA 5E7MA 3RSOA 3IQXA 4YDSA 2VHTA 1X1SA 5TVKA 4EKDA 3CIOA 4XTCS 3BB3A 4EQ6B 1MV5A 1GSIA 1E0KA 5A4JA 1LF5A 1Q1BA 4ZIRB 2PX0A 4M1YA 1JJVA 2OG2A 2VHUA 4LJYA 4A0RA 2XB4A 1JB1A 1R0XA 4HUQA 1DBSA 3KKPA 3SE0A 1VG1A 1AKEA 4DRZA 4QJ3A 1QHYA 1VG0B 4L9SA 4PPGA 1IY2A 1WXQA 3LXXA 3TBKA 2FH5B 2ZE5A 4LJ6A 2LKCA 1TU3A 1KAGA 3EWSA 4GRAA 4NYJR 5DN6A 1F2TA 4HZUB 4IEIA 5TARA 2V1XA 3KKOA 2ZETA 3NKVA 1M34E 1ETUA 1NP6A 2XAUA 4B3FX 3CH5A 1VG8A 3K9LA 3GLGE 2WPDD 3CWQA 4C9BA 4MKFA 3TH5A 1E1QD 3AV0B 4TT3D 4DT1A 5G3YA 4ARZA 1NVVR 4TWZA 5ANRB 4GPTA 5HZHA 4PSAA 3SQWA 1PLJA 2GZDA 3AF1A 4HB3A 4M53A 4D6PA 1GOTA 1ZD8A 5FFMA 2C9YA 2FGKA 2GZHA 2HCJB 2CLSA 3QPVA 3W3ZB 2HF9A 2PCLA 4ASUD 4HAWA 2Q21A 2VQSA 2XSZA 1W0KA 4UNQA 1N6RA 1KI6A 4DLZA 1P60A 1SVLA 2CCKA 3VNVA 1U9IA 1E9SA 4DLRA 1K6MA 1ZRHA 5L3VA 2ATXA 3QVUA 4I1VA 3TSWA 3KQKA 1GRQA 2BMDA 5CM8B 3WBKA 1ZMXA 3FPAA 5EE3A 2JLUA 1XCGB 2QAGA 4HB4A 2WICA 4TL9A 4TSFD 5JRJA 2ZE6A 3A36A 4HEJA 2ZSAA 3GLIE 2CK3D 1N5IA 1QHXA 3H84A 4QNMA 5EUQB 2DR3A 4B76A 1NY6A 1EGAA 3TSOA 2YZ2A 1UKEA 1Z0IA 3ZIAA 4N1AA 1IJEA 5FOUA 4EJSA 1SGWA 4HDQB 1X8LA 2HV8A 2IXEA 3DO6A 3SQXA 4N3NA 2PX3A 2V6IA 4YONB 5EJEA 2C9CA 4M0LA 4D0NA 1OH6A 5AUQA 4LV6A 3EAQA 3BE4A 3W6NA 4QGGA 1XEFA 2JIZA 3FOZA 4FCWA 4NYMQ 2IT1A 4QGFA 1DAGA 4DC9A 1NNEA 4WA7A 3REFA 2VP6A 2O8DB 1N25A 2C78A 3KX2A 4MRPA 4NTZA 3RANA 4OQFA 2J0UB 3KL4A 3QXJA 5H1YA 4DCSA 5IT5A 4YLGA 1Z83A 1GZSA 3SBEA 2BDTA 1Z6GA 1NKSA 2RKOA 1Q3TA 1SKQA 1COWA 3O8CA 3OAAA 1X1RA 4LJAA 1D9ZA 1G16A 1TU4A 1U94A 1UEJA 2GETA 4NE2A 2OESA 3T1QA 4U00A 4IOJA 1T0JB 2A78A 2BWJA 3LD9A 1M6NA 3U44B 1A7JA 4M1OA 2BV3A 1HYQA 3W34A 3T61A 4BLQA 1YZNA 1G6HA 5KNDA 4R2HA 4IVQA 3IBYA 4ZCMA 1HQYE 4XTRA 3ICQB 5DHFA 2VYFA 3LFUA 3HR7A 4LCBA 4QNRA 4P4TA 3FMFA 2H18A 2Z0MA 1H65A 1E94E 2FEMA 2XJ9A 1IONA 4KFTA 2GK6A 4IOMA 5KDDA 5CDFE 1W49A 2IHBA 2BMEA 1TX4B 1OFUX 4QRHA 1W0JD 2E9SA 2ZUDA 1GL6A 1JR3A 1R6BX 3I1FA 3K9GA 1U99A 2ZAMA 3ECCA 5J4YA 5FBVB 1TEXA 5G53C 3T15A 1G3QA 2EYUA 2FE4A 2VL7A 3C41J 3UG7A 4IOLA 3KQHA 2PEYA 2FJUA 1MRSA 2L0XA 3AGPA 2VTKA 4MYCA 5DHAA 1FP6A 1G7CA 1KZGB 2FPKA 2QN6A 2IS6A 1WP9A 4Q4AA 5FL3A 2NG1A 3VR6A 5KSZA 2YOGA 3A1WA 2F55A 4CGZA 3EG5A 2G1KA 4ZDJA 5EP4A 1N6PA 3QSYA 5F9HA 4LRWA 5JJKA 2O8EB 4A1FA 5G40A 2GA8A 2ODBA 4CW7A 3I3SR 4BFZA 3PEVA 2BBOA 3VX3A 4A2WA 4Z51A 3AVYA 4CEIB 5C1BA 4BRUA 4URXR 221PA 3K1JA 1Q3HA 1Q20A 3WMEA 3GJ5A 1Z6TA 1H8EA 2FPMA 5J5CA 4NBSA 4XVRA 4EQ6A 1YZTA 5IDVA 3RRNA 3UPUA 4Q7KA 2BHRA 1E2LA 4LHWA 4ZIRA 2BBWA 3SZRA 2AKAB 2V8OA 3K0AB 3EPJA 1UF9A 1GRNA 1ZP6A 4BLTA 4C0HA 2D2EA 2D7DA 5B30A 2G83A 4A9AA 3RVBA 4LC1A 3I5YA 2HJVA 4ILEA 1E32A 3U3OA 1P75A 2FF7A 2JASA 2R6AA 1YZLA 4D2IA 2AL7A 2E1RA 3AP1A 4C7OB 4EAQA 4LC0A 1P7CA 4KHZA 3RC8A 2IS4A 5JLJA 2QNRA 1GAJA 2ZIAA 3GJ4A 1UBCA 1DS6A 3QG5A 1EFUA 4QBFA 3R8FA 2FWRA 3W3AA 3U3RA 4BLRA 2FSGA 3FHOA 3U3KA 3ZVMA 4QHYA 5LB4A 3DL0A 4DLVA 1ZM2A 1E9RA 3O8DA 1U0LA 5HCNA 2C95A 4IHQA 2EQBA 2GXQA 3W8NA 4BFXA 5IRCD 3RDPA 1SVIA 3E1SA 2YC4C 4ZO4A 3QKSB 2P6UA 2W0MA 3EZFA 3GLHE 2IF2A 2J41A 3ICEA 1KKMA 4W5HA 2ZTSA 1NN3A 4G01B 3OEHA 3X1XA 3GJXC 1Q12A 1W0KD 4IDNA 1IY1A 2UVQA 4RZUA 4KSBA 4MITA 4TL6A 4E09A 3C14C 1VCIA 2OILA 5G3ZA 1PZNA 3P4YA 1MOZA 3BORA 1NN1A 1NG1A 1RJ9B 4AKEA 2OCYC 1P2VA 4Q1CA 2ZJ8A 3QF7A 3KKMA 2VP0A 4G5OA 4EPXA 4JBXA 1KZ7B 2F3RA 2R62A 521PA 3T06B 3ZIAD 3CNOA 4LBYA 1NBMA 3SYNA 2A5DA 5KHOC 4JMPA 1KDTA 4GZLA 2W6IA 4MRSA 5LD2C 1X8JA 2CL7X 3BB4A 2R65A 2ZS8A 4XVQA 4JYBA 5HPYB 4MYTA 4R9UC 4RZ2A 5F98A 2PMKA 1AS2A 1G6OA 3QXXA 4JLOA 4LBWA 2CL0X 3U5ZB 3QQ5A 1E9DA 3LBNA 1S1MA 1OV4A 1E1RD 2GVDC 4F38A 2GF9A 3CF2A 2O8DA 4A0HA 3S1AB 2DWPA 5KPJA 5C46F 2GF0A 3RLFA 2J0UA 