2JATA

Structure of deoxyadenosine kinase from m.mycoides with products dcmp and a flexible dcdp bound
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
202
structure length
190
Chain Sequence
MKIAIFGTVGAGKSTISAEISKKLGYEIFKEPVEENPYFEQYYKDLKKTVFKMQIYMLTARSKQLKQLENIIFDRTLLEDPIFMKVNYDLNNVDQTDYNTYIDFYNNVVLLSFDIVIYLRVSTKTAISRIKKRGRSEELLIGEEYWETLNKNYEEFYKQNVYDFPFFVVDAELDVKTQIELIMNKLNSIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEOXYGUANOSINE KINASE
publication title Structure-Function Analysis of a Bacterial Deoxyadenosine Kinase Reveals the Basis for Substrate Specificity.
pubmed doi rcsb
source organism Mycoplasma mycoides subsp. mycoides sc
molecule tags Transferase
total genus 64
structure length 190
sequence length 202
chains with identical sequence B
ec nomenclature ec 2.7.1.113: Deoxyguanosine kinase.
pdb deposition date 2006-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2jatA00
1NJGA 1TPZA 1R5OA 2EVWX 1G8GA 2VSFA 4OBEA 5G3ZA 3GLFA 1LF0A 1WXQA 4RCZA 1V5WA 4TWZA 1NN3A 4Q02A 5B30A 2VP6A 1NF3A 2KI5A 1TNDA 4DCNA 1CR4A 4B47A 4JJKA 1YZUA 3VHLB 4OQMA 4JYCA 4DCVA 3U7HB 5DN6A 3RAPR 2VBCA 4LX0A 3PUZA 4ZIRA 4HAXA 2OO7A 2QI9C 4LJ6A 4HAWA 4V0ME 1CS4C 4MDEA 4BRUA 4CGZA 4EFMA 1ZYUA 2JLQA 1ZIOA 4RZXA 3I72A 4UNPA 2GZHA 1KIMA 2C98A 3K0FA 3HPQA 3U6BA 2FFAA 2QP9X 4N1AA 4JKYA 1T8TA 4TL9A 5EXTA 1ETUA 3U7FB 4I81A 2H17A 1CP2A 1XJQA 2J41A 3GJ3A 4A36A 3VKGA 2IYVA 1AS0A 1JXMA 1KY2A 3RWMB 5JS8A 4M2LA 1KDTA 2PJRA 1AQUA 3GLIE 3EIEA 3P26A 2FGJA 4WXPA 4CF7A 3U60B 2F9MA 1U9IA 3K0CA 4HB4A 4WZBE 2BBWA 4A4DA 5JRZA 2ANBA 4XWAA 2ZYWX 3AKCA 3UWKA 3I92A 4Q00A 1N5JA 4LHXA 1ESNA 4I1OA 3AKEA 1M8PA 3GLGB 4FMBB 2QE7A 4IFBA 2ZI6A 2O8CB 4H1UA 1KZ7B 5JZVA 4U02A 1XJCA 5GJCA 1GKIA 3ADBA 4RZ2A 1JR3D 4C0JA 2CLSA 1CKEA 4LOAA 1NN0A 3A4LA 3QPWA 1W4RA 1QZXA 1HUQA 4KJZA 4EFNA 4EJSC 1OH8A 3CX8A 3WP0A 1IOZA 4TLAA 3IIMA 2RCNA 4JBXA 3A37A 3NDBB 2GWHA 3QXHA 2OG2A 2IUTA 5FOSA 2H5EA 4B73A 3WRXC 3FB4A 4B48A 5KSYA 2PX3A 3EW9A 4BASA 2ZE7A 3T5GA 2QEQA 2IYTA 4ACAA 2HT6A 5FTKA 3LRPA 1G8FA 3Q9LA 3CZPA 1IJEA 1PLJA 4GT1A 4B44A 3K9HA 3R8CA 2F1JA 5FOUA 2TMKA 4Q03A 3SJAA 2JIZA 4HB2A 3FFAA 721PA 2N1BA 3PFIA 1XXHB 4D82A 3QI2A 3K0EA 5EUQB 1IQPA 1T5LA 1ZM2A 2ZE5A 3R7WA 5DN6D 2OBMA 1SKYB 3M0EA 3TQCA 1NY5A 4JL6A 1OPXA 2G0TA 4GP6A 2WBLC 4F7WA 2IYUA 4MUBA 1IN5A 1NLFA 2JA1A 4QGAA 4RSGA 3SS8A 2KE5A 2WWXA 3GJ4A 3NVAA 4ERNA 3B1XA 1UPTA 1YZNA 2ZJBA 1T5IA 2ZSAA 5J4KA 4BFYA 4JT4A 1CULC 4W7SA 1RKBA 2RGDA 4X8OA 3RVBA 1EWRA 2CL6X 2QP4A 4CT4B 2J9RA 1TMKA 1OIXA 4X8HA 3CKLA 2V4ZA 2PZGA 3B6EA 3SFZA 3MWYW 5G40A 2A3RA 4Z8XA 4O25A 1ESMA 1XZQA 1US8A 2DR3A 2J87A 1KK1A 3BE4A 2O0HA 4A6PA 4DT1A 1SXJE 1IM2A 4PC6A 3VR2A 1A2BA 3B1WA 3LW7A 1Z6YA 3IEUA 1WBDA 1UBFA 3AP3A 4LHWA 2QE7D 1W1WA 5KO2A 3D8BA 5J4HA 4NYIR 1W0KA 2YWGA 2IS4A 2YC2C 2NO1A 2O8EB 4JLVA 4ZCLA 2VP5A 1BOFA 2QRZA 3L0PA 3PITA 4DWJA 3DOFA 2JAQA 3SHWA 2PEYA 4DSNA 2ZI7A 3EX7C 1CU1A 2W2VA 4HUQB 3SEAA 2BMFA 4FMCF 5E3HA 1KI6A 2GESA 4BZQA 1G6HA 2XSZA 2DY1A 4JLDA 3SZRA 1QHXA 3THWA 4JVNA 2GVDC 1TUIA 3TAUA 4BEBA 5J4YA 2J7PA 3OAAA 3RLFA 2QMUA 3MCAA 4ASUA 3K0AB 5FTLA 2JIZD 2I4IA 4IOJA 2VRWA 3N2EA 2EWWA 2ODWA 1G3QA 2Q9BA 4C0KA 3AEZA 3EPKA 1IONA 1IY2A 1G7SA 3N2IA 1I4TD 5AJVB 3CX6A 1XB2A 4QHYA 2QN6A 4V02A 1E0JA 1GL6A 4L8GA 3EC2A 4LV8B 3BB1A 3CRVA 4CVNA 3KQUA 2C03A 2Y8EA 5JI3E 5LPNA 1LV7A 3ETLA 3K1JA 4UXIA 3C41J 3T12A 5HTKA 4I1SA 2RGAA 3DZDA 3VTKA 5DE3A 2ZRCA 1KGDA 2IWRA 2QMEA 1GL7A 4DSOA 2W58A 2ZR9A 1V43A 1ZMXA 1OLOA 2GBLC 1JAIA 2CLCX 2HF8A 4KITB 4HDQB 5P21A 4JJZA 1UEIA 2ORWA 4RFSA 1X8LA 3BORA 2W2XA 4Q19A 3BB3A 2GF0A 3TSZA 2X1VA 5JWRA 3BFVA 3FFBA 3LDAA 3QKRA 1JXOA 2OM2A 3K70B 5CYOA 1NIPA 1P5ZB 3GEEA 4NH0A 1MRNA 1G6OA 421PA 1RZ3A 2CDNA 2OV2A 1OIVA 1EX6A 5TXGA 3LLMA 3IBGA 1EX7A 3NHAA 1RPZA 1VG8A 2AD5A 1YE8A 2ZS8A 1PUJA 4DHEA 1G5TA 2NTYC 2OSBA 1W47A 2DB3A 2BMJA 2JEOA 2WWIA 3K0FB 3VR1A 1KDPA 1OYYA 3SR0A 1W0KD 4BLSA 4V0OA 1YR6A 3LBNA 4US2R 4WW0A 1G3IA 1N5IA 4ZCMA 1VIYA 2WZQA 1P2UA 2FN4A 3P4XA 4GP7A 4TTQA 4A2PA 4V0KA 1E9CA 1JQJC 1E2PA 4DLRA 1U8YA 2QQ0A 4B3FX 2XSZD 1N0WA 4E09A 3ZDQA 1J7KA 3BIFA 1UADA 1EWQA 1R2QA 2ZRLA 1P3JA 2CE2X 4Q9JA 2J7PD 3OAAD 1KJYA 1XP8A 2LKDA 2RGCA 2ZRFA 3B9PA 3BXZA 4LYHA 5FTJA 4ASUD 5GVSA 2G9NA 5CITA 2QPTA 1QRAA 3A1UA 4LJ5A 3UXMA 2V7QA 4XVUA 1KNQA 4AYTA 3W5JA 4MRPA 4JVSB 2NMVA 4DLSA 1A7JA 1F60A 2YC4C 1Z3IX 4Q7MB 4UNQA 1ZC4A 2FFQA 4YDHB 4R71A 1GDDA 3QF7A 4IVQA 2R65A 3THOA 5CK5A 1TF5A 1RVDA 3EZ2A 3BB4A 4NDZA 4US0R 3TIFA 1GIAA 2D7CA 2OLKA 1KO7A 1W36D 1B0UA 5EZ6B 3NBFA 1HE1C 2CVFA 4EDHA 2ERXA 3RSOA 5LDDC 1DS6A 1EFHA 1FTNA 2DHRA 2GJSA 2E1RA 3W8RA 4A15A 1TEVA 1JEDA 1MO3A 3R7WB 4FWIB 2N42A 2WJIA 4B32A 1E9AA 4AI6A 1Z0KA 3B78A 1N6LA 4TMWA 5JJKA 5KDOA 5CLLA 1S1MA 2VPPA 3C5HA 2OCAA 1E1QA 1GOTA 2CBZA 2D2EA 1Q21A 3UMSA 1ZD1A 1L4YA 1A2KC 1FMLA 1LTQA 3FHCB 3FMPB 4NONA 1Z2CA 4QRHA 4FN5A 2NIPA 2BWJA 1R10A 5EP2A 2Q9CA 4TMKA 3T61A 3CR8A 3TNFA 1E2DA 2ECKA 4JLJA 1QVRA 1O87A 3TW8B 1SXJA 2NO7A 2NOAA 1US8B 3RRZA 2FJUA 4DT1B 1T9HA 1J8YF 3EZ9A 4W5WA 1ZC3A 2GKSA 1YR9A 1GNQA 5A4JA 3FDIA 4C7OA 3PENA 1M6NA 3L43A 3REFA 4GOJA 