2JATA

Structure of deoxyadenosine kinase from m.mycoides with products dcmp and a flexible dcdp bound
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
202
structure length
190
Chain Sequence
b'MKIAIFGTVGAGKSTISAEISKKLGYEIFKEPVEENPYFEQYYKDLKKTVFKMQIYMLTARSKQLKQLENIIFDRTLLEDPIFMKVNYDLNNVDQTDYNTYIDFYNNVVLLSFDIVIYLRVSTKTAISRIKKRGRSEELLIGEEYWETLNKNYEEFYKQNVYDFPFFVVDAELDVKTQIELIMNKLNSIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEOXYGUANOSINE KINASE
publication title Structure-Function Analysis of a Bacterial Deoxyadenosine Kinase Reveals the Basis for Substrate Specificity.
pubmed doi rcsb
source organism Mycoplasma mycoides subsp. mycoides sc
molecule tags Transferase
total genus 64
structure length 190
sequence length 202
chains with identical sequence B
ec nomenclature ec 2.7.1.113: Deoxyguanosine kinase.
pdb deposition date 2006-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2jatA00
4OL0A 2XX3A 3RS2A 2PMDA 1OXXK 3VX4A 1M7HA 3L8ZA 3EZ2A 4RZ3A 3BOSA 1DVRA 1Z83A 1W0KD 1IJFA 4JLOA 2QSZA 4QGAA 3VKHA 4M9XA 3GLIE 4KI0A 1XZQA 3VFDA 2B21A 1W49A 3MCAA 1KI7A 2QP9X 3AVTA 2QTVB 4GOJA 1GIAA 3B9QA 1CJUC 1M1YE 1UFQA 3CR8A 1YR8A 1JR6A 1SXJE 2ZRDA 1LF0A 2H1LA 4GPTA 3A1SA 2BBOA 2CVFA 2CJWB 4LBZA 1W7AA 2I1QA 2JLYA 2AWOA 2EFHB 3W6NA 1JXMA 4US2R 3FTQA 2BJVA 1X6VA 1ZM4A 4KCGA 4ARZB 4UXHA 3KUDA 4HLUC 2NMVA 1P2UA 2FOLA 3L2OB 1Z6TA 1Z0FA 2JEOA 3C14C 2V3CC 4BFYA 1CJMA 2VHUA 3PV0A 3BBPA 2GBLA 1M34E 3CZPA 4DLRA 1Q1ZA 1W0JA 2Q21A 1AQYA 3CRVA 3AUYA 1XWIA 1PVOA 2GZDA 4B44A 2H5EA 3N2EA 1M8PA 1T91A 2OM2A 2Z4SA 3LDAA 1E0SA 5AWFC 3OHMA 521PA 4GL2A 1D2EA 2VHCA 1E0JA 3LBIA 2JLSA 2VP2A 3CW2A 2V8OA 1FZQA 2P5SA 1ZCAA 2W58A 4HAUA 1EX6A 1TPZA 4HI0E 5A0FA 2WWYA 4LY6A 4B2IA 1FL9A 2ZROA 4M1KA 5H8WA 2GJ8A 2EU8A 4NCNA 4Q02A 3SJBA 4D4LA 2OG2A 2YOHA 1ZNYA 1UEIA 1NRJB 3EIQA 3TQFA 2V1XA 2JATA 2ZRPA 3L82B 2ZSDA 4QG7A 2BHRA 1G4AE 1WRBA 1SVSA 2RGNC 4PAQA 3EW9A 1N25A 4EPXA 3AVVA 1Q0UA 3GD7A 1Z07A 2CHQA 3QVUA 2QY9A 2P6RA 3EIHA 1XDBA 4LBWA 1IJEA 4M22A 1NLYA 4RFSA 4AK9A 3FDIA 2ZE5A 2PCJA 4JVMA 4U5XA 5BYKA 3KUCA 3Q7PA 1G8GA 1R5BA 4LJAA 1TF7A 4N3NA 4HB4A 4TMVA 4WVFA 4EIWA 2NPFA 5BW8A 3R8FA 2XOKA 3K0SA 2CL6X 4F4CA 3VAAA 2RGAA 2YVUA 1KMQA 2AWNA 4BRUA 1C4OA 5HTKA 4QGHA 2ZJYA 3ZS9A 1R0YA 3UG6A 3LXRA 4NBSA 5EXSA 1HV8A 1IAQA 2CMKA 5SZHB 4IOMA 3PEVA 1XB2A 5E4FA 2LKDA 4ABYA 1A2BA 1G8YA 3ZYCA 2NZ8A 3VKWA 1P6XA 1W48A 2OCYC 3L43A 2Z5FA 3THWA 4GSYA 3PUWA 3T34A 4E22A 1ZUNB 4TYQA 3SQXA 2DCUA 1B0UA 2AKAB 4GT1A 2A5YB 3SOPA 3QXHA 3W8RA 2GAAA 1Q20A 2JLRA 2VSXA 1G19A 2ZUCA 3HJNA 1QG2A 4XTRA 3ZJYA 4D0GA 1CF4A 2IYTA 3BORA 4DSTA 421PA 4QJ3A 4Q9LA 3A1TA 1MRSA 1UBGA 1IY2A 2GVDC 4AWXA 1R2QA 2D4HA 3PIRA 4I1VA 3A1UA 5CJPA 4U7DA 5F9HA 4WA7A 5HE9A 4MYCA 2ORIA 1GG2A 5FTNA 1P72A 5TB5A 4D6PA 1ZU4A 3B13B 4DXAA 1JPJA 1VKJA 4KXFB 1WMSA 1K6MA 4UKDA 5L3RA 1PV4A 1OXVA 1YVDA 1ZYUA 1FW6A 5JBQA 1OFTA 4DBLC 3LW8A 4LHWA 4JT4A 5BN3A 2FX3A 4RFSB 4U02A 1E2KA 2PH1A 1AS3A 1HQCA 3CM0A 1NL3A 2QGNA 2ZR0A 5IF9A 4L15A 4IDQA 4D25A 5KOYA 5EE1A 4N1AA 4YXWA 2ERXA 1VCOA 3IILA 4AG5A 1HUQA 1KO5A 3J81k 4JLDA 3LLMA 5LD2B 1AQUA 1GUAA 5E7IA 5EE5B 1TF2A 1OHHA 1P9NA 1Y3AA 2BKUA 4XVUA 5CYPA 1HEIA 5TXGA 4L9SA 4WW0A 3IQXA 3NWJA 5KU1A 3BE4A 4LWZA 2BM1A 4FXPA 1IN5A 4BZXA 1MKYA 1Z29A 2PT5A 3EC2A 4LJ5A 3SHWA 4HSEA 2JLZA 2ODWA 3AVUA 2GESA 2VEDA 2J5XA 2GJSA 2ZS7A 4I1OA 3THWB 4PPNA 4QKQA 1SQ5A 2REXB 1GZSA 3FKSD 5K8IA 4JVSB 2IEYA 4XSHA 3B8HA 3K70D 3WXMA 4PAMA 3NVAA 4LUCA 2WJYA 4IOJA 1AKYA 3T1OA 3ZVNA 3KJHA 4MKGA 5TARA 3WY9A 3VHLB 1T3SA 3TMKA 1HE1C 4NDZA 1Z0KA 2P67A 4NHOA 5CLQA 2W0MA 2X77A 5KTYA 4C30A 1NIPA 5KUTA 1MO5A 3CR7A 3REFA 2YJTD 4TYPA 2W6JD 2PCLA 3BRWD 3X1YA 2QAGC 4KFTA 1QHHB 3ZIAA 3T15A 1Z2CA 4JJKA 1E9SA 1O3YA 1TQ4A 3OE7D 2VH5R 1OFUX 2YWHA 3KKOA 4URUR 3SJZA 1NMYA 1G7RA 3NC0C 4JLMA 3P27A 3U4QA 3WBKA 4C0SA 4C7OA 1E2MA 2RKOA 5AUNB 4A0HA 1GITA 1CRQA 2C9CA 3RSOA 4X8OA 5FBQB 4Z8XA 2WWIA 2VHTA 2W2VA 4YMWA 1I2DA 1G3MA 2GK7A 1NVXQ 5G3ZA 2C2HA 4AKGA 3K0AA 4B75A 3SDZA 5KDDA 5CIWA 1KDOA 4OYHA 5HKKA 4CEIA 2X8AA 2BMEA 2ZUBA 3FHOA 4LSGA 3RS0A 4AYWA 5HZKA 4ZI3A 4ZIRA 1XD8A 5KYKA 4IOLA 3PENA 1QHNA 1P7CA 1OV4A 4F91B 1IN8A 4C0AC 3AGQA 2V9PA 1G291 3B82A 1KHTA 4S2EA 3CRMA 4K81B 4HEJA 2OCPA 1KJYA 2VA8A 4M2LA 4A2WA 5FL7D 3JVVA 1KK2A 2OXCA 3GJ0A 3W9YA 3I8XA 2JDID 2YWFA 3QQ5A 5B58C 3CPEA 1CR2A 1II8A 1N0WA 5JHGB 3KJIA 5CM9C 3QBVA 2IS6A 1Z6XA 4G5SA 3MFYA 3A58B 4M1SA 3ZZ0A 3BC1A 3EAQA 4L9WA 4A9AA 5JWRA 1KGDA 2ZXUA 4XIGS 4Y0VA 4KITB 2DHRA 1QVRA 3AB3A 1JR3D 3C16C 5AUPB 3I4LA 4NCHA 3AF4A 2A3RA 1PLKA 3NTUA 3I5YA 1XPUA 2J0VA 3RLFA 2IA5A 2Z83A 3RYTC 2BDTA 1BS1A 5J4VA 3TVDA 4OK3A 2XXAA 4GI7A 2ANBA 4IVRA 1GNQA 2OCAA 2R6GA 4KO8A 1CR0A 5EE0A 2BC9A 3U4QB 2QZ4A 1HTWA 2R9VA 3EA5A 3VR5A 4C7OB 3U44A 1S1MA 4PHGA 4FCTA 3QXSA 2IYXA 3V9PA 3R20A 3LWNA 2BBWA 3MG9A 3U3KA 4BLOA 1T8UA 5B64A 3U3RA 2J59A 2A2ZA 1JJVA 2XITA 4P0TA 1OH7A 1W36D 3Q5EA 3CUEF 2QP4A 4B32A 3NBYC 4RD6A 5EXTA 3O8RA 4LJYA 4ZIRB 1E2EA 3B6EA 1OXSC 3E2IA 2X2EA 1II0A 1UKEA 2ZU6A 3CRW1 3S1AA 5GJCA 1YE8A 2GETA 2IUSA 2VP4A 4B3XA 5KNCA 5FOVA 4OQFA 3CNNA 1LFDB 1KZGB 1IN4A 