1TPZA 4GOKA 4UNSA 2WJVA 4D80A 1U81A 1KI2A 2GBLA 2CVHA 2QTVB 3EZ6A 5GVRA 3IPYA 3U6BA 2QZ4A 1HTWA 1KTVA 4Z8YA 4TQUS 2CNWD 4JL6A 2I4IA 4EFMA 3FKQA 5HCIA 3U44A 1XTSA 3Q9LA 3RRYA 3TAUA 3WY9A 1EFCA 3VQTA 3C8UA 4KITB 4AK9A 421PA 4B74A 4WVFA 5GJBA 5FPHA 4M1WA 4EPRA 1UEIA 4JYCA 4OHVA 5FR1A 3PG5A 1XZQA 1GTVA 2Z5FA 2ZRNA 4L4UA 1NVUQ 4QJ5A 3BOSA 1IHUA 1IN6A 1AK2A 1MO4A 3WXMA 5FBLB 4QKQA 1GUAA 1UM8A 2NO9A 3OFNA 3PENA 2ZYTX 1OIWA 4NMMA 4A82A 2WAYA 2G9NA 1L4UA 4M9QA 2EYQA 4TMVA 3KB2A 4A6XA 1UDWA 1W1WA 5FTLA 1FZQA 1Z0JA 5FTNA 4C2UA 2ODNA 1D5CA 3ASYA 3L0SA 5BYJA 1XNJA 1KIMA 2QT1A 1OFTA 1QHIA 1A4RA 2GESA 3GEIA 3FHTA 3IQWA 4POAA 4GSYA 3VKGA 1JEDA 2F1RA 2YOHA 3FE2A 2Z43A 4LX0A 1VMAA 3WP1B 4NPHA 2PLFA 5JBQA 2HDNB 1N5JA 1DAMA 5CJ2A 2CCJA 1U9IC 2O8EA 1KO1A 3CW2A 4ZPXA 2WWXA 2ZRFA 2GEVA 2J46A 3EASA 4GFDA 1UFQA 3FDIA 1Q1EA 2P2LA 4CEIA 3K0FB 4OQMA 1XPUA 2Z4RA 2QAGC 3B1YA 1GFIA 1TMKA 4KU4A 3WP0A 2O8FB 2Q0HA 1JXOA 3FKSD 1YR7A 2PT5A 3TAHA 4B2PA 2AD5A 4B47A 3TR0A 4Q47A 2WJIA 3K0AA 2IYWA 4EJSC 4LGMA 1P73A 4JLPA 2ZJ5A 4NU0A 4F93B 3AKEA 1Z8FA 3MGCA 4G1UC 2Z83A 3REGA 5IF9A 1LW7A 5J47A 2W0SA 1RYFA 1E4VA 3KKQA 3AGQA 5DISB 5TDHA 4F91B 3A1UA 1G291 5C2JB 2OCPA 121PA 1U90A 2X19A 4C7OA 1ZM3A 3RWOA 2YKGA 3KXLA 4IOKA 4HAVA 2IF0A 2CL6X 3LQRA 3QUSA 5CB8A 3I61A 4PXAA 3HYRA 1OYYA 2C04A 2IYLD 2FA9A 1XRJA 3I8SA 3HU1A 3RABA 1XMSA 1IN4A 1ANKA 2VP2A 4OJKA 3PUYA 4HAYA 1KOFA 1YRAA 2AFIE 4BFTA 2FPLA 3VNUA 1R4AA 4OI0A 4GP7A 3FGNA 1L2TA 1K8RA 5TB5A 4ZCLA 1N6OA 2OCBA 4RD3A 4XD7A 2HLDA 4RZ3A 1TADA 2CHVA 4IJMA 2FSHA 1ZUHA 1D9XA 3AKCA 3ZZUA 1XWIA 2FX3A 4KFUA 2QSYA 1SVWA 4A8JB 5FBRB 3IDQA 3AH8A 2YYZA 4V0OA 4HATA 3X1YA 1ZINA 3GCGA 2AHOA 4QL3A 3ADBA 3GPLA 4M1TA 3W90A 1CULC 1CEEA 4AYWA 4LOAA 4CF7A 2OM2A 3QBTA 1ZC3A 2AN9A 3VR3A 1ZBDA 3QI2A 5FOWA 2D3WA 1ZJ6A 4DB2A 1NMZA 4Q66C 4US2R 1CRPA 2PZGA 3EXAA 1NL3A 3DPUA 4OHWA 3GEHA 2AKYA 2EFGA 4MDFA 1U98A 3CM0A 4F4JA 3NDPA 4MGYR 4OI1A 2IWRA 4DDVA 2HT1A 1XTIA 5KPDA 1NBMD 4ITRC 4M4SA 4R2IA 3X2SA 4PQYA 4DCTA 1KK0A 3CPJB 3C4JA 2G6BA 4XSGA 5EZ5A 3EARA 1N0VC 4NYIQ 3AVOA 4TYNA 1OXUA 4XOIA 2MSCB 4M1MA 4TLDA 1WDTA 3Q3JB 1ESMA 4RD4A 4WXPA 5FR2A 1U0HC 1DELA 2EFHB 1RFLA 3S1AA 1AA9A 1E1QA 4TT3A 1JI0A 1MKYA 2GAOA 2YVUA 1P9WA 1BMFD 3MMPA 4P33A 4URVR 5CLQA 3PR1A 1G7RA 1E2EA 4OBEA 4A92A 2N46A 1F5NA 2F9LA 1X3SA 3BK7A 4CRWB 1XMVA 1DPFA 2WMNB 4NL4H 3IUYA 2ZITA 3RAPR 3QENA 2ONKA 3EZ7A 1OIXA 2QPTA 4ASUA 3QKUA 1G3RA 3AVXA 3W8RA 1FL9A 4OK6A 3U7FB 1JQLB 3K70D 2IXFA 3NEYA 1PLLA 5FI0B 2YOFA 3QF4B 1H8HD 2QPOA 3KQNA 3B7GA 4XWKA 4BQSA 3ADCA 2PZFA 1CP2A 3BBPA 4XIGS 1OPXA 3Q85A 1ZUIA 2P6RA 4A0FA 1AZSC 4TSFA 4DEYA 2WIAA 2CK3A 2ZJOA 2I3BA 4IXMA 1L8QA 1J2JA 3LY5A 4P4UA 2AWOA 4K46A 1E9EA 3Q7QA 3LAWA 1T5LA 1VCMA 3ZZTA 4YMUA 4LK2A 3THYB 4D25A 2OFXA 1E96A 1VCNA 1KI7A 3T1VA 4US0R 3C16C 3K0CA 3P26A 3D6TB 1JEEA 4GDFA 5FH9A 2DBYA 5D3QA 1Z28A 1FX0B 3RWMB 1T0HB 1TF5A 3MLEA 1ZYUA 4C0SA 3D31A 2CDNA 4N0DA 4A6PA 2RH5A 3L0OA 3CZQA 3U7EB 4BFYA 5L3SB 1DE0A 4Q1DA 2FFHA 1XTKA 2FSFA 1G7SA 3R20A 4CEHB 3MJRA 1OKKD 5EZ6B 1RRPA 3PEYA 4TYPA 1HH4A 1J70A 5H70A 4R71A 1RRFA 3QKRB 3EC1A 2HT6A 5K8TA 2ZSFA 3AF3A 3K0FA 2NO7A 4LWZA 2RGEA 3OIVA 2V3CC 1TTTA 1T9HA 2J3EA 3LWNA 2O8FA 1F3OA 1J7KA 4JLDA 2WTUA 1GKIA 2G77B 2KBEA 5F3WB 3B60A 3BB1A 3DHWC 3VR4A 3JVUA 2CVFA 4PO1A 4TMXA 1B0UA 2PL3A 3M1IA 4PZYA 1T91A 1ONBA 1XD9A 1G3MA 5CITA 3QXCA 1HURA 1VECA 3RYTC 3IPXA 1YZKA 4H9GA 3N70A 4A2QA 3OESA 5FPKA 2J0QA 4E22A 1E2PA 1ZNXA 3SNHA 1W0JA 2DFLA 4QG7A 5AR1A 3HYTA 2ANCA 2WIBA 4LYFA 3TUZC 1XP8A 3PCRB 4TTQA 4AIIA 2UZIR 2GBLC 1G7TA 1JJ7A 1GP2A 2H1LA 2J7PA 2VPPA 1NJGA 4RD1A 5JS7A 3VR2A 2AWNA 2GKSA 1VKJA 1XF9A 4IDQA 