1N9ZA

Integrin alpha m i domain mutant
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
184
structure length
184
Chain Sequence
CSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQLKKSKTLFSLMQYSEEFRIHFTFKEFQNNPNPRSLVKPITQLLGRTHTATGIRKVVRELFNITNGARKNAFKILVVITDGEKFGDPLGYEDVIPEADREGVIRYVIGVGDAFRSEKSRQELNTIASKPPRDHVFQVNNFEALKTIQNQLREC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Integrin alpha-M
publication title Engineered allosteric mutants of the integrin alphaMbeta2 I domain: structural and functional studies
pubmed doi rcsb
source organism Homo sapiens
total genus 65
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2002-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 1n9zA00
1RRKA 4F1JA 1MQ8B 3RAGA 1SQ0A 3M6FA 4MMYB 4Z7OB 3EH1A 4PN7A 2NVOA 1M2OA 1IDN1 1MHPA 3EGDA 4NENB 2B2XA 4HQKA 5BV8A 2VDPB 2WINI 5KYXB 3HXOA 1T0PA 1FNSA 3TW0A 4MMZB 1AUQA 5KYUA 3T3MB 2VDRB 4FX5A 2O7NA 1PD0A 3PPWA 3QA3E 3HI6A 4C2BA 1CQPA 2VDQB 3EGXA 3GXBA 3NIGB 1IDOA 1MF7A 1ZOPA 3EGXB 3PPXA 2NUTA 4C2AA 5ES4B 1MQ9A 2IUEA 1JEQA 3Q3GE 1JEQB 5HGJA 2VDMB 4UM9D 4O02B 4Z7QB 3PPVA 3ZDZB 3FCSB 3EOBI 1M2VB 4CN9A 5HDBB 1FE8A 1U8CB 1U0NA 1IJKA 3BQNB 3VI4B 1JLMA 4NENA 4XW2A 1AO3A 3F78A 4BJ3A 5KYXA 4Z7NB 1PT6A 2VDLB 1AOXA 2XGGA 1CK4A 4JDUA 1BHQ1 4NEHB 4WFQA 1YVPA 2I6SA 3IJEB 1DGQA 1MQAA 1ZOOA 1RTKA 3ZE0B 3V4VB 5KYYB 4HQFA 3BN3A 3EG9A 2QTVA 3EG9B 1MJNA 4WK0B 2VDNB 5LN1A 3NIDB 1TYEB 3IBSA 4IHKA 1XDDA 1UEXC 1ATZA 1QC5A 2VDKB 1M2VA 3ZDYB 1QC5B 2X5NA 1N9ZA 2XWJI 3E2MA 4WK4B 1BHO1 1M10A 3TVYA 2M32A 3ZQKA 4DMUB 3K72B 3ZDXB 2NUPA 2VDOB 2NUPB 5KYNA 5E6UA 5E6SB 1T6BY 4G1EB 5E6UB 3T3PB 2ADFA 2ICAA 4MMXB 4WK2B 1RD4A 3BQMB 1JV2B 3K6SB 5KYWA 3VI3B 1QCYA 1PD1A 1Q0PA 2ODPA 2ODQA 3EH2A 5KYWB 1V7PC 2WW8A 1M1XB 1OAKA 5KYYA 3F74A 1YVRA 1SHTX 2XWBF 1JEYA 1RS0A 3V4PB 1JEYB 3K71B 3EOAI 3ZE2B 1IJBA 3N2NA 1U0OC 4WJKB 1PCXA 3PPYA 5HJ2A 1N3YA 1M1UA 4F1KA 4HQNA 3EGDB 5E6RA 3TCXB 1SHUX 3TXAA 2VC2B 3NIFB 1DZIA 4A0QA 4UM8B 4M76B 5E6RB 1XDGA 2I91A 3ZE1B 4CNBA 2I6QA 4IXDA 4G1MB 5KYUB 4IGIA 3K6SA 3HXQA 1ZONA 4HQOA 4UM9B 3EFOA 3EFOB 4C29A 2NUTB 3FCUB 1L5GB 1NA5A 1XUOA 4CN8A 1LFAA 5E6SA 4HQLA
chains in the Genus database with same CATH superfamily
2P8SA 1AK1A 1I33A 3W78A 1VRVA 3WV4A 4RTKA 1EGAA 1FNNA 2AC2A 2IYLD 3IELA 3SJAA 1M6NA 1DJMA 2F17A 1ZMTA 1I1HA 3BREA 3C6QA 2P2DA 2QSZA 2PQMA 3CCFA 3I73A 3QP9A 2ZI6A 1V37A 3BGOS 3TECE 3T8YA 1PI3A 2OXIA 4KFRA 3UANA 1N2CA 4EBBA 2IS6A 2A9PA 4ZAFA 3DLBA 3PZRA 1EFUA 3AEKB 4CL8A 2KE5A 1GN8A 5DVZA 3TTYA 2PUVA 4M3NA 3WRXC 1CDDA 4HEA1 1YB2A 1CJTC 3F5QA 4BVBA 5L3VA 1RBMA 2CLIB 3G5TA 2W22A 1O94C 3KR1A 4EECA 3ILVA 1NSYA 4DIMA 2AYYA 3FPEA 3KWMA 1FU8A 1T3LA 1T9KA 3LIPA 4IIFA 3FKSD 4RVNA 3I30X 1FXWF 3R0XA 2AJLI 4URVR 4JR2A 2DBRA 3JSXA 4FJ2A 3QENA 1B6SA 5JANA 1VZ2A 3JW8A 3HCEA 1AO3A 1CZRA 1RBZA 4RIGA 3JQAA 1O6BA 4ZGGA 1TUBA 3RTBA 4F6RB 3K09A 3GMIA 1YAHA 2JHAA 4BFSA 1OFIA 4C4XA 5C7OO 3DDCA 1L5YA 1M74A 5DWVA 2D7JA 4TV8A 3JYPA 3QSYA 5IDWA 3RTDA 1D1SA 2DSTA 4QUHA 2GHTA 5ESXA 3SKVA 5C7YA 3FHJA 5FPTA 4N40A 3RLFA 3YASA 2WILA 5F4ZA 3ABSB 2Q9CA 2ZUDA 2H1LA 2B92A 3UTDA 2XMGA 3KLNA 1P7VA 3QEMA 4U7GA 1JXOA 2ZIUB 5DI3A 4WXEA 3GRCA 4OHUA 1VTKA 2H4XA 4P34A 2B1GA 4GOND 1TO6A 1R0BA 3U26A 3K70D 4XUGB 2OXFA 3K35A 4PRZA 1UEJA 3OCVA 4OBXA 3RTAA 2AW3A 3CW8X 3D81A 1SD2A 3LCUA 1MOSA 2GNOA 4U7FA 5BWNA 1R5JA 4F5ZA 2OPBA 3DMDA 3CPSA 5GVRA 1Q11A 4ZFNA 1KI2A 3PFBA 4YV0A 1Q0ZA 1IAVA 2JFQA 3FKQA 1JVNA 3KEQA 4R0VA 5JXJA 1ISJA 4LHXA 3J80A 1S2OA 4C5AA 2GUGA 1FS4A 2Q1UA 3CUWA 2CDRA 1NVKA 2MWMA 3CURA 4URHA 1YC5A 2BBWA 3PKIA 3H5IA 4A6XA 2XCSB 1L5SA 4Z54A 3O3OB 5GZ3A 3FPKA 1BH2A 4M83A 2WPDA 1WSDA 1AKUA 1J33A 2F1OA 4R8LA 3R4VA 2W2LA 4AJOA 3GMTA 3G2MA 4MS1B 5FCDA 3WGUA 2P4SA 1EK1A 2V58A 3OOEA 3H4VA 5DM2A 1GY8A 5ES3A 3NEAA 4BLSA 3CNNA 3L8CA 3LHFA 3SQXA 4NU8X 4EFNA 4OG2A 2FPUA 4WCFB 1PT8A 5AW9A 3I58A 2PRYA 2QTGA 1QYVA 4RTOA 1Y4ZA 1F1BA 4DBVO 1UF9A 2C8LA 4RHTA 4FW9A 3I32A 2ZPTX 3AVVA 1TKAA 1E69A 2PTGA 1ABFA 2YN4A 2YXLA 3HKCA 3ASYA 3KQVA 4OVKA 2G6BA 1BXGB 3RK4A 3BWBA 3UOGA 2B37A 4LZWA 1J25A 5BUSA 5GM1A 4XVCA 4KCGA 4XJTA 1CRZA 1L3IA 2YOHA 5CX1A 4DJEC 3FDJA 4BJ6A 1OH8A 3CMMA 3C3AA 2QD1A 1YE5A 5BN4B 3G6WA 1RZVA 3GHYA 3FHLA 4YAGA 1ZR2A 1U2EA 2R2GA 3V4FA 4MP6A 2HWWA 2B34A 8MHTA 3GJRA 1IJEA 2J5XA 4U0JA 3MFYA 4P4TA 3SXUA 4E14A 4RD3A 4H6WA 4X64B 4YRTA 5IVKA 3ORSA 4GVLA 1YU6A 3NP9A 1MIOB 3IR5A 4G07A 3VNSA 3EVNA 4HGPA 1BGXT 1XYYA 1Z4NA 1I80A 1Y5NA 2OXCA 3UJ3X 1GPLA 1S3IA 1ZA1A 4D57A 3PNOA 4FSDA 2VDMB 2WG1A 2WA1A 5E2AA 5HGJA 1G20E 4EEXA 2C92A 4HEA6 4WZ6A 4LXGA 5DEOA 4N0QA 4N3BA 5DP1A 5SICE 5FR2A 1RKQA 5BQPA 4JI7B 4H6PA 2VXOA 2PUHA 4CM9D 2XYQA 1P75A 3QKUA 1UDRA 1NW5A 4N18A 3Q2IA 3HBNA 5I7WA 4HC4A 3JRNA 1UC4B 2E3JA 3FNQA 4PICA 5ERYA 5IF9A 1WKVA 2NOAA 1VE6A 1RRFA 3PHIA 2Y2UA 1FU7A 1LX6A 1RTKA 1ZNQO 1SCNE 3HFGA 3QKTA 3LUAA 4L75A 4UKDA 4W7SA 4XUCA 1Q0SA 1P3Y1 1MJNA 1KS9A 1MB3A 1O94D 2IS1A 1DFGA 2CMHA 2EX4A 4Y6RA 5JNTA 1I6MA 1WY5A 5CK4A 4JYZA 2BC9A 4UEOA 1R8SA 1JIQA 1M2VA 5GWXA 3T3EA 2ZSIA 4FDMA 1BHO1 3BJRA 2IY7A 1POWA 2DPXA 4QTTB 4BNDB 2O7QA 