4U2DA

Crystal structure of dienelactone hydrolase s-2 variant (q35h, f38l, q110l, c123s, y137c, y145c, n154d, e199g, s208g and g211d) at 1.67 a resolution
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
233
structure length
233
Chain Sequence
b'MLTEGISIQSYDGHTFGALVGSPAKAPAPVIVIAHEILGVNAFMRETVSWLVDQGYAAVCPDLYARQAPGTALDPQDEAQREQAYKLWQAFDMEAGVGDLEAAIRYARHLPYSNGKVGLVGYSLGGALAFLVAAKGCVDRAVGYCGVGLEKQLDKVPEVKHPALFHMGGQDHFVPAPSRQLITEGFGANPLLQVHWYEGAGHSFARTGSSDYVASAAALANERTLDFLAPLQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxymethylenebutenolidase
molecule tags Hydrolase
source organism Pseudomonas sp.
publication title Directed evolution of new and improved enzyme functions using an evolutionary intermediate and multidirectional search.
pubmed doi rcsb
total genus 84
structure length 233
sequence length 233
ec nomenclature ec 3.1.1.45: Carboxymethylenebutenolidase.
pdb deposition date 2014-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4u2dA00
3GFFA 5ALSA 3HSSA 1VJ5A 1XZCA 3HACA 5A7HA 4XWGA 1WCYA 3WWCA 3FCYA 5AIBA 5CURA 3P2MA 4DNOA 3I2GA 3DYVA 4BTLA 4AB1A 1P0PA 5A7FA 1IUPA 1VE6A 4J3JA 3D2BA 5DWDA 2Z3ZA 5LZ2A 4JYMA 1LZLA 1ODSA 2WIGA 3GELA 4GW3A 3G9XA 1XQVA 3GZJA 1MN6A 4L72A 3WK7A 2C7BA 1CVLA 1FJ2A 2XDWA 5DNWA 1GKLA 4DIUA 1YAJA 4BE9A 3NGMA 2V97A 2QJWA 3VKFA 1DWOA 4M0EA 1VXRA 1UWCA 5JD4A 4BVJA 2HU8A 5CBKA 3BIXA 1AUOA 3LLCA 4C87A 4UHHA 3R3ZA 3RM3A 1CUWA 1CUYA 1CUBA 2XE4A 3DEAA 1RYYA 1XZIA 1ACJA 3IVMA 4C4XA 4XJVA 1ZICA 2XT0A 5A2GA 1JKMA 1ZD4A 4UHFA 4TGLA 3VJKA 5E4YA 1DINA 5AI9A 1W6RA 2ONCA 2WM2A 4B9EA 2RIPA 1N8SA 4AN0A 3CN9A 3UMJA 1SCKA 2PM8A 4IH1A 2BUBA 4INZA 1XZJA 4A23A 3MGAA 2HA7A 1EB9A 4HS9A 1UOOA 2BKLA 3ESDA 2OCLA 1UK7A 4Q05A 1LBTA 2FJPA 4UHEA 4X97A 1B41A 1XLWA 2LIPA 3PUIA 4H35A 5EIEA 3EQ7A 3QZUA 3KD2A 4I3FA 4AQDA 4B84A 4UHBA 3R41A 1N1MA 3F97A 1YASA 4BP8A 3IULA 1QFMA 1ZGBA 3STWA 3QMMA 1LPPA 4CI9A 4J0DA 4OYLA 1EB8A 4WDRA 3WYNA 1CEXA 5CT5A 5JARA 1AGYA 5AOAA 2XUAA 2AJ8A 3VVMA 1LPMA 2HA5A 3H18A 2PUHA 1R9MA 5AKZA 1USWA 5K3FA 3R3UA 2BGRA 4BATA 2HFJA 1U2EA 4A5SA 1EVEA 2VQ6A 2HHAA 5LKRA 5EIHA 2WFMA 3D59A 2BFNA 5K3AA 1NU6A 1EHYA 3KSRA 3ANTA 4OU5A 3W04A 4X6UA 3WA6A 4EY8A 4ZREA 4KE9A 2CKMA 1E89A 4G8CA 1QIMA 1LPAB 4LXGA 1XZBA 2VAVA 5IH7A 1R4ZA 2PU7A 3DL4A 5JANA 1XRMA 1CUCA 2QMQA 1FSSA 4BCDA 3STYA 1EK2A 2VJCA 3C8DA 1HBJA 4W1SA 2Z8ZA 2VTVA 1GT6A 4KRXA 1S8OA 3TGLA 5DYYA 4WCVA 3GBSA 3JW8A 2HM7A 1XFDA 2ZSIA 3L1IA 2ZJ7A 5K3BA 1W52X 1JJFA 1YS2X 2HRQA 1BCRA 2ZJ6A 4OD0A 3BF7A 3AFIA 2Z5GA 3D2CA 4UFNA 1XLVA 2PSJA 2XMBA 1QOZA 4CFSA 4J0CA 4H77A 3AIKA 4H7FA 2VJBA 4QEKA 1WB5A 5AKGA 3W9BA 5D3ZA 4OSEA 5E4TA 2ORYA 4KAJA 1HL7A 4LIPD 3A6ZA 4H7IA 5CXUA 2B20A 4IH9A 4J0GA 4UBIA 3AIOA 2BAGA 1XROA 2WUGA 3W9UA 4K2AA 4X6YA 2HFKA 4ETWA 4PSCA 1E8MA 4H7EA 1GPKA 2ZYHA 3WL7A 5JATA 3L1HA 3DS8A 1R50A 1FFAA 2XUIA 4OYYA 5AI0A 3H04A 2C0QA 4N8SA 1CFJA 4E11A 3S2ZA 2JGJA 3ZV7A 2HIHA 1BU8A 3AJAA 4FMPA 5BWBA 1ORWA 3ESCA 4B7ZA 3JWEA 2WUEA 2J3QA 5FUMA 4CG2A 4UUQA 4Y2JA 1UT6A 5A7GA 1Y7HA 4EUSA 4Y2RA 1H2ZA 4GXNA 4QDZA 1Z68A 3DOHA 5HFAA 2PKYX 4X95A 2EDCA 2WIFA 5K5EA 5BWCA 5E4JA 3PI6A 3DD5A 2X8BA 2G5PA 3FYUA 3PDCA 1IZ7A 3H17A 3G0GA 4UBNA 2QKYA 1R3DA 5LIPA 3T52A 3FSGA 4OU4A 2V9ZA 3BDVA 4C4ZA 4GLBA 4H0CA 3N2ZB 1J1IA 3BJRA 4N8DA 3O95A 3W06A 2AJBA 5H3HA 4F0JA 2ACKA 2XUPA 3FLEA 4LHEA 1XQWA 5T4HA 5AKYA 1AQLA 4N5HX 2V96A 3HC7A 4CG1A 3WL6A 4Y2SA 2G63A 3AZPA 1QE3A 3BDIA 5FV4A 3M3DA 1K63A 1ACLA 1IZ8A 2WFZA 5HKBA 1EDEA 4FNGA 4E15A 4HRXA 3OOSA 2BCEA 1UOQA 4IO0A 5BV7A 1LPSA 3D7RA 1UOPA 3W2TA 3OG9A 1W4LA 4GBGA 4FLMA 4K6HA 2Y2VA 1L7RA 3FVTA 4X71A 2H1IA 2JGIA 2ZSHA 4D9JA 5CW2A 4FLFA 2CZQA 5K3DA 1WM1A 3MUNA 2I3DA 3HJUA 3H0CA 4F5ZA 2CJPA 4BE4A 3A2NA 1FFBA 1JT2A 2XLCA 3WJ2A 2AXEA 2DHEA 4U2CA 2JEYA 3WKCA 2XMSA 3ZWQA 4G4IA 4AMZA 2ZYSA 1F8UA 1QIJA 5ISMA 4C6HA 1BN6A 1YB7A 2BUAA 3QH4A 4BCCA 1HLGA 4YPVA 2XUDA 1MO2A 5C81A 1T4MA 4GI1A 2HL6A 4EHBA 3VJLA 3WL8A 4MYSA 3B12A 4MWTA 4BDTA 3LCRA 1QIKA 3WMRA 3IUQA 4FOLA 3M82A 4FKBA 5AKEA 5AK4A 4AMYA 2PSHA 2IITA 1GZ7A 1LLFA 1WPXA 1MT3A 3M81A 5CT6A 5AI6A 1QTRA 4UBKA 3FLAA 3UUEA 1O6FA 2H7CA 5ALRA 1XLUA 4UHCA 1KU6A 4PSDA 3O9VA 1C4XA 4QDTA 3C6XA 1XZLA 1GQSA 3H2JA 1L7AA 1XZAA 4KRYA 2PVSA 4G9EA 1ZI6A 1TAHA 2RAUA 3EIOA 1XZKA 1SFRA 3PF8A 1A8QA 3WL5A 5T4EA 1LBSA 1G5FA 4HRYA 2JF0A 3WI7A 1H22A 1TCBA 2GZSA 1RWQA 4QE3A 3IURA 3I2IA 3QPDA 4S0XA 3WWDA 1BROA 5T4BA 1MTZA 3H1AA 3WWPA 3EBLA 1CUDA 2GBCA 3BL8A 3C6BA 2C5FA 2VJDA 5DJ5A 4Y2YA 4EY6A 1DX6A 4P93A 5JZSA 1HQDA 4P9NA 5FKJA 2WQZA 2OGZA 4B82A 3I1IA 2JIDA 1XRRA 2PSDA 5AI5A 5LZ7A 5C8XA 1AKNA 4RE6A 2XUQA 2WHPB 4FLEA 4Y2UA 2XUHA 5ALJA 2QUAA 3DOIA 4H7JA 4WFIA 2ZJFA 5DYWA 4EB0A 2Z8XA 5CT8A 1ORVA 4OPMA 5ESRA 5BOVA 3A2MA 2XI4A 1WB6A 5HKAA 2QM0A 2PSEA 2GYUA 1ZGCA 4XIIA 1C7JA 3DLTA 4LXIA 1IUNA 3FYTA 3TRDA 3LIPA 3WKDA 1VLQA 3WK8A 4F21A 2WU4A 1Y7IA 1QIHA 3DJYA 3IUMA 2JGFA 5KWJA 3R3WA 4GECA 1XRNA 2VT6A 2XUOA 3G02A 3VJMA 4W63A 3RLIA 1AX9A 2NW6A 1F0NA 4XX1A 1AC5A 2BJHA 3PFCA 3DDUA 2WSLA 2WJ3A 1XRLA 2I3ZA 4EZIA 4KJXA 5LP1A 1P0IA 2H7YA 3GA7A 1L7QA 5AKLA 3G8YA 2B61A 1GQRA 4G9GA 4LYEA 1CV2A 1CUZA 