4NCKA 4TMWA 5JEEA 1KSGA 1XEWX 1KSFX 3WMGA 2BM1A 5KYKA 2A30A 5KSYA 1SXJD 5GJCA 2B92A 2R9VA 4UJ3A 4TMZA 2IUTA 5JHHB 1GKYA 1RRGA 2NOAA 4Q1BA 2X77A 2JLSA 1GIAA 2GNOA 2GJKA 3UK6A 3IHLA 3ADDA 3KJHA 1YQTA 4D4JA 4TTPA 2GCNA 4A8JA 5DI9A 2UKDA 5B57C 3MG9A 3KZ1E 1ZNYA 1XD8A 1JR6A 1NI3A 2YV5A 4Q4JB 2GCPA 1VHTA 2CE2X 2AK3A 2QMOA 1TL7C 2WMOB 3LV8A 1KK3A 2B7BA 2R6GA 4G5RA 1GWNA 3HPRA 3KDSE 1PV4A 2GHIA 2SHKA 5K8UA 4JL5A 1W2GA 2AFHE 5EP3A 2REXB 3EX7C 4M1SA 3TSZA 2VO1A 5CIWA 1OHHD 4PHTA 4TTRA 2G3YA 5AJVB 2XGJA 1W36B 5DYIA 4LYAA 4QM6A 1VIAA 2WWYA 3DKPA 2IX3A 4A4DA 3SJCA 1WCV1 3IBGA 4NYIR 4S35A 3ZVNA 2O8CA 2FZLA 2QMUA 3N2EA 2F1IA 1C4OA 2A5YB 1XEXB 4XWAA 2BMFA 3SHFA 2JJ2D 5EE0A 4Q9KA 2KJQA 4MGZR 1WB9A 2NIPA 4JSYA 2VEDA 2B8TA 3GLFE 1LTQA 2GEUA 4B34A 2O52A 4DSNA 5AUOB 1OJLA 1HV8A 3AUYA 1NLYA 3I8XA 1S9DA 3ZYCA 4RKFA 1SKYE 1S2MA 2ONJA 4ZDIA 4URWR 5JJLA 1G8HA 4LBZA 3QF4A 3TR5A 3T5DA 2VF8A 1P61B 3ND9A 3V4RA 2NMVA 5F2EA 4QHTA 4DLXA 5L8VA 1KI9A 2Y8EA 3O8BA 3BH7A 3FFAA 721PA 5FL7A 4DSTA 4UXIA 1JAHA 1TUEA 4DCNA 5EXSA 2A3RA 4KVAA 4TYQA 4DWJA 2IHYA 3P1JA 4FCVA 3LNCA 2D4HA 2G88A 3NBYC 2KSQA 2P5SA 4I1SA 4W5JA 3AP2A 5BWMA 1E4YA 1E3MA 2DB3A 3H1TA 2WSSD 2ZYVX 1Q0UA 3CKLA 1IXSB 1HE1C 1E2MA 1FX0A 1CR0A 3HWSA 1A2KC 3PUXA 4UNNA 3TIFA 3LH5A 4DCVA 2H92A 1EFRA 1XCMA 4C0BA 2V7QD 3ZS8A 1GNPA 3O8RA 1W4CA 1E1RA 3RC3A 4Q9LA 3A4NA 4FIDA 4LZZA 5GJWC 4XVUA 5L3SA 1E2QA 1GKUB 4FMCF 3CRQA 1AJEA 5JEDA 4V0NA 1K5DA 3IHWA 3BFXA 4CEHA 1BYUA 3ZDQA 1E0SA 4N0EA 1CTQA 1Y63A 4GI7A 2IBMA 1MABB 4Q4HB 1AS0A 2FMXA 2IA5A 3QKRA 2GCOA 1QF9A 4JT4A 5JWOA 2CNWA 3GJ3A 4A2PA 1OFIA 5JCZA 2JA1A 4FI3C 2A7QA 3T34A 4URUR 1PUJA 3K70B 5FBWB 5J4HA 4C3ZA 3KFXA 2DFTA 2VIIA 4C0KA 1UADA 4QC2A 2HCBA 5DI3B 3KQUA 1I4TD 1R5NA 1G8FA 2OEPA 5SZJA 3TNFA 3FMOB 1SVMA 1MO3A 2V6JA 1FNNA 3VHLB 4RJLA 3RNLA 2NO6A 4DLSA 1WBBA 1IQPA 4M22A 3JVVA 1QG4A 1YZGA 4Q03A 4EPWA 3LO5A 2IK8A 4GP6A 3KJEA 4JSTA 1D6JA 3CRRA 1JECA 4JLKA 4OHZA 4Q4LA 4AD8A 5AJWA 4PFSA 4CEJB 3SFVA 4CT5A 1MO6A 2OO7A 1Q21A 4MKIA 4Q7MB 3RS4A 5BYKA 3VKWA 1X6VA 1CRQA 3TUJC 1FOEB 3ADKA 5FUWA 3T1OA 4H1VA 3FVQA 2ZANA 4OK3A 1RKBA 2J7PD 3UG6A 2W6JA 1OXVA 1FMLA 2R44A 4JLJA 4W7SA 4C0AC 4RD6A 2ZS9A 4TN1A 2X2EA 1FQJA 1ZD1A 3TW4A 1W4RA 1OLOA 1XXHB 2BKUA 4Y0VA 4TZ0A 1FFHA 1ZM4A 4PAOA 2P65A 1NVWQ 1WBDA 2A2ZA 3DM5A 4NCHA 1S4QA 2BBSA 1OXSC 4IFBA 3TK1A 3CPEA 1E6CA 4F4CA 5K8LA 3FKSA 4ESHA 3ETLA 1XDBA 4PAMA 4Q4JA 5SZIA 3KJIA 1GRRA 3VHXA 4DSUA 2JLQA 1XJCA 1M2OB 2QROA 2RGNA 5KDLA 1HA3A 4TMTA 1JNYA 4JVSB 1KNXA 4DCUA 2P6NA 2ZRCA 1NVXQ 3C5HA 4RFSB 4B75A 2NQ2C 3K0CC 4FINA 1FMJA 4V0KA 1KY3A 3THWB 1QVRA 3U2QA 2XXAB 2D74A 2IEZA 1RZ3A 3LX8A 1G9XA 1UJ2A 1LV7A 3OEED 3ZH9B 1M8PA 2RHMA 2WVJA 2C5LA 1OE0A 4V0MA 5E7IA 3ZS9A 4HZUA 4JZKA 4EFNA 621PA 1EESA 1ZNZA 1AS3A 4JL8A 3FYHA 4BEJA 3E5HA 1OB2A 1KO8A 2CE7A 1KDOA 2QMEA 2ZJZA 3LQQA 2ZSEA 1XEXA 3IO5A 3AVVA 5HKKA 3WNBA 1NMYA 3CNLA 1ZIOA 2FFQA 5KNBA 2ZPTX 2RGDA 2P67A 4TYYA 4LJ4A 3A58B 1KY2A 1JR3E 1SXJB 1JBKA 5DH9A 5EE1A 1XTQA 1DO0A 1CKEA 3NVAA 4B2LA 5FI1B 4ZV4A 3VR1A 3FWYA 1R10A 2EW1A 2VP4A 3NHAA 1N3BA 5FUYA 5KOYA 2B8WA 4Q9JA 1SHZA 2QI9C 5G41A 2OE2A 4B6FA 1Z08A 3BERA 1YJ5A 2FEOA 2WHXA 1P5ZB 4D0LB 3NXSA 2IYXA 3GQBA 2IWHA 1FPMA 3ZLJA 4V03A 3VMFA 3GJ6A 2O0JA 1AIPA 1DOAA 2BOVA 2QP9X 1DAFA 1O3YA 4BECA 3AVTA 4BFUA 5FL7D 2ZVQX 2OAQ1 5DLQC 4DJTA 2O0KA 3B5JA 1ZC4A 2RHDA 1CBUA 3ZVRA 1D2NA 2MSDB 3PEWA 5BN5A 4CDGA 4D26A 4I4LA 5EE9A 2CJWB 1Q44A 3PXGA 2G1JA 1QVAA 1E2GA 3L0IB 2EFEB 4KXFB 2F3TA 3V4FA 3L8ZA 4ZDKA 2KE5A 2JLRA 2XOKA 3U61B 3VU9B 1EFRD 3QXSA 1ZVQA 8OHMA 5CYPA 4P31A 1YVDA 4NYMR 5D3MB 1GM5A 2YJTD 1BMFA 4HAXA 1N6NA 5A5GA 4BFWA 3AM1A 1MABA 1Z3IX 2IYUA 2NPIA 4M2LA 4Q4HA 4A8JC 3PEUA 1G5PA 3NC0C 1XJ0A 1VIYA 1LFDB 1S96A 5J40A 4MQBA 4KO8A 3CRMA 2GJAA 3DMNA 1KI3A 2F6RA 2ORIA 3EA0A 3RSLA 2VHJA 4IFEA 3FMIA 4YDHB 4LBVA 2ZRHA 3BWDD 3MD0A 3TMKA 3KUCA 2C98A 2V54A 3RS3A 1H8HA 3LLUA 4CIDA 1P9NA 4PC6A 1KJZA 3KFVA 1GG2A 1S8FA 2ODWA 2HUPA 1PLKA 1KHTA 2VBCA 5DI3A 2XZOA 3N5CA 2JLVA 2KI5A 1OB5A 3RS5A 1G19A 4DLUA 3SDZA 3E70C 5BW8A 2QL6A 5JCPA 1KGDA 1GILA 1BO6A 4XSHA 3I4LA 4AG6A 4B71A 3G0HA 2PLRA