1E99A 4IRUB 3TMKA 3L2OB 2YWEA 2KJQA 2RGNA 4Q4JA 4BLQA 1KAOA 2Q0HA 3CBQA 3OEHA 3NC1C 2J3EA 1DTSA 1FMJA 1I2DA 2CVHA 2PCJA 2V7QD 1K5GA 4XTRA 2WMOB 3WNCA 1QHHA 5AJWA 3NTUA 2HV8A 3SQWA 1A4RA 1KSJA 2Z6VA 1YQTA 1W5SA 2ZRBA 4TQ9A 3RS2A 1XU4A 3GP8A 1VYTA 1DO0A 3BH0A 5B64A 1FNMA 1NY6A 5BWMA 4FI3C 4BWYA 1OB5A 3MUFA 3AUXA 3R9XA 3CW2A 4R98A 5L3RA 2REBA 3X1DA 1N2CE 2ATVA 1E98A 2C9OA 3THWB 2WKQA 5JMTA 1L7VC 4QBFA 1DVRA 3CUEF 1KO1A 4JYBA 2HEIA 3RSLA 3R20A 4LBWA 4LJYA 4HAVA 4C0QC 5FUVA 4NL4H 2ZVQX 1XPOA 2JLVA 2YOFA 3VKHA 3NEJA 1KDOA 2OUKA 1D9ZA 4L4UA 2IYYA 1XCPA 1NKSA 4ZV4A 1Z08A 1FQJA 4JLMA 2HUPA 4LUCA 4Q01A 3IO5A 2GJ9A 2FSIA 2OZEA 1M7BA 3AV0B 1E1QD 2XJ4A 5M04A 2DWQA 1G8PA 2Q3HA 3GJ0A 5HKKD 2AL7A 4Q1FA 1M34E 1VMAA 1Z6AA 4JL5A 3AM1A 3QF4A 1K5DA 1W36B 2DWOA 2GZAA 2CHVA 5KUTA 1R0ZA 1OW3B 4RFSB 1ZW6A 1QG2A 4Q7KA 1U98A 3HU2A 3FGNA 3KQLA 2MSCB 2V1XA 2G6BA 1VECA 2EFHB 1G7CA 3MG9A 4JT2A 4PAQA 3QKRB 4M1MA 4QJ4A 1U94A 2XEXA 2OAQ1 1NVXQ 1ZD8A 2FOLA 3TRFA 1M2OB 4DC9A 1IAQA 4EPXA 1JALA 2OBNA 3WY9A 1ZM3A 4PSAA 5JJIA 4OI4A 3TUZC 4FMCB 1NP6A 2P0EA 3RWOA 2CLDX 4D81A 3P4YA 3ECCA 4AKHA 2G1KA 4M1TA 4ESHA 2QUZA 4HAZA 3E70C 4KFUA 2FZLA 4HLCA 1UKEA 2Q21A 3BRWD 1SVLA 3Q8XB 2B8TA 1RRCA 1Q57A 4NYMQ 2IXFA 2XTNA 1OSNA 2Z43A 1T0HB 3T5DA 3HPRA 5L3VA 1GKUB 1ZNZA 1I2MA 3CWQA 5G41A 2OBLA 5DYIA 2Z4SA 4DKXA 4LRWA 2BKEA 3VHXA 4JS0A 5HE9A 4W9MC 2QENA 4PO1A 2UZIR 4ESVA 1XEWY 1Q3TA 4ACBA 3K9LA 2G77B 1E2FA 3MJHA 1S0UA 4LK2A 4FINA 4P32A 2GEVA 2R6AA 1TQ2A 2OFXA 2WKRA 5J47A 1ZIPA 2ZRDA 4YLGA 2EFCB 3I32A 2OCBA 3T15A 1WRBA 2PH1A 3A4NA 4II7A 1CJKC 1AGPA 4YMVA 3THYA 4NBSA 2IF2A 2GJKA 4HYYA 4NE2A 4US1R 1RC8A 2ZRGA 3BFKA 4DLYA 4I99A 2O0KA 3SI7A 4KSCA 2H18A 3IHLA 3L0IB 3ZZTA 2OCPA 4ABYA 4M9QA 4DDWA 1DELA 4IOKA 1G4UR 3B1VA 3GEIA 4CZ2A 1P7CA 3I1FA 4HI0E 4S35A 1XBTA 2BVNA 1BIFA 4UNSA 4RD4A 1DAEA 1QHGA 2EWVA 3B1ZA 4LHZA 3ZZ0A 1CIPA 2QA5A 5FBQB 3KJIA 1MH1A 4PPGA 2JCSA 5CDFA 4B6EA 1HV8A 1QVAA 5LBIA 4A9AA 1OH5A 1CEEA 3ND8A 4RZUA 1CLUA 4A6XA 2VIIA 5FUXA 2J59A 2ZJ8A 1OFTA 1KNXA 1Y3AA 4GDFA 2NGRA 1PVOA 3LXXA 4WBSA 4B3DA 1G3UA 2ZJYA 2V6JA 2PMKA 3TVTA 3NBYC 2AHOA 4GRAA 4I1UA 1MO4A 4LBYA 4MYTA 5FPKA 4XJXA 2QMOA 2X77A 1AS2A 1P2VA 3LX5A 4FMDF 5EZ5A 1II8A 4A92A 4WA7A 3QPVA 2JLZA 1KJZA 2WTUA 3IQXA 3RDPA 4DB2A 1SXJB 1ZJ6A 4XSHA 1ZCBA 1RRFA 1D5CA 2VSXA 3EWAA 4B6FA 1I4LD 1XZPA 2CXXA 5E7JA 4AG6A 3DDCA 2AD1A 1HYQA 4JLOA 1VKJA 4IDNA 2PEZA 5LB4A 4EIWA 5JWHA 3PUVA 1E2EA 1IN4A 4Q4JB 3NDPA 1G16A 3WYFA 4BLPA 4QM7A 4BPBA 2XOKA 4Q18A 5DI3A 1Y63A 2ZAMA 5E7MA 1NN1A 3PXGA 1LW7A 1BS1A 2LKCA 4LV6A 3KB1A 4DEYA 1DAMA 1E4YA 1P2TA 4F91B 1OE0A 4AURA 5HE8A 2ZS9A 1ZUIA 4HEJA 4ZDWA 3DHWC 5H70A 5DLQC 1IXRC 4KVAA 5AJXA 3LVRE 3PJRA 3IGFA 4NPHA 1E32A 5UKDA 4AK9A 3U44A 3B1YA 3CB4A 1E0KA 2D3WA 2BEKA 3RC3A 1KDRA 3UG7A 4HLUA 5IDVA 1OF1A 5KHOC 1XTKA 3K09C 4Y0AA 1P75A 2D2FA 4IFEA 4YC7A 4EPYA 1R4AA 4NZYA 3TR0A 1HH4A 2R6GA 1Z6TA 2FSHA 4WZAE 1Q1ZA 5KSOA 1XD2A 3QNUA 4FCWA 3A58B 3QOFA 4LC1A 1F2UA 4TN1A 1Z5ZA 3SU8A 3P1JA 3NC0C 4LGMA 4A8JB 3IQWA 1VCMA 2FPMA 4JSYA 2FEMA 4IKEA 5EXSA 3EAQA 3H86A 4F4JA 3GQBA 3SOPA 1E79A 1KSGA 4IVRA 3RYTC 4LJ7A 5FR2A 2NO6A 3Q72A 4XWKA 4KXFB 1N3BA 1GRQA 3QF4B 3FKQA 1HY3A 4XD7A 5FI0B 1ZM7A 4UNRA 4HB0A 2ZYTX 3AKYA 4GMXA 3X2SA 4GI7A 2IYXA 3GD7A 1RIFA 1FP6A 1W5TA 5CYPA 5KTYA 3CH4B 1XMSA 4Q9IA 3W6NA 1OH7A 2WJHA 3N5CA 1KAGA 4MITA 5FR1A 4JL8A 3WMGA 4D26A 1Z22A 5JRJA 3LBIA 4LSGA 5EQTA 1JAHA 2RGGA 2EFGA 2RGEA 2FPKA 2GXUA 4W5JA 1SVWA 1GZSA 2AKAB 1G9XA 2WWHA 4ZDJA 1R5BA 2YKGA 2ZUBA 4P4SB 2XOKD 4DSTA 3EXAA 3AVVA 1W49A 1F2TA 3E1SA 4HDCA 4CEHB 3LBHA 5KYKA 4ZDKA 1EFTA 1GUAA 1LVGA 1NBMA 2FH5B 1H8EA 4GMDA 4CEIA 3U2QA 1AZTA 2CL7X 2IWHA 1MKYA 3CF6R 1NVVQ 4BFTA 3X1XA 3PR1A 1Q20A 2KBFA 1JPNA 1T3LA 1WP9A 3V4RA 1X86B 2VP0A 4BFZA 3A4MA 3U3KA 3A1WA 2YV5A 2YOGA 3OIVA 4JVLA 1J70A 2C78A 1U8AA 2HCJB 3GJ6A 2BBSA 3KFVA 2YVUA 3A8TA 1E1RA 4CEJA 4G0NA 2C5LA 3V9PA 2Q9AA 3KKPA 3K9NA 1WBBA 3K0CC 1HEIA 2ZEJA 3T34A 3VFDA 3TJZA 3FWYA 2IHYA 4EPWA 3TUIC 1HQCA 1P62B 4RD6A 3W90A 1E0SA 1P4SA 2ZR7A 1D2NA 2YOHA 4XOIA 1XEWX 3ZVNA 3THYB 1E79D 2XJ9A 5K8LA 1E6CA 4AYWA 4PAMA 4DLVA 1QHSA 2QMHA 4QNMA 4MKFA 3SJBA 1ZUNB 2ZJZA 2V54A 3U3RA 3Q5EA 3ZZUA 2R62A 3AVOA 3LAWA 3CONA 1YU9A 2CE7A 2FMXA 1XPRA 5DYGA 1KI4A 3FKSA 3NWJA 3LFUA 2ZXUA 1GM5A 1E9RA 4AKEA 4POAA 4URYR 2IS6A 2A5GA 4XSGA 3K70D 1VCIA 4URUR 2ZUCA 4M9ZA 3LV8A 4UKDA 4Q21A 3M1IA 4G5QA 2AWOA 2RB4A 4M53A 2Q3FA 3NKVA 3M6AA 4NCHA 1IN7A 3RRNA 2RKOA 4G01B 3DKVA 3SQXA 4L9WA 4TYPA 2H7VA 2DBYA 4IEIA 2GCPA 4A2QA 1G4AE 2EYQA 3RS5A 3TW4A 1U99A 4QOSA 4OJKA 3WYAA 1RJ9A 3NH9A 3IPXA 4X8LA 5GJWC 3TLXA 5FBWB 4URVR 1G3RA 5B57C 1ZM9A 3HR8A 4A0GA 3C4JA 2ZRHA 1NBMD 3AVQA 1H8ED 1II8B 1UKZA 2IUSA 2OXRA 2VTKA 2BHRA 4Q9HA 3ZQJA 4OQFA 5J4VA 2QT0A 3Q3JB 4KBGA 3ZGXA 4EKDA 4HAYA 2QT1A 1OXSC 4L16A 5BQ5A 1UJ2A 3ZD6A 1AKYA 2VA8A 3VR3A 3JVVA 1D2MA 1T4GA 3G5UA 1TQDA 1SVOA 2FEOA 3LX8A 2W6IA 4GNKA 4C0HA 3FMIA 4LJ4A 3CNLA 1KI2A 2A78A 3RABA 1G8YA 4HAUA 3TH5A 2KB0A 4TL6A 2C8VA 3PUYA 1E1RD 1EG7A 1OT3A 5DI3B 2A7QA 3NBZC 3ZVRA 3I61A 2MSDB 4LHVA 1TQ4A 3GLHA 2WSSA 3KJEA 4OQXA 2Q6TA 5JWOA 4JVMA 4URWR 4DLTA 1E96A 2BMDA 