2J9ZB 1SUWA 4XFDA 3KZ1E 3DCYA 3AJDA 1RU3A 4OYLA 2Y1XA 4YXWA 2C59A 2PK3A 5TQ0A 4D25A 1VFPA 3PFIA 4RPIA 1USWA 3CF0A 1S6YA 2OGUA 4QM7A 3ICQB 4FSHA 2OFFA 1ZSYA 4OL9A 4UEJA 1MQSA 3E7PA 4CIVA 4ZTZB 4IQ0A 5BWCA 3DEJA 3UJAA 4CU2A 1JR3E 1TU0A 2BJVA 2YYSA 1UAYA 3CUSA 5T57A 3UH1A 1A7KA 2FE1A 4OB7A 4Q3LA 4ASUD 2C58A 3EOAI 3UYKA 1K08A 2WVHA 3DMPA 3QIAA 1P3DA 4B3FX 3AZQA 4NMLA 4DRYA 1K6XA 4QXPA 4HDSA 3ZXIA 1NJ6A 4R3UC 1H2AS 3EFHA 3RS9A 3ZC3A 1N3YA 3UC9A 1I7LA 2EJBA 2VP9A 3BMOA 3P5SA 5AW3A 5ISMA 1HOXA 2XYGA 4LBWA 4DUGA 4LIPD 1ZGZA 5G02A 5EHGA 4HH0A 5A5VA 2R85A 2X6RA 4WTOA 3B7PA 5AI9A 5DSXA 4B32A 1G20A 1VIVA 3NOQA 2QPAA 1M6HA 1GRQA 2PT5A 4L4SA 1L7EA 2J09A 4OB8A 3RRYA 4D79A 3R0VA 2BMDA 5JZVA 1AS2A 4DILA 3PIIA 1K0UA 3KZKA 1ZD8A 2R4TA 1XD2A 4HQLA 2ZVDA 3ZDAA 1MN6A 3A9TA 5EWJB 2MDTA 3OZRA 4Z4FA 3OJXA 5DLDA 4JGIA 2W93A 3L0YA 3BXGA 3MCUA 2WJ4A 2RKOA 3FSEA 3QJYA 4JENA 5LZ4A 2R5NA 5TVKA 1ZHOA 3X1KA 4N3CA 4XLZA 1SVUA 5EZYA 1H2XA 4QYXA 5AKJA 1U3UA 1E5XA 5JMOA 1IWPB 4C6TA 3B78A 3B5EA 1DQSA 5FLKA 1RYDA 4A0SA 1HNNA 1ZGHA 1US8B 2H2AA 4N5HX 3T34A 2G72A 1GAEO 3MCZA 2WMDA 3LT4A 3RVPA 2EU8A 3K09C 4TZKA 3P9IA 4NARA 4BV2A 1PZXA 2Z0MA 4U2KA 5IUJC 3QEAZ 1WETA 2O8FB 3EJWA 2XX3A 1EWKA 4NCAA 2V97A 4KWIA 1OZGA 4WVFA 3KXIA 4XM1A 3SBXA 1ISSA 2NQ8A 1HT1E 4WGFA 1U2PA 2I71A 5CFOA 2XT0A 1ACMA 1I30A 3OZEA 3KEGA 3PQ7A 3VI4B 3A1WA 5CA1F 4OHZA 3DA8A 2V7PA 5B3JA 1KOGA 2GSDA 3LCVB 3U3OA 1JR3A 4YV1A 2QD2A 1NGSA 3LVRE 2POCA 5U4XA 4YRQA 3PTLA 2EFCB 1WSAA 3MB5A 2Z30A 4AXBA 3O91A 3DXYA 3AHHA 4OQYA 2FFJA 2PMDA 1ZN7A 5D3MA 3RASA 3IVCA 4BOYA 2CB0A 3HNRA 4YRDA 3BN3A 2FWNA 3P26A 2ZYDA 3EEIA 2P4HX 5FTLA 1DKQA 3GLQA 2B7BA 4FFLA 3RFUA 4CM7A 1C3OA 2GHIA 4MDEA 3EHDA 1FUIA 4RLFA 1L9KA 3QPWA 3OQ6A 3JQ7B 2C4MA 4N65A 4NFYA 1XU7A 4QA9A 5IC6A 1SXQA 3DVAB 4MQLA 1QWSA 2WTAA 2HF2A 4R31A 3WGIA 5C5CA 2C7QA 4YT5A 4PBRA 1Q1NA 1U1CA 3LA8A 1N6LA 3EXG2 4YACA 3GLIB 4HNVA 4MQUA 2X4GA 1H42A 1EZZA 2ZB7A 3WMFA 4MDYA 4RKYA 2B78A 1XZGA 2OHVA 3C7DB 4S1NA 1G4HA 2Z6QA 2NT3A 4UU1A 4XIFA 1XVAA 1JAZA 2PYZA 2YWXA 3U49A 4JVMA 1YE3A 5KJCA 5EJ4A 4RHYA 2XGOA 3NKFA 3ICVA 4REMA 4LNUA 3PI7A 3OIGA 4K9MA 3O9VA 4OKIA 4WZAA 4PLZA 5DF1A 5HCUA 3D3KA 3G8AA 2EZ8A 1K8QA 4Q5IA 3S8YA 2ABWA 5FWDA 4FEAA 1OGIA 2FZCA 1EH5A 4IH4A 2Z4RA 2QVCA 2Q9UA 1L4MA 2G82A 3HTXA 3LY7A 3NCHA 1P0IA 1R4ZA 3SOPA 4E1BA 3KOXA 3UAZA 5B6PA 1NKVA 2PH5A 5LZ5A 4CKXA 1DKPA 1SG9A 4HYEA 2DTEA 2X0JA 4QU8A 4NZZA 5CG1A 4Q4DA 2GJKA 3QX3A 4BNMA 2UVPB 3ID6C 1IUKA 3NBQA 5DDIP 4NC9A 4C29A 1X0XA 2QKYA 3CRW1 3I83A 1H65A 1STOA 4RZIA 4ZCPA 5FV4A 1YCFA 3WVNA 3W04A 2C7BA 4HNHA 5KHLB 3ZNPA 1Z45A 1YC2A 2FSHA 2QYOA 1GGJA 1E2UA 3WKBA 3UW1A 2PUGA 3UZUA 3IXLA 3O4GA 1UM9A 4RPJA 4DMKA 2OZLA 4LY9A 1EHYA 5LXTF 1F2TB 3ZCUA 1E5QA 4X1IA 1IPFA 2EBHX 1HFKA 3UENA 1X7WB 3KOMA 2VUIB 4KO2S 1VL5A 3H2YA 3UUGA 2PSHA 5KYUA 3RGWS 4E3WA 4Z9XA 4W5QA 1LBEA 2GX6A 5EHZA 2CBXA 5G0SA 2NAFA 3UWKA 3NCTA 4J3FA 2V5AA 5SYMA 3EGXB 4AZ0B 4K28A 3FTCA 3E2IA 3MAGA 3MT8A 2DWPA 3PK0A 2NNWB 5FPQA 3ER9A 3E35A 3D8RA 5B55A 5KNDH 3WK4A 5ALRA 2EP7A 1LVHA 2CNWD 2JS7A 3HWSA 2J32A 3Q7PA 2HMSA 2SICE 4GNKA 4E15A 1NKTA 1XAJA 4ZU1X 1UH5A 1FQWA 2JA2A 1DTEA 2P69A 2ZAMA 5TNXA 5ILQA 5EQJB 3IEPA 3HPQA 3RFFA 2CXPA 3FB1A 4PGFA 1DRVA 1G16A 1YJXA 1I9GA 5DNYB 1JDJA 4RFLA 4DV1B 3IQWA 3QEBZ 1W9MA 4GPZA 1YKFA 5DNEA 2EW2A 1K63A 1WXIA 2FEKA 3OM1A 1L4FA 5KTYA 5DM70 3NHYA 3PWZA 2RGUA 1GKUB 1PJAA 4WAUA 3JQAD 4ZIRB 1SUEA 4MQEB 4KAJA 5EJEA 3BERA 1CJSA 3KWLA 2AE2A 4MCIA 4ML3A 4TTSA 2A67A 1GNVA 4M1YA 1USIA 3PXCX 2BDUA 1TYEB 1LWNA 4WXRA 4UAUA 2EYUA 5EKUA 3ZLBA 4H4CA 2WA2A 2RH9B 4D8XA 1NVVR 5BN5B 4Q21A 1KYVA 2C4UA 3N5KA 1GL7A 2NPOA 3I3OA 4HPJB 5K8CA 2TRSB 3PX2A 5E0OA 3ZDXB 2Q9BA 2CUZA 1XHFA 3PCTA 2PT7A 3FPSA 1XMJA 3PWKA 3QG1A 3GF4A 3OKPA 1TADA 3FWNA 4WACA 1N3IA 4DA9A 2EFYA 5L3RA 4LMRA 5JQGB 3K6SB 2A4MA 4NYJQ 1JEEA 3G0OA 1GZVA 3HV0A 1L1RA 3TQSA 5KNCD 3HABA 4P92A 1W7AA 1U11A 2RONA 1MC8A 1XRRA 2HU5A 2WM9B 3LQKA 1F0NA 4FKBA 3QWIA 1E2FA 4L2IA 2F8MA 5KYTA 2W8BB 3NNNA 3NXKA 4I66A 2WABA 3SF8B 1M1NA 2G1UA 2AFIE 4KSYA 4JBLA 3OJFA 2Z1MA 4QQRA 2C4TA 4YGYA 5FL7A 1VCOA 3BXEA 1U0LA 4QG7A 2GZAA 4ODIA 4WKCA 2B4AA 4ZVPA 4ZV9A 1ABEA 2X15A 4S12A 1VL1A 1E99A 6YASA 3UWOA 2WG2A 2YN0A 2WU0A 4L50A 3R7SA 5JAMA 4GKAA 1Z12A 2GF9A 2P9FA 3A3PA 2JATA 2B25A 4O3FA 4U2EA 4DT1B 1E6LA 4TTQA 3OLVA 2X8JB 3U62A 2AK2A 3K15A 2OAEA 5HCNA 2WIKA 4MI1A 4DY4A 5KJFA 3HYTA 4MUAA 1I8TA 2VHTA 4PWYA 2O7VA 4C7OA 5C3UA 4O2RA 4QUIA 2B9VA 5EXSA 2B7LA 3S7ZA 1ND6A 1CP2A 1TVMA 5DPMA 4BY9E 2Q1TA 6Q21A 4H31A 3ADBA 5D1HA 3OLWA 2J3KA 4S35A 3BF7A 2XUZA 4H2DA 2PUCA 3DS8A 1X1AA 3FUTA 4PSCA 4YMLA 1QHSA 1N9KA 5C8YA 3ZKWB 3RAGA 1RNLA 3B1XA 2NIPA 3OFJA 4MIOA 3W5VA 3U1TA 2IS2A 2F3UA 1H93A 1PG5A 1RRGA 4D6YA 4MKZA 3O4IA 1RHUA 1U4NA 4BLQA 2PR7A 3N58A 1SZPA 4LOAA 5C4IA 3EA0A 3SQDA 3P96A 3R23A 2VR1A 4KN5A 4LQCA 4AO7A 3VV3A 4PTYA 2QVGA 2GPTA 4IUDS 3NS7A 1SCKA 4OHMA 2EJVA 3ZLUA 3HDTA 4DA4A 1EA7A 3IUMA 3KLOA 1MBZA 3THYB 4KJXA 2O7RA 3VH4A 2ZSEA 3F47A 1NONA 3TCKA 5KX5F 1UBEA 1N7JA 4JUDX 3Q1KA 4WI1A 3VYTB 3DXFA 4MEAA 4LOHA 1YB5A 4IIBA 3VVBA 4RIFA 2XB6A 3ESDA 3LL7A 4B5KA 