2X5XA 4N8EA 1EDDA 4NMWA 3C6YA 4EY5A 3IIIA 1CUXA 2ES4A 3S8YA 5AM5A 3G0DA 2OAGA 1Q84A 5LYYA 2XMCA 4UPDA 4G8BA 4PW0A 2ZYRA 5D3KA 1GPNA 4ZV9A 4I4CA 3PUHA 4ZWNA 4X90A 5AKKA 2XQKA 4P08A 5AKJA 1QO9A 3H2KA 1W76A 3R3VA 1E5TA 3G0CA 2PL5A 2EEPA 5I8PA 3FVRA 1J2EA 3VVLA 1MJ5A 1TIBA 1QIIA 5HF6A 3ZI7A 1Q0RA 1YSCA 5FP0A 5EI5A 3WLAA 5AK5A 3VXKA 4PSUA 3ANSA 4DMFA 4K5QA 2QXUA 1B6GA 1JJIA 4KE6A 1ODTC 4OB6A 3AZQA 1BEEA 4B85A 3K2IA 2BGNA 4QNNA 3ESAA 3C8HA 3DQZA 4J03A 6YASA 1CUIA 2XMZA 3EF3A 3ZPXA 5HQ3B 1SOMA 2QJRA 1LNSA 1BRTA 4WY8A 3H2IA 4OB7A 3V9AA 1A7UA 2QR5A 5DLPA 1U4NA 1CLEA 4BVKA 3HLKA 5SYNA 4IHAA 3H2GA 4M0MA 1HDEA 5CT9A 3PF9A 2QT9A 4N5IX 2AJLI 2UZ0A 3MUOA 2C4HA 1EINA 2XB6A 1MPXA 2XMGA 1IVYA 2VJAA 2WHRA 4EA6A 1VOTA 4WFKA 4Y2PA 3E1GA 4QA9A 4DYHA 2CUTA 1JU3A 4J0KA 1CUAA 1JMYA 5DNUA 2PX6A 5A62A 5AKIA 3CN7A 3IA2A 4X6XA 1CUGA 1N5RA 3G0BA 4KAAA 1PJAA 2QVBA 1W75A 1DWPA 2FJ0A 2FX5A 1TQHA 2WTNA 1R88A 3AINA 1JU4A 4FWBA 1H23A 4Q3KA 2VT7A 5ALWA 1NX9A 1FFEA 1LPOA 4HZGA 4G8DA 3IBTA 3QBJA 3C6ZA 1SC9A 4OB8A 2YASA 5HQ3A 3R0VA 3U0VA 5HZGA 3OPMA 1UK9A 5AK6A 3G0IA 4ROTA 4X00A 5EGNA 2J3DA 4AO7A 2ECFA 7YASA 2GBIA 2J4CA 4J0IA 2QUBA 4HXEB 4F60A 1EK1A 5ALYA 1BE0A 1YA8A 5CH3A 5CH8A 1K6EA 1DU4A 3GROA 2OG1A 4BAZA 4X93A 1MX5A 2JGEA 5AO9A 3WA7A 5HFNA 3K9BA 4Y7DA 1JJBA 3TJMA 2XMQA 4M0FA 3FOBA 4Y2QA 1F0PA 3I2KA 3WJ1A 2JGMA 4OCZA 1H2WA 2WIKA 1YR2A 4ITVA 3F8SA 1THGA 5ALIA 1UXOA 3H1BA 3L1JA 4JYPA 1KEZA 1THTA 4BYMA 2H9YA 5AM0A 4B6GA 5ALVA 4FFVA 1GGVA 1Q0ZA 2CEKA 5SYMA 1E8NA 1CUSA 4PQEA 2R8BA 1EH5A 2OCGA 3QMVA 5LLSA 2RONA 1ZD2P 4AX4A 1OCEA 3NUZA 1ZJ5A 5HCUA 1K5PA 2G4LA 4FHZA 4C88A 3BF8A 4J0HA 5AJHA 4E14A 4L9AA 2HA3A 3O4IA 1CIJA 3O0DA 1MAHA 1YCDA 3QPAA 3STXA 2OAEA 1WOMA 2Q0XA 3TEJA 4L0CA 1AMNA 3FNBA 3ESBA 4GDMA 4Y2TA 4XVCA 2QZPA 4QWMA 3IUNA 4CCWA 1JMKC 4HAIA 5AI8A 4BTVA 5FLKA 4JEIA 5JZ9A 2WIJA 4W1PA 4ARAA 5KREA 3BE8A 2P8SA 5HF9A 3F67A 1XZMA 3QPCA 4H7HA 4BZZA 4J7AA 1X2EA 3R3YA 1T2NA 4DM7A 4BDSA 3EQ9A 3G9UA 1XKTA 2WUFA 5HK9A 3SC2A 1QGED 4MWSA 1W1IA 3UUFA 1I6WA 1ETHA 1AZWA 4FTWA 3R40A 4YASA 4OUKX 2B4KA 4DMCA 1PV1A 3E0XA 2WTMA 5FDFA 3G9ZA 4U2DA 2Y6VA 5ALMA 2DFPA 5AK3A 3E4DA 4FFWA 4JNCA 2XUJA 1YS1X 1UKAA 3I2JA 3OTQA 1X2BA 1VXOA 3V1LA 3IDAA 3VDXA 4B80A 2VA9A 4UHDA 4BC0A 3FAKA 2OQVA 4MEBA 2VEOA 4BCBA 1Y37A 2I03A 4B9AA 1JFRA 4BB0A 1OXMA 4AO6A 1A88A 1XZDA 4DSAA 2ZVDA 1XQXA 4X3CA 4UFOA 5CH5A 5JAOA 2C5GA 2WLSA 4B83A 5EFZA 1BN7A 5C8ZA 2HADA 3KDAA 2HU5A 2DCMA 4I19A 4GEGA 5JZBA 2DHDA 3PFBA 2ACEA 1HKHA 4TPKA 4DNQA 3WIOA 3PE6A 1M33A 4G4GA 1DT3A 3OM8A 4G4JA 1G42A 5ALPA 3V1MA 2XUFA 1QIEA 5ALFA 1ISPA 4X85A 5AKXA 2QOEA 2GBFA 2WU3A 3ZLUA 2CMFA 2DQZA 2WG2A 3DKRA 3QMWA 3NWOA 1U65A 3D5EA 2XMDA 2XQIA 2WKWA 4Q3LA 4BZWA 4KYVA 4KEAA 3WWOA 3ILSA 1TK3A 4HXGA 5ALHA 2GBGA 4HVTA 5ALKA 5C7YA 2WHPA 4BRZA 5ALEA 5FPQA 1R9NA 2D0DA 2K2QB 4MQLA 5IVDA 5AM4A 5DNVA 2X76A 1KU0A 3WK5A 5FOQA 4UBMA 4MYDA 1CPYA 3I28A 2H7XA 1QFSA 1A8UA 5ALLA 3E3AA 3STUA 5CRIA 3AILA 4H7DA 5JADA 3FBWA 3NOXA 1G4HA 3V1NA 3DKKA 3M83A 1ZIYA 2G5TA 1C7IA 2C0PA 4CCYB 2Y6UA 1EVQA 4ZRDA 4BC1A 1WB4A 5AICA 1XRPA 3C43A 1VZ2A 3FLBA 2Y1KA 2BUCA 4YK7A 3QYJA 5ALTA 1YAHA 3G7NA 1ZD3A 3B3QA 4HTAA 5JAUA 3C5WP 1CUHA 5ALGA 2RHWA 3WKAA 3I1YA 4PV7A 3VISA 2OLEA 4RGYA 2RHTA 1FFDA 1DQZA 3C87A 4W1QA 5LKAA 4BAGA 5D6OA 5T4FA 5AP9A 2DHCA 2YXPX 4QLOA 3D3NA 2HA4A 4ARBA 2GYWA 3O4GA 5LZ4A 4DTCA 4JUIA 3OC0A 2B9VA 3DCNA 4HXFB 4C01A 4BAUA 3FYUC 1E66A 2WFLB 3Q8WA 1D07A 1TRHA 4DNPA 1TCCA 4P92A 5AHXA 4UBOA 5ALZA 1CUUA 2QTBA 1WPRA 1XQYA 5AOCA 1MX9A 2OQIA 4FBMA 1VZ3A 1XZHA 1GPLA 4L3WA 1WHTA 5DYTA 4MEAA 4QDXA 3F96A 5AI4A 2IIVA 4AZ3A 2OGSA 4MQMA 4V2IA 2VSQA 2PBLA 4MXDA 5K3FB 4O08A 2XQGA 1MX1A 3AZOA 4X92A 4DLNA 4RE5A 4BBZA 1UZAA 2HDWA 2WUDA 4IH4A 3I2FA 3K6KA 3O9MA 4KR0A 5CTAA 2XMRA 1FFCA 2CBGA 3WK6A 3Q0TA 1X70A 2HU7A 5CXXA 2QXTA 1EDBA 2PUJA 5EHXA 4A16A 4WY5A 1MU0A 1JI3A 1ZD5A 4Y9SA 4X7BA 4BRSA 4LXHA 3ICVA 2QRUA 4GWLA 2O2GA 2WIDA 5JAHA 4QWWA 4CIBA 5A71A 3BJMA 4H7KA 4KE8A 4H18A 3BWXA 1BEZA 4AXBA 3WK9A 3HABA 3I2HA 1NU8A 1GKKA 3HEAA 3STVA 5DTJA 2Z3WA 3PICA 2OCKA 4Q1VA 1XZGA 2R11A 3YASA 1QIFA 3SK0A 4EBBA 4B81A 4Y2VA 4ZV7A 2W6CX 2VAXA 1DWQA 5JD5A 4NS4A 1VA5A 1LPNA 1DQYA 3RKSA 4G1FA 2HA0A 1BS9A 4DMHA 1GXSA 1LGYA 1UFOA 2O2IA 1UKCA 2GYVA 2OPHA 2WILA 2VATA 3LS2A 5J3JA 3C45A 5ALUA 1VA4A 5EHQA 4FBLA 1CQWA 1QZ3A 1CR6A 4EY7A 3SWWA 3KWJA 4MJ3A 3RARA 2XQJA 2HRRA 3WWEA 3D0KA 1OILA 4RNCA 3WKEA 1EX9A 3WYDA 1EI9A 1H2XA 1AURA 2AJDA 4E46A 1WHSA 1PFQA 1ZJ4A 3BXPA 2XQFA 2ZYIA 4U2BA 2HA6A 3JYHA 3T4UA 1IUOA 3O4JA 3QM1A 3C5VA 5FXMA 4FDMA 4ZXFA 4NZZA 2WJ6A 3C70A 2YH2A 5JAPA 1P0QA 5AKHA 1R1DA 3KOOA 3F98A 4PNZA 4QLAA 3H2HA 5D7BA 4UFPA 2PPLA 2I78A 2O2HA 4B0OA 4FNMA 3G9TA 3N0TA 4X94A 3DL7A 3FSGD 5JIBA 4Q34A 3KXPA 3WKBA 4KAFA 3O4HA 3I6ZA 3CCBA 4UBJA 2XLBA 2WHQA 5AIAA 5EHZA 3FWHA 5HK8A 4Q82A 1ZOIA 3D4LA 3STTA 3AUKA 1DTEA 3AIMA 2JEZA 2RGUA 5ALXA 1UK8A 1ZI9A 1Q83A 1N5MA 1IMJA 1A8SA 4WDQA 1UK6A 4UBLA 4U2EA 4CIAA 1P0MA 2WG0A 5KWIA 2HA2A 3EQ8A 4RPCA 4WFJA 4TVKA 5JASA 3DYIA 1CUFA 5EIAA 3X3HA 2XUGA 3QVMA 5A6VA 3R3XA 2GZRA 1K4YA 4PO3X 3GUUA 1CUJA 1CUEA 4CCYA 5JYCA 3WQHA 3I6MA 1O6GA 4DNFA 