4U2DA

Crystal structure of dienelactone hydrolase s-2 variant (q35h, f38l, q110l, c123s, y137c, y145c, n154d, e199g, s208g and g211d) at 1.67 a resolution
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
233
structure length
233
Chain Sequence
MLTEGISIQSYDGHTFGALVGSPAKAPAPVIVIAHEILGVNAFMRETVSWLVDQGYAAVCPDLYARQAPGTALDPQDEAQREQAYKLWQAFDMEAGVGDLEAAIRYARHLPYSNGKVGLVGYSLGGALAFLVAAKGCVDRAVGYCGVGLEKQLDKVPEVKHPALFHMGGQDHFVPAPSRQLITEGFGANPLLQVHWYEGAGHSFARTGSSDYVASAAALANERTLDFLAPLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Directed evolution of new and improved enzyme functions using an evolutionary intermediate and multidirectional search.
pubmed doi rcsb
source organism Pseudomonas sp.
molecule tags Hydrolase
molecule keywords Carboxymethylenebutenolidase
total genus 84
structure length 233
sequence length 233
ec nomenclature ec 3.1.1.45: Carboxymethylenebutenolidase.
pdb deposition date 2014-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4u2dA00
2BUBA 1FFCA 2HA7A 2LIPA 2BUCA 3C5VA 3RK4A 2PU5A 3IUQA 3D5EA 5JAPA 2HFJA 3H2GA 4HVTA 4KACA 4V2IA 5HF6A 4I19A 2O7VA 4L72A 2BUAA 4BAUA 5KWJA 3OPMA 2GZSA 2WTMA 1ZJ5A 1UKCA 1XZAA 3QH4A 3I1YA 5A6VA 4RNCA 1NX9A 3CXUA 3F98A 2JF0A 4XJVA 4AN1A 5JAUA 5FRDA 4AX4A 1EA5A 1GQSA 2J4FA 2AJBA 1CFJA 5DYYA 1XZGA 1LPOA 2OXEA 1UZAA 3O4GA 2XQJA 1XZHA 3E0XA 4IH4A 5EGNA 1CLEA 1QE3A 2X8BA 2WU3A 3I2HA 5K3FA 4BATA 4BP9A 5A62A 1GPLA 3A2LA 4LHEA 2DQZA 4Q34A 5JALA 2ONCA 1QIFA 1ETHA 4FTWA 1UT6A 1F0PA 5LLSA 3GROA 5E2IA 4BYMA 1VKHA 2J3QA 3R41A 1JKMA 4LXIA 4GLBA 1N8SA 2WM2A 1CUJA 3WYNA 1XZBA 3I2GA 1SFRA 1SC9A 2VATA 5I8PA 5CT9A 2O7RA 2ZYIA 4P08A 4DMCA 2AJDA 1CUVA 2I3ZA 3VVMA 1CUFA 5ALHA 4UBNA 5ALWA 4CIBA 4EZIA 1XZKA 5AKZA 5H3HA 2PSEA 2WIFA 3D3NA 4C01A 3OG9A 2WUDA 2GYUA 5AOCA 5E4JA 3ILSA 4QLOA 4BDTA 4H7DA 2HDWA 3DKRA 3TRDA 2O2HA 3WKBA 5E4TA 5C7YA 2JEZA 1EX9A 1C4XA 4RPCA 5K3CA 5HFAA 3DYIA 2CKMA 3FAKA 1E5TA 4FHZA 5HKAA 5AK6A 1IZ7A 1ODCA 1CQWA 3FWHA 3FYUA 3WWEA 1Q0RA 3A2MA 5DWDA 1UFOA 2PSFA 3G9ZA 4G8CA 4GEGA 4Z49A 1P0QA 3R3UA 1EHYA 2HRQA 1U65A 1YB6A 5K3DA 4EY7A 4JNCA 4LIPD 4YX9A 1TCCA 4KYVA 1UKAA 2K2QB 3ZWQA 3D0KA 4L3WA 4UBOA 1QO7A 2XQKA 5C8VA 3HSSA 5LYYA 5ALGA 4PO3X 1LGYA 4X71A 4UHBA 2OQIA 3PUHA 4MYSA 5DNUA 5ALQA 1H2YA 2QS9A 3I6ZA 4X6XA 3H18A 5IKXA 1FFEA 4QZVA 2YYSA 4Y2SA 3F97A 3NWOA 2D5LA 4IO0A 2C5FA 4X97A 2EDCA 4DNPA 3IIIA 3C6YA 4C6HA 4G4GA 5EI5A 1Q0ZA 4KEAA 1EB9A 3FCYA 1WHTA 4ZXFA 1SOMA 2NW6A 4BRSA 2VJDA 2P8SA 3O0DA 3V1MA 4KRXA 4Y2UA 3PF9A 3WK6A 4AZ0A 1ZD4A 3SC2A 3GELA 4OPMA 4BZZA 3WK4A 3RLIA 3A2NA 4J0DA 4OU4A 2PL5A 3L1IA 3SK0A 2XLBA 4DM7A 1XZLA 4ARBA 5DNWA 1OCEA 4M0MA 1BU8A 2RGUA 2H7XA 3R3ZA 4E14A 2PSDA 5FXMA 5I7UA 5AK5A 1JU3A 1PFQA 5AKKA 2XUDA 1H2ZA 1E8MA 3H2JA 3IDAA 1UXOA 3HEAA 4BVLA 5HZGA 4ARAA 1QO9A 2HA4A 1UKBA 4BTVA 1DT3A 1QTIA 3O9MA 2VSQA 2BGRA 3WZLA 5CW2A 2XB6A 4B9EA 4DNQA 1QGED 1EB8A 2I3DA 3W06A 3FCXA 5LIPA 3HC7A 3FLEA 3DOIA 2ZSHA 1LPMA 2G4LA 1VZ2A 4B81A 5ALSA 3NUZA 2VT7A 3N2ZB 1ODTC 3ZLTA 5DJ5A 1ODSA 3FSGD 2OQVA 3TJMA 5AI4A 2EEPA 3WWOA 4GBGA 2D0DA 4J0IA 1QIMA 1QIGA 1PJAA 3H04A 1P0MA 3KSRA 4PV7A 3WA6A 3FBWA 4JUIA 1FJ2A 3O4JA 1MX9A 4JYPA 2ROQA 3WIBA 1WB6A 1P0PA 1QFSA 5AM1A 4X95A 2H7CA 5AOBA 2WUEA 1IZ8A 2VQ6A 2XMSA 5KWIA 4PW0A 4HTAA 2ORYA 5ESRA 3DDUA 3VKFA 5ALFA 1S8OA 5CXUA 5AKXA 2C4HA 4DLNA 4UBLA 3W05A 5FDFA 1QTRA 3IURA 4KR0A 3V1NA 3MVEA 1QZ3A 2RAUA 1XZDA 5AI5A 4BC0A 2FJ0A 2XMQA 1EINA 1ISPA 1ZD2P 3BJRA 4UHEA 3A70A 1IMJA 1BCSA 4OD0A 3G7NA 4OYLA 3AUKA 4S0XA 4AB1A 1R3DA 1UOOA 3H19A 4H0CA 1MJ5A 1Y7IA 1MX1A 4U2BA 5D7BA 5JZ9A 1VE6A 4MQMA 3DEAA 3VJKA 5FKJA 4F0JA 2X5XA 2Z3ZA 3FLBA 4G5XA 1KU6A 5FOQA 3LIIA 3UUEA 1MU0A 2OCGA 1QOZA 2G5TA 1ZICA 5BWCA 5JASA 4O08A 4B82A 2HM7A 2H9YA 1XLUA 3R3WA 4CIAA 5JZBA 3ZLUA 4KJXA 5K3EA 1TIBA 5IVIA 3F8SA 3S8YA 1XQXA 2AJ8A 2CBGA 2YH2A 2WHPB 3R40A 3X3HA 2W22A 4G4JA 1QIDA 4QDZA 5C81A 1IUNA 5T4FA 3VVLA 2ZYHA 3RARA 3GZJA 4Q05A 2O2IA 2XUHA 4Y7DA 4C4XA 3HRHA 5LZ5A 1XZCA 2PU7A 4RGYA 5DYTA 4AMZA 4M0EA 3O4HA 1EVQA 3QVMA 2GBFA 2IX9A 2C0QA 4N8DA 5BV7A 1KU0A 4FNMA 1VE7A 3JWEA 4Y2QA 3MUOA 1DTEA 1XLVA 4IHAA 1XRQA 4TVKA 1GT6A 1WM1A 2J3DA 1ZIYA 5HK8A 4D9JA 4ZREA 3BDVA 4PSUA 2C7BA 4L0CA 2HA5A 2Y6UA 3C5WP 4Q3KA 2DSNA 3OURA 2CJPA 4LKOA 5FPQA 4G4IA 3PF8A 4QEKA 2WUFA 1CUSA 1A8UA 4X3CA 1XQVA 4J0GA 5DYWA 1R50A 1T2NA 2XUFA 2EDAA 4TGLA 1MTZA 1QIHA 4H7KA 3C6ZA 5CT8A 4M0FA 5F4ZA 5AM0A 1CUBA 1X2BA 4DMFA 5AIAA 3DJYA 3ESBA 5JZSA 1HPLA 5CT4A 3BDIA 4W63A 4W1PA 4Y2PA 5LKAA 4NS4A 1ZJ4A 1CUZA 2C0PA 2VEOA 2CZQA 4MWSA 4W1SA 4ZWNA 1DX4A 4BDSA 2OCIA 2WTNA 2GYWA 2ZYRA 1E8DA 3WKEA 1CIJA 1J1IA 2XUQA 3STVA 3ZPXA 2XI4A 1CUIA 2Y6VA 1MNAA 4DGQA 4A16A 4GW3A 1JMYA 4FWBA 4YPVA 3EBLA 2YASA 1GGVA 3OM8A 1EK1A 1ZI6A 3ESCA 1XKLA 4AMYA 4BB0A 2BJHA 2WIJA 4IH1A 2OGZA 4Y2JA 3C6XA 2PX6A 1QIEA 1CUGA 1RWQA 1DX6A 1O6GA 1D07A 3EIOA 2WILA 3B3QA 5A7HA 3PE6A 1BCRA 5CH8A 5HQ3B 2XUIA 3D2CA 3F67A 2RONA 1R1DA 1GKKA 1R9NA 4WY8A 1CUHA 1VA5A 2WFLA 5ALEA 2QUBA 1BRTA 1CEXA 3IB3A 2OCLA 3GA7A 5ISMA 2OLEA 1HQDA 5AIBA 2WKWA 3FYTA 3PICA 1QIKA 4X6UA 5AO9A 3KWJA 3QMWA 1DU4A 4GXNA 4F5ZA 4KE9A 4UBMA 3ICVA 3IUMA 4EY5A 