4U2DA

Crystal structure of dienelactone hydrolase s-2 variant (q35h, f38l, q110l, c123s, y137c, y145c, n154d, e199g, s208g and g211d) at 1.67 a resolution
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
233
structure length
233
Chain Sequence
MLTEGISIQSYDGHTFGALVGSPAKAPAPVIVIAHEILGVNAFMRETVSWLVDQGYAAVCPDLYARQAPGTALDPQDEAQREQAYKLWQAFDMEAGVGDLEAAIRYARHLPYSNGKVGLVGYSLGGALAFLVAAKGCVDRAVGYCGVGLEKQLDKVPEVKHPALFHMGGQDHFVPAPSRQLITEGFGANPLLQVHWYEGAGHSFARTGSSDYVASAAALANERTLDFLAPLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Carboxymethylenebutenolidase
publication title Directed evolution of new and improved enzyme functions using an evolutionary intermediate and multidirectional search.
pubmed doi rcsb
source organism Pseudomonas sp.
total genus 84
structure length 233
sequence length 233
ec nomenclature ec 3.1.1.45: Carboxymethylenebutenolidase.
pdb deposition date 2014-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4u2dA00
3LIIA 4OSEA 2Z3WA 3STVA 2HA0A 3GFFA 2WFMA 2PL5A 3UUEA 2C58A 1W1IA 3E4DA 1XZGA 1DT3A 3OPMA 4OYLA 2DR0A 5AKZA 5JIBA 3VXKA 5ALYA 5A7FA 4UFOA 1VJ5A 1VA4A 1A8SA 3CN7A 3C6ZA 1TCCA 1AURA 1F0PA 2IX9A 5JASA 1OXMA 1LPBB 2WFLA 2OLEA 4H7JA 3R3VA 2B4KA 2HFKA 3ESDA 1VOTA 4B85A 1UK8A 4WJLA 1MT3A 3EQ7A 5DJ5A 4UFNA 3W2TA 3IUJA 4WY8A 5LZ5A 1G42A 1G5FA 2QT9A 4UBJA 3PUIA 3F97A 2PM8A 4HS9A 1MN6A 4JNCA 5AIAA 1EDEA 3EQ8A 4XJVA 5CH8A 3ED1A 2JF0A 2XQKA 3H0CA 4TGLA 4EB0A 2RI6A 4B80A 2WG2A 3F9CA 4W63A 2JGMA 3VJMA 1WB4A 1BS9A 5EI5A 4Q05A 5EHZA 1AMNA 5AKHA 4G8CA 5D6OA 3C8HA 3HZOA 4XWGA 3DLTA 1CFJA 5CW2A 4M0EA 3D2BA 5AOBA 3CN9A 1CIJA 4K2AA 5AJHA 5JARA 4Y7DA 4N8EA 5KBYA 4CG1A 5FP0A 1LLFA 2XUOA 2VTVA 3IURA 2QXTA 5ALNA 4QDTA 5CT9A 2QMQA 5ALGA 4AB1A 5J3JA 4U2BA 4PSUA 3WWEA 5AKEA 4KYVA 1ZI6A 3JYHA 4UBIA 3O0DA 3G0GA 1JJBA 1EB8A 2ZYIA 3D2AA 2ZSIA 3WK6A 1X70A 3AIMA 4EZIA 4BP9A 1C7JA 2ACEA 3AJAA 4RE5A 4G5XA 3AINA 1EDDA 5LZ9A 4F5ZA 1EK2A 5K3BA 1G4HA 5AKKA 5KWIA 4KR0A 4F21A 2X76A 3DCNA 4DNQA 2XMRA 5JD4A 3BIWA 5BWCA 4N8SA 5CT5A 5FOQA 2OXEA 2DQZA 5HKAA 3H2JA 4KAFA 1QFSA 1EVQA 1B41A 1FFEA 4KRXA 5AKXA 1O6FA 4CG3A 1MNQA 5FUMA 1QIJA 1LNSA 1XZIA 3WKAA 3WWOA 1VLQA 4H7FA 5ALIA 4FBLA 4UBMA 1ACLA 2H1IA 3D5EA 4L9AA 2XUFA 1EDBA 4G8DA 3W9UA 1XZHA 3STUA 3H04A 1E8DA 1XRNA 4W1RA 4UFPA 3SX4A 4MEBA 4CCYB 3HACA 1QO9A 4GWLA 3HXKA 4J0GA 5FPQA 5AI6A 5AKIA 2PBLA 4FTWA 4J0CA 1GT6A 3T52A 4QA9A 1J06A 2WUFA 4B81A 5DNWA 2B61A 4C6HA 1KU0A 3V1MA 3O4HA 3QMVA 3BF8A 4G4IA 4C87A 1Y37A 1XRMA 1S8OA 2PU5A 3K6KA 4QWMA 4F60A 2J4FA 5E4JA 3CCCA 4JYPA 2RHWA 3HYSA 1T2NA 1BRTA 3OURA 3L1JA 1QIIA 4B0PA 4LXHA 1QIGA 3IBTA 4J0IA 2XMGA 4Q3OA 3O95A 1L7RA 1W75A 4NMWA 2B9VA 1EXWA 1PV1A 2NW6A 5K5EA 4MYSA 1CUYA 4EY7A 2GYWA 3L1IA 4WDRA 3WKBA 3GELA 1EVEA 1QGED 2R8BA 3D3NA 2RAUA 3PF8A 1GKLA 5K3FB 5CRIA 3K9BA 2CJPA 3GROA 2OG1A 5C81A 1H2XA 3AZQA 1UOPA 4QNNA 4PF1A 2CBGA 1J1IA 4G1FA 4Y2TA 2QUBA 3K2IA 3LIPA 5AK6A 4X94A 1TIBA 1GQSA 5AHXA 3FVTA 1BCRA 4Y2SA 4MWSA 4IH1A 3ESAA 4ZRDA 1GXSA 5LZ8A 3A2MA 3D4LA 2WHPA 3F96A 2HHAA 3SWWA 5HK8A 1QZ3A 2XMQA 4AXBA 5LKAA 1K6EA 4JYMA 1E8NA 1H2WA 5C8ZA 2QS9A 2O2GA 1EB9A 3R0VA 3NGMA 5AH0A 2HRQA 3R3ZA 5C7YA 4XX1A 2G63A 2H7CA 3MUOA 3D2CA 2CEKA 3I2GA 2XI4A 2XB6A 1BU8A 1ZOIA 4HAIA 2I78A 1UT6A 3R3WA 3VJLA 4HXGA 2OCGA 3M82A 2HA5A 3A2LA 1KU6A 1Y7IA 1ISPA 4K5QA 4Y2JA 5DTIA 5HF6A 1TCBA 1QE3A 5ALOA 3FYUA 3FOBA 4G4GA 1CUJA 2ONCA 4P08A 5CH5A 4P9NA 2VF2A 2X5XA 1THTA 1BROA 3R3UA 1XZFA 4WFIA 2GBFA 3D7RA 5ALEA 2XUHA 5HFAA 1SCIA 2GZRA 3NWOA 4JEIA 2RONA 3G9ZA 2PSJA 3QH4A 1A7UA 5KWJA 1YR2A 5EHNA 1XKTA 4Y2RA 3A6ZA 1WPRA 2VA9A 4RPCA 4L0CA 4LYEA 5AI0A 3F98A 3IUNA 1WHTA 2Y1KA 3W06A 5LIPA 4B84A 3KOOA 2BFNA 1QOZA 1FFBA 1ZGCA 1AC5A 2PSFA 5HQ3A 2Z5GA 4I4CA 1DX6A 2RGUA 5CT8A 2X8BA 5ALFA 2WIDA 1VZ2A 4TVKA 1SCKA 1XKLA 4CIAA 4DIUA 3G0BA 2HU5A 6YASA 3U1TA 4AX4A 2XMZA 2HA3A 4WFJA 1YA8A 4LKOA 5JANA 4QZVA 4M0FA 4Y2UA 1VE6A 1JFRA 3FYTA 1XRQA 4LHEA 4PSDA 1X2BA 4BAUA 1ZD2P 2ECFA 3WWCA 1UWCA 2AXEA 3WA6A 4C4ZA 2WTNA 4FBMA 3TJMA 3FCYA 3RLIA 3WKDA 4X91A 2EDAA 3YASA 2GYVA 2XUGA 5ALTA 3L1HA 1ODCA 1YB7A 5DNUA 1JMKC 3WKCA 2FJPA 5YASA 1XLWA 1XZKA 5EIHA 1D07A 2OGZA 1GQRA 5K3AA 3BIXA 4E46A 3G0IA 1H23A 1QLWA 3RKSA 4PW0A 3OM8A 5AIBA 4NS4A 4Y9SA 4G9GA 1EK1A 4ITVA 3STXA 1EA5A 4GW3A 3STWA 3BDVA 2XUDA 2PSDA 3ZLUA 2JGFA 3C8DA 1YSCA 4ZXFA 1CVLA 3VVLA 2XMBA 1MAHA 2WFLB 4C89A 1OCEA 3DYVA 2HFJA 3C43A 4NVRA 3OOSA 3W9BA 2V98A 2ZYRA 3IUMA 2Y6VA 3G8YA 1CUFA 4DGQA 2AJDA 4L72A 1UZAA 4H7DA 1CUGA 1JU3A 5A2GA 3FLBA 2PKYX 1P0IA 2OQVA 3QBJA 5K3EA 2CZQA 5EGNA 1QJ4A 4DM7A 2R11A 3BE8A 1E5TA 2HM7A 3DOIA 1QIDA 4UBNA 2J3DA 3WL7A 4B9EA 4KJXA 3EF3A 3C70A 1K5PA 4M0MA 5HCUA 1ZJ4A 4OPMA 1CR6A 4Y2VA 4H18A 5IVIA 5ALHA 3I1YA 4MJ3A 1USWA 4ZV9A 1LPOA 4KE7A 4Y2XA 2WU4A 1E3QA 4X71A 5AM4A 3QITA 3G0CA 1Q84A 4Q34A 3DD5A 3WJ1A 2WUGA 4EHBA 4AQDA 1LPNA 4DNFA 2WHRA 2WIJA 4UBKA 3ANSA 4F0JA 3X3HA 2DHEA 3BJMA 1IZ7A 5JADA 3DL4A 4BCCA 2WJ3A 3PE6A 3WK5A 4IQ4A 3R40A 1AZWA 2BJHA 1GPNA 1AX9A 2RIPA 2XQJA 3QMMA 3F67A 3UUFA 2ZJ7A 4WFKA 3G9UA 1CUHA 4OU4A 5I8PA 4FNGA 3G9TA 4GHWA 3DS8A 2O7RA 3WWDA 1CLEA 2HADA 1XZMA 5EIAA 3IULA 