1CUVA 5HF5A 1QIGA 3QITA 1CRLA 3V48A 2DQYA 4K6KA 1QIDA 4AN1A 1YB6A 5IVKA 3KWFA 3ED1A 1ZI8A 2YYSA 4CG3A 5CMLA 2V98A 3HYSA 5JALA 4YX9A 3FCXA 2WJ4A 4C4YA 5AM3A 3HI4A 1LZKA 4LKOA 4QDUA 1J07A 2Y2UA 3H19A 2WG1A 5AM2A 1H2YA 2DR0A 4LYDA 5K3CA 3MVEA 2QS9A 1SCQA 2JGKA 3V1KA 5LZ8A 2OCIA 3WZLA 1QJ4A 5CT4A 3RK4A 1ZIXA 1ODCA 4W1RA 1HPLA 4JH0A 1MNQA 5C8VA 3ICWA 4B0PA 1EA5A 1CQZA 5DTIA 5E2IA 3WZMA 2ROQA 5IVIA 2C58A 3W05A 4U2GA 3B5EA 3CXUA 1RP1A 3IUJA 4U2FA 4QDOA 5FRDA 4KE7A 2IX9A 2J4FA 1QTIA 2OXEA 1DX4A 4ZGBA 1DT5A 5I7UA 4DSZA 4AZ0A 1E3QA 3ZLVA 4DMKA 2PSFA 3HRHA 1QONA 1XZEA 3DNMA 3A2LA 4GHWA 5FPPA 3HXKA 5ALQA 5IKXA 4X91A 2XUKA 4J0JA 2O7RA 2PU5A 4KACA 2DSNA 2RI6A 1VKHA 2D5LA 4Z49A 4G5XA 4BVLA 4ZI5A 1U8EA 2CB9A 2VF2A 4C89A 3LP5A 5I9IA 3OURA 5LZ5A 1F6WA 1QLWA 5ALDA 4W9RA 5F4ZA 3WIBA 4WJLA 4AO8A 3FYUB 3I6YA 4Y2XA 5YASA 1XKLA 5JD6A 1G66A 4DGQA 3LIIA 3IB3A 5LZ9A 2AJCA 2E3JA 5ALOA 1XRQA 1XZFA 2JGLA 3U1TA 1UKBA 4NVRA 2O7VA 3BIWA 5AM1A 5HF8A 1TKRA 5K3EA 1E8DA 1LPBB 4PF1A 1QO7A 4QZVA 2OGTA 1TCAA 3ZLTA 3HZOA 4EY4A 2EDAA 1BCSA 1J06A 5AOBA 2W22A 1MNAA 1K8QA 5AH0A 1SCIA 3F9CA 4IQ4A 4BP9A 3WK4A 2FUKA 2WFLA 5ALNA 3A70A 1VE7A 3CCCA 4K6GA 5EHNA 1EXWA 3SX4A 3D2AA 1MAAA 5KBYA 4Q3OA 5IVHA 2JBWA 1YA4A
chains in the Genus database with same CATH superfamily
2YIVX 2Y67A 1SIOA 2EG5A 3HSSA 4DCPA 5DEOA 3R0IA 3INTA 2BKEA 1XZCA 4D46A 3JZAA 3LT0A 5JSKA 4JJ7A 2JK0A 4BWFB 5FTKA 2QK4A 5B3JA 4DA0A 3O8CA 2AMJA 2FFRA 3AI3A 3LRXA 4KXWA 4WBSA 3GB9A 3GRRA 5E6UA 2BISA 5FBKA 3KQKA 2ZJ5A 1D9XA 3HWX1 2XIJA 1M73E 3I2GA 4QXQA 2A7XA 4AB1A 5JJ5A 1P0PA 5A7FA 1J5EB 3Q85A 2DUNA 1VE6A 4MS4A 2XRYA 2POCA 1L1EA 4U7FA 1N6HA 1NN1A 4DCSA 3UATA 2PKQP 1UBNA 1Y5LA 4A2QA 3BAZA 4QO7A 2KM1A 3WNZA 1IPFA 5JMPA 3OCXA 4DBZA 1G1MA 1MVNA 1YS4A 3R5SA 4KB5A 4ZVUA 3CWZA 1LZLA 3GFSA 5K3SA 4EI2A 1L7NA 2FXVA 3NOQA 5LZ2A 2HYDA 1TEZA 3GELA 2GPJA 3CURA 5IK2D 1GN8A 2VDQB 2VJOA 3GDWA 2PKWA 3B9PA 1RQ2A 5JS1A 1DDGA 4MW2A 1EE1A 5KAMA 3U7JA 2NQTA 3H65A 4KH0A 1QOQB 3UO8B 1MOSA 5J5VA 4N12A 2RG1A 3G1UA 4IGEA 1PD1A 1T8RA 3LFTA 5BSVA 4RU1A 1VSVA 3C39A 3K09A 3HR4A 3B2EA 4J8PA 2MYPA 4WNAA 4OXKA 2E48A 1GKLA 3A6KA 3EIWA 4MS1B 3L6DA 1VIVA 4UVDA 5H8WA 1M8GA 2V97A 3DT9A 4L8LA 4NFLA 3BXXA 3KLBA 1MXHA 2BFFB 2F8LA 2BFOA 4LZZA 3WRVA 4ZVRA 4AG3A 3R75A 5I7FA 3X1JA 1M0EA 4BKMA 4H1HA 4B34A 4ZVPA 3DDCA 4M0EA 1FP4B 4HBZA 5BMVF 1QAQA 3JPWA 4R68A 1Z12A 4JLUA 5K0ZA 2JLYA 1YD7A 1YXMA 2D4HA 1Q6ZA 5C5EA 2BFBB 4PAQA 2Q5JA 2OD2A 1XB2A 1IPHA 1GQFA 2J3MA 2QNRA 3I42A 2BFFA 1D5WA 2HU8A 2XBLA 3E5HA 3KLNA 4IR7A 4EHIA 3BGSA 4S24A 3RYTC 3BIXA 3MLAA 2JD0A 2JIRA 3FOAA 3TJZA 3OJWA 4HF7A 1RRCA 3PD0A 3RVSA 1QJCA 4IUDS 4PNEA 2XD9A 5K8LA 3QQPA 4UM5A 2Z5LA 3R3ZA 3RM3A 2P5TB 3Q7PA 3PFIA 3QJ5A 1CUWA 3HHPA 2FX3A 2FLWA 4IVQA 4B73A 2OM6A 1OWLA 4M6WB 1XZIA 3KK0A 4UZEA 1KFJB 1NOKA 2HSDA 3GP8A 5EIWA 4XJVA 2Q41A 1AIPA 1ZICA 2O9JA 1VJRA 4D6PA 5D85A 1RMTA 2XT0A 1K7EB 5GIPE 4P1ZA 1KQ3A 1HY3A 3O2JA 3RYHA 4BO9A 1VBMA 2VKTA 4TL9A 4DV3B 5FNZA 1ZD4A 2FY8A 3V42A 4RMGA 2IE0A 2WVGA 3AR6A 3IBGA 4FKMA 2HNAA 4FS3A 3RQSA 3TYXA 2CL0X 5J4HA 1SKYE 1O95A 2HOQA 1W46A 1CR2A 1L6IA 3CONA 1W6RA 2A5JA 3DDWA 2XGSA 3QLUA 4HQLA 4YRDA 3WLTA 2WM2A 5JHHB 1DAIA 1DVRA 4YV2A 5L40A 4R51A 3KR2A 4FBGA 1V16A 3CN9A 3G2MA 3BX1A 5FD8A 3UMJA 1SCKA 4UVHA 5D3QA 2FF5A 3IQIX 1USUA 4JY7A 1J2TA 3A4IA 2A14A 4WHMA 2E5WA 2B3DA 1XZJA 3H6GA 4D45A 3D3JA 2FSIA 2W8BA 4X1KA 1ZSNA 3ROFA 4A23A 4AZ0B 3E27A 2NG1A 3IKTA 3EMVA 1J25A 4Y18A 3QEBZ 2H1CA 2P2LA 2I65A 3MT9A 1NUSA 5TS3A 4GS5A 4AWXA 5TRTA 3TDMA 2PNJA 2IHKA 3DVAA 3X2FA 2RBGA 2XD4A 4WVLA 5J4LA 3EPHA 2AG8A 3QX8A 3O91A 4DG9A 4GM1A 1U2GA 1PQUA 4M38A 3A9RA 4KRGA 4MUJA 4UHEA 2YFQA 5I9TA 4F72A 5HR5A 1L1RA 1G8AA 2BZGA 3RAEC 4C7XA 1E0JA 3QLEA 4A27A 1L7EA 5TJHA 2QENA 4NNJA 2NU6B 4BJ1A 2WB2A 3DAFA 5AT1A 3V8QA 3PUIA 1ZC3A 4UUBA 4A0SA 3WMXA 4H35A 4E13A 1PE0A 4QELA 5EPEA 4AQDA 4EEZA 4IDGA 2YDYA 4JYCA 2JFYA 4FJ0A 4J7XA 4OKNA 3W5IA 4AJ2A 1WTCA 4B84A 4BLOA 3FFTA 3JARA 4EO4A 2GD2A 1WXFA 2DPXA 1YOVA 3HB0A 2C04A 3R41A 1DQSA 4A2CA 4YRGA 5LMZA 4LYFA 5LQCA 1ZUIA 3F97A 5E7IA 1FRVA 3KP1A 3AUTA 1YASA 2MTBA 3KB6A 4FHCA 3QVTA 1HE2A 1NVAA 2W6JA 5C5DA 5DHFA 1X7XA 3LP6A 3ADOA 1DB3A 3LT4A 4RL6A 3V34A 3C7DB 3NO4A 5JJCA 3ZKAA 1ZGBA 5IJWA 3ZCVA 1L5YA 1R0ZA 2CVFA 2P4SA 4QOEA 1YZ3A 1W1UA 1HSZA 2GPWA 4Y1GA 1P5HA 4EB6B 10MHA 3EGIA 4MWZA 3R76A 2FW1A 2YWGA 2O5EA 1K66A 2YV1A 5FPSA 3R23A 3R3SA 2PE5A 5IS2A 2ZI9A 3AW9A 5CT5A 4ENWA 4ENVA 2Q2WA 3K0BA 3PPVA 2BGGA 4KGXA 4JLMA 3RUHA 5EUBA 2HIAA 5JH7A 3HCFA 5L3RA 4EJ0A 4K6CA 2C7PA 1PWXA 4RO0A 4GLLA 1RAIA 4TLBA 2VFAA 3UA3A 3ET5A 3R3UA 1J7JA 1RE1A 3RBZA 3B36A 2BGRA 4LCBA 4REQA 3I0MA 1RJ9B 2XECA 4R1TA 2VQ6A 2HHAA 5LM3A 3LUFA 2IH4A 1IBSA 4LF4B 2YJTD 2WFMA 4L3OA 2A5YB 4U02A 3SIRA 3IBCA 2FQXA 1XTQA 3SG0A 3OKCA 2BFNA 4BLRA 1NU6A 3LKBA 3Q7TA 3KSRA 3S29A 4LGCA 3GY0A 4F92B 4RDCA 3KAKA 1P1BA 5AXAA 2VLIA 4E2WA 3HCEA 1CY7A 3D0OA 3H5OA 1UC8A 3P97A 2OBBA 1SVIA 3G85A 1EJ0A 3Q5DA 3WP0A 3MINB 3PXCX 3Q3VA 4X6UA 1N3YA 5K4AA 2CF6A 4EY8A 1ESMA 2YWJA 4NAHA 4ZREA 1O89A 4J91A 1XCGB 3BB4A 1P2VA 1E1MA 4HO1X 4R8SA 3GCXA 4PZAA 5D5HA 1GPDG 2PZEA 3MUEA 4B87A 4ZEVA 