1N9ZA

Integrin alpha m i domain mutant
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
184
structure length
184
Chain Sequence
CSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQLKKSKTLFSLMQYSEEFRIHFTFKEFQNNPNPRSLVKPITQLLGRTHTATGIRKVVRELFNITNGARKNAFKILVVITDGEKFGDPLGYEDVIPEADREGVIRYVIGVGDAFRSEKSRQELNTIASKPPRDHVFQVNNFEALKTIQNQLREC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrin alpha-M
publication title Engineered allosteric mutants of the integrin alphaMbeta2 I domain: structural and functional studies
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 65
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2002-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 1n9zA00
1M1UA 4NEHB 1CK4A 4O02B 5HGJA 1AOXA 2VDOB 3ZDYB 3Q3GE 1JEYB 3TVYA 3EH2A 1JEYA 1M2OA 4WK2B 3HXOA 4UM8B 2ODQA 1RRKA 2VDQB 4WJKB 5HJ2A 1DZIA 1T6BY 2VDNB 5HDBB 5E6SB 4C29A 4HQOA 4JDUA 5E6SA 4HQNA 4Z7NB 3VI3B 1OAKA 3HI6A 1JV2B 3F74A 1DGQA 1MJNA 1ZOOA 1T0PA 2I6QA 3GXBA 1M10A 5LN1A 2ODPA 1PD0A 1UEXC 3K72B 3TW0A 1QC5B 1XUOA 1QC5A 1FNSA 4IGIA 4A0QA 4WK4B 1MHPA 4CN8A 2QTVA 5KYUB 5KYWB 1PT6A 1MF7A 5KYUA 3V4PB 5KYWA 2WW8A 4BJ3A 3EGXB 4PN7A 1PD1A 4UM9B 4FX5A 3EGXA 4F1JA 1ZOPA 4MMZB 1U8CB 1U0NA 2B2XA 3F78A 1IJKA 3M6FA 3QA3E 1IDOA 5KYNA 3ZE1B 3V4VB 3ZDXB 2ICAA 3PPXA 5KYYB 4Z7OB 5KYYA 1N3YA 2NVOA 3EOAI 4MMYB 4Z7QB 4IXDA 4UM9D 1BHQ1 1SQ0A 2VDPB 3T3PB 1LFAA 4C2BA 3TCXB 5KYXB 2VDMB 2IUEA 5KYXA 3FCSB 3ZDZB 1ZONA 4G1MB 1RS0A 4WK0B 2NUTB 1IJBA 1AUQA 1L5GB 2NUTA 1RD4A 3NIDB 1MQAA 1M2VB 3BQNB 3PPWA 5E6UB 1BHO1 1M2VA 1XDDA 5E6UA 2VC2B 3EFOB 1TYEB 4DMUB 1JLMA 1N9ZA 3EFOA 3RAGA 3VI4B 2XGGA 2VDRB 1QCYA 3BN3A 3IJEB 1IDN1 4HQFA 1JEQB 1AO3A 4WFQA 1JEQA 1PCXA 3EG9B 3EG9A 3TXAA 4CNBA 1Q0PA 4NENB 3NIGB 1SHUX 3FCUB 2VDLB 1V7PC 2XWJI 3PPYA 4NENA 1SHTX 4C2AA 4F1KA 1CQPA 2X5NA 3ZQKA 5E6RB 2M32A 1XDGA 2XWBF 3N2NA 5E6RA 2O7NA 3K6SB 2I91A 4HQKA 3EGDB 3BQMB 4MMXB 3PPVA 4CN9A 2I6SA 3K6SA 3EGDA 3K71B 1RTKA 2ADFA 4G1EB 4XW2A 3E2MA 2VDKB 1YVPA 3T3MB 3HXQA 1MQ9A 4HQLA 5ES4B 3IBSA 3NIFB 1ATZA 1MQ8B 4IHKA 3ZE2B 1M1XB 1U0OC 2NUPB 2WINI 4M76B 1YVRA 2NUPA 1FE8A 3ZE0B 5BV8A 3EOBI 3EH1A 1NA5A
chains in the Genus database with same CATH superfamily
4CR8A 1QV9A 4JCOA 3WGYA 2P1ZA 4PAGA 1F0KA 1ZEJA 2PKWA 1CUAA 1WA5A 3TUIC 4KQ2A 4WV3A 4GOMD 2EU8A 2H4WA 3OF2A 5AUNB 1G8KA 1AKYA 3OX1A 5TNXA 3W34A 3OQBA 2GBGA 1BMFA 1U4OA 3R41A 4MJLA 4TKVB 1APBA 2HY7A 3WMGA 2ZI9A 1SU6A 4TKVA 3C6QA 1VHLA 1N0UA 2VNKA 3KYCB 1ST3A 2O5EA 3G23A 4RJIA 4JI0B 1J2EA 2QM0A 3KYCA 1I2AA 4MO2A 3UF0A 4E2XA 5JXJA 4D3DA 1ZA1A 3RRFA 4BTEA 5JV5A 4A15A 1ISSA 3MTGA 1DMSA 4IDCA 1PZNA 5ALNA 2G63A 5TB5A 2WWXA 1T0PA 5GZ1A 4E07A 1EFDN 4JL6A 3BE4A 1YZ3A 1RWQA 1Y4UA 3VZCA 2QRMA 2H57A 3DTVD 5HVNA 2CHQA 3CZ5A 2Q3MA 1ZVJA 4JR1A 5CAEB 3TLKA 5CAEA 4MULA 4D3ZA 1ONSA 4HDOB 3ZVLA 3IELA 4IGIA 2AOTB 2FZLA 3U7FB 2AOTA 1AQYA 4MPJA 1PK9A 3LDGA 4KQIA 4MVJG 4E30A 4PRKA 1C41A 4EFDA 2IPXA 1KI6B 1QYVA 2CUZA 4GM4A 1VKHA 2IBTA 2PSSA 1KI6A 1HTWA 2ZRAA 3EGXB 3LQYA 4B31A 4BNTA 3EGXA 4HGPA 5HXAA 1NHWA 4IR7A 4M1OA 3AINA 4PLWA 5JR3A 1XMOB 4OQLA 4QU8A 1UK7A 3EZGA 4N12A 2HWWA 5H3HA 5KSPA 2V9PA 2IBMA 4AO6A 2PO5A 3O93A 2NU9B 5DNDA 2NU9A 3BF8A 3F97A 3TL2A 4G07A 3B1XA 2Z8XA 1U1IA 1YCFA 1I4DD 1ST2A 2P6NA 2SECE 4FSXA 4LC0A 5EMHA 1U6KA 2OXFA 1WUYA 4KU4A 4U1RA 5TGZA 3FZYA 3CSSA 2WNIA 1XVLA 1Y7TA 1HYHA 2R48A 4Z4IA 1J2YA 4R8SA 3G0GA 3TZLA 4UHCA 4C22A 2Z2XA 1IXYA 5F5XA 3V1TC 3UJDA 2YHIA 4JI4B 3CZAA 3CW9A 3EFOB 5LD2B 2EDAA 2OECA 3HYSA 3LC2O 1PWHA 2HU2A 3BA6A 1J33A 1W85B 3EFOA 2XZOA 2KYRA 1MG5A 1W85A 1WG8A 4M49A 4CIXA 4MUJA 3DW1X 1S02A 3QITA 1P0FA 3BM5A 3E7XA 3PHJA 2VF4X 4F2WA 2HUPA 1XZJA 4NU0A 4QVIA 1HH4A 1C81A 2I34A 3GNLA 2PD4A 1Z8HA 2IWHA 3WO1A 4BLUA 1G7RA 2NXJA 5BUQA 3GLGA 3CBGA 3UJBA 3B2QA 1L7PA 5TVKA 4Y0VA 1W88B 2BHSA 1PTJC 2J5KA 4O4HB 4PE5B 2QRPA 3NBXX 1W88A 2O2IA 4LY6A 1LBEA 2OHJA 1Z7EA 4JQSA 4O4HA 2IZ1A 4G5YA 3S2FA 1S01A 4KACA 4O2BB 5CVTA 4YY3B 1ZY2A 1EFRD 1HL3A 1JW9B 2IQ5A 4O2BA 2GKSA 3WIBA 5F35A 5KJEA 2HA3A 3MJTA 4QM6A 2C8JA 1LWOA 5HRCA 1CVLA 5DHFA 1Z4MA 2IIPA 1G0NA 4RULA 3ZE0B 3DS8A 2QORA 1Q0TA 1H93A 2RJOA 4JLUA 3EXG2 5BUCA 4XRRA 1KI9A 4G0UA 1NTOA 4JT4A 1V3VA 4UD6A 5KNBA 1F2VA 1T5DX 3JW8A 4D9JA 3B6KA 1QH1B 4MDHA 1J5PA 3H1EA 5H81A 1QH1A 2QYHA 4ZI3A 5CLFA 3NNDA 5ILQA 1H2ZA 1N33B 4QHSA 5EP2A 3NT5A 3VU9B 1CY2A 4B3GA 1QV7A 3VU9A 2VHYA 1Q77A 4AC9A 3M1AA 3OEHA 2I5PO 2BD0A 2RSLA 3KLNA 4QGSA 1Q2XA 3GP5A 2GCPA 2ACVA 4BRUA 1WB9A 3MTQA 3LTEA 3NPAA 1TCBA 2HQ1A 3BHNA 5T8KC 3TLGB 3GJ0A 2Q45A 2ZSUA 3TLGA 5ECDA 4HV4A 3S6JA 1SHLA 1Z74A 2QYTA 4EPVA 4EDHA 1KETA 4FFLA 1J90A 2J4FA 3QUAA 4C6HA 4OSEA 1OIXA 1NYLA 2GEJA 4LBYA 3C5WP 4C7VA 1NXPA 1XN1A 1C80A 3AVPA 3AYZB 3PF9A 4P34A 1RI3A 1WUIS 3DOUA 4QPJC 5TQ0B 4NAVA 3DE6X 1W35A 3WLJA 5TQ0A 2X0JA 2G9ZA 4DNFA 4F5YA 2ZJ6A 2WT9A 1D2NA 1EDEA 2HW8A 4D99A 2IKSA 2B69A 3IPCA 2IXEA 3H8WA 5SY9A 1OHHD 5CDGA 5TT0A 4WAUA 1F2DA 5CEEA 5CPBA 3S2GA 1LW7A 1MTZA 2QLBA 3D31A 3JQPA 2JJYA 5FOWA 3IJRA 3NM5A 4QYTA 4DV2B 3CVWA 1CY6A 5KYYB 1DO2A 3MTDA 4YONB 4FGKA 5KYYA 3V32A 3IIEA 2BYTA 