5K3DA 5BV7A 4WCVA 5CTAA 4KRYA 4UUQA 5AKLA 3WJ2A 1UKCA 4KE6A 4S0XA 1ODTC 2Z8ZA 1W6RA 5ALRA 5FXMA 1CUCA 3ESBA 3R3YA 1TK3A 1N8SA 3DQZA 4A16A 4X92A 1TCAA 1XZBA 4E14A 1CUSA 5AK3A 4OD0A 1AKNA 2PUHA 2WJ4A 1XZJA 4CIBA 2XUIA 2WU3A 1XZCA 3C5WP 2QR5A 2XQFA 4YK7A 2WLSA 1NU8A 1LZLA 1C4XA 1R1DA 5JAOA 4FLFA 2FX5A 3PICA 1HLGA 3I6ZA 2D0DA 4UHHA 5JZSA 4RGYA 4AN0A 4H35A 5CXUA 4C01A 4J0HA 3N0TA 1QIHA 1N5RA 3DYIA 4CG2A 2G4LA 5E4TA 2OGSA 4BE9A 2C5GA 2G5TA 1L7AA 4J0KA 1GZ7A 2QVBA 5ALUA 4IH4A 5JALA 2G5PA 3H2IA 3ZPXA 1N1MA 4HVTA 2C0PA 2WQZA 5SYNA 4DNOA 1MPXA 5AM5A 5DYTA 3BL8A 5JD5A 1JT2A 1ZIXA 3KWFA 1VKHA 4JH0A 1THGA 1HL7A 5FLKA 4OU5A 4ZREA 4FLEA 1CV2A 4U2GA 4UBLA 3LS2A 1MU0A 1FFCA 2CKMA 4DMKA 1ACJA 5HZGA 1E66A 3EIOA 3H2KA 2IITA 4Q3KA 4X6YA 2DFPA 4W1QA 4BAZA 1CUXA 2PVSA 2JEZA 5DTJA 3IUQA 2OCKA 5EHQA 4Y2PA 1MJ5A 3WK9A 2GBCA 4FKBA 4A23A 2ORYA 3HC7A 2QOEA 1VXOA 1NU6A 2ZVDA 3G0DA 3WYDA 2YASA 4UPDA 2FUKA 4YX9A 3KWJA 2JGJA 3I6YA 4QDOA 3C6BA 3STTA 1QONA 5BWBA 3FCXA 3AZOA 2QJWA 4H7HA 3I1IA 4IH9A 1HDEA 2YXPX 3W05A 1IUNA 1CUVA 2Y2UA 5JATA 5KREA 5ALWA 3BDIA 4HRYA 2XLBA 1ZICA 3VVMA 5LZ2A 5CMLA 3H2GA 1SFRA 2HA6A 2FJ0A 2OGTA 5HF8A 3DKKA 4EY5A 2HA4A 4AO6A 2HL6A 5AM1A 1ZIYA 3A2NA 4KE9A 3FYUB 4X3CA 4ZV7A 4B0OA 2WTMA 2VT7A 1WCYA 4FOLA 2DCMA 1A88A 1Q83A 1ZJ5A 2O7VA 3DOHA 4BYMA 1DWQA 5JD6A 3MUNA 3DDUA 1ORWA 3KXPA 3U0VA 3UMJA 4X6UA 3C6YA 3BXPA 3QVMA 1EI9A 5CT4A 3M3DA 2ZSHA 5HF9A 1DWOA 5DYYA 4AZ3A 5AKGA 1UK9A 1XZLA 4MEAA 2Y2VA 5A7GA 1BCSA 4ARBA 1MO2A 3D0KA 3CXUA 3LCRA 5AI9A 5D3KA 1EH5A 4PQEA 3ICVA 3STYA 2PUJA 3I28A 3HABA 4U2DA 4OCZA 4X90A 1VE7A 4BC0A 1QO7A 2J3QA 1CUBA 5T4EA 1CUIA 1FJ2A 5CH3A 4DMHA 2BCEA 5K3FA 3C6XA 1CRLA 4DMFA 1L7QA 1BN7A 2AJCA 5HFNA 3Q8WA 1DINA 5A71A 4LXIA 4I19A 4IO0A 3TRDA 4ZGBA 4BZZA 2BUCA 4HXEB 2QZPA 3WWPA 4DSAA 3DEAA 3ICWA 1XQVA 1Y7HA 5FPPA 3PFBA 1U8EA 4KAAA 4QLAA 2QM0A 1E8MA 4JUIA 1UK7A 3AZPA 3V1KA 1FSSA 4BDSA 2PU7A 4DMCA 2Z3ZA 1K8QA 4Q82A 1HKHA 1DWPA 2E3JA 1XZEA 4GXNA 4BATA 1BE0A 4QE3A 5D7BA 4WY5A 2EEPA 3WIBA 1VA5A 4DLNA 3PDCA 3QPAA 1A8QA 4UHFA 5I7UA 3PUHA 4IHAA 5ALZA 1F0NA 2WIFA 5AM0A 4FWBA 3TEJA 4LIPD 1H2ZA 1MAAA 4YASA 1XRPA 4U2EA 2WSLA 2XMSA 4UHDA 2HU7A 5ALXA 3T4UA 3QMWA 3VDXA 3GBSA 3QZUA 1CPYA 5LP1A 2BKLA 2VJCA 4BBZA 2AJBA 4V2IA 3WQHA 1R4ZA 2WJ6A 4K6GA 5CXXA 1TRHA 3LP5A 2WILA 2AJLI 2BAGA 3EBLA 1QIKA 4KAJA 5ESRA 3ZV7A 3VKFA 3FSGA 5IVKA 3WK7A 3IVMA 4BCBA 3O4GA 1J07A 3AILA 1VXRA 2C0QA 5EFZA 2HIHA 1VZ3A 4UBOA 5H3HA 3FVRA 4INZA 2XDWA 4J0JA 4J03A 2OPHA 1CUZA 1DTEA 3C45A 1U2EA 5SYMA 4W1SA 1JJFA 3WIOA 2XUKA 2HDWA 4CCWA 4BC1A 4AN1A 4N8DA 3V1NA 1QFMA 3NUZA 3AFIA 2VJDA 4J3JA 4UHBA 3HEAA 2RHTA 1PJAA 2I03A 1W4LA 2O2IA 5JZBA 5CBKA 2LIPA 3Q0TA 2XUPA 1XZDA 3SC2A 1XQWA 1IVYA 4GI1A 4KACA 3VJKA 3I2KA 2ACKA 3V1LA 4B7ZA 2WG0A 1JKMA 4B82A 3DNMA 4HXFB 2DHCA 4P93A 2XE4A 4RNCA 5FV4A 2XUAA 1XFDA 3QM1A 2YH2A 5AK5A 1I6WA 3A70A 3WI7A 1P0MA 3H2HA 2WG1A 5AM2A 2BUBA 2Z8XA 1TKRA 1NX9A 3HJUA 1F8UA 2ZJ6A 4QEKA 4MYDA 1MX5A 4FLMA 3N2ZB 4W9RA 3AUKA 4AMYA 5ALVA 1WM1A 1AGYA 3ZI7A 3B3QA 2OQIA 5E4YA 1LPPA 2B20A 4BVJA 5JYCA 1N5MA 2WUEA 4GEGA 3WL8A 4D9JA 1J2EA 2H9YA 4CFSA 4Q1VA 2JIDA 3DKRA 5ALPA 3IB3A 1AQLA 2PSHA 1XRRA 1CQWA 1YCDA 4XIIA 4PNZA 4ZI5A 1MX9A 1XLVA 1EINA 2HRRA 4ARAA 3H1BA 2CUTA 4BP8A 2JEYA 4C4XA 3BJRA 4BCDA 4BZWA 4E11A 2D5LA 3I2HA 2Y6UA 2VSQA 3JW8A 4A5SA 3M81A 3QPCA 1K63A 4AO8A 4BRSA 2QXUA 2WIKA 4MWTA 2VJAA 4ROTA 5JAHA 4H77A 3WLAA 4QWWA 4DSZA 2QKYA 5DWDA 5DYWA 3G02A 3NOXA 2QJRA 3GUUA 1DU4A 1ZGBA 5IKXA 1DX4A 2JGKA 4AMZA 2VATA 1YAHA 4UHEA 3IA2A 5D3ZA 4EBBA 1C7IA 1T4MA 3H1AA 4FNMA 5LKRA 5AOCA 1JU4A 4C4YA 1QTIA 1GGVA 3D59A 4B9AA 3TGLA 3HLKA 1CEXA 1IUPA 1RYYA 4K6KA 5ALDA 1O6GA 4HRXA 1WOMA 4J7AA 1UOOA 2AJ8A 4PV7A 1QTRA 5HK9A 2GBGA 2CMFA 4BDTA 3ZLVA 1W76A 5E2IA 2DSNA 4X93A 4MXDA 2K2QB 2WIGA 4U2FA 1CUDA 3FSGD 5C8XA 1ZD3A 2OAGA 1LPMA 3IDAA 4FHZA 5AKJA 3RARA 1ZD4A 1U65A 3S2ZA 1ZI8A 1MNAA 1WB5A 4MQLA 2EDCA 1XRLA 3WA7A 1G66A 2XMCA 2XLCA 4OUKX 4BTVA 1FFAA 4CI9A 3BWXA 1UOQA 1Q0ZA 4BE4A 2I3DA 4Y2QA 5AI5A 2QTBA 1XQXA 3FLEA 3E1GA 2XUJA 2VJBA 5AI4A 4EA6A 4OB6A 1W52X 5AO9A 3OG9A 5HKBA 2J4CA 3H18A 3R41A 2DHDA 3B12A 3FYUC 4QDZA 1R9MA 1UXOA 2GYUA 4G4JA 4Y2YA 4BVLA 2PPLA 5IH7A 5F4ZA 4ZWNA 4X7BA 4PSCA 1A8UA 4PO3X 4AZ0A 1YB6A 1P0PA 4BTLA 4EY4A 1EX9A 3IIIA 2HA2A 3W04A 2JBWA 2JGIA 5LZ4A 5CT6A 5AP9A 4GLBA 1R88A 4X6XA 2XQIA 5ALMA 2WHPB 2DQYA 3HRHA 2BGNA 3WYNA 1LPAB 1B6GA 3DL7A 2XUQA 2XT0A 1M33A 1ZI9A 3S8YA 5A6VA 4QDXA 4XVCA 1OILA 1QIEA 1JJIA 1P0QA 4HZGA 1BEEA 4G9EA 1XQYA 3O4JA 5HF5A 2JGEA 3ANTA 1XROA 3B5EA 5EHXA 3RK4A 3G9XA 1UKBA 3O9MA 4HTAA 5C8VA 2OCIA 3KD2A 2H7YA 1IMJA 3MGAA 3F8SA 2C5FA 2W22A 2C7BA 2YYSA 3WZMA 4W1PA 1CUWA 4G8BA 1TAHA 3I6MA 1FFDA 1E89A 1AUOA 2V96A 3O4IA 5DNVA 1EHYA 1K4YA 5ALKA 5DLPA 3FLAA 1CUEA 4TPKA 2XMDA 2ZYSA 4KE8A 2VAXA 2VQ6A 3V9AA 4CCYA 1ODSA 4ETWA 3R3XA 2V97A 5ALSA 3ESCA 4P92A 4WDQA 1XZAA 1QIFA 1BEZA 1ETHA 1U4NA 2JGLA 3JWEA 1WB6A 1LGYA 4FDMA 5A62A 1LPSA 4X85A 5K3CA 2W6CX 3SK0A 5LYYA 1MTZA 3C5VA 1XLUA 3WL6A 1GKKA 4EY8A 5FDFA 1H22A 1JI3A 1HBJA 2HU8A 5ALLA 5FKJA 5A7HA 4BAGA 1HQDA 4Z49A 1LZKA 2C4HA 1TQHA 2ES4A 3WK4A 5EIEA 2H7XA 3P2MA 5HQ3B 