5L4SA 5TQ2A 1CCWA 1USGA 2GBLA 3OZSA 3BSFA 1FSFA 1NBHA 4LXGA 1WBBA 2C2HA 1Z2AA 3R5HA 4LXUA 4NEHB 1YIDA 1V8FA 3GXBA 4OLFA 1AKRA 3TRJA 3AVPA 3OZDA 3LDGA 3L0PA 1BWRA 4QGSA 4F2HA 3L6RA 5JANA 1CF4A 3LD9A 3OD1A 4I4LA 1GPWB 3ZCUA 3WFZA 1EK2A 3UHAA 4LI3X 8ABPA 4YMSA 2JLUA 2VQDA 4RD6A 1B8VA 1JEEA 2XSZD 4MROA 2OP0A 2QYSA 2WRZA 1W85B 1M76A 2HH9A 2F1RA 3LI2A 3VU3A 2CSUA 1PX0A 1TW2A 2WMDA 4CE6A 5DYYA 1L3IA 1P0CA 1W0JD 2QPAA 3HYRA 3KIPA 3M6LA 2PFSA 1PQYA 4FFSA 4PY2A 4WCVA 3BWBA 3JW8A 1PYOA 2JEOA 3RC2A 3FM9A 3RYCB 3PJRA 3IT3A 1J20A 3QJYA 3D7KA 2G4CA 4HH3C 4AZWA 5DX1A 2I9PA 1TQDA 1WW8A 1Q11A 4KLZA 4C1NA 4YDQA 4BB6A 5EZYF 1ZNWA 4AZVA 2ZE5A 2ARKA 2VHCA 2BFBA 3DLIA 1YS2X 4UTOA 3K9CA 1OPXA 4HFRA 3ZIUA 3GL9A 3EGXB 5EJFA 2PUDA 1U1FA 1OBFO 1IN7A 1K6IA 1LW7A 1RHMA 3HFGA 5J59A 2Z5GA 3T94A 3TRFA 1BVUA 3FPBA 2B98A 1AA6A 4MV5A 4AS1A 3H11A 3M1AA 1Z4MA 1SOAA 3ABRB 2ZJ0A 3VR4A 3VUFA 3ZIAD 3VC2A 1N0IA 1H5NA 1QOZA 3CH4B 2QR3A 4DXHA 1WRBA 5KNCH 4J0CA 4D92A 1KI1A 1Z2CA 3HDVA 3IILA 3UF0A 1DEAA 4RPIA 3BRSA 3D4IA 3AIKA 4H7FA 2VJBA 1CIVA 2X0KA 3HO6A 3LOUA 3RS5A 1OMOA 3TPFA 2Y8EA 1AU9A 5E4TA 1YVUA 1NMZA 3PWKA 5B2ZA 1G2IA 5HIMA 4N5NA 5ICFA 4YUAA 4FYVA 3HNPA 1NDHA 3S99A 2ZS7A 2JCGA 2XNJA 4JP3A 4JVMA 4TS4A 5FUWA 1BDIA 1KORA 2JVJA 1UC9A 4ZOLF 3AIOA 1XROA 4PONA 4BVBA 5LQKA 1A1VA 3IQWA 1IDN1 3IUBA 3OT5A 5DX0A 2AOWA 3JQQA 1RC8A 1QB7A 3DHYA 3PIIA 1CNFA 1ZD1A 2PV0A 2DBRA 4AULA 4HDRA 4ETWA 3AUYA 3JATB 5JUWA 4H7EA 5D2CA 3X43A 5A4FS 3PDIA 4D8YA 2HK9A 3NTRA 4RVSA 5T7BA 3EODA 2ZYHA 5DEIA 1AGRA 3L0DA 2JH8A 3H99A 3DS8A 3EUAA 5IJXA 1R50A 1FFAA 2FZ4A 2XUIA 3EAQA 1BWSA 3ILYA 4ALMA 1NQTA 4OYYA 3Q3IA 4IWNA 1YL5A 5EUMA 1XBTA 3OQMA 4JZKA 1CDEA 1NUHA 1SZDA 1BHQ1 3PNLA 4KPUB 3WTBA 2ECPA 3AHEA 3F6EX 5EMNA 4JENA 4QM6A 4ZVOA 3SYNA 4E11A 1NFQA 2BLLA 4EUHA 4Q3BA 4HDOB 3U9TA 4EKEA 5HKKA 3SEZA 3VFDA 4MJ7A 4GX0A 3I9NA 4XD7A 5TJ9A 5ECYA 4EECA 5B53A 4RJLA 2ENUA 4CGZA 1KPHA 5JWOA 3U7FB 2JLZA 2K6GA 3CISA 4ASUA 3GMIA 4EGCB 3ENQA 3UG7A 2VUHB 1SCBA 2C4KA 1V11A 2CVHA 3OTHA 3PQ4A 4GR5A 2I71A 4P4GA 5IM4F 4LFBB 4Z4HA 1U94A 3B48A 1JALA 3ZBQA 5EXEA 1NYLA 4N0DA 1RLMA 5B58C 1TZCA 4B7ZA 3ZDDA 2IGBA 2EQ5A 4P5DA 1D2HA 5CNJA 2WUEA 4AIIA 2W6PA 3BMNA 1NM5C 3UMBA 3KWLA 2VXBA 4OHYA 3AHFA 3JASA 4V2UA 3EEFA 3ZVMA 1N77A 8OHMA 1K3TA 3KYDA 4UUQA 1TF5A 3EBPA 1ZCFA 1M3SA 2YWEA 3ZZ1A 4F9TA 1DXOA 1Y7HA 3G3EA 2XWJI 5ELLA 1SUEA 4Y9RA 4EUSA 3MB8A 2EGHA 3WS7A 1KDRA 1UC5B 1GL9B 4H6PA 2RKWA 1H2ZA 4GXNA 3ZDQA 3FRJA 3BJEA 4NPHA 4QDZA 3Q41A 4BNNA 1IHUA 1B26A 1Z68A 3N7UA 3VR6H 2PKYX 3LDAA 3R5KA 4LJRA 2P3LA 3CB2A 6AT1A 3ZZ0A 4HOYA 4JHLA 3WX0A 3CG0A 1ZSYA 2H07A 4MSUA 2IU6A 1EWQA 2DUJA 5E4JA 4BV2A 4WBNB 1QRRA 1II9A 1O0CA 4HNUA 4BRUA 1ADGA 4YMTA 2G5PA 5A0TA 2QB5A 2RHDA 3WE7A 3RIHA 3OFVA 2UXDB 1IZ7A 4TV8F 3H17A 5B57C 4B7CA 1DARA 1RRKA 2A9JA 4NYJQ 3B6KA 6GPBA 1ZFNA 1LSUA 4Q19A 4UBNA 3DBIA 3FPGA 1NDUA 4PPNA 1VGRA 1G3QA 2I2AA 3N53A 3ACCA 2DZDA 2NTNA 2FQQA 4KO2S 4XCXA 1ADYA 1C0KA 2P0EA 2Q4OA 2ZYWX 1ZEJA 4MYTA 4OU4A 2COEA 4PPYA 4R1SA 5FLYA 4DQLA 4CTJA 3B6JA 4WCDA 4DC1A 1Q2XA 5KIAA 1AT1A 2ZXEA 4C4ZA 4XLZA 4BKUA 1XV5A 1S2NA 1Y5MA 1T3TA 2JL1A 4L4XA 4UASA 3GRPA 2I6XA 1OWNA 1KJQA 3E7WA 3G2OA 4LRTB 4N49A 4E2YA 2PSSA 5DISB 1MC8A 3LUGA 1KDOA 4N8DA 2IZOA 3VR1A 3PYMA 1SRQA 4L6AA 5T8KA 2AJBA 2CBXA 1FX0A 2PJRA 2A1TS 5MGBA 1DC3A 3UGQA 2ACKA 3K35A 5KOHA 1F1BA 1FIUA 1CBUA 1QCZA 1XC7A 2FRDA 3EXEA 1U2QA 3OZVA 1PR0A 1SVOA 4YHBA 1S96A 5C32A 2M2IA 3UV3A 1IUKA 4EKGA 4J0QA 1I6LA 1AQLA 1KY3A 2FE4A 4YR7A 4F91B 1FYEA 2PZGA 2IW3A 3HC7A 1G3RA 2HXGA 4HWRA 1JJVA 2A9OA 5CDSA 3AXSA 1UBUS 4L75A 2XCSB 1F60A 2FUNB 4YAOA 2OVBA 2WKPA 2Q6OA 4I4TF 1EAMA 3M6AA 1SURA 3OECA 3G0OA 3M3DA 4IMPA 1N2IA 2Q1TA 3CLTD 3T61A 2QM7A 3TEFA 4EEKA 1GZDA 3A32A 5E9AA 3G9QA 1Z4JA 2JGNA 3FZYA 4UPEA 5B1EA 2PPVA 3RD5A 4ZZ2A 3LE8A 2C94A 3C3YA 1LDBA 4QFBA 1AUQA 2I55A 2FFHA 4YXFA 1ULAA 3OCWA 4HLDA 3A8TA 1AM4D 2BCEA 3EJWA 3HJBA 4L8GA 1RTKA 5L3ZA 3V8RA 1PJQA 4BGDA 4KPEC 2C5SA 1ZGZA 2Q45A 5DK6A 4U5QA 1VKOA 3K9HA 2X0NA 4TWZA 2Y27A 2ZJYA 1COWD 2NZJA 1GZ6A 3D7RA 1ADFA 3KEGA 4JX9A 5AUQA 3T7RA 2HJGA 3OCZA 4TMZA 1O6CA 1V5WA 4EATA 4AY6A 3ZZMA 2GPYA 1TMOA 2FQYA 3CRW1 1E4EA 3BCUA 4HAWA 1F4VA 1N6NA 2IQ5A 3KEQA 4L51A 4XB1A 1TU0A 5DXAA 5JS8A 4NONA 1L7RA 1WDWB 3OPVA 4GOJA 2BHLA 1FDTA 5JXIA 1S7GA 1XEWY 4WV3A 1JFVA 4IJVA 1FYDA 1WDTA 2EZ4A 3Q4GA 3SFZA 4D9JA 2QRJA 5FBVB 2CJWA 5JSZB 2VDNB 5AHKA 2CZQA 4R2KA 2I2FA 3LK7A 4MW6A 1RAFA 1Q0UA 3C3PA 3G8AA 1P7VA 2PN1A 1GQ2A 3H16A 4TZKA 3JARB 1N75A 4DWOA 5J4VA 3K5WA 4YRSA 2YXDA 3S5JA 4M1TA 3TR6A 2M6SA 1L4LA 3HKCB 3VKWA 3VSCA 4KIWA 4IIBA 3SSNA 2P3OA 3JRNA 5IT5A 4F3KA 3MN1A 1FFBA 3T7CA 4TXHA 2BMEA 1WXEA 2DHEA 3WDKA 3M4YA 1K9VF 5KYXB 2JEYA 3MTAA 1YR3A 3N2KB 1EK6A 5DIZA 2J67A 4XWWA 2ZTLA 3O92A 4DQDA 2QVYX 1DC4A 2FEMA 4G4IA 5DBHX 4OKIA 5E3JA 4BP1A 3PEUA 2XDQA 1OYOA 3PX2A 4FCVA 1XPJA 3MMZA 3GA5A 1BJKA 1F8UA 2DR3A 3M49A 1YB7A 4JMPA 2BUAA 1EGMB 4UHKA 5AYVA 1Z6XA 5H81A 1K4MA 3QH4A 3FTDA 3DC2A 1EP9A 5A4IS 3B2QA 2PLWA 1RAHA 1CJCA 3FF1A 3H9CA 1E2KA 1V43A 2VO1A 1GG2A 2LKCA 4NMLA 2ORVA 4OQMA 3AU9A 1MO2A 2V3VA 4YPVA 2IDZA 1U04A 4GI1A 3TW6A 4PXAA 5GTDA 2C9CA 2HL6A 