2JATA

Structure of deoxyadenosine kinase from m.mycoides with products dcmp and a flexible dcdp bound
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
202
structure length
190
Chain Sequence
MKIAIFGTVGAGKSTISAEISKKLGYEIFKEPVEENPYFEQYYKDLKKTVFKMQIYMLTARSKQLKQLENIIFDRTLLEDPIFMKVNYDLNNVDQTDYNTYIDFYNNVVLLSFDIVIYLRVSTKTAISRIKKRGRSEELLIGEEYWETLNKNYEEFYKQNVYDFPFFVVDAELDVKTQIELIMNKLNSIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEOXYGUANOSINE KINASE
publication title Structure-Function Analysis of a Bacterial Deoxyadenosine Kinase Reveals the Basis for Substrate Specificity.
pubmed doi rcsb
source organism Mycoplasma mycoides subsp. mycoides sc
molecule tags Transferase
total genus 64
structure length 190
sequence length 202
chains with identical sequence B
ec nomenclature ec 2.7.1.113: Deoxyguanosine kinase.
pdb deposition date 2006-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2jatA00
1P73A 3MFYA 1OXXK 4N0EA 4AD8A 4PQRA 4TL9A 2IL1A 2ANCA 2BCJQ 4JLPA 3BB1A 4LJYA 4TMVA 2ZANA 1CRQA 3DOEA 1G20E 5B58C 1BMFD 4PSKA 3U7FB 3MWLA 4KU4A 2HXYA 1W4AA 2CHQA 2DYKA 2UVQA 4GL2A 2FFQA 2YC2C 5L3QB 1DAKA 1RRPA 3CONA 4FWIB 2ZTSA 4TWZA 1I2MA 2I1VB 5EZ6B 4KYIB 3ZVMA 3PFIA 2ZJAA 3PXGA 1RJ9B 2WWYA 1Z8FA 3B6EA 3RS5A 2V55B 4G3XA 1SVIA 3RLFA 1SXJD 4IFBA 3WMEA 3ZZTA 1G6OA 3NEYA 1XF9A 2PCLA 2VP2A 4DLVA 3GJ4A 5LPNA 4DEYA 3BERA 3GEEA 3THWB 2FV8A 1N6IA 2ZRKA 2GCOA 2CL6X 4RZ3A 3KZ1E 5LB4A 4LV8B 4P4TA 3T15A 4ARZA 4US1R 1TUIA 3UWOA 1KDRA 2FF7A 2ZUCA 2W0MA 2W83A 1ZD8A 3GJ7A 3ZS9A 1UBFA 2ZRPA 2D4HA 1AGRA 2X1VA 3WYFA 1FX0A 1G8HA 1GVNB 2J41A 3CR8A 1MH1A 3PENA 1OV4A 1VDZA 1CKEA 2DFTA 2QSZA 4GMXA 1NSTA 3VR2A 3K53A 2DFKB 4K46A 1LV7A 2J7PA 4Q02A 5L3SA 1ZD1A 4XOIA 4MKFA 2OFXA 2JA1A 1KK3A 3THOA 3QKUA 2Z0MA 1E0KA 4KBGA 5TARA 4V02A 4DIEA 4ON9A 4X8MA 4F4IA 4WIAA 3GEIA 2WJIA 4EJSC 4WZAE 3TUZC 3PUYA 3ZGXA 1II0A 2FJUA 1BYUA 2BKUA 4GT1A 2C99A 5JJLA 3LH5A 1TX4B 3HU2A 1L4UA 1G3IA 1ZP6A 1VPLA 2PZGA 4GMDA 3QKTA 2XZPA 1FMLA 4W5WA 4GZLA 4KHZA 4Y0AA 3ZVRA 4URZR 4YDHB 3E1SA 4R71A 3N2IA 3EX7C 5DYGA 4TMKA 5K8UA 4KITB 1XTKA 4PSAA 4A15A 1NJGA 1UDWA 1NG9A 1NN3A 3DKPA 1UBEA 3ZVLA 2WKQA 3FFBA 1ZUNB 1TNDA 2JLQA 3K70D 6Q21A 2O8DB 4GI7A 4Y0VA 3SJZA 1XJCA 4YXWA 4YLGA 3TH5A 1T0HB 5SZKB 4KJZA 2ZI4A 2DR3A 4IOMA 4JLBA 4YMUA 5BN5A 3Q3JB 1GNRA 2BKEA 4ZV4A 4A0HA 1ZU4A 4Z1MA 3EIHA 3K0FB 4Q9HA 2WPDD 3RNLA 4FWTA 4NZYA 2JIZA 4RD3A 4DCTA 2AKYA 3DVLA 2P5SA 1G5TA 2YC4C 3L0IB 3AVUA 1RPZA 1W49A 1VG0B 2JAQA 4PQYA 5HKKA 2ZE5A 5FBRB 3L8ZA 4LHXA 2G1KA 5BQ5A 3OAAD 4B34A 2K5UA 1G21E 1OIXA 1IJFA 1JR3E 3PG5A 4R7ZA 4PC6A 2P5TB 1NVXQ 4JZKA 2OCYC 2NZ8A 3K9NA 4IVRA 2PH1A 1KI4A 4N3NA 1N6HA 4RY2A 3QG5A 3SJAA 3CR7A 1KZ7B 1IXZA 5LB2A 2WWFA 3KQLA 1G291 3R9WA 1MO5A 2QY9A 4OK3A 2AXNA 5JRZA 2GF0A 4LV5B 2PJZA 3SHFA 2OXCA 2ZJOA 4NU0A 4OK5A 4FCTA 3ZD7A 4BFYA 1E98A 4LJ6A 4JS0A 4FMDB 1KNQA 2IW3A 4LWZA 2WZQA 3LNCA 4TLAA 1WA5A 4FMDF 5KSYA 2ZUBA 4ITRC 3BC1A 3EPHA 1OXVA 3TUJC 2GEDA 4PO1A 3H4MA 4OKSA 2SHKA 2CJWA 3R7WB 4W7SA 2G3YA 1NNEA 1KJZA 5FOXA 1MV5A 4BUJA 1COWD 4HDOB 1CLUA 2OSBA 4WXPA 5D3QA 3ECCA 2IS4A 4ILEA 2BM1A 1BKDR 1KAOA 4IW3B 1OYYA 4B3DA 5GJBA 5D3MB 3A37A 3BH0A 1DAGA 3JZAA 5J5CA 3I4LA 4RD0A 1NL3A 4OHYA 4G5GA 3KTAB 3CUEF 2PL3A 1KYIA 4JKYA 3HR7A 1G16A 4RD1A 4QKQA 4A36A 3RANA 3VMFA 4NCIA 1DAMA 1DTSA 1YZQA 2WWHA 4KFSA 1ZMXA 2XB4A 3KL4A 4TN1A 4KFRA 4X8OA 3U3RA 4BFXA 5JSZA 3TBKA 4A2WA 4EUNA 1E2NA 1EESA 1ZM3A 4QHTA 1ZC4A 1GITA 2QT0A 2YHSA 4LCBA 2OEPA 3T5GA 3IUYA 2JJ1A 4M53A 3X1ZA 3RSLA 4M0LA 5CM8B 4LHZA 3BH7A 1JQJC 4A8JB 2WM9B 4NYIR 1O3YA 3MJRA 1EFCA 1XCPA 2I3BA 2O0HA 3BOSA 4IDPA 3U7HB 5EE3A 3QEJA 3SE0A 4UNRA 5LD2C 1KAGA 2ZRDA 2VHJA 4D4LA 1ELOA 2WWWA 2VHQA 5EXPA 3CX8A 1NVWQ 3NKVA 2PLRA 2VO1A 2V4ZA 4B3XA 3GLFE 3DDCA 5L8VA 5IRCD 4Z51A 1Z0KA 1W4RA 3CPEA 1N5JA 3LXRA 3QSYA 1NSFA 4E22A 3GLGA 4MA4A 1Z47A 1N3BA 3QENA 4EFMA 1H8EA 2WOOA 1A4RA 3GJ0A 3PJRA 3DOFA 4MYUA 3SFVA 1II8A 1GKYA 1R5BA 2GA8A 4XWAA 1ZIOA 4JL5A 4R9UC 1KO7A 1NMXA 4PPFA 2ZSEA 2QAGA 1OH6A 1Z2AA 1VG1A 1OXSC 3GCGA 4CEIB 4QG7A 4KFTA 1HYQA 1LB1B 3U3JA 1VYTA 2CHVA 2WAYA 1FPMA 1W0JA 2Z6VA 2DWQA 3DZDA 4I1OA 3P4XA 2IXGA 1HY3A 1Y3AA 3D8BA 3F5FA 4L9SA 1N6KA 4HLCA 1ZYUA 2WJJA 3P20A 3OIYA 1IOZA 1SZPA 2ZI6A 1R5OA 1EFUA 1WRBA 2GWHA 3BWDD 3E70C 2QM8A 2ZRJA 3W9YA 5FUVA 3DMDA 4F93B 1AS2A 4JKIA 1QHIA 1HE1C 4MGKR 4EQ6B 2WV9A 3JZMA 5K8IA 4DB4A 4O0MA 3FHOA 2BMEA 3QKSA 2WWIA 1IY2A 4ACBA 4DT1A 1UJ2A 4RZ2A 2G1JA 1US8A 1IXSB 2J59A 1G7SA 1WF3A 4C2UA 4FIDA 2FFBA 3EA5A 1E0SA 3THXB 3B7GA 2QZ4A 3RS0A 2ODNA 2GZHA 4FINA 3VU9B 3ZS8A 3T1TA 5B2ZA 3ETLA 4TLEA 5AJXA 2KJQA 3AVYA 1SQ5A 4WBSA 3T06B 3SU8A 5TMPA 4MITA 1W47A 3AUYA 1BS1A 5FOTA 3BD9A 4KAXA 3T1OA 5F3WB 4B75A 2O8BA 4GP6A 3BB4A 2A7QA 1CJUC 3DHWC 5FUXA 1EX6A 3NIBA 4O2LA 2GNOA 3QVVA 3P27A 1MRSA 5CJ2A 1R5NA 5AUPB 1E2QA 2GEVA 1UPTA 1U8YA 3CWZA 1E79D 4NYJQ 1Z5ZA 4LJ9A 2VP6A 1OSNA 1LS6A 5FI0B 2F7SA 2H7VA 1W1WA 4D81A 4U7DA 4RD2A 2HEIA 3FMIA 4HUQA 1KMHA 4NH0A 2F1JA 5DN6D 3TKLA 1ZJ6A 4DEXA 2B8TA 2GJKA 3GJXC 2BMJA 4IHQA 1R8QA 5TVKA 2WJHA 1AJEA 2OCAA 1T3SA 4JLVA 3KUCA 5CLLA 1ZNXA 2AWNA 5AWFC 1XTSA 2BJWA 