4N5IX 1WHSA 2BUAA 3WL5A 4GECA 2WUDA 5T4BA 2Q0XA 2IIVA 3OC0A 1IZ8A 4X00A 3E3AA 4UHCA 3CCBA 4AO7A 3QYJA 4MQMA 5CURA 3ILSA 3DJYA 1Z68A 3I2IA 2BGRA 4OB7A 4K6HA 5ISMA 5LLSA 3C87A 4KEAA 5IVHA 2WM2A 1R50A 5ALJA 5AK4A 2QRUA 5T4HA 4C88A 1R3DA 2P8SA 3PF9A 1X2EA 1UFOA 1ORVA 2OCLA 2WFZA 3QPDA 4X97A 3HSSA 3WKEA 2UZ0A 3MVEA 4H7IA 2GZSA 2WHQA 2OAEA 2ZYHA 3O9VA 4OYYA 3WMRA 5FRDA 4FFVA 4LYDA 1SCQA 2I3ZA 2VEOA 1QIMA 1GPKA 1CQZA 5I9IA 4RE6A 4OB8A 3AIKA 4H0CA 2GBIA 1PFQA 4N5HX 3I2FA 3FNBA 4J0DA 2QUAA 1GPLA 4L3WA 1YA4A 4X95A 1JMYA 1WPXA 4O08A 4QLOA 4GDMA 1H2YA 1YS2X 5JAUA 5AM3A 4B83A 5IVDA 1Q0RA 3G7NA 3ZLTA 3HI4A 1IUOA 1RWQA 1DQYA 4BVKA 1ZD5A 3FBWA 2ZJFA 3GA7A 4B6GA 4NZZA 1LBSA 4EUSA 3KDAA 5AICA 1KEZA 4I3FA 4DYHA 4QDUA 1BN6A 1YAJA 4E15A 2VAVA 2WKWA 1CUUA 2PX6A 1UKAA 2XQGA 5JAPA 1LBTA 3WZLA 3PFCA 5AOAA 2HA7A 4LXGA 4GBGA 3E0XA 5JZ9A 3H17A 1YASA 3M83A 1DT5A 5AKYA 5ALQA 3OTQA 3FAKA 3V48A 2V9ZA 2CB9A 3EQ9A 1CUAA 1R9NA 3FWHA 1MX1A 4Q3LA 2ROQA 7YASA 1SC9A 3H19A 4DNPA 2O2HA 3KSRA 5BOVA 5AI8A 5LZ7A 3WK8A 4FFWA 3AIOA 4FMPA 4DTCA 3GZJA 3I2JA 1HPLA 3LLCA 4YPVA 2VT6A 2PSEA 1UK6A 3RM3A 4U2CA 4BB0A 4EY6A 1SOMA 3VISA 5T4FA 3BF7A 1F6WA 1DQZA 4H7KA 4BRZA 4H7EA 1YS1X 1RP1A 3ZWQA 3PI6A
chains in the Genus database with same CATH superfamily
2QW1A 3DWEX 3HV0A 3JPWA 5IKEA 1QP4A 3NAZA 3R7SA 2MSCB 3STVA 4NV1A 2UZIR 2OLKA 2AK2A 8AT1A 2BSAA 3GFFA 4TL6A 4BGDA 1NM5A 3AXTA 3UENA 4KDRA 4BP3A 4NJMB 4GX1A 1I94B 1L5QA 3SOZA 3UUEA 4WEOA 4WUVA 1XEWY 4F84A 2WB2A 1A71A 4R31A 1U2GA 1Z62A 5EGSA 5JPCA 4ARUA 4EB3A 4YMGA 4OFXA 5JR3A 5K0SA 1DL5A 2AH5A 4W8HA 3NVKI 1FTYA 3TIIA 3OZIA 4UTRA 1OLSB 4RKEA 4HWKA 2YIMA 1RKQA 2DR0A 2FW6A 2V59A 3FRIA 4OA8A 5EEGA 3Q2IA 1STOA 4NCJA 2V03A 1FJHA 1P60A 2P5TB 2EWMA 2WK1A 2VSOA 3HLTA 2DBVO 4A91A 4NYMR 1XMVA 5K2MA 3COYA 5TIIA 3BRWA 3FW1A 3HJTA 2DERA 3OQMA 4UFOA 1VJ5A 2GK7A 4NNPA 1N4AA 3CPJB 1QCZA 2Q0SA 4WA7A 1FS4A 2XF8A 3QYFA 1AURA 3CUYA 5AXDA 3QFTA 3KALA 4IHJF 2C2OA 1U9ZA 3FMVA 4X61A 4JY7A 5A3VA 4GKBA 2C9BA 4BLUA 4UQOA 1ESCA 1I9GA 3AI7A 2NTEA 3R3VA 4PO8A 4ESEA 7REQB 4Z9FA 5IAOA 1Z4LA 3H5RA 5A03A 2Z83A 3OCUA 2ZKIA 2Q1XA 4RA9B 3T7EA 3IDZA 3UWPA 1M72A 3CLVA 4BN5A 2XBMA 4JHLA 1L5SA 4EM6A 1M7HA 3B8EA 1SD1A 2YMQA 2EZTA 3P20A 4YDRA 3SS9X 2HSWA 3U4DA 3IPYA 3SKYA 2CDBA 4AJJA 4F5WA 2GBPA 4FX5A 4HJXA 1T1EA 5DJ5A 2K87A 4R0VA 3N3AC 5IABA 1UPCA 2EYUA 2P2SA 2QEQA 4NR0A 3ZWVA 2X9QA 3C6MA 3KZXA 2O2SA 1NXWA 3USZA 4IIVA 2GZ1A 2E6KA 1TF5A 4Y8VA 3HKEB 2ZBFA 3O8OA 5JC1A 5JCXA 2ZWMA 3L8CA 4H6VA 5JRZA 4ZARA 2V4UA 3ASVA 5JZMA 4UD2A 2R7MA 4EGSA 1II8A 1JDUA 2ON6A 5ELXA 1JR3D 1E0SA 4HS9A 4E6EA 4EZBA 2QW0X 1DG9A 1SK8A 2A4MA 1U9CA 2Z4TA 3AU9A 5K0JA 1J2RA 2XQKA 3B6KA 3LW7A 1NXSA 5DHFA 4EB0A 1JHVA 1YMUA 2YZNA 4EJMA 5ERYA 4GO1A 4ANFA 2PRYA 2WG2A 2CEAA 4HZIA 1JG6A 2GZ2A 4PM4A 2Z2KA 2ZWPA 9LDBA 3GRFA 4U39A 2IXTA 3SIWA 1R8JA 1WB4A 2P6NA 3QE4A 2V7BA 4KW7A 4TQ9A 1A76A 1O2DA 1V1MB 2RDMA 3PDWA 2HW8A 2QUIA 1FUUA 1DAFA 1QF9A 3RYIA 4L0MA 2OVBA 1AMNA 4NONA 2IYEA 3VPHA 1FXWA 2V6BA 3GYGA 3Q7EA 1TLTA 1G21A 1Z2CA 3OOEA 1P91A 3MTGA 4HKTA 2TMKA 3KZVA 4I50B 4ZO6A 5CNMA 3G1TA 4M0EA 4PYMA 5TNXA 3D81A 4G5YA 4J29A 4L2IA 1U1IA 2JLQA 1DBRA 1N3BA 5AOBA 4B3GA 3E9ZA 1AKUA 3K9WA 4XGKA 3FMIA 1E4VA 1R0CA 3HYRA 4HGQA 2B8TA 4LDNA 3R0JA 1SOUA 3IJEB 3ZWYA 3VKGA 3GLQA 1HDCA 5FP0A 1A2KC 1Z74A 3MPOA 4LZOA 2XUOA 5JSZA 5BVHB 2AOTA 1QYWA 3AFHA 4CTOA 5K03A 2QXTA 2ZS7A 2B3DA 1B0UA 4KUEA 4KMSA 4XEHA 4KHPB 5E1OA 4DJ5X 4LHZA 2W6QA 1TTTA 4NU5A 1P2TA 4MQBA 4BJ5A 5ED4A 1YOVA 1M67A 2DH6A 2BR3A 4KYUA 4BVAA 1E63A 3D7KA 2D5BA 1QHEA 3ZWWA 4GMXA 2P9QA 3ORYA 2CMKA 1M5UA 2ZT8A 4HJRA 4U2BA 1HTBA 4YYZA 1PQ4A 3TEMA 3EEIA 1OH6A 1KJJA 4D02A 3IC5A 2JLZA 2A5GA 4N3GA 3AEUA 3PVSA 3WWYA 1VJCA 1D4AA 4WVFA 1OIXA 4IO1A 3JYHA 5JYBA 2P75A 1N3LA 3CF2A 1P4SA 1DJOA 2CL6X 3MTJA 3G0GA 3FMFA 3MTDA 5JJLA 4TS4A 3T4EA 2H5IA 4FOSA 1RQNA 1FU7A 1Y1RA 2ECKA 4LK3A 1K92A 3A3PA 5SY4A 1UBLS 2BGIA 1VMIA 3FPHA 2PANA 3UCEA 2OWDA 3A58B 3V1TC 3D2AA 3B9QA 1T1GA 2ZSIA 3H0KA 3WK6A 4EHIA 4TLMB 3RRJA 4DBVO 4GX0A 1CK4A 2FEPA 1QVVA 2IYUA 3Q7SA 4JC5A 3S8MA 4KI0A 2ONKA 2ACEA 1P5ZB 2EBFX 2FVYA 3AJAA 2BM1A 3O8BA 5TPZA 2CZCA 2NACA 4G5XA 5C1OA 3ZLJA 1EDDA 2B8NA 1WUHS 4F7DA 4DJTA 2JKVA 1C9EA 2OGWA 3MTQA 5E3IA 3T7IA 5KNDA 1Z5VA 3TZBA 1M6YA 5AKKA 3TXXA 2XXBA 4JXZA 1KPGA 4HSEA 2FGJA 4D0GA 1PF7E 3RC8A 3H5OA 1ZOPA 4DUGA 6NULA 1KJWA 1QMPA 2BM9A 3EA5A 3D0RA 3E61A 3Q85A 1TZCA 3CNQS 2E4WA 2Q1YA 3JTMA 4AG5A 1VG0B 1YC2A 4MB2A 3RSLA 4JT4A 4DNQA 1ST2A 3GUCA 4AS1A 3PTLA 5BNTA 3PQ4A 1JQ3A 2C2ZA 3BH6A 4J43A 1BW9B 1IFXA 2GZHA 2POCA 1E69A 3N07A 4MS3A 5DN6D 1XMPA 3FHLA 1PR9A 4X20B 4KQKA 3T1HB 3HJHA 1XCMA 1D7OA 2NU8B 2C2YA 3ZN2A 3A6DA 3LECA 2JCBA 2WINI 1US8B 3QY0A 2BHRA 2AWNA 4WEQA 2ZTHA 5FR2A 5HIMA 3C8MA 3H2JA 4J9VA 4FE3A 3KZCA 1KMNA 1RFLA 2WU8A 1F2TB 1B41A 1S9HA 4LMBA 4CKWB 2FN4A 1VGQA 1ZLYA 5A02A 1FFEA 2BHSA 4KRXA 5CT5A 4LK2A 4MW9A 1GGEA 1J8DA 4RLQA 1XU7A 3C1UA 1LLQA 1MNQA 3EGOA 1Y7PA 3G0OA 5FUMA 4G25A 4LF5B 2ZCJA 3DLAA 3OOHA 5ULLA 4RTMA 1LC0A 1OA0A 2I4IA 2WHEA 1IPHA 1X7YA 4H7FA 5K8UA 1E9AA 3P94A 1NBOA 5ALIA 1KY4A 4KHZA 4ZHSA 3D1LA 2GK4A 2JFGA 4YWJA 3LCMA 2IK8A 