3F6CA 4EELA 1B0PA 1KAOA 2PTHA 3E1SA 3IPRA 4LDZA 6CHYA 3KDPA 2X40A 4MYSA 1A4XA 2VDUE 2VH2A 1LDEA 4UW9A 3P2KA 3BGVA 3H4TA 1CZUA 4BDTA 3FMFA 3SJBA 4GPIB 1M2KA 2H18A 3RFCA 3SU8A 4RD4A 5B2FA 2FJUA 1K92A 1PAUA 4ZV4A 5B3LA 5IT0A 4CKEA 1CS4C 3QBTA 3GNTA 3RLFA 4N01A 1FVOA 3IEIA 3RRBA 1R0KA 3V8VA 1A1SA 1W5EA 1NUTA 3QFRA 4FOLA 1K8XB 4ZJPA 4F4UA 3ORHA 4QJIA 4GZ6A 5EZYB 3C1OA 1LS6A 2X8AA 4KXFB 4DG8A 4OM7A 2E18A 4QOSA 5CXQA 4MH0R 2IITA 5C35A 3RF6A 4HK4A 2NNWB 1LLFA 4XQCA 2JJYA 3JRXA 5C1IA 2W42A 1RIIA 1ZAYA 2LR0A 3HBFA 4WXMA 1EJBA 4YJ2F 4PX3A 1WMDA 3UXYA 1W85A 5IM4A 1A4UA 2IYFA 4WKGA 3TUIC 1E1LA 3KE9A 3MMNA 3VU1A 2YVLA 1UMKA 3GVPA 1NMYA 1Z4NA 2WM3A 1N6RA 3FLAA 1NWHA 4C0HA 4F4FA 4PLYA 5FTLA 4NFHA 4KNYA 1O6FA 4LDNA 4IIVA 4JEUA 4MRVA 1ZC4A 4FGJA 2J48A 3GJSA 1KU6A 4UHCA 1N32B 3U81A 4DB4A 1G55A 1Z6ZA 4QDTA 3OA2A 3C6XA 4G1CA 3CNLA 3EDOA 1J8YF 4EJ2A 3HP7A 5I9SA 3U3OA 1V8PA 1J24A 5KC8A 2QJTA 1GQSA 3QEOA 1OHHA 3QG5A 4LFCB 1SC6A 1VDZA 3K6SA 3AI1A 4HQOA 5BWLA 3IEVA 4ZHQB 3SQXA 1N2GA 1XZAA 3KR0A 4KRYA 9ATCA 1T13A 1UIRA 4V03A 1L9KA 1AUXA 1EZZA 1TPYA 3OCJA 1JQDA 4XWYA 5CLQA 1JECA 4AF6A 1TAHA 2RAUA 5DV9A 4A0GA 3V9PA 3O1JC 2IBMA 2QE7A 4Q4AA 4LISA 1A8HA 2ZUCA 2BFDB 3P2YA 3RVPA 5H83A 1C4OA 4LV8B 2O6LA 5B55A 1ZPDA 4AX8A 1U90A 3GFVA 1SXQA 1UFKA 2JCSA 1RVDA 1JR6A 2PQMA 2BC9A 3DF9A 1LWNA 3C0KA 3ZD9A 5DLYA 4KFUA 1OT5A 2GZSA 4O2LA 4PHCA 2DJIA 3H6HA 3QPDA 3I6QA 5EZSA 4IJ6A 4DSNA 2L2QA 3HH8A 1UBKS 1DP4A 3I9JA 3LF2A 3OICA 4QO8A 5HZMA 5COAA 2X0RA 1LFDB 5KWIA 2ZBFA 3IDFA 1MO4A 2W7TA 4R1NA 3T5MA 2GFHA 3ZWVA 3IIJA 3WWPA 1JR2A 2ATXA 1E59A 4P0QB 3MGGA 4GYYA 3W6UA 3ZCXA 1E3SA 1JXQA 2C5FA 1P2FA 2VJDA 4CMAA 5KPDA 3FPFA 2DTDA 3FPLA 5IHPA 5EXPA 4EY6A 2IS1A 3BORA 3W5BA 2V7BA 4MRRA 3G5MA 1FRFS 4PANA 4GLFA 5DIFA 3TF5A 2CVOA 3Q0IA 2C96A 3H13A 4G0ZA 1R16A 4Z9BA 3VHRA 4DR6B 1V7PC 4JT8A 2EKBA 2RJNA 2H31A 4P38A 5LCXA 2V74B 3VUEA 5FKJA 3F8WA 2WQZA 3CE9A 2FP4A 3MHPA 3NVDA 1UR5A 1GV0A 2GAJA 4F3YA 1Z22A 1CWUA 4LCJA 2GMWA 3Q12A 3H75A 3ZD6A 1K0UA 3GEIA 4E07A 4JLBA 5AW2A 3F49S 1R9GA 3Q87B 2DHQA 3WL4A 4NBRA 4R7ZA 1UMBA 5FA6A 3EULA 3HRIA 4CGYA 2H2WA 4WFIA 2PR7A 2VHQA 5DYWA 5IDXA 4EB0A 4ZEMA 2DKFA 2F48A 2NU9A 1H1TA 2G0TA 2YIDA 5JOQA 3PZBA 2WSYB 3WRYA 1V1JA 5AVJA 5BOVA 2P2GA 1KZGB 1V47A 2VR1A 2Z2ZA 4Q39A 3ADDA 3HG7A 1SR8A 2QM0A 2HF7A 3AHJA 4IXMA 4KUGA 4KPYA 1DC8A 4KTTE 2HWYA 1NVXQ 2JPDA 2OHOA 3IQGX 4QJ5A 4E2XA 3ICCA 3QENA 4XQ9A 1PGPA 3UCXA 3IUYA 3ZD8A 1AV7A 3IPXA 1X9GA 2GYUA 3JWIA 3VAYA 4DS3A 1RYDA 4XIIA 2PIAA 2GCNA 4OBWA 2ODNA 2NZXA 2QLBA 2QP9X 3FUTA 3H8VA 2CK3A 2ZRGA 5JYDA 1CDZA 1K89A 2QL9A 4J9UE 2I6TA 4LJ7A 1RKQA 1I7LA 1GHTA 2AEEA 4OHVA 3LHDA 4L1KA 3EGWA 4RY8A 5CCXA 4FB5A 1U2RA 1UM9B 5K6TA 1PKEA 5B7PA 4YJHA 1KEEA 4K9KA 1OAOA 2HRBA 2O1XA 3C16C 4XQEA 3T8YA 3K4QA 3WLQA 3EZ2A 3PFWO 4JZYA 2FWMX 1UBLS 4ZZ1A 1MQSA 3Q8XB 3DJYA 2CSXA 2BR5A 2PA3A 4LF8B 3BCSA 2HR1A 5ILQA 2XBMA 3CVVA 1JI0A 5KWJA 1XJWA 2OTCA 4E33A 3BRWD 3I8XA 1SO8A 4R8VA 2ZE6A 4JBXA 1RFLA 1GDTA 2XA2A 4DIBA 1E6EA 3HTXA 4M1EA 1TVKA 4G8JA 1JIUA 3F71A 2ZRIA 3VJMA 3M8KA 1TECE 5JFTA 3HJRA 1TVMA 2NW6A 4XX1A 3GGGA 3SVTA 1UZUA 4M8SA 5H1YA 2PCLA 1CRZA 1DAFA 4FE7A 4EYOA 1KBZA 3LM8A 1WLSA 3GA0A 4N5MA 3DPSA 3ZHCA 2PMCA 4X1IB 4JS0A 3UWMA 2GT1A 5CDYA 1TEHA 4IFIA 2QD1A 3ROTA 1GZVA 2I2BA 2WZDA 4KJXA 1JHUA 1I5EA 3GA7A 2ZCVA 4D74A 4UUPA 4RGBA 4E51A 1XAJA 5LP1A 3OLWA 3W8NA 2V7TA 5JXHA 5FCDA 5AVXA 1B93A 4ZOBA 2R44A 1GQRA 2NTYC 3PQCA 4G9GA 4QTZA 4ZOCA 4JV5B 1OZ0A 1CV2A 4HC4A 1HOXA 1T5HX 3SLRA 6REQB 2X5XA 3U4IA 1EGQA 4PYLA 1ZK3A 4D4JA 3U44B 1AH2A 3VR4D 5DE3A 4LRQA 4M6WA 4MGHA 3LC7O 3IE2A 1LRKA 4ZAYA 3SAJA 4ZCMA 4XIJA 8AT1A 1YKGA 2TS1A 3PI7A 4IQ0A 3VQTA 1ZM2A 2WJAA 3G0DA 3KTAA 4KLCA 1X7ZB 2PUWA 2OAGA 5SV2A 4BO4A 1Q84A 1U3FA 3DE3X 3TS1A 2F8SA 5LYYA 3P9SA 2ODBA 2YHUA 2ODWA 2EYUA 4E6EA 5KOHB 2XMCA 5K8VA 1XD2A 1KETA 3KQLA 5JS7A 4G8BA 5FORA 3SF0A 2FMFA 1H0KA 1ECFA 2IODA 4R54A 4UAGA 2ICAA 2ZSUA 4UTPA 1E2JA 4W9MC 1HYQA 4I4CA 2IV7A 3U4CA 3JPYA 4LS3A 1T4CB 3EGXA 3A1EA 3I01A 1G5QA 3HSKA 3OO0A 3LQRA 5AKKA 5DDIP 3X2SA 5HBRA 4NU6A 4MPJA 3QOWA 1P9OA 1JIQA 1E5TA 2ZE7A 4QGHA 4C7KA 4W5QA 3MMPA 2O8BA 3K20A 2EEPA 3GRUA 1BX0A 1U2ZA 3MWDA 2X7XA 4HHEA 4QXOA 3FH0A 5JCJA 4GUDA 1QIIA 3H3XA 3ZI7A 2IY8A 1TJ5A 2EARA 1YSCA 2JI4A 4PBRA 1N2OA 5FP0A 1IWBB 3TK1A 5JEDA 4YT4A 1U31A 4F5WA 3VXKA 4PSUA 1WP4A 1F2TA 1LLUA 2FEAA 3ANSA 2FVXA 4HDRB 4K5QA 1CF2O 4QOHA 1T35A 5DSZA 1VFNA 3F4KA 5ILGA 1KFBB 4HUTA 2FPGA 2QXUA 1W96A 1VCNA 3FDZA 3B5IA 4RS3A 2V5AA 4J1TC 4KE6A 1FDSA 4LZLA 4TWJA 1NPDA 3WGYA 4YCLA 4F3CA 3MA0A 2VJPA 4DLSA 3P7MA 3HYTA 5AJZA 2I80A 3LBYA 3TTTA 5HYVA 1HDOA 1P0FA 3A4NA 2P9FA 1HQKA 4U00A 3WV5A 2I8CA 1DHTA 4IUCS 4JL5A 4KKXB 3P45A 1U0NA 3ESAA 1R4NB 1ILWA 2FVYA 2WFAA 5JCJD 3UOAB 3FNGA 2JG3A 1NC1A 1SBYA 1CUIA 4BX8A 1AHIA 3OA0A 4FJ1A 1HFEL 4KXUA 3ZPXA 4A1FA 5G1OA 4BX3A 1J33A 1M1NB 2AG1A 4E5NA 1VHTA 1LNSA 4U7TB 3ZH2A 4CMBA 1GRVA 3AL3A 4WY8A 4UNNA 3L6CA 5FF9A 1PDWA 1RQPA 3V9AA 2YXEA 4QUAA 2GPAA 3N86A 4LOKA 5ECDA 4TL8A 4HGQA 2VP9A 2EJTA 2QR5A 4GEKA 4OK5A 2MMGA 1P19A 1WZIA 2HAEA 3EUWA 4PG8A 1REQB 1YU9A 2NADA 4DC0A 3DDOA 5JMWA 1UBEA 2I4RA 1KYXA 3IP6A 5JBNA 