2JIOA 5H8WA 2BFBA 4TGLA 4TZ6A 8LDHA 4CBVA 3IT0A 1L4LA 3JD3A 3KRTA 1P5ZB 2E6KA 1V6CA 3LT1A 2GF2A 2OD7A 2BPOA 4MW4A 2WKPA 3ZVRA 1X70A 4DCCA 4DJFC 2Z6AA 1W581 1FYDA 2H29A 4N39A 4Q05A 5AI6A 2XGSA 2AFIA 5BN3A 1Q0RA 1A9XB 4ND7A 1FUKA 3SR0A 4WFIA 2ZW9A 1G1AA 4JSRA 4NYMR 4PYLA 5CD1A 3P0EA 3ZXUB 2ZRLA 5LQMA 2QI9C 4GEKA 3KJEA 4UAGA 4Z6KA 4NYIQ 5EKXA 1LTQA 2YY5A 3O6VA 1KZHA 1XQVA 1A4RA 2BEVA 4RC9A 2C03A 3EIFA 3TW4A 5H80A 3AT1A 5K01A 2R6DA 5CW2A 2Y27A 3LA6A 4M8KA 4W6QA 3RVJA 4EKNB 7GPBA 1R37A 3H0CA 2NZWA 1DWPA 4L0QA 4YT8A 4MUYA 4FILA 2HCJB 2YRWA 3AOGA 1TU3A 3B6KA 5EPEA 2UYOA 5C5EA 4CMKA 3PX3A 5COBA 2WQ7A 1KMHB 5BW8A 4D97A 1HE2A 3O9MA 3D8UA 4YK7A 1AMNA 2VNIA 1Z0SA 1DAPA 3DT8A 3HKDB 3AL3A 3Q7EA 4YXWD 1FXSA 1SPBS 1MOPA 5JROA 3R6DA 4EI2A 2GB4A 3DMTA 4IIJF 3RVNA 4HWOA 4JQOA 4UDXX 2PL5A 2PUFA 5BNZA 1Y4UA 3GJ3A 3RSOA 2VQFB 2DBQA 4MROA 4OA5A 3T7AA 3WYFA 3T15A 2I1QA 3AVOA 3D59A 5JQGF 3M9LA 4OYHA 1KYZA 1Y5IA 4NV3A 5TE9A 2BP7A 1K3UB 2Q3HA 2WSSA 3ND8A 3NP7A 3FE2A 2VHZA 4JIGA 4K9SA 3WRVA 5JASA 1ZUNB 1ZK2A 2FZLA 3TJZA 1FMFA 1DAOA 5GJCA 1U90A 3L05A 5FWXA 1TRHA 1X1BA 4RTLA 2I8CA 4YX9A 3ETCA 2WNIA 4DUGD 3IE2A 1TT5B 3EFOB 3QI2A 4LDAA 1R8XA 2NUTB 3QWBA 2WE8A 3A1NA 3DEYX 5EWLA 3OQJA 1OWPA 1SD5A 1B42A 1NXOA 2IEZA 4JT2A 3ESQA 4O5OA 4P33A 3BXFA 4ECAA 1JLRA 2IUSA 4I8XA 5EIAA 1DARA 4G0OA 3NYIA 3PVZA 4TTAA 5IJ9B 1WOYA 2F9FA 4Y1RB 2JJQA 2PG3A 5D01A 4FONA 3IRUA 4PTZA 5K09A 1ZJZA 2PWBA 2RHRA 2XH8A 5TQ2A 3CYFA 4EG1A 4YRKA 1K86A 4TXLA 3R7FA 5BW4A 3ZQ6A 4DNXA 2L69A 2XCOA 1YRHA 4L22A 4RXUA 4XVRA 5EYPB 1NP3A 3SQMA 1VHDA 4P22A 5ITZB 3CVYA 2AT1A 1P33A 2VKQA 1IC6A 3ZV4A 1FDTA 2Q4EA 4HCJA 1ZW6A 3RT1A 4E03A 2FPIB 4P84A 2BE9A 4LDJA 3CO0S 3HU2A 2I4IA 5FF9A 1DC8A 2FJUA 5ES4B 3OIDA 3IMGA 4NBRA 1XNRB 5G1NA 2WHQA 4BBJA 3SYTA 2IHZA 4MARA 4CIBA 1WHSA 4YI5A 1JIUA 2DWCA 4E0BA 4ZXFA 1V5EA 3IEMA 3CJTA 3FCSB 2Y92A 5CNMA 3OURA 3IHTA 4R41A 1CP3A 1BXRB 2YJ5A 2VT3A 2YR0A 4OHBA 3TD9A 1JRLA 5F98A 1NBAA 1UXIA 1X8XA 1K92A 4RK5A 4AQDA 2GBLA 2HT1A 4WN9B 4MRNA 2O9JA 5AI5A 3PC6A 2QTFA 1PT6A 5LYJA 2EG9A 4MAFA 5TPWA 5EJ9A 4DLAA 4DPLA 1XA0A 3T0GA 5LM3A 2WG0A 3O1IC 4AO8A 3COZA 1KERA 4AFNA 2HJGA 1FL9A 2IXFA 3D7SA 4IY1A 1JR3D 3A6EA 4NZPA 1XMOB 2R8XA 5KU7A 1Y8RA 2QRHA 4FFWA 3SZGA 4BB0A 1T2FA 4OI1A 4JLMA 3OOHA 2R44A 1QOQB 5A4MS 1I3MA 3F8TA 4DE5A 4I50B 5G2OA 2YIDA 3PHLA 3AVXA 1YSCA 2H16A 1H0KA 3QU5A 5GONF 1M2FA 3RVQA 1KO1A 2HMYB 3LG2A 5ALDA 3ZY3A 4B6GA 4CXMA 2B21A 2ZBRA 4DFDA 3LAWA 2PUBA 4M0MA 1HDYA 1U2GC 3W06A 1G9SA 1NMQA 4AROA 2AN1A 3H3XA 2G06A 5FYDA 4YV2A 5IM4A 4KR2A 1DOZA 3ZS9A 2JVKA 5G53C 5BOSA 1EVZA 2VLBA 3GEEA 4KXYA 3MJTA 1ELOA 4ID3A 5LA6F 3C5WP 3MCVA 1MTOA 2FPRA 3DGEC 3ZJ5A 1XRQA 5J47A 2EHJA 2TYSB 4X20A 1YA6A 2R1TB 3BRWD 1EFCA 1W46A 3JZAA 1QX4A 1S96A 4AUNA 4CEHA 4FW8A 3UFXA 1SU7A 1KY4A 3HGTA 3TG8A 2W6JA 4F93B 1U0TA 1RXCA 5EP4A 4RH3A 2O8NA 5K03A 3IEVA 5KSWB 2C2XA 1MEEA 2DHQA 5J9FA 1CNMA 2PEYA 4G4SO 4BECA 2IYVA 5KKAA 4E5KA 5CBPA 4HWKA 1P2DA 2HL6A 4CEIB 3L77A 4NEGA 4LYAA 1WV0A 2CMGA 2PKWA 1E64A 3A2MA 1P9RA 1YI8A 3NAMA 4PSVA 4UU0A 3Q9LA 4LFAB 5DGCA 1G7RA 4H7DA 1Y3BE 3RSLA 2WP8J 4ZZ3A 3KHKA 2XGJA 2R6AA 1BVHA 1Z08A 1RFLA 5E6SA 3RR2A 1BGVA 4JBNA 4KQXA 4KFTA 1X74A 4WBXC 3N2EA 2JB9A 3K9FC 3IVXA 3GRVA 1DG3A 5GOZA 4W5TA 4YXFA 5H9VA 3K0SA 3CM0A 3VC1A 4GBJA 4BZXA 2QR2A 2VUHB 1QH0A 2GEJA 4J43A 2O8CB 2JFOA 4ZT3A 1E9EA 1UXJA 3MGCA 4MZDA 1N2IA 2B82A 4EYGA 4MUHA 5IJ0A 5KTNA 1Y0BA 3GH1A 3Q5GA 2BMVA 3Q72A 1MF7A 3HYCA 4Q16A 3ZV5A 4ON9A 2QD4A 4C07A 4OHWA 4E3ZA 2P78A 4RCVA 4TLLB 1J0XO 1P44A 2ID7A 3K70B 1RACA 2F8LA 4DLBA 2AKEA 1Z13A 4F3NA 1AKVA 5FWAA 2WKRA 1T2VA 1MPTA 2C4KA 3A4NA 1XLVA 4GLOA 3P1JA 3RTGA 5HKKA 1XGKA 1S4MA 1W34A 5BSVA 4L8GA 5DHUA 2W43A 4UFPA 5AVSA 2JNWA 3LQRA 2QUKA 4YT4A 2C29D 2QJRA 2R5WA 1NUSA 1SMKA 3WE7A 4DLWA 4DW8A 4D6PA 5TMPA 4X71A 4GI3A 4LNHA 1ST3A 2XJ9A 4HDMA 3EHEA 5DNVA 4JI1B 3SBEA 5FUVA 3F97A 1XAHA 4IXWA 2OV6A 4G56A 1MQAA 1CR4A 1QONA 3K0FA 2XUKA 5CFQA 3ERCA 1JFFB 3KUDA 4IW3B 2GVZC 5TSDA 3V42A 3M5WA 3RTCA 1N75A 1C9MA 4FNAA 1KYIA 3R5FA 3KAJA 2I2FA 4DLTA 4LXQA 1SA0A 3OBIA 5FO0A 3W7BA 1VYUA 3NEYA 4JXJA 1N9ZA 4NL4H 3OO0A 3W2HA 2XBLA 4DDVA 1R1DA 2EKLA 2JCXA 5EL0A 5EGSA 2UUAB 3OIWA 4BVJA 3V4RA 3IESA 1HO3A 2J41A 2QE6A 3FOBA 3WHKA 1CUAA 3Q3IA 3N74A 4P98A 3TH5A 4DA6A 5IZ4A 3DKVA 3HBAA 3HYSA 2DFKB 1DZ3A 2FN7A 1V7PC 4TTJA 1TCAA 3ZWQA 1OXMA 2OK8A 1PDWA 1POXA 2PZLA 4IYJA 5GONA 1PT7A 4F12A 1E92A 2O4CA 2C9DA 3PTAA 2FN8A 3QM1A 5CCBA 4U2GA 4I50F 1E79D 1SZJG 5C8XA 2XUDA 3KKMA 1Q0LA 1ZUD1 4KLZA 1F20A 2XRYA 2XLBA 1VJ0A 3RO7A 2F3TA 3V8EA 4AUMA 3O2JA 2NP6A 2VBFA 2ZEJA 1LXCA 4QU5A 5SYNA 3RC3A 3QVKA 1NRXA 3EZXA 5FL7D 1F3LA 3P2JA 3SC2B 3ZHZA 3WP1B 4C06A 5E6RB 2QL6A 2R60A 1J0AA 2XQVA 3HZHA 1EJBA 3AF0A 1HKHA 3AESB 4F38A 1GPUA 3TUIC 2ANBA 4C7JA 3OZBA 1CX9B 5IABA 4AQ7A 1ADCA 3SZMA 2DHCA 3HKBB 4LF5B 5B3KA 3UK0A 4DCUA 5G4LA 3SG0A 4MV9A 3AR5A 4ZD6A 3K2BA 2E4ZA 2NQ2C 2YMMA 1IYZA 4QTXA 3ZGLA 2O5VA 3DV0B 1DBQA 1VLHA 1RRVA 2PAAA 3AR7A 4LV6A 4QBKA 4Q4AA 3DZBA 3IJRA 1RRKA 3ENZA 3PT9A 1EQ2A 1CQZA 2UUOA 4ZOQI 1EA5A 1KDZA 2CF5A 1AUVA 4HGQA 3LXXA 4MQFB 3DWIA 4YMTA 4MA0A 