3IIJA 4HLUA 2ZYUX 4URZR 1C9KA 5J4HA 4JS0A 1FFHA 2JLUA 1E1QD 5FH9A 1E9DA 2FG5A 3ZVMA 3I8SA 3DM5A 1KK0A 3DKPA 4XWAA 4XVQA 1K5DA 3AKDA 1Z5ZA 2RMKA 1II8B 1NJGA 3R7WA 4TLCA 3LY5A 2EWWA 4CIDA 2ORVA 3LV8A 4KBFA 3OIWA 1RZ3A 1MABA 4OI4A 4RJLA 3VU9A 2WKQA 1UBFA 3RSLA 4P32A 4LZZA 3PUYA 1GKIA 1RKBA 2CLCX 2ZRJA 3VTKA 1WCV1 4WZ6A 2H8KA 5FOWA 4AKEA 4JLPA 1NI3A 3MWYW 3GLGB 4Q4HB 1YZKA 2EWVA 3D31A 3KTAA 1F5NA 1KI4A 5JCPA 1E2HA 1CEEA 3KL4A 1EGAA 3KJEA 1YR6A 3TUZC 2V7QD 2XXAB 4ACBA 4HUQA 5FBWB 2IS4A 1E79A 1G16A 1HYQA 3FKQA 3U44B 3MJHA 3OEEA 1G5RA 2MSEB 1EFRA 2F7SA 3C41J 4TSFA 3OZXA 1NJFA 1UF9A 3O47A 4OQNA 5FTMA 3ASZA 1E9AA 2WSSA 1COWD 2XSZA 3AUXA 4RD2A 2Q9BA 5H68A 4FMDB 3TBKA 4GFDA 4LHZA 3U7HB 2PMKA 5HR5A 1WB9A 5LD2C 1SXJA 1E0KA 3TH5A 2CCGA 5AJXA 4IDPA 3OEHD 5CLLA 5CDFE 3THXA 3GJXC 4DCVA 1ETUA 4R9UC 2BIFA 1ELOA 3S1AB 3LO5A 3EC1A 4QJ5A 1XX6A 4ZV4A 2AXPA 1IN7A 4FCWA 3ADDA 1VG1A 1II9A 5JFGA 4QHTA 3KQUA 4C0LA 1E1RA 2JLWA 3PJRA 3BJIC 5C4MA 2C5LA 3CIOA 3R7WB 2F1HA 1US8A 2NO9A 2WWGA 1OB5A 1LB1B 2PJRA 3X1DA 2WPDA 1CJVC 1CP2A 1TUEA 3IPXA 3QKRA 2ZRFA 5FUYA 2FE4A 3LX8A 3I92A 3VU9B 2J0UA 4Q7KA 4BLQA 1H8ED 2UZ3A 1NVVR 2VYFA 4ACAA 4HYYA 1X3SA 4AIIA 1KSJA 1D2NA 3THOA 3VHXA 3VNUA 4BFZA 4HLDA 3NH6A 3I62A 1L4UA 3HDTA 3W5JA 4A6XA 2IWRA 4XSGA 4ESHA 3WMGA 3KTAB 2O8CA 1FP6A 2ZI9A 4BE7B 2OFXA 3CRQA 4PANA 5D3MA 1YZQA 5FBRB 3T5DA 2ZAMA 4HUQB 1NN3A 1Z0DA 4EFLA 1ONBA 1SVIA 2B92A 1S4QA 4TTRA 1BIFA 1RFLA 1U99A 1YZNA 2JCSA 3NBXX 3GQBA 1RRCA 2FFHA 4KYUA 2VL7A 1E2NA 3KQKA 2EFDB 2GA8A 4DLVA 4XD7A 2ZEJA 2ONJA 4EFNA 1SXJB 4QBFA 4GRAA 2HCBA 4UNNA 4DSUA 3K9NA 2ZR7A 4DUGA 2OFWA 4XVRA 2WVJA 1NVWQ 2P6NA 4CF7A 2QORA 2VSOA 2XTNA 1FQKA 1H8HD 3B7GA 3CF2A 2J46A 2NOAA 1ZVQA 3PR1A 4WAUA 4X8LA 4L8GA 1MH1A 3KQLA 4LYAA 3PFIA 5TV2A 3IIMA 1ZNWA 4DDVA 2PT7A 1WQ1R 2B6HA 2VP5A 2QPTA 4W9MC 4YMVA 2BCGY 2ZJ8A 3Q3JB 4BWYA 1US8B 3EPLA 3TAHA 4HZUA 2LCFA 4O2RA 1U2RA 1T6NA 1F60A 1Z0IA 3QKRB 1QZXA 2XAUA 3HYRA 2ODNA 3SNHA 1MO4A 1LTQA 1OF1A 4KFRA 5AJYA 1VHTA 3U7FB 1XD9A 3IEVA 4OQXA 1VCIA 3RWOA 2BM0A 2QT1A 2GXQA 2VP9A 2IHYA 4RZUA 2O8CB 2OAQ1 2MMGA 2QENA 2YWGA 4Q7LA 4UNSA 1KI8A 3GLGE 2CCJA 2DFTA 2ZANA 3D3QA 1U8AA 2BOVA 2YOGA 5F3WB 3TE6A 1Z47A 2O5VA 5EP2A 1A1VA 5B30A 4MKFA 1WA5A 3FB4A 3TUJC 1XRJA 1Z8FA 4Y0AA 3WYGA 3RWMB 3IBGA 3EZ6A 4PC3A 1IHUA 4TYWA 4DLSA 4YDSA 4D2IA 1U9IA 1G3UA 4ZI2A 2QAGA 2QMHA 2R62A 1UM8A 3DMNA 3C5CA 2IYYA 3MMPA 3HR8A 2IHBA 2ODBA 2Q3FA 4P4SA 3K9HA 1DO2A 2Q9CA 2PZFA 2FZLA 4PO1A 1HT1E 4PPQA 4EUNA 2HUPA 3HPQA 2PX3A 1NF3A 3TAUA 5JJLA 1FNMA 2CBZA 3U5ZB 4O3MA 2ZE7A 5IDVA 1F2UA 1OPXA 2RH5A 1GL9B 1PUIA 1KK1A 4TQAA 2YWEA 4W5WA 1U8YA 2ZI7A 5AR1A 1IOZA 4PTLA 3X1ZA 5EE9A 3AQ4A 4ARZA 4EPWA 1K5GA 4LJ7A 4FW9A 1Z3IX 2VO1A 5DGXA 1NBME 2ZRNA 2ZAOA 3QEOA 4OK5A 2ZI4A 3VNVA 1FP7A 2F55A 2NZJA 4HZUB 2FV8A 4I81A 3LAWA 1UDWA 1NKTA 2C99A 2DR3A 3AVQA 4JVNA 2D7CA 1N6IA 3X1WA 1G7TA 5EP3A 2ATXA 1NVVQ 2NO1A 3SBDA 1PZNA 4HB3A 3EXAA 1TQDA 4RSGA 1NY6A 5B57C 2GXSA 2QM8A 3DDCA 1ZIOA 1P9WA 3WBJA 1VIYA 2QSYA 4FMCF 5JRJA 1IXSB 4OI0A 3WYFA 3LX5A 1P2TA 2AHOA 2NPIA 4FN5A 4HDCA 2CL7X 4EFMA 1YR9A 4MYUA 3BGWA 1I4DD 2J9RA 5CM8B 2I1VB 1TTTA 2ZYWX 4I1UA 4RD1A 1XTKA 1DG3A 1GSIA 3NC1C 5F2EA 2YV5A 1CR1A 2CNWA 4DLYA 1VHLA 2OSBA 4HLQB 4IW3B 2RGDA 1DTSA 4R71A 4TL8A 2ZVQX 1KSGA 4Z51A 3X2SA 1AKEA 1W2HA 3QBTA 4P4SB 4E07A 1E2PA 6Q21A 1BH2A 2J1LA 4DCUA 4TL6A 2R44A 2CE7A 3F3YA 3QG1A 4DDTA 3BK7A 2QBYA 4PQYA 5SZJA 1P3JA 3QXXA 4Q4LA 3DZ8A 2GNOA 3OF5A 5FPSA 4A1FA 1MOZA 1EFTA 1GP2A 1ZD9A 4NPHA 5GADl 1IQPA 1F2UB 1T0HB 2NIPA 4P4UA 5JECA 5J40A 2O8DA 1FQJA 4JLKA 1LW7A 1Q1QA 3AF0A 2P2LA 4F7WA 2VRWA 4IDOA 2C8VA 5DO9A 3TQCA 2HV8A 4KODA 1G64A 3THYA 4JLNA 2OAP1 1YHNA 3KQHA 1T5LA 5J4LA 5EJEA 2NQ2C 1X8KA 3L8YA 4PR0A 4NE2A 5E7MA 1FUKA 1TQ6A 2JJ2D 1DBSA 2OT3B 2FPKA 4M1WA 2DPXA 2WJHA 4R7ZA 3VQTA 4UNPA 1SZPA 4O2LA 2AR7A 3FE2A 3SC3A 1NNEA 1T8TA 2JIZA 1XPRA 1DAGA 4JBYA 3WHLA 1ZBDA 3UMRA 1IN6A 4LV6A 2G6BA 5KPJA 4H1VA 3Q9LA 1AIPA 1NG9A 1NLFA 2H57A 4QXAA 2C98A 2ZYTX 2IYLD 3DOEA 1CJKC 4C3ZA 1GDDA 3IEUA 2W2TA 1T5IA 5FI1B 3EZ7A 4D26A 2JLVA 1MT0A 5IHPA 1S9DA 4E03A 1T9HA 5KHOC 2H18A 5GJBA 1AZTA 4PC7A 3EWSA 5M04A 1SVLA 2XJ9A 4CVNA 1HA3A 1T3LA 3KFXA 1CIPA 4TZ0A 5CIQA 2GZAA 2FH5B 5IRCD 2FEMA 1W2GA 3A4MA 4Q00A 1GFIA 1QRAA 2W83A 1E2GA 3VR2A 4RD3A 4NU0A 2QBYB 1ZM7A 4I1SA 4JBXA 5KSPA 4QM7A 4GZLA 1SXJC 2GCNA 4MQBA 1DG1G 4IEIA 4KFSA 1VPLA 3QJYA 5DISB 3UKDA 5CB8A 1XTQA 2WWHA 4FI3C 2O8DB 3T1VA 1CXZA 2MMCA 5FTJA 4QJ4A 1RVDA 1UJ2A 3VX3A 2AL7A 2Q9AA 3L0OA 5JJKA 1I2MA 1N6RA 1WDTA 2OILA 3THYB 3H0KA 4TQUS 4UQOA 3EIEA 3DHWC 1E2LA 3BFKA 3ECCA 3BWDD 3DL0A 4URWR 3SEAA 4QM6A 3SQWA 3QUSA 2MSDB 1OH5A 2HF8A 1CKEA 3NBFA 1G3RA 3MWKA 4CDGA 2QAJA 3MSXA 1AM4D 3EASA 4V0ME 1M74A 5P21A 4GNKA 2VF7A 2EVWX 2ZQ5A 4L16A 3H84A 3M1IA 1RE0A 2OCBA 4TYNA 4HATA 1KY2A 5CYOA 1L2TA 3ICQB 1OFIA 1QHXA 3EZ9A 2AD1A 1G4UR 4DDWA 4X8HA 4JYBA 1E2JA 2QPOA 2CK3D 2PEZA 5JRZA 1CBUA 3B1ZA 1TF5A 2P0EA 4DSNA 1T4GA 2CHVA 2JJ1A 1P75A 3HU1A 4G5GA 4IRUB 1P62B 2AKYA 5KDOA 3CX7A 3U6KA 3CBQA 2C78A 1S96A 1Z0AA 4Q1AA 4FMBB 2HXYA 1S3SA 3BH6A 4LV8B 4ASUD 2AK3A 3ADCA 1OKKA 4K8OA 1QHHA 3AVOA 3GCGA 