4QA9A 2IIVA 3DD5A 4A5SA 1W4LA 3A6ZA 2OCKA 3IUJA 3R3YA 2WIDA 3LP5A 3BJMA 3AILA 3HABA 1ZOIA 2ES4A 5HF8A 2VAVA 1SCIA 1VXOA 4K6HA 4CFSA 1QLWA 1UK9A 2WQZA 3BIXA 1GXSA 1GKLA 2JGJA 3PUIA 4WY5A 5CXXA 5JANA 3AIMA 3W9BA 4K6KA 3LCRA 2XQGA 1K5PA 3CN7A 4J0CA 1E66A 5EHZA 4B6GA 1TRHA 4DMHA 4PNZA 1B41A 4FMPA 3HXKA 4FLEA 4EBBA 2WHQA 4UUQA 1GQRA 1VA4A 5ALRA 2GBCA 3U0VA 3AFIA 5D3ZA 2HRRA 4GDMA 4CG2A 1W76A 3E3AA 3RKSA 3WL5A 5T4HA 4W1RA 2Y1KA 3AZPA 4GWLA 5ALOA 2X76A 2HU7A 2VA9A 1EH5A 1WHSA 4J0JA 1XFDA 5AKYA 2JGLA 1CV2A 1U4NA 5BWBA 5CRIA 1ZI9A 4KRYA 3EF3A 4EUSA 3WK9A 5FUMA 2XMGA 3TEJA 1AUOA 3WK5A 1XQYA 3C6BA 4JH0A 5EFZA 4G9GA 3STWA 5LZ4A 4WFKA 4BP8A 2VT6A 1N5RA 3T4UA 1G66A 3BWXA 5AI9A 4OYYA 1Q83A 1LPBB 3I2IA 2AJLI 1QFMA 1XRMA 1W1IA 4ZV9A 3WYDA 1ZI8A 3D4LA 3WWDA 3TGLA 1QONA 2GBGA 2DCMA 2WU4A 4BAZA 5ALMA 2OGTA 4H7IA 3D2BA 2J4CA 2XUPA 1ZD5A 3H1AA 1XZIA 4XVCA 1R9MA 3Q8WA 1AQLA 3ESDA 4KAJA 3F96A 1RP1A 4FLMA 3MUNA 4GECA 4LYEA 5AKIA 3VISA 2XE4A 2Y2UA 1TAHA 3WL7A 4XWGA 1C7JA 5EIAA 2VJBA 2Z8ZA 2ZVDA 4X7BA 3ESAA 1EK2A 1Q84A 3M82A 1A7UA 4AQDA 5LP1A 3UUFA 2PVSA 1F6WA 4UHDA 4Y9SA 4WCVA 4BRZA 4E46A 4DYHA 2FUKA 4FOLA 2XDWA 3BXPA 3IBTA 1A88A 2WG1A 5AKGA 5K3FB 2WJ3A 5AKEA 4UBIA 4K2AA 3FYUC 4HAIA 4RE5A 3C70A 2FX5A 3V1LA 3VJLA 5EHXA 4BC1A 5AICA 4N5IX 4QDOA 4EB0A 2QM0A 4AO6A 1FFDA 2WFMA 4MYDA 1JJIA 5D6OA 1CUYA 2V98A 4WDQA 3YASA 2BGNA 1WPXA 1SCKA 1J2EA 4X93A 2QT9A 4X91A 3ZV7A 4X6YA 3AJAA 1OXMA 1G5FA 5CH5A 2I03A 1TCAA 2G5PA 3F9CA 2UZ0A 4P93A 1WB5A 2XLCA 2WIKA 2XQIA 1YSCA 3WIOA 2HA3A 4U2GA 5SYNA 2XMCA 1THTA 4Q3LA 1AZWA 5AJHA 1J07A 3WZMA 4ETWA 5J3JA 1H23A 3QMMA 4KAAA 4ZGBA 4HXFB 5C8ZA 3E1GA 1XZFA 5FPPA 4ZRDA 4CCYA 4P92A 1MN6A 2CUTA 1LZKA 3D7RA 3HZOA 4DNOA 1PV1A 3H2IA 5YASA 2XQFA 4IQ4A 3O9VA 4UBKA 4CCWA 5I9IA 2WIGA 3G02A 4Y2XA 2PKYX 3G0CA 3AINA 3W04A 4C88A 3IULA 1TCBA 5JARA 4G8DA 1WB4A 3WLAA 5T4EA 3WI7A 5SYMA 2VAXA 4N8SA 1DWOA 1W6RA 4DTCA 4OUKX 1UK6A 5ALIA 4KE6A 4YK7A 3ZLVA 4PF1A 2WLSA 5D3KA 1EDEA 2OG1A 2AXEA 2RI6A 5EIEA 4HS9A 4PQEA 4TPKA 3AIOA 3FLAA 2OPHA 3DL7A 5AI0A 1XKTA 5JD4A 5AI6A 4HXGA 4CG3A 4AO8A 2Z3WA 1HDEA 2PUHA 3DYVA 2V9ZA 3ZI7A 2I78A 3WL6A 3E4DA 3QPAA 5CTAA 1KEZA 3K2IA 2HL6A 1XLWA 4H7HA 3R3XA 3AIKA 2JGEA 4B0OA 2QJWA 1OILA 3IVMA 2B9VA 3QBJA 1A8QA 1U8EA 4Y2YA 3WKDA 3JYHA 3I6MA 4FLFA 4FNGA 1QIIA 2QJRA 4PSDA 4LXHA 5AKLA 5HF5A 1LPPA 2QMQA 2WHRA 1JT2A 4X00A 1XZEA 2CMFA 2XT0A 3T52A 3DS8A 5JIBA 4RE6A 4C4YA 3OOSA 3M83A 5CMLA 2JIDA 4YASA 4HRYA 2ZJFA 4K6GA 4UHHA 1JMKC 2B4KA 2GZRA 2QVBA 1VZ3A 4BCCA 5AM5A 1E8NA 4OB8A 4G8BA 5FLKA 3HLKA 1CPYA 5JAHA 2XMRA 1P0IA 2RHTA 2VF2A 4W9RA 1XRRA 4LYDA 4QNNA 4I4CA 3H0CA 3O4IA 4MEBA 4B85A 2R8BA 3C87A 2DHCA 4K5QA 5CH3A 4BBZA 1UK7A 5FP0A 3V1KA 1DINA 1TKRA 4EY4A 3QYJA 1ZIXA 4X85A 2PSJA 4HRXA 1EDDA 3QPCA 4Q3OA 3WJ1A 1XZJA 3DQZA 4CCYB 1LLFA 3EQ7A 4XX1A 1CUAA 1CUUA 2VTVA 1ZD3A 5EHNA 3LIPA 1HBJA 1TK3A 2QTBA 3L1JA 4KE8A 5A2GA 1H22A 4B84A 2WJ6A 3D59A 5ALUA 4N5HX 4JYMA 3FNBA 4B83A 2BFNA 4U2FA 1FFAA 4AN0A 1UOPA 5BOVA 2XMBA 2WG2A 4AZ3A 4NMWA 3PFBA 4ZI5A 4EY6A 1N1MA 3W9UA 1IUPA 2JGIA 3WWPA 3CN9A 5A7FA 5IVKA 5CBKA 1MX5A 2JGMA 3BF7A 3QITA 3R3VA 3P2MA 3H2HA 5DLPA 4DIUA 4MQLA 4UBJA 3DOHA 4X94A 5K3BA 5ALPA 2HA0A 1JFRA 1WOMA 4DMKA 3FYUB 1EXWA 1F0NA 2WUGA 5KBYA 1YASA 5ALTA 4GHWA 3RM3A 4BCDA 5A7GA 4A23A 2Q0XA 1ORVA 2ECFA 1EI9A 3WL8A 1THGA 5A71A 1GZ7A 1AMNA 4QDTA 3FSGA 1FFBA 4ZV7A 4W1QA 3WKCA 2CB9A 1LBTA 3WQHA 1DT5A 1G42A 2BCEA 3I28A 1JI3A 2XUKA 3GUUA 3H2KA 4WFIA 5JD5A 4FFVA 4C87A 1CUCA 1M33A 4FFWA 3UMJA 4H7EA 4BE9A 3FOBA 3WK8A 1K63A 2DR0A 2DHEA 1YA4A 5ALLA 3SX4A 1EVEA 4E11A 2O2GA 3WA7A 4LXGA 1Z68A 1MNQA 1UWCA 3VJMA 1CQZA 1W75A 3I6YA 1AGYA 3GFFA 2JGKA 2HU8A 3KOOA 4L9AA 5LZ9A 4H77A 4U2DA 2B61A 4NZZA 3STUA 4N8EA 1XRPA 4QWWA 2DHDA 5ALKA 1MAAA 4H35A 1JJFA 2BKLA 4E15A 1YB7A 2G63A 4FBLA 3DKKA 1X70A 4BTLA 1I6WA 1TQHA 1YAJA 5E4YA 1AX9A 3QPDA 5ALVA 1Y7HA 2V96A 2DQYA 1L7AA 1ORWA 1VLQA 1ACLA 5HQ3A 2QXTA 4H7JA 3CCBA 1JU4A 2HIHA 5AM3A 3KD2A 5AM2A 1A8SA 5IH7A 1LPNA 4J03A 3K6KA 4X90A 5JATA 1UK8A 1CUDA 1AKNA 4BVJA 4DNFA 2WFLB 3SWWA 3DNMA 5EHQA 3L1HA 3KWFA 5AP9A 4BCBA 3NOXA 1GPKA 4WFJA 3OTQA 3G9XA 1XRLA 2JBWA 1VJ5A 3LS2A 4QWMA 3HJUA 1QJ4A 2WHPA 4OSEA 1LPSA 2XUJA 4EY8A 3G8YA 3VDXA 5IVHA 2QOEA 4OCZA 2E3JA 3N0TA 1LNSA 3STTA 1CUEA 5KREA 3H1BA 5AHXA 4J3JA 4MEAA 3WJ2A 3I1IA 5AKJA 1ACJA 4HZGA 4MXDA 2R11A 1SCQA 4F60A 3MGAA 1YAHA 1K8QA 2OAEA 3OC0A 1MT3A 3ICWA 1UOQA 4UHFA 5AKHA 3NGMA 4QDUA 1IUOA 2ACKA 3ANTA 1J06A 3LLCA 5JADA 4B80A 1EDBA 3B5EA 2QZPA 2WG0A 2HU5A 4J0KA 5HCUA 3WKAA 1USWA 2QR5A 1YS2X 1LPAB 3G0GA 4U2EA 4INZA 4FKBA 4C89A 2QXUA 2VJAA 3D2AA 1YR2A 4FDMA 4ITVA 1DQZA 4EA6A 4UHCA 2PM8A 5DTIA 3ED1A 5ALJA 1BE0A 1ZGCA 1O6FA 3HACA 4DSZA 1L7QA 1U2EA 4J0HA 1GPNA 4UFNA 4H7FA 3VXKA 3QZUA 3S2ZA 5LZ7A 4B9AA 1K4YA 1BROA 3EQ9A 3Q0TA 5JAOA 1W52X 1XRNA 1MAHA 4GI1A 1AURA 4NVRA 3BF8A 4BAGA 4H18A 5JYCA 2XUOA 4C4ZA 5DTJA 2HHAA 2B20A 5IVDA 3BIWA 2CEKA 4X92A 2PPLA 5ALZA 4BE4A 5AI8A 4HXEB 1CR6A 2C5GA 2VJCA 2HA6A 3I2KA 5AK4A 1QIJA 2WFZA 3K9BA 3M81A 4AXBA 4QDXA 4OU5A 3M3DA 1IVYA 5DNVA 2HA2A 3C8HA 5AOAA 4G9EA 2QKYA 1AC5A 3PFCA 3IA2A 1RYYA 3CCCA 4UPDA 1ZGBA 1HL7A 