1DAGA 4MKXA 2WMOB 4MS4A 1YASA 3PFWO 3RYTC 3AX6A 4AS2A 4ZA2A 3IGFA 3NT2A 4MEBA 3PUIA 3H6HA 4R81A 5T41A 5JATA 3ZOKA 4W4TA 1YVEI 3H5TA 4TSFD 4PFKA 3TNLA 5K6AC 5KC8A 2FZ5A 3TR6A 2C54A 3WHIA 4N0PA 2EWVA 4ZAYA 5T67A 4CM5A 4X24A 5CT8A 5FUMA 3PXEA 4P31A 1G8KA 3H7IA 5AW0A 2I7DA 2V4MA 4DZTA 1MLDA 5I9MA 2J0QA 1X7XA 3WLHA 1H8ED 3NONA 3R5TA 4YUXA 4WV3A 3UUEA 1MW9X 2VQSA 4XX0A 4X45A 3X2EA 1FUEA 4MGHA 1AKYA 3ZWDA 4C0JA 5BSHA 4RKQA 4Y2TA 1AK9A 2YIJA 4TXMA 4WASA 1E2JA 2X0NA 2VT7A 2G9VA 5E95A 2Y66A 5DT2A 2OFWA 3QFRA 4B71A 4FYHA 3TOCA 3PQ5A 4J7UA 3SJCA 2C3YA 4YP5A 4UQPA 2NV0A 2PBLA 4IDHA 2DTDA 4MJ7A 1ZC4A 4I5DA 3LUDA 4ER6A 1E1DA 2I4RA 1UDAA 1JHQA 4UREA 4DWVA 3LDHA 3EDCA 4MYCA 3EX7C 2UYCA 1C7EA 3CX7A 5DHSA 2O2IA 5JIBA 1I0IA 5AK3A 1QHYA 1KAGA 3I92A 1NXSA 1R10A 3DBRB 3I9V1 3LPAA 4DA7A 4LHSA 4DMRA 3OE1A 4TMVA 3IPXA 1T3GA 3KKKA 4O2BF 3VKHA 2YRFA 4UM7A 5CPBA 3OC6A 4PHTA 1XNJA 2XB9A 4JFAA 1AQUA 4TROA 3QEOA 4WKPA 3SF0A 4UARA 2GN4A 4AYWA 3RUFA 1Z88A 4PM4A 4NK5A 1ZJ6A 3FMPB 3ZW7A 4B35A 3DGFC 3ENWA 3IDSA 3T5GA 1H3EA 4PFQA 2X7HA 3WBFA 1HY3A 2O2YA 4TVSA 5J2UA 4ND8A 4TL8A 1HF3A 4EEKA 1XZJA 2E4XA 2JASA 3A8TA 3OF2A 4CMHA 1W4CA 2EQAA 1T4CA 3C3EA 3BG5A 4GL4A 4LHYA 3KXDA 2Y1GA 1M6VA 2CLMB 4UCXA 4X8HA 1KBQA 5CIQA 5G3YA 3VZRA 1G9TA 1CCWA 2PE5A 3QEJA 3D3NA 2QD3A 2IA5A 1J42A 3DW1X 3BIJA 2BFCA 2JLXA 2I3BA 4P3NA 3HH8A 4DV7B 3IQZA 4E94A 2I6QA 4HB3A 4YRAA 1EXNA 4WWHA 1Z63A 3GBSA 3KYCB 1CWUA 1TMKA 2P9YA 5H9WA 4B2IA 3EIWA 1MZVA 3KU4A 3P7MA 4YYEA 3ILXA 4F2WA 4OGWA 2DY0A 1G18A 1RXVA 2WSSD 4G5SA 3F73A 4NHOA 3FOAA 1LBSA 1KSJA 3QELB 2RBEA 4FCVA 4O6VA 2OMKA 4FZ3A 5HQJA 2NO9A 1W4LA 4Y9SA 4B3XA 3L1IA 1SVLA 4F7DA 1GZ4A 2QA5A 4UE2A 3VYSB 1JPUA 3C3PA 4I81A 3S2ZA 3KQKA 1Y33E 4U9UA 1UJ2A 1Q3TA 1GFIA 2Z5FA 3Q10A 3TIGA 2AG8A 4JNKA 3UB4A 5JDCC 1L4YA 1E7SA 4FYXA 1NXVA 1ZIPA 3KKPA 3LC0A 3B9PA 5LFAA 3PLRA 3LYHA 2Z2IA 2KS6A 1GEEA 1O95A 1QGUB 1WCIB 3DPUA 1QG6A 3R7AA 1K8RA 1ZN2A 2K2QB 2FOXA 2V8BA 5MF6A 1WNFA 1YHNA 3KJXA 5DP2A 2D3TA 1VJCA 4P5DA 1VLVA 3C85A 4FNOA 3ZU5A 1DWUA 1EWQA 1XTKA 4OP2A 3UF0A 3RBZA 2B8WA 3PPXA 3BX1A 3TQHA 5KVQA 5DYWA 3WL5A 621PA 1UBMS 3F6SA 1QGDA 4QPPA 4DDKA 1M0WA 3I6ZA 1E0KA 4Y2QA 2AOXA 2C78A 1GL3A 1O77A 2V7QA 3GEPA 1GYRA 5AIBA 4Y18A 1CUWA 3TTSA 2ZRCA 1N4AA 4IVNA 4LX0A 3ANLA 5FOUA 2B1JA 5I3CA 1GCIA 4ZO7A 2ZSFA 1N6HA 1VCMA 3K1JA 1WUJS 3F78A 4BJ3A 1TJ4A 1UBSB 4R01A 1ZLXA 3BYZA 1YI0A 3L0BA 3DEFA 3LQFA 4RACA 2GCPA 2PXAA 4BVHA 2A84A 4P6VF 1Y80A 2QX7A 2VSYA 5C5IA 4HVAA 3PA6A 3KS9A 1OUMA 2DEUA 1D4ZA 3Q8KA 1BU5A 4PAGA 2FVXA 1R9JA 2WTXA 3CEHA 3ZEIA 2XYPA 3DZKA 4CKCB 4LF8B 1VG0B 1MTZA 1UBCA 4WJZA 4ZOCA 5DHQA 3ZCRA 4JASB 4NAHA 2VDNB 3AXTA 3ZPXA 4BO7A 3JALB 5GV7A 4IBOA 4G0YA 5DLYA 3WBJA 3L6DA 3SQWA 5HFNA 1ONPA 4LPKA 3D1LA 3GYBA 4D2IA 2O5EA 3C8DA 2VJMB 3WGJA 1IL0A 5FPYA 1UKEA 1AQYA 1M10A 1ZO8A 2WC1A 4CQMD 2VOJA 6NULA 3SZUA 2OZEA 5NULA 1QUEA 4JB0A 1J1UA 1JQDA 3I9V6 1I0ZA 5AO9A 2NSYA 1MC5A 2QTMA 1KTIA 1O96B 2C95A 3JYHA 4U2CA 2GOYA 4Z99A 2V9CA 2XZLA 1RD4A 1SC3A 3M9WA 4EUSA 2I67A 2JIZD 3LK6A 5BRNA 1F6WA 1KO8A 4IJQA 1NMZA 2HNKA 2OTCA 1VLZA 2VWHA 5EOVA 1KQGA 1RQLA 4II3A 3HM2A 3GLFE 1LPPA 2QNRA 3GROA 4R1LA 3GNSA 1B23P 5TQVA 2G28A 1SVMA 2BEJA 3P9SA 3GDWA 3AR8A 4JYBA 4GIBA 2Q8QA 5EP1A 1BCRA 3DBIA 3I0MA 3T4XA 4OMUA 2Y76A 1XOIA 3FROA 3M5CA 4EJFA 4MV0A 1GTMA 4PS1A 3GQVA 4PBSA 1E77A 2H85A 2YV5A 4U8GA 1YXMA 3V9PA 3OZGA 3VPSA 3HLTA 1I2BA 3FPFA 3FVTA 2HSJA 2V6JA 4JR0A 4P4GA 2UZ0A 5FBVB 1M8PA 1P45A 2AMLA 1NF9A 4Z51A 1PWYE 1I4LD 3DO5A 2NAPA 4R40A 1NBME 1QO0A 2AV6A 4MGKR 1U3VA 3P9RA 1RBQA 2OD2A 3HG7A 1GZUA 3OMWA 4ER5A 2BIFA 3BD8A 4EY8A 3GC6A 2DKFA 5K8IA 3STYA 3ONFA 1L8XA 1IY8A 3OFNA 4ERXA 3M7IA 1XKXA 2HK9A 4JL6A 1SRRA 1OOEA 1HC7A 3EQ8A 2WAMA 4JP1A 1KVSA 1M2WA 3E3AA 3EH1A 3MD0A 2JD1A 2QN7A 5KQSA 1W4BA 2IPOA 4DOMA 1HLPA 4ZPJA 3JQAB 1B4DA 2WMYA 1QGYA 1TUBB 3UQZA 5I6DA 4G1UC 3OCJA 3SLKA 4L76A 1G291 2QM8A 4BNTA 3ANYB 3BQ9A 3M0EA 4TV8B 2VHVA 1KEEA 1XZCA 1TF7A 3SNKA 1ZH2A 2F43B 3QVTA 1PF7E 3DBLB 3M4YA 5EMHA 4AJHA 2UZIR 4EMTA 3PCRB 3A25A 4ESVA 1E1KA 3QVMA 4PLHA 1GUFA 1BXZA 4BZZA 1UMCA 1EFTA 1ORRA 3AFGA 3BDVA 3KYJB 4YDRA 1N25A 2FMFA 3AB3A 1V71A 5KCZA 2EZ9A 2FDCA 3QEMB 1GKKA 2GTIA 2PCJA 3F6PA 3QPUA 4M22A 4MWZA 2I29A 3L82B 3MIIA 4TLDA 3S40A 4DLXA 1DV2A 1ECPA 5M04A 4Z4EA 4G41A 2J9FA 3U6BA 1W0JA 2P77A 1I5OA 1YULA 1JFLA 4O59O 3GLFA 5HKKD 1TRKA 2PRJA 5C35A 5A5GA 1SUAA 2FFBA 3H75A 2BT4A 3P2MA 1CJKC 1NWCA 4JDUA 1P0PA 2Z2YA 4YRRA 1NQUA 5BRAA 3KVNA 5FB3A 5FO1A 1XTJA 1FMTA 4G81A 2O48X 2VAXA 3D6UA 2EBWA 5IHXA 4TUYA 1PQPA 4YIKA 1BA2A 1GLNA 4ZI7A 4ARSA 1XKQA 1BMDA 1K7EB 3ABQB 3K31A 4XWTA 2VHCA 3TSAA 1VI6A 1DUVG 1ZI9A 3BHNA 1WMFA 4GPAA 1Z7WA 2FRDC 2V5VA 1N1EA 1J21A 4XYLA 3JR7A 1ZRSA 2HHCA 3BRQA 4JJKA 2NTEA 3RVDA 4DQDA 1FQOA 1KYWA 3SHWA 2GD2A 3DZFA 2FR1A 2P0YA 4B87A 3PTZA 1ISGA 2OC9A 4B09A 5IXYA 1KRHA 3A9WA 1BO6A 2ZRBA 3PE6A 4M7PA 1PQUA 5HGXA 2WU8A 1UKAA 1X39A 1XTVA 8ATCA 2AQ8A 1EWYA 4TQUS 4G0QA 5CVCA 4OQ4A 5CFNA 4LYGA 3DW3X 3N7UA 1EIZA 2ZJ8A 4H1UA 5AFSA 4JVSB 3BGIA 2NZUG 2WF5A 1VL0A 2R84A 3AR2A 2LNDA 3ZS8A 1TK3A 2WSIA 3CSDA 5FNZA 3ZHUA 4XGQA 3WDLA 