2KBEA 5L3QB 3PCRB 5EQTA 4Q9HA 3I32A 1PUJA 4BFVA 3ZQJA 4A0GA 1H65A 4ZO4A 1Z6GA 1ZP6A 2QMUA 4RD4A 1X1SA 1GTVA 2F3RA 1JEEA 2C95A 3IGFA 4Z1MD 4KVAA 4US1R 1N5KA 4E5UA 1C1YA 5FPHA 1KI2A 3FFBA 2LWIA 4HDQB 1U98A 2J7PA 3VR6A 2O0HA 2QQEA 5FR2A 4DB2A 4MDEA 5EXPA 1XMIA 5KPDA 1JAHA 3I1FA 3QEJA 4PHFA 3UWKA 1A7JA 4KBGA 1KAOA 5CDFA 4LHYA 1KI6A 4AI6A 4NTZA 4XTCS 4OHZA 2ECKA 3CF6R 1QHSA 2GKSA 4Q4JA 1E9EA 1E94E 2VP6A 2ZIAA 2C77A 2G3YA 4LPSA 3CPJB 2WKRA 2IX3A 3K09C 1GNRA 3KB2A 1UADA 2HCJB 4IFEA 2H16A 3GEEA 1YZTA 3A37A 3OAAD 4V03A 5GVSA 3R9XA 1E96A 1CU1A 3B2EA 1BMFA 1A2KC 2N42A 2VHQA 4B35A 2ZJZA 1SGWA 2G0TA 3FWYA 4AD8A 1KYIA 4AG6A 2EFEB 2ZRIA 3FHCB 3M4YA 1R0ZA 4LPKA 4TQ9A 2A5JA 4HAZA 5HZHA 2XNDA 4Q9KA 1BOFA 2AX4A 3FMIA 1W36B 3K0FA 1HURA 2V6IA 2C96A 5A5GA 3Q8XB 4NYIR 4PSVA 5FI0B 1R8SA 2V4ZA 3PITA 1U9IC 4X8MA 4B3DA 1OFHA 1G5PA 1MV5A 3REGA 4DHEA 4DLXA 4C0JA 4TLBA 3I73A 1LS1A 1GL6A 1T3HA 5GJVC 5KNBA 5LB4A 2ZITA 1NN5A 4JLJA 3PXGA 2ZRBA 4M1TA 3LVQE 1XU4A 4BGDA 4ZDWA 4LHXA 1Z0JA 1TQ2A 3CWZA 2IWHA 1CTQA 3EA0A 2HJVA 4TTPA 1B23P 3BFVA 4RD0A 1XEWX 1YJ5A 1FPMA 2ZREA 4TMKA 2WOJA 1FX0A 1MRNA 2ZJBA 1W0JD 2YZ2A 2IS1A 3GFOA 1XTJA 2RHMA 5CK5A 2GF0A 3DPUA 3D8BA 4A8JB 2CLSA 2XZLA 1KI6B 1SHKA 4A2PA 5TVKA 4LV5B 2ZU0C 4MRPA 4NYJR 1E2QA 1E9RA 2IYZA 4I99A 4F4JA 3T1TA 4Q4JB 3MGCA 4UJ5A 1TX4B 1XEXA 1IXRC 3FGNA 1JQLB 3T35A 4ERNA 3AP2A 2O52A 2QTFA 4LRWA 1VCMA 3ADKA 5UKDA 1EESA 1EXMA 3ZD6A 5L8VA 1ZIPA 1AN0A 2BJWA 3RRNA 1X8LA 1DAIA 1W1WA 4QNMA 3UMSA 1XMJA 2NG1A 1G6HA 4TMZA 3OFNA 4TLAA 1JQJC 4MGIR 1KK3A 1DARA 1D2MA 3E1SA 3K0FB 3LBHA 1XCMA 3MRSA 2R6FA 5TDHA 1KDRA 3GJ5A 2HT1A 2WTUA 5FOSA 3GLGA 3A36A 4Q4HA 4B76A 3IO5A 2DFNA 2HYIC 2PZGA 4EPVA 4AY2A 1YZUA 2QM7A 4PHHA 3TR0A 2F9MA 2XOKD 3AP1A 3QOFA 1D8TA 3QY0A 4PZZA 1DELA 4JLAA 5GJWC 4TLEA 4JYCA 2I4IA 2EFCB 1P2SA 1E6CA 2Q0HA 1NN0A 4BUJA 3VR3A 2K5UA 4B6EA 1A82A 4UNQA 4A36A 1FX0B 3WNDA 1S9HA 4DVGA 2OBMA 4NCKA 4ON9A 4KLZA 3PUVA 4GMXA 1AJEA 3QI2A 1E99A 1FUUA 4OJQA 4IDHA 8OHMA 2WICA 5AJZA 4IXNA 5SZKB 3VKGA 3N70A 1JR3E 4BEBA 2VTKA 1E4VA 2CLDX 1JALA 1VG8A 3E70C 3GEIA 4LC1A 1XEXB 3DKVA 4CYMA 1W44A 1NBMA 1EWQA 1TMKA 4C0KA 1AK2A 3B5JA 3GJ3A 4ILEA 4KU4A 3B1XA 4DT1A 2WJJA 1XTRA 5IK2A 1OIWA 1VMAA 3BFXA 1R5NA 3U3OA 4PZLA 1XNJA 4Q1BA 2A9KA 2AK2A 2GEVA 3ONWA 1QF9A 4G0NA 2QI9C 4NYIQ 1RRPA 3GJ4A 4PAOA 4WXPA 5TMPA 3W34A 2ATVA 3K1JA 4ZDKA 2VF8A 1GKUB 4ZDJA 4G3XA 3RVBA 1UPTA 2A5FA 3K0EA 4V0NA 4WXRA 2D62A 4KHZA 4YDHB 4LBYA 4D80A 3HP1A 3H86A 4BQSA 2DB3A 4YXWD 2HLDA 2GXAA 2J41A 4Q1FA 2R2AA 2QE7A 1XCPA 3C7KA 1JI0A 1ANKA 1GRQA 3PVSA 1RW4A 2YOFA 5BQ5A 2UVQA 4Q7JB 1KIMA 2ZJOA 5KSYA 3HU3A 5C1BA 1OHHD 4CRWB 4DCTA 4MKHA 3GLFE 5K8TA 1X86B 2V1UA 2NTYC 4ZCLA 5G53C 4C0HA 3ZH9B 3KKNA 2WJVA 1LY1A 4MA4A 1XMVA 721PA 2F6RA 5JLJA 3SR0A 3U3JA 4M0LA 3U6BA 4LJ6A 4CT4B 2GJAA 5A4JA 2OO7A 4M21A 4OHVA 4JLBA 2W6IA 5DN6A 5JSZB 2AD5A 3R9WA 4YMUA 1FOEB 4OK6A 3H2YA 5HE8A 3KB1A 2O8BA 4GOKA 4NYJQ 2QNRA 5BWMA 1WBBA 4OI1A 4D4MA 5JI3E 3ADBA 5EP1A 4OHYA 4OI2A 3TSZA 2QTHA 3TJZA 3F8TA 2KWIA 1BKDR 1FMJA 1P61B 2RGEA 1YZLA 4UXIA 1D5CA 2Z0MA 5BN4A 1MR3F 1QG4A 1UKZA 4DRZA 2FN4A 3NHAA 1G20E 2OV2A 1K8RA 2O8EA 2HEIA 4DT1B 2ZVPX 2F43A 1DAEA 3FMFA 5FBLB 2XTZA 1QVAA 3B85A 3NDBB 1M7GA 2RB4A 3KDSE 4TMTA 3IPYA 4BLTA 1W0KA 1BYIA 2H92A 3CNOA 5FTLA 3ZIAD 1LF5A 2F1IA 4EJSB 2GJKA 5DNYB 4Q48A 2R65A 5J4KA 3ZVLA 2ZRKA 4MRNA 1XMSA 1G8PA 4P33A 4M1MA 1SULA 5FR1A 3T61A 1GWNA 4KFUA 3GEHA 2HJGA 1P9RA 4KJZA 1OE0A 3T1QA 4CEHB 1RRGA 1ZUIA 4S35A 1XF9A 2ZI5A 2OBNA 5FPTA 1IY0A 5HKKD 5GVRA 4DLUA 1TAGA 1KI9A 4C9BA 2ZE8A 1GNPA 5G40A 4BLPA 4Z54A 2WWWA 4G5OA 5DI9A 2QEQA 5EZ6B 3U2QA 3SBEA 4US0R 3GJ7A 5JWOA 4JL5A 1HH4A 1KO1A 3AF3A 3TIFA 1OH8A 3G0HA 1Q21A 5KSZA 1XXHE 3RRYA 1NVUQ 2PJZA 4HB2A 4BFSA 4URVR 4JT2A 1ZM9A 2O8BB 4A8JC 4GBMA 1VECA 1Z22A 2E1RA 4RCZA 2WMNB 4LK2A 4YMSA 2Q6TA 1XPOA 1YRBA 2ZPTX 4OHWA 5FPYA 1KAGA 2RAPA 3U60B 3CO5A 4B47A 4TZ6A 4OBEA 3K9GA 2ZI6A 1JEDA 4PSAA 2O8EB 1XCGB 2AXNA 2F43B 2G77B 3RS4A 1GILA 1RJ9A 3M0EA 2FEOA 1DEKA 4V0MA 1NLZA 4JIMA 2G9NA 1KMHA 1XZPA 2J7KA 4M8NE 1EK0A 3K09A 2FPLA 3L0SA 5J5CA 4XWKA 2CCKA 3VR4A 1U81A 1GKYA 1AS0A 4LJ9A 4NL4H 5C18A 2WIAA 1KTVA 2CXXA 3D6TB 2J3EA 5ANRB 3TK1A 3KQNA 2OHFA 4WZAE 2J45A 2G1JA 3GPLA 1NY5A 4B43A 3DM9B 1A4RA 2B7BA 1T0JB 4GZMA 3U7EB 3Q5DA 1VYVA 4YONB 5K8LA 2EQBA 4JSTA 3LBNA 4PXAA 4B3FX 1VG9B 1ODFA 3DO6A 4C2TA 3AVYA 4F93B 3SFZA 5TY0A 4P4TA 4BFWA 3SZRA 3UPUA 4TN1A 1YRAA 2VP0A 1V43A 1ESMA 5HCIA 3K0CC 4W7SA 2BV3A 3BB4A 5ELXA 2G88A 1N5LA 1DAMA 3V00A 3Q85A 4A2QA 4B6FA 1Q44A 2IF2A 1N5IA 2HDNB 1R6BX 4URXR 4II7A 2YNMA 3C5HA 4QBGB 3VR1A 4A6PA 4CT5A 2XNSA 4FD2A 2IK8A 1KI1A 2Q3HA 3HU2A 4DEYA 5FBVB 3GFTA 3ZS8A 5CITA 2R6AA 2DBYA 1DAFA 4Z8YA 2WBLC 4PPGA 5FFMA 4P31A 2QU8A 3C15C 2WM9B 2WWXA 5JMTA 4V0LA 1OJLA 3VMFA 2WMOB 1DAKA 1MO3A 1RJ9B 2EYUA 2QUZA 3O8CA 3IIKA 1M6NA 1KMHB 4NH0A 4LYHA 1N0UA 1KSHA 4BFTA 5F9FA 1R0WA 2FWRA 5DYGA 3B60A 4B2PA 1G8FA 2GCPA 4IJMA 4B34A 2FSHA 1TNDA 2IL1A 3GJ8A 4B71A 2O0KA 3TR5A 5AUOB 4EQ6A 2B7CA 1UKYA 4HZIA 2QG6A 5L3VA 3TSWA 1NG1A 3U3MA 2FSIA 3NIBA 1E79D 4B3CA 1QHIA 2YKGA 3QKSA 3I5XA 1GRNA 3OEED 3N5CA 4PC6A 1EFRD 2D2EA 