2PZKA 3V00A 4AG5A 3PDJA 3AHCA 4FEEA 2XXAA 4IINA 4B32A 1G8KA 2JNWA 3SIXA 4OFZA 5CT9A 1F2DA 2WZCA 1GZ4A 3SN6A 5L3SA 2GXUA 2QE6A 2HGZA 2QTLA 3DQPA 4QEZA 3AFMA 3EXIA 4FE3A 4RJ2A 1JJAA 2HXSA 5IAEA 1MPTA 2W2NA 3T5PA 3HKCA 2CN1A 3RVLA 3ZVRA 2W6JD 2Y1LA 3SS7X 4GMGA 4LE1A 3LU1A 2ZSEA 3OQVA 1YZLA 4HAZA 2ENWA 2VAMA 4O4IB 1VOTA 3ESXA 4DLXA 4BQPA 5KX5A 4Y2PA 3E1GA 1MJGA 4KW7A 1C9DB 3QFSA 1L8AA 2P30A 2WU8A 3CEPB 2BEKA 3K53A 5E9WA 2IYZA 4EABA 5MFPA 2P9BA 3WNQA 1IXKA 3LX4A 3WP1B 5HUQA 1HT3A 3F6YA 4C0AC 3BMXA 4E5MA 1FLNA 1CUAA 2P77A 1I32A 2RI0A 4H3VA 4UDYX 2IU4A 3WGNA 3BFKA 2ZSDA 4EGFA 2A59A 4JC5A 2PX6A 2JLAA 3KQMA 2XH8A 2G1UA 1VLHA 3DAHA 2EG9A 2E1RA 2I67A 2RHOA 1F1JA 2QVGA 4F4HA 2XVAA 3E9NA 4PG6A 3TIIA 1H1DA 4NABA 3FOZA 1DWPA 2FJ0A 3B5JA 4A92A 7MDHA 3AF6A 1S2LA 3L3BA 1R0RE 1HMYA 3QKUA 1G6Q1 3N3AC 1U0JA 3H9BA 5EZ5A 4BEJA 4TV9B 4YS6A 2Z1NA 4DT1A 2OV8A 1EKXA 2HX1A 4FWBA 1H23A 2JFVA 3D1JA 4P98A 5NULA 1S3SA 2L82A 4UUOA 4E7OA 3SXUA 5EP2A 5JPDA 5FUYA 3T1YB 1M7HA 2XJ9A 2Q4DA 4EY3A 1NX9A 4UD6A 2E5LB 1RXCA 5LIRA 4G4SP 4G8DA 3FCOA 4RF3A 4BNZA 3IH5A 1NMSA 2R85A 4C07A 5KNBD 3U49A 1QNLA 3MLBA 1NXXA 2BRUC 4GR9A 1VL2A 2BEVA 2FFAA 4OEHA 1I4TD 4PPGA 1FTYA 3UWDA 3QBJA 4FMBB 2GCOA 2C2YA 2G17A 5KQLA 4OHPA 4X1IA 1V9SA 3VO2A 3GQBA 2JI9A 1M54A 1SG6A 4IIDA 5TPZA 1XVTA 3SR3A 3TZ6A 4BJ5A 2X2EA 1JTFA 4B79A 3BIOA 3G0IA 5F2EA 3UFXB 4ZT5A 2C57A 1KGSA 4EARA 1IBLB 1U2TA 2OAP1 4K88A 5EWMA 2CXOA 4A2PA 1WU8A 3KDSE 1BX3A 2HLPA 3LQ2A 4PCVA 3VX4A 1SZJG 2W6QA 2WSSA 3EQ6A 4JSYA 5HP4A 1NL3A 4PINA 3EFBA 3IOEA 2GA9A 4KQ9A 2ZIUB 1BE0A 3AG6A 4IXNA 4ZKEA 5A3JA 4CM4B 3OZXA 4M7PA 2YL2A 1YB4A 2H2IA 2MSLA 4IUBS 5BSGA 2EOAA 2KMLA 4LWQA 1Y6GA 2IX3A 2OG1A 4ZVLA 4AJIA 3QUCA 3O2QB 4KMRA 3VHXA 3ND6A 5H80A 4C0QC 1OVMA 5FO0A 1XE3A 5EEHA 3AVOA 1QH8A 1L5OA 1IH8A 1NVUQ 5DHSA 5B4TA 1JJBA 5ERXA 2BMJA 1VPTA 1OASA 4CMCA 4CXMA 3WQRA 3ZZUA 1BMFA 3OQIA 4Y2QA 4EO7A 4RTJA 3HEMA 3RFVA 2HDOA 3OHSX 4O8CA 3FPAA 2PAAA 4NZYA 3W3AA 2H51A 4MLPA 4LWZA 4OCZA 1KQOA 5EQTA 3VR5D 4XWKA 3RRZA 1KVTA 1OFIA 2VK4A 3RBVA 3SHVA 2WIKA 1YR2A 4V24A 1RAGA 2YDXA 5DM0A 1IBCA 4WK0B 2HSEA 1L0BA 3MWDB 1F0KA 1HC7A 2PGOA 2V3WA 3RFXA 3A14A 3HO1A 1THGA 2GETA 4Q3NA 4OP1A 5MDHA 4EQZA 5EIFA 1KZ6A 3UHJA 3L1JA 2WWTA 1QG0A 4JYPA 5H9VA 1JKJA 4YPOA 3RC3A 4S04A 3B89A 1BVHA 1XOIA 2H9YA 3IR7A 5FR2A 5ALVA 1B15A 5LMCA 1EIWA 4MYCA 4X1KB 3DMFA 1Y8RA 2G71A 4I8XA 5L4NA 2R48A 5IC4A 1NBME 1UPXA 2FP4B 3FDZB 4EUFA 2IPOA 1S2OA 1QWOA 5BQ3A 1L2TA 5CNIA 1E8NA 2X9GA 4EVQA 3DXFA 3KE8A 3UGTA 3OPYI 3CG4A 4MYHA 4Y6GB 1THMA 1RR6A 1U9JA 2R8BA 4R16A 5U1PA 3SSOA 1W7AA 3QHAA 3S0JA 1Z0DA 3BKWA 5CGQB 3ETLA 1GLVA 1U2SA 2D1YA 2Z58A 2RONA 1MDFA 3CUEF 3LBNA 4DV5B 4Y2HA 5IXYA 1SHUX 1T2AA 4QVKA 5ITVA 1NAHA 1DIRA 3OY2A 5HCUA 3L7DA 3AFGA 1AQNA 1BS2A 1C9MA 1VLVA 2YZNA 4EX6A 2NV6A 4MUHA 2XGGA 3BF8A 2IHVA 4EH1A 2WUVA 3PC7A 3KBOA 3BYZA 2OVFA 1KS2A 3AR3A 1GTL1 3EISA 3KYJB 4JITA 4A8HA 2FMXA 2CDBA 2BFPA 2OESA 2VSOA 2EF1A 1ISIA 2W83A 4HRVA 4DN6A 3NIGB 2FW0A 2ANBA 2BMFA 2E9SA 2BGTA 4IV5A 1QKIA 3K0FB 4U7WA 1ILEA 5FA5A 4FSHA 1EX7A 2HQ1A 4JCOA 4P82A 1LB1B 2Q0XA 3PGKA 4Z0TA 1D6SA 2P75A 1AMNA 2HBQA 3E3OA 4CMEA 2WT9A 3HP1A 3QKWA 2BCGY 1BIFA 4BFVA 4YTEA 5T67A 2BTQA 4GX2A 2EKPA 2JARA 1A9XA 3LVFO 1VL6A 4MV1A 3WSVA 4ZIRA 2YV4A 3AHIA 5FLKA 3GLUA 2H4XA 4YMWA 5JZ9A 1NUAA 2GEBA 1ZY2A 2D5AA 3BE8A 3SNHA 4BO2A 5KREA 4DCOA 1FP1D 1RWVA 3LX6A 3JASB 1WG8A 2HPVA 3PUZA 3EHEA 4Y1EA 4ADSG 1QVZA 1XZMA 3QPCA 1X8KA 4H7HA 1BDJA 4JC4A 4KXNA 1HT1E 1WVMA 3LUHA 2EFJA 3PQ5A 2VDOB 4PIMA 4UAUA 3DO6A 1QMPA 2DFKB 4BDSA 3ZUPA 1N25A 3EQ9A 3UYKA 4DQXA 1J97A 4QARA 3BD6A 3G9UA 1XHEA 2FR8A 2NXNA 2XF2A 3VNRA 5FAKA 1QGED 3IJ5A 6NULA 5IJ9A 1HZZA 2A0KA 3HJNA 4G6ZA 4F7DA 4KMSA 1U99A 2C8JA 3VVBA 2J3IA 1KF0A 4GOOD 7GPBA 1T3GA 1E2DA 3MRVA 4YJKA 1F17A 4RMIA 4HLCA 4K9RA 1YI8A 2ZPTX 4BP3A 2XOKA 1LV7A 4E5VA 3KPVA 1N4AA 4KOAA 1T9GR 2HB6A 4FMCF 5JZVA 1XMXA 1K8ZB 3R40A 2VP4A 3AWDA 4KQ1A 4YASA 2XZLA 3C7CB 1ULTA 1NX6A 3Q7EA 4FYXA 3UA4A 2WTAA 1WW2A 3E9DA 2VHWA 4ZJYA 5FDFA 2I6FA 3A9CA 1T34A 2JGDB 3G9ZA 3ON5A 2XZPA 4U2DA 5K51A 5TNXA 5TR9A 1T9CA 1ZXBA 4GU5A 1NVTA 4BN4A 4CEJB 1XK7A 4RL4A 4XCQA 1KO5A 4Y1FA 3TG2A 4RHTA 2PRIA 1H66A 3AHGA 2BGLA 3NWBA 2WWGA 1VIDA 2Q8NA 1US8A 1YS1X 4FT2A 3LDUA 1QYDA 1D2GA 5CCBA 1ZD8A 1M2VB 3QQ5A 1X2BA 2L17A 4R2MA 5FH9A 4ZTBA 1OX4A 4I4NA 5HJ7A 3IDAA 1KERA 4XX0B 3T3GA 3QPUA 3GJTA 4W99A 5FQNA 3HJTA 2FGJA 1R12A 3QX3A 2C99A 2IPNA 2XODA 1XNJA 1RP7A 4PCUA 3LW7A 4A8JA 2XOXA 2VA9A 4ILEA 2EAUA 3G59A 4MAFA 4PSAA 5DASA 3S55A 4BC0A 3UVEA 3GAZA 3LF1A 4BIIA 2R25B 3CUKA 4G1EB 4N5DA 4EHAA 5JAZA 3WY9A 3DVRX 3RFFA 1Y37A 3EH1A 2I03A 3U19A 4RSHA 4MKZA 3RGGA 3D8SA 2BGIA 4IZ6A 1PK7A 1Z4LA 2HK6A 2EJUA 3GP5A 2IL1A 4FGLA 4J3FA 1Z82A 1PSZA 2PEYA 2ZVDA 3D6TB 5ICCA 3PJEA 3NWEA 1P8AA 1X9HA 5JAIA 3RHFA 4B48A 4EDFA 5C53B 1XQXA 2X9NA 4X3CA 4XH9B 3FFBA 3FTCA 3KLPX 4BU0A 3PUXA 1UMCA 2FQ1A 1KR5A 2IE8A 2WLSA 3LMKA 4J07A 1YJQA 2CFTA 3HN2A 4TMFA 5K99A 1OLSA 2CXRA 3OZEA 2HU5A 4TSRA 4FD3A 2CZCA 3GHHA 5EP3A 4FFRA 1N3LA 1Z88A 3FNRA 4N18A 2UXCB 2QVCA 4I19A 1BHSA 4GEGA 3GGCA 2Q6LA 3WHLA 1H8EA 4KDFA 4ZO9A 3P71T 2AXNA 4DNQA 4PYRA 1K5DA 