4F97A 3GX1A 1OX4A 3ZDEA 2XSZA 4QXAA 3I76A 2CEAA 1WB6A 1MGPA 4KXXA 1JSCA 2BN4A 1D2CA 5FI5A 3X1WA 4IHJA 2VQEB 4JI4B 4F8YA 4EZEA 1OTHA 1L5QA 2Z2XA 4UHEA 4QGFA 4UCWA 3U1BA 1D03A 4GO1A 3UV7A 1VOTA 3I3SR 4ARBA 3DMHA 4RULA 1WXEA 5JO0A 3H7AA 3L06A 1ADGA 3VQTA 2GFIA 3P71T 4D74A 4AZVA 4G36A 1GQSA 1ZAKA 1O95C 4R7TA 4B4WA 1DBIA 1XPUA 4KXVA 3N6RA 1VG9B 4JYPA 4HQRA 3LNCA 4HGZA 1PN3A 2DETA 1PJSA 1Q83A 2CK3A 1KP3A 5DM60 1NVEA 3QH4A 3SE7A 5HS4A 4P08A 1QG2A 1MABB 3I04A 4QYSA 5FBWB 4KQ9A 5G0UA 5G1PA 1P91A 3OD1A 1M2OB 1N4DA 4ISBA 4OL0A 5JI2E 4C6SA 2JH9A 4YRZA 2YXEA 1X1DA 3GAAA 3MWEA 2ATIA 5EMLA 4CLRB 3FCXA 4IS3A 3PPWA 4EGSA 1SC1A 3TTUA 1F5SA 1FNCA 4K26A 1T1RA 5K8VA 1TQ4A 5J4YA 4QICA 3DMYA 1CF4A 4DWJA 4RAQA 4QEKA 1PEDA 2E5FA 1YDWA 2PX3A 1QOPB 4EG8A 1BX1A 4WNIA 1M2VB 1YF3A 3DZCA 4MVJG 3D54D 1EUQA 4RD6A 1QH9A 5FHRA 3D3EA 4ZQBA 3QE2A 2ONCA 1OLXA 1A5BB 4PNZA 3PUYA 4FDTA 4TV8F 2Y1EA 2PUJA 1ECJA 2HIMA 2J3QA 1TT7A 4AJPA 4EB8A 4N1AA 3UXHA 4DQUA 1Y7PA 4WHMA 2ZJOA 1GG2A 2F55A 5L3QB 1N1GA 1YZYA 3TD6A 2YH2A 2VT2A 5CH3A 1GPBA 1VMKA 4XI9A 4UHKA 2OBNA 1Z15A 3AVTA 4A5SA 4QFDA 5IC5A 1CNEA 4Y2JA 3VA7A 4GPTA 1IATA 3C87A 3MT9A 1XVVA 1C7JA 3F5SA 4CG1A 5HVNA 5HE9A 1QS0A 1NBHA 4QDOA 1VJ5A 1LV8A 4V2UA 1GZ6A 1VSBA 4JQCA 1DQPA 4TMKA 5K3BA 3PUZA 5ECGC 2UU9B 1PEKE 3BHIA 4FE7A 4PLPA 1NU8A 4AN0A 3TX2A 1E3WA 4MUEA 1RVV1 5FHQA 4EB6A 1N34B 1HDCA 1P2TA 4QEZA 2NXJA 2C2ZA 2V6MA 3TZLA 1HE5A 3UV6A 1JSXA 2GZ3A 5IDVA 2BSQA 1T6YA 2Y68A 1ODCA 1RP7A 2FG7C 2FSGA 4OP3A 4S2EA 4U02A 4UM5A 1ZVJA 1XKTA 2IXDA 4EDFA 4H59A 4OBEA 3WFZA 1RJ9A 3OWHA 2F9LA 2HCTA 3AFHA 3D6MA 4RF4A 4YAIA 4QYMA 3FCOA 4X0EA 5LNK1 3OMXA 1ODFA 3BMNA 1ZMOA 1W93A 1YNOA 1CR6A 4JLDA 3RQSA 5A4IS 2JAQA 4C0AC 4OGFA 3T1YB 5HPYB 4AP5A 4PIVA 4QVIA 5CT6A 5GJWC 1LWOA 5EJIA 3TRIA 1OF1A 1WULS 2QT0A 2QG6A 3A36A 4OQPA 3CLUC 1N7HA 2O2JA 3HJBA 4G5HA 4XIIA 3TCXB 3KC2A 2GT1A 2CYCA 3V55A 4CCYA 2O1WA 1RXIA 1YMVA 1T3HA 1TOAA 2DZDA 3NH9A 4F2DA 4HAIA 1B74A 2H4ZA 3GT3A 1YS9A 1U7ZA 4XQCA 4YECA 4ZOBA 4B6RA 3O2NA 4OHFA 4LRQA 1OMOA 2Z2ZA 1OASA 4LXYA 3FCUB 3LUGA 3IV9A 1J8MF 4P7FA 1CQXA 2AOUB 5FJIA 1Z83A 2AOTA 2NADA 4DXDA 1C9EA 3A6PC 3RTEA 1OYYA 1AKQA 3D64A 4I36A 4QOJA 1ZA2A 1Y48E 2VNKA 5CPFA 1EM8A 1HLGA 1YH3A 1L7BA 3K9HA 5I4KA 3JVDA 5KHAA 3F6CA 5DASA 4CI0B 4JEUA 3OTGA 3Q4GA 4DDTA 5L6MB 5K3OA 4RPGA 1TVKA 2XHEA 1PP4A 2B2XA 2ZT6A 3RVLA 3IIIA 2GFHA 3F90A 1UL1X 2WWVD 4I1VA 4LK3A 2GAOA 1HBJA 2JI4A 2OZVA 3KDAA 5F5LA 3UPUA 2VH2A 4D9CA 5ER6A 3RI3A 2QQ0A 1UIMA 1GQ2A 3F9CA 3JAKB 4YJGA 3Q5EA 1I94B 3HB4X 5TIIA 4K6MA 1O95D 2E5WA 1QE5A 1T8WA 2Y8EA 3BTVA 1WMSA 4LRUA 4JBWA 3MCTA 3K73O 4QYIA 5J43A 4ENPA 1JZSA 4AN4A 2WFLB 1DCMA 1JEQB 2ZROA 1C3OB 1E2GA 3R5SA 4QPJC 1CS4C 3A70A 4BGEA 1NJ2A 4I46A 3M4NA 4GWKA 1DKRA 4RVHA 4KXUA 1XPOA 1MJGM 5EJ6A 2DTXA 2CMFA 3C8ZA 1GQOA 2Q8NA 2ZS8A 4XGKA 5IN4A 1QFYA 3V3TA 1O6FA 1Q84A 2W6ZA 1A9SA 3RD5A 4LOIA 4ZALA 1VJTA 2V7QD 5LBIA 1XRPA 3PUJA 2NSHA 1RRCA 1CZOA 5F73A 2PO7A 3F3YA 4KKXB 1YL5A 4H0CA 2Q6OA 3DL4A 2H52A 1KPHA 3JTMA 1OI3A 2ZYGA 4HLNA 4RGVA 5EHNA 1YOVB 3S70A 3G2LA 1ZOOA 1JDTA 1B76A 1WCXA 1WMBA 1NF8A 2XYHA 3CUEF 3N28A 5DCLA 3PNPA 4ETIA 1VRWA 5EGNA 1QBKC 3U7QB 1J06A 2IPLA 4QBIA 1DHRA 2FK7A 3O74A 3N39C 4RPCA 3L41A 4GOXA 4JYMA 1OB5A 2XDQA 1GXSA 4DSUA 1OJ7A 2H0AA 1NN1A 4XQ0A 2GRAA 3P5BA 5EIEA 3CZ5A 5DZSA 1UK9A 4FKMA 3IDZA 1T5TA 5LB4A 1K89A 1CS0A 2EC5A 4F6CA 2EQBA 3NZEA 4J7XA 1DAKA 1NQXA 1ZD9A 1ZIOA 1MGOA 1VC2A 1FMLA 3QGMA 4UTNA 2WW8A 4X6LA 5DU2A 2QXUA 2MSLA 1YZUA 1XZEA 3AK4A 2DKOA 2Z6VA 5DX0A 2NXWA 1K4YA 3S1AA 3ZY6A 1T2AA 2PIDA 1QYXA 5EUBA 1B6GA 1UBGA 1KSGA 2C42A 4JLVA 4OHOA 3KG2A 4BDTA 3WMXA 1VG8A 1WRBA 3QVLA 1WXWA 4LS3A 1HFEL 4AMVA 2CWWA 1TA0A 2EIXA 1XHEA 2P0EA 1OWOA 3JQDA 1RWBA 1GPMA 3ZHXA 1H3NA 4ME6A 1PG2A 4PVCA 4YQZA 2VAWA 2O8DB 1CT9A 1T0IA 3IMKA 3VDRA 2OCXA 1QIEA 2XQGA 1E98A 1GARA 3D6TB 1RAFA 4J1QA 3WGKA 4IXDA 5F7ZA 1WP4A 5KYUB 3VR2D 1FFYA 5CLGA 4YRGA 2ZREA 3IPAA 2Z8YA 1JHUA 3OCUA 1FDIA 4C4SA 1L7AA 5AHRA 5A3RA 2QL7A 4IIYA 3PC7A 3GJXC 3NG1A 2REXB 1RLMA 3MNFA 4G0ZA 1U2RA 2Z04A 2ID8A 1EX6A 4US1R 1S7GA 1QO0D 3EDMA 4PPYA 4C7XA 2QPOA 1P0FA 5JJBA 5EZYF 3JQFA 4QX6A 1AZWA 1JDUA 1RI2A 1SQ0A 1T0JB 2HI0A 2ZT7A 3I05A 2BMFA 3IA7A 5T8KA 4KV7A 3VDXA 4EY7A 2CNKA 3CLUD 1WF3A 3UBTA 4IOMA 3DHWC 4C0QC 3H5WA 1SHKA 3V00A 4BLOA 1Z7YA 5ICMA 3BXHA 3ZNQA 1U8AA 2JJ1A 4TSRA 4RV9A 1UANA 5BT8A 3WYNA 3EMKA 4V0SA 1DS6A 1EEXB 2ZJFA 1MV8A 1NMEA 1AXGA 3E8XA 2A94A 3NUZA 3Q7QA 4IQ8A 2X8WA 4ZT5A 1ITZA 5PGMA 1DL5A 4ENWA 4K9RA 3PX7A 4GHWA 1FFGA 2VHJA 2VHQA 1YQ9A 3MTIA 5LP6A 1GO2A 2J9XB 4K46A 4ZQHA 5DGIA 1DVRA 2SHKA 3OJCA 3KWJA 1B73A 2JJ2A 3VR5H 2AZ4A 3WLEA 5JH7B 3PEWA 3P0FA 3GFBA 2JZCA 2W6PA 1DADA 1DJPA 4MR7A 4EUNA 5K0GA 1RYMA 1TQHA 4Y30A 4DDMA 3VR4A 1B14A 2XT6A 2KBFA 4PQRA 3DE0X 1GTG1 5IJXA 2N47A 2QR5A 2V55B 3PGJA 3U7IA 2E89A 3SYLA 5BPFA 1XHLA 1VPWA 2YWCA 2C2MA 1W0JD 3ZTWA 1FFCA 4FC6A 5JNLA 2WIGA 2O5RA 2WLSA 1N57A 1SELA 2BGMA 4PY2A 5AM4A 3V4VB 4G85A 4B6SA 4XKJA 4ES6A 2CSUA 3EVGA 2ZCUA 3EG9B 3V34A 4EK9A 1GEGA 2C5BA 1RJWA 1E6KA 1JLKA 1W87A 2W70A 4AY3A 1CNFA 1FDUA 2AUMA 1IY1A 2X23A 3WWZA 3R9KA 4ZXPA 1Q7GA 