chains in the Genus database with same CATH superfamily
2FZGA 3L1HA 3SR0A 1RE1A 1R9JA 1XVTA 2XWQA 1DDIA 5E3IA 5H8WA 4RELA 3WZMA 4WESB 1Z2AA 3M2TA 4JR0A 4OGGA 1KJ8A 4OO3A 3RQSA 4D5EA 4HNTA 3EIHA 4IMRA 5KQRA 1EK2A 5E6RB 4B3RB 2P0EA 3S68A 4AS3A 2O2JA 1PR4A 1N2JA 2O5VA 1PFQA 3GPDG 4CEJA 1GZ7A 2PX6A 1U0GA 3D54D 1MHPA 1Z6XA 2H2AA 1FSGA 2PRIA 2ZJFA 4ARSA 3MRXA 1QUEA 4MROA 4OREX 4BLPA 3C6QA 1LDEA 4WH0A 4X95A 4HUTA 4GOMD 5BORA 2QL9A 3K8ZA 4PZUA 3RRMA 3K8OE 4RZXA 1EX9A 2Q3DA 4U0JA 4TV8B 3P4UA 3KDPA 4TWJA 2EFCB 2GLUA 2RH8A 4FWIB 3IQEA 5FOQA 5CK5A 1JEYA 1UAAA 1OKKA 3CX8A 3R3UA 1AUXA 5AK3A 4D4IA 5H4GA 5JJIA 1U7XA 2EZUA 3U1BA 4XEUA 2MSLA 4LVNA 3KYIB 3VH4A 3AI2A 1XAGA 4WZAE 1CJMA 1E8DA 4AJPA 4XARA 4YAEA 1NAHA 4BN5A 3LUJA 2FX5A 1XKTA 1L4MA 3X43A 4Q7LA 4B1FA 3DOFA 1DCKA 5DLDA 4AQ7A 1T5SA 5CVVA 3G2QA 3VU8A 1IEXA 2GEJA 3DZDA 5G2OA 1M2OA 3SS8A 2A1TS 3IRUA 1AHPA 1P2SA 1WA5A 3HLKA 5EWLA 1I9CA 3BSFA 1SUPA 1ML4A 5CT5A 3S0JA 4B7ZA 2BDUA 3EVBA 3IB6A 4UZFA 5KTPA 5F7XA 3O03A 1IRIA 2XXAA 3FPHA 4HNAA 3ESRA 4MP6A 4QGBA 4UM5A 4DLBA 4LFCB 3KS9A 2WEKA 4FN5A 1ZA2A 4KSCA 4R8LA 1F4LA 2GUGA 5JS2A 3TTVA 2OTCA 3L8EA 5FB3A 3K6SB 2IFTA 4DQKA 3WAGA 4KYUA 4KTTE 4EZEA 2IYOA 5JMWA 4X91A 4DRYA 3N7AA 2Y66A 1EWTA 3K8YA 3KYJB 1ZVJA 3DEFA 4HQLA 3QJGA 3OWHA 4AF6A 1B6RA 1FYEA 1K88A 1JE1A 1PNTA 2C96A 3B6EA 3NBMA 4LNAA 5FA8A 3SEZA 4JIMA 5L40A 3EIEA 4E4RA 3GMIA 3C5WP 3G82C 3DDZX 3BD9A 5BSUA 1ORIA 4O2BB 2ES4A 3HJUA 4KFRA 3IDZA 3BJIC 5HKKD 1KEEB 4F2DA 1QGDA 4E5VA 1U5AA 1MQSA 1TCAA 2AQIA 2P0YA 5TMBA 4PZZA 4UHEA 1T9AA 2XTMA 2D2VA 1FVOA 1OBCA 5KTSA 1JG3A 3NGMA 5I4BA 2I6FA 3HGMA 5F9FA 1MHTA 4MRVA 1EFPB 1OILA 1V96A 1P2UA 1DARA 3R41A 2D0DA 4FYJA 4GDMA 1M3SA 5TQVA 3F5SA 3EW7A 4UU1A 5ADHA 4LHEA 4C4ZA 5HJEA 1BFDA 1MVLA 1TUBA 1Z6YA 1V1MA 2OR3A 4OQZA 3RS7A 2R7LA 1U2GC 4WAUA 5DULA 3O2JA 2B5WA 3Q3GE 3JZFA 1DCMA 3PTZA 3LQKA 1PHRA 1URPA 4C7XA 4R69A 4RLFA 4BMYA 4F46A 1M75A 3F46A 2OXIA 2JGJA 3ZWNA 2OHFA 1NLFA 3PXAA 1S89A 3BSSA 2ZDHA 3EQ7A 4JOCA 2C3PA 4A3SA 1QFMA 4YJ3A 3VX4A 3ZGXA 1RSZA 4IDFA 3GFSA 2Q5JA 5TRTA 2JNWA 3FFBA 2HQOA 5UKDA 3D6VA 3GLIB 4B6SA 1Z0AA 3PE3A 4FHCA 4LMBA 4M7PA 3RFFA 4ZCSA 3ZQJA 2WM9B 5JYCA 4UU0A 2IIBA 3RYFB 2UZ1B 5J2UB 1M1YA 5EWMB 2F48A 5JW6A 1LX7A 2IS2A 2L17A 4QBIA 1QTNA 2PV7A 4FR5A 1YRBA 4GZ6A 4KN9S 5KYUB 4Z3OA 3QU4A 1Y5MA 1U31A 5D3MA 1MDBA 3PC6A 2PT7A 3NTRA 1DDOA 3KQMA 1OIVA 1EUCA 5EINA 3TQRA 3VZCA 4FFLA 2YYAA 1Z2CA 2IHTA 3LLMA 4A7PA 1V35A 3HNRA 1WVIA 1P4SA 1S1CA 1YBFA 4LPSA 1RLUA 1GTMA 1JU4A 2W2TA 3DNMA 1DOHA 4TKZA 4UFNA 1Y3CE 1CCWA 3DBLA 1Z7EA 2ZJ0A 3GBSA 4HWPA 1O96A 2V6GA 3CLTC 1ZA1A 2R6JA 1Z7BA 3CX3A 4ZOEA 3ZQ4A 2Z6VA 5DCUA 4PO9A 4Q15A 1U28C 3JSAA 3EXG2 4KBGA 2O0HA 1SZJG 3ABOB 3U4HA 3IR7A 4QDTA 2JFXA 3CVYA 1PFUA 3MF4A 3TF5A 2C2KA 1IN8A 2H7CA 1QZTA 1D4FA 3CR8A 4TMKA 2KMLA 3DW1X 4O4LF 2QJTA 4OFWA 1CY1A 1Z25A 2FN8A 3WYGA 1MIOA 4ZYWA 2FVYA 1Q91A 1WVMA 1J90A 4ND1A 4NH4A 1NN0A 5DEIA 3UTDA 3ZKAA 1NXTA 5AJZA 2UZAA 1HDRA 2CMHA 1K3UB 1AKUA 3BGSA 4ED9A 2LCFA 4WESA 3OPMA 2A6PA 3ZE9A 4HTFB 4DIDA 3CN9A 3RSSA 4F6LA 5TQ0B 4GLBA 5E6RA 5FTMA 4S05A 1G5IA 1KAQA 4OK5A 2C4UA 1H6AA 3OEWA 4B7XA 3TO5A 2G82A 3CR7A 2RK4A 2FGJA 3U4GA 3ZHCA 4JXZA 