4TSFD 3RABA 3RS3A 2FJUA 2PZEA 3AVWA 4D4KA 4RVCA 1LS6A 2A78A 2WSSD 2XSZD 1NN1A 1EFUA 1E2DA 4URYR 2Y8EA 3AP3A 1R10A 3GP8A 1W4AA 2CEAA 4A82A 2X1VA 1AS2A 3AV0B 3P4XA 2JGNA 4AKHA 2QRNA 5LDDC 1SXJD 4EAQA 4Q7MB 4LC0A 1S1CA 3DMDA 1Z6YA 2ZR9A 4M4SA 4C0BA 3RDPA 2AFIE 2IYRA 4R2IA 3W90A 3EPJA 4WOPA 4IVQA 1U8ZA 2QMEA 4UXJA 3I72A 3QPWA 2HF9A 2ZRAA 3WNCA 4AYTA 1P4SA 2H17A 3FKSA 4KAXA 4NYMR 3K9LA 4AYXA 3B1YA 3QPUA 4FMDF 3BD9A 3W8NA 1HT2E 2KSQA 1LVGA 4M9SA 1JBKA 3SS8A 4XJXA 4C2UA 3JZAA 1KI3A 4XH9B 3NKVA 1E1RD 3RRZA 2OFOA 4B33A 1S8FA 2X19A 4PO9A 3BERA 3ZLJA 3AVPA 1GM5A 2WPDD 5LB2A 2O0JA 4HAVA 1E2FA 2V54A 3KKQA 2WIBA 3WMFA 1MO6A 3D7MA 4TMWA 821PA 2W6JA 4Q1DA 3TSOA 3MLEA 1X1RA 2GJ9A 3SU8A 1QHYA 3TGPA 1IY1A 4L5BA 3SJAA 1QBKC 2EFGA 5DHAA 3OE7A 3SFVA 2Z4RA 3TW8B 2P3SA 4EQ6B 3CLVA 5BXQC 1JXOA 3KKPA 3QVVA 4EJSC 1G6OA 1HY3A 4PSKA 4BZPA 3F0TA 5JS7A 4MUBA 1PLJA 3QKSB 3SE0A 3QE0A 3MAAC 1P73A 3HYTA 4Q1EA 4EDHA 3ZGXA 4FINA 3BAFA 3P26A 2CE2X 4HDOB 1G7CA 4Q21A 4M1OA 1G18A 5CB6A 1YZGA 2GCOA 2OE2A 4DZZA 4XD7D 4FCVA 4HAWA 1D6JA 121PA 4W5JA 4DWJA 3ZD7A 1N6HA 4G01B 3EPKA 4YQFA 3AF2A 1YQTA 4K46A 4DUGD 5DE3A 5G3YA 4IEEA 1A5TA 1ZMXA 1KNQA 4TYYA 3IBYA 2DYKA 2FPMA 5L3QA 3R9IA 2VPPA 1E9FA 1R0XA 3K8YA 3NHBA 4DCNA 5FL7A 5H70A 5DHFA 4B3GA 2ZRGA 3SYKA 2WKPA 1XEWY 1SHZA 2ZYVX 3K70B 3QSYA 5FTKA 3SJCA 2JDIA 2XJ4A 3DVLA 3T06B 4TTQA 1M7BA 4A4DA 3FHTA 5J47A 1TU3A 2REOA 4XWOA 1KJWA 3LH5A 1CLUA 3W3AA 3B9PA 1G41A 3KX2A 1J8YF 3RHFA 1F6BA 4LBVA 4B3BA 1KDPA 2GDJA 3PQCA 1OYWA 1ZC3A 2ZJAA 1HQYE 3GLHA 1XJ0A 2JLXA 2RGCA 4DIEA 1E3MA 2N46A 1VYUA 2YYZA 5AJWA 4BFXA 1JR3A 1DAHA 4IHQA 1WF3A 3I3SR 3PUZA 2FZ4A 3QXJA 1UAAA 2YINC 4QC2A 4QL3A 2J0QA 2E87A 2ZSFA 3CH5A 3DZDA 4Q66C 4TMXA 4NZYA 2A30A 2D7DA 3BS4A 4IVPA 4ZKEA 2N1BA 4LHVA 2UKDA 2F9LA 2XEXA 1SVWA 1UDXA 1XFAA 3LQRA 5EXXA 2EYQA 4B2LA 1RC8A 2QL6A 3BH7A 3LNCA 4ZDIA 1Z06A 4KLNA 4OQLA 1GOTA 5DSZA 2ANCA 5KDLA 1XD2A 3L0PA 4DCSA 2IUTA 4MYHA 5J4YA 3LVRE 5HPYB 4EPYA 1ZJ6A 4A0RA 1SKYB 2P6UA 5JZVA 1Q57A 3OIUA 2CHGA 2GCOB 5D3QA 2AN9A 1JAIA 1G21E 4N0EA 5CK4A 1FMLA 4PC1A 5G41A 3NDPA 3UIEA 2ASEA 1KJZA 4ZCMA 5C2JB 3RS7A 1R8QA 1W4BA 2GEUA 4D0LB 1NSTA 2QQ0A 5L3SA 3MWLA 1LV7A 4NYMQ 2ZM5A 1FTSA 2IW3A 1NSFA 3SN6A 3GLFA 4Q19A 1E1QA 3RNLA 3CX6A 4IDNA 4WIAA 2WHXA 1XEFA 3C8UA 3QKUA 4DKXA 4CGZA 1PLLA 4BRWA 1J8MF 2GXUA 1OIVA 4G5QA 2P65A 2OESA 2WOOA 1KKLA 1KKMA 3GLHB 4WBSA 2ZRMA 1N6OA 5EP4A 1M2OB 1CJTC 2CDNA 4KV9A 2GRJA 2ZSAA 4A8JA 2RHDA 1Z63A 2ZE6A 2MSCB 4UJ3A 1Z2AA 3OIYA 3RANA 4GP7A 3X1XA 1ZAKA 2ZS8A 2VIIA 3KZ1E 2ZUDA 3EWAA 1J2JA 1KO8A 4KYIB 1TL7C 1DE0A 1Z08A 1Q12A 4NONA 2V7QA 4MRVA 1I4LD 3NBZC 3WNBA 2DWQA 3JVUA 2IS2A 4ESVA 5HCNA 3LA6A 4CZ2A 4FIDA 1TU4A 1G7SA 4TT3A 2CNWD 2JA1A 4B48A 1XD2B 3UATA 4JBWA 3Q7QA 1COWA 4ITRC 3I61A 4POAA 3LRPA 1DADA 1TUIA 5FOXA 3TNFA 2QROA 1ZM3A 2J87A 1XBTA 4R98A 1W4CA 2VHJA 1X8JA 5CJ2A 2OLJA 3OEHA 4RZXA 3W6PA 5KO2A 1E4YA 3QPVA 4LX0A 2GK6A 1FTNA 2A7QA 1R5OA 3LLUA 4NP6A 4R2HA 3FYHA 4BASA 1OXTA 5FPKA 5SZIA 5L3SB 1ZU5A 1DPFA 5EE3A 5KNDA 1XJQA 1TADA 1L4YA 3ZZTA 2ZJ5A 3R8CA 2O8FA 4M9ZA 1ZRHA 4O25A 3GLFB 2ZRCA 3ICEA 1BYUA 2IYQA 3CKLA 3KFVA 2BBSA 4LJ8A 3WHKA 4RKEA 4JL8A 1U0JA 4F92B 5KSOA 3BIFA 5BYJA 1XTSA 2B8WA 2FSGA 1CR4A 2XZPA 1YU9A 4M9QA 2OLKA 3K0CA 1E9BA 1S3GA 1E32A 1XXHA 2C03A 4H9GA 4KVGA 5JWHA 2G83A 1H8EA 2D06A 1N6PA 4Q9JA 1JB1A 2GILA 2EW1A 2FF7A 3E5HA 4RKFA 1VTKA 2JIZD 5C46F 1OSNA 2JAQA 2BBTA 3ZDQA 3A1VA 2W00A 2PX0A 4OJKA 2BCJQ 4V0OA 3NEYA 4TL9A 4AC9A 1D9XA 621PA 2KBFA 3RAPR 5AUQA 221PA 4V0KA 2QGZA 3FMPB 3QNUA 4PX9A 3ETLA 1ZNXA 2WJGA 4Q9IA 2H7VA 2FNAA 2ZTSA 3LD9A 4Q4AA 2IYWA 4LJ4A 1IBRA 3A6PC 1JECA 1P60A 4BLSA 1N0VC 1ZNZA 4M53A 4DJTA 2QA5A 3RC3A 3PEWA 2IT1A 4HLCA 3RRMA 2W2XA 5JEEA 1AA9A 4GOXA 3UWOA 4G1UC 2Z43A 4KSCA 1SKYE 2QPAA 1U0HC 1GVNB 1OIXA 4MGKR 3BB1A 1EWRA 2YHSA 3A1WA 4QHSA 1EFHA 1SKQA 2PLFA 4J0QA 2FMXA 4JVLA 4OHXA 2BEJA 4Q1CA 3MJRA 4YLGA 1H8HA 3LFUA 1W4RA 2A5DA 2OUKA 2KE5A 3PUXA 4IFBA 5EZ5A 3EPHA 1TEXA 1NMZA 4LI0A 5EUQB 3K53A 2O8FB 1RRFA 5K8UA 2ZS9A 3GJ6A 4XOIA 2GWHA 1CS4C 3AVXA 1J70A 3W3ZB 3EZFA 3ND9A 3BXZA 4E09A 4A15A 5DYIA 3K70C 3CPHA 3QXCA 5EUMA 2ZI3A 2SHKA 1F2TA 4JLVA 1Q1BA 5AK0A 2E9SA 3A8TA 2D2FA 1XXHB 3KXLA 1E69A 1VIAA 4W5HA 2QMOA 4OKSA 1DS6A 1LNZA 1UBEA 2FFAA 2KJQA 5JSZA 3GLHE 1VYTA 1Z6AA 1ZINA 4PQRA 4DB4A 3WMEA 4Q03A 1N3BA 2IEZA 2Z6VA 1G3QA 3UK6A 3K0AB 4DSOA 1PJRA 2JJ1D 1WP9A 3HPRA 3AKYA 3IDQA 3MUFA 4MITA 4QHYA 1G3IA 1P2VA 5DI3A 2ZETA 4KSBA 4D4JA 4CEIB 4Q4AB 1F48A 1SVOA 2DFKB 4JZKA 2XZOA 3CB4A 2FDCA 1ZD1A 2IYVA 1XP8A 3UG7A 5JEDA 2BKEA 1UKVY 1WXQA 4FWIB 2JASA 4RY2A 2FFBA 2BMJA 1E2IA 1I4TD 4RZ2A 2AFHE 5FUWA 2C04A 1OKKD 3ND8A 2GBLC 2V55B 3G5UA 2WV9A 1EX7A 4EJSA 3UMFA 1XTIA 3IQWA 3QIAA 1QDEA 1UBCA 5AJVB 3RS5A 2KB0A 4OQMA 3SYLA 1KSFX 2VLIA 2IC5A 2XB4A 4H1UA 4PO8A 1U94A 1EG7A 2V6JA 2J0SA 4FWTA 3JZMA 2JLQA 4PC2A 1O87A 1OLOA 2UZIR 2IXFA 1U0LA 3OESA 1GL7A 2J7PD 4B74A 4CEHA 1AGRA 3G82C 3W5IA 1SVMA 5C4GB 1N2CE 4FMCB 3CONA 2R6CA 1FNNA 4F38A 3BH0A 4MRSA 1N5JA 1KDTA 1W46A 2OBLA 1F2TB 3UXMA 4BECA 3IUYA 2IBMA 3DEFA 3P20A 4PFSA 2NO6A 2IYUA 3CZQA 1HE8B 4IKEA 3EX7C 1G5TA 4O0MA 4V02A 1OYYA 