5GJVC 2FDCA 4Q1DA 4Y0VA 1XD9A 4G1UC 3QBVA 2IL1A 3U44B 3GFOA 2GAOA 3OF5A 1HT1E 4NCJA 2WIAA 4K46A 2IC5A 3EIHA 1N6KA 4LYAA 3ND9A 3VX3A 2H92A 3VX4A 4D6PA 4EAQA 2GXQA 3C5CA 4MGKR 2BDTA 5EP3A 2XTMA 4WIAA 1Z06A 1T91A 3W8NA 4B76A 2ODNA 5FPSA 4NYJR 2QTHA 4NCKA 2WKPA 3GMTA 3I5YA 1FZQA 3FKSD 1Z0FA 1G5RA 1K6MA 1XD2B 4TYWA 3B2EA 1ANKA 1F2UB 4IOMA 1MOZA 3OFNA 4KVGA 3A36A 2EW1A 1P9RA 4FMDB 3OZXA 4NCIA 2AK3A 2PZFA 2AR7A 5CJPA 4BE7B 5IF9A 1NIJA 3A1SA 5HPYB 1LS1A 4IOLA 4TQUS 4YMUA 2BBOA 4R9UC 3K53A 1NMXA 4D4LA 4DDVA 1W4CA 3W6OA 2AXNA 5KOYA 1YJ5A 2GBLA 3VKWA 1J90A 4L5BA 3NXSA 4RD0A 2WWGA 5CM8B 3ZH9B 1W4AA 2V55B 3U4QA 2YZ2A 1II0A 4JBYA 4I1VA 4LV5B 2FF7A 3SJCA 821PA 1DBSA 1E2JA 3T1QA 1EFUA 3QXSA 4MGZR 4PZLA 3RS0A 1P60A 3HP1A 2V6IA 4XIGS 2D06A 4E22A 4V0MA 3B60A 1GG2A 2K5UA 4U7DA 4GL2A 2ONJA 4KFSA 2ORIA 3P20A 2W6ID 1UEJA 4B2LA 4DB4A 1M74A 5EJEA 4TYQA 1W36C 4XH9B 4FIDA 3JZAA 4R2IA 2WHXA 3C16C 3Q5DA 4QGFA 1S96A 2BC9A 2Q3MA 3T1OA 2VHTA 4FCVA 1F2TB 3KQKA 2YYZA 1NLZA 2WSSD 3O8DA 3GJ7A 3IO3A 1JNYA 3QVVA 4A82A 4CEIB 3GLIA 3VU9A 2ZQ5A 4HSEA 2FFHA 4D4MA 1VG9B 4OI1A 3C7KA 3Q7QA 2NQ2C 4OHZA 5TB5A 5E4FA 3D31A 3CLVA 1W2HA 1G17A 2HLDA 2QRNA 2WAYA 3MFYA 3X1WA 2VHCA 3CNNA 1CXZA 1N5LA 1BKDR 1U8ZA 1KO5A 4MKHA 3P27A 1JQLB 1MT0A 1HURA 4J0QA 221PA 3F0TA 4EPTA 2XZOA 4URZR 2AKYA 4G5SA 4Q1BA 3ZD7A 3KUCA 1OJLA 1DARA 4FD2A 4BLTA 1RFLA 1W0JA 4L15A 4CEJB 4TLBA 2JLUA 1H8HA 1F3OA 5DO9A 3OFND 4PXAA 1FL9A 1XPUA 1TF2A 5H1YA 3QEJA 3AGQA 1GILA 2QU8A 3TAHA 3NIBA 1JECA 1Z0IA 3QPUA 3ADKA 121PA 4LJ9A 3U5ZB 1AQYA 1ZBDA 2NPIA 1Z0AA 1KI7A 5JBQA 1SVSA 1UF9A 2GCNA 3FPAA 4KAXA 4MUAA 1DG3A 3QXJA 1N5KA 4MRSA 4NKRA 5CIWA 3ADDA 3I8SA 1SHZA 2O8DA 3GLGE 2EFEB 5DNYB 2PT7A 5FL7A 5FH9A 4B34A 1Q1QA 2J45A 3ASYA 2ZJOA 1A1VA 5JCPA 3GPLA 4F92B 1E9EA 2WJVA 4PFSA 3UKDA 2G0NA 1VG0B 2V9PA 4UXJA 3KQHA 4XVQA 3WBJA 2HJGA 2GCOA 1Z0DA 4MYHA 4Q47A 3H84A 3T1TA 4PANA 1GKYA 3AVXA 2F1IA 5FI1B 2BJWA 1UKVY 3SNHA 3LO5A 2JJ2A 1ZNXA 1QBKC 1NI3A 2B6HA 3ASZA 4KI0A 1OH6A 5D3MA 2ZJ2A 1XTSA 2QP3A 3OE7A 1NMYA 1RJ9B 3L8ZA 3MWLA 4QHTA 4TTPA 1SULA 3UK6A 4AKGA 4LYFA 4HLQB 3THXB 3NHBA 1T6NA 4WZ6A 1XXHE 1GWNA 1KI3A 1G5PA 2FA9A 2IBMA 4A0HA 5BN5A 4V03A 3WXMA 1FW6A 1CJUC 5KDLA 4URXR 1SKYE 5EE3A 3U7EB 3MAAC 4JLPA 2HLDD 1TU4A 3EARA 4QJ5A 3IIJA 1XJ0A 4OL0A 3CIOA 4M22A 1CJVC 4U00A 2YWFA 3AGPA 3SDZA 4QNRA 1SVMA 2IS1A 3L82B 2OCYC 3AF0A 3CRRA 3SYLA 2F6RA 2IYRA 4CIDA 1WCV1 1E2MA 4IEEA 3LNCA 5JLJA 2A9KA 3RRMA 3HR7A 2XAUA 1G8HA 1W0JD 1Z63A 4M9XA 3NBXX 1H8HD 4O2LA 3HYRA 3GLHB 4O0MA 4WXRA 2E9SA 4DRZA 4FXPA 1KK0A 3PEYA 1W44A 3PG5A 1L8QA 1Z29A 3B5JA 2VEDA 4BFWA 3IBYA 4IXNA 2RGNC 1PUIA 2Z5FA 2RGXA 5EXXA 3JVUA 3MWKA 4ILEA 2OT3B 5G53C 5GVRA 3V00A 1FX0A 2JJ1A 3E5HA 1TQ6A 1AIPA 1DPFA 5FL7D 4ZCIA 3R9IA 2H1LA 2ONKA 3M4YA 5F9HA 1OFHA 2GRJA 2YJTD 4O3MA 1E2QA 1E9FA 2RAPA 2ANCA 2C96A 4DVGA 5DH9A 3NEYA 4PC3A 1E2KA 1DAHA 1XF9A 1KK3A 2VF7A 1CRPA 4AKIA 4A8JA 2O0JA 1E2HA 5EE1A 4AD8A 2WOJA 4M1YA 2GTPA 4HZIA 2KWIA 2QQEA 4Q1AA 1YRAA 5AUOB 2JJ2D 3WYGA 4IJMA 2JLXA 3D6TB 2VL7A 2OHFA 2E87A 4TLCA 5H68A 4MQBA 3H1TA 3OE7D 3L0OA 3EIQA 3DM5A 2QAJA 2QAGC 2ZRAA 4IDOA 1YZKA 3DVLA 4HDOB 2QPOA 1F5NA 5CM9C 3UG6A 3U4QB 3ZVLA 1SXJD 4C3ZA 1R5NA 2GDJA 1JR3E 521PA 2G83A 2W00A 4DIEA 2EYUA 4CW7A 4TYNA 4B35A 2BKUA 2C95A 1Z28A 3QBTA 5AR1A 4RKFA 1G7RA 1ZD9A 5FUWA 2RHDA 4DJTA 1EFCA 4PSVA 1YZTA 4IDPA 2VYFA 3KKOA 1XWIA 3OEHD 5FOXA 4P4SA 3QVUA 2CJWA 1NG9A 1TL7C 2P5SA 4QJ3A 1EXMA 3GLFE 4CEHA 1X6VA 5FOWA 2BMEA 2MMGA 4D4JA 3EZ7A 1WB9A 3GLIB 3VU9B 3K8YA 3QUSA 4KLZA 5L3QA 4Q4LA 3UMRA 1SVKA 2A5YB 4Q4AA 4Q1CA 3O8RA 2JLWA 4Q9LA 5F9FA 5JJLA 3AF1A 5K8IA 1OV4A 2XZLA 2BCGY 1DG1G 2JJ1D 4WOPA 1PJRA 1N6RA 1UKYA 4DSUA 2P6RA 4C30A 4HLDA 5E7IA 3AVWA 4F93B 1M1YE 3V4FA 4MGIR 3ZS9A 1AJEA 4M0LA 4P4TA 3DO6A 4QBGB 3LY5A 2FSGA 2XITA 4KYIB 3JZMA 3UMFA 1U0JA 4NTZA 4RVCA 4PX9A 3ICEA 3FMOB 2QSZA 2ZI5A 1N6NA 4F38A 1D9XA 3MMPA 4EFLA 2FGKA 1KYIA 2A2ZA 4Q7LA 1E3MA 5KSZA 1VTKA 4OHWA 3ZJYA 3FE2A 2ZI9A 1VHTA 3AH8A 3KKNA 4Z51A 3HWSA 4E03A 2OAP1 1P72A 4G5RA 1KO4A 3A1VA 4OJQA 1JI0A 1C9KA 2R6FA 4V0NA 5A5GA 3AP1A 2B92A 1IHUA 5KPJA 1IXZA 3W34A 4B3XA 2O8DB 4PC2A 4OI2A 2JLYA 2GXAA 1S1CA 4TLEA 2F7SA 4BFXA 4U5XA 4CDGA 4P4UA 1OB2A 3VNVA 2IYQA 4PPNA 2W6JA 3KXKA 1Q1BA 4AIIA 1KKLA 5E95A 2BEJA 5F2EA 2QL6A 4Q4HB 8OHMA 1CF4A 5D3QA 1G64A 2GCOB 1NMZA 4LJAA 4QGGA 3QSYA 3CPEA 2NO0A 3B9QA 2X2FA 2SHKA 4FCTA 4BZXA 3AVUA 4TMTA 1LY1A 4PR0A 5CLQA 2Z0MA 3TK1A 3RC8A 1LNZA 1TUEA 2ZSEA 2IA5A 5D3MB 5BN4A 5EE5B 2CNWA 3KQNA 4UQOA 5AJYA 1WMSA 4IXMA 3SYKA 2ZJ5A 2CK3A 2WIBA 4JMPA 1UBGA 4Q66C 5KNDA 3FHOA 1SGWA 2D7DA 1G291 2QTFA 2FV8A 1GSIA 2JLSA 3IPYA 1WF3A 2H8KA 3WNDA 2GILA 1TTTA 2PCLA 2ZSFA 2XTZA 2AFIE 3DMDA 1XMJA 4A0RA 3QJYA 4MH0R 1XCGB 5J40A 3U6KA 5LD2B 5FTNA 4PZYA 5TDHA 1ZUHA 3EWSA 3SBEA 2QSYA 4KU4A 1FUKA 4UNNA 1OXTA 2ZRNA 2VP2A 2B7CA 2IK8A 2GJ8A 2WOOA 4KCGA 1OIWA 4KHZA 1MRSA 2ZU6A 2QORA 2IXEA 3QE0A 1P9WA 4ZI3A 1PV4A 1T3SA 4PZZA 2IHBA 2RGBA 4ITRC 3A6PC 3ADCA 5L8VA 3LWNA 4MKGA 1RE0A 2IYWA 5FL3A 5KPDA 3TE6A 4PC1A 4C0LA 4G3XA 5EXPA 1Z8FA 3BERA 2AXPA 1FX0B 4ZO4A 4IDHA 2VQSA 2GF9A 2IW3A 2GK6A 3K09A 2J46A 2R6DA 5GADl 