1VKJA 3C14C 3P1JA 1XD2A 1N5KA 1QRAA 2OT3B 2QAGC 1XX6A 1R6BX 4QFMA 4UQOA 1DAHA 2WIBA 1YR9A 2G83A 3FPAA 4B47A 5L3VA 1N25A 2QAJA 3NG1A 3QE0A 4MRRA 3LX5A 2FOLA 1Q1EA 2ZIAA 2N46A 2ZXUA 1ZNYA 4D4KA 1XEXB 4DLYA 4JLDA 3TW4A 2EFHB 4A4DA 4KODA 5EP3A 2XZOA 1E2PA 3EASA 3AP3A 3TVDA 4IEEA 4OHVA 3ICEA 2BOVA 2HCJB 1VTKA 2XXAA 3AQ4A 2V7QD 1W4BA 4BLQA 1G7TA 1HUQA 3QXCA 3F3YA 2OZEA 2QQEA 3B1YA 3IIKA 4ZKDA 3SFZA 5FL3A 2ZU6A 4E09A 5CK4A 4ZIRA 3WMGA 1ZUIA 1DG3A 3IDQA 5FPTA 2FU5C 3OEEA 3L82B 3LO5A 3VR1A 1VYVA 1ZNWA 5JWHA 1P9RA 1E2FA 3QXHA 2O8EA 2FEOA 3U3MA 4AYXA 4Q9KA 1U9IA 5KUTA 4V0MA 1W5TA 3B13B 4W9MC 2VHUA 4PC3A 4JLNA 1BIFA 2ASEA 1Z08A 4KSBA 2OBLA 1UKYA 2GJ8A 3VX4A 2O5VA 1U98A 2CCKA 3HU1A 3REFA 3S1AA 3TQCA 3AP2A 3NDPA 4JSYA 1F2TA 2C78A 3RWMB 4Q7MB 2QNRA 3AVOA 4DCNA 3TR0A 1XD8A 1A2KC 4EPYA 1TPZA 1P6XA 4LBWA 4DVGA 1OHHA 1WBBA 4B2IA 1XBTA 3OEHA 1Z22A 4WAUA 1IM2A 2IXEA 3L0SA 4BGDA 1FZQA 4TQAA 3AF2A 1IQPA 1ESMA 4DZZA 4KI0A 1KI7A 2ERXA 3NVAA 4PTLA 5FI1B 3MG9A 4OI2A 3K0CA 4IDOA 1CR4A 1OFHA 4LX0A 3CW2A 1YZGA 1VIYA 2NO9A 1G8YA 2RGNC 5EXTA 1Z0AA 1IHUA 4FN5A 3IGFA 1PZNA 1YZTA 1HEIA 4GNKA 3CH4B 3I8XA 1QF9A 5F98A 1R0ZA 3GPLA 1XP8A 3W5IA 1W48A 3K9GA 1N6RA 3V4FA 4LPSA 3LRPA 3IQXA 2JEOA 2C9OA 2CVHA 5GVSA 1QHGA 3GJ8A 1E9EA 1W0KA 4PC2A 2AHOA 3FWYA 4KBFA 4UJ3A 3KQKA 2BCGY 4QJ5A 1LF5A 3SI7A 1AQUA 1C9KA 4RFSB 3W6NA 1JXOA 2QG6A 4M9ZA 3CH5A 1EFTA 4D0GA 1UDXA 1XMSA 3IILA 3RS2A 3IO3A 5LBIA 5KU1A 5SZHB 4RKFA 1EGAA 4DXAA 3NHBA 1SXJB 4A9AA 3GLIB 1LW7A 2J0QA 5FTNA 2FSHA 2RMKA 4ASUA 1P2VA 2ZRFA 1S3SA 1KHTA 2NPIA 1MABB 4TYNA 3DEFA 4HLQB 2JLRA 4M8NE 2HJGA 3Q72A 1FFHA 1SVSA 2P6UA 3UWKA 3F8TA 4OJKA 1QDEA 2Z4RA 3RRNA 1W44A 4E03A 4WOPA 3WRXC 1VCOA 1WE2A 1G8FA 2QP3A 3C15C 4B32A 2R65A 1HT1E 2NG1A 4BZXA 2JLYA 2F55A 2XZLA 2D7DA 3QG1A 2R6DA 1U9IC 3JVVA 4MRSA 3FGNA 5FOWA 1Z29A 2PX3A 1CS4C 2JASA 4TT3D 1NVUQ 3C41J 1ZUHA 4Q66C 1P2SA 1U0LA 3QBTA 2XSZD 4LHYA 3O47A 1XZQA 2WJVA 2ZUDA 2XJ4A 4QGHA 3ZVNA 3SQWA 4O2RA 2I1QA 2IYZA 3EXAA 1FTSA 2XITA 1KY2A 4F4JA 2D3WA 4GBMA 4AYWA 3TW8B 4D4MA 4LJ4A 3AVQA 3CPJB 3D31A 2GBLC 1DVRA 1NKTA 2FH5B 5HCIA 3HPRA 3U4QA 4NPHA 1HV8A 2R8RA 1OFIA 2R6CA 3ICQB 1E2EA 3K0CC 2FNAA 2IEYA 2ZYTX 4G5OA 4HSEA 3TSOA 3VX3A 1NN0A 2QPAA 2FPKA 2WJYA 3O8DA 4AKEA 4Q18A 4HB3A 4YMSA 1GKIA 2AFHE 5JMTA 4LBZA 2QN6A 4NE2A 4CT4B 3ADKA 1Z6XA 2XNDA 4A2QA 4A82A 2FFAA 5C4GB 4QJ3A 221PA 5DSZA 1M8PA 1OIWA 3OIWA 2BBOA 3W8RA 1EFHA 4KLNA 1PVOA 1E9BA 2VPPA 4MH0R 5KDLA 2ZITA 2CHGA 4R2IA 3I8SA 2BMFA 2IS1A 2WICA 3K0AA 4LDJA 4LYFA 2IS6A 4DLWA 5EXXA 4D82A 4EKDA 1Q22A 2EYUA 4PHHA 4RKEA 5SZIA 1QG4A 4JL8A 1E2KA 3A1VA 4QBHA 4UXIA 3THYB 2HV8A 2H16A 4U02A 3BJIC 4A92A 2Q21A 1NBMA 3GLHA 4Q4JA 1ZM4A 4LSGA 4FMBB 3EC2A 3FYHA 3HP1A 2IWHA 4DCVA 2GILA 3HYTA 1P62B 3RS4A 4Q4AB 1R4AA 3QIAA 3E2IA 1UM8A 3AH8A 1AM4D 3E5HA 1KDOA 4B44A 3RWOA 2C8VA 5KYKA 1DO2A 2NOAA 2ZJZA 1IXRC 1N6NA 2CLSA 3H2YA 2FGJA 2J0UA 3TRFA 1KDTA 2HUPA 2QROA 2BEKA 5KOYA 2CK3A 1P2TA 2X77A 4M22A 2F43A 2JJ2D 1GSIA 4H1UA 5CLQA 4CZ2A 4Q9LA 4B73A 1LFDB 4Q4HB 3IEUA 4B2LA 5BXQC 2YINC 1QHNA 1Z83A 2XOKD 1NJFA 2BWJA 1TF7A 1XXHE 3I1FA 2GXUA 4EJSA 4PPGA 2I4IA 4L16A 4L15A 3VQTA 3EARA 3QF4B 1GFIA 1FOEB 2AK2A 2EFGA 3P26A 3EIQA 1CJMA 1XXHB 5AUQA 2W6JA 3R9IA 1J8MF 3IBGA 5B57C 1PUIA 4DCSA 2HT1A 2GK6A 3I92A 3VHXA 3MJHA 3T12A 3LVQE 5J4VA 2F1HA 3AVPA 2WSSA 4TSFD 2G0TA 1DPFA 5B64A 1Z07A 1WQ1R 4MYHA 4XH9B 4C0SA 3LD9A 1ZBDA 1TADA 2IUUA 2EFCB 1JB1A 5DYIA 5FUYA 1H8HD 1TQ4A 2ZSFA 1KK2A 5FL7D 2CLCX 1S2MA 1RYFA 4Q1DA 5FBWB 2YV5A 1VHTA 2VIIA 4HI0E 4IEIA 2IXFA 3WY9A 2DFLA 1LS1A 4B48A 1E1QA 1SVKA 2QP4A 1OFTA 2RGGA 1CULC 1Q1BA 2CNWD 3M0EA 4NONA 3OHMA 5CK5A 2OAQ1 2R62A 5JZVA 1NLZA 4ZCLA 3TUIC 3NHAA 4O25A 1KKLA 1U94A 4P32A 2F3TA 3LAWA 3EC1A 3GJ6A 3DM5A 3PVSA 5EUMA 4CVNA 1QHYA 1NVVR 4LYJA 4C4PA 2ZE8A 2ODEA 4UNPA 1ESNA 3RABA 1W7AA 4OI0A 2FZ4A 2ZVQX 1TUEA 3ADBA 2FEMA 1FUUA 2NQ2C 1KO5A 1CEEA 4TLDA 1MR3F 3ZIAD 5KO2A 4CEJA 4LYAA 3N70A 2BBSA 4EDHA 1FQJA 2OFOA 1G9XA 2XNSA 3OIVA 5JS7A 4CGZA 4POAA 1IN5A 1N5IA 3KKOA 3X1XA 3LLMA 2PT5A 2YKGA 3RYTC 2HLDD 4C0HA 5CB8A 2GRJA 1F60A 2OFWA 2C04A 4Q7KA 1VCNA 2NMVA 4H9GA 5JJIA 3LQQA 3CZPA 2Q6TA 2YJTD 3OIUA 3EG5A 1KSJA 4QM6A 2VH5R 1FW6A 2A5YB 2P67A 4DWJA 2QMHA 4OI4A 3WBJA 1QVRA 2QMUA 2PT7A 4AY2A 1PLJA 3T34A 4TL6A 3QI2A 3R8FA 2GCOB 1KI6A 1Z3IX 521PA 1BO6A 3ASZA 4G5RA 4M21A 4ARZB 1XD9A 3NXSA 2H1LA 2JLSA 2YYZA 1RYHA 2QMEA 2XTZA 3SNHA 4URWR 3PEWA 1E1RD 1W36B 2O8DA 1G4AE 4RCZA 1OKKD 1P72A 1OB5A 2JDIA 1DAIA 8OHMA 4HYYA 1OH5A 4M9QA 1FX0B 2VP5A 5HZKA 4QOSA 3K0EA 3FFAA 4RFVA 5P21A 2Q3FA 4YQFA 4BLSA 2D62A 4XSGA 4PAOA 4F38A 5DLQC 3AKYA 1AGPA 3GJ3A 5L3SB 1Z6AA 1DE0A 2QI9C 2ONJA 4TYPA 4DRZA 1AS3A 3KQUA 2QBYA 2NIPA 2FZLA 4C0AC 1CR2A 2J0VA 1OLOA 1Z0DA 2EVWX 3AGPA 1RW4A 2ZRBA 3FKQA 3PEYA 4XVRA 2O8CA 2OXRA 1U81A 2C5LA 2PMKA 2ZRAA 4Q1CA 2P6NA 4OI1A 2A9KA 3NH6A 1R0WA 4PHGA 2N42A 1KMQA 5EP4A 2IX3A 1G5PA 1JR3A 4FW9A 4EPVA 4D2IA 2P0EA 2RCNA 1DELA 1T5IA 4HAYA 4US2R 2PZFA 3TQFA 3BK7A 3BXZA 4DKXA 5E3HA 1I4LD 3AF0A 4JIMA 4CRWB 3A58B 3W6OA 5FBVB 5IF9A 4HDQB 2F3RA 1AN0A 5GJVC 4MGZR 2FG5A 2R6AA 3A8TA 3LX8A 5H1YA 5HR5A 2ERYA 4KV9A 1KNXA 4AKHA 