1HURA 1FW8A 2W48A 4QNMA 4EGCB 1ISPA 3LRPA 5HYVA 3EBLA 5AOAA 1E4EA 1PT5A 2JJ8A 5E6UA 4Y9UA 3VBEA 4O4IB 1G0OA 1J8FA 3G59A 3QVSA 3GJ5A 2F4NA 4ZU6X 2JEZA 3WG9A 3WA7A 4RV4A 4HD8A 2X86A 5CEFA 4ZT4A 3DD5A 3DNPA 3HP7A 1B1AA 1F2DA 1NBMD 2CZGA 3C5VA 3MMNA 5BUQA 1QDLB 1XXHE 3JQQA 1ZS9A 3DF9A 4M36A 4H16A 2CLFB 2HRCA 1FRFS 3SFTA 4YQEA 1QVVA 1P6UA 3OHSX 4DXAA 3VDNB 4OH7A 1C1HA 2BFNA 3G89A 3KOWA 4GE0A 3ZEAA 4IGAA 3W9BA 4MVJE 2X0EA 2ZR0A 4ZO4A 2XMCA 5GIOE 1QHNA 2N3ZA 3SIPA 1HWYA 3IKLA 4MGZR 1LK7A 3W9UA 4OI0A 1F2UA 2QNIA 3AHEA 3EXHA 3WNVA 4BBAA 4AI6A 5B4UA 1XZKA 4A0QA 2GRJA 3LWDA 3DV9A 4E33A 2HTFA 3G1WA 2XKAA 4YJ2B 3AYXB 3M3PA 3B20A 1MOQA 2JGDA 721PA 3LRXA 1ZK1A 1QH1A 4GKBA 1GSOA 1KARA 3PC4A 5FPPA 3BMCA 5CB6A 3IERA 3REQA 1M75A 2Z9CA 2G0NA 4AMBA 3L07A 2QW8A 4MV1A 5JD6A 3HVHA 3FJ1A 1CY6A 3CUVA 2OYRA 3VC7A 1M6YA 4COKA 1XX6A 2W6MA 4AKGA 2AHOA 3NWOA 3AHFA 2IOQA 3HSYA 5J63A 5KPDA 4F1JA 2HX1A 1E1NA 4FFRA 5IH7A 1OZHA 2K7ZA 5ALYA 1KVTA 1VCIA 4FGZA 4AMZA 2ZRIA 1X19A 1M9NA 1QVZA 2AN3A 5YASA 2CK3D 1U3GA 4JGBA 1CEQA 4ABYA 3HVRA 3PDUA 2R7AA 5THXA 3DFMA 3PYXA 3WL7A 2J67A 4BCCA 2V4UA 1QQBA 5EZ6B 3A4IA 3RRFA 5KWSA 1GZ5A 3DKKA 4M0LA 4TKVA 5FQOA 4B6EA 1UZMA 5JC1A 2IXAA 2ZUSA 3GAMA 4D3XA 3Q9SA 5EIWA 4BO3A 2EGUA 3VU1A 4X8OA 4CMIA 2DQKA 4JKOA 1PS8A 5LOVA 4HAYA 2XUHA 2QAIA 1THGA 2DFNA 5K6TA 1AF7A 1WW3A 3QHPA 1MO2A 3HDHA 3WOVA 1LTKA 2VKTA 2G3YA 1H5QA 3OOYA 5DK6A 3JYLA 3QBDA 3IFSA 3I2IA 2Q8PA 4JHXA 1C2TA 2NZVG 5IU6A 1G63A 4MJXA 5A7HA 1XXHA 1UMBB 1G2OA 1AGYA 2C1ZA 4XUEA 1LNQA 2YHBA 4RDHA 5EKTA 1YRBA 4RY8A 3QV1A 4QODA 2IYFA 3BGSA 5JSYA 3O3NB 5J4KA 3WNCA 2IYAA 2I8AA 1NDQA 2AHRA 2RARA 1HYGA 2V03A 2QTNA 2RAFA 3CCCA 5L95A 3ZBUA 3DP9A 3H9QA 3OOWA 4QJBA 2X7JA 1NM5C 2Q6IA 3MCWA 4Q15A 5AP9A 1MT3A 2QVYX 1OHHA 4PCLA 2VF5X 3KFVA 2W4QA 4QDXA 4IDEA 4IFEA 4D9JA 4JFRA 4MW1A 1Q5PA 1LC3A 2JIRA 4JLPA 3G8DA 4B34A 2HXYA 4B40A 3P0IA 2QSUA 2I4TA 1ZH6A 2BP7B 2XYRA 4JR1A 4Y2RA 2GI4A 3HC7A 4B4OA 2BFAA 3CT4A 3GN2A 4FX2A 4AJIA 2DH5A 3CT6A 3KXKA 3UJDA 5JYEA 1P5RA 2GN6A 3MJCA 4H7IA 4RLHA 2BEUA 5IK2D 1K7FB 2MOKA 3I9OA 3FTNA 2AH5A 1ZCZA 2REQB 1YBVA 1C0PA 2V7GA 1RQ2A 1VCHA 2ORYA 2X1MA 3B1VA 4XWAA 3NTUA 1GZ7A 2O54A 4OYRA 2HHLA 1UKBA 1VP3A 2IEIA 3BD9A 3HZRA 1T6NA 4Q37A 3OCZA 4JI5B 3V7NA 4B83A 1AKNA 1E8MA 2X9VA 4QYWA 4ARCA 1JG1A 1NBIA 3IQGX 2R6HA 3LKDA 4O1MA 5J59A 3F6RA 3LOPA 4QOIA 3LHKA 3EVZA 4FCWA 4GR5A 3C6YA 4KO1S 4HH4A 3NIFB 4FYJA 4WOPA 4UPVA 3HJUA 1KKUA 1OYWA 2BZSA 1F4VA 3HEMA 4K6GA 4U5XA 3BMQA 3VR3A 3M5PA 4DL9A 3HDVA 1JJBA 3ZHQA 5BUZA 1NPYA 1XCLA 5T8KC 6REQB 2BHLA 2Z57A 3IE1A 2IS4A 5NLLA 3B2QA 5FOSA 4HYYA 1Z5PA 2QN8A 2X2FA 3FSGA 1CFZA 1RXWA 2OGWA 2LR0A 1CUZA 2MTBA 5FOVA 1SPXA 3CQ9A 5DTJA 3N5CA 1AQJA 4UVDA 2XMZA 4B3DA 4BBPA 2JPDA 3MK31 3PGVA 4H4EA 2YJNA 4TOIA 3VJMA 4JI0B 1G41A 5AVJA 5D5QA 1IBCA 2PQ2A 4PC1A 4MMYB 1Q95A 5CVJA 3VNRA 2XRZA 3A6GA 3VZBA 2PX6A 4URXR 1Q74A 3MJSA 4XJXA 1Z07A 5JCJA 4NK4A 2QMUA 4DV2B 2CVHA 4R1NA 1ADYA 3RQIA 4EHBA 2QUIA 4A73A 4HDRA 4Z49A 3GJ4A 1LDGA 2XV1A 3ZWVA 4PANA 1C4OA 3CGGA 4UUPA 4WA8A 2XXAA 5I7UA 2I7XA 3H3JA 3I34X 5LQSA 1JFSA 4JBHA 1NT4A 2I9KA 2OAGA 4R1QA 2Y0BA 4CQMB 4URZR 1JH8A 1RAEA 5K20A 2YOGA 5F2NA 3HJGA 3WJ7A 4EIWA 3P94A 1HDGO 5CYOA 1N0IA 2EJWA 1M3SA 1UMDB 2ZPAA 3CWQA 2GN1A 4ENRA 3AY7A 4BUZA 1XK7A 3QU9A 1DIHA 4CKEB 4AAYA 3JS5A 5B57C 4UNQA 2O1XA 3R7BA 1QOZA 4EFMA 3DUFB 4JT4A 4G25A 2JCSA 2XZDA 5FQNA 1BSVA 4OATA 4Z7NB 2AN4A 4XCXA 4MV7A 3STTA 4CIAA 2A58A 3AJ9A 3H3FA 4J0DA 1VIAA 1YTUA 3EIOA 4PYOA 3REOA 4EKDA 4B3GA 3DC2A 3R5XA 4KHZA 1A8UA 2C61A 2FP3A 3LKVA 4Z9FA 3IUJA 1D2HA 2QW0X 4ENUA 1CUDA 1E60A 4YMSA 1A27A 4V1CB 1YL6A 1W8DA 4C6HA 2F2TA 2BFDB 3REFA 5TJHA 5IC4A 3EIQA 1C41A 2HT6A 3AWIA 3FZYA 1L5FA 3M1YA 4HTFA 1B3RA 2W2MA 4IYRA 3TX6A 4DIUA 2UXCB 2WJIA 3CX6A 4E70A 4FFBA 4V0KA 3WIEA 3KBBA 1QP7A 1CZUA 1F6DA 1IM2A 4R98A 2AS0A 1J24A 3SI7A 1DIBA 4WL0A 5DBFA 4ZQIA 4BN4A 4CEHB 1D4FA 2Y2VA 3DSRA 3K72B 4OAQA 3MLEA 3UAWA 3BE8A 1S8FA 3FDFA 4LBZA 3IOCA 4JMPA 1ZD2P 3GJ6A 3ICCA 3RSCA 2IQ5A 2MSKA 4HFNA 1GDDA 3IODA 5DN6A 3RNLA 1Q1BA 1XZIA 1ACLA 1VJGA 3AEUA 3CJQA 4MV6A 4P7JA 5ALMA 3ZNOA 3OTHA 5CBPB 1WXFA 4WADA 4HY3A 4DQ0A 1ZRMA 2P4UA 2YMQA 1M33A 3NU1A 1RRPA 1UPCA 5FT9A 2EWWA 1T91A 3SYRA 3TPFA 5KYYA 3VRHA 1GV0A 1P2BA 3IPCA 2QROA 3UQYS 1W1WA 1KK2A 4KXMA 4EHDA 3GFTA 5JYCA 3NANA 4D44A 1SOMA 1C1DA 2RBKA 1JPVA 1TCBA 2XVYA 3I45A 1Z37A 4D9KA 1NDHA 3W5AA 4YJDA 4UTXA 2XTMA 4U7PB 1OBCA 4UUQA 3OAAA 4JROA 4UJ5A 1PFUA 5J1SB 3I2GA 2B69A 3FMOB 1PFGA 3A04A 3U40A 5FPKA 1RAIA 5I7OA 1C3EA 1Z8HA 2QTZA 3LF1A 5LVAA 2C9MA 2UZ4A 2M6LA 1SCAA 3CV3A 3JYOA 1II8A 2OUIA 2YJ3A 4AZWA 1NHGA 1XUOA 4H0FA 3JYQA 2YC4C 3L7CA 3E3MA 3DVQX 2YFHA 3KKNA 1WM1A 3JD0A 3D0KA 3QFHA 3GGSA 3SVZA 1Y6GA 3DEIA 1PJ8A 1ZXLA 2VNJA 1Q16A 2YDYA 3W1EA 4D9BA 2IP1A 3II6X 1J9GA 3N3BC 2FPXA 2EL9A 4HR7A 1T13A 3SIRA 4JJIA 1A9QA 1ARZA 1RQNA 1IBLB 2NNLD 3ORYA 1AGXA 2BR4A 4IQFA 4AY6A 2WJ6A 5FLYA 2VDQB 3AP3A 3K0FB 3N7TA 3EISA 2Z8XA 4BX8A 1J1IA 1SC4A 3GH3A 4LISA 1DT3A 4PPFA 3KT6A 1QM5A 2JJ1D 1L7VC 3JQBC 2HRQA 1HNXB 5JNVA 4R8MA 2DJIA 4CR8A 1JU4A 1R3DA 2XHZA 2PT9A 1BVUA 3L0OA 2QRKA 3CMCO 