3L0SA 1CR0A 3I5XA 2P2LA 5JSZA 2PJZA 3WBKA 2MMCA 2O52A 4GSYA 4B43A 1U90A 1NL3A 1FQKA 4BLRA 3BOSA 3R8FA 3UPUA 1XMIA 4Z54A 1J2JA 2KBEA 1QDEA 1H65A 2G3YA 2QY9A 4QBIA 1Q44A 1S3GA 1X1RA 1GAJA 2FNAA 2CNWD 3SYNA 3DZ8A 1Z2AA 1KY3A 4O2RA 3IILA 2CK3D 3QEOA 2BJVA 1MV5A 3IIKA 1XMVA 5ANRB 4PQRA 5KNBA 2UZ3A 2RH5A 3AF4A 4QC2A 3CM0A 4ARZA 2ZYVX 5IT5A 3B7GA 2FG5A 1BH2A 4AYXA 5EP4A 1UBCA 4QXAA 3CRMA 4QKQA 1RRGA 3TR5A 2HF9A 5EE9A 1XTIA 4LDJA 1C4OA 4R7ZA 1VDZA 4Q1EA 1N6OA 2VSOA 3HU1A 1YZQA 1NJFA 3Q7PA 3KUDA 3Q85A 4D2IA 1DO2A 3DKPA 4KYUA 3UATA 2IT1A 2GXSA 5AUNB 1JJ7A 2CJWB 4B75A 3LH5A 4JZKA 2FE4A 1N0VC 4EPRA 4XWOA 2X19A 3BAFA 1ZU4A 5EUMA 3ZS8A 4A0FA 3KZ1E 4F4IA 3OIYA 1JEEA 4C0BA 3AB3A 3K70C 2LWIA 1HT2E 4M1SA 4JLAA 3MD0A 1JJVA 4NU0A 5L3QB 4X8MA 1YVDA 4H9GA 1N6IA 1Q12A 4ZI2A 2DFTA 3KB2A 3NG1A 4Q4AB 4KFRA 3O8BA 2RHMA 5CJ2A 1N6PA 3P32A 3CRW1 3IKJA 4HZUA 3GJ5A 2XGJA 3AQ4A 2B7BA 1KI9A 5C1BA 1U0LA 1A5TA 2IYSA 2XB2A 5TVKA 3O8CA 1AN0A 1IN8A 1DADA 1NN5A 2D4HA 4M1OA 3VR5A 1DAIA 3OHMA 5FPHA 1W46A 3BWDD 5HCNA 621PA 1DE0A 4L9SA 3GJXC 2HDNB 1U9IC 4QM6A 3LD9A 3L8YA 4M21A 1YHNA 3SFVA 1JPJA 2BCJQ 3TKLA 3UANA 4JKIA 2A5DA 3MGCA 3QQ5A 4PO9A 4EJSA 4NHOA 2GAAA 2B8WA 1XEXB 1T0JB 4KLNA 4FW9A 4EQ6B 1XRJA 2DFKB 2VO1A 2C04A 4QBHA 3EASA 3RANA 4NMMA 4XD7D 2ZETA 1QHNA 4UXHA 1E2IA 2REXB 4JLKA 2BV3A 5J5CA 5FOVA 1COWA 2F43A 3PEWA 2ZVPX 2FWRA 4QL3A 2UVQA 1ZVQA 2BM0A 1FNNA 1R0WA 1MABA 3BBPA 1ZM4A 5TV2A 2NG1A 4RFVA 2XX3A 1XTJA 3VNUA 4D0GA 1E94E 1J99A 4TT3A 3ICQB 4YQFA 2WWYA 1E9SA 3MWJA 2EQBA 5GJBA 1IBRA 3O47A 3KXLA 2OESA 1TADA 1E4VA 5CB8A 1WE2A 3D3QA 1G1MA 2GNOA 3I4LA 1XFAA 2ZUDA 2WM9B 4JBWA 2FPLA 1AKEA 5HZHA 2HCBA 2IYLD 1D8TA 1S2MA 3KJGA 1P2SA 4TMZA 5JS7A 5F3WB 3KDSE 3QXXA 3THXA 2GHIA 4IW3B 3LQRA 3SJZA 4OK3A 4GZMA 2V8OA 3R9WA 3F8TA 3MRSA 3EC1A 2ORVA 3KL4A 5TARA 3ZLJA 4E07A 3FVQA 1I4DD 3CWZA 5C2JB 2J5XA 1O3YA 3QG1A 3QY0A 4JIMA 5FFMA 1HTWA 1BMFA 4C9BA 3KXIA 5IHPA 2CHQA 4KBFA 4QHSA 2ZM5A 3B85A 4LPKA 5AWFC 4GOKA 2P67A 2ZS7A 4DIDA 5BYKA 1N0UA 2OFWA 1Q1EA 4DLZA 3D7MA 2F1RA 3QKSB 3VQTA 3PEVA 2Z4RA 4LJ8A 1KTVA 1U81A 1LF5A 2IF0A 4IHQA 2QGZA 3B82A 2CCKA 3CO5A 1KOFA 5IK2A 2O5VA 1Z47A 4LYJA 1NVUQ 1Z6XA 2P3SA 2O8BA 1XTRA 2ZTSA 3BS4A 5JFGA 4BFUA 1MR3F 2C2HA 2ZPTX 1KSHA 2W0SA 3GFTA 4EUNA 1FP7A 2P5TB 3FYHA 3E2IA 4TL8A 1COWD 4MYUA 2QG6A 2C9CA 4RZ3A 1ODFA 1OXVA 1T8UA 2XB4A 4K8OA 4B2PA 4MKIA 5JSZB 1AK2A 2GZDA 4TMVA 2W0MA 2QZ4A 2HXYA 4TT3D 1YZLA 1KZGB 4LPSA 2JLRA 3BJIC 1SKQA 2N46A 4Q48A 3SC3A 3BC1A 3UWOA 2WSMA 1GL9B 1ONBA 2H16A 1C1YA 1AA9A 3EZFA 3AVYA 3KTAA 1XX6A 2ZROA 3FMFA 1ZAKA 4M1KA 3EPJA 1VPLA 4KFTA 1TF7A 4D80A 2JDIA 4YMTA 3QKTA 4PHHA 4PQYA 1YZGA 3MSXA 2CEAA 1RRPA 3BD9A 4GBMA 4DUGA 2F55A 5TMPA 5FTMA 4ARZB 2XZPA 4BUJA 3IDQA 2NPFA 1GRNA 3VR6A 4B71A 1TU3A 5FBRB 3K9GA 3ZYCA 2PL3A 2QPAA 3OEEA 2FSFA 3TQFA 1BMFD 5J4LA 4HATA 1NNEA 4NCNA 1G21E 1SZPA 4E5UA 3RS4A 2VHUA 3CRQA 2ASEA 4PHTA 3PCRB 3S1AA 1ZNYA 5LB2A 1WA5A 1PLKA 3X1ZA 4OI0A 1J8MF 4ZIRB 1E9BA 3GLFB 2CCGA 5K8TA 1CR2A 2ZE6A 5G3YA 1EGAA 2H57A 2W83A 2W2TA 3J81k 1GVNB 1KI8A 4DLUA 2WJYA 5IK2D 2IUUA 4KSBA 3A1TA 3PV0A 1UAAA 4OHXA 3CF2A 5DHFA 2VH5R 4TLDA 4B74A 5DSZA 3ZVMA 2J0VA 2LCFA 1E2NA 2F1HA 1R6BX 1E2LA 1QHIA 2CMKA 2P65A 3U3OA 3I8XA 4B3GA 1CRQA 5JHHB 4HZUB 4RJLA 2EU8A 4PSKA 5ELXA 1D6JA 1EESA 2GEUA 3WMFA 3EA0A 1FPMA 3H4MA 1GRRA 5TY0A 4DXAA 1ZP6A 4Q9KA 3F3YA 4XVRA 4Z1MA 2QNRA 4B3BA 4LZZA 1KO8A 1K8RA 4BEJA 3U7GA 2ZE8A 2JJ8A 1LS6A 4TZ0A 1E9DA 1W2GA 3VR4A 4D0NA 4DBLC 4JLBA 4D0LB 3AF3A 2PBRA 1P73A 4YMWA 5EE0A 5SZJA 4ZDIA 3ZIAA 1R7RA 1X8KA 2WV9A 3KKMA 2OXCA 4QG7A 3TSOA 2J0UA 2MSEB 4RCYA 2PT5A 4EJSB 2I3BA 3WHLA 2HYDA 3ZQ6A 3C14C 4AC9A 4MDFA 3FTQA 3TGPA 3DPUA 3PUWA 2O8FA 4M1WA 4M9SA 5A0FA 2OE2A 3BH6A 4DCUA 3DL0A 4S2EA 2JDID 3I62A 1CR1A 1E0AA 2F43B 3SBDA 4DUGD 2ZRMA 4LI0A 4P3YA 4PO8A 3SN6A 2QBYA 2BBTA 5CB6A 2G88A 2IEYA 2C99A 1MABB 2KSQA 1QF9A 1WQ1R 2GA8A 4GFDA 4Q4HA 2ZITA 3OEED 3AVTA 1IY0A 3KKQA 2DFNA 1IXSB 1BYUA 1YR8A 2QM8A 3CR7A 3GEHA 1UDWA 3BGWA 1MO6A 1FTSA 2IXGA 4NYMR 2AWNA 5KDDA 1DAKA 1FUUA 2PLRA 2WMNB 2YWHA 4NYIQ 1NSFA 4F4CA 3FOZA 2PMDA 3H0KA 4DCSA 5HCIA 2IS2A 2ZANA 2XNSA 1R8QA 1ZRHA 1W7AA 1AS3A 4ZKDA 1PLLA 1T3HA 2QM7A 3AUYA 4JSTA 3DM9B 1F48A 1S3SA 2NZJA 1EFRA 5BN3A 3IEVA 1G18A 1IN6A 5FPTA 4I4LA 4UJ5A 2PX0A 5CDFE 5JHGB 2F3TA 1S8FA 1RYHA 2ZIAA 4LY6A 3TSWA 4NYJQ 5HKKA 1G19A 5B2ZA 3CPHA 2VHJA 1VIAA 1OHHA 1YR7A 3U3MA 1RYFA 1L2TA 1VCOA 2ZJAA 1DEKA 3PEUA 4OKSA 4Z1MD 2X2EA 4K81B 5L3SA 3K0SA 2XXAA 1SXJC 1VCNA 3B8HA 2DPXA 1P9NA 4BQSA 3LLUA 4OQLA 5HZKA 2BM1A 3ZIAD 3RS3A 2EFDB 2OFOA 2V3CC 3VAAA 4B33A 1OXXK 1UDXA 4TSFA 5AJZA 1JR6A 5LD2C 3AP2A 4MA4A 1N25A 1KMHA 3U3JA 2WPDA 1Z83A 2O8BB 3DOEA 4RD3A 4BZPA 3WNBA 3HJNA 1JBKA 5BXQC 1AM4D 4YONB 2D74A 5DI9A 4YXWA 3FHTA 1G7TA 2A30A 2ZREA 5JI2E 4P31A 3TBKA 1CJTC 2WJJA 2WJGA 5DISB 1XEFA 1KK2A 2ERYA 1HE8B 2C77A 4KO8A 4TYYA 5F98A 2B21A 4G5OA 5KNCA 2OILA 4QFMA 3C15C 1UM8A 2WVJA 1Z6GA 1KI6B 2HYIC 1CTQA 4P33A 2GEDA 1ZINA 3GJ8A 3DEFA 1WDTA 1ZNWA 4BFVA 1OKKA 1TAGA 4RD1A 1DAGA 2ZRJA 4MYCA 1N6HA 4IVPA 3QG5A 2FX3A 2P6NA 4PAOA 3BK7A 4DEXA 2CL0X 2L0XA 4YMSA 4BRWA 3KTAB 3AKDA 5B58C 4C0AC 