1E89A 3HI4A 3G9TA 2HFKA 2YXPX 3JW8A 4I3FA 4WDRA 2ZJ6A 4PSCA 2ZSIA 4B0PA 2H1IA 2V97A 3FVTA 3GBSA 5CT6A 1F8UA 3WMRA 1LBSA 5K5EA 3ANSA 1B6GA 2C58A 5EIHA 4JEIA 3KDAA 2OAGA 2PSHA 4UFOA 4IH9A 5HKBA 2XUGA 1JJBA 7YASA 1BN7A 4KAFA 5AH0A 1HKHA 3G0DA 1R88A 1DQYA 2BAGA 3PDCA 5AM4A 5HFNA 1Y37A 4QE3A 1CUWA 1CRLA 2ZJ7A 2RHWA 5LKRA 2FJPA 5K3AA 5HF9A 1WPRA 1LZLA 3H17A 3IUNA 3FVRA 1FSSA 3QM1A 4OB7A 4Y2RA 4ROTA 2PBLA 3QMVA 4MJ3A 1YA8A 2XMDA 3V48A 2ZYSA 4XIIA 2HADA 3V9AA 3STYA 3DCNA 3BL8A 5ALDA 2IITA 5C8XA 3EQ8A 3C45A 5LZ2A 3I2FA 1MO2A 4J7AA 3W2TA 5ALXA 5ALYA 3PI6A 2JEYA 1E3QA 3DL4A 2WSLA 4U2CA 1YCDA 1H2WA 1K6EA 1BEEA 1NU6A 1G4HA 1T4MA 4B7ZA 5CT5A 1NU8A 1DWPA 3KXPA 3WK7A 1DWQA 4Y2VA 1L7RA 1BS9A 5FV4A 5JD6A 3C43A 2OGSA 4G1FA 4WJLA 4F21A 1N5MA 2PUJA 1C7IA 2Y2VA 1X2EA 2Z5GA 1R4ZA 4BVKA 3HYSA 2Z8XA 1YS1X 2QUAA 3STXA 2H7YA 2GBIA 4FBMA 1VOTA 5HK9A 3AZQA 4CG1A 2RIPA 4Q82A 2DFPA 2XUAA 1HLGA 5AK3A 1MPXA 3R0VA 3G0IA 4OB6A 1H2XA 2W6CX 4UFPA 5CURA 3G0BA 2WJ4A 5LZ8A 3I2JA 1XROA 3G9UA 5T4BA 5ALNA 4CI9A 4Y2TA 1XZMA 3B12A 2ACEA 4EHBA 4QLAA 2XMZA 3DLTA 4AO7A 1BEZA 4KE7A 1CUXA 1VXRA 6YASA 3BE8A 4P9NA 1CVLA 3C8DA 2QRUA 4DSAA 2JGFA 1BN6A 2AJCA 1XQWA 4MWTA 3WWCA 4BZWA 4Q1VA 1WCYA 2GYVA 3AZOA 3O95A 3U1TA
chains in the Genus database with same CATH superfamily
4IXDA 1EVKA 4IDPA 3W5IA 1P2FA 3RAFC 4R98A 1XJCA 2P0EA 2DWUA 3T61A 2GEDA 1MV5A 1CQJA 5EINA 1YK0A 2P9HA 5BVGA 1YR6A 2LIPA 1LW6E 1EG7A 1X3SA 1XXHB 1XEWX 1RYZA 3TYXA 1KAOA 2DLCX 4NFSA 2H5IA 1DEKA 1NE7A 3IHWA 3K0AB 3WMWA 4DLLA 5A1JA 2GA8A 4QTZA 3CUYA 4Q4AA 3WBFA 2QTRA 4OI1A 1AE1A 2DC1A 2OZKA 1KHTA 2ADOA 2C29D 4QUAA 1ESEA 3B8EA 3D5EA 3IDSA 1S02A 4YGXB 3W6ZA 3R6WA 3DAYA 3NHSA 3PHHA 1GFZA 5JAPA 2EJUA 5IWCA 4B31A 2VWQA 1AY0A 4CQMD 4NCKA 5G0WA 5DTQA 5EZYA 5FOTA 4KACA 3MCWA 4Y30A 1I2ZA 1Y82A 1M1ZA 4D9NA 4G97A 3X44A 1L8LA 4F38A 2WAXA 2XRFA 2R1VB 4CGZA 2GZSA 2HXGA 1U3VA 4OQMA 1ZJ5A 3U7GA 1IATA 1T2FA 1UKCA 3MJVA 3QH4A 3HA3A 5TT0A 4BVAA 1L2TA 1B6TA 4JX8A 3UXEA 3U4DA 2JF0A 4NESA 1BA3A 3RC7A 3EZ6A 4AX4A 4FKZA 2CLMB 1FDTA 2OMKA 3TL3A 1F0YA 3EF0A 5M2QA 3SHQA 1J0BA 1FMTA 2G3YA 4OAPA 1FVFA 4RKEA 4C14A 2AJBA 2D1SA 4G5RA 3GP5A 1CFJA 3HPRA 4HQLA 4DAOA 4A0RA 3A4YA 3KE9A 2X2OA 1LPOA 5AR1A 1JIJA 4XUCA 3W8RA 2WHYA 1ZINA 1U8XX 5JH7A 1JHAA 1E63A 4FYWA 3MJDA 2NO1A 1RXIA 1KKUA 1WU7A 1LFAA 3EXG2 4NBNA 2M98A 3QU9A 5EGNA 1H9BA 2Q46A 4O4LA 4FYYA 2JA1A 4ESOA 1CLEA 1QE3A 4C4PA 5K3FA 2XBUA 3E3NA 3GDOA 1KS2A 3D9QX 3I2HA 4R69A 3E53A 2QMYA 4YEDA 4KQKA 2HF8A 1RZVA 3A2LA 1FTSA 3T54A 1OH5A 4LHEA 2QN7A 2DQZA 4A1FA 2Q8PA 2Z1MA 2UYQA 3B89A 3FGNA 4UULA 4JOBA 1U0OC 3EDCA 4YDRA 5AVRA 4EYEA 1D5WA 2ZUBA 4S1PA 3IQFA 3ZZ0A 1UT6A 1T9ZA 2HI0A 4NMMA 5IT4A 3S0JA 1FC0A 2ZFUA 1SXJC 1T6BY 4DVGA 3K72B 4F71A 3DDZX 4BZQA 2DTXA 4MUYA 2H51A 1UJCA 5ARCA 5J23A 1OXSC 3LHSA 4RD0A 2ZS8A 3GROA 4IIBA 5IAOA 2ADFA 2WWRA 3B9RA 4B3MB 1YFJA 2I29A 4L8FA 3LT4A 3AR2A 3ZGYA 4YCCA 1AB6A 2W2OA 2J3QA 4AS2A 2PUAA 2VYCA 3U7QA 4LY0A 1PJ2A 2XCLA 4GLBA 3O82A 1N8SA 4DUPA 2JDID 13PKA 3INYA 2V8BA 4NY1A 4RXUA 2RHJA 1CUJA 3I30X 4ZO7A 3WYNA 2D13A 4E4TA 1SFRA 4ECEA 2FCRA 4ZEWA 2C99A 2VLIA 4QGBA 4HUTA 1IOZA 1X3LA 4P08A 2QQ5A 4EPWA 5IAEA 4B6EA 3ER6A 1FUUA 1GSAA 1PTJA 1SC3A 3FYCA 3EGWA 4NCHA 3SYNA 2QPLA 4E08A 2GERA 1X9IA 4TXMA 1VECA 3VVMA 3WSTA 1W34A 1E4YA 5E1MA 3LCJA 4MIYA 4JXKA 5FR2A 1TE2A 4QTUB 1ZA1A 4UTPA 1AM4D 3DB2A 1E1QD 1JLLB 2O5EA 5H3HA 4O2RA 4ZVPA 5WRFA 4CUJA 1F2VA 2FEKA 3N0VA 2Q2NA 5P8WA 2JFUA 2VHJA 4AKTA 4D1YA 3OG9A 1V48A 3IDQA 2R8RA 5AOCA 2ZYVX 3RYCA 3VDMA 2A9KA 2JCBA 4JBNA 2HEGA 2Q6OA 2X4IA 1U8TA 5E4JA 3C3XA 1YIOA 4QLOA 4D99A 1CX9B 2HJVA 1FA9A 4IY1A 3D4NA 3D7NA 4MGIR 5FO0A 4H7DA 2NPFA 2NXCA 1NW7A 3TRDA 4E2XA 2O2HA 4E2FA 1SHZA 3ZHVA 3BXFA 4KQ9A 3FPAA 1WHSB 2QX6A 2BMDA 3HVKA 1D2RA 3AHDA 5E2BA 3GJ6A 2JEZA 2E55A 3K9LA 1WBDA 3BE6A 3TB4A 5K3CA 1E1NA 3GVIA 4R8VA 4LNAA 3WRYA 1NSFA 4DM4A 4ZYWA 2G09A 1Z25A 3WIVA 4B2LA 5I6DA 1R3UA 2HYIC 3Q5GA 1QFXA 2FZEA 3QY0A 5JMPA 3AG6A 2XW6A 2EZ9A 1CF2O 5HKAA 3K7EA 3ZDZB 2DXIA 1GTL1 1HRKA 1M6YA 1XSEA 3K05A 2OO3A 4LRUA 4XRRA 2DH6A 3FWHA 3Q2IA 3TSCA 1U0LA 4RD2A 1SH7A 4LXTA 8GPBA 3TLGB 2EQAA 1F14A 1Q0RA 1N2SA 3U3MA 2VQ3A 5FPSA 5A3SA 4EYOA 5IHPA 4WNIA 5LLDA 2Y76A 4GEGA 4K9KA 2RBGA 5C3MA 1V1RB 2RG7A 3QUBA 1EEXB 2DBYA 2TRSB 3MAAC 1CEQA 4YRFA 2WB2A 4HJRA 2H6EA 1EHYA 4HUJA 4DLAA 4GX2A 5K3DA 4ZJUA 2GXSA 5IKMA 5J4YA 1B76A 2IOQA 4RH0A 1AXEA 3LZDA 3K0FB 3HJRA 3AF5A 1N2ZA 3OMXA 2B8WA 2O2XA 2Q1UA 4WLVA 1UADA 5KAPA 3TB6A 3SBEA 2PRIA 5BR7A 1JQJC 4JOCA 2O8DB 1KYVA 3DGFC 3TNDA 4TMVA 1ODJA 1SQGA 2A5LA 5BQOA 4CV0A 4Z51A 4DRYA 4F4IA 1JAZA 2GAAA 2HK6A 4BYGA 5JDIA 1X7YA 4W6QA 5LB4A 3GDHA 8ATCA 3QVSA 2K2QB 4D9MA 3FFAA 2R7MA 1YRQA 1VHDA 1JDPA 1FMLA 1QF9A 1E92A 3SI7A 4BJ5A 4BPRA 1G7TA 4E3WA 1BHSA 3CV3A 4KV7A 5AK0A 4D4GA 3GPIA 2I2BA 1J24A 3NVMB 1GQYA 1QNLA 1UJBA 4H3HB 5F4BA 3RU7A 4XWWA 3TZKA 1RP7A 2F1OA 3AW9A 1RYDA 2V3VA 2AS0A 2VQFB 1O7JA 3W5VA 4B35A 4PICA 4PO3X 3NM6B 2JS7A 1Q0SA 1PKEA 1K7XB 2GFIA 1TVKA 4W7HA 4X71A 5JISA 4IPTA 3P0FA 1VJ1A 3I5YA 4UHBA 3IAFA 1CW2B 2OQIA 1P1BA 2FLKA 1GGKA 1RM3A 3H5WA 3LTEA 3RHZA 3KZ1E 1QHHB 2XCUA 4Q7EA 1JLMA 3FF1A 1LV7A 