2NO4A 4RUKA 2Q3DA 1CT9A 2VLIA 4KYVA 1YQUA 2DWOA 2QDKA 1VG0B 2BFBB 2CVPA 2PBFA 1BOOA 2LE0A 3GJRA 4HGZA 4PCLA 2BFBA 3ZCRA 4ZTUB 1LDGA 2QIPA 3TE6A 6LDHA 3AVTA 2B0CA 3QKRB 4RPJA 4C05A 1SCNE 1UBNA 3QKRA 4I4NA 1VIYA 4QXAA 1SC9A 3KKKA 1RJFA 1PJ2A 3EVZA 4KGVA 4YIKA 3UM9A 5SZIA 2AA3A 2B25A 2QL7A 3MCVA 4Q3CA 2D1TA 3GMIA 4BV3A 2A9FA 1O95A 3IAHA 2G25A 3P2EA 4H3HB 1RRMA 1UH5A 3PL1A 3SIPA 3FN4A 2DT5A 1ZIPA 2WJJA 3EDOA 1WWKA 3KAJA 5LZ7A 3WDLA 1QHEA 2V4MA 4UDOA 4WLOA 4ZMSA 1MA0A 4DCUA 4S0XA 3NQ41 3JD1A 3MT9A 1LI4A 5F73A 2VNHA 5CDFE 3RROA 4J29A 2OK7A 1M34B 3BB4A 2BEWB 1H6BA 1M34A 4TM8A 4US2R 4U8HA 2BEWA 3NWEA 2BTOA 4MUFA 4B76A 4WECA 3VR0A 2GK6A 3F67A 4LYYA 2ATIA 4KWIA 4EUFA 2QMUA 2PFKA 4N7RA 3EPPA 5K3EA 1CQWA 3SZLA 2F3SA 4WI1A 3N1UA 4FEEA 5B1SA 1A4XA 2RAVA 3FGPA 3UXEA 4CIWA 3FNGA 4ZDIA 2WA1A 4LVCA 4RD6A 2DPXA 3VR5A 4ZCIA 4N6NA 2CMFA 3EGCA 2ZJOA 4XWTA 5CVVA 2QG6A 3GJ6A 5T41A 3EC1A 4PF1A 4W1QA 1LB1B 3V4LA 1T4BA 4CR6A 1XYVA 3R7SA 1PLJA 4L6IA 5BSTA 5AJHA 3WBFA 1EI9A 1KK0A 3EXIB 2HWXA 2W2XA 4D02A 4HGNA 1Y33E 1GFIA 3B82A 3EXIA 4Y7CA 1CZKA 2QVYX 4KIWA 5TPZD 3ZWMA 3CVYA 4EJ0A 3BA1A 2PBRA 2OPHA 1VXRA 2XCOA 2DPYA 5LDGA 1YIDA 3AW8A 2ODQA 3DHWC 4TSFA 1AZSC 1C3XA 3LU1A 1C4WA 1JIXA 2JEOA 4K9LA 3QKTA 1FS5A 3TCKA 4ON9A 1E92A 4OKSA 2XBLA 3UUFA 1BE0A 2R00A 4Y2RA 3OSUA 2DM6A 1WTCA 1C0LA 3H5IA 1GCGA 4WNYA 2HIHA 1QPBA 2WIAA 3G89A 5FJIA 4URYR 1QIIA 2A2ZA 2FUEA 2GBLC 2HI0A 5H0IA 1RZ3A 4FYVA 3PG5A 1RBMA 3GROA 3STYA 2GVZC 3EMKA 3M6LA 2FP3A 3BFKA 2PAFA 3QVKA 5KJ1A 4FU0A 2NO9A 3SYNA 2PAAA 2CD7A 4AKSA 4EF6A 4JV5B 1KDVA 2R4UA 3GT3A 721PA 3RK1A 1JLKA 2F1IA 3UK7A 4KRFA 3O82A 2AXQA 1FTWA 5KYTA 5MGBA 1TJ3A 1V6AA 1V8FA 1W0JD 3AJEA 3CYFA 3ETGA 1XTVA 3FWPA 3Q12A 3R7LA 4DIMA 4URXR 2PZJA 2W6QA 3FYCA 4AURA 3ODPA 4F3KA 4BZZA 3JQQA 2J5QA 3QXSA 1J8VA 2ZQYA 2VK4A 3V5NA 1MOSA 4UARA 2QP4A 5AW7A 3P4UA 1FS4A 1KSHA 1OWLA 2H92A 3L0DA 4LTNA 4TLLB 2YIMA 2CV0A 2FDRA 2G88A 3MNFA 1XQYA 4CUJA 5E4TA 2XV1A 2QMZA 4EECA 2VUIB 1JILA 1T5SA 4YDHB 3CKMA 4Y3UA 1XDBA 3OOWA 4LPKA 1AN0A 2FEKA 1V47A 3DFUA 3ZCVA 1P5ZB 5EOVA 2WM8A 3A9SA 5BPHA 1A0OA 3I04A 3O0TA 2C8KA 5ALDA 3CTPA 1SU8A 3KQWA 3TW6A 1YE5A 3H8VA 1W9MA 1I5EA 1JE0A 2XMPA 5DGHA 3EIXA 3LP5A 4PC2A 3V2HA 1E2KA 3TIIA 1W8DA 4GWLA 1WPQA 2OFWA 2B4RO 4D9NA 4IIUA 1FZTA 3HR7A 1T4MA 2JAXA 1MAWA 1PZFA 1W6UA 3QIVA 4IINA 4NENB 3RKUA 2D2IA 1A9ZA 4NENA 4W7IA 2VO1A 2MT9A 1GZVA 5DNYB 1QKJA 3JQ8B 1JRLA 4HNSA 4RD3A 1NV8A 3JQ8A 1CR6A 1U0JA 3DMYA 1RPJA 3OIUA 3O95A 1F14A 1ECCA 2GN6A 1T3GA 1Z06A 2P2SA 1W2WB 1W19A 1YBVA 4C1NA 1VZ3A 3DHNA 3GLKA 3ZJUA 1I5RA 3C15C 4X90A 4FUTA 4PHHA 4GICA 3U4DA 4EBFA 1GU7A 3K0SA 3MHTA 3REQB 3RW9A 3V1KA 2A1TS 4C4TA 1FIUA 4PZDA 3ISVA 4WLEA 3HXTA 3REQA 3V80A 6GPBA 1QHXA 3DDNA 2QL6A 3GLTA 3P71T 3PXDA 4ZTZB 4K3VA 4MWGA 3ICEA 2HA6A 3E7DA 5E9JA 4FDLA 4MI6A 1RYZA 3VKGA 2QT9A 3WL7A 4GLBA 3K9GA 5EMKA 3WA7A 4EB0A 4BZPA 5HQTA 1L5KA 2JLAA 1N2GA 1USVA 1NSYA 3NNSA 4FTWA 5AVOA 2CMDA 2DQ4A 4CI9A 1J1UA 3EDQA 5AT1A 1TYZA 2A94A 2J67A 3CX4A 1Q11A 3FLBA 4LXHA 2IQIA 3MJEA 3HXOA 2OLEA 5SZHB 1BX1A 1FCJA 2FK7A 1HFWA 2NYUA 4ZCQA 4BL5A 2V59A 2YRXA 4HN2A 4TQUS 1JHMA 5I4IA 2O07A 2JZNA 1SM4A 5EUBA 5B4UA 4JUIA 1G5FA 4ZVRA 4E3ZA 1Q92A 3VVMA 4BCDA 3SHTA 2B3DA 1NLFA 1W2GA 2NT4A 3CQ9A 3HI6A 3PDUA 1L5LA 5HUQA 3P9CA 4DCNA 4HFRA 2IHJA 2P4UA 4MRNA 1BU5A 5F2EA 4EKEA 5ADVA 3K9BA 1TO2E 4M9SA 3SOPA 1VJGA 4LZPA 3DP7A 3GJSA 3EOZA 2XODA 5GIPE 4AUMA 3HCWA 3M9WA 4AICA 3I4FA 2R1UA 3PA6A 1SC3A 5LLTA 1F8GA 4EUHA 2PUCA 1VKOA 4KFRA 4REQB 4ZOAA 4FS8A 4GAEA 4PGGA 4REQA 1DC7A 3EF3A 3KOUA 5FNVF 1HDXA 5D86A 2V58A 4RO0A 1D2HA 1FNNA 4C7KA 2VSYA 1CY4A 1T24A 3OIDA 4RIIA 5FPSA 2V65A 4IZOA 1C4XA 5FBRB 1UT8A 3QY9A 2CLLB 2GJAA 2VHCA 3IURA 2L0XA 1XZAA 4PWZA 1THMA 5JAZA 3WWYA 3L4KA 3IYLW 3W77A 1XLTC 1Q2UA 3HJAA 3O8NA 2ROQA 3H04A 2YUTA 1GZSA 1JTVA 2ZB7A 2RAUA 4NJMB 5G1PA 3FOCA 2VDMB 4RFVA 2IJGX 4NJMA 3FNRA 1JALA 4J0GA 1G5IA 3L7MA 2AL7A 3GN1A 2QU8A 4RK5A 5SY6A 2XNDD 5C32A 3KKOA 1L5FA 3LGXA 1P4HA 2IXFA 3ORFA 4JOQA 2PX2A 1N4AA 3MAGA 5CD9A 3QU2A 4E6PA 2GYYA 4NS1A 1F8XA 4EZEA 3PENA 4FCTA 3CJTA 4YWJA 4MKIA 2ZAOA 3EW7A 2X4LA 3FCXA 2Q28A 3OZDA 4EF5A 2ZPUA 4COOA 1IUKA 4I9UA 2EAUA 4PICA 4RTJA 2VJLA 4TMZA 2WJWA 5KTYA 4JLJA 2ZXFA 4CF4A 3WB1A 2QSYA 3NG1A 3HRKA 1C9NA 1C0IA 1JAHA 1E32A 3H3JA 3L6BA 4LJ9A 3ELBA 3VO2A 2Z09A 3ZV6A 1MUUA 4LZWA 5ICMA 2IU4A 1UOQA 3D3NA 3I5MA 1GNPA 1NLUA 1SC1A 1W4BA 2BBTA 1GOTA 1XCGB 4YMIA 2OGUA 5IUNC 2RONA 4P3NA 2G1AA 3N39C 5K0JA 3RU9A 1G6OA 1XV5A 3C4JA 1KZYC 4J16A 5GP1A 1N5KA 3AG6A 2IU3A 4BMXA 1Z4JA 3HEBA 4DA6A 5FAKA 1U2PA 4JS0A 1EQ2A 1JQLB 3WNQA 2GARA 3C8MA 1Y1TA 2JIBA 2BBWA 2VUHB 4ZOLB 3OZFA 4KHZA 5JDCA 1U8XX 2J7PD 5DT9A 4ZOLA 3VOAA 1BX0A 4XE5A 1K7SN 4P32A 1RC0A 4BB6A 4LJ5A 2AG5A 1XRLA 5D7NA 3H65A 4ATNA 4D4JA 3BB3A 1CK4A 3KBBA 1Z8NA 2H2GA 3NC4A 5FKJA 4YR7A 2KE5A 3TTVA 5LOVF 4QM7A 3KR9A 1BSVA 3RARA 3D6UA 3G0IA 3G79A 5GM1A 3P32A 1ZH0A 4ZT4A 4BFYA 4CMIB 3ZDBA 2B8EA 2E21A 2FEOA 1QYWA 1O3YA 2IW3A 3QBEA 4RSRA 3SQOA 2W6OA 4CMIA 3EJWA 3DOEA 4HAZA 2DZDA 3WYEA 5KDDA 4HL6A 3UA3A 3LT0A 3P27A 2WJPA 3PFBA 3BORA 3R3ZA 4HN4B 5ED0A 