3OIUA 4C2TA 3X1YA 1MO5A 1D2EA 1G3MA 1P6XA 1UFQA 2Z83A 1VHLA 2HJVA 2I1VB 2J7KA 2QAGA 5AUPB 1KJWA 3WP1B 5AUQA 4BGDA 1IY1A 3QENA 4LC0A 2DYKA 3HYTA 4CRWB 2X8AA 4A8JC 4PTLA 1FOEB 3QXCA 1EFRD 3WHKA 3BH7A 3IHWA 1F6BA 4C2UA 4MRRA 4V0LA 1Z07A 4AY2A 5C46F 5C18A 1XDBA 3KFXA 4PHGA 3EG5A 1R0YA 3EPHA 4A2WA 1OHHD 3CH5A 5DGXA 5EP1A 3S1AB 1KKMA 3I3SR 5C4MA 4BLOA 4DLXA 2NZ8A 1Q22A 1NLYA 4FWTA 3PQCA 2QGNA 4MRVA 4B3CA 2GK7A 1X3SA 4RKEA 2R9VA 1HA3A 1NSTA 1EK0A 3W6PA 2ZYUX 4LWZA 4TMXA 1DAFA 1LB1B 4GPTA 4BFSA 4Q5IA 3PVSA 4CYMA 4TSFD 5K8UA 3G0HA 2YNMA 3BFXA 1XD8A 1M7HA 1QHYA 3KX2A 1FFHA 2WPDD 1LFDB 2JATA 4OQNA 3I73A 4OYHA 1UBEA 3W9YA 1VYVA 2AFHE 2CHGA 3G82C 3C8UA 5IRCD 4YXWD 5DIFA 4WAUA 1R8SA 4PPFA 3T1VA 3W3ZB 5FUYA 2J1LA 1XCMA 2WAXA 1SHKA 2GJAA 4CT5A 5SZIA 2XNDA 3EA5A 1E2GA 2PLFA 2QROA 1CBUA 1Z0JA 1XNJA 1VYUA 1ZU5A 4OK6A 5KU1A 1NBME 4JLNA 3MJRA 2NO9A 4Q7JB 2PZEA 3CZQA 1L4UA 3F5FA 2R2AA 3WRYC 5C4GB 5JEDA 2J0UB 2A5FA 2DWPA 3EPLA 1ZCAA 1OKKD 2VLIA 1XEXA 2AK2A 4EQ6A 3LA6A 3WMEA 3DMNA 4MRNA 2ZI3A 2O8FB 5JECA 2JASA 3GLGA 3MLEA 2O8CA 2OLJA 3LW8A 3OESA 2A5JA 1ELOA 5FPYA 2ZRIA 2REOA 3RNLA 4KODA 4LBVA 3LXRA 3PIRA 3RHFA 3W5IA 1E69A 2QBYB 2J0QA 1KMQA 2DFLA 2FU5C 2AX4A 2YHSA 3EZ6A 4N3NA 2HT1A 3SE0A 1G20E 1OYWA 2F9LA 3TVDA 3U61B 3QKUA 4MGYR 1W4BA 4TTRA 3RS7A 1JB1A 4D4KA 1NVVR 1NRJB 3CNOA 4TQAA 3B13B 3UIEA 2ODEA 1XTQA 2ZAOA 4LBZA 1BYIA 4BECA 3GFPA 1GNPA 2IX3A 4N0DA 4AWXA 1XXHA 1OFIA 2ZU0C 4WVFA 5KSPA 4A1FA 4GZLA 3N70A 2I1QA 4C4PA 5CIQA 4ZKEA 1A82A 1QG4A 1TX4B 4NP6A 4ON9A 4AG5A 1II9A 3QIAA 2ZR0A 4KV9A 2RMKA 2ZSDA 3GCGA 2R44A 3CPJB 1R0XA 2CCJA 3SHFA 1SVIA 4DZZA 4PC7A 4TZ6A 2WWWA 1VG1A 3AVPA 1W48A 2IYZA 1Q0UA 4DCTA 3H2YA 4IDQA 3QKSA 2YINC 2ZRPA 5L3SB 5DHAA 2ZI4A 4ZPXA 2XNDD 5H8WA 1CJMA 2XXAB 4GOXA 1S4QA 3ONWA 3TUJC 2FZ4A 1BO6A 5FOTA 4DDTA 1KI1A 4G5GA 4LCBA 1IJFA 4M4SA 3AF2A 2P6UA 1KSFX 2ZRKA 4DLWA 4C7OB 4R2HA 1B23P 4H1VA 1YKSA 1KMHB 4OK5A 1YRBA 2GVZC 1HQYE 2OEPA 2BOVA 1X1SA 2ATXA 1GITA 1OXUA 1RW4A 4YDSA 1GFIA 3W3AA 3T06B 2R6CA 5JCZA 1DOAA 5SZKB 3RRYA 2BIFA 3HU3A 4D25A 1M7GA 2D62A 3REGA 3VMFA 1SQ5A 2UKDA 2DCUA 4RD2A 5JEEA 1QHHB 4W5HA 5AK0A 3T35A 2VP9A 5BW8A 1GNRA 3NH6A 2W6JD 2O8EA 2ODBA 4OHVA 4PPQA 2R8RA 3GLHE 1P61B 4LHYA 4XTCS 2V1UA 4OHYA 2IEZA 2J0SA 4QGHA 2HXSA 4DDUA 1KHTA 2FFBA 1Q3HA 3KJHA 3CF0A 2C9YA 4HUQA 1TEXA 4N0EA 3LQQA 1AGRA 4TL7A 5CK4A 4HLUC 5BYJA 4M8NE 6Q21A 2AN9A 4EPVA 4RY2A 3HDTA 1GTVA 2GETA 3IUYA 3K0AA 4PHFA 1NVWQ 1GP2A 4HUTA 5FBLB 1G41A 1S9HA 4PQFA 2VF8A 3OIWA 4HB3A 5FBVB 2WICA 2JGNA 2QAGB 3LVQE 1JR3A 4B2IA 3CX7A 3PUXA 2VHQA 1U2RA 2G1JA 2WWFA 2ZSBA 1X8JA 1NKTA 4C0SA 1S9DA 1U0HC 4Z8YA 2VP4A 1OFUX 2F3RA 1AZSC 2QTVB 1NG1A 1PZNA 4P0TA 4UJ3A 5HR5A 5SZHB
chains in the Genus database with same CATH superfamily
1NNI1 1QCZA 4J2OA 4BGUA 1IEQA 2I7TA 4OBEA 3JALA 2GOYA 3EC7A 1LF0A 1WXQA 3VAYA 3TG8A 5JU6A 4TKUA 4BCDA 2O7VA 5KHOC 5KCMA 5B30A 2VP6A 1NF3A 2D0DA 3MWEB 1O95C 3T3EA 1WB6A 1Z3CA 2HH9A 4JJKA 4IAOA 1BE1A 4OQMA 1RBZA 3REOA 1GZUA 4FB4A 4F6CA 2V8BA 2DECA 2VBCA 4PYLA 3K16A 3TJRA 4HAXA 2OO7A 2VPIA 3HP4A 4LJ6A 2ZT5A 2Q41A 1E5XA 4QFBA 4HRVA 4MDEA 4BRUA 2X14A 3W3AD 1H2XA 1ZIOA 2Q99A 4RZXA 5CTAA 4UNPA 2QIPA 3K15A 1AKUA 3EPPA 1KIMA 3L7YA 4BHTA 3K0FA 1PZGA 1CQZA 3LCMA 4M88A 4N1AA 1JWBB 9ABPA 5LVAA 3JD2A 4HAOA 3P7MA 1ETUA 2G5GX 8AT1A 4B84A 5IUKC 4I81A 3LL7A 4OX9B 1OVMA 3TKYA 4FDUA 1EMDA 1E7QA 1AS0A 1JXMA 1KY2A 1R4NA 1Z5WA 2I65A 2KM1A 3I2HA 2XT0A 4M2LA 5T3UA 1FFEA 3WL5A 4ENPA 4ZICA 2FUCA 1AQUA 3DOJA 3KEMA 2CHEA 1RWOA 3EIEA 1HKHA 1RHKA 2R7KA 2WTBA 2XWJI 3DZIA 1NW7A 1M1ZA 4IIYA 5D1HA 4XDYA 4DMCA 1VL1A 4CMCA 5I5EA 1QB8A 3AKCA 1KZYC 1V4BA 4J0DA 2Q28A 4WEQA 3U3DA 2QUKA 2XEDA 3DEKA 3GLGB 3E53A 4FMBB 4R1MA 5G4KB 2O8CB 4H1UA 3U26A 1DHTA 1HLFA 1PTJA 4U02A 1I9GA 4POOA 1XJCA 3HBFA 4O8ZA 2PM8A 5KNCH 4RX1A 5GJCA 1H1DA 2Q9UA 4RZ2A 3RIYA 1JR3D 4C0JA 1U2GA 1CKEA 2CLSA 3GOQA 3KLPX 4KE8A 2RHCA 2VUIB 1VLQA 2YY6A 3FWZA 4KJZA 1SOWA 1L5MA 1Z13A 4PZ9A 3FDFA 1O54A 2RCNA 3JU3A 2NZYA 4JBXA 3A37A 3RV3A 3MC1A 1Q0TA 3ND5A 3QXHA 4YJGB 4RACA 1K9SA 2H5EA 2BF7A 4Y2XA 4GM4A 3FB4A 3R6LA 2WIKA 4B48A 2PX3A 4WXYB 2G9RA 4WJKB 3AOEC 3O3NB 4DA9A 2IYTA 2WINI 5T4EA 3LRPA 1XC7A 1G8FA 4HQNA 3RRJA 3UHPA 1IJEA 1PLJA 2H00A 4UM8B 3R23A 3DZJA 3AM3A 3SJAA 5B37A 3F74A 3WLQA 2JIZA 3NRBA 2OXTA 3IP8A 1NX9A 1F7VA 4PYRA 4AY4A 4DSZA 3QTLA 4R1OA 4H18A 1SD2A 3RUHA 2O1WA 2ZE5A 4G0OA 1G63A 3WYNA 3IUNA 1NGSA 3P0IA 4LDNA 2NXNA 3TQCA 1NJ2A 2AFIA 2PAFA 3ST7A 4CFYA 1XE3A 4F7WA 4J0GA 4BB9A 2Y3IA 2P91A 1IN5A 1NLFA 4QDUA 3SS8A 3S1SA 2WWXA 1T9CA 2FLKA 3QFRA 2O05A 2OTCA 3B1XA 4OF4A 1YZNA 4F5ZA 4BKOA 5J4KA 3HCPA 2AQHA 2EKBA 1NJ1A 1CULC 4JT4A 1HWYA 4YNBA 3KL2A 2F67A 3WLRA 4ZN6A 1U1IA 2ZZMA 4YXFA 1HXHA 1EWRA 2CL6X 2QP4A 4CT4B 4EUSA 2L18A 3FNBA 4L3WA 3UNXA 1F51E 4YV7A 4MWCA 2G4LA 3GRRA 1PZMA 2PZGA 2J9ZB 4PG4A 3MWYW 3SFZA 3T7EA 3VM6A 4Z8XA 4MS3B 4O25A 3PWSA 1AMOA 1KQFA 2K87A 1ZA1A 2OOKA 3BE4A 3OPYI 1EQ2A 2NNLD 1SXJE 1GZ7A 3A28A 3A3OA 1A2BA 4QBTA 4MR7B 1QIHA 5EIWA 3LW7A 1M75A 1RIIA 1EFPB 4RK4A 4UTZA 1JU3A 4DLAA 3IEUA 1WBDA 2WF5A 1JG1A 2W2NA 1J5XA 2D4AA 2GHRA 1LJ8A 3MCUA 4R8LA 4C3OB 2XT6A 3TIGA 4V0SA 