4ZCMA 5IKXA 3PSAA 4RM3A 1ID8A 1DQPA 1M1YE 2B7BA 3ISVA 2WDZA 4JBWA 2WB4A 4LCEA 4PC7A 1VJ0A 3GMTA 4RPGA 3ZI4A 3QU4A 3TMKA 4BQNA 1NUTA 2KI5A 4F11A 4QZVA 1GZ3A 1HXHA 3FETA 2YYSA 3INRA 3RVDA 5LMZA 1UZMA 1VMKA 4Q7QA 3HWRA 3FXAA 3V1YA 1CC1S 3A1WA 1P33A 4J3FA 4BNXA 4K46A 4TL9A 2GM9A 1FOEB 1OBHA 3K5HA 3WRYC 2M6RA 3VNSA 1PQYA 5F35A 1LK5A 2C3MA 1MBZA 2C5FA 4P3PA 2XB2A 1CQXA 2OR3A 3AJDA 4JJFA 1QQAA 1N5LA 1Y6RA 5CXQA 3HNPA 1BO6A 1CDZA 1K89A 1YJAA 1YMVA 5MF6A 2JAWA 3ABIA 2EL9A 2FNAA 3C6YA 4MARA 4C6HA 4DLTA 1VGQA 4WSOA 3R5KA 4KEAA 1AUVA 5EI5A 2B35A 2OP1A 1Z5OA 1WIWA 4UVEA 3HYRA 2R48A 1KK3A 4EI2A 5FBZA 1PIWA 4HAVA 4NSNA 2IXBA 4OV6B 5KC8A 3BE5A 3MQ4A 2XGGA 3PDIB 1O0SA 2VJDA 2H59A 1KVUA 3SXPA 1M54A 4P35A 3BG5A 1WZIA 2YZGA 3O0DA 3OPYI 4MHTA 2N1MA 2G1UA 3OEHA 3WLQA 3RJMA 3CLHA 4NPAA 3FMPB 3PF9A 3EXFA 4CLRB 4EUFA 6ADHA 2X4GA 2W6ZA 4YJFB 2Z6AA 2W9XA 1NLUA 3E15A 4O8CA 1P4JA 3EZFA 4MW5A 3UZUA 4MB0A 4EQZA 2KLHA 5EJ9A 1ZW1A 3JYNA 4ROSA 3RHTA 4NCJA 4ID3A 4WLNA 3WK4A 1GPUA 4Y9TA 3RLIA 1T3SA 3UXMA 3SBOA 2GWRA 3JWIA 2WTBA 1L4GA 2AVDA 4LGMA 5CU7A 4JUBA 1PQ4A 3B9QA 3WNQA 4TYYA 4GNKA 2QU7A 5HM8A 3TLJA 3AF0A 4M0MA 3AWIA 1NJ8A 5DHSA 3F1LA 2G9QA 2OXCA 2ATXA 3BMNB 3ASUA 4YI5A 4ZCTA 3W90A 5EP3A 1WBJB 2RGUA 2JIQA 2OD9A 3DEJA 3SMVA 2H7XA 4PG6A 1E58A 1ZK3A 3P0JA 1U11A 1SCAA 2H3HA 5CNIA 3RDPA 2KMLA 4QXPA 4XGIA 3SICE 3QRWA 3VPCA 1MA3A 5ADUS 3DPSA 2WU8A 1BMFA 4Y1GA 3I39X 3GGOA 1QKJA 1YJ5A 1XF9A 5AK5A 4AKSA 4P3XA 5CVCA 1E2GA 5BW6B 2XUDA 1FLAA 4RVNA 3VAYA 1P5JA 1NG9A 3CWZA 1X38A 4QU0A 4CL2A 2QZZA 4FQ5A 3H2JA 1IHOA 3IDAA 2JA2A 3QVGB 5BUZA 1U1IA 2ISQA 3ONEA 2B99A 4N6OA 4P3NA 1T9GS 2OB2A 3E9YA 4DLUA 1N2CA 1Z82A 2JAUA 1SXJE 3K3PA 4FCWA 1N8NA 3V2GA 1VCOA 5KYVA 2QRQA 4KIJA 1LLCA 1Y8AA 4V1CA 1DT3A 1N2CB 1QTIA 3TXAA 1GSHA 1SPBS 3O9MA 4EEXA 2VSQA 3ITNA 4QXMA 4MI3A 4LV6A 3CO0S 1DOHA 1V2GA 2C9MA 2HH9A 1UJ5A 1UODA 5JAOA 2E48A 3WLMA 1SN7A 4DXAA 3Q3CA 4NONA 1ZJJA 2A35A 4UCXA 4DNQA 3BOSA 4AY4A 2BDTA 3N9IA 3P9NA 5EE9A 1EFPA 1NI4B 1YIAA 5DMXA 1T0UA 3UVEA 3ZWMA 4FT2A 3BWYA 5FUXA 4N3BA 4YRNA 3FCXA 4E3ZA 3QF4B 5EXSA 1MB2A 3DOIA 4NCAA 1KO7A 821PA 2WYHA 3HY3A 3LBAA 5EPEA 4B44A 1LS6A 4DWJA 4KVFA 3CZRA 3IP1A 5EMHA 4PEVA 1HX7A 4DCPA 4Q7KA 1LPMA 2HRBA 4Q3NA 4INJA 2ET6A 4BGUA 3AVXA 1Z35A 1U7DA 1SKYB 2G04A 3K2BA 3TQCA 2CDCA 3V3TA 3F6CA 5JI2E 1Q1NA 3I5MA 4S24A 5T8KC 3RODA 1QHGA 2VT7A 3F5QA 3N2ZB 1OKKA 4OMDA 5BSHA 5C37A 1T0PA 3I9LA 2V9CA 4UASA 4JBLA 2BSAA 2DR2A 4QOJA 3LDUA 2NO4A 3C3WA 3ORSA 3H8SA 5ICFA 4BO9A 3EY9A 3SZ3A 1ODSA 3RSLA 3KKEA 1Z75A 1IXRC 2ZS9A 3KLMX 2OY0A 1ZP6A 3Q3VA 2OQVA 3RRMA 1T8SA 2YV2A 4GGPA 2IOFK 4B09A 3RK0A 4J0IA 3JQFA 1QIMA 1UP7A 2UZ3A 4TLAA 4EUHA 4KYTA 3G1TA 5DE3A 3QKSA 5B53A 3H04A 2PKEA 2VF5X 1RHQA 3R24A 4QJ5A 4XCVA 5FYQA 2PKQO 2QZJA 4LBVA 2IIQA 3HN7A 5E1DA 1X9HA 2IQIA 4JUCA 1NUHA 2ZUSA 3GHHA 1N6HA 3L02A 5TPZD 2GCGA 2HDNB 2JJQA 3CLTD 1TZBA 1YZ3A 1T4CB 3EVTA 3NB0A 4W9NA 5HZMA 3JR3A 3WIBA 1N5IA 4YR9A 1NLFA 3IJEB 4P32A 1CB7A 2YJNA 2OA0A 4HF7A 1ZWKA 1FQWA 3VH2A 2FMHA 2VNHA 3FYHA 4G1BA 4X1KA 2JCXA 4WXYB 5F1KA 1VKNA 2BR5A 1T5BA 1ZKMA 1NNLA 2VQ6A 2ZWAA 3FZNA 2FE1A 4Z7NB 6PFKA 3T5PA 2ORYA 5ESRA 3DDUA 1CJVC 1XRSB 2VZEA 1WG8A 3WRVA 7REQB 4FFPA 5FEMA 1E6EA 3OD1A 1E9SA 1PT8A 4L8VA 2GEKA 1X92A 4BLPA 3Q3EA 4HDSB 2HCRA 3GFBA 3CE9A 3R0JA 4ZMRA 2D00A 1QU3A 1CZRA 2A1TS 2ZB3A 3I62A 3C48A 4CTNA 5HUJA 4OHYA 1QTQA 3EARA 1I5OA 3IODA 4AZ0B 1DAOA 1XZDA 1Z5PA 3KPJA 4HNHA 5HCIA 1PW5A 2RSLA 1BVUA 2DUJA 3QLUA 4KQMA 4CKEA 5DM60 2XMQA 1BDHA 3LH5A 1EINA 2L17A 3DEZA 5T67A 3NO4A 2ZRJA 3RCBA 4QPJC 3BJRA 1JEQB 3N2GA 3HJTA 4RHUA 3CEHA 1C80A 3A70A 1BWQA 4DPKA 5BMVF 1ZUD1 2I33A 4Q01A 2XADA 2WKRA 4H6PA 5DN9A 1LRKA 2LR0A 2HSZA 4OD0A 3BC1A 2LXNA 2PX4A 2MINB 1VYTA 2I7TA 4NYJR 4Q4LA 1L4EA 4YHBA 3K1TA 3ZGLA 2D1RA 2CBXA 5ULLA 1BE1A 1JXAA 2VH2A 8ADHA 3WFIA 2JFOA 1DG9A 3HY6A 4O5OA 3KLPX 5IABA 4MR8A 4RVCA 2Z2ZA 3MD0A 1MJ5A 2BDUA 2B5WA 3F6YA 4BV3A 1E20A 3TD2A 3EFHA 4DJJA 3VR5H 1GNTA 4HFJA 4U2BA 1T1RA 4NDNE 1WVIA 4X65B 1GOTA 2GSWA 5A4AA 4DV3B 1H9AA 1P9RA 3MWFA 2BSQA 3D5TA 4JOSA 1XMJA 3TNYA 4KR2A 1ND6A 4L08A 3UOGA 1HORA 1GRRA 1IRIA 4G0NA 1L6IA 5K0EA 2UU9B 4G5XA 4F1KA 3VTAA 1HEUA 3M7IA 5CCBA 3LLMA 4XASA 1OXBB 3DWGA 3LIIA 1TD9A 1JR3D 3CH6A 1MU0A 2CFOA 2IV7A 2OCGA 4TQGA 1XOIA 4BWVA 3RWBA 3WGUA 3TUZC 4CLEA 1Z16A 3TQFA 1PJZA 1N75A 1QOZA 1OC2A 4JVSB 3UAXA 2D2EA 1T3LA 4FHDA 3WJAA 1W35A 2XZTA 3WC4A 5JASA 1NJ5A 4C3OB 4Z7JA 9LDBA 4LF6B 4W9NC 5HS6A 1YQUA 3NAQA 3NNNA 4DJEC 2Z56A 5THQA 2BN4A 1T6NA 1SXPA 1SEPA 2P9ZA 1DI0A 1SXJD 2GSDA 2VP2A 4EVSA 1Y3BE 3D7MA 5LJIA 4E2ZA 3MMXA 4KR3A 1L3BA 2BM1A 5H16A 4QUGA 5JZBA 1X15A 1H3FA 1MOZA 2FI1A 1KI7A 2G4VA 2IVFA 4L57A 5BNFA 3VO2A 3ZLUA 2FH5B 5GM1A 4DW8A 5KTPA 1DX9A 4KJXA 2CEAA 1F9EA 5CM9C 3OIDA 4PGAA 3I61A 2MJLA 3MWYW 5DDIP 5EERA 4N40A 4DQ0A 3S8YA 3R40A 4M8NE 2FSVC 3OQHA 2BJVA 1H6CA 4ALMA 2FSFA 1AGRA 3SQWA 4G4JA 2FR8A 4DADA 4A2CA 2ONYA 4EMSA 3NWEA 2PNFA 3U1VA 2CJWA 5CDGA 3U9SA 2OCBA 1TU3A 1BA2A 5DCLA 2LUOA 5BVGB 5C81A 4LNHA 1I30A 1ZU4A 4M1WA 3VVLA 1T3ZA 2OOKA 4OKNA 3GZJA 3RARA 2JLYA 4IG9A 4TVOA 3GRRA 4FNAA 2O2IA 4TWIA 4X8LA 2XUHA 3DWFA 3GK3A 4RV4A 1U8AA 3S68A 