4PPFA 2PEYA 1NP6A 1IM2A 1F3OA 2VSFA 1RYHA 1KY3A 2BMFA 5F98A 2NO7A 2QN6A 4MGZR 2RGNA 2NO0A 1IXZA 1R7RA 2IF0A 3EARA 3TW4A 1G1MA 1RPZA 4TT3D 3NH9A 4JL6A 2F3TA 1BMFD 1UEJA 1RYFA 4QRHA 1Y63A 3GLIA 2ERYA 2YC4C 2WAYA 3LW7A 4GP6A 5DI3B 3IKJA 1Q22A 1OXUA 3QF7A 2XNDD 3F5FA 2TMKA 1N6LA 2R8RA 2PL3A 4Q18A 4D81A 2KI5A 4NMMA 2XB2A 3QG5A 2GEDA 3WRXC 3B78A 1OH6A 4P3YA 4RFVA 1BO6A 2Q3MA 4QBHA 1DOAA 2QP3A 1JPNA 4LGMA 3KKMA 1OB2A 1W47A 2FFQA 3H4MA 3WP1B 3OIVA 3WYAA 1W36C 3CNLA 2VBCA 2FGKA 4G5RA 1IONA 3LXXA 4D82A 2A5GA 4NCJA 3GMTA 4ZPXA 2W0SA 1E0AA 2OZEA 1G17A 3A4LA 4MDFA 1CULC 2FU5C 2VQSA 4JMPA 3AF1A 1W5TA 1ZUHA 4QBIA 1MABB 5FL3A 1AGPA 2QRZA 1OW3B 3H1TA 3NG1A 3TKLA 1J99A 4LYJA 4QOSA 3T12A 1DO0A 1QHGA 2QT0A 4HAXA 4NCIA 4D0NA 2GTPA 4JKYA 1N6KA 1U90A 4L4UA 2GAOA 2JJ2A 5FUVA 1NKSA 1KZ7B 4DC9A 1GRRA 2BVNA 3TVTA 4LDJA 4EKDA 4MUAA 1ESNA 3FPAA 3L0IB 2NGRA 3MD0A 1OT3A 3A4NA 5DH9A 2ZSBA 3ASYA 3WP0A 4EPTA 2XTMA 2PLRA 3UANA 3AKEA 3PEUA 4MGYR 3ZVRA 3PG5A 3TLXA 2JJ8A 4PZYA 5LPNA 1WE2A 1VDZA 2ODEA 2RGBA 1Q3HA 4HUTA 3OFND 4U00A 3GLIB 4CEJA 1VG0B 3QF4A 3RC8A 5JCZA 1CRPA 3TUIC 4TL7A 3SYNA 4B73A 3IHWA 3QKTA 1E9CA 4ZKDA 3AM1A 2L0XA 2FA9A 4CW7A 5JHHB 4LCBA 3THXB 2X2FA 3KXIA 1J7KA 2ZJ2A 4AURA 2BWJA 2I3BA 2OXRA 3CX8A 3U7GA 4BPBA 2IXGA 4M1YA 3TRFA 2C9OA 3LQQA 4BZQA 3O8DA 5FOUA 1GAJA 2GVZC 4DEXA 3CH4B 1S0UA 3CRRA 2R6DA 4Q47A 4NKRA 3AH8A 5FUXA 5IT5A 2XGJA 5BN5A 5JS8A 3V4RA 1KNXA 1Z28A 3QENA 5E7JA 2HYDA 2J0UB 3FVQA 2D74A 4DLTA 4ZCIA 1G8HA 2WZQA 4EPRA 2PBRA 2ZSEA 3GFPA 3BB3A 2BMDA 3W6OA 1AZSC 1J90A 2RCNA 4JSYA 2GZHA 2ONKA 1G9XA 3KJGA 3B1WA 1V5WA 5LBIA 2DY1A 5D3MB 1D9ZA 3WRYC 4DLZA 4N0DA 1NBMD 2F1RA 5JJIA 2ZRLA 3AEZA 1Q3TA 4DLWA 5E3HA 3IHLA 1L7VC 4Q01A 2CK3A 3FMOB 5B2ZA 5IK2D 2LKCA 3P4YA 1KOFA 4CEJB 2C9YA 4A0FA 1YKSA 1ZM2A 3QF4B 1RIFA 5DIFA 4MH0R 4PHTA 1E98A 1NIJA 4GMDA 3P1JA 3B1VA 2CVHA 1VCNA 1TEVA 2ZRHA 1W5SA 3MWJA 4MKIA 4WZBE 4F4IA 2DWOA 4ASUA 4QGFA 3CWQA 1R4AA 4JKIA 2ORWA 4BEJA 4IOKA 2G0NA 5H1YA 1JJ7A 2CJWA 3HR7A 3NXSA 4BLRA 1N6NA 2OEPA 2HLDD 2IYSA 4A92A 2QE7D 2D3WA 3CF0A 3N2IA 3C4JA 4PQFA 4QGGA 4Z1MA 4RCYA 2WWFA 2BEKA 1YR7A 1EFCA 3Q72A 3T5GA 4DDUA 3FFAA 2IUUA 3KXKA 3ZZUA 5E95A 2WJIA 3FOZA 3DOFA 4HB0A 4IXMA 2HT6A 3EG5A 3P32A 3O8BA 1Q1EA 4JJZA 4BFUA 4TWZA 4QNRA 1KO4A 4C4PA 4AKIA 2GF9A 2YC2C 2B8TA 3HWSA 1SVKA 4HAYA 2RGXA 2DWPA 3NEJA 5JI2E 2IXEA 3U61B 2G1KA 2W6ID 1WBDA 5DN6D 2WAXA 1ZC4A 2WSMA 1JNYA 3IO3A 5DLQC 5FOTA 1ZD8A 3SI7A 4I4LA 4YMTA 2FGJA 1P5ZB 3PEYA 4TLDA 1ZCBA 2P5TB 4QFMA 2DFLA 2F1JA 3M6AA 4YC7A 2CL0X 4DIDA 4LOAA 4UNRA 1L8QA 2RGGA 2REBA 1KO7A 1ZW6A 4GDFA 3SHFA 2FSFA 3AKCA 3OAAA 3ZQ6A 4LYFA 1S2MA 4Q5IA 4C0QC 1NMXA 3V4FA 3AGPA 4MYTA 2GHIA 4MRRA 2QAGB 1XJCA 2HXSA
chains in the Genus database with same CATH superfamily
2PMDA 3PFBA 3P9RA 5LBTA 1OXXK 1J0EA 4QU0A 4E1BA 3D5QA 3L8ZA 3L7BA 3PTAA 4QGAA 4KVFA 1IJFA 2HQ1A 5E38A 2BL4A 1RJGA 3W79A 2HSJA 3PIDA 1W49A 1AF4A 1CD5A 3QOWA 2QP9X 3V8NA 4W5NA 2WVGA 1GIAA 1CUGA 1CJUC 3S68A 1GGFA 3K6SB 1C0KA 2CL5A 3BG5A 3WWEA 5CM2Z 4M55A 3RIHA 3LQKA 1Q0PA 1FTWA 2H1LA 1L6IA 4GPTA 4OXRA 2HLNA 5CNMA 4HT3B 1T8SA 2CVFA 5BW5A 4ZOLB 2HU8A 5AW2A 2EFHB 5FA5A 3W6NA 1JXMA 3BQMB 3V4ZA 3H5NA 4US2R 1ZM4A 3N28A 3Q3EA 3W9BA 1EIZA 1X87A 3NFYA 4UXHA 5F12A 3ZGYA 3KUDA 4GKJB 1DKRA 5DLDA 3SS9X 1I3KA 2D0IA 2DWCA 2FX5A 3B8EA 4ZQBA 2JEOA 3C14C 3S8YA 3EUWA 4TRNA 1CJMA 1B0PA 1JFRA 3CHYA 1U7XA 3BBPA 3PV0A 2GBLA 2ISQA 4E12A 1UANA 4H60A 5EKSA 4DLRA 3D1JA 2Q21A 3KC2A 3DDHA 4OVKA 3B9RA 1PVOA 1Z5WA 3AUYA 1O6ZA 2GZDA 3CLKA 5AKZA 5ALMA 5A6VA 3N2EA 5A9SB 3LDAA 4DF3A 3O8OB 3OHMA 1BA2A 4WACA 1A5ZA 1D2EA 4MR8A 4ZVMA 1YRHA 4YUYA 4G0ZA 3FRHA 1E0JA 1HYGA 4W6ZA 2W58A 2P5SA 3FOAA 1ZH8A 3Q8WA 4L6AA 2C3YA 2Z6AA 1TPZA 3AZQA 2HWKA 3I09A 4HTFA 1K0FA 1E59A 1L8XA 3HGTA 3M5WA 3EEOA 4EJ0A 4X60A 5GY7A 5H8WA 3RYFB 1JEJA 4K2AA 2DQYA 4JEHA 4KJXA 3BDIA 5F5XA 1U7TA 3SJBA 1WW8A 2OG2A 2XQIA 2YOHA 1EUCB 1UEIA 1NRJB 1TK9A 2V1XA 1TZBA 1Z7GA 3L82B 4QG7A 2BHRA 5AXAA 3AX6A 1HTTA 1WRBA 4MR7B 1BEEA 3HYLA 1SELA 1MRZA 5HDBB 3TJRA 4PAQA 3VPDA 5JY1A 3FIJA 1ORTA 4XEHA 3TMAA 2DLCX 2Q1WA 4QASA 1X77A 3Q3GE 2CHQA 3C3EA 4R41A 3T7RA 3WR5A 1DBPA 1IHDA 1R0RE 1IJEA 3RUAA 3ZWNA 4S24A 5IWAB 1SN7A 2IEIA 1FXWA 4AK9A 4LWPA 3A6FA 5SY4A 4BNYA 3FDIA 2ZE5A 4N48A 2A58A 4JVMA 1PWXA 3FPKA 3KUCA 3O4VA 2EFYA 3Q9UA 4U0KA 5K0JA 1R5BA 2EBUA 1FNBA 1OWLA 3T3EA 1XQ1A 2A4KA 2G1AA 1QV7A 4N3NA 4CM3A 2PL5A 3GARA 5B4TA 4KSYA 1PN3A 4HQRA 2CL6X 4F4CA 1FA9A 4P34A 2D59A 2RGAA 4J07A 1KMQA 1TAQA 1FQOA 2EP5A 4TZKA 4AN0A 1Q17A 2BGWA 5FI3A 1CY6A 3DWGA 1R0YA 5AO9A 3UG6A 3GMIA 2Y2UA 4ZZ0A 4NBSA 2FEAA 4RIFA 1W9HA 3ZDZB 1YE5A 3Q7SA 4F72A 1HI9A 2OO5C 2NZ8A 2QSUA 4O1HA 1ZBQA 2YN0A 3OQIA 5K51A 4BNWA 4CFYA 3NOXA 1PZEA 3THWA 4GSYA 4RPIA 3T34A 4AF6A 2R8ZA 4MR8B 3SQXA 1B0UA 4GT1A 2A5YB 4EHNA 4CL8A 3W8RA 1QGAA 2H59A 2YRXA 2ET6A 1UPFA 3NP7A 2JFNA 1HDEA 3HJNA 4G4SP 3ABZA 3F8SA 1QG2A 5DYTA 4O2BF 4XTRA 3ZJYA 4BBJA 5F1PA 5JAPA 4AWAA 2IYTA 2SBTA 3BORA 2VK1A 4QJ3A 1A7AA 4ZOQI 4TS3A 4NARA 4RZQA 3A1TA 1AH2A 3R4VA 2GVDC 4AWXA 1JAXA 3GZJA 4OAPA 4P1ZA 1KEZA 3PIRA 4I1VA 4MW7A 4B45A 4LRUA 3TM5A 5F9HA 4S2UA 1EHIA 5AKKA 1MHPA 