3RNOA 3RK4A 4CXMA 4IHJA 1I94B 1DC7A 4WJLA 1PYDA 1FQOA 4B40A 1K63A 3L6DA 3QSGA 3MTGA 2X15A 2P9CA 1H93A 1G55A 1GKKA 1OA1A 2IHVA 4ZALA 3RIXA 3WNQA 1KEPA 3PITA 1QIDA 4MUYA 4NU5A 5A9SB 3FJYA 3GRYA 2R1TA 5JSUA 1H5QA 1CU1A 1PD0A 3P9RA 1UQUA 1VPDA 4OPMA 3SEAA 2VH1A 1DRKA 2BPOA 3KTFA 4FMCF 4HK4A 1Z4IA 1JB9A 1TRHA 1AHNA 2Z8XA 2SICE 1ABFA 4IG4A 4JOBA 4RCVA 5TQ0A 4WFKA 2DY1A 3SX0A 1XDWA 4JLDA 3Q7TA 3NI2A 5CPBA 5LZ9A 5IAOA 2GVDC 1WXIA 3OAAA 1EKXA 4GC9A 2E2WA 2HD4A 3LP8A 2CFIA 3UAYA 4RF5A 3AF5A 4RUKA 1X7ZB 3MQ4A 3SC2A 4V1CB 2Q9BA 1A96A 2DFDA 2WHPB 4QU8A 3ZNNA 1DOHA 1AB5A 3X2EA 1Q92A 1SY7A 1I4TD 2JI4A 2VXBA 5AJVB 2H1SA 3H9EO 4G5FA 2QN6A 4P6VF 4EAAA 3MLBA 2AXEA 2PNFA 1YS6A 2Q62A 5L4LA 1DRUA 3FTCA 1YS1X 5ESRA 1Y81A 2XYPA 1IZ9A 1RWPA 2I6UA 3PNKA 2RHHA 4JJAA 5HTKA 2KX7A 3FUWA 3T12A 4ARUA 3DV0B 5D5HA 1NQ5A 3OF2A 2XWBF 2IWRA 2ZJ4A 2W58A 2VRCA 2AJCA 1OLOA 1M2JA 1JAIA 1P2DA 1S02A 3M34A 1O6CA 4ZGGA 4R1NA 2D1SA 4G1BA 4JJZA 3IEMA 2P2YA 2A88A 2OQ2A 2FZWA 1TIKA 2OK8A 2ORWA 4RFSA 2X6RA 4FTWA 3QVOA 1KQOA 2WUVA 3X1KA 4IZOA 4ZHQB 2GF0A 3GYGA 2WW8A 1C30B 4OBBA 5IM5A 4ZV7A 4G65A 1R4MA 3DMPA 3CO0S 3LDAA 3M7IA 1Y48E 4WASA 1P5ZB 3G0CA 4KE9A 2EKPA 1G6OA 4NH0A 4L5AA 1DDIA 1VGQA 5TXGA 5IC6A 4D9MA 4QGSA 5P8WA 3S1LA 4BWGA 2AD5A 5M3BA 1GRVA 4X9XA 1PUJA 4QODA 2NTYC 4D3YA 3IUEA 4Z0HO 4BVBA 1L5VA 1YOVA 1Q0QA 3H3FA 2BMJA 2WWIA 1ICIA 4S2UA 3QW4B 3VR1A 3NBQA 4JJ6A 3ZUGA 3VJMA 2LUOA 3GPBA 1RBMA 5EHNA 4JUIA 3F6CA 3IA7A 3PE3A 1YR6A 3LUPA 3NETA 2GN2A 3M4ZA 2ZQZA 3OCJA 3ABSB 3CSSA 2WZQA 1WBJB 4QRIA 5ARBA 2FN4A 2PRZA 3LZCA 4NK5A 4EL5A 4TTQA 3F1KA 4KQKA 3E7DA 3IV7A 1JQJC 3EVEA 1Q84A 4DUPA 3EGOA 3W3AH 1K27A 2IHJA 8ABPA 2P35A 3L9XA 3FNHA 4BJHB 2DBQA 4PGHA 1GO2A 4B3FX 1W96A 3L04A 1EWQA 1XYYA 2QJTA 5BSHA 1QIEA 2CE2X 1BRTA 2FW6A 4Q9JA 2J7PD 1KP9A 1KJYA 3B9PA 2G08A 2LKDA 3BXZA 5AHRA 2P90A 4HDAA 5FTJA 2DQSA 3GB9A 1GADO 4DCOA 3TPFA 1ZR2A 4CQNA 2XUJA 4ZI7F 4IJVA 2QPTA 4AUEA 4TV9F 3UXMA 1A9PA 4EB6A 5K3OA 4AYTA 3R09A 2DHEA 2P2DA 2VF4X 4JVSB 2NMVA 4C29A 3FDJA 3K6SB 1A7JA 1J2EA 1TTPB 2FYTA 2A1TS 3BMCA 3CT6A 3D6UA 4ILKA 2DQYA 3H5LA 1JGTA 3CURA 3FG9A 4Q7MB 3WAGA 4CDRA 2BFFA 3OPNA 2C5HA 2FFQA 1S4MA 3R3SA 1SWWA 9ATCA 3VC3A 4FONA 3IOCA 2VZEA 2R65A 4QO7A 1X80A 2G6TA 1FYFA 5ALEA 5J1TB 5KVQA 1HE2A 5ILQA 2IITA 2HU5A 3EZ2A 4NDZA 4CM8B 3LUGA 2D7CA 5K3AA 1GFWA 1KO7A 1DO8A 5AKKA 2C7QA 5ELMA 1E20A 1QP7A 1WZUA 2BRUC 3NBFA 1HE1C 3RSOA 2XOXA 1XK7A 1E62A 1WDKA 1Z0UA 1H66A 5FNVF 5A4MS 4COKA 3KHUA 4J16A 1H42A 2GBPA 4RANA 1T1JA 1YGYA 3R7WB 3ZBQA 4L4ZA 1E9AA 1FDOA 1YB7A 2GD1O 2HIMA 3T3OA 5CCXA 2AKEA 1T9GS 1V35A 1NWHA 1S1MA 1VRWA 2AEMA 1ECFA 4OHFA 4Q3BA 5CW2A 5D8DA 1YWGO 2IUEA 5WRFA 4F2DA 1P1RA 1E1QA 2AZXA 2MHCA 4RS4A 3P9QA 1W87A 1Q21A 1H0HA 4I6EA 1E4OA 1ISHA 1LTQA 4WVLA 4NONA 3G23A 2HZBA 3OTGA 3ANTA 4HNAA 2NYUA 3EGXB 1LPMA 3VYUB 3V9AA 3ANXA 3WGIA 3ICWA 5EP2A 1H2RS 3ZOZA 2B4TO 4HUJA 2DY0A 2QLTA 3DC7A 3VZDA 2CLOB 3FSEA 4F2HA 1O87A 2XRZA 2NO7A 3EVDA 5FXMA 1JG2A 1VA4A 1US8B 2NOAA 7ADHA 2JRLA 4C3UA 3OSUA 2CD9A 4BQQA 1T9HA 3EZ9A 3MPOA 1EJ0A 1GNQA 3CTMA 4LIPD 1N2XA 4RTSA 1YCHA 4IRUB 5HEKA 4FNOA 1TT5B 4Q4JA 3H04A 5CFPA 1QPBA 2QN8A 3D6JA 5ADHA 2HTFA 5AVXA 3TPCA 1KWGA 2C54A 1MPTA 2PCJA 4KXQA 3W4KA 3A3KA 2C5BA 4GO1A 2Q07A 1QHHA 3E9CA 3EXG1 1CUBA 2X0EA 2HV8A 4EH1A 3SQWA 3PXBA 1O6BA 3E9YA 5AJUA 1WF6A 3Q1KA 4TQ9A 2MIIA 2WJ4A 3H18A 1YASA 3FGZA 3QX7A 4F12A 1KMMA 2HDOA 4FDLA 3T5PA 5BWMA 1RLIA 4CM4B 5FI3A 3ZWAA 3DVAA 4WY2A 2I3GA 4C06A 3U9SA 5A4IS 1O5OA 3MWDA 4ZC1A 1ZIXA 1YAHA 4FHGA 4QECA 4K6GA 4HN2A 4LQCA 1KH1A 1VE1A 2ZIXB 3Q0TA 5B6PA 3TLBA 3MJCA 3NONA 1MB2A 3QE2A 9LDBA 2C9OA 2AOUB 4DCPA 1KQGA 3RJTA 1IIRA 1KO1A 3GROA 3H1GA 2BZGA 2UYQA 1XSEA 3CEAA 3DOIA 3GFVA 2V98A 3MVEA 4OATA 4AG3A 1BS2A 6REQA 4FOLA 4LBWA 2RE8A 2MYPA 2C42A 4NL4H 2ZVQX 3BN3A 4DTIA 4G8CA 2EZUA 5DT2A 3VKHA 2R68A 2QJOA 4WMLA 1JVNA 4UHJA 1KDOA 2OUKA 3C8HA 5E38A 2O2XA 4EZEA 2G70A 3NLLA 1NKSA 1Z7GA 1NPDA 1Z08A 3HXPA 3H4VA 1FQJA 2AI1A 2W11A 5KNLA 3IO5A 2EW8A 2FSIA 5ER9A 1M7BA 3AV0B 2XJ4A 1X9HA 2JFVA 1H9CA 3AV3A 1OI7A 2DWQA 3OIFA 4ZAVA 3O90A 3HE3A 3DZCA 1LPNA 2Q2QA 5H5JA 5LA6F 5D3ZA 5T8KA 4Q1FA 4R8SA 3UZUA 5JATA 1GPAA 1M34E 1Z6AA 2J67A 4URFA 3LC0A 1BCRB 5D86A 1K5DA 3BL5A 5FUMA 2B5WA 1EE2A 2VAPA 2WU4A 1WKVA 1ZW6A 1DEOA 3LHDA 1QG2A 5JYBA 1D0IA 1HE5A 5HJ5A 3KQLA 2B34A 1VECA 3ENZA 3MG9A 2R1VB 3AEKB 1XJ5A 3ADPA 1L5SA 3IEIA 2VZ9A 2H1RA 4OP1A 1JFTA 2R48A 2EOAA 2OAQ1 1GZ4A 5FLYA 1M2OB 2QLFA 1IAQA 1NPTO 1UKAA 3CB2A 1JALA 3D3WA 1ABBA 4CE6A 3FUCA 3WY9A 8MHTA 4ML3A 1DIRA 1R50A 4ZVLA 2PGNA 3HH8A 1JWLA 5KC9A 4ZOAA 4D81A 3V6LA 1ZVJA 4BO5A 1BW9A 4LFAB 4M1TA 4ESHA 1LBIA 1UWCA 2X7JA 4KKVA 3WKCA 5CB4A 4KLAA 5D5QA 3EB9A 3NFRA 5BSMA 2UV8A 4HLCA 4PE5B 1ZIYA 1QTIA 3MHPA 2Q21A 3BRWD 3F5SA 4NBWA 5ITSA 1N77A 2JFUA 1Y1TA 1URPA 2AMJA 4OHCA 4TTSA 2DX7A 5B3AA 4NYMQ 4ZJUA 2XTNA 1K6XA 1OX5A 3O3OB 2J6HA 3DUFB 1RLJA 3DZHA 3PS9A 4ARIA 1QFJA 2R4TA 5EWLA 2AZTA 3CWQA 3H11B 4HCJA 5EA2A 4ZVVA 1CB0A 3FMGA 4MS1B 2MT9A 4CM9D 4YJFB 2JCGA 4CIWA 4RY9A 1RP1A 2Z4SA 1ZSNA 1VP3A 1WZCA 2I1LA 1WDLA 3DV2A 2PBFA 3V42A 1QTNA 4KKXB 2PFSA 4OG2A 4PO1A 2UZIR 1XEWY 3JQCA 5G4KA 