3R3JA 4R8RA 5LMUB 1YR8A 3B1VA 2V7QA 4AUNA 4QQ8A 2EFDB 3E8MA 4NCXA 3IUPA 2EP8A 4TV8A 5DRYA 821PA 3WHPA 1AV6A 4YMLA 3IP7A 2JVKA 1K8YB 2H08A 5A4DA 1R4ZA 5GGXA 3BA6A 2G8NA 4YECA 1G3IA 4IL5A 4LHZA 4OU5A 1GAWA 2EWWA 2H5LA 3O2SB 2JAHA 3LE8A 3NETA 1CVLA 1KP9A 2C7BA 3CLUC 1MFZA 3AZQA 4JI3B 2NU7B 1VJDA 5IJWA 2DSTA 1QZXA 5DE3A 4LECA 4UXHA 2IHJA 1JQBA 4XB2A 5LWHA 1K7SN 2IUSA 4KGZA 5L51A 5J1SB 3KM0A 4OBWA 2VF5X 3H6HA 3COSA 3I6IA 3OZVA 3QE2A 4HD8A 4HPWA 2WWFA 5M7EA 4JLVA 4YCDA 2ZBDA 1G59A 1KQGA 4PBTA 4PNZA 1O5IA 3HADA 1YS1X 2UU9B 4O0LA 1SOMA 3EZ9A 1RWWA 1RM0A 1SG9A 4HFRA 1H3EA 3G7UA 1DX4A 4XH9B 2I8LA 2OBLA 4RVUA 3ZGYA 4WZBA 1ZD9A 5C18A 1FSPA 5JOQA 5AUPB 2V7VA 2YZNA 2J59A 2WR8A 4HI0E 5BSMA 3GX1A 1C7QA 3DLPX 3TTSA 1WOYA 2VH1A 5F7ZA 5EAIA 2FMIA 3NBFA 3K6SA 1X87A 2W83A 1ULHA 3C6ZA 3KB8A 5DK6A 3DDHA 1HE5A 2A33A 2XUKA 5DSZA 4B3BA 4YRIA 3DULA 5IXJA 2APJA 2CL5A 4LAFA 1Q74A 2WA2A 4DMUB 4F8YA 1UDXA 1XCJA 3D59A 4CCWA 5EYPB 2BGKA 3OZRA 4KE9A 4OMUA 4BE9A 3UMJA 4S12A 1RPJA 4FBGA 4Y6LA 4CUZA 1TFUA 3JPYA 2B98A 3OIWA 3H18A 2KM1A 2QU7A 2V3VA 4E2FA 1KEEA 4QQFA 3W3AH 3AEZA 5ADUS 4RO0A 1PGJA 4RHTA 3H6KA 3K70C 3O3NB 5K8IA 4WNAB 4E07A 2EKLA 4US1R 2C58A 5CLJA 4L6IA 4BMZA 2BONA 2Z30A 4BJ3A 2JLZA 4Z9AA 3EUWA 1EFPA 3COZA 3JQGB 5LBUA 2WM3A 3KE9A 5JNLA 3Q72A 2BGJA 4IV0A 1LSOA 4X8HA 4FSHA 3SXUB 3V1KA 2BCGY 2F59A 3ZDCA 4B3SB 2IDKA 4LHVA 1K6EA 4OLJA 2DY1A 4BQOA 4QDUA 3BGOS 3B38A 4QU5A 1N5DA 3C3DA 4HDCA 2I3GA 4S2EA 3HJNA 1C81A 2NVBA 4PR0A 3S2EA 2FDRA 4UZEA 4CFYA 4QJ4A 1BRMA 5JAIA 3ETEA 3U3MA 4FJ2A 4YO7A 4AXXA 1IBCA 1NIPA 1P62B 1G6KA 1X1EA 3NBXX 1PJQA 2HX1A 5AI8A 3I2GA 1Z47A 2OSVA 3K6KA 3PGKA 3QWFA 4C01A 4EHAA 4RCZA 2XUDA 4R9SA 4O5OA 5SY4A 3L6EA 2LP4Y 3GLIA 2H7XA 2HQBA 2M6RA 1HZZA 3QZUA 1RWMA 2IYYA 2FUKA 3RYFA 1VBMA 2IRWA 3OJOA 3Q8XB 2DPHA 5EWMA 1RCFA 4R8KA 5AVXA 4HEA1 2X3YA 3L7NA 3I34X 3W6UA 1U3TA 3Q6MA 3I04M 5KYUA 2DR2A 2JRLA 1GUZA 1RLJA 2VHYA 2OXFA 1N4AA 1W96A 1L5HB 1Z7WA 1WWKA 2IP1A 3OLWA 1CJTC 4M89A 3QPUA 4QPJC 4RMNA 3NT5A 3PJDA 4WQMA 2DTXA 5GM1A 3NORA 5BWLA 4N65A 1BMDA 2B6HA 3PDHA 3A14A 1YD7A 4URYR 1RKUA 3WB0A 3K71B 2H1IA 4DZZA 1NR5A 1CUXA 4FW8A 3SS7X 2IYTA 3SYRA 3ZQUA 4EYQA 1HE8B 4DDKA 3TFQA 4Y1GA 4MVWA 1YKSA 1ZFNA 3CZMA 4F12A 4UAGA 2Q3MA 2D5CA 4H6XA 5A7GA 4JLMA 4B6RA 2WA1A 3G68A 5C8YB 3QGMA 3AM4A 4NFLA 3P0RA 1OF1A 2O2YA 1SJ9A 4RTPA 4LJ9A 1B8VA 4BGDA 2LDBA 2H8KA 5AKKA 3TINA 1ECBA 3EF1A 4V3BA 3WGOA 4DDTA 3ZU6A 5LDGA 1SVOA 3L4KA 2A86A 1UMKA 1VJ5A 3ILVA 2PKXA 4V1CI 5JXWA 4RVDA 1U4SA 3GN1A 2YZKA 1I80A 2PKQO 4M38A 1CIVA 3OZDA 4CIYA 3QWBA 4OQLA 4LKRA 1OFVA 4WIAA 2EVWX 3LS2A 1N5MA 1HC7A 1ZIPA 2F9MA 3JASA 1NFFA 4G5HA 2A5JA 4OI4A 3M5DA 3TG8A 5FLXA 1N2HA 3B9QA 3TD6A 3WIBA 4F72A 1DXHA 1TMYA 4HTFA 2IH4A 4A6DA 5TQ0A 4WXYB 1KAHA 3LVQE 4ENUA 4U7TB 3JZMA 1YK0A 5E7QA 3HVJA 1F4PA 4YP6A 2RGAA 4F2PA 4ZFNA 4R84A 3L2OB 4TMFA 1ZD4A 7ADHA 5AQEA 1EFHA 3CUVA 4Q1AA 4V24A 2J0EA 1GGEA 1KU0A 3ZX4A 5KU1A 1IFXA 3RD5A 5EXXA 3WLQA 1DC6A 4HYTA 3I9V1 3HCBA 4GBMA 4Z9YA 3ZTYA 4L08A 2Z8ZA 1MGPA 2X7HA 2Y2VA 2YMLA 3LBIA 3LUHA 5JYDA 4TL8A 2WWVD 2C59A 5FOTA 4ZGBA 1M5RA 2WJ4A 3HDJA 1RIFA 1F14A 2NU7A 1JU9A 2J0SA 4M7OA 2A9JA 4FZRA 3BGWA 3X1JA 3EW9A 3E82A 1LV8A 2JLAA 4D43A 4G0MA 1E4OA 1Q57A 5ESWA 1YDGA 2PRSA 3DBHA 4GKAA 3SOZA 4BS9A 4JC5A 1QHNA 2QTZA 1RZVA 4MA4A 3URMA 3VSDA 1EBBA 1OYOA 2AB0A 3GOQA 4YUAA 3ZBQA 5TV2A 3MN1A 4QDXA 2ZWIA 2CJFA 3CX6A 3KE8A 1XZMA 4O0MA 3K32A 3GLUA 1W6UA 4LF5B 2RD2A 1FS5A 1IY0A 3V55A 1JKFA 2OP1A 4PC7A 5EOVA 1Y1SA 5U9CA 1HQKA 3TVTA 3LC2O 1WPQA 4GF5A 2DUWA 4NAUA 3U1TA 1L5OA 3RTAA 2X9QA 1CDZA 3MTEA 3DT6A 4RMGA 5AVSA 2JIOA 5DSTA 3VPSA 1AZTA 3F97A 5CH3A 3T1TA 2IUYA 