3PD0A 1NBOA 2WQ6A 5FPSA 3OPQA 4UASA 2ISQA 4C21A 5A2GA 5LYJF 4JKYA 3DT6A 1LKZA 3MWKA 5FXMA 1UJMA 2X40A 4GVPA 5ALJA 2HAEA 1GSIA 2ZQZA 1CHNA 3N8DA 3NDJA 3DFIA 4EQZA 2YZKA 2X1VA 1FJXA 4Q3BA 4QM6A 4P3KA 4MUBA 5A7FA 1JECA 1JMYA 1BXKA 3HNPA 3X44A 1SH7A 1YK0A 3KQYA 2GA8A 3HUDA 5F3RA 1VL2A 5C53B 2W0MA 4OQZA 2ZTHA 3VR4D 4AF8A 2FSVA 5L4SA 2BM1A 4J0IA 1NURA 4MVCA 3ABIA 4ZYTA 1OH7A 3LT5A 2Q1WA 3NGXA 1XPRA 3ADDA 3D9QX 1NATA 2MYPA 2NM0A 2QTAA 3L8FA 4HFJA 3PXUA 3VR6D 2O14A 4KVZA 1CY7A 3MWJA 4M99A 4KQCA 3CUKA 4W7HA 4LSZA 4ER7A 1E9SA 2R9VA 2H2DA 4OPMA 3DPIA 2LUOA 4B3BA 3OPMA 3E58A 4EF5A 1E5TA 4UOZA 4HDNB 3CVUA 5LPNA 5ECDA 5HE8A 4JH0A 5E9JA 3ZGNA 4F04A 5D1NA 3K53A 4C30A 4WECA 2RKBA 2VDVE 3V1MA 2B9EA 5C7IO 3PLNA 1RCFA 2P6MA 3AR9A 1IH8A 4J0KA 5JNWA 1WZIA 3KUUA 1RS0A 3V4PB 1I3NA 4DZZA 2D7DA 1GPKA 3U3DA 2HDNB 3TM5A 1XCOA 2WSBA 1MPXA 2FP4B 3I6YA 3NFYA 4OI4A 2VYVA 3KDPA 4XWGA 2ZDQA 2B8JA 1KE1A 4XA8A 4ALIA 5HJ2A 2M6RA 2JRLA 1YB7A 3VC3A 3SE0A 3VH3A 3Q7RA 4DEVA 9GPBA 4HUTA 2XGMA 2GD0A 2ORIA 1Q20A 2WSLA 1P7PA 2GM3A 4LA4A 4J4HA 5DGDA 2ZB2A 2HHAA 3ZD9A 2VDWB 1EVLA 3W3ZB 4BNWA 4KIFA 1CE8A 2FZWA 4O2LA 3UT5B 3INNA 1OLOA 3C14C 4J4BA 2VIIA 3EAFA 4M4SA 1ZONA 1MO4A 2YWFA 5DCYA 3ZHCA 2WHPA 4LZZA 5IARA 1F8YA 2OGZA 3L0PA 4BFWA 3Q98A 1NYRA 2XPCA 5BR1A 2FYTA 1UFVA 3CUTA 3KKZA 4OP1A 1S89A 1H1TA 2XWQA 3NTOA 4R3WA 5G4KA 2QV7A 1SCUA 2ETXA 4RY2A 1NA5A 3EW9A 2I76A 1EJ2A 1LY1A 4JL8A 2Q6VA 3JPWA 3C7AA 3LL4A 2HB6A 2XMPA 2ZAGA 3DUWA 3G68A 4I99A 4UDNA 1GQYA 2Y1LA 4L02A 3GLRA 1RQRA 4LYHA 4ZQCB 1OFVA 4TXHA 3BKWA 4L15A 1AF4A 2I2XB 3KQOA 3P9CA 1GWNA 2P9CA 2I3GA 1BYUA 3KTAA 3UMJA 3RAEC 3PQ3A 4HVLA 4O25A 3HXTA 3MGAA 1ULHA 3QRWA 1WDLA 4JC0A 5B1IA 3ZHOA 4BVAA 3CZMA 4FOOA 4YRNA 1TTPB 1HFWA 1PW5A 121PA 3EF3A 1FDVA 2D2IA 5GP1A 2AA3A 3S2FA 3VR6H 2IU3A 2VTBA 4XYMA 1NW9B 3KTDA 4UBMA 4FFMA 4CPDA 3DJYA 1BW9A 3GLUA 1D8AA 1NJ5A 4I55A 4BO2A 5HKLA 2EXXA 1A5AB 3A32A 5E7IA 1AG9A 3TB6A 3T0IA 3PQCA 1EI9A 1RMTA 2DLNA 2PL9A 4FM9A 4I4IA 1XAGA 3ODGA 1LPNA 5HDBB 3PS9A 1N2EA 2WWIA 4WRRA 5J58A 4KNYA 2GXAA 2E21A 4W1QA 1F5NA 4OHPA 2D5AA 1EDEA 2CN1A 2WB4A 3L8EA 4YRIA 2IHTA 2GM9A 4B3JA 3HEAA 3E82A 4UUBA 4FLEA 3RFVA 3QUSA 4OBWA 3KD2A 5C3MA 1P7CA 2QK4A 1KRXA 3NXSA 3ICOA 1Q6ZA 1QE0A 4OOFA 3C2QA 2C3PA 2ZYRA 3NLLA 3UT0A 3DDHA 4J75A 4WXYB 5B1DA 5E7JA 5IDXA 3V7FA 7MHTA 1BKDR 2H1SA 3NOVA 2PSFA 3DOHA 1AH2A 3UKOA 4MVJD 3JQ8B 3IKVA 2AQHA 1R0KA 2IC5A 3HJFA 3C0KA 4OMFG 5F9MA 1OFGA 3ZK8A 2V59A 4QOFA 3T12A 1ECLA 1OHHD 1RYBA 2GPNA 3WP0A 2GR9A 2PM8A 3EPRA 4BJHB 1YRLA 2K6GA 2WJPA 2YKGA 1VE1A 1XTPA 2CFIA 2GCNA 2PTHA 1W9HA 3B12A 4JCCA 4MHSA 3A3KA 2G77B 1LQUA 2YHAA 4ZDJA 3VDQA 1A50B 3AUFA 2RGAA 3DFZA 1CY0A 1NC1A 2IZ0A 2W2KA 2BLLA 3F74A 4W1SA 4KWCA 4A26A 1Q2UA 1T9GS 2R1VA 3H4TA 3ZV3A 1PVOA 2C0QA 3UCXA 4BLUA 5LWQA 1GU0A 3L4BC 3D3WA 1DO2A 1DFHA 3E4CA 3OOSA 4KAFA 4HVCA 1R15A 1EVIA 3H1FA 1EVYA 4DBZA 1TC1A 1EFAA 3EDYA 3HXKA 4F3CA 2WWTA 4IZHA 4X7PA 2FHSA 3GFGA 3CWCA 1U98A 1YJBA 3K4QA 1U7UA 1EG7A 3ZWBA 4ZZ2A 1V11B 1XRJA 3DXXA 4TYWA 1QX3A 3DHNA 3GRKA 2C7OA 3QXCA 1ZKMA 3LP8A 1JEAA 3HU5A 3VDMA 4FHZA 4XYBA 3RNOA 4DMCA 4KPUB 4ED9A 4B43A 4BE7B 5LB2A 1SKAA 4Q7QA 3MELA 1Y1QA 2A57A 4TTIA 3VR3D 4Z3KA 2OESA 3FVRA 5DTMA 4BC1A 1DTWA 1E1QA 1EZ1A 5EVJA 1LFAA 1JW9B 5A3QA 5C8VA 1VRCA 5BYAA 2O6HA 2BY4A 4P38A 4DRXA 4A27A 5JBNA 2C2HA 2FPPA 2PLNA 3DEAA 1YNSA 1HGXA 1Y7IA 4IDNA 3JZIA 4LPSA 5E4FA 4B3HA 3TIVA 4ZHQB 4OX9B 1PAUA 5TGTA 1Q12A 2HLDA 3ESXA 2C4HA 4OJTA 4EG0A 4NOLA 3DEZA 1CIJA 1R4NB 5INTA 3ED5A 4DR5B 4JXXA 2GUWA 4TQAA 4RJLA 1SIUA 2PFGA 1M2NA 3N86A 1WB9A 1GPYA 1C30A 3T3MB 4BC0A 1NFFA 1FDWA 3PQ6A 4QBGB 4MVJH 4TWJA 3ZCXA 4HRXA 3VKFA 5IHPA 3CWZA 1DPGA 2C5LA 5J1TB 3ZW8A 4M98A 5BQFA 1E1MA 2W6IA 5JCJD 2BDEA 2CVZA 4TMTA 3CKMA 3JY6A 4QUBA 4C3OB 3HSKA 3V6LA 1GILA 4PF1A 4W1RA 4N82A 3H9BA 2NYRA 4U7TB 5E7MA 1HEUA 1XQXA 4Q02A 2AI1A 2WWYA 3W2FA 4B2YA 2GBFA 4GS5A 5ERGB 3FNIA 5I7FA 2XVMA 2GNAA 1KQ3A 5E1DA 2G08A 2R96A 4NEQA 2V7EA 2BZ1A 4ZVVA 5C9ZA 1E3QA 2OSVA 1MW8X 3KYDB 3ORFA 5FNVB 5JJKA 2VJBA 5CXQA 3INRA 5JAPA 1PZMA 2FEAA 1E3JA 2XA9A 5K2MA 3S27A 1V8DA 3UN1A 3STXA 3WKDA 3ZY4A 3L7NA 1JJFA 3QVGA 1HR0B 2CL7X 4ANFA 3Q5DA 5FYQA 3GLGB 4D96A 3NJ4A 1GLVA 2OA0A 1H5NA 1LW7A 3KWFA 2GAAA 3RIMA 3O8CA 3L0ZA 3IXQA 4A8HA 4DNOA 2WVGA 2YJGA 3DE2X 4WBNA 4BMZA 1BCRB 9ABPA 4GOJA 3ULKA 1KRWA 3E2MA 1B3BA 2AXQA 2J9RA 1Y8AA 2JAWA 4YUWA 2ATVA 2P5TB 4PZEA 5GAJA 3T3DA 3UCFA 4TKZA 1DEHA 1BDHA 2BRUA 3PQ4A 4KZPA 3TBHA 1RLIA 5AI4A 5AKYA 2R8YA 1G55A 3TDMA 5IJWA 2R6JA 3IE0A 1F1JA 3UB2A 3FDIA 2OKCA 5J2UF 4F1WA 4Y2XA 2ARKA 3AERB 5AI0A 2YCBA 1KJYA 1Z4JA 4I6EA 4B3SB 1W2GA 4MIEA 3MOIA 1LC0A 3FFAA 5BV7A 2HR1A 4ATNA 3A6HA 1MB2A 1A1VA 3PGLA 1QIFA 4JLUA 4LZOA 1DKOA 3ZWCA 1E3LA 1K75A 1LQ2A 1IQRA 2REOA 1EKXA 1RWNA 1IEWA 1UBTS 2ZPUA 3H2GA 3IEUA 4G26A 3EPPA 5TS3A 5I7VA 1TO2E 1L2TA 3REGA 3ZJ4A 1RZRA 1GL9B 3RRZA 3RVOA 1EHCA 3IAM6 1FRZA 3GARA 3LUHA 3RREA 1KEWA 1Z2OX 2IK8A 2EZUA 3GEMA 3B1JA 2QQ5A 3R3VA 4QFBA 3IQXA 2KWIA 2NO0A 4Z0TA 3HKEA 1IN5A 4IG4A 4C4AA 4FKZA 3FHTA 1DRWA 5KB3A 5F7XA 3OAAD 4HN4B 2P41A 1ZOSA 4UPDA 2VUUA 4WEOA 2QQGA 4KRYA 4CN8A 1MEJA 