3EAQA 2O52A 3UIEA 3QXXA 1P60A 3OFNA 4I1SA 1T4GA 3R7WA 1ZM9A 3LDAA 1E94E 4C30A 4MQBA 4RZUA 3NWJA 4NCJA 5JCZA 2E9SA 1M34E 3B85A 2H17A 2W6ID 3Q8XB 1K5DA 4HAUA 4LZZA 4D6PA 5J47A 2EQBA 4IFEA 4M1KA 3CBQA 3KB2A 3TMKA 1Z6TA 4HAZA 2R9VA 1DEKA 5TXGA 2XB2A 4ZDWA 1VG9B 3KTAA 3SYKA 4ZDKA 1CTQA 4AK9A 3U3KA 3TE6A 1A1VA 2CK3D 2AD1A 2WBLC 3PUVA 1F48A 2NPFA 2OHFA 1CJKC 1KI2A 2FE4A 2H8KA 2QE7A 3IPXA 1PLKA 2OLKA 3KX2A 4GFDA 3HYRA 3PEUA 4Q1BA 4CF7A 4LY6A 1TEVA 2X8AA 5EP2A 4U5XA 2AKAB 2WHXA 1T91A 1P61B 2V6IA 621PA 3L43A 4ZCIA 1FP7A 1R0XA 3C8UA 2W6JD 3W90A 4DUGA 2V8OA 3B9QA 3RRZA 4DCUA 1YZUA 1JJ7A 1RRFA 4M1YA 1FUKA 2QRNA 1OIVA 1E9AA 1U0HC 3A1WA 3HJNA 1R7RA 2QQ0A 1DS6A 4BRUA 3F0TA 1Z63A 2VLIA 3TJZA 3VKGA 2AR7A 3CNOA 2CJWB 2QU8A 2VL7A 5FFMA 3U61B 2RB4A 3WYAA 1NY5A 5KSPA 2B21A 1HQYE 3X1YA 1G6HA 5CDFE 1X8LA 2E1RA 5JEEA 3ZDQA 5G41A 3GLFA 2R6GA 2IWRA 2EYQA 2KWIA 5G3YA 2OBNA 4ZCMA 1VYUA 2Z43A 1RFLA 3OF5A 1QHHA 5TDHA 3QOFA 3T1VA 4URXR 1HTWA 2ZR7A 1RVDA 4G5SA 3EIEA 2ZRGA 2C77A 4XTRA 2ONKA 3WNDA 1JNYA 4A2PA 3OE7A 1MRNA 3QY0A 3H86A 3AVWA 1XJQA 4V0LA 2REBA 4GZMA 1ZD9A 4HAWA 2PZEA 2FA9A 2ZYWX 1A5TA 1P9NA 2FMXA 1XMIA 3KQNA 1Z2CA 3PR1A 3M4YA 3CRQA 1IY0A 3TNFA 1FTNA 1AIPA 1S8FA 1DADA 2MSEB 5C2JB 4XD7A 2LKCA 4PHTA 1W36D 2VP0A 3QF7A 5BW8A 3BFVA 1EXMA 4QC2A 3OESA 2QTHA 4PO8A 5GJWC 3CRRA 3U2QA 5J4LA 3KKNA 1G7RA 4TQUS 4TYYA 2G0NA 2IYSA 3CRW1 1QG2A 4NBSA 1X3SA 4UNNA 4A0RA 1OFUX 3RAPR 4MRPA 1GP2A 3AF3A 1XTRA 4OQLA 3W5JA 4AYTA 2GAOA 2GCNA 4E5UA 1GRRA 5JHHB 3GP8A 4C7OA 2J7PD 2WVJA 5FOUA 5HTKA 3VR4A 3K1JA 3PUZA 1SKYB 4NP6A 5DI3A 4KSCA 4W5JA 3VTKA 5E4FA 4DDWA 3RRYA 5KNCA 3VU9A 3O8BA 1QHXA 3AF4A 4GOKA 5TB5A 3MSXA 2G6BA 4WVFA 1KSFX 2O8FA 1Q0UA 3OZXA 4OJQA 1KDPA 5B30A 3TGPA 3TAHA 1ZM7A 4HDCA 2NO1A 1II8B 1N5LA 4Q1AA 3MWJA 1UKVY 1II9A 1YR8A 2ZSAA 4MRVA 3NDBB 1UBGA 1YRAA 4LGMA 3WBKA 4R2HA 4BFZA 1PV4A 4D25A 3FTQA 4D4JA 5BN3A 4QBFA 1XPOA 2QPOA 2OAP1 4NYMR 4MGIR 4ZKEA 2FN4A 3UMSA 2P6RA 1D5CA 1L8QA 2PBRA 3B1XA 3ND9A 4RZXA 4G0NA 3Q7QA 3X1WA 4V0KA 3KKQA 4GP7A 4PANA 5KDOA 4YXWD 4TTRA 1GRQA 1KO4A 3VKWA 4W5HA 5J4KA 3LWNA 3L8YA 2D74A 3R20A 5BYKA 4DC9A 3QKSB 4QGFA 2ZU0C 2OO7A 2DPXA 3DL0A 1US8B 4ZDIA 4Z1MD 2ZJ5A 3IQWA 1U0JA 4B2PA 2GF9A 4JL6A 2WTUA 3MUFA 3ZYCA 1CF4A 3V00A 2RGNA 2JIZD 1EFRA 4Q01A 1LVGA 3O8RA 1KKMA 2PCJA 3WNBA 5HKKD 4PX9A 4IVPA 3B82A 3UXMA 5IDVA 1P3JA 1MOZA 2O8BB 1MT0A 1BH2A 2O0JA 1U99A 1W4CA 1ZM2A 3B8HA 2FSFA 4OQFA 2B7CA 1S1MA 1UFQA 2G88A 3UPUA 3FKSA 2V1XA 4K8OA 3VR6A 4TZ0A 2ZRHA 2WKPA 2WSMA 4URUR 4B33A 1P7CA 4B43A 4ESVA 3I3SR 1NP6A 2ZM5A 1IBRA 4KCGA 3VR3A 3DKVA 3NC0C 2LKDA 4TTPA 4ZO4A 3VFDA 2GK7A 3OFND 3NBFA 1AK2A 4M1OA 4OHXA 2JLVA 3RS3A 3U7GA 3U6KA 2D06A 1P4SA 1ZCAA 3EW9A 1CU1A 1Q3HA 5FOVA 2ZI7A 5EJEA 2J3EA 4KLZA 1VMAA 4JSTA 1G64A 3AKDA 3RC3A 4D26A 4DBLC 1Q44A 3U6BA 2C95A 4N0DA 1XD2B 3FMFA 1GIAA 3TVTA 2DWPA 3WNCA 4M1TA 4F7WA 3REGA 3KJEA 4IXNA 3UMRA 2Q0HA 4OQNA 1E6CA 4L8GA 4NDZA 3U44B 821PA 5KHOC 3SYNA 1K6MA 1SVLA 4HLDA 2ZYUX 1JR6A 3I5YA 1IAQA 2H18A 1WDTA 4Q7JB 1G17A 2HDNB 5DIFA 2JLUA 4GOXA 4KXFB 2OESA 4BLTA 4TYQA 1E4VA 1UBCA 4MUBA 4PO9A 2XXAB 1VHLA 2GBLA 2IYRA 2IYWA 3KKPA 5J4HA 1IJEA 2XEXA 2EU8A 4M1WA 2MSCB 4M9SA 1J7KA 3VHLB 1UKZA 2VEDA 4HAVA 4ZIRB 3N5CA 4Z54A 2YNMA 3QEOA 1BMFA 4XVQA 1J90A 1W2HA 2JJ1D 4QM7A 3VNUA 4EPXA 4LJAA 1KO1A 2EFDB 2IEZA 3KQHA 2JATA 5AK0A 3D3QA 1NLFA 2AD5A 2BIFA 4RFSA 4YMTA 1ZW6A 4DDTA 4YC7A 1J2JA 2JJ8A 1E0JA 2DBYA 4NCHA 3S1AB 4A1FA 2PX0A 4PPNA 2P3SA 3GEHA 2W2XA 1KZGB 2OV2A 1SXJE 3SDZA 3R8CA 4BFUA 3GLIE 1NY6A 2ZS9A 2VF8A 4B74A 3CF6R 1XCGB 3CZQA 1G4UR 3B2EA 1RZ3A 2RKOA 1H8ED 4LUCA 4LOAA 2A5FA 2UZIR 5FBLB 2RH5A 2BVNA 5CJPA 4A0FA 2GESA 2JLWA 4Q00A 1D2NA 4DHEA 5EXSA 5L3RA 1KI8A 4ABYA 3G0HA 1W0JD 5TY0A 4FD2A 3CX7A 4HZIA 4Q19A 4FI3C 1Y63A 3ZQ6A 1AQYA 2RGBA 3AGQA 2W00A 4XVUA 1E9SA 2FSIA 4NYIQ 4OQXA 3BFXA 5CIWA 2IHYA 2IUSA 2VF7A 3AUXA 1E2GA 3T61A 4WZBE 1B23P 4EPTA 5KNDA 3DM9B 1G41A 1GRNA 4Q03A 5FTKA 1OH7A 3QKRA 1NIPA 4JLJA 2TMKA 3P32A 4BRWA 5JI3E 1YZKA 3QVUA 3VR5A 3C4JA 4XWKA 5KTYA 1A7JA 721PA 2HXSA 3J81k 2A2ZA 3IEVA 5EE5B 4PC1A 3CLVA 5JEDA 3SR0A 4IKEA 2QTFA 4C0QC 4DSNA 5KDDA 4DLUA 3QXJA 1G3RA 121PA 2GDJA 3TAUA 3PIRA 4WA7A 4V0NA 4KVGA 2WWGA 2AX4A 1JAHA 4LJ7A 1NIJA 4G1UC 4B6FA 2QA5A 4R98A 3AEZA 4LRWA 1M2OB 2DFNA 3NTUA 3IKJA 2ZRNA 4V03A 2RGXA 3MRSA 3KB1A 1E2HA 1UF9A 2OLJA 2J46A 4DIDA 4MRNA 5IT5A 1XZPA 1SXJC 2C98A 1NG1A 3L0OA 3QJYA 2UKDA 3EWAA 4HB4A 3CF0A 1YZNA 3CO5A 1S4QA 1GILA 2WPDA 3BRWD 3GQBA 1AS0A 2GTPA 3CNLA 3NBZC 4P4SA 1CIPA 4DDVA 3H1TA 4Q1FA 4Q4AA 1LTQA 2J87A 3BAFA 2KB0A 3EA0A 4PFSA 2IS2A 2F1RA 4GSYA 3UG6A 2GAAA 4PR0A 3WXMA 3OAAA 1D8TA 1VCMA 3U4QB 1Z28A 1G3QA 2P65A 5C46F 2IBMA 2HF8A 5CIQA 2FDCA 4ZI2A 1W5SA 2J7KA 4RSGA 2BC9A 3A4MA 3ZZUA 4PZYA 4BPBA 2H57A 2DHRA 4JJZA 4EPWA 1RKBA 2FPMA 5DHAA 2IF2A 1F2UA 5JI2E 3U60B 1TTTA 2RGDA 4OYHA 4S35A 4HZUB 4B3BA 2Y8EA 4CT5A 3QF4A 2IYQA 4CEHA 1XXHA 1FQKA 4C0KA 1GUAA 2WJGA 1LF0A 3MD0A 2G77B 3K0AB 4B35A 5EUQB 1GTVA 4GOJA 1T3HA 2QGZA 4HATA 1G7CA 2F6RA 4JBYA 1M6NA 3QPVA 3H0KA 2H5EA 2RGEA 2NZJA 3QBVA 3ADCA 2RHMA 2DB3A 1TAGA 3GLHB 2WKRA 3BIFA 3MCAA 1UAAA 1LY1A 4NKRA 3FMPB 