1FRQA 1Z5UA 4X6YA 2G77B 2ZB4A 1FSSA 4S0ZA 3PNMA 3GDHA 1IY9A 3EH2A 2GN0A 2CDRA 3BCRA 2GRAA 3CUWA 4M7OA 2GEVA 1TQ2A 2HRBA 2Y4OA 1B1CA 3BG5A 4NCXA 1TIPA 1GCUA 1SUDA 1YJ8A 5COAA 1OBHA 3T54A 1X8XA 2EFCB 3OZVA 1Z56C 2QRPA 3BM5A 4KXYA 1HT3A 4QPDA 3KQWA 5NLLA 4B5KA 4IRXA 1QR2A 4WNIA 3A4NA 4YMVA 3GGOA 4K6HA 5T4HA 3FPGA 3IE2A 5CX4A 5F2KA 2IF2A 1DINA 1ARZA 4LFCB 2C2MA 4FSHA 4NE2A 4MI1A 2F17A 1RYYA 3AFGA 4DLYA 1RC8A 2TMGA 3E2PA 2C0PA 2RHBA 4XB6B 5CM2Z 1CZRA 4FZRA 1G9TA 3FWPA 1KJ9A 3L0IB 1PNTA 3JQGA 4DDWA 3AF6A 4L5YA 1G4UR 1IZ0A 1MIOA 1EHYA 3RKUA 2W6QA 1EFAA 3E0XA 1A95A 3FZNA 5A62A 3QV1A 2YY7A 1RE1A 4OMCA 3KTDA 3EF0A 1CYDA 5CA1F 4S35A 4GZ6A 1BMQA 2Z2IA 4RD4A 2Q3LA 3GG9A 5HIAA 3AJAA 4IQGA 4LHZA 3PGMA 3BWBA 3ZZ0A 3W4JA 2VJMA 4ZOLA 1D2GA 2HQ1A 3N07A 1CE8B 2IYAA 3OZIA 4H4DA 3ZE2B 4BUCA 4BO0A 5IJ0B 3ND8A 1ZPDA 4CKZA 3PLNA 2DKNA 2H2HA 4PN7A 4FYVA 4QYMA 1QSGA 3OG9A 5KYTA 2ZJ8A 1OFTA 1WCIB 1PVOA 1SHJA 4ERXA 3IXLA 3VZPA 3RFFA 2CZCA 3LXXA 4WBSA 3U4HA 2ZJYA 1NFQA 2HFKA 3WQRA 4B3DA 9MHTA 4INAA 2QE6A 3IAM6 3W2TA 5EIFA 2AHOA 4M6WB 1YFJA 5B1EA 1WPXA 3OPXA 2B25A 1GUBA 2BELA 1AS2A 3MBOA 4MQMA 5D84A 2G9UA 2P2SA 3DAPA 3NV7A 4FMDF 3SKYA 3QPVA 3JTMA 4D6XA 2JLZA 3IQXA 3F8WA 3L9WA 3TMAA 1T0PA 3KEGA 4YN3A 5HSGA 1YRWA 1EFVA 1SXJB 3DFIA 3UM9A 1MF7A 1TO2E 4TMYA 2M6KA 2IVZA 1IB0A 3OT1A 4YJ2F 1SC4A 2NO4A 2ZBFA 3M3PA 1SOAA 5EYPB 4UVGA 2A33A 2QL5A 3DDCA 3PCXA 1C81A 4ATNA 3SSMA 4P3OA 2OYRA 1NC1A 4UM9B 2R8BA 4R9NA 1CQPA 1FSZA 3RVOA 2VSNA 4W5RA 4DQDA 1JDNA 1BN6A 2QUHA 1TO6A 3WYFA 3K71B 4E5YA 3PD1A 3ZX4A 1B8PA 4D8VA 3SBEA 1Q1AA 4Q18A 2QVLA 3EMVA 1AKVA 1LW7A 2LKCA 5E6SA 3TIIA 4MVJP 4DEYA 5CB0A 1B3RA 1DV1A 4HBZA 5GY7A 1V3TA 4ZYYA 2RBEA 3GVXA 3SYMA 1OE0A 4FR0A 2A0XA 3GEPA 1XL1A 1ZUIA 5F12A 3ZBTA 1YE5A 5DLQC 2CBGA 1CIJA 4YTEA 4Y2TA 1CF9A 5AJXA 3PJRA 3DDNA 2YXNA 3IGFA 3U44A 5UKDA 1RWXA 3FYUC 4O2AB 2G7ZA 4HD8A 4PLFA 3NHKA 2D3WA 3A7DA 3VJLA 2BEKA 2CN1A 2PZJA 1KDRA 3DONA 3QLJA 4KQWA 3UG7A 4ZQFA 3TM5A 5CCBA 2HW8A 1OYVA 1FS4A 4YC7A 1YS7A 5AHOA 1PYGA 2DVMA 4KXUA 1NJ6A 1SXGA 1U3CA 2V03A 4LRYA 2R6GA 3SEQA 5F5XA 1Q1ZA 2J3KA 5D51S 3V8VA 1G42A 4F6RB 3BMOA 1XD2A 1BDMA 1X7ZA 2B94A 4U63A 3O4VA 4B4KA 1I0IA 4E88A 3LA8A 3L1UA 2WHPA 1LFAA 4LC1A 5AXAA 1S2OA 4QIHA 3SU8A 2JI6A 3P1JA 4D4GA 1HC7A 1IB6A 4LGMA 3NHZA 3FLEA 1XXLA 3KJXA 4GE3A 5JSFA 1VCMA 2FPMA 3Q7IA 4JSYA 2QRQA 4Q7EA 1PE0A 1PVVA 2V5AA 4Q9DA 5EXSA 3BXFA 5FI5A 3WDMA 4MAAA 4YR9A 2I91A 3GQBA 3ETEA 3OFSA 1V39A 4KIUA 1KSGA 3LKBA 2Q2NA 5FR2A 1JE1A 1RKQA 2NO6A 4XWKA 2H31A 4OHKA 3SXUB 4KXFB 1JEQA 2C4HA 1S2LA 2Q46A 5EJ9A 4UNRA 1USUA 4L7VA 1QO0D 5GINE 3I39X 3X2SA 2J6IA 3LT2A 2PKQP 2YIDA 4DJDC 5KTYA 1W5TA 3JVEA 4W5OA 4DRYA 3K9CA 4Q9IA 3ZHZA 3W6NA 2CJFA 4HGYA 1QRDA 2H8GA 4JK3A 5FR1A 4QYWA 5J9FA 5MHTA 1HZZA 1M6EX 1RLUA 2WUEA 5FO0A 5HFNA 1GSOA 1YC5A 2EFGA 2RGGA 1GD1O 2C83A 5FWDA 4S3MA 1VI6A 4ZV9A 4W5JA 2V0CA 1BKSB 1PFVA 2EG5A 1CNEA 2AKAB 5E2AA 1G9XA 4PTYA 4C2BA 1QQ7A 1QQBA 4JI2B 2ID8A 3B1KA 3NHFA 5I45A 1GR1A 4FKZA 1U8FO 5EZYF 4ZEOA 1PN3A 2XOKD 3EXAA 4FDTA 4ZMRA 1V9LA 2I0FA 1FNDA 4QFDA 5LQAA 3E1SA 3CKYA 1RYEA 2Y0CA 1ZOLA 1M2VA 3LBHA 3VPBA 2QRLA 4FNAA 3W5DA 2UYCA 4ZDKA 1EFTA 2QRHA 3ZHYA 5DNUA 1K7CA 4HZGA 3RAGA 4BB5A 2IHZA 2JCBA 7GPBA 1FP4B 4GEKA 3ROEA 5IBCA 3B5EA 1NVVQ 1KMNA 3RYHB 2CJXA 4GI5A 2H2GA 2WU1A 4PBTA 2WU8A 1Q20A 5FEMA 3EWNA 4QEZA 2FW8A 2AG0A 3UUFA 1R8JA 4RY0A 3M4JA 1T1RA 2QN9A 1M33A 3U56A 1IYZA 3QVGA 2VP0A 2ZUVA 5CEEA 1GPJA 1UH5A 1EX9A 3OIVA 4KQXA 1J70A 4ENVA 5C5DA 1QYCA 3QUAA 4EMTA 2I8CA 1JJAA 1W25A 1SIWA 1Z4OA 3D5EA 3NM5A 1AO3A 4MMXB 1VKRA 3PF8A 4C5CA 4YUWA 3LKZA 3GAAA 2B4KA 5LQNA 4K6CA 2Y27A 1DV2A 1VJCA 2GK3A 3KZCA 4P86A 3K6SA 1HEIA 2EF1A 3T34A 3PZRA 4OY3A 3VFDA 1N36B 3BXPA 5LZ5A 1G20A 4F46A 1E0SA 1P4SA 1SO8A 1MNAA 4JN6B 2YOHA 3K35A 4KRFA 4JKOA 1DCMA 3G5MA 3IULA 4AYWA 4DLVA 3ML1A 1APBA 3HDHA 3IDOA 1WXHA 1PTJC 4WH0A 5K3BA 1PFKA 4JI8B 5HF6A 1CWUA 3AMVA 3TGLA 5BOSB 2Q1WA 2ZJZA 3IVGA 2V54A 2ZT8A 1Z34A 1PK7A 3OTHA 1U2GC 1DAPA 2H08A 1QGZA 4R3WA 3ZZUA 5CH3A 4ZEMA 5KOIA 4QREA 2FPRA 2CE7A 4E7PA 4AMBA 1W29A 1XPRA 1FZTA 2HMSA 3V4LA 2PKXA 1I6LA 2QXUA 2ZQYA 3LFUA 4RQAA 3TZ6A 2ZXUA 1GM5A 3WO0A 4LF6B 8LDHA 3RFVA 1HR0B 4XSGA 1VCIA 5CT9A 3PKJA 3LV8A 4G8BA 1ECLA 2GYUA 2XUDA 2Z8YM 3I6MA 4Q21A 3PHIA 2Z4TA 1R37A 4XYMA 3UGTA 1HRDA 2Q3FA 3NKVA 2APJA 2B4YA 1E8DA 1RXYA 4FZVA 3K2IA 3TDNA 1JHQA 4G01B 4ZPJA 5AI4A 4JJIA 1SA0B 3I3OA 3IODA 2QNIA 2FX5A 1JN0A 4M0DA 5K3SA 3WBBA 2B36A 1T3ZA 3GUCA 3OH8A 5DEIA 4Z9BA 3HJRA 1RJ9A 3TLXA 4AJIA 1QAQA 3DAFA 2EQ5A 1UMBB 3PGVA 3DDHA 1H8ED 1JX6A 2IUSA 3C3MA 3ZQJA 4EECA 2BHRA 2AUNA 1RQXA 2YJZA 4J2HA 4O8CA 2QT0A 4KUHA 5I9LA 2PZAA 1M66A 1W73A 4IXTA 4KBGA 1ZDMA 3HDQA 3NU1A 3ZGXA 4BGVA 4YREA 2GI4A 1CF2O 2QT1A 4FDAA 4L16A 3ZWVA 2FSPA 4TVSA 3UPUA 1WMFA 3PGKA 3ZD6A 1AKYA 3PD0A 3G2MA 1Z4MA 3JVVA 3W7AA 3G5UA 3G9UA 1SVOA 3UBMA 1IM5A 3TN7A 1TPYA 3PIDA 1TT5A 4GNKA 4R9VA 5EUCA 1JIIA 1OTYA 1KI2A 3O9ZA 3UWDA 4A23A 1G8YA 4XZ3A 3TH5A 1V6SA 4HEA1 2KB0A 3WDSA 4EP1A 1RZUA 3HUEA 2C8VA 4CWAA 1YVUA 3MHTA 2E6UX 1YHZA 2A7QA 4ITUA 1JA0A 2YW9A 2ZRQA 5EI5A 3ZVRA 4G0WA 2JJYA 2HX1A 3KZXA 1NAIA 3GLHA 2QLNA 1X7XB 