4RTSA 1A5BB 1TGVA 2PGLA 1VIMA 4OB7A 1NF9A 4Z9XA 3KFVA 2HEGA 3G0HA 4LRWA 2XD4A 3HRHA 4JYPA 4P31A 1BCSB 1L5MA 2C2GA 1TRKA 4IIBA 5BY2A 1J23A 3ZOKA 1BCSA 9ATCA 3QSYA 2AWNA 3G2PA 2XQFA 4PQFA 1UAGA 3ZLUA 4YRLA 4O1MA 2LCQA 4BEBA 5FLEX 3AJ8A 2LPMA 4RVSA 4IIVA 4J8PA 4L4ZA 2QRNA 3ROKA 3U37A 1XHLA 4I5DA 1GQRA 4JC4A 5IANA 3F5FA 1Z29A 2C8LA 4FZRA 4B5KA 4DR2B 3PRKE 5CFLA 4ZOCA 3JRXA 3EN0A 3NOVA 2QTAA 4BPBA 3T61A 5KNDH 1OOEA 3JQDA 4GP6A 4FFOA 2IGBA 2FZWA 2X86A 3ZGLA 4WZBB 4FX2A 5AVYA 4TXMA 1LC0A 1LS6A 1TKRA 3BK1A 3ED5A 4WZBA 3GCGA 2P5SA 2PVSA 4OHPA 4FS3A 3V9AA 3VVBA 2ZBEA 1ACMA 1TT5B 2FJUA 2CNLA 4IUDS 3JTEA 1Z34A 2VDPB 1TT5A 4LRSB 3WI7A 5ELXA 1F8UA 1OFVA 3GIDA 4LTMA 1P0IA 3HWRA 5D5PA 4LDZA 3T38A 1B1CA 4ARUA 4EG7A 4N39A 5K4AA 2H08A 5I7UA 1JIUA 5BRAA 1QTQA 4RS4A 4A91A 5FQNA 3E9YA 3KVRA 1PFVA 2CE7A 2QD2A 4P0QB 1S2MA 4M83A 1CB7A 1KMNA 1ZD9A 4QT4A 3Q98A 1GTSA 1WDKA 1Z63A 4B09A 4V0MA 5JFTA 2CBZA 4HH4A 3TSAA 3R76A 5K3SA 3GA0A 1Y1KE 1WDLA 4W4TA 5I9LA 2I4IA 4ZKEA 3BDVA 1AF4A 3AKCA 3F1LA 4XFKA 2C5SA 1CS0B 1U2GC 4QDUA 1G5RA 3QX8A 1CS0A 2AN9A 1BS1A 3LT1A 5GMOA 2JFWA 3NTXA 3MD9A 4YRRA 2V98A 2PQMA 2OYSA 1OI4A 2AF3C 2UZ3A 3W90A 1KVSA 3GB9A 5FLKA 1JKMA 4ALNA 2WLTA 4UXJA 5JFGA 3EZ9A 1MG0A 4RF5A 1B1AA 3AQIA 3QG1A 4ID9A 3HU1A 4N7JA 5K9ZA 2XYPA 3R2JA 2OZEA 3ABOB 3GVXA 1KU6A 2C1XA 2IPNA 3RBZA 3ZQ4A 4LZZA 1SU4A 1NPTO 2BM0A 3QJ5A 2PLAA 2VHQA 2XRYA 3H17A 4ND3A 3TTSA 2HA4A 5FV7A 3WGGA 4E13A 5KYVA 4LI0A 3E3MA 4PZZA 1J5EB 4IJKA 3LQQA 4D74A 2OAEA 2Q27A 5KX5B 1KBQA 3G3EA 4W9NA 1Z4PX 3GRZA 5KX5A 1AU9A 1OX4B 5FUMA 1C1HA 1OX4A 4LXGA 4D42A 3CVUA 1QBKC 1MC4A 5J43A 5DX8A 1KRWA 1L9XA 3M82A 2Q2NA 4MVYA 3JALB 3RVOA 4GMFA 1NU8A 2CE2X 4LQCA 3JALA 5BQ5A 1YS7A 2O2EA 3A6GA 2JCSA 1IVYA 2VP0A 4OQ4A 5F2OA 2MJLA 4PYLA 5CNIA 1E3EA 4AY4A 5JEDA 1W0CA 2CXOA 2HRBA 1EP2B 4BO0A 2QL9A 3GC6A 2EZ8A 1HDIA 2DPLA 2E9SA 3GYBA 5E6SB 5F52A 3W8EA 5I48A 2AJBA 2XH8A 5E6SA 4ZANA 1DAPA 5KC8A 1I8TA 3REOA 2QTZA 3IUYA 2GPNA 2PX3A 1CZOA 3GOHA 1KIFA 4JL5A 4ZV7A 3T3GA 4GSYA 2W22A 5JW6A 1FXSA 2O06A 3DQZA 3KPVA 3UJ9A 4DT1B 1Q0QA 1SXHA 2GLXA 2I55A 2YMLA 4INZA 4TKMA 2IDJA 1GNTA 5JVDB 3U62A 4TLCA 4DT1A 1MAHA 4BC0A 1ZISA 2GN8A 4IXTA 4KN9S 1NW6A 2OTCA 1PWEA 3QHAA 4LY9A 3SYTA 2IZ6A 2L19A 2OO3A 2ZB8A 3MWYW 4NNJA 4UU7A 4BX9A 2X1VA 3NDPA 3N3BC 4NU5A 3GGDA 2DB3A 3WRXC 4UU1A 4AQYB 2F3PA 4PGFA 2E1PA 2I54A 5BV1A 5FPYA 2XT0A 2Z83A 2EBWA 4C5AA 3K73O 4CLDA 1GD1O 2WVHA 3EHDA 4CQMA 2XGOA 3R23A 1RKVA 2A6PA 1CZNA 2RH4A 3INNA 2MYTA 3VVLA 1ZC3A 4ZIRB 3NIBA 4G1VA 4EAAA 1F2TB 2GNAA 4ZIRA 1ZINA 1F2TA 2LRHA 4AL4A 1SBCA 3KQUA 3DVQX 5CYGA 3T7TA 1HDOA 5FTKA 2D74A 3AOEA 5EXEA 4H1TA 1P3DA 3ONWA 4DXAA 1EJ0A 5DTRA 4F4CA 1QRUA 4RNCA 4MGEA 4EG1A 1JBKA 4C4AA 3JZDA 1XD2B 3PVZA 3RTCA 1WTAA 2QXTA 1XD2A 1RD4A 1CYDA 1XXHB 2TYSB 2ZPTX 4MCIA 3TW4A 3N0WA 3ZW8A 1XXHA 2FWRA 3IAEA 3QM1A 4N0MA 1GPMA 1DV2A 1M6YA 3F5MA 4H27A 1SCDA 2EKZA 4GR5A 2ZCUA 4OOEA 4F5EA 5DBIA 3IOBA 1Z5WA 1UJ2A 3PXEA 5AOAA 5TX7A 1X42A 3BCHA 3PHHA 3ZHRA 3E9DA 1NE2A 1ZRSA 3VU8A 1E2NA 4MI9A 4L78A 2OGWA 3S1LA 1R00A 4HEA1 2J9ZB 4PAWA 2RCNA 5TXGA 4OK3A 5JRJA 1C0KA 1JE1A 1SWVA 2TRSB 1F4VA 1PJAA 3E3LA 3HGTA 4B74A 4XOIA 2WSMA 3C0KA 4BGEA 1E2UA 1KWKA 1E1QA 2C4WA 2YN0A 1M5RA 2HA2A 3C43A 3HQ4O 5JJKA 4MRVA 4DLLA 4OX9B 3H2KA 4DLSA 5AKIA 3SSNA 3WLNA 5DEOA 2I91A 3ES9A 1ZHOA 3F3KA 4BWVA 5AD1A 4L95C 1A8PA 4ZCSA 3ANSA 3DAOA 4KODA 3W78A 4J0FA 3WBJA 1QYIA 3ZYZA 1EE2A 1WMDA 3PWTA 5CYOA 2Z0MA 4NVRA 1SMKA 1H1LB 2Y6UA 3EQ6A 4NRDA 5E8RA 1H1LA 2G5PA 2ZRDA 3FW1A 4EK9A 1T6YA 2R8ZA 4I6JA 4KREA 3DT6A 1SN7A 4PFQA 5KREA 1WOYA 1O77A 2QUAA 1H4QA 2AFIB 3AR2A 5ECWA 2PSEA 2AFIA 2RGUA 1I1OA 1CQXA 4L0DA 5JS1A 4UBNA 4C5CA 1GT91 3MVEA 3NGXA 4JNKA 4OBBA 3BJMA 2Q6KA 3O74A 4Z86A 4PTYA 5GPBA 3CVVA 4YT5A 1HZJA 1P17A 3K16A 1KE1A 3KEOA 1TCAA 3N8HA 1FMJA 4XQ9A 4ZQGA 1J70A 2FPOA 5HSGA 1X1DA 5CT6A 4G5GA 2DG2A 3PX3A 4X1IB 2WHPB 3MWJA 1E3DA 2JRCA 4X1IA 1ZNZA 2WHPA 2VTVA 4PBRA 1VG9B 3IAAA 2V0CA 4D9EA 4MPPA 4GL4A 3KLPX 1DIOB 1YUBA 3DF7A 2ON6A 1B0AA 3O3OB 2C59A 2DGDA 2V7PA 4ZT2A 4GOLD 2PRYA 4QBKA 4OQQA 4NONA 1DJLA 1JDNA 3O9VA 2V3WA 1P7ZA 3RABA 2RGWA 2VQFB 2COEA 3FTDA 3OWHA 2F64A 1E2QA 3HGMA 3MYYA 3Q3EA 3F46A 1ECJA 1JB9A 2HMYB 4O63O 2ZTVA 2RDMA 4Q9HA 3EPHA 3Q7PA 2ORED 1RQ7A 3L8FA 1H23A 2ABWA 3K9HA 5CLQA 5MHTA 4YUXA 2QVXX 1WHTB 3KHSA 4LXTA 4EUEA 4J2TA 1WHTA 5H83A 2FRXA 2RCYA 2Y0DA 3DXXA 1R8SA 2REQB 2V96A 1R8XA 3IPYA 4FMDF 4S12A 1G6Q1 2REQA 3PJDA 5LQAA 1TA4A 3CIOA 3LYLA 4EVSA 1TQDA 1JI3A 1GU0A 2ZI6A 2VP9A 3ZIDA 3L4JA 3HABA 1P8AA 3O90A 2EJWA 5CVDA 4ENUA 1T0JB 5HCNA 3DYIA 3LQ4A 1QDUA 3UMBA 1U0HC 1TLFA 3AU8A 1NIPA 2ECKA 2RHRA 4IFTA 1M74A 3GAMA 3TK1A 2HRQA 2ZKLA 4A1FA 4YRKA 3RSFA 5JT1A 3AB3A 1IOWA 3H4MA 1QIJA 3BRWD 5FPKA 4PC7A 3S3TA 1GFWA 3L7KA 1YDWA 2J59A 5FTNA 4Z6KA 3BCSA 2PX0A 3HUFA 3PGXA 3ZU2A 3Q2IA 2Z2JA 1KA9H 2GNPA 1YSCA 3R7FA 1G4AE 1W48A 4HADA 2OG1A 4EKYA 3LWZA 1MX9A 1AZLA 4KI0A 4M9QA 3AWIA 1HYGA 3Q10A 5B1DA 1D6JA 5B12A 4P2GA 3DOCA 3SKVA 3KT0A 1G21E 1JVBA 1RBQA 4KO3S 4D8YA 1NLZA 3L8ZA 1Z0IA 4L57A 3EEYA 2BTEA 1YE3A 5L3ZA 1KMHB 3O4GA 3HGQA 2GK3A 5EJ8A 1KMHA 3MCUA 