3NH9A 1COWA 1EG7A 2Z4SA 3OEED 2BEJA 5JWRA 4DJTA 1GNPA 4EPRA 3ZZ0A 5C18A 1BYIA 1GNQA 1NI3A 2J1LA 4B76A 5L3QA 4F4CA 1J70A 5DGXA 2OUKA 2J5XA 4PZLA 1S3GA 5F2EA 3FMOB 3GFPA 5HE9A 3BGWA 4Q7LA 2QT1A 4P31A 4AI6A 1RJ9A 2RGCA 1WMSA 5FTJA 3K70C 4WZ6A 2V3CC 1GG2A 2C96A 5K8TA 4ERNA 2ORWA 2NGRA 3AV0B 3HR8A 1X1RA 4EAQA 2F43B 3AKCA 1KO8A 3THWA 2KSQA 3K9LA 3GFOA 2ODBA 1P75A 1U8ZA 1OW3B 1OHHD 5CYOA 1T9HA 2P2LA 2VYFA 2CL0X 4TMZA 3OEHD 4LJ5A 5HCNA 2CCGA 5CB6A 4EJSB 4TMXA 5HPYB 3EPJA 3KJHA 3RC8A 2FPLA 3IIJA 4URYR 1U8AA 2REXB 5FR2A 1P9WA 2B7BA 1Q12A 2XJ9A 4BE7B 2VRWA 4PAMA 2QSYA 4UXHA 3BS4A 2GKSA 2R6FA 4BASA 1OXTA 2ECKA 1RRGA 2FSGA 4UNSA 4LC0A 3NC1C 5H8WA 5M04A 3LBHA 4KVAA 3QPUA 4TLBA 2VTKA 3LVRE 3ZH9B 1W0KD 3LV8A 2ZEJA 3CKLA 3TIFA 4QNMA 2GJ9A 5IHPA 1CXZA 4MKIA 5DNYB 4JLKA 2AN9A 1D9XA 3KXLA 3AB3A 3HDTA 4I1UA 2QPTA 4AKIA 3CIOA 3T35A 3GD7A 2J9RA 1ZCBA 4G5QA 1IN7A 1WB9A 4ASUD 2V1UA 3TR5A 4L9WA 4NYJR 1S9DA 2VP4A 2A5GA 2WAXA 1SVWA 1FP6A 1ONBA 3LA6A 3Q9LA 4QHSA 3TLXA 1YVDA 3KFXA 4XSHA 1N0UA 1SHKA 3EZ6A 2ZJYA 4JBXA 1WCV1 2ZRIA 1SVOA 1KSGA 3W8NA 4QBIA 3AVVA 2B92A 4CEJB 2HF9A 3Q5DA 3AVXA 4JVSB 1WBDA 2X2EA 4ZDJA 2ZE7A 3QQ5A 1ODFA 1XMVA 1V5WA 3NBYC 5G40A 5JRJA 2J0SA 4KFUA 5GJCA 2D7CA 4DLTA 1HA3A 2ZRLA 1N0VC 5HE8A 2HYDA 3UG7A 5IK2A 2Z5FA 3K0FA 3LW8A 4JLOA 1PLLA 2W2VA 2R44A 4YMVA 1JXMA 2VHCA 1CP2A 5GADl 1TEXA 1TQ6A 3CRVA 4LJ8A 3HPQA 1OXUA 2W0SA 1ANKA 4QRHA 1DBSA 3CM0A 4TMWA 1D9ZA 3B78A 3LXXA 5FOSA 3PUXA 1MO3A 4Q9JA 1R10A 1JECA 1KI6B 1T5LA 3B1VA 3ND8A 2D2FA 3A4NA 1KGDA 4OHWA 1GL6A 5AJVB 4US0R 3H84A 1XPRA 5G3ZA 4CDGA 1OT3A 4DLSA 2QRZA 3LQRA 2NO6A 5CITA 4JLMA 1E79A 5DO9A 2X19A 3A1SA 3CWQA 3BE4A 2RAPA 5AR1A 3MWYW 3RVBA 2VQSA 2QGNA 4CW7A 5EE0A 4GDFA 2XNDD 1T8UA 3RRMA 2GXAA 1KI1A 5LDDC 5DN6A 1YKSA 1Z6YA 4NHOA 4PC7A 2B6HA 2KBEA 1XEFA 3NEJA 2BBWA 5EZ5A 4TYWA 1F6BA 5FPYA 3V9PA 4M1SA 4QHYA 3IBYA 2QBYB 4MDFA 4Q5IA 4M9XA 4ACAA 2JLXA 5AUOB 1E0AA 5BWMA 5EE1A 5FTMA 1NBMD 5ANRB 4BLOA 2DCUA 2PEYA 1XTQA 2YOFA 5A0FA 3EZFA 2BMDA 5DE3A 2O8CB 4C0LA 1W36C 4QNRA 2DY1A 3DO6A 2AFIE 1KTVA 4GRAA 4I99A 4B6EA 4LHVA 4N1AA 2BV3A 4A6PA 1CJVC 4EFNA 3SBEA 3FDIA 3EZ7A 3I32A 5D3MA 2PJRA 2IHBA 1CBUA 2L0XA 4HLUA 3EPLA 2IA5A 3KUDA 3SJCA 1AKEA 3D7MA 5LD2B 4X8LA 1S1CA 5CYPA 2A30A 1S9HA 1G3MA 1Q1QA 2AK3A 2IYVA 2ODWA 4LHWA 1X6VA 2GXQA 2V7QA 4NMMA 1UEIA 4TTQA 4C9BA 1W46A 3FHTA 1HT2E 4I81A 3G82C 1RC8A 4I4LA 4L5BA 1OB2A 4Q48A 1M1YE 4LBYA 2Q3HA 5ELXA 1SVMA 1A2BA 4Q21A 1JALA 1UADA 1ZAKA 3RS7A 4HUTA 1Z0FA 5F9HA 1R0YA 1T0JB 1KJYA 1M74A 4A0GA 4Z8XA 1YRBA 4A8JA 4B71A 4HEJA 4DLRA 4JYBA 2IYUA 4C0BA 1YE8A 5E95A 5JFGA 4MYTA 2PLFA 1RIFA 2WSSD 4KYUA 1X8JA 4OL0A 3PUWA 4L4UA 3CPHA 5KSOA 4J0QA 5CDFA 4LK2A 5FPHA 3K0SA 2C9CA 1DO0A 1JPNA 2QORA 3LBNA 3D6TB 4D80A 4IDQA 1XMJA 4B3FX 2ZETA 4BFWA 4BFSA 4RCYA 2H92A 2WIAA 4CIDA 1TMKA 5JWOA 5UKDA 1B0UA 1XRJA 2C03A 2ZE6A 1E1QD 4P33A 5E7JA 2Q3MA 4IOLA 1L7VC 3JVUA 4H1VA 2GXSA 2VSXA 3BBPA 1UKEA 5TV2A 5FTLA 3ADDA 4U00A 2Q9AA 2Q9CA 3X2SA 5JHGB 1A82A 3SJBA 1D2EA 1N0WA 3EWSA 3PCRB 3WP1B 3O8CA 3FOZA 3I61A 2FGKA 4CEIA 5FH9A 4XIGS 3QXSA 2JCSA 1R2QA 4P4UA 3SQXA 4HB0A 4LYHA 1XFAA 1OF1A 1N6PA 2MMCA 3QNUA 1XPUA 5JSZB 4C0JA 2ZRCA 3IHWA 4XWOA 3A1TA 1AKYA 4I1VA 3ZLJA 3AVTA 3FVQA 1KSHA 4DB2A 3V4RA 1MKYA 4PZZA 4E07A 4BFTA 4PHFA 2F9MA 2GVDC 1U90A 1R8SA 2R2AA 3FHCB 4TQ9A 2OG2A 1N6LA 4HLUC 1DAEA 5GVRA 4EQ6A 4BWYA 1SKQA 1SKYE 4BEBA 3GLFB 4NTZA 3G5UA 5C4MA 1XDBA 3BH6A 2IC5A 1QHHB 2VSFA 2IT1A 3THXA 4MYCA 3GLGE 2FFHA 4UKDA 1KJWA 2Q9BA 3QUSA 3RDPA 2ZQ5A 1OE0A 4IOJA 4KO8A 3GLGB 3PEVA 2ZSBA 2EWWA 2GVZC 2D2EA 3I5XA 4AIIA 3ZJYA 1Q1ZA 2B8WA 1E99A 2QENA 1NVVQ 3T5DA 2ZSDA 4A8JC 4C2TA 3SS8A 3WMFA 3AKEA 1TQDA 2GZAA 1X8KA 1OYWA 2QAGB 2VA8A 2A78A 5DISB 3BORA 3SEAA 1M7BA 4TT3A 4JT4A 1XTJA 2JDID 4BQSA 5K8LA 5KNBA 4JVNA 2XSZA 3PITA 1FNNA 2V54A 4JLAA 1TF2A 2PMDA 5H68A 3C5CA 4EFLA 2ZYVX 3A4LA 1E9CA 5EQTA 5JCPA 4C7OB 5IK2D 3LLUA 2XTMA 2ZRMA 5FR1A 1F3OA 2CLDX 4LV6A 2ZPTX 5DI3B 3SBDA 1G19A 1HE8B 2ZJ2A 4BEJA 1VECA 2ZROA 2IYXA 1G8GA 2NTYC 4OHZA 3SZRA 3RHFA 3KKMA 4CYMA 4P0TA 1DOAA 1G18A 3Q85A 4JVLA 4DT1B 1XTIA 2O8FB 2UZ3A 3KXKA 3EPKA 1T6NA 4URVR 1KOFA 1XWIA 1GZSA 1X1SA 2OCBA 5C1BA 3TSWA 5AJWA 4M2LA 4TL8A 2VHTA 4UNQA 5FUWA 1NN1A 4IJMA 1XCMA 4A6XA 1D6JA 1I4TD 2CCJA 4IVQA 2XTNA 1TF5A 2FWRA 1JR3D 2EW1A 4JYCA 2GEUA 1FL9A 1ETUA 1P2UA 1XEXA 3UKDA 1Z0JA 2ZS8A 1P5ZB 1TL7C 1YR7A 2GCPA 1EWRA 2OBMA 3NBXX 1JJVA 1YU9A 5H70A 1OPXA 3ZD6A 2ORVA 2KE5A 3DZ8A 3VAAA 1E2MA 1Q57A 1GM5A 4DSUA 1XB2A 1TQ2A 1T8TA 1CR1A 1GKUB 4IDHA 3U7EB 1G8PA 1SHZA 1IN4A 4HUQB 2WMNB 1EWQA 1KMHB 4QGGA 2CXXA 3ASYA 3PQCA 4TLCA 4JJKA 2OM2A 2AL7A 1ZC3A 4MGYR 2CMKA 1Q21A 1FMJA 1N6OA 4HAXA 2XGJA 2W2TA 2GJSA 1YQTA 5HZHA 1IN6A 1I4DD 3U44A 4ESHA 1Q20A 2WOJA 5EP1A 1KI9A 1FNMA 4FCVA 1DG1G 1E9DA 1YJ5A 5BN4A 1HURA 2LCFA 3CB4A 2CDNA 2W58A 4LI0A 4AWXA 5JLJA 4YDSA 3L2OB 3W34A 2QEQA 1KK1A 4IRUB 2JJ2A 5FPSA 4BLPA 5KPJA 4AG5A 1NMYA 2OCPA 3FE2A 1RRCA 2ORIA 3DMNA 4DSTA 4DLZA 1KIMA 2XOKA 3T1QA 4XJXA 2LWIA 3ONWA 4AG6A 1ZVQA 5J40A 1E32A 3U3OA 3WYGA 3DPUA 2QE7D 1L2TA 4PQFA 4BECA 5JJKA 2NO0A 1KY3A 2YOHA 2ZI9A 2IYLD 4JMPA 1WP9A 2ATVA 4OK6A 4BZQA 