5F9MA 5BRNA 1CJMA 3EW9A 4D3XA 4DIKA 4LY6A 1HFJA 1NVFA 1DT3A 2FPPB 2AC2A 2DQ4A 2C07A 3K9FC 1FTGA 3T5BA 1VKRA 2Z4TA 3HCCA 2QY9A 1PG5A 4I55F 3RE1A 1ISPA 1I9GA 2LGJA 3EUEA 4X85A 4K86A 2GBFA 1YS7A 3IT2A 5JSYA 2I2WA 5F3DA 4CL8A 1O6ZA 4F56A 4OFXA 2V7GA 1U9YA 1YJXA 2P4UA 3NWOA 2JAOA 1QV7A 1YQTA 1N8KA 5CUQA 2Y71A 4MKFA 4OXNA 3VTAA 5BN1A 5PGMA 2WKWA 3TZKA 3CHYA 3D64A 1JFTA 3ONWA 5E6SB 3M7IA 1P9NA 4ML3A 3WWOA 1IIRA 3ILSA 2B1JA 2ZTUA 1TK3A 1E2EA 3OJ0A 3QXXA 4MQ4A 5E6UB 4QKQA 4RMNA 2AN4A 2JIOA 2O59A 2MDTA 3MJRA 4I5GA 1EXMA 1GPJA 2GBGA 5IZCC 4HVTA 5ALKA 1N1DA 5C51B 1P5FA 4GMKA 3CMMA 2R8RA 3NXKA 5E6SA 5FPQA 4BRZA 2D0DA 2OYSA 2DWQA 2ATEA 4I9UA 2K2QB 4HTFB 5EKTA 3IHWA 5AM4A 5I4IA 3QE3A 2GPNA 5A4DA 2QLMA 1KU0A 2ZGVA 3JQRA 3KPUA 5FL3A 1Q17A 4LVUA 4CKEB 4HLQB 1RCUA 4MYDA 5FLXA 2FZGA 1AS3A 1KO4A 2OHJA 1I4EB 5FOVA 3D4OA 3LQFA 4ALLA 3ELYA 1A8UA 3RT9A 1C81A 4ZQFA 4AJEA 3QKRA 2X3YA 1P2UA 4ND5A 5JNVA 5FWAA 1I4WA 3VH2A 4M7RA 5DM60 4JVLA 3U48A 3EXAA 1FU7A 3TQCA 1XQ6A 4FZJA 1DAHA 1MB4A 4RQBA 4BVEA 3IKMB 4CMIB 5C8YF 4KU4A 5BMVA 4K8RB 5JADA 3NH9A 4QUJA 4KV9A 2FW9A 1YNSA 1OBHA 3FETA 3DKKA 4KKVA 1QV9A 4P33A 1SQGA 3ZOKA 1QFYA 2R79A 3EEIA 3AOEA 5CM9C 3M6VA 3L05A 4ZRDA 5F7OA 2O50A 4BC1A 4D9BA 3K70C 2QG4A 1ABFA 2GK3A 5EL0A 4C0WA 3WOHA 3L4KA 3D7LA 2BMWA 5B1HA 3LT1A 4H4EA 1VZ2A 1V37A 1ES9A 3E2MA 2BGWA 4BTEA 2Y1KA 3E9MA 4MVJD 2I9KA 3CZMA 5G53C 4B43A 4MUFA 3TOCA 1YAHA 1OZGA 3G7NA 5IBQA 1PI3A 2AWNA 3RJMA 1NWCA 1RBYA 4AKHA 2E4UA 1ZD3A 1HZZC 1Z7EA 4HTAA 5JAUA 2W2VA 3TKLA 1D0IA 4DADA 1JZSA 3NUQA 3P9NA 5BPHA 4FZ5A 2OSBA 1B43A 4UQOA 1G3IA 4QYMA 2BW0A 4FQ8A 3ZU6A 3HBLA 2H08A 2QVXX 2CXNA 3JQDA 3S3TA 3UENA 3QOFA 3OTWA 4PV7A 2ZPAA 3VISA 1VPDA 5CJPA 4RGYA 2G80A 2RHTA 5CBPB 3NQ41 2FAXA 4BAGA 4WLOA 1PQ4A 4WZAE 1UWKA 2ZSJA 4KWEA 5T4FA 5IYZA 2OWDA 4CM8A 3U1BA 3U0BA 3LUPA 2GAIA 4QFMA 4QLOA 4NF2A 5DSTA 3MTQA 5ERYA 2Q6IA 2CNOA 2PIDA 3O7WA 2QXYA 3V4OA 4RTPA 2X1MA 4F8EA 4CT5A 4ARBA 4N9WA 2RE8A 1U2DC 5LZ4A 2H06A 3OIWA 1ZH4A 5KHAA 4B4DA 4EI9A 2WYHA 4W82A 1YR7A 4CU2A 3K0EA 5KOYA 4JP1A 4QYXA 2NOAA 4NBWA 4HXFB 2EZ8A 3HXLA 1NLUA 4C01A 1QO0D 2A0WA 4KLNA 4BECA 4RA6A 3TIXB 4ZYXA 1AKEA 5B36A 2WNHA 3CEMA 4EFNA 4JIGA 5IUKC 5J40A 1JWLA 4ZAVA 3H4MA 2F1HA 2WFLB 2ERYA 4GWKA 1D07A 1X74A 1UH5A 3MB5A 4RPKA 4BFZA 2PK3A 4DBVO 4DEVA 3SQWA 1XXLA 4V38A 5JXGA 1TRHA 3Q9SA 3ZTTA 1BXRB 1JLLA 3TOXA 5JQGB 1FFXB 2WZQA 2O8EB 3JVDA 4DYVA 2ZI6A 2RARA 4O5AA 5I7HA 1HDGO 3NAZA 3P4UA 4NK4A 5ARBA 4NDNE 4FEAA 5ALZA 3SKYA 2DWUA 1CUUA 4ZAXA 3SHTA 1B0UA 3L6UA 2JLBA 3STHA 4UAVA 3ZIDA 3JQEA 4RFVA 3CKMA 1MX9A 1IMOA 3DEYX 4BOYA 3FKSA 5D51S 2QTTA 4TTIA 3M3PA 1PJZA 2WT4A 5JC1A 5TDHA 3L46A 4D0NA 4IEIA 2FFJA 4J7UA 4ER6A 4O2AF 2OORC 1ZN2A 4NTZA 2Q9BA 2A9VA 1Y4SA 3DFIA 1MW8X 2HK7A 1QCCA 2WABA 2WD7B 3CZRA 3ZX4A 3F96A 4DZTA 3E35A 5ABPA 3LHIA 1JEJA 2QGZA 2XNDD 3AEKB 3L1VA 1XTRA 3P0JA 4CLHA 3DE6X 2CNDA 1REQA 4ZVTA 2CLCX 5K0EA 4PGAA 2AG0A 1W4BA 3L5OA 4PO9A 2BLNA 2IYXA 5CHYA 2A67A 3T41A 1MX1A 5F52A 1Y4DE 3HXMA 1SUSA 2DXIA 4MJXA 4JX8A 3U1VA 3SJZA 1KNQA 4RE5A 2RK3A 1M5RA 1UZAA 1NZJA 5ICEA 1NJ1A 1TEVA 4GM4A 1GEGA 4M89A 1JEYB 1RU3A 4CIVA 5IZ4A 1IBKB 3VYUB 5AVYA 3PJFA 3KKPA 1GRCA 1RWNA 4KR0A 4CEHB 4EF4A 4TKVA 3A9SA 3CLRD 4WXRA 3EGEA 2XMRA 1ORRA 4D41A 2CBGA 3A3KA 5B3KA 4TOIA 4YJFA 3M9LA 1E3EA 4ECAA 4D99A 1MA3A 3WK6A 2QTNA 4H17A 3ZWYA 2J3EA 4PQGA 1X70A 4FGUA 1RYEA 4JYBA 4LTNA 3HCWA 3GLIE 1P7WA 1L7MA 4ZVMA 3LYUA 1A9RA 4DQVA 1R27A 1Z37A 2HDNB 1EDBA 3TZEA 1Z63A 1CULC 1FA9A 5TV2A 1T43A 1I9CA 2R4UA 4ZT3A 1A4RA 3IUSA 4BQFA 1YI0A 1MU0A 4EIWA 4D56A 3TCXB 4DDTA 1ZD5A 2QGFA 4BNYA 4KP7A 4WKOA 1P7ZA 4L16A 4N0EA 1J56A 1RD4A 2F3RA 3W4KA 4DT1B 4AWAA 5TLSA 5I9MA 4F86A 3FNEA 2G7ZA 1NR5A 3N3BC 3UHFA 1U6IA 5DGXA 5B30A 4RACA 3PIDA 1PJ3A 4OSPA 4B6PA 4MWDA 1I2ZA 1K3FA 2UVPA 3C5CA 3IX7A 1QB8A 4HJXA 3UWOA 2GJAA 3CT6A 4NBLA 3MTEA 1S9HA 4H4CA 2QL7A 1WVGA 2FNAA 4QWWA 1HNNA 2PG3A 1LK0A 4FN4A 3AJEA 3OT4A 5DX8A 2QTWB 5EJ7A 2GEUA 1XYYA 2A92A 2EJCA 2IYRA 1TM3E 3AF1A 3BJMA 3DMTC 3P94A 5E0OA 5HGXA 3WQBA 3H84A 1T8WA 3FAZA 1ZHHA 3I2HA 1NU8A 2OFOA 2SKEA 3HEAA 4BMDA 5EP4A 1MQ9A 3LGSA 3UJ9A 1CQXA 2ZRCA 1AMUA 1TADA 2Z3WA 3PICA 1UJBA 2AKEA 4UUMA 3LVBA 4WBNA 2I7DA 3S27A 4K0KB 4BFYA 2ZSFA 1CJVC 2AUNA 2H6EA 2W2OA 4PZDA 3YASA 5J23A 1K75A 1E1CB 4RBNA 3SK0A 1KSFX 1W1WA 3OU2A 1P33A 5FBLB 4YCBA 3SQMA 5B6PA 1PJSA 2VPXA 4UU1A 3ADPA 3JVIA 4PYNA 1YK0A 3MTDA 4FC6A 4Q4DA 4MV3A 1ZK2A 3B51X 1IN6A 3FNQA 5JD5A 1C8BA 4NCKA 1LPNA 1WPGA 4OGKA 4UCFA 2OCDA 3ZDRA 4ZHQA 2J5RA 4C3ZA 1E6KA 1GZHB 1VMAA 3FI9A 4CCAA 1LKZA 2HA0A 1UWVA 4DJTA 1I4OA 2CYAA 4O29A 2Y1OA 4JLDA 5CLLA 4F5DA 5LMNB 1T9BA 3OJXA 2ZVQX 1Z6QA 1TC2A 1UFOA 1XCPA 1UKCA 3B60A 1N5KA 4OYHA 2HU2A 1U2PA 4ZRMA 2WIBA 3WLJA 1Y4AE 2H63A 5A5GA 3C45A 5ALUA 4L78A 3WNDA 1HYHA 1E9RA 2ZWOA 4ZDKA 4MINA 3MRXA 1Z17A 4X8OA 4FK8A 1QZ3A 3MT8A 3KAPA 3G49A 1M2HA 1JDVA 3RTGA 1QF7A 4TMVA 3HU2A 3DAGA 1VYHA 3DONA 4MVJM 5AJUA 4YAFA 1U7PA 3EQ2A 3NHAA 1XU9A 3QG1A 1GG9A 3WWEA 1Q44A 1OILA 2QL5A 3WKEA 4HNSA 1EI9A 1A9SA 3IUEA 3C3XA 4TXJA 1WCIA 1H2XA 2R751 3EX7C 1AURA 3NBUA 3R7WB 4EG4A 5EC8A 3B78A 1U6KA 4EMUA 2IHYA 2AJDA 5AVSA 1KGDA 2Y1GA 4QUHA 