4KXXA 3RJZA 3ZX5A 4RTKA 4PVDA 1Y9DA 7MHTA 5IT5A 2Z95A 1CULC 1COWD 1R10A 1XDGA 1X86B 2G08A 2RB4A 3AUKA 2W6IA 3OUZA 5FFFA 4C3OB 4YV1A 4MYDA 5JXHA 1DKPA 2UZAA 2H85A 3ECAA 3N70A 4DMCA 1NJ1A 4ZI7F 4ZN6A 3I3SR 1Y1QA 4KFSA 2RB5A 5DN9A 3A3YA 1IY2A 2GQ0A 3R0XA 4OGFA 3EWSA 1SBIA 3RREA 3R6DA 4OIMA 5IVKA 1B16A 3RS8A 4QBGB 2ZJAA 1LSOA 4O5AA 1YK0A 3ZH9B 5IJWA 3CSDA 3S7ZA 1NIJA 1XRPA 1VYVA 3UUEA 4DMFA 2N1MA 4JFAA 1MNAA 3D0QA 3MRSA 4N40A 4FCVA 3YASA 3HKDB 1YRQA 2DUJA 3KKEA 3QW4B 3B3JA 5HMLA 3HKDA 3KJHA 2L69A 2Z4SA 5H59A 1KH2A 5AVVA 4A36A 2X9GA 4U2FA 1X80B 4M6WB 4QJ5A 1FVOA 4US0R 4KSBA 4CLHA 4W63A 1X80A 2C99A 4M6WA 4B3XA 2C5HA 2Z43A 2X9QA 5FADA 3MD0A 2Q2WA 4GI5A 4A4DA 3W3AH 1YS1X 3L06A 3TXXA 4AZVA 1KQGA 1A96A 1FP2A 3JPWA 4NBNA 5G0UA 1DBWA 1EX9A 4CDMA 5GJVC 1KY2A 1HSOA 1D6MA 1QG2A 3BPSA 4PG5A 4XUEA 1HMPA 2SKDA 3CRZA 3PC7A 4JUBA 1AF7A 4JHLA 3GCWA 4AZ3B 3OJLA 1ZMOA 4IHQA 4OJQA 2BR3A 3UOGA 4Z4GA 4AZ3A 1FLAA 5IAJA 2WSSD 4BP8A 3JYLA 2F00A 4NQRA 4JJAA 2C3YA 1YJBA 2JGJA 1OTXA 3M4NA 3LHKA 5H5JA 1JAZA 4F45A 4L16A 1KZ1A 1WB6A 4HB0A 5BN1A 3C70A 1E1CB 4W1RA 1CY8A 4IFIA 5EHQA 1E1CA 1QM5A 2VRWA 3QBDA 1HRDA 4MP3A 3VX4A 1BDBA 4CG1A 2W11A 3VSAA 4XKJA 1KI7A 4QNNA 5IRCD 5EJEA 3WZMA 3ZYCA 2O0KA 2H2WA 3FI0A 3QENA 4FFDA 1ZNWA 4TZTA 4BNDB 5JQGA 1E69A 3NV9A 3MIIA 4RLSA 4UREA 1MOZA 3O3CA 1XQ1A 2H4XA 4ARSA 4BNDA 2BJHA 3G0DA 3GMSA 3HCNA 2WD8A 2BKLA 3I3OA 3BTSA 2F3QA 1T2NA 3MOIA 1V4NA 2UVQA 3DMGA 9LDTA 1QTRA 5F5NA 4QG7A 4AF8A 1FNCA 4MIYA 5D51S 4XIJA 3RLFA 3FTFA 3BG5A 1CNEA 2ZW9A 1OH6A 4E5YA 3I72A 4NY1A 1HE2A 3TLCA 3M3PA 4NMMA 1A4UA 3ASVA 2OK8A 5ALFA 1ZIYA 3RFUA 7AT1A 1JG3A 5CXXA 1F0YA 1S2LA 1CEYA 4YQYA 1AGRA 4MJ7A 4R1OA 4U9HS 4NBUA 2OV2A 3ANLA 1DC4A 1SNYA 1VBMA 2ZBVA 1YI8A 1IN6A 2OV4A 3U1TA 3GNSA 1H3NA 3TJRA 5JS8A 2NADA 4QFCA 5EIWA 4Z4CA 1DUIA 3E23A 3W5AA 1XAIA 4KC0A 2ZS7A 5B1EA 3L01A 1PCXA 1Z5NA 3OO0A 4Y0NA 4OI1A 3GFQA 4XFDA 2D4HA 1BE8A 4M7OA 3TINA 4DRXB 2RMKA 3HP1A 3NWJA 1Q0PA 3MJHA 4JLBA 2OLKA 2XYGA 2XF8A 4Q9JA 1YDMA 5AW9A 3SHOA 5HJEA 1DX9A 4MW2A 4CRWB 1TE2A 2A1IA 4LYEA 4ZCPA 1MB9A 5LZ5A 5T8KA 4RHCA 3ET4A 4RMNA 1C8KA 1ULBA 2AEFA 2QT0A 2VJQA 2L42A 4TGLA 1M9NA 3T5BA 2V3CC 2VTKA 3AHEA 2CLSA 1FQWA 2J3JA 2IOFA 2YW9A 5JQGF 1WW3A 3IP3A 5K6RA 1RCTE 1HGXA 1LBIA 4I55F 1H6AA 4XVUA 1SPBS 1IBCA 4FBGA 3I92A 3DF9A 3NLLA 3NV7A 3ZV5A 2IUYA 3NHZA 2C4MA 3D8RA 3HEAA 4TZ6A 2KW5A 1LPPA 1SZPA 3Q3HA 2ZUBA 3CF4G 1LPMA 2MOKA 3I9JA 3LVBA 3AI2A 2NXCA 3DMPA 1Q1GA 5A4DA 4LZOA 1G98A 1M6WA 1EM6A 3ICQB 4N82A 1K88A 2C9MA 5JWOA 1KYYA 2Z2ZA 2D1FA 3I1JA 3ZQJA 1FDSA 1UWVA 4D2IA 2VP5A 5HZHA 4UE6A 1OH7A 2W4QA 2JAQA 1QTNA 3B6EA 4OFWA 1GG9A 1TD9A 2OBBA 2P0AA 3ENVA 2F90A 1QO9A 4WFIA 4XIFA 4OKNA 2HV9A 1NAHA 4D4HA 2IIBA 3LBYA 4B6QA 2IZOA 3TRHA 3OQPA 5SV2A 1JA0A 1H5QA 2TECE 5FCDA 4EGSA 5TF4A 5DI3B 5AUOB 3EPKA 1OGJA 2OHIA 3EZ6A 3G2HA 3OAAA 5DI3A 1J2RA 3O5AA 4CG0A 4YAGA 1M83A 4RVHA 1ORWA 2PUVA 1L7VC 2CCJA 3KX2A 5FFMA 4EHIA 5DN6D 4DLVA 5AM2A 3O83A 1IOZA 4I9FA 4GOOD 4QTYA 8LDHA 3EQ2A 3EIHA 4Q0MA 3AVWA 2NYRA 3I9FA 1RCUA 4JYMA 3VUEA 1IK4A 1K92A 2C31A 2RHTA 3R0VA 4J3NA 4CCYB 2HBZA 4CCYA 1EIWA 2QZZA 4WOCA 3C1TA 1LBQA 4DJTA 2H17A 4ENWA 2VBGA 4LHWA 5A05A 3QPWA 1VL1A 2FPUA 3ETNA 4H2DA 5FBQB 3OFND 5BVGB 4DHEA 5CB4F 3GEBA 4PS0A 4KVZA 5BVGA 5GADl 4RTRA 4I6EA 2BVNA 2EKLA 4MP8A 2IUUA 1I01A 1VKNA 1J22A 2TSYB 2EL7A 4YAIA 2FLWA 1WSWA 1TL7C 3DOHA 1EFTA 4BUCA 1QPZA 1T8YA 3MJVA 2AT1A 3E61A 1AQLA 3F90A 3Q4GA 4N5NA 1V2GA 2WFMA 3QUCA 4ZKDA 3L1KA 2D1SA 3HR4A 3I2GA 3K09C 1V5WA 3ESCA 4J7XA 3BIXA 3RFXA 1GZ7A 4BC1A 4DM7A 1NQAO 3JAWB 4MVJH 3SEAA 3JAWA 4HO1X 1GVHA 4WNIA 3A4VA 4LJ8A 3HCAA 3EWAA 4PYRA 4C0SA 4FYHA 3OICA 2Q5EA 1HE8B 4DV3B 3FJ1A 1GG8A 2QN9A 1PFUA 4IF6A 4CM6A 4DJJA 4L72A 5HIKA 4DOMA 1ICEA 3UJHA 5LJIA 3FE2A 2YV2A 1W47A 4IX1A 2ZYWX 3UYKA 2J0VA 3A4LA 1J56A 2LWIA 1XCJA 3M34A 4U4AA 2B99A 5FP0A 3UHAA 3IIMA 1CP2A 4QYXA 1ZVKA 3A6EA 1Z2AA 2GYWA 1WX1A 3BCRA 1SIWA 5HF9A 4AKIA 2C4UA 4AYTA 2I6SA 2XB8A 4DMRA 4F9TA 3DBRB 2IY7A 1I9GA 1XMSA 3FETA 3COJA 5H3CA 2BFMA 3DBRA 2GBLA 2PH1A 1V9SA 3ASZA 4EHDA 4UEWA 5CIQA 2YQZA 2RGYA 3B9PA 2DSTA 121PA 5C81A 4HH1A 1W29A 1DV1A 3M6IA 3L49A 3T7DA 2XNCA 4CTKA 4AJ9A 1T2VA 5CK4A 1P1HA 3V3KA 2WV7A 1OX5A 1QVRA 1KFEB 2AYYA 2Z58A 2YICA 3A3PA 1WXIA 4OK5A 5J1TB 4FW9A 5DNCA 2Q5QA 4HX2A 5A2QA 3VZQA 5MFPA 1PSZA 2F67A 2YV4A 3AVYA 3TRFA 2I1LA 2QQGA 2PUEA 3DVRX 2FKAA 4ML3A 3FG9A 2GPTA 3I9V1 5DCWA 4RMIA 4FOSA 4YXWA 4WOBA 2XDAA 5KCZA 1FTGA 2ZR7A 1JPJA 4D79A 3QX3A 2WYVA 1RLOA 3FBTA 4OQFA 4ICIA 2NQ2C 2XTZA 1SKQA 1VBNA 2XTNA 1T15A 3DZBA 3UH0A 1TPZA 2WMNB 1RRGA 2A9RA 3W3AA 1H2HA 2BBOA 5JSKA 3RBXA 3VJRA 4YAEA 4K3UA 5GJBA 2GXSA 4JU9A 2WA2A 3MMSA 2C58A 2OD7A 3K6KA 3K5IA 3RVRA 4XYEA 4CL8A 2ZRBA 1VCMA 2TMYA 2QZJA 3FFXA 3PUJA 4OU5A 3TW0A 3L9WA 4JU8A 1HRKA 1XXLA 3G9TA 2ATCA 2L17A 2CLIB 3CVJA 3V8RA 4EF4A 3ANMA 1A5SB 5JISA 1O4VA 5J5CA 5AVSA 3O3NB 3LZ6A 3KM0A 3NAGA 4P5EA 1MF7A 2A57A 3WQRA 3THXB 1DAEA 5B5SA 2XB2A 3THXA 3FVVA 4MUGA 3QA3E 1PIWA 4KQKA 3WQHA 1W5SA 1X2BA 1YU6A 2VPYA 4DCPA 3NTUA 3OCWA 3PRYA 2WWYA 2HUNA 3HDJA 5E4YA 1P2DA 3M6XA 2EGGA 4O2AF 4CHGA 