2QF7A 3HRHA 5DN6A 4LDAA 3T3MB 3IB6A 5EJ7A 4KYIB 4UW9A 1CZOA 1QRRA 4ZCLA 4KR6A 5DYTA 2QX4A 5FORA 4BFYA 2HIGA 3H2BA 4YCNA 2Y0PA 5FNZA 2X0JA 4PONA 4RZIA 4YV2A 3WWYA 4B17A 4AQ7A 1MIHA 3BSSA 4LZNA 1KMCA 4E13A 4X9XA 2C2MA 2VK2A 1IIRA 2C0QA 2AG5A 3WGOA 5ECGC 3I5AA 3HCDA 2ANCA 3R9KA 3A3PA 1T5LA 2Z8YM 4C29A 4WIAA 4R9SA 4D8WA 1KU0A 1AXGA 4MV4A 2C42A 3LW8A 3TLAA 1AKYA 1M2OA 3JYOA 4CKWB 5A6SA 4UNPA 4MTCA 3WLSA 3EXAA 4FNMA 4DCOA 4IYJA 5BW4A 3K70D 2J3HA 1DJQA 1NVBA 2JFHA 3R7LA 3JASB 3PEFA 1U9ZA 4M0KA 3C3AA 1ADYA 1VJCA 1A7AA 1U2ZA 4OOFA 2XITA 3C7TA 3FUXA 4UU0A 4Q1DA 4B3HA 1EFUA 2DY0A 1M0EA 3F5MA 4IHAA 4NFLA 2DFVA 2JFZA 2EOAA 3BORA 3RUHA 1OKKD 4M98A 2EJBA 3WLKX 2FJUA 5JNTA 1UDCA 1Q0LA 2CVPA 4HBZA 2IYNA 3EWNA 4G9BA 2HCJB 4V0MA 4ZREA 3BDVA 5JH7F 4GL2A 5LA6B 2ZBDA 1XX6A 5DM4A 1NW4A 3RSGA 4JLNA 5COBA 4HNQA 5HBRA 5KOHB 3D1JA 4PSUA 5D00A 1TTQB 2Y77A 1DCKA 1ZNWA 2HA5A 2F4NA 1UANA 3GPBA 5KOHA 2X9NA 3UJCA 2BEVB 2WY2D 1ADFA 1G9SA 1QDUA 2WMNB 2PH5A 4EG0A 3TLCA 4QDJA 4JL8A 4KWIA 4WNAB 1XTRA 1TYEB 2POQX 2E2WA 1OAAA 1G4UR 1QQ7A 2HO5A 1ZXLA 3NMUF 2JGDB 3EMVA 1I01A 2C3PA 4FYMA 4P34A 4UE2A 4EENA 3RVLA 1KPGA 4QELA 2QA5A 1Y81A 4L15A 2VHEA 2X15A 4QEKA 4EW2A 5F73A 2ZT8A 5FNVF 5CA0F 3A6DA 4R9VA 3NDPA 3T7RA 3C1TA 3TRHA 1R6DA 3D7LA 5IT5A 5JXIA 1MCZA 4LJYA 2XUFA 2B4RO 4IZIA 4Z9XA 2IYYA 5FA8A 4B5LA 4CR6A 1I3OA 1R4AA 3O26A 3PC8C 4GVLA 3KKLA 4H7KA 4K9RA 5AM0A 1A2QA 2DECA 4LOHA 3VU9B 1CUBA 4BBJA 1KZ6A 2VI5A 4YMVA 1I7PA 1X2BA 1ZH8A 2SBTA 4EW6A 3E4CA 2VYND 3UFXA 3DJYA 3ESBA 1USIA 1MQAA 4W63A 4W1PA 1IJFA 3F4BA 3PFHA 4XM1A 1VL8A 1YU9A 1ZNXA 1E1KA 3ROFA 5KOYA 3KAKA 2CZQA 2IKQA 4K28A 4EFMA 3VKWA 4GMFA 3MD9A 2PUGA 3PQ7A 1QBGA 2W93A 3RIYA 4CT5A 2BHRA 1OPRA 2ZSJA 3DJFA 3EA4A 3LBNA 4D2IA 1R0BA 1O96B 4CMEA 1NSTA 2GYWA 4AUEA 2QM3A 1MT0A 4LOAA 3UMSA 2VSFA 3DQPA 3ELUA 5C7OO 3QUTA 3AG5A 3AUFA 4I1UA 2QTCA 3DHWC 1K3UB 2ZM5A 4ZU3A 1GZ6A 1CIJA 2XUQA 4OF4A 4J3NA 5B4UA 2VJQA 3RS0A 2J87A 5TEWA 2XI4A 3GT3A 2JZOA 4B4DA 4JLVA 2FZVA 1E2NA 1MNAA 1RW4A 3CMCO 3SVZA 5B7PA 5L3VA 5CEFA 4GW3A 3S2EA 2XSZD 1U98A 3AF3A 1X1BA 2PUFA 3QLEA 4OXXA 3PEUA 4YPVA 3VTFA 3EBLA 3PIIA 2W0SA 4FZVA 4NBVA 1FFGA 2RGYA 2WWIA 1F4PA 4QNRA 3BGVA 1M2VB 2ZKLA 4IJ6A 2QG9A 1EK1A 1TYBE 2CHFA 3LGAA 3A9WA 1TUIA 4H3KB 2E49A 1MAVA 2CSXA 2RJOA 3KZOA 4G09A 3TL6A 4NRDA 4ZQIA 3ESCA 4ZDJA 4KGZA 3FTEA 2GKGA 1N7HA 3OX2A 5G0SA 3ONVA 2F8MA 2BIFA 3FWPA 4RD3A 4BB0A 2WIJA 5C9ZA 3BGDA 2PX6A 4Y2JA 1QIEA 2PH3A 3BHNA 1J90A 3UYLA 3O4RA 1APBA 3WO0A 1S5PA 1D2MA 1YCFA 5KKAA 1AXRA 1FZTA 1DX6A 1P75A 3EB9A 3EIOA 2WILA 3GFTA 1NUSA 1RABA 3MCAA 3OZTA 3B3QA 1KL7A 3QPBA 3M4ZA 4NULA 3SXUB 3WB0A 4U02A 1E2QA 3FNRA 2G82A 2GI4A 2WAMA 3I4LA 3PIDA 3SXUA 1R18A 4MVJE 2XTJA 4XJSA 4MB6A 1BCRA 1MG5A 5CH8A 5JCOA 4CF6A 3F6EX 3ZWYA 2QMUA 1FDSA 1XTKA 3IO3A 2YUTA 4PZ9A 2PZBA 3CNOA 3DFMA 3IIMA 4BKUA 4CEJA 1XNJA 2HO4A 3D2CA 3ENKA 1BMTA 1KF0A 2EG5A 3DBHB 3T1NA 2BBSA 4OJYA 3ETGA 1FU4A 1J5PA 3WLRA 4TOIA 1F60A 3IT3A 3CYFA 4Z4QA 1Q16A 2Z5LA 4NQRA 2EU8A 4EJSA 4LRXA 4MYHA 4PFQA 2P4SA 2WFLA 2D7JA 2PUCA 1ATIA 2FDXA 3T06B 2AWOA 3QQ5A 1PR2A 3CCFA 4LF4B 1BXGB 1Y4AE 1RDFA 3VGJA 3BIFA 4MVCA 3GA7A 2KYRA 5ISMA 4D3FA 5KSPA 1C9NA 4LV5B 2HSEA 3ZK7A 4F93B 5ERYA 1PTJC 4K6CA 1JV2B 3WLNA 5AIBA 2WKWA 1NPYA 1G0NA 1Z0ZA 3CUTA 3QBDA 5LBTA 5I9LA 3PICA 1TT5B 1Y9DA 2FG7C 4X6UA 3KWJA 3I3SR 2XKBA 3THXA 1U63A 1XN4A 2B9EA 1KMHB 3Q41A 2B78A 4EZEA 1MZPA 3DW1X 3GPCA 5IM4F 2H54A 3OF3A 1XCPA 2IEIA 5JXJA 1GR1A 1W88B 4GPBA 4UBMA 3QX3A 3QWFA 1T36A 3AMVA 3L8EA 5AUQA 1XEFA 5LOVF 2JVKA 3F4KA 4QA9A 1O5IA 2IIVA 4MI9A 4A5SA 1PG5A 1YDFA 3IQXA 1W4LA 2JFYA 4KDEA 5GONF 1PL0A 2GBLC 5JY1A 4DCSA 5TR9A 4HTFA 3A6ZA 5LUBA 4YJHB 2ZI5A 2X22A 2WIDA 5AW8A 4N48A 3IIEA 2DG2A 3RASA 5LOVB 4H1VA 1IJEA 4PPGA 3FHOA 4TTVA 4UAUA 3HABA 4C1NA 2PWYA 5B7GA 4FYXA 5J1TB 1Z39A 1CY0A 1N0VC 4UVGA 3UF0A 2AZDA 5IP5A 1U4SA 2BRUA 2PQ0A 1A2KC 3D8UA 4R7GA 4CHGA 4FI3F 2QYOA 3PZBA 3Q4GA 1OT3A 1ONPA 3D43A 4MS4A 2DYKA 4H6WA 4MB2A 4I36A 4K6FA 3IHKA 1GKLA 4FGSA 1A50B 3AT1A 3B1YA 4LJAA 4MS4B 3GL9A 4BWYA 2R2AA 4YDSA 3V2UA 3U13A 1RBYA 3RUIA 1UT8A 3OJCA 1H5NA 1PL7A 4N54A 4NHOA 4LY3A 4ERXA 1I2DA 1FFWA 2JGJA 1SHJA 2WZBA 1FVOA 3LQ4A 4WY5A 5CXXA 2ZGVA 1E9RA 5IK2D 2WA2A 2D4HA 5EE3A 3E18A 3KQVA 4JQSA 2HK9A 5CA0B 4Q0MA 2E37A 5IDYA 2G6BA 3ZWKA 1TKAA 5HJEA 2YRFA 3O8OB 5CA0A 1K5PA 1W73A 5AVYA 1TVEA 1DAMA 2QVXX 2X42A 1Z7BA 5KJCA 1BDBA 3MGBA 2P6NA 4J0CA 4BUZA 1P4AA 1FYXA 1E66A 3AI3A 3LRXA 4D8UA 4EKNB 1UKVY 1X42A 2IEAA 1VE1A 1GEGA 2EFGA 2GJSA 2HTFA 2IDZA 4FN5A 3MMPA 1TVKB 2AD1A 3GC6A 4HAZA 2UXCB 2Z43A 1L1FA 1V8BA 4PNZA 4NBRA 5FADA 3X1DA 3F8TA 3NCTA 4L27A 2AXNA 3E5NA 3L1KA 2DKOA 2HJGA 2GK4A 3N8GA 1ZQ9A 2WA1A 1CIPA 1PUIA 1EVIA 2WC1A 4FMPA 3I0MA 4MS3B 4X20B 3RF7A 1DIHA 2GOYA 3WXMA 1XVLA 5J58A 1AMUA 2J0QA 3CC8A 3VKFA 1W1WA 1TYCA 5K0LA 2VCHA 2WKQA 2Q2WA 1KJIA 3MF4A 4DS3A 2QDKA 4OQZA 1FL9A 1EQUA 3Q2KA 3B3FA 4UTOA 1QV7A 4AY5A 4CU5A 1RWWA 4F4JA 3UPTA 2DE0X 4II7A 2VYVA 4MQ6A 4XYGA 3S70A 1R8XA 3SC6A 4L0MA 4U7PB 2P77A 1W76A 4PAGA 2M32A 2BKXA 1G2QA 3I0ZA 4MYUA 1OZHA 3G2JA 1VKJA 3M1YA 3JQAB 5KYNA 1I33A 4FOPA 3TAUA 2BGGA 2Y1KA 3AZPA 3EDYA 3EG9A 4GRIA 4N7JA 