1DC7A 2C2WA 1WU7A 2HO4A 3ETGA 1X7HA 3N59A 2WWIA 4RF2A 4ZVVA 1KE1A 3EMDA 1QF7A 3N8HA 4GS5A 3ULKA 4BO9A 1JAXA 5EGSA 4UKDA 1Y81A 5EYPA 3V1TC 1IXYA 3V2UA 3TNYA 3HUFA 4AB1A 1IOLA 4K9QA 4QT4A 5HHTA 1OH5A 3VFDA 1S7GA 5CU7A 3TPCA 3HNOA 3RF7A 1D4OA 1WPRA 4D57A 3FTEA 3NJRA 3QRWA 2I67A 1B6TA 1NOKA 4DV6B 1ULUA 4LF8B 4NDNE 2CLEB 4HTAA 4B32A 1YO6A 2VRCA 1Z29A 3LBYA 2Z9DA 3QPWA 4WNAA 3QNWA 5JARA 2RGGA 3IXMA 4R3WA 3V7UA 1K7EB 2OECA 4NI5A 5EHXA 2QT9A 3FLEA 3EY4A 3JQGA 1TUIA 4LZWA 4LDZA 3BC1A 1OXTA 3SXUA 1OLXA 2CV1A 3PC4A 3OF5A 4M1QA 3WHLA 4DYDA 3ZCTA 1LCIA 4GBGA 1XRMA 5J58A 4CR7A 3MOIA 4V1CB 2KWIA 3LUFA 5EA2A 3QXGA 3CWZA 3SD7A 3UQYS 4B85A 3O1HB 1J21A 3W9BA 3AHGA 1UJCA 1HFWA 1HO3A 1EJ6A 1US8B 4N7JA 4RXTA 4YV0A 5F64A 2HSZA 5GQSA 5LQUA 2YS7A 4PHCA 3RLIA 1P4JA 2MJLA 3PL5A 3C24A 4JI4B 1RCUA 2DUMA 1L4HA 2MYUA 2P7HA 1SHJA 3FSEA 4YR9A 4XUEA 2B25A 3DM9B 4DPLA 4F2GA 5BW4A 1K3TA 2ST1A 4C4TA 3NIDB 2QBYB 1R8QA 2JLYA 1EBFA 1WTAA 1G98A 1J7JA 1UJBA 4RMJA 2IODA 1MCZA 1FXWF 3UWMA 2IY7A 1O5TA 2E3JA 4WZZA 4JP5A 2JLWA 1O7JA 1GTG1 5E1BA 1GLGA 1YE8A 2H4ZA 2DPMA 1L5HA 1ZK2A 3BH0A 1G4AE 2DTEA 3M5CA 2PA3A 4RCVA 2XLCA 1Y4AE 5EIBC 4DA4A 4N39A 3NH6A 4HLNA 3KJGA 1CY4A 1Z0SA 5LP1A 2BEWB 2VVTA 3EIWA 4MR9A 4DSAA 1X74A 4TVSA 3HS3A 4TS1A 1X2BA 3Q9NA 4RNDB 4KQCA 2CJPA 4RZSA 1BGVA 1PQPA 3HDVA 1B23P 2VXCA 1XMIA 3WSVA 3J81k 1Y1KE 4Q39A 4QASA 4AO8A 1W75A 1HETA 2I6GA 4HPXB 3JRWA 3OZAA 5C8YA 1YQXA 4R40A 5IC4A 1MB4A 3KVRA 3V80A 3ZIUA 5DXAA 5A06A 5ESXA 1OYWA 4OX9B 3E5MA 5NULA 3ESBA 1JXMA 1ZD2P 2I3ZA 4PLGA 1EWVA 1XRNA 1H3NA 4NMWA 1ST3A 1TJPB 1KMHB 3CH7A 7MDHA 2ANBA 2GTIA 1LLQA 3RHFA 2QM7A 2WKSA 2E6UX 4QD3A 1U2RA 3LHKA 4IEEA 3SFZA 2ZYWX 3JQRA 2X5JO 4GMFA 2FWPA 3SM9A 2YUTA 3SN6A 4CT4B 4RTKA 1YU9A 1Z0UA 2AH5A 3GLVA 4NOLA 3LPDA 4BDTA 4QG3A 1FB5A 1V11B 2PBFA 3DE2X 4DC0A 3F3SA 1XTRA 2YV1A 3HH8A 3I73A 1LRLA 4JR1A 4PO8A 2YRFA 5B7PA 5JVDF 2V3CC 3GFTA 4O2LA 1RXCA 5F5LA 2GSWA 4LTDA 1IWPB 1W29A 2OT3B 3KZMA 3MSCA 2LIVA 5CA1F 3R6WA 1GTZA 1U2EA 2BFNA 3CZAA 3K6RA 4KKVA 3UJ8A 4ZMBA 2XTAA 4QYWA 3EIXA 2I7TA 2QUZA 1V5EA 4D6YA 2DXIA 3DVAB 2G04A 3HNPA 4ZV9A 4JUCA 3BMCB 2FTKE 2FW8A 4XIIA 1M74A 3B1XA 1C9EA 3AR9A 4HAOA 4S0ZA 4A91A 4ACAA 1T8TA 1XZEA 2VK8A 1L5LA 3W4KA 2J9YB 2EZ4A 4H7DA 4P7GA 4TUYF 4NHOA 1PJTA 2EF1A 3HN7A 4D9FA 4TVKA 2ZTHA 2LNDA 4YCBA 4BVEA 4H1UA 3C8MA 1LPPA 5B37A 2YHSA 1YBAA 4DJDC 3LHDA 3FDFA 4DNPA 4RJIA 1LTHR 4S1PA 5C8XA 3FOEC 2HUNA 4LFAB 2NZ2A 4DV5B 1V7ZA 2W58A 1E3IA 3TLCA 4MVJG 3ZWQA 2FP4B 3L06A 3HBLA 2DPGA 2G70A 4GWGA 4BWYA 3MWYW 1U2DC 3Q5EA 2JJQA 5KUTA 2AOVA 1NF2A 3WRYC 3WWEA 5AXAA 1XE3A 1VBNA 3HZZA 3BXOA 3PQCA 5EL0A 3QX3A 5EQJB 2Q28A 2XEXA 3IH5A 3AO0B 4C2TA 2J3JA 1U1IA 1L5KA 3HBJA 1HZZC 1TNDA 4EW2A 2YVLA 1G2IA 3GFGA 3OHSX 1BC5A 2FWIA 4G84A 4A0SA 4D45A 2QD5A 1VHLA 1WEHA 3ELUA 1COWD 2SKDA 1THGA 1KI1A 3C8DA 2JHCA 1Z4MA 2IV2X 3SYMA 4OQPA 4ALMA 2HV9A 5CB0A 2PSHA 1TD9A 3GPIA 1USKA 4GXRA 1D1QA 1P29A 1Z4NA 3HP1A 3L9WA 2Z2ZA 3F71A 4LGVA 1Z0FA 2M1XA 2OBYA 5CGQB 3T5BA 5IS2A 2O2SA 2XVZA 5DTQA 5DTRA 4CUKA 2PUCA 2J08A 1NF3A 4GH5A 4KYTA 2VZ0A 3CUTA 4Q6BA 1LSSA 3SIXA 3DZCA 4UUNA 1BVRA 5JUWA 3TWOA 1QRRA 1K98A 1R9NA 2VJBA 2JI4A 2PX5A 2JC3A 3IQFA 1A5ZA 5CT4A 4IIGA 3VYWA 4DLWA 1WF6A 5SYNA 4U9HS 2ZR9A 2HU8A 3FZGA 3LKZA 3AJRA 4MJ7A 2DWOA 3VUEA 2A84A 2F90A 3DTVB 4DDWA 1ZGZA 2ORVA 4K8OA 1RXSA 3C1OA 4TKUB 2A4MA 4ZJZA 2NM0A 5EHGA 3A7DA 2GHTA 3SOPA 4MS4B 4R1OA 3OFVA 3VC7A 2B20A 4PAGA 4WWHA 3S81A 4Q6WA 1QHSA 3VR5A 3I2KA 1T8UA 4U8GA 4L5BA 4AWXA 5J2TA 2XUGA 1T8YA 3GA5A 3BQNB 1C9NA 4V1CA 4ZVPA 3FCYA 1Z56C 5AKLA 3DQQA 5HJ2A 3S29A 5AVYA 3IIEA 2V4ZA 2OFWA 2JS7A 2XMQA 1MG5A 1AQIA 1ULAA 1US8A 3KEOA 4K6GA 