1IC6A 3MTBA 3DM5A 1I4OA 1A77A 4MAAA 1QGED 2YFQA 2X22A 5GVSA 1DB3A 1P45A 4WGGA 2C9ZA 1QHIA 5EL0A 5DYNA 5DLQC 3DDZX 5FD8A 5AICA 3IE1A 4MUBA 4HC4A 4BQPA 4ER5A 1QAMA 2GZAA 5AVWA 1QK4A 2CUKA 1RYYA 4CV2A 4K6KA 3VKUA 2B4QA 1M8GA 3P19A 2XAAA 3GLQA 2R1TB 1QYRA 2R1TA 3FMOB 4J1QA 5AW3A 1DWQA 1XN4A 4MVJP 3LHIA 2HO5A 4FM9A 2EFEB 3P9IA 1XNJA 5H02A 4MEAA 5THKA 4E03A 4BFLA 1NUSA 4TXHA 1E0AA 4KE8A 4YV7A 3HBAA 3M1LA 5CH5A 1O9BA 2WIFA 3RFTA 4EYEA 4K9KA 2XQGA 3OTIA 4KK4A 1TEHA 2C00A 1XTRA 1NVWQ 2LZ0A 3KQKA 2FFQA 2KJQA 2Q41A 3PQ2A 2FRDC 4QUHA 2FZEA 5KAMA 1RZRA 4HR7A 3B51X 1SCKA 3H84A 3W8DA 4EWLA 1OT5A 2XE6A 5AK4A 3AKEA 2J87A 1SWWA 1BFUA 4Q4LA 3G1WA 1WZCA 3ENNA 3IEXA 3KK0A 3GCDA 5LZ2A 1F0PA 3A14A 1MQ8B 4W5NA 2PMKA 4KQJA 5CH3A 1KQPA 3PZRA 3Q6NA 2BKUA 3D3JA 3LX6A 1TZCA 1DELA 2OP1A 4KAFA 1HKUA 1T3HA 1Y6QA 1EAYA 2V7QA 3KU4A 4LPSA 1Z08A 3R75A 4MV5A 3EW9A 1S0UA 4GOND 3HA2A 3HXKA 4X24A 3WK4A 3TLJA 3GPIA 3IR6A 1ZRMA 4GE3A 1TLTA 4EHBA 3BZUA 1NYQA 3PITA 4RVCA 4ZZ2A 4XRGA 3L7BA 3SE0A 3UENA 2ZVJA 2PGDA 3ASYA 4CMEA 4FNGA 4F12A 2Y0PA 2NU8B 3HA7A 5K09A 2NU8A 1SXJD 1XLTA 1RRPA 2OBFA 2Z04A 3KV3O 2IYNA 5CJJA 3S29A 5KVCA 1E98A 3P8ZA 4B4UA 3WYAA 1M1NB 4H0CA 5HKOA 3WGTA 3CISA 1M1NA 1Q74A 2GTPA 3BL8A 5DEIA 4Z0HO 2XUDA 1VM6A 1OWOA 2IDKA 5EQJB 4ZCTA 1NNLA 5KC9A 3TQOA 3AUTA 1T2EA 4QXPA 4LK2A 2QTTA 3P9YA 3B3AA 4GUDA 2AVDA 5EMLA 3UWMA 4C3ZA 2Q6OA 3IT0A 1T35A 3C3PA 3FOBA 2HK9A 3WGIA 4WN9B 2YWHA 4S0ZA 4KNYA 1NDHA 4WN9A 4D9GA 3H4TA 1FNSA 4C03A 2CYAA 3GFVA 3KSBC 1A9XB 1N3LA 1ULTA 4QLBA 4GZ3A 1FDUA 1VIVA 3TNYA 4D8XA 1A9XA 1FQKA 2ZROA 3I9MA 3GAZA 4QRHA 4YX9A 1X9IA 5L51A 4GKBA 3TX6A 3BAZA 3IL2A 3HKCB 5JAMA 1PFWA 2AB0A 4WZAB 3F3SA 3HKCA 4GIBA 1SAYA 1GR1A 2F48A 3PC4A 4WZAA 2IV3A 2WWFA 1YVUA 4MKRA 3UGTA 3A6DA 1OGIA 4JT9A 3WLPA 2R7MA 3HCPA 1Q0SA 2D2EA 3LA6A 4UNSA 1W59A 1RKUA 3M70A 1PJZA 2W2LA 4G4JA 4RNDB 3N9IA 3T7IA 1XEWY 1D7OA 4R54A 4EOGA 5ISMA 2VCHA 4BMYA 1P74A 1PJSA 1W4ZA 2AN5A 1F17A 2A9VA 4MV3A 2JLQA 1EUZA 2ANBA 4Z2AA 4DG8A 2DEUA 2H3EA 1FFAA 3D6FA 3OPQA 4L8WB 5IARA 3UFBA 5DYTA 1PF7E 2H1VA 1ONOA 1DEHA 1DWUA 4WDQA 2NU6B 2VATA 3IUSA 3KHUA 4BE7B 2NU6A 2JEZA 2PPLA 2CUNA 1TVKB 2R60A 2X9LA 3BREA 3D6NB 2FR8C 1AUXA 1A98A 1ETHA 1TVKA 3GV0A 2MTBA 3H99A 4K05A 3PC2A 4PSKA 4QARA 5CDHA 3SVTA 4YACA 5FR1A 4C06A 2OE2A 4YPVA 4CGYA 1E5TA 2Q7DA 2OQVA 2OR3A 3QUQA 5LQSA 1ZM4A 1V9CA 3RVLA 2GMWA 2Y92A 4XGQA 2VDLB 5IBPA 2VWHA 1QCDA 3HCFA 5JE8A 4MTLA 4H7JA 2IYXA 3EGWA 5COBA 2WIJA 5JNSA 4QYIB 4AN1A 3TNJA 3HVHA 2WUGA 4QYIA 3RC8A 3BQMB 2FE1A 4Z4EA 5A3RA 5A71A 4CUKA 1PWYE 2HZ7A 4H7IA 1I2CA 4PZAA 2ATVA 4U00A 3ZJ4A 2VDKB 2C9CA 1OCEA 4BLQA 1QRAA 2IUFA 2Q5OA 3OY7A 3T1VA 3IDZA 1UJ6A 4XR9A 1S2NA 2PMBA 2OUIA 4I4TB 1BROA 5DE3A 2AN4A 4F6RB 3E0XA 1JYFA 3A1UA 1RPNA 4I4TA 3JQAB 3EARA 3L79A 1G3UA 2FN4A 2HWUA 4MAMA 2UYGA 3JQAA 4F6RA 4EM6A 4ZHQF 5JJIA 1VDZA 2MU1A 1HYBA 1ZOLA 2YQ4A 5B36A 1LX7A 1YC2A 2J5RA 4HFMA 1E9DA 1OFUA 4OAOA 1A1SA 5J59A 4DLBA 5CFOA 5CPFA 1T5BA 1JTEA 3M2TA 4P2BA 1W0KA 3CUKA 3K15A 4K9OA 2FFBA 1CDZA 1TKAA 4EZBA 3G7NA 2OD2A 2D1YA 5J3JA 1FW8A 4F5WA 2FPPB 1TUIA 3LDAA 2C1ZA 1FTNA 4MLCA 1ZCBA 1T8TA 1D2AA 2FPPA 2GFHA 2NYVA 3LQ1A 3MPUA 3PQEA 4Y7DA 4QHYA 4AXBA 3PRJA 2J3QA 1QVZA 1SY7A 2YIJA 1WCYA 2ZANA 4W99A 5BSMA 3K70B 1CU1A 2BMVA 2IYQA 1EXNA 2EZTA 2I6TA 2NTNA 4EHKA 1QRDA 5BN5B 1BZYA 2Z1NA 5IU6A 1MOPA 1BW9B 1SEVA 3P2JA 3PTLA 4BMPB 5BN5A 3TGPA 1BW9A 2Z2IA 5AH0A 1MT3A 2O1SA 4V38A 3FJYA 5K8VA 1L4NA 1QIKA 4FYMA 1QS0B 1AQJA 1STOA 2JFZA 1QS0A 2FW7A 1I6MA 1RKBA 4IWXA 3E9ZA 2GN2A 1CZRA 1DQPA 1TM4E 3PNKA 1M8JA 3B48A 1BFKA 1XP5A 3WWCA 1RADA 2P2DA 2WUDA 5JMPA 4OREX 1TO6A 1QORA 4HRAA 3RYCB 4JXZA 3RYCA 3W5CA 1EWQA 1XJQA 4I2NA 4H08A 2HO4A 1WO8A 3R7AA 1E2GA 3D2CA 4HUQB 3RFFA 1A71A 1YU9A 4HUQA 5DLYA 4U2KA 4AS1A 3LIIA 4PEVA 1S9DA 2OSVA 3DKPA 1VLHA 5LWQA 1GAWA 1XAJA 1XELA 3ISJA 5J4KA 1ZZEA 4YJ2F 3TZ6A 1T13A 1FTQA 3ORQA 1ZUNB 3AY7A 2VPZA 3WA6A 4CKYA 3HHPA 5KVSA 1ZUNA 1ZICA 3UTDA 1U7HA 2DKOA 3NOQA 4NCJA 4X64B 5M7EA 2OHVA 2V9ZA 2JIQA 1ZONA 3NT4A 3WKCA 2OCYC 3ZOZA 3JAKB 1E5XA 2ZUSA 1OPRA 4HZIA 4QOHA 3D3KA 3JAKA 4RE6A 1MHTA 3JQGB 3E1GA 5A5DA 4YR9A 3JQGA 1JEDA 2ILTA 1NP7A 3ZBPA 3LXMA 2FMFA 5BSKA 1O6ZA 4X44A 4GPD1 3VR3A 4G3XA 2PXXA 2XEDA 2HCTA 3MTEA 3L0BA 4OATA 1UMCB 3CS3A 3GPLA 2C0QA 4EG5A 1UMCA 2HH9A 3C97A 3OD5A 1S2OA 2A35A 4UMEA 4TSRA 4UULA 1IY8A 2HPVA 4RTMA 4ED9A 1I3LA 1KYTA 3DZIA 5DK4A 4LJYA 2Q3FA 3LQKA 4TSKA 4M4SA 2V6IA 1KFKB 4QTTB 3QE4A 1GPH1 4MO9A 4F1KA 2HPAA 1E2EA 4YAKA 3CRQA 4PU0A 2B6HA 3RF7A 4AULA 4Y2VA 2BV3A 4MMXB 3TI9A 3WL6A 1NM5A 2I9PA 3WIEA 3F96A 5DULA 2M2IA 3DPUA 1Q21A 4OLJA 4Q47A 4CM4B 4YO7A 1AM4D 4CM4A 4YYZA 2Q6LA 5K3DA 6CHYA 1U5AA 3E7FA 3E6AA 2J0SA 2Y71A 4JI5B 3HB5X 1SOMA 3FHJA 4MWCA 1EHYA 4P33A 5EE1A 3BRCA 5AW6A 3QFCA 1OB5A 1BIFA 3X1WA 3MSCA 2NG1A 4HYEA 2HZBA 3CRNA 1VCIA 1OW3B 3OCCA 1QB7A 4K6GA 4DADA 4QYWA 4WY2A 4D6YA 3F4LA 3RI3A 4RJKA 1ZW6A 1RPTA 4ZOQI 2GT1A 3N0RA 4UATA 2ETXA 3G9ZA 1SXJE 2CLCX 2YN2A 1T43A 1UXJA 1WETA 5TGTA 4PLFA 3U3DA 3E9NA 1U9IC 3SICE 2CB0A 3JVUA 1IMOA 2GJ8A 2PUHA 2VJBA 1EA7A 1KC3A 1Y4SA 3I6QA 1N1DA 2ID9A 4X93A 1UKZA 