2ZE7A 3B5JA 3KTAB 3D5EA 4FD2A 2D2IA 1AF7A 4L9AA 2XUFA 4QYIA 1F4VA 3VOTA 4D8WA 1EDBA 2GWRA 3KVVA 4G8DA 5EQTA 4C7OB 2FETA 2H08A 3A8TA 1XZHA 3H1EA 1OYWA 5KNCH 4JR0A 1I6LA 3V8MA 2KB0A 1P2FA 1FUEA 3SYNA 3RC2A 2JJ8A 4RK6A 1X8JA 2PUVA 4L57A 2QXYA 3T0GA 2I4TA 1U6IA 4DE5A 4DV5B 1JDBC 1J0XO 3IHLA 3F6YA 2DMRA 2R62A 4KX5A 3PDUA 2C2HA 3FB1A 3SDBA 1TM3E 3RB8A 3HO1A 1GNQA 5MN5A 3SX4A 1P45A 1GO2A 4C21A 3HCAA 4CCYB 2OM6A 1XTPA 2FTKE 3A27A 4N7BA 3GNQA 4M0UA 2Q1UA 3HXKA 2YHIB 3GOHA 4AQYB 3RH0A 5CB0A 5M2QA 6PFKA 3WGHA 5JDCA 5JMWA 1XZQA 4KFCA 1JGTA 2G36A 1HOXA 1M1YE 3L4JA 4RMIA 1HMYA 1VJ1A 2FPLA 4D46A 7ADHA 3FHJA 4NAUA 3UAWA 5LB2A 2IC5A 1XWIA 1EFPA 5JQGA 5HIJA 1ZEJA 2WV9A 1E9FA 1WCIA 1POWA 1J06A 4PYKA 2WUFA 2IEZA 4MHTA 2K6GA 1VMAA 4ZI2A 3ZE9A 5ABPA 3IAAA 2V3CC 4D2IA 3V1MA 1LC3A 4OKSA 3PC3A 4OHPA 1ZA2A 3BF8A 1SC4A 5FLYA 4C87A 4IJUA 4G67A 2JIRA 1CC1S 4QWMA 1FOEB 1E20A 4DUPA 5E4JA 1Z5WA 1SVUA 3CCCA 4JYPA 4JJFA 3W4IA 4KWIA 3JD2A 1VKZA 4EYSA 4IMRA 4PHCA 4BRWA 3RS7A 2XE7A 5KU1A 2P5UA 3HCRA 1JAZA 2IYZA 4B0PA 2XYGA 1QIGA 1KKUA 3RI3A 2VP6A 2ONZA 3ASZA 5EP4A 5I01A 1KAMA 1ESNA 2BMFA 3K2QA 2BGUA 4PX5A 2WTUA 1VL0A 1NVBA 2FG5A 3TUJC 4TSKA 1Y8QB 3CNNA 4UMFA 5K51A 4DM4A 1WHSB 2LNDA 2PAAA 2BVNA 2PIAA 5FNZA 3TR6A 2EQBA 2AYXA 3QV2A 3AVVA 1A9OA 1DKRA 3VNBA 3VZPA 3BD9A 1CQJA 2V9CA 2DU8A 2OV8A 3II6X 3L0CA 2IW3A 4YLEA 4OOFA 1KRHA 1S01A 2GYWA 1A5AB 1RLMA 4MRPA 4B75A 2QORA 1R6UA 1EVEA 2EHDA 1G0OA 4F3RA 1DJNA 1NJ2A 2OP0A 1I0LA 1CYDA 1KYVA 1BG6A 1GKLA 3IUYA 5BR8B 2ZDGA 4GZ3A 3HBMA 2OG1A 5C81A 3LG2A 1RMTA 2P78A 3KZNA 5BPFA 3AZQA 3I61A 1UOPA 1II0A 4P4GA 4YRLA 2PQ6A 1M0EA 1MVLA 2CBGA 5HEKA 1A8IA 2GEJA 2ID4A 1CIVA 1UJ2A 3HKBA 1E2PA 1L4GA 4G1FA 4WJZA 2Q1TA 2J9FA 2X8AA 2YIVX 3KSDO 1C4KA 1T5IA 3LIPA 4X1IB 3UAGA 4LJ5A 1L7PA 2C99A 3OCXA 1V8PA 1WNTA 2DCUA 3AQ4A 3QNMA 1ETUA 5DHTA 1YDFA 1BCRA 3IBFA 1IIBA 3B6IA 1E94E 3L8DA 1VSVA 4IH1A 4LE1A 4HEHA 4OJKA 5IHXA 3PNMA 4ZRDA 4P7BA 1YKGA 4IDNA 2PYDA 5HQTA 1JVNA 4Z0HO 2AD5A 1WZIA 2QAGC 1PZNA 2H1HA 3AERA 3BHIA 3D3KA 3PD7A 3IKVA 1ZK2A 1DKPA 2CVFA 2D1RA 3R0QA 4OP2A 2W90A 1ORRA 3RUEA 4CF5A 2VLBA 4E21A 2PRIA 3E1KA 2XMQA 2GT1A 2Q2QA 5KJCA 5HBGA 5CCBA 4Y9RA 5LKAA 1BKSB 3HJRA 4LNAA 4UM5A 4EG0A 4IFBA 4YAOA 1E8NA 1L1EA 1SVNA 1H2WA 1YJ5A 2BLNA 3D54D 3GDFA 5IYZF 5F98A 5LYJB 4NE7A 1ECLA 2PD3A 3PG5A 3Q6IA 4PGFA 4EPVA 1HYHA 3GJ3A 3PUYA 1C50A 3B7GA 2W42A 5T5QA 4BLQA 1M8PA 1Y6JA 3PWZA 5AVSA 1O08A 1SMKA 3PIRA 3ELBA 3ROXA 3WLPA 1W2GA 2OFFA 4DQVA 4E7PA 5ITSA 2IH4A 1KVSA 4CETA 1R8QA 3CUKA 1KK3A 3VH4A 3GARA 4S0ZA 5TT1A 1VBNA 3KQNA 2ZRDA 4A2CA 5EIOA 1JNYA 2G63A 2NUBA 2PKWA 3QXHA 4IG9A 5D5HA 3Q1KA 5BNZA 1XDZA 5UKDA 4JLKA 1ZVVA 4CKBB 1KOFA 3T9CA 1OPRA 1RAGA 3CUSA 2XIJA 3NV9A 4UNIA 3EAQA 2PCLA 3DAYA 4ZVOA 3QHAA 2I78A 4JJGA 2DRIA 1O58A 4QU0A 1HLPA 3VJLA 2FUG1 4HXGA 2OCGA 3AB8A 1RZRA 2VF5X 4LRXA 1X39A 3HS3A 4PR3A 2WTEA 3PUJA 5K0TA 1KU6A 5MFPA 1TCUA 3O7WA 1OASA 3WYBA 5KB3A 3EEOA 4G6ZA 3RADC 4HVCA 1ISPA 1UBTS 2DWCA 4LCEA 4MITA 3SR0A 3H2ZA 4Y2JA 2OBXA 4HDRB 3EXEB 3U3OA 1IMOA 4MR8A 4Q24A 1TCBA 1FYWA 1N36B 3T34A 3FYUA 4PIPA 1WDWB 2EF1A 2EP7A 4QTZA 3W7BA 2VWHA 4K6MA 4QBIA 3RV4A 3ZVKA 5CCXA 2YQ4A 4TKUB 2DJIA 2ONCA 3RVBA 5I4KA 4NENA 3DEZA 3THYB 4PZUA 5FI1B 4P9NA 3UJ3X 1Z4OA 3GEPA 3AKYA 4Z9BA 3W3AH 1THTA 4RFSA 4R5HA 4NXNB 4MAMA 5DWVA 4WFIA 4EKGA 3WAJA 2QU8A 5E3HA 5B53A 3NLLA 2NUPA 3KTFA 3P9KA 1JBEA 4C04A 1SCIA 1ZN7A 3JD3A 1MJNA 2E4UA 4TSFA 3KD3A 3RRYA 2RONA 4EW2A 2ZSKA 2ZRNA 1IG0A 3G9ZA 1QZTA 1SQSA 1XDWA 1XDGA 1OGYA 3CTMA 4QGHA 2FSVA 3KFXA 4JA0A 4QGAA 4JJKA 1QCDA 1FDUA 3DV0B 1MVNA 4XPZA 4F9EA 3WLHA 5ICFA 4L85A 1G41A 1FS6A 1BEUB 4R05A 2C97A 4Y2RA 2RGWA 4RTOA 4K3VA 4JA2A 2R751 3ZHQA 4URXR 3OJCA 1QPZA 5KC9A 3HCEA 1PL6A 1XF1A 2FSGA 2G80A 4EI9A 3FWZA 4KIJA 4LCJA 4DA4A 4M9QA 2OSVA 4ZRMA 2SHKA 4H1VA 3THXA 5A0VA 2IODA 2NZWA 4OBXA 4B3MB 3GMTA 5IU6A 1RWMA 3QVJA 1VE3A 5IT4A 2P3LA 2V6FA 3A6PC 1W93A 2O6LA 3WYEA 2RH8A 1QE0A 2Y1KA 1DTSA 4DYDA 5L3VA 1DEKA 2OOKA 2XGGA 4FYKA 2Z2YA 4H3SA 2AZMA 5HS6A 1TW3A 4LI3X 1LEHA 1B2RA 1PCXA 2GZDA 4JCCA 1D1PA 3WGKA 2BFNA 1ZGCA 1FFBA 2A92A 2YQZA 3KBOA 1AC5A 3KPWA 3EGXB 2M32A 4PLYA 3K05A 3PWTA 4YDSA 4NOKA 3PCRB 2YBDA 4IV0A 4CMEC 1OE0A 2OD2A 5HQ3A 1YI8A 4EO4A 1DX6A 2PE5A 3MB5A 5CT8A 5B2ZA 1EFRA 1F9EA 3NNSA 2P67A 1E0JA 4OJTA 4AJOA 3C5HA 2UYCA 1DIOB 1RPNA 3N6VA 1XCOA 3B1FA 4GWGA 1RXWA 1N6IA 4DIUA 3G0BA 5LA6A 4BEJA 4B09A 1FFSA 2XRMA 1JQBA 3U1TA 1VKNA 3EH1A 2XMZA 4WMLA 4EB6A 5PGMA 5EEHA 1ULUA 4EUHA 1T6NA 2HA3A 4MYUA 4WFJA 4F91B 4ZTUB 3GVIA 4QZVA 1H3EA 1FFGA 2OBBA 1R18A 1ENYA 1GCUA 4LI0A 2BC9A 2WR8A 3DZFA 4PSDA 2Y0PA 1X2BA 2GLTA 1X8XA 1ZD2P 3AJDA 4BAUA 3KJFA 5C0OE 5I6DA 3E9RA 1T6YA 2AXEA 5CA1B 1KFEB 3Q9UA 1JKFA 1LNQA 5GONF 2RGEA 4E22A 1PZHA 4D41A 2RGDA 1P7VA 2YICA 4UM9B 1PT9A 2QN6A 5BSVA 2WF6A 1QOQB 1LK0A 1RXIA 3WKDA 2ISCA 3CW9A 3L6OO 1E79A 1I1QB 2FSFA 4Z4EA 2EATA 4B3JA 4CLRB 2HRZA 2C03A 2AR0A 3YASA 1UMCB 2NXWA 2RKOA 1X74A 1RBZA 1FIUA 3M4NA 3F2VA 4MS1B 3HXLA 4NBVA 3JX9A 3ZW8A 1YB7A 2REOA 4ZVKA 5DNUA 1MQ8B 1JMKC 1PS0A 2IV2X 4DSUA 3WKCA 3GNLA 3U40A 3ITKA 5DHAA 1AK1A 4DUZB 2QTVA 3DE6X 3P32A 3T3MB 1XZKA 5EIHA 2GVNA 4KLAA 