5CM9C 1NRJB 4S2EA 2JLZA 3BB3A 1AZSC 2O0KA 1X86B 1D2MA 2QUZA 3CF2A 3KDSE 4Q4LA 3I62A 4RJLA 3I72A 4TSFA 1S96A 4YONB 2RGAA 2ZAMA 4DUGD 2HT6A 1JQLB 1Q3TA 2JGNA 4MUAA 2IYTA 2RHDA 1E2LA 2IYYA 4TMTA 1H8HA 5FL7A 4AKGA 3VKHA 4BLRA 3EZ9A 3AM1A 1N2CE 1NKSA 3WHKA 3MMPA 5F9FA 2GETA 4V0ME 3IHLA 1XJ0A 3B9PA 4QGAA 2O8EB 1ZNZA 2N1BA 1E4YA 2CNWA 3CNNA 4NCKA 1GWNA 1TU4A 3TSZA 2F1IA 1XNJA 2IF0A 1IONA 2CE7A 1E2DA 1OJLA 1HQCA 3L0PA 2ZJBA 4PSVA 5AJYA 1SXJA 2ZAOA 5A5GA 4F92B 3GLIA 2HJVA 3Q7PA 2HYIC 1G3UA 2V6JA 1F2TB 1BOFA 4AC9A 1KK0A 2IUTA 3W6PA 1MABA 1VCIA 3WP0A 5FPKA 2ZVPX 2BM0A 1G1MA 1HH4A 2YZ2A 5JECA 2C9YA 1QVAA 1K8RA 3OE7D 4JBWA 1XEWY 3W3AA 3MGCA 3SHWA 1MO4A 4Q1EA 3UMFA 4NL4H 4OBEA 2QP9X 3A1UA 4GPTA 1O87A 5E7MA 3ZIAA 1I2DA 3U5ZB 2EFEB 2DWOA 3B60A 2KI5A 1MO6A 4HB2A 4B3CA 2XAUA 4V0OA 4LPKA 3GMTA 4ZI3A 1E69A 3QPWA 1QZXA 1E2JA 1M7GA 4QXAA 1E9FA 1IN8A 3LY5A 4NCNA 4XD7D 1QBKC 2ZS7A 2HLDA 3IPYA 3SC3A 5DI9A 3K09A 3P4YA 2C2HA 4BFVA 2ANBA 2CVFA 4MDEA 4JT2A 1Z6GA 3MAAC 5KSZA 3I73A 4F91B 3KJIA 1Z0IA 4LBVA 5A4JA 1J99A 3Q5EA 2GJAA 2CEAA 1G5RA 5G53C 2A5DA 1NF3A 3GFTA 3M6AA 4PAQA 2GZDA 3M1IA 2BBTA 2F9LA 4PXAA 3A6PC 1Z06A 421PA 3W3ZB 1JEDA 2IK8A 1LNZA 1YR6A 5FBQB 4O3MA 1PJRA 1TU3A 4WW0A 4AURA 2CL7X 1E3MA 1ZINA 1JAIA 1E1RA 3MLEA 3B5JA 1OKKA 4RD6A 1GDDA 3KJGA 1E9RA 3AF1A 4B3GA 2PEZA 4QJ4A 1GL9B 2CBZA 3UANA 2A3RA 1CJTC 1VIAA 1EK0A 1AA9A 2MSDB 3AP1A 1JEEA 2ZR9A 4MKGA 2BDTA 2QMOA 3B1ZA 4RD4A 3UATA 2OILA 4TL7A 3TK1A 3KXIA 4Q47A 4ZPXA 1W2GA 3LFUA 3THYA 3CX6A 3CRMA 4FCWA 5DH9A 3QKRB 4D0NA 2BHRA 2X2FA 1GAJA 3C5HA 3K8YA 2E87A 5SZJA 1ZU5A 1K5GA 4BZPA 1JPJA 1NLYA 3SYLA 3FB4A 4G01B 1CRPA 1E2IA 1YZLA 3A36A 4FXPA 3K9HA 4YMWA 2YWEA 2ZI3A 1RE0A 3RSOA 1EFRD 4M1MA 2WWXA 3GJ5A 3WRYC 2V9PA 3HWSA 3KFVA 4OQMA 4IOKA 1C4OA 1YHNA 2YOGA 1KI3A 3LBIA 1S0UA 2EWVA 2MMGA 4HZUA 4IXMA 2QM7A 1VG8A 2YWHA 5AJZA 4K81B 4X8HA 1OH8A 1M7HA 1IY1A 2REOA 4EIWA 1NN5A 4JVMA 3PV0A 4Q4HA 3K70B 1XEWX 1ZIPA 1PUJA 1QHSA 2NO7A 2Z83A 3IO5A 5J4YA 2A5JA 4RVCA 3FKSD 3K09C 1SULA 3WHLA 3BFKA 3SOPA 4Q9IA 2QL6A 1J8YF 1WXQA 1DAFA 2BJVA 2QTVB 5JBQA 3X1DA 4NYMQ 3N2EA 1XU4A 2XX3A 2AWOA 1T3LA 2AXPA 5EE9A 1H65A 4DDUA 4TZ6A 2YWFA 4MKHA 5JS8A 2W6IA 2VP9A 2J45A 4P3YA 3ZQJA 5KPDA 1NBME 1EX7A 3GLHE 4P4SB 3C16C 4II7A 4FMCB 4XTCS 2ZREA 3MWKA 3EZ2A 2OE2A 5E7IA 2G9NA 2ZR0A 4Q4JB 4WXRA 3SN6A 4FMCF 1V43A 4DSOA 2ATXA 1CR0A 1AZTA 1L4YA 2ZJ8A 1U2RA 5DHFA 2HCBA 3UK6A 1SGWA 1E96A 2CE2X 1GOTA 2GHIA 3HU3A 4UJ5A 2YVUA 3VNVA 1UEJA 3IIMA 4IDNA 5AUNB 3R9XA 1JBKA 1DARA 1F5NA 2VSOA 3C7KA 1F2UB 2WMOB 2ZI5A 2KBFA 4QL3A 2J0UB 4M4SA 1ZRHA 2YWGA 3LW7A 5BYJA 1NMZA 4CEHB 4LC1A 3B1WA 4PPQA 1JI0A 2FX3A 2VBCA 4DLXA 4D0LB 4Z8YA 4UXJA 4QBGB 1GL7A 4C3ZA 1C1YA
chains in the Genus database with same CATH superfamily
1VI5A 2JAWA 2C92A 4LJYA 3FWZA 2CKDA 5FBZA 1P7YA 4KPGA 3AFMA 2I6FA 1DJQA 2OO3A 3H0EA 5B58C 4PSKA 3PHHA 1Z3CA 2FPPB 3MWLA 2W2LD 4KU4A 4DADA 5KVSA 2HCTA 3PQ4A 3EXHB 2XMRA 4PFQA 3UPDA 5KJFA 5L3QB 4JXZA 4FWIB 4DLBA 5BSGA 2CT8A 4TWZA 5B7PA 1I2MA 1YJBA 2X4IA 4ROSA 2I1VB 3ZVMA 3G88A 3FROA 1YZVA 2FUNB 3IB3A 1NUPA 1Z8FA 4NPAA 1T1EA 2EL7A 5IC6A 4D43A 1SVIA 2BHTA 2QX9A 2Z04A 3DAYA 4FGKA 1ESZA 4IFBA 2PCLA 3BE8A 3P4UA 4KIGA 1R18A 3KOUA 4HNSA 4U39A 5FLKA 4RO0A 3DT9A 1TVCA 1SM4A 4WXEA 2XH8A 4RORA 4RACA 2JAXA 5CVDA 2XYQA 3C74A 4RZ3A 4EARA 3ZCPA 2VPXA 2P0YA 4JUBA 4LV8B 4LZWA 4NNPA 3T15A 5I4CA 4ARZA 1ZHHA 1JIIA 1W25A 3RAEC 4XQ0A 1V9SA 2HK6A 2I54A 5G4KB 3WZMA 2ZUCA 2R1TB 3R77A 1QFJA 1I1OA 3FNEA 2W83A 1XCJA 5DWVA 2PH7A 2J32A 3GAFA 1H4QA 2BFCB 2VUSA 4Q16A 4FR5A 5MN4A 1Q0LA 4X6XA 2J41A 3R3ZA 3NWPA 1VDZA 4YWJA 3DTVA 1KH3A 4BU1A 1KFBB 3K53A 2DFKB 3STUA 2O3RA 1OWPA 2DFVA 3H8JA 3SR4A 4LNUA 1RWBA 3LUBA 4G24A 4PIMA 3WK6A 2OFXA 2IH2A 1T4MA 1NRIA 4Y1RA 4S3MA 1KK3A 3IR6A 4UDXX 3THOA 1VLLA 2AC4A 3EDOA 4GM4A 1G98A 4F4IA 4EJSC 2YWDA 4V0RA 1O7JA 1U1DA 4INZA 4W1RA 5EMLA 3TUZC 1BYUA 2BKUA 4TROA 4LZJA 2O6LA 5JJLA 2IZOA 2CXHA 1TX4B 2D0IA 4TV9B 3HU2A 5JJBA 2OC4A 3VR5D 1UK9A 4PRLA 3ANSA 4DQUA 2NXEA 5B3AA 2PZGA 1EWKA 3L7KA 3F4KA 4GMDA 3QKTA 2XZPA 1RABA 4RNCA 5GOZA 4W5WA 3ER9A 4EBFA 4KSYA 1JXQA 1W35A 5D5QA 1WNTA 3ISVA 4YDHB 4CM9A 4RE5A 1SQFA 2COUA 3HGMA 1PW7A 4Q3KA 3EX7C 1W9HA 2Y9MB 2XE6A 3JD4A 3KK0A 4QO8A 5K3FA 2H07A 4BKOA 2QD2A 4ENTA 1V71A 4FXOA 5HFAA 1XTKA 4PSAA 5K51A 2YN4A 1UDWA 1MGPA 4GVXA 3MTEA 5A9TA 4LJKA 1UBEA 1IM8A 4RPKA 4QGSA 4UM9B 3FFBA 1F5SA 2I03A 3KVOA 1ZUNB 1TNDA 2JLQA 2WDZA 2XYHA 3K70D 1IPFA 4TM8A 6Q21A 2PA3A 4QEKA 1W6UA 2AEJA 2E37A 3NT4A 3NT5A 5BVHB 3L7LA 4YXWA 3G5LA 3M89A 1JLKA 1K86A 5IYZF 4F4UA 3TH5A 2IH4A 4OQ4A 3U1BA 1M1NA 1TMOA 1V6AA 4JLBA 3W77A 3KSBC 2PMEA 3ZHXA 1C9YA 3Q3JB 1JKXA 4ZOLA 2QTLA 3D8TA 2O5EA 3EIHA 3Q2OA 2FN3A 3WA6A 4D4GA 3VO8A 1A9ZA 3IAS1 4NZYA 3QSGA 2JIZA 1UP7A 3OKCA 3NPAA 4B84A 4JXXA 4CTKA 1CEYA 1G5TA 2YC4C 4H2DA 1RPZA 3OFVA 1W49A 2Q4DA 1TZMA 2AFIA 3LPDA 2ZE5A 3NNDA 4PQYA 3UM9A 5C0OE 1QAOA 1JFFB 3L8ZA 1H3FA 5AXDA 1YE5A 4GIBA 4Q34A 4B6OA 3C48A 2V58A 3A6DA 4XR9A 3PG5A 4R7ZA 2WEKA 1TK3A 3C45A 1NVXQ 5LFAA 4QQ8A 1LSUA 2NT3A 2OCYC 3PFFA 2KS6A 1FMFA 2C84A 4FFBA 4INPA 4N3NA 4PG5A 4RY2A 1QJ4A 1CF9A 3SJAA 2A88A 3CR7A 3ZV6A 