5FTNA 1P72A 5DM4A 4AKTA 4D8XA 1O1YA 1ZU4A 1TLLA 1WXIA 4RM2A 3ZW8A 4MPRA 5FJIA 2NSLA 3W8FA 4DXAA 1JPJA 1VKJA 2HQRA 4ZOBA 4MZDA 1WSAA 5FB3A 1Y9ZA 4IQ8A 1ZYUA 3IR7A 5JBQA 1OFTA 3CVVA 1WW3A 3X44A 4MUGA 4I3HA 4D57A 4FBGA 2W2MA 2J5QA 2B20A 3COZA 3MGAA 1RLOA 5JNUA 1H2EA 3KUXA 5F51A 4P2BA 1KGSA 5C5DA 5I47A 2RAUA 3ZWQA 4L15A 4R05A 4D25A 1NXQA 1E2BA 3LBAA 3WGGA 4B4OA 1HDIA 2ERXA 4V1CI 1YULA 1WULS 4E7PA 3OA0A 3NJ4A 3A3OA 3RVOA 4E09A 1NJ1A 5AM0A 3RIXA 2MYNA 3LLMA 4Q9NA 5KTSA 1AQUA 3EF0A 1K6XA 3GAFA 4CWAA 5CA1B 5A2QA 1OHHA 3SHVA 3F6PA 2C4WA 3LQ1A 3FSJX 3LC1O 2JC3A 2X0FA 2DGDA 4L9SA 2IXDA 5KNBH 1LLQA 2YMLA 1T5DX 4A26A 4LJ5A 4Q37A 1VA4A 3BFJA 4FW8A 3CBGA 3SHWA 2ODWA 3OQIB 2JLZA 1H9AA 4L8FA 4C4AA 2ZS7A 5CDSA 3THWB 1OY1A 2TYSB 2DAPA 2E3JA 4PAWA 2F9FA 1HFJA 4AZ0A 1GZSA 1NSYA 3NT2A 4O4LF 4Y2GA 2W37A 2QL7A 2WYIA 5BN1A 1JIVA 1V5IA 2B5VA 2EBWA 4IOJA 1PR3A 5CVDA 3T1OA 5LDHA 3KJHA 1I0ZA 5TARA 4UTXA 1NX6A 4DWVA 1EZ1A 4JASB 5LR6A 1E2UA 1Z0KA 4NDZA 4NHOA 3NAQA 4L6CA 2O2SA 2C5SA 2QNIA 3PNMA 4DJFC 3AHJA 4PS1A 1J42A 1I1OA 1ULSA 4MPJA 4TWRA 2YJTD 3M6UA 3KU4A 4TYPA 4ZT2A 5KVSA 1F2DA 4QYMA 2RHBA 2JD1A 4NZZA 1Q77A 4QEZA 2PCLA 5ITZA 5CPBA 1AF7A 5CA1A 3UV6A 4FB4A 3ZBTA 3AEYA 3HBAA 4GC5A 3UOGA 1I6KA 2PSHA 3OPYI 1JR2A 1W5FA 1ND6A 3I45A 3MTDA 4ND4A 3NC0C 3ORSA 4IZIA 1RWPA 3BPSA 3K1TA 1OT5A 1F8FA 3CLUD 4C7OA 2WMDA 3UXHA 2GSWA 4BGUA 1CRQA 2AF4C 2G82A 3EH2A 3G9ZA 4Y6GB 5FBQB 3RSOA 5HMLA 1G3MA 4EFKA 1NVXQ 3ACCA 4BCCA 2ZW9A 3K0AA 1F8GA 3SDZA 4B75A 1C3VA 2NYUA 3ZDAA 3TZ6A 3OWOA 1W1IA 4B17A 4BNHA 5HKKA 4CEIA 5E6SA 4XXHA 4ZVKA 2RGYA 3FHOA 1P1CA 1Z6PA 3O82A 4AMZA 1QR2A 5HZKA 5JBNA 4J76A 1I36A 1NF2A 5FF9A 3BA1A 3OCJA 4ZAWA 5IYZA 3OJFA 1P7CA 1OV4A 4C0AC 1LU9A 4NAVA 1FSZA 3CRMA 3NHWA 5I9MA 2QN7A 2OCPA 3KT8A 4S3MA 5DXFA 4G1CA 5HX7A 4W5OA 4IZOA 3LFTA 2OXCA 3M49A 2PIDA 3ITEA 3W9YA 4FFBA 4UHEA 4AP9A 3G7UA 3JYHA 1TEZA 2ZUFA 2YWFA 4MX8A 4EKNB 4KAJA 1X1EA 2ZB8A 3O3CA 5BSWA 4AJHA 4YRCA 2YX1A 2ZQYA 5C1PA 4BKOA 3RNOA 3OX3A 2AR0A 5E9AA 3AFIA 1LTHR 1FVHA 4BRSA 2UAGA 5LXTA 4QDUA 4L9WA 4A9AA 1ECBA 2ZLBA 1PJ2A 1JLRA 3FBGA 2ZXUA 4XIGS 3DMTA 2WJ3A 4MVJD 1AKQA 2VAXA 3AB3A 4BJ3A 4F3TA 3NP9A 1JR3D 1YR1A 5AVJA 1UXKA 1XVIA 2QRKA 3JD2A 3G0GA 4GD3Q 5DCUA 2IEDA 3I4LA 4KQXA 4M38A 4RKRA 3ETJA 3K1YA 4JEUA 1WU8A 1RWVA 3WVNA 1XPUA 5CH5A 2J0VA 2XMGA 3IDFA 3RLFA 2IA5A 4KQJA 4ILKA 2WYOA 4OK3A 1EP3B 2ANBA 4IVRA 1UM9B 4E5KA 5BR1A 1CY1A 2B34A 4KO8A 3FZYA 2HNKA 2BC9A 3H17A 2QZ4A 3H3JA 3I01M 2R9VA 4UC0A 5EE0A 3VR5A 4C7OB 5KYUA 3U44A 5EGNA 1FFYA 3VPFA 3OCCA 1S1MA 1UINA 3FRIA 4Q3OA 4N5IX 4B0OA 1K4MA 4PHGA 1YFZA 3EEQA 3HCBA 3IQGX 2J5RA 2FKAA 1QHFA 2D1RA 4S1PA 4B84A 3U3RA 4J1NA 4XFJA 5KAPA 1MGOA 4X92A 4WGFA 2C00A 3E9RA 1MB0A 4NZMA 4KNVA 3TD6A 1U0OC 1TKCA 4RD6A 4B32A 2V3VA 4KNWA 1JG7A 1E2EA 3L8MA 1UC4B 3MTIA 3O8RA 5IYZB 4CIBA 1T4BA 1S01A 2EP8A 4KXXA 4OMUA 2CMFA 1MUUA 5KNCA 2GETA 4TSKA 5FOVA 3NIGB 2P2DA 2JBWA 4WK4B 3B70A 3EQ9A 1IN4A 2JHPA 4HLUA 1TE2A 2FY8A 2OECA 4IIEA 4C5BA 1JFSA 4URZR 5TLSA 1DKLA 3KLBA 2XWSA 3ELDA 2R7LA 3I8SA 1R37A 2QMQA 3JTEA 1ACLA 1CNFA 4XVQA 5B55A 2GN4A 3UBMA 1RE1A 1K5DA 3AKDA 1DJNA 3DE3X 2O59A 2YMPA 4W7IA 3R7WA 3BHNA 2C4TA 1HNWB 1H2HA 3X43A 5CX1A 5CDTA 2B83A 3RG8A 1JG4A 5KB3A 1KAEA 1Y4ZA 3TOZA 2A1IA 4K6HA 1MABA 4CU5A 4OI4A 3FM9A 4RJLA 3SF0A 3VU9A 3WKEA 4MV4A 3KYIB 3MERA 2A9VA 4LZZA 2ZAIA 3I5AA 1B4DA 2CBGA 2ZRJA 2CKDA 2OUIA 4FEGA 1WCV1 4MDYA 2H8KA 4AKEA 3MWYW 3MRXA 2FPOA 3KCNA 3D31A 3PQ3A 4JI8B 3H5OA 4RVOA 4J0GA 2WU1A 3KQYA 5JSKA 3MOIA 2V7QD 3RFTA 5JBIA 2WWTA 2WU0A 1O8BA 2QN2A 3LM8A 4HH4A 2ALJA 3T4UA 5KREA 1TKBA 2ZZKA 3ET5A 1T2DA 1DZ3A 2AN4A 5CCEA 3HJCA 3LA8A 3NBQA 3FKQA 5KYUB 4DIBA 1X1TA 3U44B 2JAWA 3OEEA 2MSEB 1EFRA 1QFJA 2A1TS 3C41J 4ME6A 4IFTA 4YT5A 4FE4A 1NJFA 2FMUA 2H2HA 3O47A 1Y4DE 5FTMA 2G80A 1E9AA 3RJTA 4Y6PA 3AUXA 4DN6A 1JHYA 3NTXA 5DM70 3TN7A 4FMDB 2UUAB 3VRHA 3I6BA 3UEOA 4GFDA 4LHZA 4Q3EA 5HGXA 4LQCA 2I4MA 4NF2A 3TBHA 2DF8A 4OREX 3U7HB 1M1YA 3A6GA 3JVDA 4S1VA 5ED4A 3KSMA 3H9BA 3JWIA 4GECA 1TU0A 2PKRA 4XZ3A 4BP3A 5ADUS 2P0YA 1DKOA 3OEHD 4IDPA 5EYPA 3WG9A 3GOQA 5CDFE 1Z15A 1Y1SA 1EIWA 3RV3A 1BROA 3RK0A 3GFVA 3V32A 3E9DA 4QDZA 3VC7A 6GPBA 5JAIA 4IMJB 3B2QA 1N57A 5EIBD 2PAFA 9MHTA 3GHHA 1N75A 3SZLA 3ISJA 1M2FA 2DHQA 4FCWA 3IULA 1VG1A 3CEMA 3M9LA 1QQAA 5JFGA 1RC1A 1R0CA 1U8FO 3KQUA 2FPIB 4C0LA 3CTPA 3JTMA 5CFQA 2IHVA 2QRMA 3MPOA 4BQQA 2P2GA 3EY4A 3R7WB 3I83A 5I7FA 2BGUA 2KMLA 2WWGA 3F96A 1LB1B 2IEGA 3PQFA 5KC8A 1OB5A 1SQFA 1KMIY 3KOMA 4AROA 2WYVA 4UPVA 1CJVC 2I2DA 2PA0A 3L6RA 4TVOA 4JI4B 2FE4A 3LTNC 3BILA 5KYVA 5IDQA 3LX8A 2X9LA 3VU9B 4RF4A 2WQ6A 1DQSA 2G8NA 2UZ3A 4GIBA 4N0QA 5ALEA 8ABPA 1QIFA 1OFVA 4BGIA 5JARA 3RT9A 1KSJA 2XAAA 2AZ4A 2OGUA 4GLBA 1PFGA 2VWQA 3M2PA 3LNTA 4IV8A 4YRJA 4MWTA 4XSGA 3FH0A 3DAPA 3K15A 2UYYA 4J9UE 1RQGA 2RFLA 3WMGA 3F6SA 3VZCA 2TMDA 1F12A 3NOOA 5COQA 1PR9A 1F17A 2BUBA 4JI0B 3HZZA 3BMOA 1LI7A 3E7XA 2O7QA 5FBRB 3T5DA 5KQGA 3UVEA 3IPRA 3HA7A 1Q0QA 1SVIA 2B92A 4R1TA 3ODPA 4Y2QA 4UVIA 5CPFA 1IBLB 1BIFA 4RGYA 4B9EA 4EF6A 1UXHA 5ALYA 4CMAA 1SUCA 3ZXXA 4BUZA 4OMDA 3R74A 1OPRA 4ARBA 2J9ZB 5CHEA 1RRCA 4LOHA 3F6CA 4MV3A 3OJWA 