1TYDE 3G0BA 4NQRA 4QAQA 3HXLA 3WADA 4F3RA 3TS1A 3MCAA 1WDLA 1WXFA 1DQPA 3OIYA 3K9NA 4MQ4A 4MWTA 4YAKA 1S2NA 2IU4A 3CRNA 5CYOA 1D2MA 5C1PA 3QK7A 3T41A 3CSSA 1WW2A 2XVYA 3G9ZA 3JD0A 3QVJA 2QBYA 2XMZA 3JR3A 4YRGA 3T7EA 2Y6UA 1EE1A 1EK1A 4L2IB 3FTFA 1U7DA 1T3GA 4OYLA 5EJIA 3AINA 1FJXA 1U7PA 2R86A 1S2DA 3MWDB 1Z6ZA 3K94A 4ZXPA 1U02A 2J45A 3JRXA 3QMVA 1E9BA 3W5BA 1S2OA 4NZOA 4RIEA 5BN3B 1ZMTA 1U3CA 3MMNA 2RAUA 1BD3A 1UZMA 2V8BA 5AW5A 4DQUA 1RBYA 2IDMA 5JY1A 3GRRA 1NJ8A 3SDSA 3ZY3A 4FW9A 2BEWA 4UUMA 2GVZC 4Y2PA 3TVDA 4BQFA 2RI1A 3U4QB 2PZ8A 5DT9A 3PC8C 1GL9B 1PEKE 1GYQA 1MAHA 4JUIA 4FP9A 3WKCA 5CFMA 4QHSA 3KQVA 1V43A 3K1ZA 3L7OA 2BJWA 1OH8A 1I2CA 1GPH1 5F4ZA 2EGGA 3WIEA 1TMOA 4NBKA 5H83A 3GLFB 4FKZA 2PJDA 5CM9C 1PJLA 2PMCA 3RKRA 4OM8A 1GCGA 1KQNA 3ROQA 4KGDA 1FNCA 2ZRQA 1VMIA 4RL4A 5K3SA 2G9VA 1GSOA 1ZESA 3CLKA 2JH9A 2HWYA 3BL6A 3HKEB 4IGEA 4KWHA 1YI1A 5BO5A 4ZAVA 2YVAA 3AYZB 5J4VA 3LP6A 3ZWBA 2ZZMA 3NNNA 2B34A 1KMHA 3QKTA 4Q4DA 5DTIA 3RVLA 3ZHUA 4DMRA 5IJ9B 2C82A 5L53A 3GMDA 4Y0AA 1XXHE 3R8CA 1CUDA 4X3OA 3B7WA 4D44A 1QRTA 4DIBA 3QWIA 5JZOA 3W6OA 1CHDA 1E2NA 1M1NB 2J32A 3HDGA 3H2HA 3PF9A 1LWOA 1J8YF 4JC8A 3JRNA 1R12A 1V11A 3QLTA 2A9VA 2GFQA 1QO0D 1Y34E 3FRIA 2K87A 3TNDA 4DKJA 2ZZNA 1I1HA 3G89A 3SJ7A 3AL0C 3HO6A 2HF8A 4J3NA 2AYYA 2H3EA 2H9YA 4X41A 2PBRA 2QWXA 1EE9A 4IMPA 4LV8B 2JKYA 3QU2A 4G0NA 4G4JA 2W2KA 1D0IA 1OI3A 1IEWA 2BKEA 3FWKA 3UHPA 2F8SA 1PU2A 5A04A 1NV8A 1IJFA 3DVAA 2WZBA 3OKAA 2WT4A 1Z16A 3KKNA 4AVYA 1VIVA 3A1VA 4NECA 1UPTA 3FB1A 3CF6R 4PLCA 4OL0A 4JQYA 5SZKB 3CB4A 3QELB 4TGLA 5JYBA 4XLTA 4LYGA 1V45E 3DAGA 5ECDA 1WS6A 5BRJA 3UA4A 3C5CA 3E3MA 1E62A 2QZPA 5JT1A 3FVWA 3Q15C 4I1OA 4JZYA 4E14A 1QF6A 3HC7A 2JVJA 5DNVA 5EY5B 3RR2A 1WW8A 4Q34A 4RABA 4RGQA 2CXOA 5DYNA 5ARCA 2RGNC 5EJMA 1TAGA 4LNUB 2XGGA 2ZUTA 2W6ID 4JCOA 16PKA 3T5MA 3OKCA 2FP4A 3VU0A 2FRVA 3B1KA 3D7SA 2Y76A 1WXDA 2FG5A 4YRJA 2WPDA 3OQPA 1P9RA 5BSFA 6PFKA 1LS6A 3GFPA 4D81A 1SC9A 1H4SA 1RVDA 3R3SA 3MZ0A 3RYHB 2QY6A 3EMBA 4J0EA 4PNPA 4REQA 3RYIB 2ZR0A 3ZDBA 2FY8A 1BE8A 2ZJBA 1MN6A 4O4IF 3HJRA 1PR6A 1Z0ZA 2QL7A 3CJTA 2D0PB 3L82B 3NIBA 3QEOA 4W5WA 4AYTA 4NEQA 1DIRA 1GQOA 2HBZA 4FBLA 3H9EO 1ZGGA 2GPAA 1AE1A 1GZVA 4JB2A 1CS0A 4EBFA 4IV5A 3AKZA 4A5OA 1REQB 3KOMA 5AJXA 5FI3A 4B2YA 1GHTA 1OTYA 1I4OA 1RC1A 2HQ1A 2RBKA 3F3YA 3LUBA 4FD3A 4JGGA 1Q1QA 2DUNA 2CLOB 3QLVC 4HMPA 4Z0HO 4XQ9A 3SC3A 3SX0A 3ODPA 3ZY2A 1BEUB 4FTWA 1F0KA 4I99A 1DB3A 3RODA 4TS9A 4HNSA 5CJPA 4YV2A 3HVRA 3NTOA 2E1PA 4BAUA 1O94A 1R18A 1W0CA 2YWGA 1EPUA 3L84A 1Z34A 4LUCA 2YVKA 4YRCA 1B0PA 3QBDA 2IUEA 3VPAA 3GAMA 3HJCA 3MBKA 4Q9IA 3W9SA 1VLQA 2MMCA 4MJXA 4TXNA 5K0FA 2QAGB 4CMCA 1UANA 2WBLC 4MUYA 2O19A 2QAJA 1G17A 3ILSA 3DTVA 4TLBA 2AF3C 2HA5A 3USZA 3EFHA 4PQGA 1YQGA 4MGIR 3A28A 5G4KB 1A95A 2XCSB 4ZKEA 1XPOA 4DJ5X 4TKUA 4UPVA 4IJVA 4X8LA 5A2QA 4IQ4A 1KPHA 1BXRA 4Y6OA 4Y2JA 3L6UA 3WC4A 3MJEA 1VL8A 3NXKA 2R11A 2OV8A 5BOSB 2G63A 2GZAA 4WMLA 1BJTA 3E6AA 3UIEA 3V9PA 1F20A 2QORA 4I5DA 1Y5IA 3DMDA 3PNSA 3ILXA 3JQAD 3AR6A 5CLIA 3JR7A 3PI6A 2IIVA 4Y6SA 1M54A 4EEZA 2ABWA 2HNBA 1X1AA 1TQ2A 2FNAA 1IU9A 4QOHA 4DUYB 4QVKA 5EXEA 1DVRA 4C5AA 4L4YA 2SKEA 1WZ2A 3A06A 2BUAA 4P92A 2OXTA 5KDOA 2W7TA 1DTSA 2FJPA 5FYDA 1TQDA 3OT5A 4RM3A 5L3RA 1Z88A 3GZ4A 5LMCA 2QUJA 3I0NA 3S28A 3HXPA 1FIUA 4AJ4A 4JROA 1VYVA 3GO4A 1M66A 2LKDA 1W85B 2Q4EA 4FMDF 4UAJA 4WZ6A 5CTAA 3TI7A 1TJYA 3AUKA 3NHRA 5BY2A 3NAQA 1FCJA 2JIPA 1NRXA 2Q9AA 3CCBA 4L51A 2FSIA 2QZSA 3DDUA 3FTNA 1A1VA 4UNRA 4RVCA 3ID6C 3EPRA 5BN3A 3R77A 2O7NA 3THXA 1Q7EA 1BIFA 2Y67A 3HE3A 3G7SA 2C83A 4S1OA 4UVGA 3CX7A 5DYGA 4AS2A 5IJ0B 1XFAA 4MKRA 4EUHA 3OUUA 4EFLA 