4JHLA 1IXZA 1PKEA 5GONF 2WWFA 2B8JA 1IRXA 3EULA 3MLBA 4DWOA 1DKQA 3Q1LA 4OHFA 1MO5A 4U2BA 4HXGA 3P2MA 4KO2S 4I0WB 2AXNA 3NBKA 4LV5B 1NSYA 2PJZA 2V03A 3TZHA 5H4HA 4AF7A 2G1AA 2Z9CA 1KU6A 4FCTA 1OBOA 4KGDA 3IULA 5LYJF 4NNOA 3AUJB 5LJLA 3IOMA 4C5BA 2HCRA 1GZ4A 4MWOA 4HFNA 4EGJA 2Y0CA 2UUAB 4LIPD 4I4TF 3AYZB 3DV2A 3E5MA 4I9NA 3U31A 4F8EA 4Z3OA 3EPHA 4PO1A 2AJDA 2ZSIA 4HGZA 3L1VA 4OKSA 1GPJA 4BGIA 2CJWA 4X24A 2BTEA 4WKBA 4ZT4A 2CWWA 2Q5HA 5FJJA 4CMIA 4L4SA 5JZBA 2N0SA 4UTNA 2HGSA 1L4LA 1Q15A 3JAKA 4WXPA 5JBIA 2OSBA 4GQBA 3ECCA 3P9CA 2CJFA 2JJYA 1WU8A 2AUMA 1VL6A 1BKDR 1EFLA 1PEAA 2E21A 2VEOA 1OYYA 2R8ZA 3V7WA 1BSVA 2JCGA 2BFPA 4B3DA 5A5DA 5D3MB 2A86A 1MQAA 2BTQA 3A37A 3CTMA 1E6KA 1TJPB 4HWSA 1D04A 2RJNA 3I4LA 4TS4A 3WLSA 4CV1A 1FYEA 3OMWA 1RZUA 1YQQA 1QXSA 3CUEF 3I2FA 1F6DA 1A7UA 2YIDA 2PQMA 2GNAA 1G16A 4RD1A 4GQAA 3QZUA 3W8EA 4QOHA 3VMFA 4UUBA 3V55A 1V7ZA 1E1LA 1TW2A 1DTSA 1PW5A 2PRZA 4KFSA 4MXDA 3BK1A 4LXGA 1Z15A 3KB8A 4A2WA 5JSYA 2NYAA 1UQUA 4RV9A 4HQFA 2PL5A 3L01A 4MVJE 4RENA 3I9V6 2I7XA 4LCBA 1V5IA 2H08A 4CMEA 2O1SA 5BSFA 4LHZA 1OILA 1PZMA 4PZEA 4ZREA 3T38A 1JQJC 2DY0A 2WM9B 1IWOA 4CBVA 1QB8A 3AW9A 3HDQA 1Y42X 1TM3E 1V4VA 1WPQA 4J9VA 2FRVA 3PJDA 3EEYA 5EE3A 5LBUA 1S3FA 1Z4MA 2YWCA 2ZUFA 1VRWA 4YPFA 4H4DA 1NVBA 1RIIA 4OLJA 1IPHA 1FP2A 2WWWA 4ATNA 1ZOSA 3R7SA 3NT2A 1AKRA 1P1RA 2PLRA 4AICA 1KL7A 3ZNQA 3NQ41 3CUYA 1NKVA 4GWLA 3HKCB 2GA9A 4LYGA 2PGLA 5BNWA 3QP9A 2OBBA 3O3MB 4GPD1 1DJMA 1YRQA 4QOJA 5HEKA 1Z0KA 4QREA 3ZV5A 4X85A 1SU6A 1QQ7A 5DM2A 3LL4A 1XNHA 2WYIA 3D9QX 3H7IA 5FLXA 2BGNA 2BW0A 5H3CA 3GLGA 4MI6A 1Z47A 4A2CA 4XYLA 2K7ZA 2ZB2A 4EFMA 2WVGA 1H8EA 2WOOA 3FW1A 3F2VA 4MV4A 4MVJP 2I2BA 1II8A 1BXRA 4XWAA 2WD8A 5CVCA 1ZSVA 3OE4A 1VXOA 3ONNA 1W0CA 3ZUGA 3OI7A 3ANTA 4GGMX 2QAGA 2QN3A 1OH6A 1VMDA 2P75A 3O4VA 3PE4A 4K9KA 4CEIB 4CR8A 5FORA 1VYTA 4ER0A 1E58A 2DWQA 5CA0A 4UUNA 3P4XA 2GCIA 4ZZ0A 3UFBA 1OAOC 2C59A 4KQJA 1ZYUA 3AC0A 3QMPA 1H2YA 4UM9D 4YX9A 3UUWA 3NGLA 1GAWA 5BW4A 1IOZA 4MMXB 1QOPB 1R5OA 1XHLA 1W59A 2IEAA 1N5RA 2YMQA 2IOYA 4ZWNA 3W9YA 4F93B 5FUVA 5HKLA 3AHFA 1NUHA 4JKIA 4AJEA 1RPJA 2OHHA 1GUZA 4TN5A 3ZJTA 1SNYA 1QHIA 2RI6A 2EKBA 1MLDA 1WXFA 3MMSA 4K0RA 4BLWA 4D9KA 4EQ6B 5K8IA 3UPTA 4ACBA 1PG5A 2ECQA 1UFRA 4PN7A 1UJ2A 2G1JA 4WKNA 1G7SA 4C2UA 4FIDA 3JYHA 2NUTB 3EA5A 1PEDA 1E0SA 1XYGA 3THXB 2WD7B 1T9AA 1Q0ZA 3EN0A 3RUPA 4ZQGA 4S1PA 1ACJA 2AZXA 3KVRA 4JOBA 2OPHA 3VU9B 1W94A 3UW1A 2JKVA 2ZIFA 2KJQA 4H27A 5AJXA 5M2QA 1T2DA 5TRTA 1EUQA 1GTJ1 1Q7CA 3HCRA 5THQA 3VO2A 5FOTA 1U2ZA 4PCLA 2H7YA 1BMDA 1T1IA 5AIAA 1KDZA 3ZJ4A 2MJLA 4RL6A 4D9BA 4FFOA 4RA9A 1DOZA 2TMGA 4UUAA 2PL1A 4PX3A 4O2LA 2GNOA 4UM8B 3P27A 1Q91A 2WB4A 3DOJA 1SC9A 3DUFB 2PUAA 1SUDA 1E79D 1PGOA 1ZCFA 2G5GX 3IYLW 2VP6A 3F9CA 2BSXA 1LS6A 2D5LA 2WNHA 4C7KA 2XDQB 1W1WA 4RK0A 2GB4A 3RBXA 1ONNA 4RD2A 2HEIA 2JL1A 3FMIA 4X44A 4D81A 4HUQA 3HZOA 4G63A 5AI6A 4GX0A 3TKLA 4DCOA 3L7AA 3PPXA 4ZI7F 1OI2A 2DKNA 4KRXA 2FLVA 2B8TA 4J1TA 1IUKA 4MW4A 1F8GA 3ORSA 5A6SB 4NECA 5IVPA 4W5RA 2P77A 2LDBA 4YWHA 2WJHA 2B98A 1C2YA 1CP3A 1PWZA 2XNJA 5BUCA 1AJEA 1PNOA 4I8XA 4JLVA 4R1UA 1A0OA 3GPCA 4H7IA 3RK0A 1O9GA 6NULA 2AWNA 2QTTA 1NYQA 1W34A 2BJWA 3EY4A 4G67A 5EESA 1A88A 2OORA 2ZKIA 3E8MA 3OFKA 1XD2A 1Z68A 1EWVA 2GN0A 4LCEA 2OT3B 2QAGC 4YJ2B 1KVSA 3V1UA 1F06A 4IWXA 3DEAA 2VDOB 4UQOA 1F38A 4JC8A 3SXUA 2QSJA 2G83A 2PX4A 2Q3LA 4BDTA 1RPTA 5EIOA 1ZJJA 1N25A 1EB9A 2QN2A 1A04A 1RLOA 2WUWE 3A6JA 3BJMA 3KR9A 4GRDA 1BW9B 4GSKA 4JUFA 2GYWA 4A91A 4YYZA 2ZIAA 5K0LA 3U7RA 4Z53A 1ZNYA 4D4KA 4AMZA 2D59A 1Z7BA 3LQFA 3B5IA 2O3JA 1XAHA 2C8JA 4Y7DA 2GN8A 1WSAA 1ZHFA 3PDIA 5EP3A 2HWUA 4DIMA 3ZNPA 1AMUA 3WTCA 2Q7XA 3HJRA 4IEEA 4E5MA 2AMVA 5ADVA 3ICEA 2BOVA 4GE3A 1WY5A 2CZCA 3KZXA 1VTKA 5TEVA 4BMPB 1JDPA 2FCRA 3ELUA 4U7FA 2YYSA 1XCLA 2PMBA 4I8IA 4KYTA 3X44A 4MW2A 4BLQA 4R69A 3QXCA 4D3DA 4DG9A 2OZEA 3E2PA 1BNCA 4XDYA 1ZRMA 4ND8A 5FL3A 2ZU6A 1DQYA 5C52B 5ENVA 3N2KA 3VDXA 5DKFA 1DG3A 3JQGA 3KALA 2OXEA 1K5PA 4QXRA 4KXLA 1UBJS 2FU5C 3OEEA 4G5XA 3U81A 3L82B 3LO5A 1K27A 4RTMA 1VYVA 1C7QA 1H2RS 4WMLA 1TKRA 4Z7JA 3S40A 1K98A 1P9RA 2HJRA 2IIBA 3F7TA 4OV6B 3IMGA 2FEOA 1RWKA 3BF8A 1K5HA 1TTHA 3U3MA 2R4TA 1GA4A 3A31A 2G67A 3M49A 3U7QB 5MFPA 1MGOA 2ASEA 4O1MA 5LZ9A 2G7ZA 4LJRA 2OBLA 1UKYA 4ZVOA 4QTUB 3HU1A 4M6WB 4PX2A 3REFA 2CD7A 1BJKA 5M3BA 3TQCA 4D9CA 3SR3A 1UM9B 1AX9A 5FRDA 5C5IA 5EHIA 3RWMB 2PUHA 5CA1A 4Z4EA 4YRSA 2IDKA 3ER8A 3E3AA 2V6FA 4YJKA 3SGLA 5JH7F 5HX7A 5T4BA 1Y5NA 1OHHA 3HMKA 5KCMA 5IUNC 1SKBA 1N9GA 1W85A 5JDCC 2UVDA 3O9VA 3V5NA 2I2DA 2MSWA 3A6GA 3BXGA 4WAUA 1UMCA 1NAIA 2RGYA 4KDRA 4ZO6A 4BFLA 4BGDA 1IQPA 4LWPA 2JHCA 4JB0A 4MQEA 4J7AA 4KI0A 2K87A 2W6CX 1C9EA 4PTLA 4FJ0A 4GEKA 1CR4A 4LX0A 2X3UA 1YZGA 16PKA 4KXXA 1Y7LA 1RLTA 3OEYA 2VDWA 1Z0AA 1IK4A 4RETA 3K5PA 4OEHA 4DVJA 3WLIA 1PWXA 1QF9A 1R12A 4IBOA 4NMWA 1DBPA 1C80A 4EKNB 2QRQA 5IJ9A 4PR3A 4BO3A 3W5IA 3K9GA 4LWOA 2C9ZA 1KEUA 4GF5A 3KPVA 1N7IA 4WK2B 5HS4A 3G68A 5CDYA 2Z1MA 1P81A 3KKLA 4U2GA 1GZ5A 1W0KA 5CH5A 4BJ5A 3FFXA 3I1YA 2XB8A 3WC4A 3UAVA 3FWYA 4K28A 4KBFA 4X41A 1YRWA 3D3KA 4D9IA 1AQUA 1JVNA 1QM5A 2ENUA 3LTEA 