1Q7BA 4JGGA 3M81A 2Q6TA 2R25B 2RHWA 1G6KA 4MIKA 4CIYA 5JWOA 5IZCA 4QXOA 4K0RA 3H9JA 4ZT5A 1MGOA 5FBHA 4BVKA 3IAHA 3EIFA 1AX9A 3UWPA 2AMYA 3ZWNA 2VI5A 1HT1E 2C20A 3TNLA 2C57A 3OZAA 1F12A 1PR0A 1ZK2A 1EM8B 4K46A 4LYAA 5CH8A 3VX3A 4EAQA 1TCVA 3BREA 3O0DA 1WS6A 2GXQA 4YCCA 5TVGA 5EP3A 2XTMA 3LVBA 2AOUA 5KYVA 1ZJ4A 4L5IA 5IVIA 4B87A 5G0WA 1O97D 3VI4B 2D1TA 2GM3A 3TZCA 4B76A 5KEIA 5HBGA 2ODNA 3VYSB 5F7XA 1F14A 1SUWA 3KZNA 1CD5A 3RREA 3GMTA 4BBPA 3BWMA 3FKSD 1Z0FA 2P9JA 2Y99A 3OLVA 2D1YA 4RPJA 4BX3A 1XZCA 1KR2A 1XK6A 4ZWNA 2II6A 3A6KA 3D7KA 1P7WA 1DWQA 3ZNQA 1YL6A 4ZRMA 4KVGA 1P9RA 1Z15A 4KYTA 3ZWYA 4AJNA 1N33B 3GNQA 3QMVA 2C88A 3OJFA 1PGJA 1NIJA 1ZBQA 5TQ2B 2PR2A 1UBSB 5JS2A 2E82A 4DILA 1LS1A 1M34B 1MFZA 1C1XA 4BU0A 2G4VA 3DH0A 1QCDA 3QELB 4ZAZA 3O4RA 1LTKA 1SXIA 2AXNA 2EDCA 5KOYA 1Y37A 5ALTA 2QZZA 4R1SA 2NZXA 3VKWA 4L5BA 1EXDA 3E15A 3KOYA 4RD0A 3Q8MA 2WEKA 4IILA 4AS3A 1MQ8B 2HTEA 2VBFA 2O1SA 4TKVB 3QRWA 2AB0A 2C5FA 4P5PA 1Y7TA 3MRVA 2Q6KA 4WGFA 3KALA 4I1VA 2EQAA 1ZXXA 4Z9YA 1A5AB 4YRFA 5G02A 4D9HA 1E2JA 4RXUA 4O29A 3T1QA 821PA 2FCRA 3QXSA 5IP5A 1A9QA 1LZLA 3M6IA 3MYRA 1CHNA 3RS0A 1VL5A 3KAPA 5IS2A 4XIGS 1KE2A 1MT3A 2D06A 3NEPX 2JAUA 2W6ZA 3I34X 3HS3A 1N8KA 4C2AA 4GL2A 1MO2A 1AKQA 3P20A 4YGXB 5AI0A 4EY8A 1NW4A 4TYQA 2DQZA 4O0LA 3WGZA 1T2EA 4NJMB 1JKIA 3Q5DA 4QGFA 3BSWA 2BEVA 3FOCA 2Q3MA 5ALPA 5BWNA 4FCVA 4IMIB 1MJHA 4NOKA 2O2ZA 3W7BA 1D8AA 3RLIA 4Q24A 2Z56A 3MFQA 3UOAB 3AI2A 2BFAA 3IO3A 3S5JA 1YJXA 1JNYA 3DD5A 3MJFA 3QVVA 3ROQA 4A82A 4CEIB 4PZUA 1KVTA 1HDGO 2X0JA 4U0JA 4HSEA 2GWRA 3A9WA 5BVHA 4KXLA 2OC4A 5LOVF 1GUZA 3Q7QA 2Z2JA 4P3XA 1RQPA 2NQ2C 4QTTB 4R51A 4K8RB 1QGOA 1RHQA 5FV7A 4MUEA 5A1TA 1W2HA 1G17A 1JKMA 2HLDA 3H11A 5FA6A 3V1LA 3X1WA 5DGIA 2B98A 4OL9A 1RHUA 2VHCA 3CNNA 3T3HA 1BKDR 4YJHB 1KO5A 1XZKA 2WILA 1JQLB 3NNNA 3JXEA 5FWNA 4F9TA 3F1LA 2EHDA 1PHPA 3E5RA 1P2FA 4IIBA 3FSJX 1CQXA 4G5SA 3KUCA 1PW5A 3H5OA 1OJLA 4EUFA 1CCWA 1RFLA 1Y89A 4CEJB 2JLUA 4LI3X 1NRXA 4PXAA 3WQSB 1FL9A 3C39A 3EYWA 5H1YA 3NYWA 1X2EA 2VT3A 1GILA 3AGQA 4J0EA 5NULA 4LNUA 5LQCA 5T4BA 2QF7A 121PA 3F46A 1EJBA 2OGWA 1AQYA 4LJ9A 3U5ZB 5D1NA 3MW8A 4YT5A 3K3PA 4GUDA 4J75A 1V2HE 2WD7B 1GAWA 3EDCA 4YRCA 1KI7A 2DM6A 3SM9A 1C0LA 1J2UA 3PR3A 3FPAA 3QNWA 4MEBA 4MUAA 4MRSA 3ADDA 1BHO1 1SHZA 2DH5A 2EFEB 1BC5A 2XQKA 1DLIA 5FL7A 2TMDA 5FH9A 1Q1QA 5KQPA 3SHVA 3MBKA 2K7FA 2XUQA 4YAFA 5CX1A 1JBQA 2ZJOA 4ZZ1A 4UBLA 2OO5A 3FPSA 4RDIA 4N7BA 1XRMA 3WWYA 3LLSA 5TPZA 1BVUA 1ORWA 1U8UA 4GLFA 3ISVA 5K4HA 1OWOA 4HQFA 3UKJA 3COYA 3ED5A 4QATA 3KQHA 1QGYA 5SYMA 2A5LA 1B43A 2HNKA 2PWPA 3E3OA 2H2FA 5MF6A 2W2QA 1CE8A 1T0IA 3M2PA 2ONCA 3RIGA 4QPCA 1BDHA 1U2ZA 5DT9A 5I48A 1V4NA 2ZYDA 1QU2A 3GUUA 3NHYA 4O1IA 4PNPA 1CY4A 2VDMB 2JJ2A 3HCRA 3Q1LA 2H4YA 4UTVA 1NBIA 2OG1A 5DX8A 1UDAA 4S12A 4E2YA 4M0UA 1OH6A 1XTSA 1Y9ZA 3AUTA 3Q3IA 2QP3A 5B53A 3BWYA 3L8ZA 4J16C 1YACA 3VGJA 1QAMA 4AKGA 4PYKA 3QA9A 1ML3A 3THXB 1T6NA 2OB1A 1I10A 2ZULA 3DPSA 3MTQA 3P96A 4RTLA 1Y8ZA 1ZUD1 5HQ3A 2QN2A 3NAGA 4WCFA 5KDLA 3OCXA 1FW6A 4Y0NA 1SKYE 4YAWA 2NV0A 1S3FA 3N0WA 2DJIA 4MKRA 3HYCA 2OUIA 5ERXA 4KDFA 3IIJA 4WDRA 3QYPA 5EYPA 1LDNA 2VCYA 4FSXA 2WYOA 2YWFA 4NS4A 2ZCVA 4UCWA 3TRIA 4QNRA 1SVMA 3Q3HA 2IS1A 2JFOA 4PEVA 1ULAA 1FVOA 3A3YA 2F6RA 3JRWA 1VI2A 2WVGA 2TYSB 2W90A 2VHZA 1E2MA 5AOVA 4C01A 3ZWPA 2FPPB 2TRSB 4O4JA 1QLHA 3I01A 1G8HA 1W0JD 4ZQEA 1Z63A 3PQ2A 4M9XA 3KQPA 3E4CA 1LSJA 1QZ3A 3HEBA 4OP3A 4Q12A 5EIAA 3RF7A 3TDMA 3X1MA 4WY8A 5FX2A 4WXRA 2F48A 3FSGD 3OJCA 3PG5A 4LZNA 1L8QA 3PTZA 3B5JA 4CL2A 4BFWA 4REMA 1L8LA 4HDNA 1QV9A 5BSEA 1IVNA 1YZFA 4OGLA 2QRVA 4ZT2A 2BZSA 1Q7TA 1Z4KA 5E9AA 3QWIA 5I8ZA 3SK0A 4RDCA 2O8NA 3TTUA 1D2CA 3E22A 2AW5A 4D9NA 2OT3B 2YL2A 4ANFA 3KSAC 1ODJA 1PJCA 2F1OA 2J30A 4DIBA 4TKMA 1AIPA 2H4JA 3N75A 3HRKA 4ZCIA 3AO0B 1U8EA 4D9FA 1T3GA 2HNAA 3AZPA 4DNXA 4A8HA 2HKIA 4Y2VA 5L6MB 1NDHA 2ANCA 3MA0A 3ZDDA 3ICCA 4K3VA 4F6RA 1GGNA 4MHOA 3A4IA 1ZK3A 3FYDA 5DH9A 4B0PA 4PGMA 2MINA 1DAHA 3NKLA 1XF9A 1KK3A 3O73A 3UUEA 4X0EA 1Z7WA 5F7ZA 3TM4A 4IM7A 3LCCA 1ONPA 2O0JA 4AD8A 1IPFA 3IVRA 3P19A 4M1YA 4X91A 4HZIA 1R8XA 1V71A 4AJ2A 3BEOA 2E3JA 3SNKA 1ADJA 4BNTA 2BDUA 1U28C 2JLXA 4J7CA 4HVCA 2FXIA 4XQGA 1H2HA 5B7QA 2JFNA 5H68A 2XY4A 1Z5PA 5EINA 3G8AA 4B9AA 3OE7D 2ZRAA 1YZKA 4R9SA 4EB8A 2QLLA 1F8FA 4C6SA 1FW8A 5B7GA 3EJ6A 1F5NA 1H0RA 1W5EA 1FTQA 1Z5VA 2XVAA 1F9AA 2QL7A 5CM9C 2HO5A 5FADA 1D2AA 3ZVLA 4DIUA 1R5NA 1JR3E 4XDZA 1T34A 1IOLA 3BJZA 1FA9A 3QX3A 2EYUA 2JHGA 2RBKA 2QTMA 1NUPA 1K6EA 2GF2A 3DE1X 5AR1A 1P31A 1RC1A 4RKFA 3N2KA 5H83A 4EY4A 5K03A 1EFCA 2AF3C 3SJ7A 4ZTUB 4I50B 4H3KB 1XWIA 1XP5A 3AX6A 3OEHD 1V1RB 4XA8A 5CDTA 4CKBB 4ALKA 4LSWA 4UEWA 4JAVC 4GSLA 5DMXA 3LXUX 4FLFA 1BVHA 5E0OA 1P1CA 2PUFA 1XRLA 1X1TA 3F4KA 2DBRA 4WXMA 5JROA 2MMGA 1Y4UA 3MUOA 3CTPA 2JGRA 4MPJA 1WB9A 3QUSA 4FYIA 1O58A 4WTOA 4YQEA 5H59A 3RUDA 1FP4A 1PGPA 1BVYF 1L5RA 4NBKA 3P2OA 1Z2NX 3UMRA 2ZB7A 3QW2A 3WNZA 5F9FA 5U9CA 4EHIA 5K8IA 3IB3A 1OV4A 5KOHB 3CT4A 3RS8A 1SCJA 3WZLA 3R3JA 2AN3A 3P2KA 1QFYA 2JJ1D 1F1JA 3R40A 4WOPA 2P6RA 1QCCA 3G2NA 1K2VN 4KXNA 3AVWA 7REQA 4IG9A 1PUXA 1J49A 3P9YA 7AT1A 2O06A 1J2YA