2X4IA 4UFOA 5C1OA 2WUEA 2PT7A 3U5TA 4AO7A 4JJ6A 2XMRA 1U98A 3M6UA 1I32A 4OYRA 1M0TA 4XA8A 2QJFA 3RTGA 2I9KA 3JAMA 3O92A 2BM8A 2FU5C 2H54A 4IEIA 4RIHA 3TLBA 3PA8A 1JV2B 4FIDA 1S3FA 4EFMA 3OI7A 3G82C 4WCDA 1RJEA 3G49A 2WF8A 3TRDA 5IBCA 2GDZA 1QFXA 2C7BA 3OEWA 4D5GA 1U9ZA 3WWOA 4LGMA 5IC6A 2C7GA 1T2DA 5IPFA 3GL9A 1LD3A 5EPUA 1M75A 2A4MA 2WKRA 4NPCA 4F9GA 1FJGB 1O94D 1H2RS 2XIJA 2X0KA 4EVIA 3FD8A 1PFYA 1P7PA 4GNRA 3FB4A 4MIKA 2E82A 2QENA 3PL5A 4A03A 1ZGJA 1W5BA 5JSFA 1JJIA 4EMSA 1MO4A 4GXTA 5FHRA 1G8AA 4I8IA 3C45A 2IPMA 2ZRJA 2V3VA 3C1UA 5T67A 3H9QA 1CC1S 1HT1E 1TMGE 2GN0A 3F9CA 1EE9A 4N5DA 3VAAA 4UZSA 3ZTYA 1HE3A 5HRUA 4B3BA 4F1WA 2EZ9A 1GTMA 2IWRA 1XTZA 2MR6A 4HHEA 1G7TA 4BNKA 2Q62A 2I3ZA 4NCXA 4QT0A 1IBMB 4CHTA 1WR8A 5CFQA 1WP9A 1E89A 3EVNA 2JD2A 3CEJA 3HRIA 5ICSA 5JPDA 2HTEA 4P53A 5JYEA 2OQIA 3OJXA 4G5QA 1O87A 4A27A 5LNK6 1SC4A 3X1YA 4B33A 2VG8A 1NKSA 1CUHA 1WAMA 4HH3C 4AB1A 5D7BA 2V7GA 3OBBA 1GGEA 1COZA 2CYCA 1JMVA 4QJ3A 2I4NA 5ES3A 1Y3DE 3ZBUA 4NYMQ 5LB4A 5KEIA 4ZFNA 4HWSA 3UG6A 4DQLA 3HLKA 1X9HA 1YJ8A 1PNQA 1Q0ZA 5AVUA 1PVOA 2ID8A 3GEEA 2HF7A 3ND8A 4MUIA 4QOGA 4GMDA 3RTDA 4XQEA 4YCNA 1MB0A 2FLVA 2QD3A 5FTJA 2FTKE 1SQGA 4ZEMA 4CMGA 1IM8A 1NR5A 4I50F 4OH7A 2DFKB 2W2NA 3QFHA 4QTUB 4B83A 1PQWA 1Z9BA 1ENOA 5JIBA 1P9RA 4PC1A 5J4VA 3T7KA 2FUG1 4L4YA 3O4JA 1GTL1 4FINA 2MSNA 4EL5A 3ROEA 1OBVA 1SUPA 4KUEA 3ZWYA 2ZYGA 4DA4A 1B23P 4B2PA 2ECQA 1QWOA 3KC2A 1SUDA 1XE3A 3ZTTA 2NSLA 3PUHA 3OHMA 1EM8B 4WT7A 5H82A 1EM8A 1L6IA 3GI1A 4GPZA 3B8EA 1RYMA 5TMEA 1WCV1 4L15A 2FQQA 1V96A 2GD2A 2FVYA 1ZJJA 5I9NA 1M1UA 2ISSD 3ZWQA 4AJIA 4M8IA 3P0RA 4DKXA 5B58C 3S44A 3P9PA 3AGPA 4XUGB 2VQSA 4I1UA 2QRGA 2W37A 3C3BA 5GGXA 4PXSA 5IMBA 3STXA 3ZG6A 6ABPA 3H2IA 3R5SA 5CT4A 3P9QA 4TTSA 3WYBA 1U1DA 4WCVA 1ZD1A 5DHAA 4ZV9A 1JNYA 4DZZA 4J6EA 1L2TA 1LV8A 1E0DA 4GFDA 2RHWA 4WJKB 1OYWA 3LHSA 1GG2A 2WHEA 1JF8A 2C95A 1U7TA 3KXLA 1ODSA 4NYJQ 1GU1A 2ZE5A 3ZWNA 5DM60 5A2GA 2A8YA 1CPYA 4NYIQ 3BS4A 4C6TB 2FWAA 3IBGA 2O8BB 3D7SA 1PGQA 1ZA2A 4U2GA 5K3CA 3WV4A 4C6TA 5A6SB 2O8BA 1UCFA 3G5UA 1M76A 5A6SA 1G41A 1T29A 3FXAA 5DYIA 2HA0A 3ONEA 2E4WA 4PW0A 3UB4A 3PRHA 3ZEAA 4C0BA 1L6RA 1ZK2A 1FXUA 2WWTA 5F76A 4CM3A 2WT8A 4C4OA 4UDYX 1KAMA 2NTYC 1EFPB 1NULA 3QEBZ 1KI4A 2P2YA 1EFPA 1VSBA 2EBUA 3EVGA 4MMZB 1ZVMA 4PZPA 1L4EA 3MW8A 2JDIA 2Q5HA 2QUZA 4NKRA 5BSUA 1Q7BA 3UK6A 3ADCA 1IN4A 5HE9A 4EKNB 2IXTA 1XTIA 5D3ZA 5KO2A 4EG8A 3VPSA 5JG7A 5JAOA 3VTAA 3VOSA 2I22A 2P4QA 1QO0D 2IOQA 1B8OA 2ZGVA 4POAA 3FOEC 1GEEA 1ADJA 1NRJB 2PDAA 3I04M 3STVA 3F6BX 4AMGA 3PIDA 4LX8A 3EDYA 4U7FA 2ONKA 1E79D 4OQNA 1Z88A 4MQUA 3NBUA 1L4YA 3QVGB 2H1IA 3BK7A 4ZOLF 2I7DA 1AG9A 1E0KA 3DCIA 3GR6A 3QVGA 4X3OA 3VSCA 3SG0A 4A5OA 4B5LA 2FZ5A 3L7DA 4D56A 1D04A 3QKUA 4U63A 1J39A 1FF9A 3IHTA 1GV0A 3C7CB 3CFYA 3I5UA 1BGVA 2G9UA 3O8CA 2OQ2A 5MN6A 4HPXB 4MW7A 1KZ7B 1OF1A 4MB2A 3RSLA 4JENA 3UWOA 5KWEA 1EWYA 3CIFA 4HGRA 4ANFA 3QRWA 1S89A 1QFSA 5KPJA 3C6BA 3EGOA 1R0ZA 2FF7A 1W581 2IY8A 3E15A 4LCEA 4WEQA 2Y0EA 1GAQA 3P1JA 5CRIA 4D43A 4FFMA 5HKBA 3NFYA 3ZY5A 4Y6SA 3ROFA 3S1SA 4QL3A 3GXOA 1RW4A 4Z9YA 5H4HA 2NZXA 2CFSA 1E2BA 3CR8A 2J9XB 4PHFA 2J3DA 3EGDB 2CHUA 2GA8A 4RQBA 4Q4CA 1BN6A 3DPIA 3EGDA 1KHHA 5AKHA 4QEKA 1YZLA 2UYYA 4GWGA 8OHMA 2AJ8A 3ZY4A 1YZVA 3HCCA 3HEMA 3CBQA 4AT1A 2GNOA 1R8JA 2ZR0A 3A9RA 1KKLA 3A1NA 3M6WA 4TQGA 3MXTA 1EBUA 4HMQA 4F8JA 1HDCA 3COVA 1JQJC 1RHJA 4Z3DA 4BJ6A 4HWTA 1PWXA 3VA7A 2GYUA 1J06A 4FJ0A 1NBOA 4IFEA 4DDTA 1EFCA 1FFHA 1U3WA 2ZWAA 3LCVB 4GLJA 4XX1A 1XG5A 2VXYA 2ZTLA 3ZNNA 4ENQA 5B6JA 1E7MA 1YA6A 2QE7D 3LBFA 3D43A 4Q1AA 1NA5A 5F21A 3K0CC 5UKDA 2H4ZA 3ZDXB 1AQNA 1Z28A 2OFPA 1WXHA 5EFOA 4AMBA 4E2YA 3HY6A 3F2VA 3FDJA 4TKUB 3UKJA 2AUNA 2W2OA 4TKUA 4HN9A 2P69A 2Q3CA 1QLWA 4XGRA 2HPHA 2QRLA 2GM5A 5JBQA 4L3WA 4YI5A 4EY8A 3A1SA 4CDGA 3EQ8A 2XMQA 2GHIA 1T1GA 3AMVA 2ZTHA 4ARCA 4PZYA 1TAGA 2ZSKA 1RFGE 3KALA 2Y93A 2YNMD 3FPAA 3I01A 3AZOA 2GM9A 1AKNA 3P4YA 3FZEA 4NP6A 3R74A 3G5TA 1P3Y1 3EE6A 3ZGOA 3QKSB 4UQOA 2PG3A 4L02A 4UKDA 4V0LA 5CM9C 3QKSA 4EY5A 3TFOA 4ZAZA 1YHYA 2VT2A 4PY2A 2ZDQA 1PBTA 3GFRA 5D3MB 3C8DA 3OE4A 1G8FA 1A97A 1Y63A 3O1LA 5D3MA 2YL2A 2WG2A 2B7CA 3GGSA 4WBNB 4WBNA 1XPUA 4A0QA 1I51A 3URMA 5HPYB 1E3WB 5LXTB 3AP3A 4NU6A 5LXTA 1E3WA 1BH2A 2Y1CA 4QWWA 3L8EA 1R50A 2J6IA 1Q50A 1WZIA 3TAUA 3LXXA 3I9KA 5JZBA 2WJYA 4D45A 2P2GA 1GVNB 4EY7A 2PR7A 4RH0A 1H2FA 4R7ZA 2DBYA 4FZ5A 1DARA 1ICIA 4C2UA 1IYZA 3LUGA 4GEGA 5KNLA 4DR7B 4I1PA 4YASA 5JHGB 4PQYA 3P9NA 5SYAA 4D0LB 1LDBA 3MK31 1KQNA 5JMWA 4GXRA 4A6XA 3CNEA 2VL7A 1NATA 3ACDA 4TKZA 1E6MA 4PTZA 1JG1A 4GX1A 2FR1A 4FE4A 4L7VA 2FB9A 1HUQA 2WUFA 4IIDA 2R1VB 4CV0A 2JI4A 4G36A 1NP6A 1QDEA 2R1VA 3OQHA 1OZ0A 3SBDA 4IY1A 1EK0A 2NYAA 4F72A 2W5UA 3BC1A 3HCDA 5M2QA 4UU0A 2ECFA 4NFYA 4MHOA 3IOYA 3RFCA 2JGKA 2HX1A 1DEXA 1TYEB 2ZR9A 4ZARA 3RAGA 2DWPA 1YIOA 2F1HA 3MERA 4GW3A 1IDN1 1LPOA 4R2MA 3RJ9A 3K0EA 1M66A 3QF4B 4TX1A 3RSGA 3S70A 4CKWB 5L7WA 3QF4A 2HHAA 4CKWA 3TTXA 2P11A 1B0ZA 4K0RA 1ZKMA 1WM1A 3C8ZA 3N2ZB 2QMEA 1ISFA 1HFEL 2X9VA 4NR0A 1YRLA 4TXNA 3KP1A 5EIFA 4EJMA 4YCCA 2XWJI 2DBZA 4LSZA 1E63A 