4CKXA 4QIHA 5I9MA 5TQVA 3ECAA 1ZK3A 3T5MA 5LBIA 3LKBA 2IPAB 1S2IA 4YLYA 4RKFA 5LIPA 1STOA 4QEDA 2E2WA 3NHBA 4B81A 3AL3A 4A9AA 3GLIB 2VK8A 2FSHA 1TEZA 3E7XA 4B3MB 1U6KA 3D3EA 1D1SA 3P9KA 1P2VA 5E7QA 5A1JA 2GM9A 1MX3A 3UWDA 4LW8A 4RUKA 3WK5A 1RVV1 3DEFA 2IPNA 4B7UA 5I4BA 1OGIA 4D44A 2G40A 3NHSA 2HJGA 4K86A 1QLJA 1ZK2A 4P8RA 3UWKA 2HWKA 1L6RA 1QDEA 2YQZA 5AOAA 2QUBA 2Z4RA 5JMPA 3TTUA 1P19A 4RTJA 2QP3A 1SOVA 1S8NA 3C15C 3M2TA 3PNQA 4N5IX 4B32A 2F55A 3W5UA 3JTMA 1LPAB 1OLUB 4FM9A 3GQVA 1KC3A 4WXMA 3KSMA 3A1DA 1V7PC 4RSRA 4XIIA 5CDHA 1Z29A 2PX3A 1XCOA 3G0GA 1AXRA 4MQMA 4XZ3A 3JQ9A 4IHJB 4A03A 3ZDXB 3OM8A 1ZUHA 2IV7A 1WMBA 4Q66C 2C07A 3PBKA 4F9GA 4YVFA 2B99A 1OWOA 4MNTA 2GQ0A 3KYDB 3LP6A 3RBZA 4CG2A 3MTGA 4QJBA 2HJSA 1HFJA 1BWSA 5K3AA 3VOTA 4YCBA 2IV2X 1U3WA 4Y7CA 3KQQA 2XITA 4EFDA 3FOBA 3MUEA 4G84A 4JJFA 2V65A 3TW8B 3WR5A 4D4MA 3ECSA 2VUTA 3CPJB 3CEHA 4C07A 5BNZA 2CBGA 4IIYA 2GBLC 2X5XA 2HA5A 4BNLA 2VT3A 4F6RB 3HPRA 4ZEVA 3E9RA 4YP9A 2AFHA 4KQCA 2E5LB 3ICQB 3D4IA 4YRLA 3FBGA 1YSCA 2DH5A 3MERA 4RPJA 4Z4CA 1LSSA 1EAYA 3O8DA 3IOEA 3R41A 4Q18A 2I4NA 4D46A 2AFHE 4FDMA 5JMTA 4HEA1 2ZSUA 4CGYA 4GWKA 4NE2A 5G1OA 3TZBA 4EJ2A 2B0CA 3N0WA 3Q3VA 3AB7A 1YJCA 3BKXA 1U2GA 4PGMA 2DLCX 1UMDB 1NASA 1NFRA 3DW1X 5C4GB 4QJ3A 3OIWA 4Q3NA 2BBOA 3GZ4A 1EFHA 2DZDA 5ELLA 4HNAB 2VPPA 3CLRD 4MH0R 2YHAA 2YW2A 4F2GA 4G9GA 3VYRB 4S1NA 1H22A 4N7MA 2WICA 4D4IA 1T5HX 3NYIA 1E62A 3HNOA 5EXXA 2G82A 3LUFA 5ESWA 5CVTA 2HSZA 3L05A 4PHHA 4RKEA 4QYXA 5F33A 4Y6LA 2X22A 2OZKA 4MUEA 1GN9A 1ZRSA 4QQNA 4IG9A 1WETA 1QFYA 2IE0A 3BJIC 3A7EA 4X60A 2VDUE 1U6JA 4N48A 1ZM4A 2ETVA 3IXLA 1GPUA 3B5EA 3FVWA 4HL6A 1GSAA 1Z34A 3OZDA 4C3VA 1R4MB 3RSZA 5KQRA 4FMBB 1SC1A 1XTZA 3C1AA 4I5DA 5TQJA 1P62B 1E3DA 1N2OA 1T43A 3E2IA 5LKRA 1AM4D 3SC2A 5IARA 3QW4B 2C8VA 4WLFA 3OWHA 1DO2A 1BZYA 2VT7A 1U7WA 2BEUB 4KJXA 4YQZA 4QTYA 3H2YA 2FGJA 1ZJWA 1RJGA 2EP5A 5GWXA 2BI8A 2QROA 3GC6A 1HRDA 4MVCA 3EFOB 3NRBA 3WBFA 5D00A 5KOYA 1ID8A 1NONA 2JIQA 1GV0A 3L0BA 1TK9A 3PRJA 1C1HA 1MG0A 2WTNA 4FGZA 3ROXA 2D13A 2YZMA 5FUBA 1CVIA 4DBVO 1YASA 1B76A 3JSXA 4EHDA 4M8KA 2PS3A 4IDCA 2B2NA 3IB6A 2GXUA 4L16A 4GYJA 4FILA 1DTEA 2GN2A 3QF4B 1M2GA 2R0QC 2P9EA 3ICVA 3P26A 2W6JA 1Q1AA 4DCSA 2XGGA 1T24A 1ZN8A 3DMTA 4CG1A 2DBVO 1PS9A 3MJHA 3K6SB 3R3WA 1A9QA 3F4BA 4WQMA 1RWOA 1X7HA 2DPHA 5B64A 2DERA 2DSNA 1G20A 3KVYA 4D0RA 1XKLA 1OYVA 3ANXA 2V9CA 3PPYA 4AJIA 5JCXA 1SY7A 4HAIA 4DV4B 1L4EA 4HXYA 1C8KA 3GG9A 4NBVA 3K73O 5CHYA 1FRQA 1H8HD 3OECA 1U3VA 2Y1GA 1JEQB 1DIRA 2CLCX 2ZP1A 1S2MA 1ZK1A 3CINA 3SBOA 3DEHA 3F49S 3Q8WA 2IXFA 1OU4A 1JHXA 1U2GC 2C2YA 5EUBA 4AWXA 4BB0A 2BGWA 3CF4G 3IIIA 2APJA 2NU6A 4TVOA 1OFTA 2Q27A 1CULC 5CK5A 3M3HA 5ALGA 2O5CA 1QGZA 5DFAA 1UP4A 1QLHA 1NLZA 3R9XB 1U0NA 2SKCA 1U94A 1JBQA 2NV6A 4Y2YA 4IAOA 1PS8A 1S7CA 5HJ2A 3UGTA 5HOEA 1P4AA 3EC1A 4Q3EA 3DM5A 3EPPA 5HG0A 3TIXB 1DJLA 5ICSA 3V2UA 1X9GA 2K4MA 3OU2A 2ZE8A 2ODEA 3QEMB 1T9CA 4DA7A 3IERA 1ESNA 2JFOA 2BFWA 4O4HF 4CDMA 1FFWA 2GYVA 4GUDA 1YRYE 3RUHA 2ZWIA 4CUKA 1H6BA 2BCEA 2NU8B 1MBZA 4MI3A 5KMGA 2CVPA 2NQ2C 3KLMX 5IVDA 4N9WA 2X0IA 3E1KA 4L85A 3UCXA 3VBEA 4TLDA 1XEAA 3Q98A 3PQ8A 5KO2A 2VAXA 2D1RA 1KPGA 3N70A 2DBQA 2J67A 2O2EA 2O4CA 3AOGA 3BZWA 4E5YA 3GNSA 1ZESA 4OP1A 4K2AA 2G8NA 1VM6A 4A3SA 1XALA 4DPMA 1RADA 3URMA 4ENWA 5IH7A 3CVVA 1F4LA 4POAA 1IN5A 3HVRA 3GD5A 5MHTA 3HJAA 5H9WA 4JV5B 1B14A 1Y5MA 2IHUA 4C0HA 2GRJA 1F60A 4FTWA 5L7WA 3FIUA 1VKZA 2XWQA 1ZGHA 3EOBI 2CMHA 4L50A 4JQYA 2YJTD 5A2GA 4FVTA 2XUKA 3EG5A 3E3MA 3L9WA 3UT5B 5D87A 2JBWA 1AQJA 2A6PA 1OVMA 2QTMA 4MJ3A 4YA6A 2XKAA 1E7MA 2QMHA 3N8GA 3E0QA 4D74A 2WU1A 5B36A 4TL6A 3QI2A 3LQKA 1QDUA 1WY7A 2AR9A 3H04A 5JV5A 1V96A 2BFFA 5U4QA 3VR6H 3ZHOA 3FF1A 3ASZA 3ORYA 4PNEA 5DNCA 3DAOA 3SHVA 1EQ2A 2H1LA 2FX2A 1DT3A 2R8EA 3IDOA 2QMEA 3UFXA 3ZJ5A 7REQB 4TMYA 3IESA 4Q9AA 3LOUA 4JI0B 1U80A 5CEJA 4LZLA 1Y4ZA 4URWR 4BL5A 3PEWA 1MF7A 4ZO8A 1G4AE 5KC9A 1HLPA 3CLUC 2IKQA 2TSYB 3FCXA 1DAIA 3AWIA 4EI7A 1S8AA 1ZHOA 4MPRA 3CX3A 2VP5A 3UK7A 3TO5A 3UUEA 2YXDA 2PFSA 2IITA 4J75A 5E6RA 2D62A 4XSGA 3KAJA 4BLSA 1Y81A 2J48A 4BV3A 3VA7A 2EFYA 5DLQC 4N0PA 1AGPA 3GJ3A 1GGEA 1Z6AA 2QI9C 1GSOA 3AIOA 4PVCA 4J76A 1FBNA 1K7YA 2GARA 1KHHA 2JGFA 5DTJA 1LZKA 3PHIA 2EGUA 4M8SA 5TC4A 5TQ0B 5YASA 1LBTA 1UPFA 5LSAA 5GOTA 4UNIA 2P40A 2ZJ4A 1CDDA 2GWRA 1Y0BA 4TZKA 1UXIA 1I7LA 3PLRA 4KTVE 1E20A 4HMOA 3U39A 4BCBA 1U81A 2W8BA 1KH2A 2PMKA 1PS0A 2WLTA 2P6NA 1M1XB 3HDGA 4OOEA 4ZQEA 4JX8A 3QVOA 4H16A 1L7NA 4YMLA 1WMEA 1G21A 4MGEA 3G2KA 1E3JA 1G5PA 1M9NA 2CMDA 4B4DA 5BNTA 4D2IA 3WGQA 3FTPA 4H1HA 1BEEA 1PBTA 3FUTA 1S01A 3UAZA 4HAYA 4US2R 2PZFA 3HXLA 3ROZA 4YV2A 3JD1A 3BXZA 3KZMA 3LYAA 3MAJA 4DKXA 4OX9B 5E3HA 1OAKA 3M5PA 3T4UA 4V3CA 2QXUA 4JIMA 4HDAA 1B6RA 4OYLA 3I2KA 4HDQB 1Q6YA 5GJVC 2GHQA 2FG5A 2R6AA 5IMBA 4II3A 2QX4A 2ERYA 1KNXA 1UR5A 3EHDA 4AKHA 2LW7A 4DA9A 1RU3A 3LKZA 4R3WA 2NZ2A 2JB9A 4I14A 1S2LA 4RVOA 1YR3A 2P4QA 1T4GA 2H63A 1E7WA 3QK7A 3D3WB 4HYEA 3RKUA 2D8AA 1YV9A 3ZTYA 1P0PA 4NCJA 5CPBA 5JCZA 1M34E 1M3SA 3B85A 5TLSA 2LIPA 3Q8XB 4CM4B 1GG5A 1FU8A 4LZZA 3HGQA 1MX1A 4M3NA 3S70A 4LTNA 3SHOA 4ZYYA 2R6R1 