1D07A 1VRCA 4S04A 3MEQA 2ZUWA 3KKEA 1MC4A 2BHNA 1G6HA 2BI8A 3BIXA 4X1YA 1VRVA 4XOUA 4H1UA 1HT2E 2ZIWB 1YQXA 4KCGA 5DV9A 1AQJA 3WB1A 4W6ZA 2AUMA 1OWLA 3KKNA 3KQSA 3ROZA 3RVOA 3S6JA 1Z06A 1NUUA 1WW2A 3MS4A 3GUZA 1LW6E 3ORHA 4Y9SA 4E2XA 1K4MA 1XL0A 2IPOA 4L8LA 3V4SA 1WXFA 2AN5A 1VPTA 5BSTA 2CXUA 2VRWA 4NCIA 4D5GA 3CISA 1SG9A 5TS3A 3VM6A 2Q4RA 4X45A 4B74A 5FX2A 2EGGA 5A5VA 3STWA 2JCYA 1UBGA 2XUDA 2FW0A 3BDVA 3FZYA 2FQ1A 5BNIA 3GEGA 5JJBA 4KL8S 5MGBA 1OH7A 1ZKDA 2MSDB 5EZQA 2B82A 3A31A 1LRLA 5FI5A 4O4LF 4U63A 1TYZA 2XMBA 9LDTA 3UFXB 1JQDA 4JQSA 3P45A 1T8UA 2Q2OA 3LYUA 4ZDJA 1SCDA 3UMVA 4L4UA 2W2QA 1FU8A 1OCEA 1FVXA 2OO5C 4FS3A 4NZMA 5FUWA 3ZGOA 1RWXA 4C4PA 4YRNA 1OB5A 5JJCA 4I66A 4GPAA 4BYGA 4R5MA 1KYTA 3OOSA 3QVXA 4REOA 1NN0A 1Z7WA 2IE0A 3IR6A 2Y6VA 2E85A 1YRAA 1FZQA 3I8XA 2VUUA 5D2CA 4HWPA 1QYVA 4LG1A 3OTGA 3QKUA 3V4RA 3W8FA 1CUFA 2B34A 2V65A 4WOPA 3F73A 2GN6A 1J2YA 3UMMA 1O4VA 5AVZA 5EJ9A 5IK2A 1DIGA 1S9DA 2P4QA 3V3TA 1N1GA 2EX4A 1YR9A 1RP7A 1NR1A 3VPBA 3I5XA 1H9CA 1JLLA 2HCBA 3EVAA 1VBMA 4MJ7A 2VHVA 2AJDA 3SC3A 2BMEA 3UWSA 2UYHA 4MHOA 1CUGA 4DBZA 1JU3A 1Q22A 5A2GA 3VGPA 4XXHA 4EFMA 3N0RA 3GWGA 2GKOA 4Q4HB 4XTRA 1RRCA 3UJPA 2VK4A 1CR0A 1XRSB 4CQLA 2VUHB 5FL3A 3W2GA 1JLKA 1C1XA 3BXHA 4JYBA 3MBOA 1E6WA 2PT6A 1EVYA 2R60A 3BQ9A 2XNJA 4NI5A 2QNIA 4AKSA 3BE8A 5A9RA 1CR2A 1Q1QA 3FDZB 4V38A 1SIOA 1W29A 2WFAA 3C3PA 1QPGA 2GEFA 2ZR9A 1DAHA 2KBEA 4I4TA 1TYCA 1L7DA 1FYVA 4UBNA 2HUPA 1CQPA 1SN7A 5DM4A 3F9IA 3H7IA 1E3MA 2IWRA 3CZ5A 3H6GA 4HX5A 3GFTA 3MUEA 1CQIA 2VDRB 1HZZC 5JAZA 1U7WA 1K5PA 2FAXA 4DDKA 4FMCB 1WXWA 1Z8HA 3AHIA 4G4SP 2FCAA 4WZ6A 1W25A 5HCUA 5CM8B 4OPMA 1SBYA 1GKYA 4KXWA 2X23A 3ZBUA 3M34A 5EYPB 3ZWMA 1FU4A 1G21B 2YRWA 4DA6A 3OFVA 1OXTA 5IVIA 3PRJA 2ZTMA 4MJ3A 5EWJA 4EDFA 421PA 3RSGA 4K9PA 5KSOA 3UA4A 4ZV9A 1LPOA 1UEJA 2JLRA 1ONSA 1JFSA 4OP1A 1E3QA 3D4NA 3GLHE 4N01A 5AM4A 3Q6MA 2NG1A 3QITA 1PGJA 3G0CA 3AG5A 1N5IA 3WGVA 5AUOB 1XPOA 3GDHA 2PUDA 5FQNA 1JPUA 1RIFA 1B8OA 3EVEA 3R5JA 4BKOA 1FNMA 2CMHA 2WUGA 4QICA 5KQSA 5FUYA 1AHPA 1YDWA 4R6WA 4AQDA 1TO6A 2AFHE 3WRXC 2AOTB 4UBKA 4MKRA 3RFVA 3ANSA 1QG0A 3QUCA 1ATZA 3ICPA 1TTHA 3INNA 5C51B 2WJWA 4IF6A 5HZMA 5IJ9A 1ZZGA 5JYEA 1IZ7A 1G18A 1K9SA 2QR3A 5JADA 4QM6A 2G7ZA 3SJCA 3HI6A 1PJCA 4MVJF 3WL4A 1OOEA 1JDSA 1ZNXA 1P5RA 1BDJA 4E1VA 3UK6A 4WZZA 4D4IA 2XODA 1T10A 3JD4A 3WK5A 4KQ1A 4CN9A 2VP2A 1YZKA 4E4RA 3DW1X 3UJHA 2RI0A 4O2LA 3G2LA 3EODA 3DLCA 3QFRA 3AY6A 5EJFA 1UJ6A 4P3NA 2OHFA 2QDKA 4H0FA 1O03A 1GPNA 2BJHA 1AX9A 1Z5GA 2YMPA 2AYZA 3AEUB 3NBAA 4Y6RA 3T3EA 4XYLA 2CT8A 4RADA 3QPVA 3GJ5A 2ZUCA 1EJBA 2XQJA 4Q39A 2FZEA 3MBKA 4ERNA 1X7HA 4PS0A 1V48A 1GWNA 3UYKA 2XKKA 2EEZA 1CUHA 1VIDA 1YO6A 2X40A 1WRBA 2YJGA 4IVPA 2UDPA 4JAVC 3EUAA 4YH1A 4Q4CA 2FWAA 3IVXA 4ZKDA 1RXYA 3G9TA 2CN1A 5B3JC 1M1ZA 3LRPA 1EGQA 4CODB 4IHQA 3EPKA 1W8DA 2C20A 1VPVA 4C1NA 4YROA 1JAYA 1RZ3A 1Z16A 5F3RA 4JX9A 5FCDA 3AYXB 3DAFA 5ER9A 4TM8A 1HDIA 4DLBA 3ROPA 3ZHSA 5LD2C 4PBRA 1FUIA 4R8VA 4DHWA 4B8WA 2HPVA 1EJ2A 5IBCA 1I6KA 4WK0B 3CR3C 3QKTA 1VLJA 4LGVA 5ETJA 1W4RA 4HDMA 2A0UA 1USKA 1LBIA 3CKKA 1E60A 4G0MA 5EIAA 1GFSA 1RI2A 1Z5ZA 1RJ9A 5BV7A 1UFQA 1NI3A 3MIZA 4PPNA 2WI8A 3DVAA 3GJ8A 4YRCA 4U0KA 1XE3A 2YW9A 3LQYA 3SMQA 4KRYA 2HNBA 4RH1A 1IU9A 1SUSA 1WW3A 1BHSA 4BX9A 5C8YF 4M1KA 3CHYA 3F6SA 5AKLA 2IZ5A 1FTGA 2R87A 1G8MA 3V1YA 3LX8A 5HX7A 3G8BA 2WZBA 4RZSA 1SKYE 4HMPA 2DFNA 4JFAA 1ODTC 3E8XA 3GQVA 2AXNA 2OTCA 1EXMA 2HCTA 4QHYA 4CDNA 2BMAA 4MS3B 1XVIA 2H4HA 2C31A 4O33A 5IUJC 5LMCA 3HCWA 2ZBPA 4U1RA 3RU9A 3UATA 2AKEA 4HFJA 1NVDA 4YCMA 1XZBA 2RGCA 3V33A 5DCLA 3SR4A 1OXBB 2EP5A 2F48A 4Q3NA 3WMEA 1GYRA 4JUBA 2A9PA 1KJZA 2GYYA 4E14A 4CF6A 2CNLA 1XCGB 3JASB 3J7AC 2IDMA 3DJFA 1WS6A 9ABPA 3BFPA 2PEZA 2G76A 3DTVB 2BJVA 2H0QA 5AK3A 2AZXA 2PMWB 1JG7A 1Y89A 5K8IA 4XZ3A 1PS8A 4MVYA 5J4VA 2G82A 4HNSA 4XWKA 1WLSA 1X7YB 4MROA 4L5JA 2ZXEA 1YRYE 1EE9A 2ZI4A 3B6JA 3IAS1 4XASA 1PVOA 4OGKA 1JFVA 3BGDA 3IOBA 1KZ9A 1X7GA 1F5SA 5TPWA 3CBGA 3NYRA 3U3MA 1EUCB 3UAZA 2WLSA 4Q4DA 4YK7A 5EIWA 3URKA 1Z2NX 5DM60 1ZCFA 4X7PA 4Z6KA 4UJ3A 4JB3A 2GA8A 2OENG 2XA2A 4URVR 3F6PA 3KQLA 1NR7A 1WU7A 2D0DA 3TZ6A 1SZDA 5JZSA 3L43A 3I9KA 1ICEA 1ISJA 1X1RA 5MN6A 2GEDA 4H35A 3RSCA 2PUCA 3H99A 3EDYA 5CXUA 4YP1A 3OWHA 3N0TA 1QIHA 4J0HA 1N5RA 4X62B 5E38A 2WPDD 2FG6C 3L8EA 2C54A 1DAKA 1D6JA 3X2EA 3LHDA 4RF2A 1U0TA 5ES3A 3AR7A 2FMKA 3RROA 1Y1KE 1Z4JA 3MXOA 1JIXA 1YVRA 3ZTWA 1SUFA 1T35A 3WZ2A 1IVNA 1SUDA 2J6CA 2HOQA 1CS0B 3I0NA 3IQIX 4HGPA 5CR9A 4UUOA 1O77A 3P2YA 5CXSA 1GZ7A 1K86A 4N6NA 3HZRA 3GZNB 1GRQA 3Q5GA 2JGDA 1IVSA 2GJAA 1NUHA 3UT0A 1WO8A 4PLPA 5AVTA 5JQGB 4MVWA 4DR3B 2OHHA 4HS4A 1WCIB 4EHLA 4V02A 2VAMA 1T9CA 3ZPXA 1N1MA 3UAOA 2QDXA 4L4YA 4O02B 1ZJJA 2Z43A 1RLTA 3U2QA 4D44A 3QF4A 4YY3B 3H2SA 1GN9A 4RIFA 2CVQA 4OHYA 1YB1A 3GJ7A 3Q2OA 2HQOA 2FFAA 3VYUB 4KZPA 2EWVA 2R4QA 5TDHA 4OAPA 2SICE 5JXIA 1N6HA 2IGBA 3F7TA 5DYTA 5B1YA 4MUIA 1FP7A 1EP3B 1EK0A 1N5OX 3ETNA 3KSUA 4HQ6A 3WHPA 1Q7BA 4JELA 3L5KA 3P0HA 2GJ8A 3W5HA 1Y42X 1MUUA 1ZIXA 1EYZA 2AEMA 1ZMRA 1C1YA 1P3Y1 1S7CA 3NI2A 1GNLA 3KWFA 4FGLA 3ICQB 2CL7X 3HBFA 4YT8A 1THGA 2PTHA 4ZQEA 4DQDA 