3N1UA 3PHBE 4V0MA 1JHXA 3BFVA 3RVRA 2EZTA 1B76A 2G9QA 3T3IA 2Q9CA 4C14A 5HVNA 2GN4A 1NXQA 3M6FA 1BU5A 1ZSVA 5EMKA 2Z57A 1TJYA 2JDIA 3P4XA 4OAPA 4BX0A 4F93B 5EJ9A 3DEHA 3OLXA 3QM1A 1K8YB 1FTNA 2V6IA 3OZBA 2AS0A 3TKYA 1S5PA 4RTOA 2W2PA 3HNRA 3EWIA 5JAPA 5F23A 1P0QA 2FUCA 4LX8A 5FJIA 1LJLA 2XA1A 1YZHA 2BKXA 2H5LA 1G2OA 2L18A 2PL3A 4S1WA 4R6XA 2W2LD 2AQHA 3X1YA 2ZCJA 1IOVA 2PPLA 3JQBA 4UFPA 2E37A 3FUXA 1JYSA 4LSGA 2AT1A 4D42A 2ZUEA 2J5XA 4KQFA 1PNRA 3UAXA 3BJZA 3IO5A 4IJWA 2O2HA 1QRTA 1E4OA 1Q1EA 2D1SA 2IP2A 3EG5A 5G1NA 3G9TA 3WVNA 4X94A 3ROQA 2B78A 3DL7A 3FSGD 1NZDA 1U0RA 2P2DA 2V7QD 4OK3A 2A1IA 2AVNA 2IRWA 3NC0C 4NU0A 4KAFA 2JGAA 1WVIA 1X3SA 4M9QA 4G4SO 3PLRA 4P7GA 5LC1A 1BE8A 5KQRA 2CKDA 3MBOA 2BWJA 3FG9A 4FYIA 4U39A 5EHZA 3IEXA 1KYTA 3EF1A 3O1IC 3P4YA 4GLOA 4Q47A 3MWLA 4G5YA 4QD3A 5FWXB 4GZ5A 8ATCA 3FWHA 1GYPA 2XT6A 3IDQA 3OE5A 4LUCA 4RK6A 1T5LA 2IGTA 2RH9B 4EA7A 2PD3A 1DTWA 1O7JA 3ZHTA 4F96A 5IAOA 1JDTA 1UXKA 1ZBDA 2ZTSA 3AQ4A 5TX7A 1L7PA 2PLAA 4JWTA 3AIMA 3VM6A 2Y3IA 3ZY6A 2RGUA 4D8VA 5JBIA 5ALXA 2XXJA 4H2DA 1DLJA 3Q10A 5KUTA 1R6XA 1R4MA 3IXMA 3LUAA 3PNMA 4Q4JB 1D2EA 4UU8A 4Q4LA 4O02B 3R7FA 1ZI9A 1O5IA 4RX1A 3UWKA 3QLUC 4NKRA 1UJ5A 4XEUA 1E3JA 4EA9A 1EFKA 4Q48A 1T5DX 5DBIA 3QWFA 3KSDO 2I4IA 3MIIA 3AJ9A 1ATIA 4PXYA 1N5MA 2C4WA 2HV9A 3MF4A 4QGFA 1C3VA 4JCCA 4NV3A 3RK0A 3V4LA 1X1DA 4R2WA 2PMKA 4LZJA 1QANA 2YZ2A 4GWGA 3AONB 4M37A 4YJ3A 4BEBA 5B2EA 1OXVA 3HXQA 2QDXA 2WWYA 1Z06A 2ST1A 3K05A 1ZU5A 1JEDA 2OC9A 3NHPA 3S2SA 4PYOA 2WLTA 2REQB 2YIJA 4CIAA 2VAWA 4TV9A 4LNUB 5I4BA 2QEQA 4M55A 4DLWA 3MPUA 1NYTA 4ZARA 2I33A 3E22A 3ANXA 4L5AA 4N7RA 2Q0QA 3L79A 1Z35A 5HE8A 4O0LA 4HADA 4D9IA 4C78A 2FF7A 1TYDE 1U02A 3RVDA 1S4MA 4US1R 1T8SA 4RD3A 3X3HA 3PEYA 2ZRHA 3JZDA 3QVMA 1JRLA 1ML4A 1X77A 1E9FA 1I5OA 3T9BA 2GZRA 4PHGA 2X22A 1R74A 2O2XA 2J0EA 1PFKA 4CDMA 1R66A 2DUUA 3GUUA 4EMBA 1YFJA 2C1ZA 3DT8A 1YACA 1GZSA 5DCUA 2G36A 2KLHA 4GRIA 1DI0A 1CUVA 2PZFA 2ZBVA 1KARA 2X77A 1C8KA 3ETNA 3LP8A 4P3PA 4YN3A 1EXNA 2BTEA 3R7DA 1GSHA 4JBLA 4G81A 3HADA 3GFGA 1UDBA 3B1FA 3WRXA 3PSAA 4A8JB 3DEKA 3I04A 3RCBA 4RKWA 3HP4A 3DFMA 3JD1A 4JD5A 3C3JA 3I9V1 3RF7A 1GSAA 1QIDA 2ZEJA 4GPZA 4KV7A 3FRIA 1U4SA 2VCHA 1NIJA 4BBPA 5KTRA 1KDTA 3VR0A 2B1IA 9ABPA 3DP7A 3EIFA 2KQUA 3L9WA 2GEVA 1TZMA 4N3CA 4CG3A 4ZICA 5EJGA 3PHJA 3DVLA 2V98A 2WQ7A 2J6BA 4JI3B 3NEYA 4DWJA 3II6X 3U40A 1BXZA 2IXFA 4R98A 3WQSB 4Z99A 4RENA 2QMZA 5AM3A 2O07A 2WAXA 4I1YA 1LZKA 3GGSA 4LKOA 1QYVA 4CV2A 3C4QA 1B23P 4F5YA 2JI7A 3BQNB 4KR2A 3UT0A 1E4YA 2O48X 3M1YA 1SHZA 3RG8A 1AK9A 4MV4A 1HNXB 5FFNA 2IH5A 4ND2A 1W9HA 3KQUA 2JIPA 2FPKA 3FMGA 2ZYGA 4JA2A 4JB0A 5KYNA 1GYRA 1I5RA 1H2YA 1M5UA 1SWWA 5CIWA 3TM5A 4Q7EA 5CDTA 5JH7F 5LQUA 3UMSA 2XAAA 2BDEA 5ENVA 1QQ5A 1U8FO 4NZ9A 2PFGA 4MRSA 4MLZA 2G5GX 2NSLA 4MV7A 4ONEA 5IKMA 1PHPA 3T7EA 2JGKA 2Q6TA 2OMEA 2VBFA 3KQSA 3GEPA 4ZP1A 4OTZA 5I3CA 4I81A 3KOWA 2DERA 4QOGA 3BILA 5J9FA 1X13A 2YYAA 4ID3A 5CT4A 2AFIA 2FLVA 3P5BA 1CY8A 2V45A 2B99A 4KDCA 4XFJA 5HZHA 1Z36A 1LBHA 1NPYA 1Q92A 4KQEA 4MRMB 2OZPA 1TKAA 1K6JA 2ZW9A 3EXFB 4Q1CA 3QVXA 3I1FA 4WFQA 5C8VA 2XCIA 3MJEA 2G76A 1Z38A 1EA5A 1CQZA 1CK4A 1C3JA 3TJRA 1DKNA 4OL0A 3M5DA 2XDYA 5E2IA 3NU1A 4ND1A 2W48A 4BQQA 2ETXA 4URWR 2A57A 4I8DA 2C58A 4RY0A 1GARA 3CA8A 4NSNA 4PQFA 2PMWB 3W05A 5J4YA 3T5TA 5CYPA 2ZYTX 1QM5A 3BGWA 4JLVA 4OI0A 3I5AA 3L7KA 1PK9A 2XF8A 1QQBA 2O4CA 2V6FA 4AS2A 3L4JA 4RDHA 3TB6A 1UZMA 1P60A 1ZINA 1EBFA 4DA6A 1QPGA 4P7BA 5JR3A 1ZUNB 4DG5A 1GUZA 1LCIA 1RQXA 2YYYA 5EXDA 5F21A 2WM8A 3E9CA 1NLZA 4ZDJA 2ZBGA 1X7WB 4TTPA 4N0MA 5C4GB 3FSJX 1G41A 2EJBA 1E3QA 2VSYA 1N0VC 1BOOA 3FUVA 4XYMA 3V7NA 3ZLVA 2RGRA 2XCRB 4BVFA 4OGGA 1KK0A 1QONA 3OEYA 3K0CA 4FQ5A 1XZEA 1FQOA 2CNLA 1GU0A 5FPPA 2EGUA 2ODTX 3RH0A 3TR5A 1I4DD 2C88A 2GERA 2XUKA 2ZI7A 1UINA 2A5DA 4MIEA 2QDKA 2WWRA 3CSSA 4B4KA 1GFZA 2VCYA 2PNFA 3K2BA 4C29A 1RKVA 3PEVA 4B6OA 1KP9A 3CH5A 3HJFA 4DIDA 2PBFA 4OREX 1IB6A 1ZEMA 3V97A 5CLFA 3CNNA 3CR3C 4WCFA 5HOEA 2GDJA 3LRTA 4MPTA 4MHOA 5LQAA 4RVFA 5BR4A 1QG2A 4BUCA 5BUZA 1H0HA 3G2JA 4M9CA 3C15C 4CPDA 4D7AA 2LRHA 4W7HA 1FZTA 2ZDGA 4WIAA 3LP5A 1J6UA 3FBTA 4MV0A 5G0TA 2IH2A 3UMGA 3GJ6A 2CMDA 1FPQA 3BGIA 1F51E 4N6OA 3QUBA 4TYPA 2HQBA 3PLNA 5DTQA 2EFCB 4RQTA 4D82A 2QMOA 2VA8A 3ETHA 1YDHA 3TTWA 4A36A 2YUIA 1PFYA 1IG3A 1Z47A 3WHIA 3I6YA 1XKLA 3OIDA 5FPYA 3ZTWA 5IF3A 1RXVA 1VE5A 4M0LA 2ZU6A 4DGQA 2LVBA 3IB3A 4Z6KA 1E18A 2AJCA 2QN9A 4AZTA 1VL5A 3SKXA 3OQJA 5GVRA 4TROA 3RS7A 4C4AA 4YROA 3TBFA 2VYNA 3GGJA 4KN8A 1KEPA 2P6PA 3N0WA 1XRQA 5BR8B 5MN4A 2QTZA 3JALB 4LDAA 2IZZA 1E94E 1KWGA 3PR2B 2O2SA 5G4KB 1X80A 4P5PA 3ZV6A 2P90A 1XJ0A 4G23A 4GOND 2W43A 2Z83A 4V1CA 1RSZA 1EAYA 3N6XA 1LPBB 4KXXA 1MGOA 1OGIA 1SD1A 1XCJA 2AA3A 3HJCA 3K1TA 5IU6A 4QZVA 3E22B 4IJ5A 5KVSA 5TPWA 5KQMA 2CLLB 2PXXA 2PDAA 3HB1A 3HNOA 2B1QA 3QWBA 5AW8A 2NWQA 4QUBA 4TUYB 3HS3A 4BV3A 3HZOA 2EDAA 1H3FA 1NBOA 3LVRE 4QSMA 3EGDA 5BUCA 2FRXA 1J06A 3HCAA 1SIBE 1MNAA 1V6CA 5C34B 4GMDA 3TLAA 4MVYA 3K71B 1UBMS 1MD9A 3A6EA 3KHUA 3ZWCA 4IQ4A 2FMIA 2BM9A 1CY0A 2KWIA 1ECLA 2X7HA 2I7XA 4HDQB 1IULA 2H1RA 1Y1PA 4HMOA 1B7GO 2R68A 2WFLA 5ALNA 5A3SA