2X76A 3QVGA 2A1IA 4CETA 3GEGA 2CY0A 2M9MA 4D9FA 4KFTA 2PS1A 1WW8A 3KOUA 4GEKA 3V4PB 1IWPB 4HATA 2YWCA 2MYUA 1L5RA 1TO2E 3IDFA 4MUAA 1ENYA 2G17A 4WEOA 3OU7A 4NI5A 4NK5A 1U4NA 1SVMA 3ICQB 3Q7RA 3B6MA 4IKEA 5TMEA 2P75A 1KR2A 4JBGA 5KJEA 5BYAA 1GNLA 3U5ZB 1XD2B 3PZRA 1SC1A 4RGVA 3DE7X 2O3RA 3MINB 4UU8A 1L7XA 2QTVB 3KC2A 4ZI7A 1PWEA 2Q8QA 2O8EB 4D9KA 3CBGA 1RWKA 1VJRA 1ZRNA 3FZQA 3GCGA 1AUOA 4MUFA 3TH5A 1U0SY 4Q48A 3FZYA 1U3TA 3NBKA 1TLLA 1AHHA 1Q7RA 4Q4HA 1O08A 1U2GC 2QNBA 4G9GA 3B2EA 1EM8A 5KOJA 3H9BA 3HDVA 5LZ4A 4ZI3A 2ZB2A 3CH5A 3IKJA 3MT0A 1L4BA 1Z2CA 3GH3A 5H80A 2BBTA 4BP8A 1N5RA 4EELA 1PT9A 3T4UA 4DDWA 1C1HA 4HD8A 1G66A 1NGSA 3BWXA 1P44A 1UPFA 4O4IF 4ABTA 3V8QA 1TUEA 3MAGA 2MWMA 4ZT3A 3L8HA 3DCJA 2JCYA 4HX5A 4KTTE 4KWHA 4Q9AA 1NNSA 2OBNA 4WN9A 2ZQZA 1GAQA 3ECCA 4M6WB 2QRMA 2ZSFA 3D4LA 3LT0A 3GLTA 4XSGA 3TGLA 1QONA 3IR7A 2KE5A 2M6LA 4ZMSA 2XCIA 1DUSA 1K92A 1RMTA 3MELA 4L74A 1IB6A 2DCMA 3EVGA 3BDAA 1ZJ6A 3CX3A 4OIMA 1U6KA 1UKYA 3T3GA 1PS0A 3K2QA 4EL0A 2OGTA 2ACVA 5A3RA 4H7IA 1JB9A 2XUPA 3DTVA 3IPCA 3Q12A 3HO8A 5IC5A 3RQSA 2JH8A 3VH3A 5JQGA 4D92A 1R9MA 2RCYA 5K8LA 1R0CA 4I81A 4PPYA 4XEHA 5KWSA 3ESDA 4KAJA 3VC3A 1DADA 3SHFA 3E1KA 4HDQB 1ZN8A 1EBFA 4GP9A 5K2MA 3WGYA 4DWVA 1ZR2A 2ZUTA 2Q45A 1GWNA 3MUNA 1Y8CA 4GUDA 4ACBA 2EP8A 1UJ6A 4LYEA 5KMGA 3EDMA 4TS9A 3P9CA 1RT9A 5JWRA 1P1CA 1TX4B 3VISA 4G3XA 1U0JA 3JTEA 4M38A 1ZH2A 2WF7A 4OSOA 2ZUEA 1N25A 3DYBA 3WL7A 1IL0A 4RF5A 5JVDA 3K9QO 3BGSA 4IM7A 4XDHA 1DZIA 1KEEA 3OJWA 2OCYC 5LQJA 2VJBA 5HTKA 2Z8ZA 1VC2A 5GAJA 2CMGA 1GUAA 2F9LA 3FVWA 3OQVA 4TWJA 4WZAB 3CH4B 3A6PC 1PEAA 2W00A 3L7LA 4MO9A 4RS3A 1QE0A 3KZMA 2VP0A 2PAAA 3KYCB 2B3DA 3HBJA 1EK2A 4X1KB 3EXHC 1EBUA 4XWKA 4AQDA 4MQ5A 5LP1A 1JTVA 2MMGA 3SFTA 2IUTA 3MIIA 1BSVA 1J99A 2PVSA 3CX4A 4F5WA 1KJJA 2PJZA 3ZDBA 4HS4A 4IFBA 4UHDA 4PAMA 2JAHA 3ROEA 3GLHE 4WCVA 3ROZA 2ZUFA 4E88A 4BRZA 1EFPB 1NI4A 2X7XA 4M8SA 3OUUA 4C2AA 2BFCB 4E46A 2CD7A 2X0IA 4QSHA 1YVPA 5IF9A 3CLSD 3G9QA 4M0UA 3PXDA 2M6SA 3A9SA 1PZEA 1JPNA 5TMPA 3PFIA 3SR4A 1QQBA 3PFFA 5MFPA 1O97C 3PJDA 4BMOB 2XEXA 4FILA 3VR5A 4HDSA 2W2LA 4YWHA 2YTZA 3TKAA 2P4EA 4C0KA 1OWLA 4Z9AA 4RE5A 4D25A 1OI4A 3C70A 4TTIA 2H4WA 2ZI4A 1GPDG 4MPDA 3RE1A 1YS7A 2H1SA 2QRHA 1EUDB 3B7GA 3OECA 3PCTA 4IKPA 3OCJA 4ZOLA 4DCMA 1DC4A 2QZ9A 2A78A 3D54D 2QW1A 3VJLA 4EYQA 3FKSA 4IFTA 1Z5UA 4BC1A 1KEWA 1E94E 3LVRE 3FCOA 2VP6A 4N5IX 3W1VA 5EJIA 2WWYA 2ORIA 5TLSA 4REOA 2AN1A 3S5UA 4EB0A 1NJSA 3KQMA 4M49A 3L6BA 5KSOA 2OG2A 2IHZA 5TIIA 2W2TA 2VQEB 2PYDA 4X3PA 2W70A 2ENWA 5BMVA 1C4KA 1JDJA 1I9CA 2GN0A 3DC2A 3ICCA 4L2IA 4LC9A 2WFMA 2NO9A 3LE8A 3VGPA 4EG7A 2NACA 2X6RA 1LBQA 1V11B 3FVVA 2BGMA 4MVJM 2NU9B 1ISSA 2XIQA 3GNTA 5EJ4A 3H11B 2D5IA 4E12A 2VTBA 2CXTA 5F23A 2PBRA 1I3LA 1P18A 2IUSA 3K0KA 5BPHA 1EPUA 3JRNA 3QHQA 3H11A 1YXMA 3H5LA 2GEVA 3NTRA 4WDQA 2RJ3A 4WK2B 4C3ZA 1ML4A 4IIHA 1YOVB 2VH1A 3UK2A 1BDIA 1AZTA 2DFKB 3SOPA 2WD9A 3ZWPA 1K7YA 4A8JB 5E3HA 3IUPA 3ZDAA 3ZDFA 1YACA 2Q5QA 2QT9A 3KXIA 4YUYA 3TPZA 1N78A 1E4EB 2YFKA 1ZN7A 1D4FA 4LWQA 2YOHA 2CDNA 3L0BA 5CH5A 5CNKA 4IVRA 3F9CA 1B7GO 2OKCA 1TJNA 1H2FA 2PLAA 3NALA 2DPGA 3SIRA 5HFJA 1W87A 4DMMA 2LD4A 2UZ0A 1YR7A 2C84A 2FSVA 2XKJE 4JQCA 5AJUA 2PGOA 2G0NA 1O3YA 4FD2A 1WDLA 4KRFA 1U0HC 2FEMA 4X8MA 1DUIA 2OAP1 2WIKA 3F6BX 2W4QA 2LBPA 3BRSA 3HKDB 3IHTA 5KJ1A 2FW0A 1RQRA 5EOVA 3M33A 5C0OE 5I01A 2L2QA 5HWSA 1ILEA 2ZRAA 1NVTA 4JQZA 2XMCA 1R4NA 1A5ZA 1D6SA 3DW3X 5T41A 1QGUB 1TFRA 5L51A 1M2HA 5KPDA 3KB1A 3H1PA 4GPEA 3UAVA 2PKXA 2HSGA 4KAAA 4M0DA 4NBTA 4CQLB 5C8DA 2F9MA 3M34A 5GOTA 4QG3A 4TX1A 3E1GA 2DMRA 1XZFA 2XYRA 2ZIFA 1LC0A 2WSMA 2C1EA 4ZRDA 3SYKA 3K73O 1XVAA 4DQKA 2G77B 3RK1A 3U40A 4X54A 5A4JA 2R1ZA 4BMXA 2V6IA 3B6IA 5CB8A 4LE2A 1M7HA 4I1VA 2ZIGA 3D7RA 1V1MA 3A1DA 4PLCA 5YASA 3LWZA 4ZZIA 1KOJA 4JMPA 4BBPA 2PJRA 2WF5A 1Q20A 1UPUA 3DO5A 4F7WA 2AQHA 1X0VA 3O75A 5I9IA 3F8WA 2B5VA 1RAIA 1GY8A 3P27A 1IHYA 2CHUA 2PH1A 1MXFA 2WIGA 2GXUA 1V1JA 2PKYX 3AB7A 3AINA 4G2NA 2CSUA 4ZTBA 3G2IA 3TMYA 1GPYA 4C88A 5IBRA 3V4OA 3VZDA 2CLOB 1XXHA 1I4LD 4F92B 1UZLA 2ODPA 5A4KA 4YRZA 3KFXA 1E6LA 5C3UA 3SYMA 2EWWA 4K40A 3I9NA 4O4IA 2C2WA 4JI6B 4UTXA 4LRQA 3EBOA 4M1OA 4CTMA 3MMSA 3R77A 1UC8A 1CDEA 2QT1A 2XECA 2VAXA 4OI4A 3KT0A 4E0BA 3ELBA 5AVTA 4EKIA 3Q1LA 1DWOA 1W6RA 4OUKX 1UK6A 2XAAA 3G5MA 4PQFA 3QELB 3DPIA 3IXQA 4R54A 3GLGA 2C83A 5BRNA 4YK7A 1JHZA 3AM1A 3RW9A 4O29A 4GSLA 4ZOEA 1EFRA 1MDFA 2I9KA 3MRVA 5A6SB 1NKTA 1KRXA 4IDFA 4DG8A 2RGXA 3U6KA 2EQ5A 1RJ9B 3SSOA 1HOXA 1LSJA 5IARA 4KO8A 1M2WA 2NZ2A 4BNDB 1IVNA 4F1WA 3QX9A 4MUXA 5IN5A 4PQEA 4KZPA 3QVLA 3R7WB 3FLAA 1M2OB 2A88A 2YMLA 4I99A 6NULA 2W5UA 2ZI7A 4RD6A 4KR9A 3FWKA 5AI0A 2AGVA 5HIMA 3KZCA 4CKBB 5JD4A 3I1JA 1M34E 2XJ4A 1CLUA 1F2DA 3BTUA 5AI6A 1XVVA 2Z3VA 4YAFA 3TZLA 1Z38A 2G28A 1Y4ZA 5CDFE 1NMZA 3QXHA 4TYNA 2J1LA 3ADKA 1E6CA 2W83A 1BX1A 4AO8A 3IL2A 3U60B 3L84A 3W0LB 3I34X 1Q6ZA 1WAMA 3PNYA 5TVGA 5DIZA 1GL6A 1MP0A 2R62A 2LNDA 3V7YA 3DYVA 3MJTA 2R86A 3G88A 5G0VA 1Z4JA 1FRFS 3ZI7A 2QV7A 4FX5A 4AWBA 4FNOA 4QHTA 5H59A 4EFNA 4KPEC 2PGNA 3L0CA 2YHAA 1DC8A 3AHEA 1SOVA 2PZMA 2W48A 1ZJZA 3H16A 2QTNA 2V7BA 3O3CA 4F84A 