4U7PB 2YHSA 3WZ2A 4X7PA 1H0KA 1OTHA 1Y6ZA 5DWQA 3JQ9C 1PS8A 5IKMA 1T6XA 1B8UA 2JCYA 1JTFA 3Q3IA 5JWRA 4FEAA 4GLLA 4WERA 5BV2P 1TTQB 2IY9A 2O1EA 2VS1A 3DT8A 2XZPA 4L2IB 2AKAB 4RJLA 1FP1D 2YY7A 3WJ1A 2QQ5A 4L2IA 3GLVA 3H5WA 4DCJA 3B38A 1NXTA 2A0WA 3D6TB 4IHJF 4B4DA 1ADFA 1VE1A 3G13A 4MWDA 4CV1A 3DVSX 5KTTA 4N5HX 2Y1GA 3B1WA 3MJRA 4BNYA 3NP9A 1OY1A 4HLCA 1KJYA 2ZTUA 1XHEA 4B0PA 4Q1DA 4YV0A 2GPAA 4PHTA 4OHMA 3KB6A 4PR3A 5BYJA 3VPCA 3WHKA 3EOBI 3GEMA 2ZXUA 3RSSA 1SIOA 5IDVA 3LCCA 5IUJC 3RUPA 1WDWB 2I7VA 3VNAA 2Z3WA 1FFXB 3QLVC 2CC2A 1FFXA 5A7GA 4NZZA 3BXFA 4NBKA 1PVDA 1S8AA 2Z57A 3FTPA 4RPCA 3DBOB 4YIHA 3UHJA 4B9AA 1QZUA 4Y2PA 2QX7A 2QAJA 4DCVA 2XQIA 1HDRA 2ZTSA 2C54A 1ECLA 2Q5JA 1KDPA 2PZMA 4ARZB 2ODEA 4LE2A 4BCCA 5FI5A 4ARZA 2MYUA 1VHTA 1UK8A 3DTVB 1R6DA 3FYTA 3VYTB 3DTVA 5DOVA 5B55A 2H07A 1R4ZA 3CZQA 3GUCA 1CUUA 3M6AA 2C98A 4RZSA 3K09A 3G6KA 2C9DA 3TLZA 3WQQA 3DKKA 3NORA 3O9MA 1VJRA 3TR0A 1C50A 1SO8A 3BGSA 4W1SA 1JEAA 3QJYA 5MN4A 4CTMA 1IRIA 1ZQ9A 2D6FA 4TTQA 4W5HA 4Q6BA 1T8WA 4LC1A 1DIHA 1MRZA 1AHIA 1K6EA 4C0QC 4MYHA 1F06A 4DMMA 5LJLA 2ZBRA 3K1ZA 1Z7GA 2OBYA 3DONA 1T1JA 4HYQA 3H1AA 2R8RA 4M88A 4QA9A 3UMSA 5TVGA 3D81A 1GKUB 3FNFA 5U9CA 2YHUA 2DUWA 4Q1VA 1JIQA 1G4UR 4WHMA 5AOVA 1H69A 2VHWA 1CCWA 5E7IA 2HV8A 4AYWA 4IOLA 4KGDA 2BDTA 1RXEA 3ZE1B 1R15A 5LVAA 1WU7A 1ORRA 4Q39A 5B57C 5JSZB 2HT6A 4KR7A 1T2AA 3ZD8A 5JSZA 3GVPA 2D3WA 4PO8A 4OHUA 1IY0A 4J43A 2I78A 4JP5A 4YAWA 4Y9DA 1OVGA 2PV7A 2CNKA 2X13A 4ZMBA 1DQSA 1UBSB 2A33A 5K0FA 3GEIA 3ITEA 4CJXA 2FZKA 2J5BA 3N28A 1DBPA 3D0KA 3K6SB 1O6FA 4L1KA 1EVEA 1BEUB 4M0CA 1JP7A 1PDVA 4QBTA 2O1XA 3RWMB 1XDWA 2DE0X 3P9KA 4RH3A 2UAGA 4UEKA 1MD9A 2VC2B 2ZJBA 1NW5A 5HFAA 2JI6A 3HJRA 3VJKA 4XWOA 1P1JA 1UKAA 4CKCB 4M1WA 1GNRA 2H1HA 2CEKA 3TLXA 1D5WA 4CKCA 3NTLA 4C7OB 3HU5A 4AYXA 2GEDA 4B48A 3F4KA 3A28A 4DIKA 4C7OA 4OGGA 3JVDA 4PGHA 3HO1A 5HK8A 1SXPA 5LIPA 5AW5A 5JXWA 2X76A 1NC3A 1L7EA 1WZNA 1O54A 1QE5A 5EP4A 3EAFA 4JI7B 4R98A 2SHKA 3P7MA 2PKQP 3CUVA 1I5OA 1RIIA 3F6YA 3NIGB 3Q3JB 4N9QA 3T3IA 4EEXA 5CDSA 1DOAA 2ZZKA 4QIHA 3HJHA 4TS4A 4TYQA 1UIRA 4BWFB 10MHA 1HLDA 1DADA 6ADHA 2F1JA 2NIPA 2QMQA 3GRAA 4KAAA 2BF7A 4CM7A 1XP8A 3FLMA 2BMEA 4FHGA 4RWEA 8ATCA 3K6SA 1C1DB 2KLHA 3RS4A 1IPEA 3M9LA 4P81A 1C1DA 1RI4A 1GLVA 1AK1A 1VHQA 2B7BA 2H2HA 2PQ6A 1VPTA 1EINA 3S81A 2JHGA 1X14A 3LO8A 4F2GA 1C2YA 4FFPA 1CUCA 3I1IA 5D01A 5F78A 3A58B 1U0OC 4BUJA 4BVHA 4PYOA 4DPKA 5H68A 4ENPA 4UTNA 3HKEB 1W36B 5F7OA 1RJGA 4D3XA 1OWMA 1E6LA 3HKEA 3IBCA 4KAXA 3A6KA 2Y2UA 1YQTA 2XT9A 5EVCA 5JATA 2PCJA 4KYTA 2PA0A 1N9GB 2G06A 1H5UA 3OEYA 1N9GA 2RC5A 4FI3C 4G2NA 4PSVA 4DABA 4F4UA 5FWAA 5JOQA 3ADPA 4UCQA 3WDMA 3J7AC 1TMKA 1W25A 1XA0A 3X1ZA 1OFHA 2IZ5A 3QU5A 3RM3A 3ZHTA 3TD2A 2HHHB 4ODIA 2ZQZA 8GPBA 2A1UB 3DLBA 2J08A 3PNSA 1OLSB 2A1UA 2QQ0A 4I3HA 2GAOA 1OLSA 4HD8A 1J24A 4BKUA 5YASA 1V25A 2GBCA 4ZAYA 2HIMA 4BO5A 3CEHA 3L92A 3PE6A 1RXVA 3VR4D 2ZJ4A 1J0DA 5C51B 1T8RA 4QG3A 3AR7A 3ETHA 3BIWA 3GMDA 4FDTA 4WE3A 2IHKA 3FCEA 3C3DA 4JB8A 5CJ2A 5IJ9B 1VHWA 4O8ZA 4WSOA 2BI8A 2NO6A 3G59A 5IJ9A 3LX5A 2B9EA 3IEIA 3LPMA 1G7SA 3ILYA 4V03A 1QC5B 2IYUA 5DZSA 1OHHA 2I2FA 2JGNA 3A11A 1DWOA 1QC5A 3BB1A 2ISCA 4UUBA 3W2HA 3B3GA 4BFSA 1N1MA 1U6JA 2VEDA 1QGAA 4CE6A 1OIVA 3EIWA 4GM0A 2XCSB 2I2XB 1AXEA 3QH4A 1E59A 3H1GA 1VLJA 1G3MA 4J0CA 4PBSA 1B42A 4CLXA 1K98A 7ABPA 1R27A 1MZPA 2QUJA 1TQ2A 1U1GA 2HCJB 3C3YA 5GY7A 1L5HB 2JEYA 3D8BA 4UQLA 1QLJA 2B1JA 4G41A 4HS4A 1L5HA 3IODA 1U8AA 2H4JA 1L3BA 5GWXA 1PR0A 1Y37A 1R64A 4XCVA 3AUXA 3B60A 3PLAE 2ZRCA 3LY9A 3CNQS 4W5JA 3U31A 3X0DA 3K1JA 4MI1A 2J41A 3SS8A 5HM6A 1B0UA 4HNQA 4FGZA 4KE6A 3ENKA 4RM3A 3NTVA 4X6UA 2NVBA 4WINA 3VO1A 4E5NA 2NUTB 2Q7XA 4YAUA 5C34B 4MV9A 4HLUC 3KQYA 4M54A 2QD1A 1UT6A 4NCNA 5EUCA 5T3YA 1KE2A 2R8OA 2NUTA 1P1RA 5IK2D 5DNUA 4JXJA 3AM3A 4E1BA 1RHUA 2NUAB 5TJ9A 5IYZB 3IMCA 1TQ6A 2NUAA 4K9NA 2V4UA 1TZMA 3SXPA 2TMKA 5IYZA 2QNRA 2XTJA 4L22A 1QF7A 3WQBA 3PQDA 1EJ6A 1ZSYA 3A05A 4FLEA 2ERCA 5ILGA 1XMIA 1L1FA 3CR7A 1JWBB 1PEAA 3MUEA 2R1ZA 4OAPA 4YP9A 1TTTA 3IHKA 1PGPA 2GERA 2CWWA 2ST1A 5J2TF 4AX4A 5BR4A 2LCFA 4EJSC 2BKXA 2WIKA 3PPYA 2H00A 4LQLA 3ZS9A 2O3RA 1QAOA 3RVPA 4YH1A 221PA 2EFHB 3MWEB 3PR1A 5DV9A 2JGIA 1DAMA 5A7HA 5C9ZA 4D0NA 3MWEA 2VT3A 5CA0B 1ECGA 1UZMA 3FYSA 4FQ5A 3ZXXA 4RDHA 2G8NA 1DG9A 3IDQA 5CA0A 1KYZA 5AHWA 2R6HA 3HDHA 2R6AA 5I5GA 3H9JA 4M7WA 4M7PA 3RUEA 3VRHA 1IULA 1BVUA 4YUZA 4UC0A 4NEGA 5K0SA 2PUWA 1Z6GA 4JAVC 1DJOA 2BGWA 2QPOA 5JZOA 1GRNA 2EEZA 3BAFA 3D64A 2HSEA 3SEZA 1Q7GA 2QP3A 1ZX1A 1UPUA 5TPZA 1I1HA 2Q0QA 3R6LA 1KZGB 4MLZA 2ALJA 2H7YA 3IKTA 5DTMA 5T3UA 2QXYA 1ZM9A 1ONBA 3VNBA 1Z0FA 4A0HA 5ENDA 3WIOA 4NZOA 2JF0A 3THSA 4X60A 4LYFA 1KXJA 3FZNA 2O8NA 5EUMA 4FZJA 3DZFA 2R4QA 4E46A 5E2IA 3W4IA 2MSKA 1O5IA 4DZTA 4WOKA 1EXVA 1TYCA 2C2MA 5IAOA 3V1NA 4EMBA 3CGWA 5AOBA 4DLZA 5A0TA 1Z3IX 1C1YA 5DSXA 1VJ5A 4G8CA 3EPRA 3F74A 3KPYA 3ORYA 3RC3A 3EEQA 2RGRA 2H1LA 1OGYA 3DMTA 3B5IA 5IFLA 1FS6A 2Q29A 5D1HA 1WKBA 3IVGA 3RKRA 4BFVA 1UZUA 3N8GA 4HEJA 4KKVA 4QGBA 2FR8A 5L3SB 2JGFA 4INPA 1W0JA 1MORA 3LA8A 3ZN2A 2VJOA 4LKRA 1U4SA 