2OCGA 3TX2A 5A7FA 3FOAA 4KFSA 1NVDA 1VKHA 4DCOA 4KGXA 3U4QA 4QSMA 3IHTA 3C5EA 2XB6A 4D99A 4JI0B 4TQ9A 1EXMA 4INJA 1JI3A 3N8KA 1K5PA 1H4VB 2Z4SA 3WBJA 3B8HA 1R2QA 5AK0A 2XGOA 3H0EA 3TZKA 4E46A 3AESB 3A1FA 4X1YB 3GLFA 1FS4A 3ORHA 1EX7A 3DOCA 4DXAA 4QLOA 2POQX 4AN0A 3LW8A 1YQQA 1DFIA 3VVBA 1WCXA 3COVA 3K31A 1MVNA 1UP6A 2OXRA 3D4LA 3QX8A 1N6KA 4NARA 4FFOA 4ZQHA 5FADA 2DYKA 2PUAA 1XVIA 5GM2A 4YRDA 3UEOA 2WKRA 1OSNA 2ZRDA 5IJ9A 2HA0A 2B69A 1P4RA 1WXHA 3AOEC 2AXQA 2ZSHA 4PLYA 3SMVA 5EHIA 3HJAA 3EXIB 4QIHA 2ICAA 1SZCA 2VDMB 5JG7A 5FRDA 4BP3A 4IGIA 4DJJA 1KNQA 3E05A 4I3FA 2M32A 4Q4AB 3Q0IA 1T15A 4TV9B 4D3FA 3GROA 2WHRA 5HUQA 3TXXA 4CMEC 2ESRA 4QE3A 3AF4A 4OHXA 4CNQA 2A5GA 1Z7YA 3NO4A 1YHNA 4EZBA 1UBRS 4HVCA 3T1HB 1VHQA 3EZXA 1QR6A 2YNMA 4XD7D 4LF9B 2Z09A 1ZRNA 1QU3A 3V4LA 1HQCA 3LCRA 2DQSA 2B4AA 3UY4A 2JZNA 1OWOA 1CS4C 4D9EA 3WWDA 4O3MA 2Q5EA 1JDTA 4QPPA 4DA7A 5TVKA 2IU3A 5J43A 1NXXA 1E3EA 4ERXA 4BO4A 1ICIA 3T0FA 3BB3A 2OYSA 3PHCA 1ECJA 4XYEA 2V6MA 1GSIA 2PE5A 4D25A 4R41A 5A4JA 1PKEA 3QELA 3DPSA 5EIAA 3U0VA 3PPIA 3WJ7A 2AMLA 3DT9A 1JB1A 1R0XA 2AX3A 1DBSA 3D3KA 3KKPA 1VG1A 4YTEA 1AKEA 2JIQA 3H13A 1EK5A 1R9MA 2XVMA 3L8GA 4RK0A 3NCTA 1Y4DE 1KVTA 3TBKA 4ZCRA 3DJFA 5CFOA 1TU3A 1TI7A 2VHZA 3EWSA 4CPDA 4YRKA 4LNUA 4OM7A 2OOSA 1QLJA 1NQVA 3HV2A 5DXFA 2GD6A 4HNGA 1T2UA 3T9EA 1EJBA 3NKVA 5C7OO 2D6FA 1M34E 1R0RE 1ETUA 3IEXA 3IXQA 2IEAA 2TECE 4ANFA 2OD9A 3CH5A 3GGJA 4ZVRA 2WPDD 1JHDA 4MKFA 3RYIA 1UWLA 2BEUB 3TH5A 1GQSA 3EFEA 1EHCA 1PZGA 4NIMA 1E1QD 3AV0B 2P91A 3C70A 3GUZA 4TT3D 2W2QA 1XTBA 3ODGA 3PNYA 4B3JA 5HZHA 3H7IA 2I87A 4N6NA 4Y98A 2XBUA 3FBTA 3WZ2A 3NT2A 2C9YA 2FGKA 2GZHA 1REQA 4MKXA 5T6BA 3ER8A 2VNKA 3I1YA 3KLNA 3U31A 3QPVA 2RGUA 1UC5B 2XCTB 3ET4A 1WCWA 1X80B 4ENWA 2BF7A 3FPLA 1Q16A 4ASUD 4MW9A 4HAWA 5C52B 1RJWA 1T34A 1VE9A 4EY4A 5IEBA 3QYFA 1N6RA 4DLZA 1P60A 1SZDA 4H08A 4LQLA 4OFZA 4P7FA 1DHRA 4MDHA 3VNVA 1SUDA 1U9IA 3NASA 1LTKA 4N5DA 2B1GA 1BWRA 1ZRHA 1Y1LA 1QGAA 3MA0A 1O94D 2QXYA 3TSWA 3KQKA 2BMDA 2E5WA 5CM8B 3NQ41 4TSRA 3PSHA 2QAGA 5KQSA 5DN9A 4BU1A 4EGAA 4KH1A 3EQ8A 2E18A 4QOIA 5LQCA 3DXZA 3A26A 1VBFA 4AG3A 1NVFA 3H84A 5G4KA 2NUBA 1NY6A 3FPGA 3R5KA 1YDHA 5BOVA 2YZ2A 1UKEA 5AW1A 2VI5A 1FLVA 1IPHA 1IJEA 4BNIA 2FPPA 4V0RA 3QY9A 2Q1WA 4ZOLB 1SGWA 4CI0B 1SO8A 1X8LA 1B2RA 2YS6A 3LCCA 1GY8A 1UBLS 5BOSA 1O0CA 4L0CA 1YVRA 3PYLA 3PF8A 4YMGA 2C9CA 5T64A 1NZFA 3H99A 4D0NA 5AUQA 1OH6A 1J23A 4ZVUA 3TTYA 4F9TA 3FDJA 3FPEA 2XUAA 2RGYA 2E4XA 3WV5A 2JIZA 4D4GA 1OFUA 3DWGA 4B5KA 4QGFA 2VUUA 4RW0A 5JAOA 3EXHB 2LBPA 4NWIA 2HHJA 1XMPA 2IZZA 2XZDA 4G0QA 5M34A 2WQ7A 2O8DB 4DAEA 3PXEA 2BISA 5G0VA 1ORWA 2GFHA 2J3MA 3KG2A 3KL4A 4JP2A 4YLGA 2HLPA 1T5OA 3ZXSA 2RKOA 4RS4A 3DE6X 3R2JA 3RQIA 2ISSD 1X1RA 1G16A 1H4QA 1TLLA 2PSDA 1W85A 4KZPA 3WMXA 4JMLA 5HJ5A 2BHLA 3TLAA 3SK0A 1M6NA 2L2QA 1A7JA 3PEFA 4M1OA 4GWKA 4OOEA 5K0EA 2BAGA 2ZJ6A 3L7KA 5TGTA 1A72A 2TSYB 1YZNA 1G6HA 4L50A 5JATA 3FPBA 4IVQA 4N8DA 5IJ0A 1M5TA 1HQYE 1UPAA 3A4VA 1Y48E 1M83A 3GAAA 3HXKA 4IXWA 1O4VA 3GNSA 3L41A 1WLSA 1Y8AA 3HR7A 2VQ6A 3DEYX 4QNRA 3RGWS 4P4TA 3CVXA 1FDVA 3ETHA 2GCEA 1H65A 3FCUB 1JWBB 3G8BA 4YJGB 1NU8A 2DBRA 1OBVA 3MJ4A 2PUGA 4ZPJA 4FGKA 3MJCA 4OQDA 4YAJA 1TX4B 2AQKA 2FEWB 3AESA 3KLMX 4JQSA 5DHSA 4EY5A 4DMGA 3EG9B 2FN7A 2IZ1A 4B3IA 1KYWA 1JR3A 4LWOA 3AI3A 2GYWA 3I1FA 3G0IA 1VOTA 4QZVA 2A94A 5FWYB 1F2DA 5JC8A 3KZCA 1K4MA 3DL2A 3COWA 5G53C 4DY6A 4F8JA 3GP3A 5IDQA 5IZ4A 2FE4A 3C41J 3MCTA 2O0LA 1GT91 3VYUB 1MRSA 1RHUA 3AGPA 1N7HA 1QXSA 2H7YA 1E66A 3B2QA 3EXIA 4JJFA 3A9WA 4MYCA 2LUOA 4UVEA 2IEBA 4Q4AA 3O4IA 1FXSA 4TV9A 3W0LB 2JFGA 3WSWA 4U63A 4GX0A 4RVGA 3SX2A 4GYWA 3EGIA