5CDSA 3AR2A 2LR0A 4HDQB 3UA3A 1AN9A 4YRPA 1UXHA 5KTSA 4BUZA 3TX2A 3KQWA 4UE2A 4NBKA 1AOXA 4D0SA 4FLEA 5DTRA 5E3JA 4OQDA 4LQCA 1A9RA 1CV2A 2SKDA 1W0KD 4N3AA 4RTLA 1CQJB 1E3EA 4PYRA 1JHQA 1ZVQA 2HHLA 4FZVA 1JSRA 4TRJA 1AV7A 5TVKA 4MJXA 1J4AA 3ZJ5A 3U4QA 1R6BX 4ML3A 2ZB4A 4PR0A 3JQFC 4P4LA 4DQXA 2QWXA 1H9BA 2ASEA 3P7MA 4I6EA 1M2JA 4JUFA 4NEGA 5KDLA 3C85A 3GT4A 2CW5A 5E0OA 4AJ2A 1J5XA 5DXAA 2DFPA 3FNHA 4W1QA 4JXKA 3S44A 2WYWA 5FJJA 5D1NA 3GH1A 5DTJA 3OSUA 3PV0A 3UG6A 5JUWA 1I7PA 3GLKA 3IUQA 2QRPA 3QOXA 3OTHA 1Z8FA 4PTZA 1JZTA 3G2QA 4M7OA 3IE1A 2C29D 4RTKA 3ETJA 2OCKA 5HTKA 5EHQA 1MJ5A 3WK9A 3M4XA 4FKBA 4JASB 3U13A 2N1BA 5B7NA 4XYBA 3OKPA 4FT4A 2ILTA 2ZWVA 4N4AA 2C4NA 2QOEA 4IJKA 3NWPA 3HXTA 4I7EA 4CT5A 1NPYA 1YBFA 3HXPA 3WYDA 3KQKA 3ZZ0A 3SE7A 2FUKA 5BT9A 3AB7A 1ZGGA 1T4GA 2P4EA 2JGJA 1CWUA 3TUIC 1UM9A 2DQKA 2W2OA 4Q00A 5F76A 5FTLA 3IV9A 3NTVA 3F3YA 3PEWA 3NASA 1QONA 3GCWA 4G1CA 2G28A 1TGYA 4EA8A 2BGKA 1UXGA 3FCXA 2IS4A 4UDYX 2DVMA 1G17A 4H7HA 1XJCA 3VO2A 1HE5A 3OD5A 5IF9A 3IO5A 1O9GA 1JEOA 2Z8YM 2C04A 2Q3BA 1B16A 5IPFA 1JPJA 4D96A 4EL5A 1RJFA 4R0NA 1IUNA 1ZQ9A 2ZI6A 3DE1X 4I2NA 3GUVA 1YRHA 1DBPA 5F2KA 4BASA 4DPKA 4HG2A 4JSTA 5JATA 5LBUA 2NZYA 5IAGA 4HRYA 2P9JA 5EMMA 2H3EA 2QTTA 1G2IA 2IE8A 3H2GA 3WO0A 4ROSA 3ZVMA 5FNVA 1GEGA 3BMQA 3OF3A 4TS9A 4R8MA 2FJ0A 2OGTA 3INTA 1J22A 1QWOA 1Z4KA 2Q1SA 5EKDA 1FNDA 3TQIA 3EISA 4FYMA 3JPYA 4P98A 4ZYLA 3U7IA 4QFMA 5AVXA 1GV0A 5AVWA 1I36A 2HA4A 2VDVE 3OOYA 5ITVA 4CUZA 4Q9AA 3EZ7A 2ZPTX 4JLSA 4QTYA 1PWXA 2J41A 4L9RA 4AAYA 2OAP1 4MR8B 3ZGXA 1USGA 3FUTA 3W9SA 2CK3D 2H16A 3FYUB 2AJTA 2ZRBA 1BJRE 1JUDA 3EXFB 3JWGA 4LJKA 3RLFA 3AETB 1Z29A 1G7RA 4IHKA 4NENB 4I99A 3CNHA 2VT7A 3LUDA 3R7NA 2XVAA 3DTTA 2CLFB 1AGXA 2VF4X 2ZT6A 3DPSA 1QNLA 4DHEA 1UODA 4OSPA 1KYXA 2CXTA 1U7DA 1WCYA 4FOLA 2B2XA 4U7TB 4U9IS 2QTFA 4FW8A 4BXOA 2C3OA 2NUPB 4D43A 4FFLA 1IHUA 3LX4A 4H3KB 3T7TA 1Q83A 3CUEF 3D4PA 3DOHA 2OOSA 3B5IA 1DWQA 4A27A 1N8TA 5JD6A 5I9MA 3DDUA 1ORWA 1U80A 3KXPA 2E37A 4PWYA 5BWOA 4IOKA 1C41A 2R6ZA 3TRJA 1SHUX 4KZKA 1NQWA 4YRDA 3BIJA 3ZW7A 1W34A 1YJXA 3DOOA 4ZCLA 3CURA 3UEOA 5HILA 1J24A 5DYYA 3KG2A 5AKGA 1XZLA 3LM8A 3E5HA 5AW9A 3THXB 1Y8RA 4PAWA 2IU6A 4BQIA 2F67A 4MEAA 2HSZA 3KPYA 1Y4UA 4QAJA 4QDKA 1GPDG 1JF8A 1GZ4A 2F3PA 2PFSA 3EXIB 3ITNA 4ARBA 4BZXA 1Y9DA 1N1DA 3A0UA 3FPFA 3GV0A 3PLRA 2Q5IA 5ARCA 4Z1OA 1KEEA 5DEIA 1L3BA 2QROA 3WYFA 4O1HA 3DYBA 2BZSA 3FG9A 2NP7A 2YWBA 2YDXA 5IJWA 4U7DA 1SQFA 5KCZA 1TZ2A 3CB4A 2VPZA 3HADA 2C5SA 3C97A 3Q5EA 4FJ1A 4X90A 3ZXSA 1J1UA 1C14A 1C8BA 1Q5PA 1VE7A 2C9YA 3OPYI 5H1YA 2IV7A 4F4JA 3GLIA 3GLGA 2CHUA 4D4HA 3F3SA 3OO0A 4LECA 3ABSB 4PZZA 2PGIA 4WW0A 4Z86A 3R7WB 4ZTZB 1L3CA 2JLUA 3PIIA 1PFUA 3WFJA 2YZMA 5IN5A 3T9BA 1C9JA 4LNUA 1GGJA 4UUPA 3PNYA 2ZJZA 3NHAA 4BGEA 2CXHA 1EAMA 4ZGGA 4KR2A 2JFHA 5LA6B 3ZJUA 2NU9A 5IS2A 1ZN9A 2IDZA 3CYFA 4RY2A 2OK8A 4U5XA 3BBLA 3L7JA 4OH7A 5GZ6A 3KLPX 2IZ6A 3MJCA 4KBFA 4QQKA 3TR0A 1KEVA 1Z0ZA 3VI4B 1J8MF 1PU2A 1Z2DA 1KNQA 4IZOA 2O0LA 3PDJA 3C6XA 1VE9A 5K1ZA 2V6GA 2PBRA 3O2NA 1CRLA 5JFOA 4I50F 4UXIA 1A5ZA 4CQJA 1D4FA 3ZHCA 1CETA 1WUTA 4C6RA 3A1UA 4ETIA 4IO0A 1DRJA 3AUFA 4ZGBA 5A9TA 2BUCA 3FYHA 1NIJA 4ZHQA 4C30A 3UO8B 2CNOA 2YDYA 1EE1A 3VZRA 3BCHA 3WWPA 4BB9A 3REGA 4EIWA 3ETLA 3BGVA 3H4IA 3BBPA 3MNFA 4DSAA 2COKA 4UXHA 1XQVA 4YCNA 4CM7A 1Y7HA 4DR5B 3HB1A 3O3OB 2NVBA 4KV9A 2C5HA 3I39X 3C7AA 3HNOA 3PFBA 4R40A 1T2DA 1W73A 3W2IA 3TSYA 1XQ6A 4C4OA 2DR2A 2W8BB 4O5AA 4PHGA 5BPHA 1IXYA 2I4NA 3FRHA 3MT7A 2H59A 4QLAA 4URYR 2YV4A 4Z2AA 4HNHA 4JUIA 3HPQA 3QW4B 4UD6A 5FPYA 4FZ5A 2J3IA 3KKPA 5JYDA 1XTUA 1U2TA 5EVCA 3CLKA 2QTVB 4MKIA 2PU7A 1UL1X 1AKYA 2I7VA 1FP2A 1RXCA 2P3OA 4NZPA 3GFGA 3IP7A 4Q82A 2HHJA 1NMQA 1YS7A 2O5VA 2ZSAA 4C29A 4U9HS 1OI7A 1Z5PA 2I54A 1TC1A 2VQ3A 1H2EA 1HDXA 1XZEA 3EYAA 4CT0A 2VP0A 8ATCA 1UH5A 1VKRA 4YV7A 4J90A 1Y1PA 5KOIA 2PG3A 5SZHB 3V2GA 2WIAA 4FR2A 2C4TA 1HTTA 2BPOA 1VA5A 3DMTA 1ML4A 3OZRA 3A11A 4EJ6A 3KJQA 2RBKA 1VCOA 3DCJA 4IHAA 5ALZA 3KKLA 4L6CA 3DFMA 5IBQA 3I5YA 5KO2A 4GPZA 5BUQA 4JP3A 4IF4A 2WIFA 3GFBA 1D6SA 1NFFA 5AM0A 1PDOA 3ABOB 4LIPD 3MJFA 5BV0A 1GCIA 1QWSA 4CUKA 5GVSA 1GN8A 2JL1A 2YRXA 4JLNA 4BBAA 4QL3A 1ZK0A 4RH3A 5FYQA 9MHTA 1PGPA 2H4XA 2W8ZA 4G0NA 1S02A 2GF2A 4XGRA 5H59A 2P40A 4E4YA 3WHLA 1WKCA 2FR0A 2ICAA 1PAUA 3KQYA 3PRHA 2BEUA 4LV8B 2JKYA 5ALXA 3T4UA 3KC2A 4ONEA 3TXYA 1ZNZA 3VDXA 2IPLA 1C1DA 2Z2XA 4XWTA 2EZ4A 4CL3A 1NYTA 1CPYA 5LP1A 4ZQFA 4I3HA 1YR8A 4TLDA 3IO3A 5J63A 4RABA 1M1NA 4S3MA 2QLBA 4Y6LA 1PTJC 1DIAA 2IHBA 1ZK4A 2ORVA 3NUQA 1F48A 4G84A 4ND3A 1M8JA 1P1JA 1SXPA 2NOAA 4REMA 4YMSA 1JLLB 1QMGA 4X1KA 1ZJZA 4S24A 3GQBB 3OPNA 2B1GA 2AJLI 1RLJA 4PAOA 4ZEXA 2P35A 4KAJA 5KHOC 5DW3A 2BOVA 1B8NA 1MB3A 2OWEA 2QYSA 3VKFA 5BQ3A 5HUJA 3QGMA 4O4HA 3K9CA 2VG8A 3FY4A 2H00A 4LQ4A 1QOPB 1P18A 4CQLB 2PS0A 4F3YA 4OO3A 3SQWA 2IF0A 1C1XB 4REQB 1FUKA 3UOAB 2BTOA 1AIPA 2C4KA 2J32A 4DA9A 3FTNA 5DSZA 2IRWA 3MT0A 4EF6A 3CRRA 1OU4A 2QQEA 4D3SA 3AM1A 2R7KA 1KDPA 5CLIA 4L5IA 2C0QA 3O8DA 4S1TA 1BTOA 3DWFA 5HG0A 3HFJA 2ZITA 5EERA 2HHCA 3WOVA 1WL8A 5EXXA 2QUZA 2JLYA 1JEQB 5K6RA 2BISA 2VCYA 4N54A 1YL6A 1PEDA 