2PY6A 3M6UA 2B6HA 4GI2A 4JVNA 4RVUA 4LGCA 4G5XA 2CL5A 2DBVO 2EFEB 5CLIA 4WOKA 2P5UA 4KQKA 5KQRA 1KETA 5HIJA 4ND4A 3A1CA 2JZNA 3EMVA 4Q1BA 2R5FA 4WH0A 3VU8A 2ODWA 1NMSA 2P6UA 3CCBA 4PZ9A 4LRYA 3T5TA 4HI0E 5L7TA 1NE2A 4LTNA 4F4HA 2QNBA 4K86A 3TLBA 2NYVA 3AEKA 3D3QA 4LOJA 3ZCSA 1QE3A 2UYHA 3ZDCA 4JIMA 4OUKX 4UNIA 1N6IA 2BGLA 1N7IA 1Q91A 1O3YA 2NVWA 1E94E 2AIRA 3FWZA 2H1OA 1JMVA 3RH0A 2AK3A 1K2VN 3TOZA 1U0RA 4F9GA 1Y3FE 1EP1B 3Q7TA 3TEMA 5IUNC 4HHEA 3RE1A 3ETGA 4BGDA 1GRCA 5DOVA 1T2EA 4C9BA 2RB5A 1FRVA 1RI5A 2GPBA 3D3JA 2IX9A 1SHJA 2BKAA 1YJAA 1TW3A 4F9EA 3UWMA 3HB7A 4YA6A 3ZE7A 5HOEA 3EEBA 1XC7A 1VIYA 3LKZA 3BDAA 4N03A 2AWOA 3VGJA 1U63A 1KDRA 1H66A 5T4EA 3AR3A 1ZD5A 2FPKA 3CZCA 5B64A 1YBHA 5JZSA 1P2SA 2CC2A 1CFJA 2PX2A 1S1MA 2PV0A 1HDZA 1F6BA 3U1VA 1RC1A 5MFZA 5AVZA 1J2TA 1NYQA 3E7XA 1E6MA 1G7SA 3PEYA 4WLUA 1WV1A 3ACDA 1KYXA 4TKUB 2O2HA 3NORA 1NNEA 1Y3CE 2TS1A 1OX4B 2EF0A 2RGXA 4DF3A 1YB4A 3VSAA 4Y0AA 1ZDMA 2JF0A 4CIDA 4DRZA 4OFWA 1OAAA 1VLMA 4QFMA 3WLTA 1U1DA 3OX3A 3E4DA 1WPXA 4IHJB 1L5WA 1YIAA 3OPVA 1FU4A 3BE4A 4KXLA 4RKWA 5DIFA 1L1FA 3U17A 2J7PA 2V7UA 3T3PB 4BTLA 2AN9A 2FWJA 3NUGA 5A4JA 1X1QA 3D2AA 4JOCA 1X1TA 4CM3A 3TTXA 4QZVA 3EIEA 1TAHA 4YUAA 5HRCA 1KXJA 1GPDG 3DDSA 4FGLA 1CY2A 1UUFA 1LDYA 4Q01A 4LCBA 1GKLA 3WGQA 1IVNA 2ASVA 3IUYA 4LRWA 3QX9A 3N76A 1ZL2A 5AHXA 5D2CA 3E22B 4KRGA 1DC7A 1FEZA 1NVVQ 3ZZMA 1NR5A 2FSFA 2NGRA 2J5KA 1L4GA 2OV4A 3B6ZA 4IDQA 3R41A 1A88A 3TFQA 1TEVA 5B1HA 2B94A 4YLEA 5L7WA 4S0ZA 4WCFA 3DM5A 2VYVD 4NCIA 5HNKA 3EVAA 3ETEA 2RB4A 3NNSA 3MWEB 4M9XA 4BKPA 1J2EA 1QYRA 4ZEXA 1HA3A 3CRMA 1JKJB 5HIIA 5A6VA 1TCUA 3RUIA 5CB4B 1UT5A 4F60A 4DKJA 5I5GA 2ZUVA 5CDYA 3G2QA 3Q87B 1S02A 3HUTA 1XWFA 2IW3A 2EJCA 3KLBA 2PLRA 1NVUQ 1P3JA 1W6RA 3QVWA 3DYVA 1G3UA 3LKBA 3DLAA 4TL6A 5B53A 2XWPA 4F45A 1PWEA 4UVEA 4IMIB 5HOQA 5BN4A 5B5SA 4HN9A 2JLZA 4KLNA 3MPUA 3ZWKA 2YIVX 3BPSA 2GCOB 1F06A 3G5UA 3K3PA 1FZQA 1CDZA 2D1SA 5CVDA 1L5NA 4ZMBA 4BQPA 2HCBA 1KZ4A 5MN4A 1XZ8A 3WB1A 4DC1A 1FNSA 2PO5A 4URFA 4BIMA 3A9UA 4DM4A 3QA3E 3OQ1A 4I6JA 4UTRA 3V8PA 1RDFA 2C9ZA 4K5QA 4P0QB 4BLWA 1E9AA 2IYNA 3RKSA 3W8FA 1F12A 4KYVA 4U2FA 1K3TA 4GBED 2AI2A 5C31A 2F3QA 2KPOA 3QA9A 1K5PA 4B74A 4BQEA 2R7LA 4D3FA 2ZJBA 3GNTA 2Z1NA 4N47A 4LEIA 4I2VA 3LWZA 3QBTA 4TYNA 2QP9X 1Q0UA 4EW1A 3G5MA 1SGWA 1SD1A 3OE5A 2OLJA 1WKCA 4EB6B 1O2DA 2AI3A 3H5LA 3K9NA 1F8GA 3AU8A 3ET5A 3FMIA 3NM5A 1GPH1 4CR7A 4WNAB 3CF4G 1VYTA 4TUYF 1ETHA 1RHQA 2QMZA 4ZJUA 1NTOA 4OO3A 2JFNA 5CA0B 1VPEA 2BRUC 2W37A 3FUVA 5CR9A 3RFXA 2IBSA 4JNCA 1H69A 1YK1A 1TAGA 1GGEA 2VJNA 2DR0A 3BMNB 2X5KO 3NIDB 4HNSA 1E0SA 1XV5A 4FFPA 4KB5A 2BEKA 4RSGA 1ESNA 4MRMB 5D6NA 1G4UR 3P4UA 2UAGA 1G60A 4W8HA 4P2BA 3H4MA 3VTFA 2VS1A 4MYSA 4BNDA 5I48A 1CR0A 3C8HA 4HQ0A 1T8PA 1TVEA 3BSWA 3TBFA 4QUJA 3S29A 4GBGA 2Y4NA 1RWWA 1ML3A 4M8LA 4J2TA 4I9UA 2AG6A 2O0KA 4F5EA 2RHLA 4CE6A 3HJCA 4A6PA 3ETNA 4IVRA 3OFVA 3RS8A 4GC9A 2CXRA 2WF7A 1D0IA 4B8ZA 5JISA 3VXKA 1PNRA 2BH9A 4MR9B 4G0WA 4DS3A 3LBFA 3LNTA 3LGSA 2NZ8A 4NYMQ 5EKSA 2XD9A 4FI3C 4IDAA 5M3BA 1TUIA 2CJFA 3G2HA 5I8PA 4HB0A 3U9LA 2VSQA 4RADA 3PC2A 4BQFA 3EY4A 1JAHA 4MQ6A 2GZRA 4IHJF 4PXAA 4RWZA 5KDOA 5CEJA 1JHPA 2H0QA 4GX0A 2CHVA 1SQSA 1TLTA 2P9TA 4A0GA 3M6IA 2OM2A 3E7FA 2ZYTX 5K05A 4IJMA 1JT9A 1KTVA 2Z43A 1JG2A 1DHTA 3AHCA 2VC2B 2RI6A 3FWPA 4PYIA 5KYKA 1FFXA 2VOEA 1ZFNA 2VBIA 1L5LA 3A26A 5KTRA 4BNKA 5PNTA 1Y1LA 4YJGB 5HCIA 4UEWA 3A4MA 1U2SA 2HZBA 4KW7A 4RV5A 4IKEA 3UMVA 1PR9A 1M73E 4HBZA 1D0SA 1RJEA 3BORA 3CTPA 1NOKA 4FB4A 5BR7A 1D5CA 1PFQA 2PZEA 1EVKA 2FJ0A 3EGCA 2QLLA 3PUVA 4NFLA 2GEUA 3QUBA 1V5WA 4PGAA 3TE7A 3SKXA 5KUTA 3ZX4A 1OI2A 1I1QB 1X7YB 3RV3A 2M6SA 3KEOA 4PSDA 3TXYA 3VZSA 1WS6A 2JHPA 1E1QD 1LRKA 5JYBA 3S1LA 3EEOA 4ZOLB 4QUKA 4DPKA 1P72A 3I9MA 4LOLA 5DN9A 3CZQA 5HQ3A 1CB7A 5JAOA 3T5AA 4LWQA 5ALKA 1BQ3A 2H5EA 1GPAA 3DBVO 1D6JA 4MLPA 1EP2B 1V4NA 1TZKA 2HLDD 1US8A 4LJLA 5EJ8A 3I1YA 3QPAA 1I5RA 4QD3A 4K1LA 1U9IA 4FS8A 3ONNA 1XDWA 2PFKA 5IT5A 4C3VA 5BW6B 2ZUFA 2O8FA 2QUJA 3PT5A 4IJ5A 4R1PA 3JD4A 3OZXA 5AICA 2J9GA 4OLHA 2BW0A 5E4JA 2IV3A 1GGVA 4Q19A 3KNZA 5HWSA 1KI9A 1NSTA 3AUYA 4TRNA 3WGYA 1L4EA 2QF7A 3LZDA 1LU9A 2X41A 1JHAA 2ENUA 3BCSA 3C1UA 4YP9A 3WBBA 3GO4A 3GUYA 3L8DA 2OQ2A 2XNKA 1QNLA 3Q6NA 3WYCA 3FWYA 1S8AA 1U8FO 2FMHA 1O9GA 3BTSA 2Z8ZA 5AHOA 3M49A 1ZGCA 3CUYA 4MTLA 3RHZA 5JSKA 4Q00A 3E61A 3S68A 2XUOA 4GXTA 4D3DA 4E11A 3KLMX 4Q9DA 4NBNA 3C3WA 4LKOA 1E58A 1JIVA 1CTQA 5CCEA 2J0VA 3UA3A 2H7XA 3B89A 3SICE 3NRJA 3E8SA 5K51A 4YTEA 3AO0B 4GSLA 3OM8A 4RSRA 1UJ6A 4YO7A 4ZT7A 1HL7A 1FTQA 5CURA 2I33A 1DQZA 3JQ7A 3BHJA 4F91B 1X8JA 2C8JA 4BKUA 1YQEA 3DVAA 3TI9A 2IWRA 4AVYA 4QHSA 1T5DX 5CHEA 3SJZA 4FLFA 1B00A 4GR4A 4R0NA 5KBYA 3GLIA 1AZTA 3FPBA 3V80A 4D9IA 1WZNA 1E61A 4B7CA 1AJEA 4G1EB 3UAOA 3FSRA 5IRCD 1VG1A 3IP6A 3LUFA 2FY8A 5KPJA 1SC6A 5JXHA 4QT4A 3CEPB 3TCNA 3WYAA 1I01A 2DUJA 4UBIA 3ROMA 4RVGA 2F9MA 3GN1A 4J2OA 5JJ5A 3NB0A 5AVWA 3KHUA 5E4YA 3IO5A 5AKZA 3T9CA 3VKUA 2IYSA 1ZHFA 2NVBA 1N3LA 2ZJ1A 1H6AA 5CBKA 1HT3A 4IEFB 1LVUA 3UOAB 2ZXFA 3KT0A 2CV1A 2OE2A 3GBVA 2ZSBA 1T0BA 4ZN6A 2GVDC 1V6AA 2WU3A 4WOBA