3JAKB 1OYYA 3K2IA 2E82A 2ZIZA 2GPAA 2CNDA 2VAPA 5GJVC 2WW8A 3OIFA 1XXHE 3OTHA 1GRVA 1RBZA 1YC2A 2RFLA 4H7HA 1JI0A 1J9ZA 3DAFA 4CMBA 3PFWO 1U0EA 2ARKA 3FKSD 4K9LA 4WT7A 3UXYA 4B0OA 1P1RA 1SBQA 1XF1A 3UKJA 1LSOA 1TW3A 1ULTA 4NZOA 1W6UA 1P72A 2NNLD 4NV3A 1T2AA 4OQFA 5CG1A 4M9QA 4N3GA 3TQIA 3IVMA 2ZM6B 3VNQA 4CUKA 1NR7A 3G2NA 3HQ4O 4EI9A 3HMKA 4EHAA 3V4RA 5KHLB 4FLFA 1YC5A 3SZLA 2P90A 3ANMA 3BK7A 1FPQA 2PZLA 4LXHA 4PSDA 5AKLA 5IYZF 1UWLA 1J8QA 5IPFA 1G8FA 5HILA 4PY2A 5J63A 1GPAA 3QOWA 4DLSA 1RI5A 3DONA 3FW1A 1W36C 3TKLA 3WOVA 1AHPA 4ZD6A 2BH2A 5LC1A 1XZEA 1VRVA 1CHNA 2GCPA 1AQUA 2XTMA 4ARVA 4EYKA 2V9PA 2JHAA 5ELXA 2FWNA 3DS8A 1XD9A 5JXHA 1GARA 3GO4A 1VGVA 1M74A 1ZZGA 3LUCA 5B1IA 5D86A 4WKCA 3GQVA 1L5NA 2WQ7A 4C4YA 3IAS6 3M83A 2V6BA 1NVDA 2AFRA 2JIDA 4MVJG 4U2KA 4YASA 3WYAA 4W5WA 3O83A 1KVQA 1OLUB 3K5IA 4UHHA 3ZY6A 1XA3A 4GC9A 1IN1A 1D04A 3QQPA 4UNIA 4DMUB 5AM5A 3PUVA 3GLFE 3PB3A 4CN8A 4XDGA 3MCUA 3F46A 1CT9A 1NTRA 1OWOA 1W19A 3N74A 4KW7A 2HDOA 1YFZA 2A0YA 3HEMA 1KERA 4F5EA 3HUUA 1R0KA 2GS9A 5HMMA 4YJ3F 1LVGA 1JQ3A 3HA7A 4BNWA 5JAHA 1SULA 2RHTA 2CNBA 1ESNA 4LYDA 1HV8A 1Z0AA 2HMSA 2X5KO 2AQIA 2RH4A 4JXZA 3T95A 4L76A 2NU6A 3OJXA 4QATA 3PHCA 2C31A 1IEXA 2VBIA 3F2VA 4BVEA 2IHNA 2ZCVA 1YNOA 3EW9A 1O0BA 4C5AA 3HJBA 4YJGA 1BG6A 1V37A 2GEUA 1XDUA 5LXTA 2C07A 4B85A 1JA0A 3LU1A 2FN7A 2V6MA 4FMCB 5CH3A 4DB2A 2B0CA 2HIAA 4PCAA 1AH2A 2QAJA 1M2VA 3RVNA 2VCYA 1ONSA 4D8YA 3C6KA 1E3TA 1BYIA 1NXPA 4X7PA 4CT0A 4OK6A 1E6KA 4X85A 4CMJA 4TZ0A 2YHIA 4MV6A 1PS8A 4HRXA 4BNJA 5JG7A 1Q0TA 3KETA 3MEQA 1K9VF 1UKZA 1R5JA 4CCYB 4IDHA 2GF9A 4QIHA 1SIWA 4XX1A 2WPDA 3CG0A 4GZMA 1CUAA 4HLNA 3CPHA 2L19A 1CUUA 2GM3A 4EVQA 1F38A 1P7PA 1SY7A 1ZD3A 3FSJX 3QEMB 5EVJA 2NSDA 1RE1A 1HBJA 2EERA 4PXAA 4TQ9A 1QG2A 4O4JB 5ITZB 2C4WA 1PT7A 2D1YA 1L5OA 2DLDA 4KE8A 1UBSB 2EBUA 3RVRA 5CBPB 1OAOA 4KQXA 4F4HA 2WJ6A 4EJFA 2H1OA 2Z1NA 3GGPA 4KZKA 1QWSA 4LF5B 5ALUA 1I4TD 4REQB 3DA8A 2IF2A 4UTNA 1N6NA 3JQEA 3IV7A 4HDRA 4U2FA 4ENSA 1FFAA 2NAFA 4REQA 4S1VA 4G0XA 1E64A 1FRQA 3ZJTA 5ILQA 5ENVA 2XMBA 1JR3A 2PKQP 3MUFA 4RVUA 4AS1A 2Q1TA 3HP4A 3JQBC 4DB4A 4X6LA 3W3AH 3MQ2A 4Y2HA 2HNKA 4IVPA 1CVIA 3OIYA 3QJYA 4G67A 4AUNA 4BE7B 4POOA 4YV7A 4KKXB 4ZI5A 3UICA 4BMVA 4U5XA 3ABSB 4EY6A 2H4YA 4CTJA 1WBBA 4H0NA 3VYTB 2WD8A 1ST3A 3IBSA 3WBBA 3CR8A 1IUPA 5EGSA 2FPKA 3WGKA 5KX5B 2NUAB 2FWMX 2O0LA 5BSVA 3ANXA 3HCNA 4DBLC 1B8PA 5A7FA 5IDWA 2CCKA 3BMQA 3ZWXA 1ZWLA 2WTUA 4GDFA 2P41A 3O84A 1MX5A 4L6CA 4NNJA 3KQHA 5HSGA 2JGMA 2NVBA 3QEOA 2O7SA 3BF7A 2Q4EA 2YC2C 5D6NA 3R3VA 3O93A 3PGXA 4P3YA 5EXTA 3TIVA 1M2KA 3CJTA 5FI3A 4MQLA 1UP4A 3M9LA 4KX5A 4DIUA 2JFVA 1ZJWA 1TT5A 1FTGA 4KFSA 4UCQA 2G06A 4L5AA 3RB8A 2F00A 3B9PA 3D8RA 1NC1A 1P29A 1AKQA 1DFGA 1DKQA 1G17A 1WOMA 1Z22A 3FTNA 3HKEB 5M5BA 4RS4A 2X0FA 3K32A 5JRDS 4TMKA 5AVZA 1CD5A 3KUXA 1IJBA 4KGDA 1DJLA 4D9CA 1GG8A 5HZKA 1GVNB 4GHWA 2C5BA 3EBPA 3RM3A 5AFSA 5LOVA 3HU1A 2CXXA 4P82A 1YJBA 5CCXA 1N2EA 3P1JA 3G0HA 1BQ4A 1ORVA 3V8PA 4DA4A 2ECFA 3ZQUA 3WL8A 1RAEA 3D7SA 3BL6A 5A71A 2IHTA 2H9IA 4Z4EA 4QPZA 4WXHA 2OZPA 5EFOA 4XR9A 1ND5A 3NC0C 4MUJA 1R6TA 3U7EB 3BTVA 4QDTA 2GFQA 5L7TA 2JFGA 4H6XA 2H4XA 5LLTA 1JUDA 4EEKA 2LCFA 4YUAA 2QD4A 1VSBA 1MGPA 1LBTA 3OAAA 4MQEA 1YZVA 4Y1FA 1DBWA 1FNCA 2BBOA 2YQZA 4EG4A 4MLPA 4IMRA 4KIWA 4Q47A 1HDYA 3X2SA 1EFKA 1HYGA 2EBFX 5JXWA 5CYPA 2IOYA 1SK8A 2OCXA 4AJ1A 2WWHA 2A9VA 1IXKA 1Z6TA 3QHPA 3LQ1A 3QG1A 5B6IA 1VLMA 2N9UA 1EE1A 3NBUA 3I28A 5EWMB 3EIQA 4GMXA 2J9XB 1N77A 4IIVA 3O8OA 2CVFA 2H1VA 1L7EA 1G6Q1 1CP2A 3ZHCA 1Q44A 1C3OA 1QYXA 3I04M 4G23A 1BH6A 2G80A 3A1NA 4YJFA 5AYVA 4QUBA 4ER0A 1N2OA 3V2HA 1BXGA 1C3OB 4ZJZA 3GLUA 1QHNA 3ENQA 2YIVX 3F90A 1P7CA 1UCFA 3GN1A 3MYRA 4FFVA 3CSUA 1IEQA 2RHHA 3UYKA 2UVPA 1K0FA 3ZD7A 4B4UA 4GKJB 4NYMQ 1LBEA 2DU8A 3O3NB 3SF0A 2CNLA 3L01A 1NBEA 2QL5A 1V2HE 3UFBA 5CLGA 5ADVA 1G98A 5LQDA 2CC2A 3RVKA 4ZXPA 4H3SA 5B7QA 1K63A 1FCJA 3HVJA 4ZO9A 4UZFA 1CR4A 1TZKA 1YA4A 5ALLA 3SX4A 1U7UA 3OIUA 1LLQA 4E11A 3DMGA 3WAJA 1RC8A 2E6UX 3ZCXA 1XFAA 3L9WA 4LXGA 5AJZA 4AVYA 3DO6A 3VKHA 5CGQB 2E9SA 5HRUA 1C9JA 3ITKA 5DV9A 1UWCA 3MMZA 2YZNA 4BRUA 2R1TB 4YMIA 2RAPA 4HTFB 4UAGA 4GD3Q 4EA7A 2QORA 4ZN6A 3NDIA 4RZHA 4YAUA 1P9OA 4LHYA 1PWYE 5E9WA 3Q8MA 1KH1A 1GZ5A 1M0TA 2BPOA 1J0DA 3AOGA 3GMDA 3TD6A 1C4OA 5LZ9A 2YR0A 4RH1A 2P2DA 3C0KA 4BNKA 4MVJI 2JFNA 4P0QB 1JPVA 1NDUA 4BMCA 2ID8A 3EOAI 3HKCB 3R5FA 5JO0A 1UJNA 2JI6A 3JZFA 4GE3A 2ZYAA 4NZZA 4A82A 1P5ZB 3CVJA 1XRPA 5EWJB 1C7FA 4AKHA 1YR9A 1ZONA 2H52A 2XUZA 3MS2A 4MUKA 5ALKA 3USZA 1MAAA 5CLLA 1JJFA 2BKLA 3B82A 3EMKA 3PDIA 4IUCS 5BP7A 5K6AC 2JKVA 5P21A 3ED5A 2NWQA 4BUCA 2O4UX 2P3LA 2Q2QA 8MHTA 3N1UA 3ZXYA 3MINA 2IPMA 4C5CA 5JYBA 4QT4A 5CXSA 1EG2A 5L6MB 2X8LA 2XVMA 5ALVA 4RSGA 1BWRA 1TU4A 3IVGA 4B43A 1JL3A 4JEHA 4NZYA 4UMDA 3BRQA 10MHA 1P8JA 1XMPA 2XYQA 3FMGA 3JZIA 4QEDA 1ACLA 1X1DA 1KDYA 3AM3A 5HQ3A 3LTNC 2QXTA 2QTAA 1WJGA 3A58B 3L8ZA 1JXQA 1XMQB 4YT8A 3MTJA 1DQNA 3CCBA 2E4YA 3ITEA 1VI5A 4FDLA 4ANFA 2H4HA 4RTOA 1A8SA 4JV5B 3N2EA 1JDVA 3AM5A 5C80A 1ADBA 3T12A 2NXNA 1NF3A 3WICA 2LDBA 1CU1A 2N3ZA 3FUUA 2GVNA 2I67A 4UE3S 5DXAA 3T3DA 4BIIA 5C7LO 1FJHA 