3VR4H 4JJ4A 3SR4A 1SCDA 3N1UA 3KQKA 3ILHA 4FFWA 1CP3A 1M1YB 1GA6A 2WFZA 5I7HA 1NZJA 2XCLA 3AJEA 3RIEA 3E7DA 3KNZA 2FMFA 4GRAA 2HCBA 3F71A 4JX8A 3FKJA 3FYTA 2ZR7A 5EYPB 3JATA 4D5GA 1N32B 3B5IA 3OFKA 2ETXA 2GAJA 2PUGA 3OKPA 2QORA 4EABA 1SUFA 5GIOE 3B7GA 4X8LA 1ZVQA 1QCYA 1YCDA 1MH1A 3MMNA 3MM4A 3WL3A 5BOVA 2B1QA 3MB5A 3IXMA 3IEKA 1WQ1R 4DDVA 3V33A 2V7TA 3BD7A 1U28C 4WKBA 4W1PA 2QPTA 2RDMA 3FVRA 1R00A 1PYDA 3VC3A 1JLMA 2VF4X 4IFIA 4BWYA 1CUIA 4BV2A 5EJGA 3TAHA 4BX3A 3EPLA 2LCFA 4WINA 1U2RA 3OUTA 4MWOA 4TV9B 1I51A 1DC4A 1PZGA 1QAQA 3QVGA 4B5KA 2XAUA 3WLHA 1T8RA 4G1EB 3EBOA 4HDRB 1TFUA 1U1IA 5ARBA 5FBKA 1JTFA 4N8EA 1ZJ5A 4NFHA 1XD9A 1K7XB 2VYNA 4B7UA 3R7FA 4OQXA 3U7FB 3QE3A 2BGRA 4KDRA 1SQ0A 2GXQA 3CSDA 3PKJA 5ITSA 2HRQA 2OAQ1 2MMGA 2Q4TA 1B0ZA 4Q7LA 2NUTA 4X66B 1PBTA 4TXHA 3ETCA 4CMCA 2CCJA 2DFTA 2JPDA 3USES 3C3AA 1BWSA 3KOYA 1Z47A 3TE6A 3OPQA 4TVSA 2IE0A 1Z39A 3MIZA 1E58A 1VHWA 1RHUA 3TUJC 1ZXLA 3WYGA 4MI3A 4PC3A 1IHUA 4QUAA 4YDSA 4D2IA 1X2EA 2GASA 3N2KB 2PV0A 5KBYA 3WGHA 4EDFA 2ZIWB 4E2YA 1NBEA 4UEKA 3DBHA 5JS1A 4CQMA 4C07A 2IHBA 4P3KA 2ODBA 5EJ8A 1N2IA 2V5AA 2ZFUA 3K9HA 3HN2A 4GE3A 2Q9CA 1UBKS 3PLRA 2FZLA 1I3OA 4RSRA 4V2UA 4Z86A 2HUPA 2Y3IA 3N8IA 3HPQA 1F3LA 2VH1A 3QMMA 4Q3BA 1P2GA 5JJLA 3TAUA 1L5SA 2JKZA 1CZOA 3UHOA 2YN2A 1ZCFA 1ODCA 1QYRA 4HS4A 1C30A 5FX2A 2ZE7A 3DBOB 2HFKA 3ORFA 3OVMA 1PUIA 1KK1A 4YAEA 1UFOA 1TA0A 2OCDA 2YWEA 3NYIA 2A9PA 4QRIA 1ZIYA 4RGQA 4U2EA 4XGIA 2PWPA 2QRVA 5FULA 2X4GA 2B4TO 3UENA 3R24A 5AM1A 4ZCSA 2GCGA 5DGXA 4H17A 2EJTA 4LG1A 1JIJA 2QTLA 1YXMA 2BGJA 4Q3NA 2I87A 2M6KA 5E2IA 5F78A 2OTCA 4EL5A 4Y7CA 1UBLS 1UMCA 1FP7A 1WUTA 5FADA 5KVAA 1Y8CA 2G4LA 1UJCA 1QK4A 3CTMA 2DR3A 4JVNA 3EXG2 3QVGB 1C9YA 4K28A 5EP3A 5IAJA 4YRNA 5CB0A 2NLOA 1PZNA 4JP3A 4R0VA 4YPOA 1W2WB 3EXAA 4HB3A 1GNVA 1NVMB 1TCCA 5DEOA 3L79A 1R88A 4X6UA 3FNBA 2QM8A 1RVV1 4CM5A 1YS2X 1M5RA 4I4CA 1NWHA 4FMCF 4R8LA 4WK6A 1TK3A 1IXSB 4CFSA 1EUQA 3IVAA 3U26A 1XDSA 3H87A 1P2TA 4LZAA 5C31A 2AHOA 1H4SA 1TIKA 2CZCA 3QA9A 4I3GA 1YR9A 1SH7A 3D2BA 1E6WA 3AEKA 16PKA 2OV4A 1MIHA 1TPYA 2J9RA 4L7VA 2IU3A 2FWJA 3H13A 4RD1A 5HMMA 3K8ZA 4CIXA 2B0JA 2YV5A 2OGSA 3OZWA 4YWJA 2XEDA 2OSBA 5KAMA 1K3UB 4KIWA 3K72B 2VHYA 3IUJA 4G8DA 5BYBA 3FTPA 3DBHB 4CQMB 1XQ6A 5AM3A 4E07A 1FNSA 2P4QA 1BH2A 4DCUA 4O4JA 1Y6RA 5AYVA 2R44A 3R5JA 2E4YA 4HNQA 1Z38A 1B3RA 3BK7A 4PQYA 4W9NA 4HQ0A 4IGKA 4FPXA 1P3JA 3RTAA 2O23A 2Q6LA 1SCUA 3OF5A 2F8MA 3LDUA 2ZZMA 2EIXA 2PFKA 3UWDA 1C30B 5GADl 1IQPA 1B76A 1T0HB 5JECA 4P4UA 3DYBA 3LIIA 2B30A 5J40A 4HWGA 1N7HA 4JLKA 4KPYA 1Q1QA 1XMPA 1YIAA 5LWHA 4O1MA 4M89A 4OAOA 4BX2A 4KMOA 1MNQA 1G64A 4CUZA 5BUQA 5K4GA 1MV8A 3C39A 1QNFA 3H16A 5A3RA 1NUUA 2X40A 1HYEA 1OU0A 5DM2A 5B1DA 3L84A 2NTNA 4JC0A 4KR0A 3ZKWB 1Y7PA 4BLVA 1ID8A 2JJ2D 1NVEA 2OT3B 2HZBA 2BELA 2DPXA 3ILYA 5I4IA 1DPGA 1W88B 4IILA 3A7DA 4IDAA 1NNSA 4MROA 1ZUNA 2R2GA 4G89A 1NNEA 1TM5E 1JMYA 2VDOB 1XPRA 5D1HA 1LPSA 1XRMA 1ZBDA 3DL2A 3FDFA 3IMGA 3UMRA 1EFVA 1IN6A 3WTBA 2ERCA 4WRRA 3F98A 2GF2A 1Q1AA 1EWVA 1ZCJA 4FFPA 1IOLA 4H1VA 1IZ9A 4JKOA 4QXAA 4DR3B 4RJKA 4EYGA 3R9KA 3AEKB 2C29D 3UGJA 4P0QB 1M5UA 1PT7A 4OXQA 4Y9TA 5TSDA 2JAUA 3A9CA 2W6MA 1T5IA 4B85A 4EGJA 1MT0A 4ID3A 3W77A 2Y0PA 5EJ6A 3KZMA 5GJBA 1Q7EA 5DU2A 2B9VA 1AZTA 1XL0A 2HADA 3AWIA 3KV1A 3KWMA 3NZEA 1GEGA 3OEWA 3WV5A 2H7XA 2XY4A 4I55A 3UJ6A 1Z4MA 4CVNA 3COJA 4TZ0A 5CIQA 2FH5B 3W2GA 5AW0A 3P2YA 5DT2A 1BTOA 5FBZA 3ADPA 1OVMA 2FZVA 4BXOA 3WA6A 2GARA 1EFPB 2W83A 4TM8A 5JXWA 3AY6A 2EARA 1D07A 4MLZA 4TWJA 4W9RA 1QOPB 4RD3A 5EGSA 2OA0A 5LZ7A 1ZM7A 1VL6A 2XV1A 3I5MA 2JL1A 3PFNA 4GR9A 3CINA 3L05A 4I1SA 4F9EA 1SCUB 3VBEA 4CR7A 1CUCA 5HM8A 4DA9A 4IEIA 2QLNA 3QJYA 5DBHX 5DMXA 4RTLA 4HDKA 1BE8A 5EJMA 4X0EA 5LQSA 2WWHA 5BV2P 2OAGA 3RODA 5FTJA 3HKCA 1E7SA 1Z12A 4QJ4A 5FFFA 4EG7A 5IXSA 3I6ZA 1DQPA 3H9CA 1UPBA 3L0OA 5D87A 3W9UA 5GZ1A 1D2CA 5IAGA 3FYUC 2OILA 3H0KA 3QLVC 4K5QA 3WLTA 1DIBA 4UQOA 1HYBA 3EIEA 3DHWC 4QPNA 1JRLA 1HTBA 3BFKA 1KFJB 4OTZA 2MSDB 2V98A 3D8NA 4LYDA 4EB0A 1YK0A 2IZOA 3L0YA 4FLMA 2HF8A 4K88A 2D1QA 3SXJA 4ARCA 2PQ6A 5TT1A 1AM4D 4KPUA 4V0ME 3E03A 1HE5A 5P21A 2YDYA 4OMCA 4DW8A 2EVWX 4KQ6A 5L4LA 1LWOA 2WSLA 3H84A 1X7ZA 2O2CA 2IIBA 3JSAA 1FUIA 1U0GA 3VYWA 6ABPA 3FPHA 4G26A 4L4XA 3KOXA 5FWXA 4FLFA 1EFVB 2AD1A 3EZ9A 3WL5A 1W75A 1GO2A 2FOIA 1C7EA 3X1KA 3BUSA 3W9SA 4LDQA 2PEZA 5JRZA 1QQ6A 3F9RA 3TKLA 3N0RA 2R6ZA 4DSNA 1DZIA 2G9RA 1P75A 2PWAA 3VPGA 3I9V6 1EEHA 2OHIA 1P62B 2XMRA 4KTVE 1LBSA 4FBMA 4AJLA 4UPEA 5C35A 1C0LA 4NECA 2C78A 1T6ZA 1Z0AA 2Q7DA 1C8BA 2F67A 4Q1AA 3RU7A 3Q6MA 2DECA 2VH2A 1H4TA 2XZDA 4PXSA 1A9RA 5H5JA 1WAMA 2IODA 1O57A 1PFKA 3OCYA 4D3YA 4F2HA 4K8OA 1QHHA 3ADCA 2IBSA 4IINA 3GGJA 4ED9A 4BXOB 3WB2A 2RHHA 5FCDA 3I0NA 4ZEMA 3OECA 2C7RA 3BE8A 4UUPA 4YQYA 2HJSA 3DJYA 3K94A 4ND2A 1E4EB 1H65A 2BFNA 3BK2A 1R66A 2JAOA 3I2IA 4RD4A 3QMVA 5IJ9A 1JEEA 1JZSA 3IGFA 4Z1MD 1T9GR 2H0RA 4ALKA 4E5UA 1YVEI 2UXCB 4BQNA 1C1YA 2GPJA 1FRVA 1G63A 1MBZA 1RD4A 2G72A 3EIOA 3KXPA 3NVMB 4LN1A 4M3NA 2LWIA 4Y3UA 4JXZA 3HKCB 4FT4A 5FR2A 2YJ4A 4R51A 4KMRA 1JHQA 1QO9A 5A5VA 2BFWA 1XNGA 4PHFA 4ZVSA 4BAZA 4WWHA 1A7JA 