4H4EA 4F86A 1PWZA 4KPUB 3LA8A 3UY4A 2UXCB 1EWKA 2ZRLA 1CUZA 5JVDA 1HE8B 1U2EA 3R8CA 3WDSA 3M4JA 5SYMA 4TMWA 5EWMA 4DTIA 2PA3A 5FTWA 2IYVA 2HDWA 3AT1A 3GI1A 3IHTA 3IJPA 1ECBA 1E2FA 3FPKA 5GWXA 1MXFA 1OWMA 4G63A 4MINA 4IQGA 2ONYA 3KUKA 4AN1A 3FHCB 3M3HA 4PPGA 3V1NA 1YA6A 1DIRA 2QP9X 4KQWA 1QLJA 3IHKA 1JQJC 3NUZA 4MP3A 4RTRA 2MDTA 3W5AA 1I01A 1Q14A 3VSEA 1XEWX 1XEXA 3AFIA 1KFJB 4O8CA 3UIEA 4IMIB 3RIYA 5FLXA 3DGEC 5LQKA 3LC1O 3JQAD 3LFUA 4O0MA 3HEAA 4RZIA 1L4YA 1JEAA 1HYQA 4LV6A 3NM6B 1P1FA 3VU8A 5B2FA 4JLDA 5DN6A 4BFSA 2I03A 2O2IA 3UBTA 3WAKA 1NUTA 5CBKA 4OLJA 1SHTX 1EVIA 2XUPA 4LJ7A 4TKZA 4X24A 3V3KA 3PBKA 2AB0A 2NO4A 3RJTA 3O8QA 2GK3A 5JS8A 2WWHA 1KA9H 5FUBA 4BQRA 4ZMBA 3M9LA 1K89A 2P9ZA 2PH3A 2QZJA 3A6LA 3F90A 3O82A 2PLFA 5KTYA 1IVYA 1RRKA 3CLUD 3IOCA 4GI1A 2TYSB 4RDIA 2PRJA 5I9TA 3QENA 2ENUA 2RE8A 3NIWA 3IRUA 4G1MB 3UWOA 3ZCTA 2OC4A 3RNOA 6REQA 1HDRA 4CMHA 1ESEA 4MW6A 2HRDA 3CJTA 2J0UA 2A0YA 4FHFA 5KWSA 3U4CA 3U3KA 1BOFA 3CKLA 1YL7A 1VG8A 3HDTA 2ZWAA 3WB9A 4B7ZA 3Q7PA 3OPYB 4ZODA 1JKMA 4E08A 5I9NA 4RY9A 5I47A 5BXYA 4CKXA 5K2OA 4XARA 1N0UA 2R85A 4HWGA 3E15A 3NHJA 3A4VA 1UJ5A 2NPIA 1I9CA 2H11A 4XIJA 4RSMA 1NRWA 3VO8A 2Y92A 2ZXFA 4KYIB 5H68A 4H3VA 3ZY3A 4FN4A 1XFDA 3EPHA 2OXTA 4OQXA 3N05A 3AOEC 5F4BA 2H52A 4LJ9A 3N6RA 4KQMA 4N7JA 3BICA 4EHDA 1S1CA 3FZNA 4YPOA 2X6RA 3A70A 4HDAA 1H1DA 1H1LB 1P0MA 3A6KA 2OZPA 3C15C 3KLOA 4IDQA 3M6AA 1CKEA 4UZEA 1MGPA 3TIVA 3GG9A 1G5RA 2P1ZA 2WG1A 4UEJA 2QRKA 2BUBA 2JLAA 4CXMA 1YGYA 1E96A 2RJOA 1NJSA 4HDMB 4Z3OA 3G2PA 3LBYA 3P9IA 3SSOA 2P9HA 1N2OA 2CNNA 4DA7A 2ZJ6A 3WLSA 3DVAB 2XR1A 2PZFA 5J40A 3OUZA 4RETA 3EFEA 2P9TA 3UC9A 5K0ZA 2G72A 4FLMA 2WC1A 3N2ZB 4NPAA 5L51A 1KH1A 1T43A 4JP8A 4R1QA 3MGGA 1ND6A 3ZI7A 5DWQA 3ZJYA 2NO5A 4HAYA 5LUBA 4EDHA 1CB0A 1LPPA 3MWLA 5AVYA 1L5HA 1I1HA 4BVJA 2W4IA 2WWFA 3ICOA 4MYTA 2YN2A 1IN8A 3AL0C 1ANKA 4EG1A 3QU5A 5FA5A 1ZSNA 1JEDA 1TMOA 4CMEA 2GD1O 2XWJI 3P0JA 4D9JA 3CUUA 3KT8A 3RT9A 1U3TA 1MR3F 1HRDA 2JIDA 1W5EA 5F12A 2R5WA 3H0EA 3FGPA 3WVNA 3QKSA 3SKXA 2FKNA 3O5AA 3QX9A 4FGWA 5KUTA 2WDPA 1U7ZA 3L7AA 4DCCA 1CQWA 3U09A 1YCDA 4MCAA 3SN6A 1YRBA 5E8RA 4CEHB 4OF4A 1MX9A 2H54A 3LXUX 3PWKA 1RT9A 1YE3A 1QHHA 1XLVA 2FQQA 4KO4S 5JLJA 3H1BA 2NADA 3N75A 3QEOA 2JEYA 3E7PA 3PNQA 2FFBA 2PMBA 4BZWA 4DYVA 3LU1A 4E11A 1K68A 5LYJF 3FUCA 2Y6UA 1B93A 1J42A 2JHCA 3AEXA 4XTCS 3PUVA 1HETA 3L04A 4LNHA 3VU3A 1P7ZA 3E7DA 3BXXA 1C8VB 4ZJUA 3K6SB 2G1KA 1SKQA 4L5CA 3QPCA 2HNKA 1K63A 3FFBA 1CLUA 2Z2IA 1GLVA 2J0EA 1AQUA 2QXUA 1U7PA 2EZ8A 1A8PA 3HCOA 3OQPA 2I22A 4JN6B 2G17A 4MUGA 3RU7A 1DSSG 4MWTA 4EEXA 3E48A 4NQRA 1TAUA 1KBOA 5SV2A 1SCJA 1XPJA 3DA8A 5JFTA 4BMCA 3WLAA 4DSZA 2QKYA 2H17A 2IUUA 4PSKA 3T9AA 4NABA 1A82A 4LDRA 2Z6UA 2VJMB 3BREA 4L02A 4J07A 3G02A 1VTKA 5B1DA 1BNCA 4W5RA 1R74A 5K4AA 1A7KA 3W8RA 1DU4A 1GTJ1 3QLTA 2K2WA 4MQFA 3GGPA 2J7KA 4YALA 4WKGA 2JGDB 4Q5IA 3HP4A 4CQMD 1UBKS 2ZVJA 4HUQB 3TR5A 1G3MA 2EKZA 1I24A 3IJ5A 3E2IA 5AVRA 1QAMA 2YXEA 3MELA 2A33A 4QPZA 5EJEA 1LDGA 3BD6A 4XM1A 3AEKB 2WKPA 1B8PA 4CMCA 2O5RA 4ZI3A 4FHGA 2X4IA 1XD9A 2V54A 1WD7A 3VOSA 5TEWA 1XOIA 3QF4B 4DWJA 6GPBA 1WCWA 1JQKA 3ECCA 3W5VA 2CZGA 1TECE 3UFBA 3KKKA 3KXLA 5A05A 2FFJA 2V5VA 3HEBA 3RS3A 2AIRA 2IGTA 4Y0NA 1HK7A 1GQOA 3R09A 4V1CA 2IA5A 2QV7A 3QVTA 1IUPA 3WTCA 1HX7A 3MHPA 2CJFA 1D5CA 1D6NA 4K6KA 4QPPA 4LC0A 5ALDA 1NBAA 2J9RA 1KVQA 1G5HA 3X1MA 5HMMA 4WXEA 4MRVA 3LTEA 2XA1A 3WRWA 4D8VA 2IYFA 5HM6A 4LY3A 1Z38A 4PV7A 5DP2A 1UBEA 1INLA 3I9OA 3KPUA 2WTAA 4MKFA 2OO5A 5JW6A 3LLUA 4RYLA 2JFQA 4MRMA 3ZLVA 5L3QA 2BFMA 1NMXA 1H93A 3ZWNA 3K53A 4LXQA 2Q62A 3SBEA 2DSNA 1BS1A 1QGUB 4NOMA 4X65B 3LC0A 1QV9A 3S2GA 2K2QB 2WIGA 3GFRA 4MB0A 2K7FA 3BILA 4OLFA 3RYHB 1XTSA 2P41A 3QPUA 4F5EA 1UC9A 5C8XA 1YUNA 2OAGA 3OKFA 1OHHA 1XTVA 2NVOA 4E32A 4K81B 4DMGA 4GGOA 3IDAA 2XRZA 1ZESA 5KZMB 1G7SA 4MWCA 1NDHA 2CVHA 4FGKA 3I04A 5AKJA 5ECYA 2LWIA 3RARA 2ZIAA 1ZD4A 5M5BA 3RHFA 2J09A 4E33A 3O1LA 1D2CA 2QTRA 3GBVA 1YHYA 3N5KA 1EPUA 2P1DA 3S2ZA 3UMGA 1I51A 5P21A 3MFQA 1SXJD 2BFCA 3ST7A 1T8RA 3T5TA 1JE1A 1SVKA 4UM7A 2QW8A 2IFTA 2V7EA 2A3NA 2YS7A 2CVOA 2P65A 4QJ3A 5IUKC 1Y8AA 2O4CA 2PMCA 2RARA 4NIMA 4TMTA 4URWR 2FPWA 2XLCA 4LSGA 3W2HA 4DPMA 3JR3A 1KSJA 1TYAE 3MCZA 2GFIA 3BL6A 1QP0A 2P30A 3NRCA 2V8OA 2CXRA 4PXYA 3OOJA 3PJDA 4HNQA 4LEIA 1UOQA 1K08A 5F5NA 5F77A 4UREA 1YFKA 3C3WA 3IQZA 1ECJA 5A6SA 4E5DA 1HZZA 1UM9B 4NSNA 3UKOA 1H6CA 3H2YA 1X19A 5AI5A 2QTBA 5TGZA 2GCEA 1XQXA 2AF3C 1ZMTA 3PJEA 1YZQA 1YBVA 4Y7CA 3NORA 3WMXA 3ZX4A 3OLZA 2IUEA 4CFZA 3ZDAA 3PC2A 2P5YA 5CVJA 2P62A 2XE6A 3QWHA 3AUXA 3CMCO 2ZROA 4J7XA 2HF2A 1TJYA 1NVVR 4HBZA 5CA1F 4KDEA 4Q7MB 4DR2B 1W0JD 2BJWA 1EIWA 3H9CA 1IHXA 1RJDA 4EA6A 1V5WA 1N7IA 2OHVA 1UMDA 2O2CA 4B6RA 4EOGA 1IE3A 2XVXA 4KPFC 2YJTD 3DPUA 3OG9A 4CM8A 2ZVQX 3BK2A 1GPMA 3HFGA 3LCUA 4QYMA 4ALLA 2EBWA 4BEWA 1Z35A 4HAOA 4IDHA 3E53A 4UVDA 4WSOA 1RBQA 5KYUA 1S2IA 2YR0A 2GI4A 3D8TA 3PGA1 4QDZA 4UNNA 3ZU3A 3G2IA 4FWTA 1JMVA 4RFVA 2H1VA 2Y76A 4FN5A 5CFNA 5HZHA 4JT8A 4ND7A 4ZPJA 3WRXA 4DG8A 1RRFA 4JJ4A 4RL6A 5ELMA 4YCBA 4DLLA 5IXYA 3NVMB 2YZGA 2H31A 1JIUA 2D7JA 5F78A 1JYFA 1AHHA 1RHQA 2L17A 