2NTVA 1S3GA 2HBYA 3KYDA 5G1NA 2QN6A 1KKMA 3VSEA 3DCIA 3A04A 4LSGA 1FFYA 2JGRA 1NI5A 3KJXA 3KNZA 2PZKA 4RHTA 4YP9A 1GLNA 2TS1A 3SWWA 3DNMA 2VJYA 3FYSA 4BBAA 3HP1A 4HN9A 2WYIA 3ZU6A 1XP5A 5G0TA 1CVRA 4I9HA 2P0YA 3PDWA 2OSVA 1ZBDA 4PWYA 1TPYA 4IIDA 5AP9A 4BCBA 2GPNA 1RRMA 2JH9A 3AUAA 4WFJA 1J21A 1TZJA 3PGLA 2OKGA 4JXJA 4L95C 1KA9H 4NMXB 3ONNA 4U6SA 2WMOB 1CJCA 2NT3A 4UQPA 3G9XA 5B1YA 3H4TA 4M2LA 2FRXA 3AVWA 1G16A 3FOWA 1YA6A 4MWOA 4ZT7A 2PA3A 2ZU6A 1ZD8A 2JVJA 3L7JA 2N0SA 4CLHA 4GWKA 1R64A 3DAOA 5FAXA 4PRZA 5DGHA 1LPSA 2A1UB 1P1IA 4BS9A 1VJGA 4BVHA 1R5NA 3KQOA 2BMAA 2Q6VA 3SDBA 5JFGA 1XK7A 3L5OA 2FGJA 4ZANA 4EY3A 3G6WA 4JIGA 1NNEA 4OCZA 4E4RA 1EM8B 5KOJB 1LFDB 2CK3A 2VG8A 3MK31 4DIBA 3CO5A 3LVBA 2XVZA 3CR3C 1LNSA 4A0GA 4N18A 4AKIA 2WWTA 3OTWA 3U4QA 2A2ZA 3GJTA 4OQPA 4COOA 2IELA 3H1BA 1XCOA 3GFSA 3H0KA 4CEIB 4G0VA 1M83A 4AUKA 4C7JA 4YCDA 2FK7A 3B70A 3SDZA 4MKZA 5JT1A 3C3BA 4HZGA 2QQFA 5FNVB 1L1EA 3AERA 4LHSA 4I1OA 4MXDA 4R84A 2BEWA 1SCQA 2V6FA 2VJMA 5LYJA 2A0UA 2BFDB 2DUMA 3VPAA 5JC1A 1YAHA 1PNQA 2ZANA 3B52X 3C8MA 2O8BA 4Q1FA 4ZT2A 3CLUD 1MT3A 3ICWA 5AHWA 2BYTA 4D26A 5AKHA 1Z4IA 3F2IA 4ZGGA 3LLCA 1ORTA 3ANTA 3CU5A 2B37A 3HLYA 4G0YA 4B80A 1DNPA 3MXOA 4NE9A 3VC1A 3U1BA 4TMFA 3FWNA 5LKAA 1F5SA 3I4CA 2HU5A 3DAHA 3DMYA 3TDNA 2V6JA 2VSXA 2M1XA 3EVAA 5AVVA 3EPPA 1ZOOA 1PFKA 1IZYA 5K0ZA 1V0JA 2JLWA 3HUDA 4XR4A 4A15A 4KPUB 3A9TA 3KQNA 1CKEA 1VCMA 1XZPA 2GPYA 3FPGA 4QYIA 3LDFA 3DMHA 3WV4A 1F17A 3BEDA 2GDJA 4U2EA 2GZ1A 1PJBA 3PFNA 4F12A 4ZHSA 5CP8A 2R44A 1U7XA 3LA6A 5FWDA 3GPLA 5KEIA 4IG4A 3RC2A 2XOXA 1SIOA 3AF4A 3SC4A 1GKIA 4FKBA 3E22A 4C89A 2FQXA 4FYVA 4R68A 3SNHA 2QXUA 2VJAA 4AFNA 4BB9A 1NLMA 2Q4DA 3D2AA 2CNNA 2RB4A 3UAOA 3ZTWA 4FDMA 5DK4A 3HM9A 1EMDA 1QNFA 3E9QA 1DQZA 2OE2A 4UHCA 3W9SA 2ZR7A 1XRJA 1L5ZA 3R09A 4M9RA 1ODFA 1Z2DA 3AC0A 3CVYA 2Q5CA 1FVXA 2UYOA 4IMJB 1EUYA 3PV0A 3KD3A 1TQ6A 5F77A 5L53A 3EAFA 5JWOA 3OLCX 5DOZA 4DSZA 3R6GA 4RJJA 2XA2A 3EH1A 4FS3A 1GGMA 2WJHA 4I14A 4EEZA 1Y6GA 3S1SA 3UEOA 1GPNA 2ZAMA 2QBYA 1REQB 2JBHA 2BF7A 1GCAA 1T8WA 3BWMA 3CS3A 3MWLA 1FS6A 3D3KA 4ICIA 5CA1F 4JB8A 1K4YA 2C3YA 3RJ5A 1AQJA 1XL1A 4O0MA 4K81B 1RJFA 2NVOA 3PXCX 2QRJA 4PE5B 5DW0A 5EMKA 2HPHA 3BFJA 4Z3KA 3A31A 1XRNA 2Y27A 3B53X 3BVPA 1ZOSA 1MAHA 5KWVA 1O4WA 1MEEA 2OUIA 3VNBA 3DTVD 2EGUA 1WEHA 4GI1A 3HBAA 4DFDA 3IELA 4YUZA 2AT1A 2WVGA 4OHVA 4BAGA 2O3SA 3M4JA 4GP6A 2XUOA 4C4ZA 1I5RA 5E6SB 4M36A 4PLZA 3V8BA 3OKAA 3LUPA 4FGWA 5JUWA 4ZAWA 2W8BA 3SX2A 1ZZEA 2PX8A 1G2PA 2FWJA 4MV8A 3FMOB 2GASA 4EW1A 3BA1A 1JEQA 3ZG6A 3ZY3A 4TXJA 2FHSA 2HV8A 3ZWVA 5MHTA 2Y66A 1KY4A 1O5TA 1ZHFA 2Z4TA 2PO5A 1L1QA 1KJ8A 1S2MA 3N58A 4Q7LA 1E0SA 1OI2A 3NTOA 4R41A 5IBQA 4BKPA 1QH0A 1KK2A 5LR6A 1ISFA 3Q72A 2CLIB 1QIJA 4GNRA 3S99A 3FNQA 3TBHA 2LCIA 9LDTA 3M81A 4R71A 3FGZA 3TX2A 1PQWA 1N6KA 3V80A 3EEOA 1ECJA 3V1UA 3TOVA 4LXYA 1T8PA 5AHRA 5H83A 2CDBA 3C8HA 3ZTYA 1PEKE 3A1EA 1IN6A 2VPIA 2J9FB 3JQFC 2QKYA 4YJ3B 3U4AA 2ZT6A 1W0JA 1VP9A 2AG6A 3WBJA 1E1LA 3OE7D 1U4OA 2ZJOA 3PFCA 4ENTA 1E1RD 2GILA 1G38A 1HL7A 4TT3A 4M8IA 3LUBA 3OZ7A 1UINA 4PGFA 2NZJA 3W8NA 3EW7A 4IIEA 2B7CA 3KSAC 1CZHA 1R2QA 1KIMA 2HFKA 2VJOA 2C54A 4DC1A 2OESA 2R79A 5KJFA 4PHGA 1XEXA 3TPCA 1NN3A 3DZKA 3AGQA 3E7XA 4I3FA 4K88A 4WDRA 2O7QA 3I01M 2C2YA 5T3YA 2YWRA 4JJ4A 2IZOA 4IIJB 1GHTA 3I52A 3UOAB 1HZZC 2YYYA 2HGZA 4OHXA 1SUFA 3WMXA 1F8UA 2XXBA 3C1UA 1X7WA 1KE2A 4OHMA 2Q6IA 2J7PA 3T9EA 2WNHA 4YN3A 2ZKIA 4M88A 4C0QC 4D41A 3QKIA 5K5EA 4F04A 3DBLB 1CS0B 3MA0A 1Y7PA 3KOYA 3QFRA 5EIHA 3O92A 1L8XA 5AESA 5EXDA 3O2SB 1J2JA 3NRBA 3NUGA 3M4XA 2BD0A 2WAYA 3M5CA 2BFWA 1OE0A 4URHA 3KHUA 1QR2A 3IP3A 3NM5A 1GQ2A 4HN4B 4IDQA 1JVSA 3QXSA 3AVOA 4UFOA 1G55A 3ZI0A 4BJ1A 4C7BA 2XUGA 1JJBA 2HR1A 1JTFA 4AU1A 4PLWA 2H48A 2XVXA 3ILYA 1BN7A 3GOHA 3ZX4A 4P31A 3I5UA 4IJKA 1R74A 2BEVA 1JLSA 1HKHA 1DXYA 1XUOA 4I9UA 2QLJA 4G4SP 2IU3A 3OZRA 3AETA 4PANA 2O50A 1R88A 4IL5A 4XYBA 4YRKA 1OZFA 3ETJA 3I01A 2WV7A 3RS8A 1YQQA 1IDN1 2BAGA 2HKIA 3IAEA 2Q0QA 3PC4A 2VXBA 1E32A 2OK8A 3W1WA 3GMIA 4PBSA 4ETNA 1Y37A 2Y9MB 3DM5A 5AW1A 3IEXA 4ODIA 1SZJG 4QE3A 1CUWA 1J2UA 1CRLA 2C57A 3LWBA 2PMFA 1JHXA 1MMFB 2RHWA 3AHFA 1T5TA 2WJWA 4DQDA 4L85A 2QTGA 4GAEA 4Q66C 1MJNA 1WPRA 3P94A 3F71A 4P4NA 3FROA 4I46A 4XX0A 2ZZNA 1JIKA 2AWNA 2JASA 1E9DA 3H5VA 1H1LB 3PC7A 2ZVPX 1YI8A 4GKVA 4P7KA 5JQWA 3FFXA 3QPVA 3QE9Y 1DKMA 1D1PA 1YMQA 4M1MA 2EFDB 1E3MA 3NV7A 1KIFA 4Y2RA 4ND6A 4NXMB 1KAGA 1X7ZB 3QFSA 1KZ4A 4G1CA 1WP9A 4MX8A 2YQ4A 2Y92A 2ZWPA 5BN4B 3W5UA 2WVJA 1UMCA 4CKWA 4YAKA 1SUCA 4F86A 2V5VA 3D02A 3D81A 1DFHA 5CHYA 2HCBA 4LJ8A 5JNWA 3N6XA 3CURA 5CVJA 3RSSA 1UJMA 3DCNA 1A1VA 4Y6GB 3S4YA 3ZWCA 4OLFA 1FP1D 4JU9A 4HWKA 1PHPA 4KN9S 5SZKB 1RWOA 4QHYA 3T4PA 2YVAA 3DKPA 1RS0A 5CIYA 1ECLA 2VDKB 3E7FA 1RZRD 2RGWA 4M46A 4IIFA 4Y18A 2R7LA 2ZPTX 4R2HA 3THWA 1GNQA 3U3JA 2ZUCA 1ISJA 4J7AA 2HN9A 3F6RA 3IDOA 2SCUB 4FOTA 1B0ZA 3W2TA 1XALA 2B4TO 2OXFA 3PI6A 2JEYA 5ALYA 1UKEA 3LP8A 3PEYA 1A9SA 1BC5A 4HPXB 4O4LB 2HRDA 3AR4A 1W5AA 1TDJA 2VF8A 2YWFA 3OQPA 1K6EA 4O1IA 4WPGA 4OQEA 4KWTA 2PY6A 4UNQA 3TO5A 2ZB8A 4B7ZA 1DWPA 4I3HA 3AUSA 1PFGA 1GG5A 2VUSA 3RJZA 2CV0A 1L7RA