1KAOA 1NAIA 3N58A 2DUJA 5KKAA 4NWIA 1EK2A 4IAOA 4PEVA 4AI6A 4NTZA 5EIOA 4LRQA 4NBVA 5CGQB 4G25A 2R1ZA 5FLYA 2BHNA 4C6TA 4MA5A 1JE0A 1O08A 1SNYA 2UZ1B 3QTTA 3VXKA 2C8LA 3IOCA 3GL9A 4KPUB 1N8KA 1W87A 1H2FA 3R44A 3RJZA 2K7FA 2WU3A 2BFFA 2P2CA 3N07A 1U1DA 2E49A 2OP0A 2YBEA 3LT0A 1X7ZB 1DWOA 1WUKS 1V4BA 3AR3A 4ZA2A 1A69A 1C81A 3K09C 3L18A 5B7PA 3TSCA 3ZOZA 2X9VA 5FWXB 1UADA 3GEEA 3QUQA 3A37A 4JROA 5K0NA 2Q4EA 4PINA 4B3IA 4GYYA 3WMXA 5HJ7A 3CT4A 3LX4A 1ORIA 4B35A 1VXRA 2WPNA 2YUIA 3Q8MA 5U4QA 1YI1A 3UOWA 4XYMA 1KYIA 2ZRIA 4TQ9A 1BE1A 3LIPA 4LVOA 4WERA 4ZFNA 4U4AA 2WP0A 1ENZA 1N2EA 2HPVA 4G0MA 4GH5A 1XYVA 4LYGA 4COOA 2AMJA 3PRHA 1VMIA 5CB4A 3L8DA 4PSVA 1M2KA 3PITA 3JALB 5EIWA 4DXHA 5BNWA 4U6SA 4DLXA 2YQZA 1P1JA 2ZJ4A 1RPJA 1SBYA 4JYMA 3HE3A 1GL6A 1T3HA 3ISTA 1WKBA 2O6HA 1Z68A 4FHGA 4ZVRA 5KNBA 1AK9A 1AZWA 1NN5A 1YFKA 2R7KA 3BWXA 1GXSB 3D7RA 3W1WA 5JAOA 5CD1A 3RH0A 3TOXA 3AU8A 5JNTA 1SXQA 3BTOA 2O7VA 3PKIA 4QVIA 3MF4A 3PD0A 3UK1A 2IWHA 1JKIA 1C3XA 2W4QA 1JBQA 3OJEA 2JGDA 4FGSA 3I2GA 5AH0A 4PG4A 5DWVA 4TMKA 5E7QA 5JZMA 1FX0A 1DXYA 1WOMA 1Y3CE 2RK3A 2ZJBA 3AB7A 1W0JD 4JY7A 4KQIA 5K4AA 2I03A 3G8CA 4OM7A 5IH3A 3ZVKA 2H1VA 2YRWA 3CZMA 1IZ7A 4PS0A 2OXEA 4H1TA 4A8JB 2XZLA 2QUAA 5T8KC 1WMBA 2H65A 4A2PA 2P41A 5TVKA 1O0SA 1QF6A 2ES4A 4LV5B 2PKXA 5IM4A 1CY7A 5JRDS 4PAGA 2IZZA 4C6TB 5LQKA 4KZKA 1W8IA 3DL4A 2CXUA 1E63A 3GROA 2B5OA 2BFFB 2G36A 5CA0A 4QPDA 1MJGM 1VI2A 1IXRC 1JQLB 3HXKA 3WWOA 3L7IA 5AK6A 1KJNA 5CNIA 3W2IA 5A2GA 5J2UA 4LRWA 4LI3X 4MTCA 3RD5A 4Q1VA 2Z9CA 1OBHA 2FXIA 4JUBA 4WCFA 5AUQA 1ZIPA 1AN0A 3VZRA 3MAGA 4LOLA 3VYVA 5BR7A 4PZUA 3WYCA 3I9KA 1DAIA 3W1VA 2CD9A 2EDAA 1HRKA 4BY9E 1J20A 1WPXA 3L1KA 5TGZA 3PE3A 4MGIR 4JNKA 4FZ3A 1CRZA 1BCSA 2WZBA 3ZNNA 4ZYTA 4W5TA 5I9NA 5IABA 3DLBA 2HO4A 3D0KA 3LBHA 3A1DA 1OC2A 4OH1A 3ZI0A 5CB4B 1IVYA 2R6FA 2C2XA 1SA0A 1KDRA 1ZK3A 1EA5A 2H85A 5HKLA 1AE1A 4CMGA 1VE7A 3AESA 3HCAA 1EQAA 2YH2A 4XDGA 3A4VA 2ACKA 3UUGA 3IJEB 4RHFA 2HYIC 2C0QA 1YCFA 4EPVA 5JG7A 4ZT6A 5MDHA 1PNRA 2QM7A 2XHZA 3DWIA 3QOFA 2X58A 5T7BA 3OZ7A 3QY0A 4JP1A 4XW2A 3WJ1A 3ZW9A 2VFAA 3D9QX 4RORA 3OEYA 2WK1A 5GJWC 4TLEA 1GU7A 2VS1A 4JYCA 1ZL2A 2RBEA 2JGDB 3LT2A 1NBIA 3OOYA 3N53A 4O3FA 5DF1A 1A9ZA 1H2ZA 3LCJA 5KJ6A 3EXFA 1H2XA 1UDRA 2ZVJA 5U4XA 4AJOA 1TT5A 1Q0RA 3EH1A 4JA0A 1FX0B 4NOMA 2CXHA 3IHTA 4UNQA 2X3FA 2ZJFA 3PFWO 4KR3A 4UPDA 3WNDA 4DY4A 4OMFG 5LKRA 2GD2A 3BQNB 2QZSA 3PUVA 4LKOA 1AJEA 5TEWA 5FLXA 3DW3X 4H4EA 4M9CA 3RYIB 2VNHA 3F47A 4AB1A 1E99A 4OJQA 2ID8A 5JS2A 5C51B 4EJ2A 1Y5NA 3QNWA 3PUHA 1JIQA 3B1KA 4MVJE 5SZKB 3VKGA 1RKVA 2PL1A 1JR3E 1EFKA 3A1NA 1U7HA 2NSJA 2CLDX 2CXTA 3LKZA 1VG8A 3DQQA 3O4IA 4PIPA 3GEIA 2ZBEA 3GVHA 4D3ZA 4RTRA 1NBMA 2EL7A 2C3OA 3O4RA 4GS5A 5J2UB 4PNHA 3B5JA 4F12A 3GJ3A 3S2IA 4HNGA 4WCFB 4GWKA 3HSKA 3DEIA 2N3ZA 1Q2UA 2JFWA 3S44A 1TUBB 4ER6A 3FW1A 5IK2A 1YF3A 1OIWA 1VBMA 4MQEA 2QKYA 3WL7A 1R5NA 3OQBA 4OHRA 4HGQA 2Q1TA 3BMQA 5FWDA 1XNJA 2AK2A 2C2MA 1BCSB 2GEVA 2I33A 4LRXA 3RADC 1N8NA 2H11A 3UCXA 1VPEA 3JZDA 1L7NA 2HK9A 3ONWA 4NPCA 3RQSA 3M5DA 1P33A 2CDCA 4IYJA 5HFNA 2O6LA 4P7JA 3K1JA 1G42A 1GKUB 1MOSA 1SA0B 2PO5A 2Y66A 3C6QA 4MUIA 2I1WA 4ZDJA 1HDXA 3K0EA 5J1SB 4V0NA 2HH9A 3AESB 3O2QB 4YDHB 5ALKA 4EG1A 1IEVA 1NYTA 4PRZA 2AC4A 1RBMA 3H86A 3WBFA 2JVJA 2KM1A 1B8PA 1V3VA 2HLDA 2PA3A 4QXPA 3CEHA 3JQEA 2WDZA 3M81A 1ANKA 2VC2B 1GRQA 1RW4A 2RE8A 1EVJA 1FRQA 2C83A 4Y18A 2WWRA 2R11A 5C1BA 2X9NA 1EEXB 2L82A 2QTZA 5EC8A 4CODB 4DNQA 5K8TA 2V1UA 1X15A 1EK5A 4EW1A 1MX9A 3EXFB 3I2FA 3R09A 1TT5B 1Y4AE 3TRJA 3PXCX 4MW1A 4EA6A 1CY8A 2O0MA 3RVJA 4POOA 4Z3KA 3QU4A 1NOIA 1FDUA 3U3JA 1NW7A 1NM5A 2WI8A 4I6EA 4LJ6A 3U9LA 1QG0A 5A4JA 4OHVA 4M21A 5CT8A 2R79A 3N86A 3BHJA 4I1RA 4LECA 2PWYA 4KWHA 4GOMD 4Z1OA 4ISCA 5K3DA 4DCJA 5JSZB 3L6DA 4WLNA 5DDIP 3F5SA 4R81A 5SV2A 3H2YA 2I91A 3AZOA 3TB6A 2GOYA 1YQEA 3CLHA 4RHXA 4YX9A 3G0DA 1WBBA 4MSUA 4OI2A 3WV4A 2O2XA 3BIJA 1U2QA 1FMJA 3N3AC 3AIKA 3PFFA 1DKMA 5BN4A 1LDBA 3WADA 3CKMA 3CUVA 2QR5A 1UJMA 4DRZA 1KS9A 3E9CA 3W5BA 1BZYA 2KLHA 3C6MA 3MQFA 4NCAA 2JK0A 5EPEA 2OV2A 4C88A 3GD5A 1TFRA 3SD7A 2HEIA 3RF7A 1WTCA 2XCIA 3K32A 3AR5A 2VJNA 3C1AA 3IPAA 4IJUA 1CS0B 1U3FA 4QYSA 5BVGA 1DINA 3YASA 1KRXA 3NNNA 3FVVA 5FBLB 1QVAA 1M7GA 2VBFA 3F3SA 4MQEB 4X54A 1EP1B 3KDSE 3EAGA 1CE8A 1B00A 1U0EA 5C34B 3BMQB 2QJTA 2ID7A 4RPJA 5FUMA 5JWRA 1QGUB 4H4DA 4QYTA 1PJAA 5JDCC 3ANTA 4I4NA 3N0WA 2C84A 3ZIAD 1ZN7A 1ZQ1A 1J8VA 1T1SA 1S2NA 1Z0UA 2F1IA 4JB8A 4BPRA 1H2BA 1KMMA 3FDXA 3HWX1 4NVRA 5L9AA 4OUDA 1QV6A 5DNYB 1UBSB 2WIFA 3M9WA 1EGVB 2Y1GA 1UWKA 1AUOA 4Y6QA 4P33A 1G8PA 4O4IF 4A6DA 2FTKE 1SULA 4UBMA 3T61A 1W35A 3HU5A 4TTTS 4CMEA 3PT9A 1ODTC 4HWKA 3GEHA 4KFUA 1UBRS 3OTOB 3OQJA 4AO8A 2ZB2A 3I2HA 3WGZA 3P9QA 4JJ8A 2JH3A 3GAAA 4S35A 2G5CA 4LF7B 2ZOSA 2XDYA 5FPTA 1AHHA 2DR2A 4IJ6A 2AQIA 4P3NA 3DDNA 3KKEA 4JYAB 4I50F 3QV2A 1U4OA 5IN5A 2O1WA 4C01A 4MVWA 4F85A 3QFSA 3B38A 4R2XA 1GNPA 4BLPA 5G4LA 1PQPA 1WQ3A 4G5OA 4Z54A 4AMGA 5EZ6B 4H31A 1SRRA 4HC4A 2V7XA 3CVOA 4XFKA 3GJ7A 3RG2A 3SBEA 3WA7A 3OOWA 1KO1A 1VB3A 4G4SO 1OH8A 4YO7A 3ONEA 4KN8A 2HA3A 1ZVKA 1JT2A 3A9WA 4K3VA 2W6OA 2R8OA 3ZK9A 5H3HA