1TJNA 4M1KA 5KBYA 3CBQA 3UICA 5DGTA 2XVXA 1DKPA 1WPXA 1Z6TA 2WFAA 4HMPA 1MIHA 4JB8A 4PLWA 1DEKA 4RLHA 4TX1A 3HXQA 3H13A 2VF4X 4ZDWA 3VBCA 1VG9B 3SYKA 2KHZA 3NANA 2P7HA 4ZDKA 4MWCA 3U3KA 1HLDA 5F2OA 1A1VA 3PC7A 1GPMA 4MINA 2OHFA 1CJKC 4GBJA 1EP9A 4IGAA 3HBNA 1PLKA 2OLKA 3Q0EA 3TLKA 5JXIA 4NZNA 5CG1A 5I9NA 3PKJA 2X8AA 1MTOA 4L5JA 4RDHA 1XQ1A 8MHTA 4IV8A 1Y1KE 2O8NA 1XJ5A 1SQ0A 2EATA 4I2VA 1SQGA 3HFGA 3NTRA 4U5XA 4UCFA 1T91A 1VP3A 1VSVA 2JD2A 1P61B 2ODPA 2V6IA 2R8XA 3B51X 3FGZA 3B6ZA 3LC1O 1FP7A 4MDYA 1CZHA 2QZ9A 4C4XA 4D8UA 4BN4A 3W90A 4DUGA 3CUSA 3NKFA 3KZOA 3LCJA 3RRZA 5KJ1A 4G5YA 2ZSKA 1RRFA 4M1YA 1FUKA 3BAZA 1OIVA 3L8MA 5EWLA 4MR9B 5H83A 1KEZA 3ESBA 4MVJG 1K75A 2QQ0A 3V9AA 1ISSA 3FJ1A 3V97A 1BXKA 5WRFA 5K0SA 3F0TA 3SPXA 4PLPA 1SG9A 2XRZA 4FGSA 2AR7A 4K3UA 3VKGA 5BT8A 1HXHA 2QU8A 5E0OA 3RWBA 5NULA 4CL3A 4C43A 3VR5H 3UV7A 5AESA 3F71A 2GASA 1X1CA 1WM1A 3BPSA 3Q3HA 3IVXA 4HDSA 5JEEA 10MHA 3ZDQA 1T8SA 3OEWA 5FIUA 4ROTA 2R6GA 1GVHA 4FKBA 5H5JA 1SZJG 1WDLA 2OBNA 1FRVA 1VYUA 1UPCA 3TTTA 2P9HA 1V16B 3ZHUA 3QOFA 3H3JA 1RQLA 1GCAA 1PL6A 3EWNA 1RVDA 3TDMA 2WZDA 3EIEA 2ZRGA 2X6TA 3GP3A 4MV0A 5LCXA 3UCFA 5LUAA 3O8LA 4M38A 2MOKA 2I76A 4RSMA 1DFHA 3NXKA 4V0LA 2EKDA 3LOPA 4XLTA 1NNSA 4GZMA 4Y18A 3ETDA 4A8HA 1ZD9A 3C3BA 2ZYWX 2FA9A 4HAWA 1A5TA 1P9NA 3ESDA 1XMIA 3QTBA 4JY7A 4Z49A 2X5KO 1XO1A 2F8LA 2W2QA 4BUCA 1YB2A 3K6KA 3A2LA 3JD3A 5HKOA 2RB5A 4P4LA 5FD8A 2ILVA 3CRQA 3LHSA 1GG9A 3OH8A 3PICA 1S8FA 4RQBA 3SQMA 2HZ7A 1X0VA 5C2JB 1N75A 1YZFA 2DPMA 1MW9X 4N12A 4YCMA 3AUKA 1V5GA 2Q2WA 4TYYA 2QR2A 1P4JA 1G7RA 3OQVA 2G0NA 3NI2A 1QYVA 5KTNA 4A0RA 4KK4A 2C2OA 1XIVA 1OFUX 2QNBA 4PFKA 3RAPR 4ZMSA 3AHCA 3C3XA 5H4GA 1UZAA 1RWPA 3VR2D 4DSAA 1MB0A 2EKQA 1EVKA 3O7WA 4YJGA 3KQOA 2WVJA 1QPBA 2OECA 1C29B 1ORDA 3DQZA 3K1JA 3EA4A 2IDZA 4N41A 4R9RA 2Y4NA 3ZLTA 2WJZB 1GJRA 2I62A 1ZX1A 1P0FA 3O92A 1AC5A 1K66A 4QASA 4RQTA 3AZPA 3SFTA 3A6EA 2G6BA 4JCCA 3VDMA 2HIMA 1KSFX 2QVYX 4WVFA 3RSCA 3PFCA 1KAQA 3QA3E 1IB0A 4BWGA 4WERA 3EJ6A 4A1OA 2OV6A 1ZM7A 3P97A 2BEWA 4ADSG 1VA5A 3VTZA 5IN4A 1RKUA 1JKMA 3LQ1A 3TLCA 4E94A 1ZKDA 2WIKA 1QQAA 1UKVY 1II9A 1XZFA 3D6HA 3HC7A 4MRVA 3NDBB 4HADA 2Q6LA 1YRAA 1L5WA 5THXA 4BFZA 3C98A 2FZWA 2OD9A 3ZV7A 2DQ4A 3NC4A 3H1AA 3KV3O 3O94A 4QBFA 1XPOA 4MRMA 2Q4BA 2QPOA 3DXYA 1IE3A 2OAP1 1O9HA 3OO1A 1RHQA 1BJRE 2ZIEA 4GOLD 2FN4A 4H08A 3UV6A 5CBPA 3DEKA 1NE2A 3ZY6A 1L8QA 3GP5A 3B1XA 3MQFA 3TSCA 1TYDE 4PONA 3QVGB 3B70A 5AHWA 3ZHYA 4HZGA 1D09A 1HI9A 3GBPA 1QGYA 5KHLB 2L17A 5KDOA 1N2XA 1GRQA 2XDWA 4ZI7B 3NR2A 3TWOA 3V8EA 1A9RA 3R24A 2DC1A 3LWNA 3RT7A 1CQIA 1PTKA 3HJTA 1EEXB 2V9ZA 1NFFA 1M8JA 1US8B 2CN1A 3QITA 2OSVA 1JDVA 3A04A 3I30X 4B2PA 4EW3A 4RTOA 1XLUA 2WTUA 3MUFA 3ZYCA 5K01A 2RHTA 2YHIA 4YMIA 2P2SA 4FLMA 1JLSA 2RGNA 1EFRA 3IAAA 3RFVA 1ECCA 2HIGA 3WDKA 2NYUA 4DWWA 3QEBZ 1I5EA 1LVGA 1W5AA 1BA2A 2JFQA 2VCYA 1MC4A 2AF3C 5A3VA 3EEQA 4OMCA 1IOWA 1PEKE 3B82A 1KS2A 3QOYA 4CV0A 1JHOA 3DLHA 1H0KA 1NW9B 1MOZA 2D2VA 4H7PA 4C1NA 3CZCA 2B9EA 1BH2A 2O0JA 4NQRA 3S2SA 1W4CA 1ZGJA 1T9BA 2MSKA 1UFQA 2PH3A 3FKSA 2V1XA 3H05A 4FOPA 4ICIA 4PZCA 4C4YA 2HF7A 3VR6A 3I9V1 4YS6A 3BTVA 5ITZA 3B9RA 4Z4GA 1WXIA 3R7DA 5HF9A 1EFAA 2Y05A 4Y67A 3LP8A 3ABIA 5JCJA 1NJSA 1HDGO 1XKQA 3LY8A 2EJVA 4IV5A 3I5AA 3QJ5A 2QV0A 4Y1GA 4YCCA 4XVCA 3PFBA 3DKVA 4IIBA 4QU5A 3EGDA 2FPGA 1NRWA 1M6VA 4NJMB 1TCAA 4OHXA 4S24A 1KH1A 1HLGA 1SQ6A 1TVKB 2AVDA 3ZEIA 4OLAA 2D06A 1P4SA 4JYMA 1ZCAA 3EW9A 1CU1A 1ZI6A 4M7OA 4C01A 4CUZA 3R3YA 4H15A 1XMOB 4KN9S 1JA0A 2FG6C 2QSUA 1KR2A 1GPNA 3AKDA 4MIYA 5KAMA 3RC3A 1OZAA 1Q44A 3JTEA 1YWGO 2HUNA 2C95A 3RSQA 3U6BA 1FDOA 3OD5A 5HDBB 2ZPAA 1VE1A 1C30A 2O2XA 3KVVA 1N0IA 2J5QA 4J7XA 4DXDA 5EJ6A 4S2UA 2RHBA 4ARAA 3I52A 5GZ3A 3DE7X 3UMRA 2Y99A 3CRNA 2Q0HA 5FTWA 5IM4F 5ENZA 3OJFA 3EBLA 4A5OA 821PA 1F0NA 5C31A 5ALSA 1K6MA 1NI5A 2O07A 3NB0A 5IDQA 1JFLA 1UBRS 2ONCA 3RVPA 5JH7B 1USIA 1Q19A 5LM3A 2P2YA 2HDNB 1YTLA 1Z2NX 4HKTA 4KWTA 1I2AA 2J3JA 2O2SA 4QJIA 1OU0A 2JLUA 2VG8A 3FOCA 4DXHA 2HQOA 1B74A 3CSUA 1PVDA 4E0BA 4TYQA 1UBCA 3EXFB 3O4GA 3INNA 4PG7A 2XXAB 1UKBA 4CQMD 5CR9A 3KO8A 1YF3A 4MTCA 4M1WA 2MSCB 4D96A 1J7KA 4JI4B 1UKZA 4XYBA 2H9IA 4O4JB 3CISA 4ZCRA 2ONZA 3Q11A 4HAVA 5I7AA 4Z3DA 3UCEA 2YNMA 2BR4A 4JWKA 1Z7WA 3GFFA 5E1MA 1BRMA 1MP0A 5CGZA 2JJ1D 1JPUA 4GRIA 3BWBA 4B31A 1YACA 3DE0X 2R97A 2W4IA 3VVCA 2QDKA 5ICGA 2BFAA 1L7XA 1OR8A 2AD5A 2BIFA 2P5YA 2XQVA 4GR9A 2QVCA 4X3CA 4YBZA 2VRBA 2FPUA 2PSFA 1E0JA 4QU0A 2C58A 5HW0A 5FO1A 3S1AB 2YXEA 2PX0A 2GPSA 3EVEA 3RYCA 4FT4A 1N2GA 4KB5A 4X7BA 5L51A 1HZZA 2OHVA 4MS1A 1B0PA 1YDGA 1R6DA 1RWMA 3RYHB 3R8CA 4BFUA 4EX7A 3BCHA 4DR1B 4R7GA 3V2GA 2ZS9A 4B74A 1XCGB 3G5TA 4G97A 1G4UR 2PY6A 3CLSC 4JJAA 3WLMA 4R8MA 4LUCA 1UWCA 5C4IA 2A5FA 3PFKA 2EJWA 4Y8VA 4BX9A 5B6JA 1HL7A 5CJPA 4NEGA 4P98A 1CY8A 5AM4A 4A0FA 2GESA 3M4XA 2EJBA 5D5HA 5ALOA 2J5BA 3TRDA 4FB5A 5KOJB 2JLWA 1M6YA 3O91A 4M1ZA 3AR8A 4QUAA 4WT7A 1FQOA 2MTBA 1KQNA 4GO1A 2OTCA 5L3RA 3WGZA 1YCDA 5JYCA 4ZAZA 3DQQA 3ZBTA 2XMBA 3AU9A 5LQDA 3N2YA 1W0JD 1N2JA 2WAMA 3EIFA 3NAGA 3TYXA 3EMKA 4XVUA 4R8KA 2H4HA 2VC2B 4N39A 1E2UA 3ZU5A 3DMRA 4OQXA 1HM5A 3R76A