4A0RA 1WLYA 1Q92A 1JXMA 3TCXB 1CJMA 1U2DC 4BEVA 2G8NA 3D64A 2FP4A 3BPSA 2LUOA 4K2HA 5LU8A 1EX9A 3ROKA 2C4VA 3I34X 3BFXA 1QO0D 1KY2A 1TGVA 2E1PA 3GPBA 2UUPA 3O3CA 2FZ4A 2ORED 2NXCA 4V3BA 4Z51A 5CFOA 1R88A 3DP7A 2E49A 3FR7A 1S3IA 4WOKA 4NQZA 3B2NA 2G8LA 2VTDA 3A32A 3G2NA 4FYPA 4MRSA 3U3RA 3UH0A 5IC4A 1PLLA 3GVXA 5CK5A 1E9VA 3N28A 3H9UA 1Y7LA 3HRHA 4HZUA 3G23A 5JH7A 2ST1A 1R27A 3N0XA 1OTYA 4RKFA 4RCZA 5B3JA 1M6HA 2L2QA 4JOCA 2VZ0A 3IERA 4H7PA 3KOZA 2FY8A 4KIUA 2IYNA 3D8UA 3OAAD 5KVAA 3GPLA 1RRVA 2VKTA 5DHRA 3K2EA 3LFHA 2F1OA 4WKCA 3ZKAA 4YAUA 3NHUA 2HBZA 1Q0UA 3E05A 1M3SA 2D8MA 1M33A 1ZI9A 2G9ZA 3DUFA 3P2JA 5A6VA 3NHZA 3NBMA 2QUJA 3C3BA 3WQQA 5IAAA 1TD9A 3GT7A 2DLCX 4W5NA 3TBKA 1UBOS 2RHOA 2V58A 2YWHA 3CVUA 3MRVA 2GWHA 4PCVA 2VJNA 2EWWA 1YD7A 4M36A 3X2FA 4BN4A 5EIXA 1W85A 1ONNA 5I7AA 3HTXA 1P3JA 1USUA 3F9RA 1Y8RB 2MSEB 2JI7A 3O4JA 4MX8A 2NTVA 3MJDA 3ACDA 1JR3E 2I71A 2YY6A 2JGEA 3ENZA 2R25B 5CBPA 1E7QA 3CEJA 2IYXA 3B5EA 2EXXA 5LNK6 5EHXA 1DFGA 2VSXA 3DOCA 2OBYA 1KQNA 4HB3A 3FBTA 1KEEB 2MMCA 4YT4A 5JY1A 3U4MA 3BYZA 3I9MA 3CUWA 2Y1DA 3NR2A 4I14A 3LFTA 4PRZA 3VZQA 1QHSA 4ZU6X 3SLGA 3AUJB 3RANA 1IMJA 2W2XA 1EFVA 3T35A 3WGMA 3MD9A 3MT9A 3IKLA 5JTTA 2Q5OA 2W22A 4UTOA 4P4TA 4K88A 1Z5OA 3JQGB 2QVZX 4QOSA 4C2UA 4MDEA 1W30A 3EAFA 5E9JA 1P2GA 4KJZA 4RENA 4R4JA 4MI3A 1M1YB 2VYFA 4UARA 3WNVA 3SKVA 4XB2A 1ISIA 3FCOA 1TK9A 3IKMB 5JFGA 4FMCF 2Z98A 3O4IA 5AXBA 4AYTA 1EHYA 2BV3A 2GTPA 1XWFA 1TZBA 3D0QA 2GJSA 3NOQA 5FD8A 1KJYA 2XW6A 3IUEA 5AJTA 3AJ9A 1ZO8A 4LE0A 1OV4A 1ENZA 3Q7IA 4IZIA 3RAPR 5IDVA 1FXWF 3KETA 4BFYA 2Q9CA 5A9SB 2ODEA 1HNWB 2F1HA 1KNXA 3AMVA 8LDHA 2V97A 5B12A 4WDQA 1YBHA 1QK5A 2ATEA 3GK3A 2CLOB 2JGLA 1UDWA 1V26A 4PBTA 3LX5A 4EH1A 2XSZD 4ZHQB 1N0IA 3GZ4A 3EUFA 2NO0A 2XB4A 4FDMA 4QC2A 3BDAA 3DSRA 4C0LA 3A4TA 1UAGA 1JDBB 2HT1A 1NOIA 2H4FA 5HQJA 3I01A 3K9FC 1MTZA 3C5EA 4MW7A 5IHPA 1N9ZA 2C4MA 4EKYA 3NDBB 1IJBA 4FM9A 2VPWA 3P9RA 3IALA 3ZHYA 1JL3A 1YZYA 1PJQA 4BNTA 1H22A 1DPFA 1AA6A 3VNSA 4LDJA 5EL0A 3OU2A 2HU8A 5JJKA 1BSVA 1Z0DA 3EH2A 1WMFA 4CKCA 1JFLA 1E2HA 2H0RA 4J4HA 4MV1A 4QXPA 2R44A 3V34A 4RVGA 2QRQA 4KPEC 4BNNA 3ZDQA 1XXLA 4XI9A 4M46A 4HNTA 3TQRA 5L40A 2DM6A 1XMOB 1KSHA 5EZYB 2HN9A 3B9PA 3TQQA 4Q02A 1WY5A 4RU1A 3BTUA 2C4HA 5K8CA 3LL4A 3FIUA 4QATA 3K1JA 4DLXA 1ESZA 3NHMA 2QVYX 1CJBA 2BUAA 4A2PA 5LVAA 2KX7A 4GECA 4WAUA 1JHDA 5DOZA 4PLWA 5LXTB 3VKUA 1Y5MA 2IYRA 2Q0XA 1NHWA 2IIVA 3OC0A 1NZFA 1UINA 2CFRA 3UN1A 1IZ8A 4DDHA 3F1KA 4C14A 5FI0B 2RHLA 5CITA 4XGNA 2KPOA 2XZTA 4J75A 3UW3A 4ABTA 4MARA 2EKBA 4AO7A 4BNZA 4JI7B 4CU5A 3UJDA 2AC2A 3T5MA 4PLGA 3I9LA 3C41J 2BGRA 2BCJQ 2PXAA 1ZOSA 1HE3A 1FEZA 2G04A 3OECA 4MV7A 4NBUA 4PYNA 4YO7A 5JAQA 3NJ4A 1I32A 1SJ9A 3VR6A 1SULA 1EG7A 1GRNA 3UT5B 3VVCA 4EO9A 6ABPA 5ISMA 4B8YA 4GRIA 5DHPA 1D0VA 1RYZA 2WYVA 1RADA 2IU4A 2NX2A 2VUSA 3G1UA 3OX2A 1LV7A 4H16A 4BKPA 2BSXA 5FWYA 3LKDA 4JC4A 1C1DB 1EX1A 1B2LA 1KTIA 1K75A 3H42B 4IHJA 4RZHA 1V43A 4PZDA 3JQFA 1AM4D 1WF3A 2JBHA 4A8JB 9ATCA 1SXQA 4C3UA 5AK4A 3HXMA 2C3MA 3N58A 5CIWA 2HTEA 4Y1RB 1B14A 4KDCA 4W82A 5T4HA 1DBIA 3WQSB 3T7KA 3SHFA 4C88A 1H0HA 1FLAA 1MEJA 3L6RA 3V42A 2O54A 3LYLA 5FORA 1UP4A 3HJGA 3KHKA 2OCLA 1UFOA 2WFZA 3L7BA 1FQKA 3PF9A 1MRNA 1WMBA 3QVVA 4IMJB 3HDHA 1IK6A 1UZLA 3HSSA 4O4HB 3SEFA 3WKEA 2DPXA 1JILA 5BSWA 2ZJ8A 3O1HB 1C7FA 4KK4A 1IAQA 4MHSA 4RMHA 4GAEA 1HDGO 5CAEB 3HZHA 5HMLA 3QMPA 1BWRA 2YJ5A 4DCJA 4B34A 2E4XA 4LBZA 4C0QC 1QBGA 2WAAA 1RJGA 3WGZA 5LFAA 1F8FA 1YQGA 1L6RA 2WZDA 3KR0A 3OQNA 4OXXA 4NEQA 2Q1WA 4LYDA 5ARDA 4P38A 2PJRA 1SCQA 4C05A 1WB9A 4KKXB 1WBJB 2HMUA 4EUEA 2R6GA 1G2PA 5A4DA 5HKKA 3ECAA 5I9IA 2QI9F 3U31A 1QXSA 3QFFA 4F2DA 4BY9E 1B1CA 4RE6A 4N5NA 4CGZA 1L2TA 1C0PA 2QPAA 5J5AA 4R7TA 3AIKA 1D0IA 1EWQA 5G02A 3AUUA 2ZZNA 4WK6A 4QYSA 3CNOA 3OJFA 4LY0A 2PGDA 1A4UA 3A1DA 5IH3A 2ZYAA 1VQ1A 3RFTA 4BJ6A 1HT0A 4ZQIA 1PZGA 1VLVA 4X95A 4YAJA 3ROEA 5BRJA 3DFUA 4QXMA 3V8PA 3P71T 1SHJA 3GEDA 1BVYF 4O08A 4OY3A 5TMEA 2HK9A 1NT4A 1H2YA 2VOEA 2R7NA 5K8TA 1DDOA 1QPBA 3WJ7A 4PNEA 2B5VA 4B83A 2Q6KA 1UWKA 1GU0A 4DUYB 4EP1A 1Q0RA 2LXNA 3HI4A 1V9SA 1IUOA 4H27A 5K8VA 5J2TA 4KI7A 3P1JA 4D45A 1DQYA 1I3CA 3FFXA 2LDBA 1NYLA 5JQGF 3U19A 3O8QB 3R9XB 4ZQGA 2ZJFA 4DLSA 4F85A 1JSLA 3GA7A 2KLHA 1YIDA 3X44A 1LBSA 4PTLA 2J59A 2D00A 2XCOA 3VR4D 4WCFC 5IDYA 2KYRA 1ES9A 4F5DA 4RHFA 3G6KA 3KDAA 5CDGA 1PN3A 4JD5A 6REQB 2IH5A 1MCZA 4KC0A 1J8QA 4PHHA 2J0UB 3EA0A 3W2FA 2E89A 4DYHA 3C3MA 1TVKB 2C2GA 2X2PA 5HDQA 4E15A 1BS2A 2HLHA 2V6MA 4KITB 4EHFA 1NSYA 2YJNA 3H97A 1TUIA 3NUGA 4I3GA 2RG1A 2YIDA 4MV0A 2NNLD 1MO3A 2W6PA 3WMFA 2VHYA 2ZS9A 3WZLA 2O2JA 1Q11A 5T64A 1SK9A 2HA7A 1S5PA 2GM5A 2QSZA 1PQYA 4JS0A 4LXGA 5CM2Z 1IN7A 4LF7B 3M83A 1DT5A 2APJA 3MBIA 4G81A 821PA 2OZLA 3TN7A 3RWMB 1DO0A 2VXBA 2JIZD 3IUPA 4OOEA 3OESA 2M6LA 3X1KA 3OTQA 5DBFA 5DGIA 5IAEA 3UB3A 1JVSA 3OX4A 1ZIOA 4X44A 2V9ZA 4HH1A 2Z6QA 3EUEA 2HWYA 3PL5A 2D5IA 1THZA 2WWXA 1ZXBA 2PGNA 2G88A 3HGQA 1R9NA 4L07A 4ACBA 2HR1A 1YDGA 3FWHA 5CD1A 5F1PA 1VL2A 1MX1A 1FBNA 4Q3LA 4ZKEA 4DCNA 4ZIRB 1C3VA 1ZONA 1YHNA 4DIKA 3VYTB 4RWZA 1UUFA 1DFHA 1OFTA 1ZGJA 2ROQA 2VIIA 3G79A 4K9DA 5B7QA 3D6AA