2Z08A 4QUIA 3TQRA 2DHQA 4EY4A 3GLSA 3OCVA 4PLVA 1GNVA 4UTPA 5K8UA 3NUZA 1SCUB 4QJBA 2XOKD 2PGNA 4N3BA 1SCUA 1VMDA 3ZHSA 5JLJA 1FVXA 2PANA 2W90A 3SYMA 5AVKA 4MB0A 4AP5A 4G37A 5K0GA 1D9ZA 2R6ZA 3ZWVA 4RZIA 1NN0A 1RWMA 3VDNB 2CJWB 2W6JD 3PKJA 1I3MA 1SKBA 2CJWA 1Z0JA 2FZCA 2IOYA 2Q5CA 3IVRA 4ZAVA 4UPEA 1X7ZB 5JCJD 5LLDA 2CVOA 3DEZA 2PM8A 1X7ZA 3KAPA 4TKLA 2V7WA 1J2JA 4PM4A 3DKIA 2YDXA 1FX1A 3B12A 2ZJ5A 4FNOA 1KJ8A 3B9BA 3OQMA 2CFTA 4EX6A 5KTNA 1GUAA 2Z5LA 3WRWA 2BZGA 1OC2A 2PLNA 4C0XA 2XPCA 2LVBA 4E4YA 3R1IA 3FZQA 5FOUA 4BNZA 1Z07A 3NJRA 1RM0A 1E2PA 1MVNA 2VPXA 1DL5A 4YAFA 1YKGA 3UPUA 4Y98A 1M2KA 4A23A 2GUGA 4YT8A 3QIAA 4ZDJA 2Y27A 4HT3B 3LNTA 4GPIB 1RQLA 3DUFB 1PI3A 4UNRA 3DUFA 1ZHHA 2ORVA 1DEKA 1XZFA 4UCWA 1LRLA 3OPYB 1QGUB 3OIVA 1FNBA 3UPDA 3OPYA 3PUWA 2GB4A 1QGUA 4LHVA 2HN9A 4B7ZA 3KEFA 4FFRA 3GJYA 3DV0B 4QLOA 4M87A 4A8PA 2BGRA 2ZIEA 3DV0A 3R0IA 3CB4A 1UBCA 4HQRA 4MWZA 3K71B 3INRA 3U6BA 4CQLB 4RY8A 4CQLA 4D9KA 5KSZA 1J0BA 2O7RA 1MQ9A 1N6OA 4IJQA 4JVNA 5DHSA 3VNUA 4GYWA 3RBVA 3SD7A 4AXXA 4W6ZA 1ATZA 2PL1A 3MJDA 5FO1A 3RAPR 4DEVA 4RKRA 5K01A 4AMYA 1WMSA 4IUYA 4M76B 3VPGA 1YXMA 2V0NA 4R2LA 3N87A 1EDBA 1N2ZA 4XSVA 4XSGA 1FYXA 1PJRA 4L9WA 3R24A 3UJ7A 3TOXA 3UAXA 1P1KA 5AW2A 1WKVA 4RHTA 4DIEA 1PFKA 1BD3A 3ONDA 1JXQA 4LV5B 1I7DA 3HB4X 3ABRB 3TRKA 1NQWA 1GCUA 5EHZA 5ICGA 4BNUA 4Y6RA 2JFQA 2ZJ1A 1P9OA 2P67A 2H5EA 1KQ3A 3D4PA 3JQCA 4AY3A 1KEUA 3WJ7A 1KYVA 5LSAA 1R4AA 5HDBB 2DR0A 4X45A 4ZXFA 3R7BA 4HQOA 3L0IB 5HKKD 4EHAA 4HTAA 2P9JA 1NGSA 1VYTA 2ZDHA 4LJ6A 2ARKA 2C57A 1Z35A 2UXCB 1M7GA 2AC2A 2DWUA 1P18A 3PIRA 1PZEA 1FSZA 1LSUA 4XH9B 4BNVA 5IH7A 4JUCA 4RD4A 1M2EA 4RK6A 5T6BA 2OHGA 2FSFA 3WRYA 2Q0SA 5HMMA 4F9FA 3M6VA 1ISRA 1XUOA 1PEKE 4J7UA 3AO0B 1FBNA 3QNUA 3WLAA 1DBVO 2CDBA 4RDIA 5AJTA 4MWTA 4UQPA 4RMJA 5BNIA 1TMOA 3LCMA 2Q4BA 4GMGA 2WTAA 5EZ5A 1U5CA 4RXUA 3U4CA 4YN3A 1U1EA 2WDZA 3AEQB 1EU1A 1SXJC 1EHCA 2VJYA 3RRXA 3AEQA 1LK5A 5LMNB 5FFNA 4Q7JB 1FC0A 2FWNA 1Q1AA 2LXNA 3DVLA 4TLDA 1U9JA 5KDLA 4OYYA 3RC2A 2DY1A 3TQTA 1FSPA 4PQRA 4NMHA 4UM9D 1RLMA 1N8KA 3ZDFA 2J3IA 5DH9A 4JHXA 2XNDA 2XUIA 3OLYA 3VU1A 4LOKA 5A5EA 3HBJA 1MBZA 2UUPA 3NO4A 4PSDA 3AIKA 4Z9BA 2PYZA 4RTOA 2BKVA 3LUAA 2RJNA 2WHRA 2B1IA 3HYNA 4P0PB 4JLAA 2HDOA 3GEHA 1QG0A 3K2QA 2W2QA 4RA6B 4C3UA 4AJPA 1RP1A 3B2EA 4CL2A 2OZLB 2P75A 3N59A 1UFKA 2O2JA 2PTGA 2QLNA 4JKYA 1IXKA 2OZLA 1JDTA 4PFSA 5FHQA 5JPIA 4RDCA 1UKBA 5IKEA 4KO1S 2QR2A 1QF6A 3K0KA 1N5OX 4XLZA 5AM0A 1XALA 1X87A 5DGXA 5C53B 2YY5A 1U9IA 3NHYA 2WKPA 1P31A 3JYQA 4U7GA 3U17A 4HNTA 4IV0A 1RRCA 1NN5A 2DCMA 2ACKA 1R66A 1TC1A 2R6R1 4X1KB 3GRUA 2CSXA 4G4SO 2I87A 4U9UA 4X1KA 1FW6A 2G7MC 3EISA 4PANA 4QOFA 1H65A 3BF7A 2LGJA 3OPXA 4MKXA 4IW3B 4P36A 2RGBA 1L4GA 1JHRA 3W06A 4PIVA 2VKQA 2E4VA 4KIUA 1JSZA 1UPFA 3GEGA 4PNEA 3TEJA 2X7JA 2QXUA 3I9OA 5INTA 2J7PA 5JNWA 3WWZA 2O57A 3B6JA 1Q0UA 1YHNA 3OJ0A 4R31A 2EKBA 1T5HX 4R01A 1CG6A 4PCUA 5AJWA 2E5LB 3OCJA 4QDJA 1KO4A 3JZMA 1SZCA 4QXQA 5HHTA 4MRRA 4AY2A 2RC6A 1E20A 1QP7A 1NF8A 1MC1A 1PL7A 3L8DA 5IEBA 1HQCA 2ZT8A 2PPVA 3SF0A 3NRCA 4C43A 2B94A 3FCOA 3O2NA 2YBEA 2DP4E 4G0NA 4UDNA 4ZJYA 1F7VA 4P83A 3USZA 2WWHA 5EMNA 5JTTA 3HJBA 5AXBA 1AGPA 3EY9A 3SLKA 1C3JA 1JT2A 2O9JA 1VYUA 2GI4A 2QTFA 1W5AA 3DR3A 4XD7D 2GILA 4MGKR 4R8MA 2OCGA 4BQRA 4Z3KA 4HQ0A 5F2NA 3V42A 1BGWA 3F49S 1MRNA 5J47A 1NNEA 3H5LA 6Q21A 4B6RA 2N9UA 1XZMA 2O3JA 2QSJA 1B3BA 1OBHA 3FRIA 4Y67A 1GT6A 4PZ0A 4DWVA 1V1RB 3UKOA 4DVJA 5KKCA 1V1RA 4MARA 2B6NA 3WLIA 2G28A 2Z2KA 3USCS 1NQVA 3HVIA 3LQRA 3BHMA 3KQTA 2WWWA 2JI7A 3JQEA 4OHBA 1CR4A 1GRQA 4X8OA 4ZREA 5AVZA 5LDHA 4AUNA 1GPBA 4D4LA 3LL7A 2Z6AA 3TEMA 4FGJA 3HKBB 821PA 1RI5A 2C3OA 1B15A 2GLTA 3HKBA 5TRTA 4DZRA 3GRYA 1MDFA 1HDEA 1USIA 2Z30A 4NIMA 4BE9A 4TYWA 4NSNA 3C3CA 1HX7A 1CIPA 1TAHA 4UUMA 1KEKA 1ZK4A 2AK3A 4Y2GA 1VPLA 1IDOA 4RCYA 1QZ3A 2HMAA 4IO0A 3K0BA 5AW0A 5EJIA 2R97A 3T41A 4X54A 3TLAA 4XWWA 4R81A 3PT9A 1U1CA 3RHZA 2IVZA 1DXQA 5FI1B 3FOAA 3IDOA 4XQCA 1AS0A 2C29D 3HCBA 3O94A 5DRTA 5EESA 3TCXB 3WGOA 1CETA 2AE1A 5KYGA 2JLXA 2C2ZA 4QNRA 1YRYE 5HX7A 4UJ5A 4BVKA 1CFJA 2Y67A 1BVRA 1RS0A 2FP4B 3VKFA 1PZXA 1QR6A 2FP4A 3UK0A 4I1VA 2Q4TA 2XUOA 2ZTMA 4MCAA 3KR2A 2GZ1A 3N2IA 4DM4A 3NHFA 5KOIA 1IZ8A 4OP3A 2XMGA 4EHFA 3U1BA 2H1CA 2XKBA 3OUUA 2R11A 5AI4A 3WKEA 2AF4C 3AR9A 3GNQA 3V1YA 1G21B 2DFVA 5LC1A 2JGDB 3ZIAD 2REBA 1G21A 4EX7A 2WKSA 3EB9A 2JGDA 3EG9B 3P45A 3TQFA 3WXBA 2RHJA 3A8TA 3EC2A 3EG9A 3RWOA 4E3WA 5ADHA 1L5QA 2ZUCA 3ABQB 4KWEA 3BUSA 4S1OA 3U3KA 3WAKA 3PKIA 1E9SA 1VRWA 3H42B 3RUAA 3A3OA 3B7PA 4TRMA 3LUPA 4GZ5A 2IK8A 3ORSA 3TOCA 3BHIA 1KI3A 4GE0A 4NECA 4Y9TA 1CJKC 1NUQA 1X0XA 1GQSA 2ODAA 3AUJB 4FOOA 4W7SA 4AQDA 4ZOBA 2VJMB 3Q87B 3CLVA 2R6FA 1S1MA 2VJMA 4WKBA 3ROMA 1PAUA 3SHFA 1WXGA 2ORIA 2CHFA 3TB4A 3ZE2B 3DMNA 2ZYSA 1XLUA 2VF7A 3DL2A 3NANA 2JI8A 3QLUC 3GRFA 2ZE6A 3P5SA 4PRLA 1YOVB 3RIEA 1Z5UA 5L3QB 3RVMA 3VXKA 1T1IA 1YOVA 2AK2A 4E2ZA 2CJYA 3FUTA 5L3QA 1QUEA 4MW0A 1R5JA 3DOFA 1GTZA 1D6NA 2W0SA 2Z9BA 5J4LA 3I58A 2LW7A 3LK6A 3GN2A 1CUEA 2GN9A 2H65A 2RKBA 3COWA 1NQXA 4FVTA 4FWBA 4HUJA 4KE9A 5KCMA 4RPIA 1PQ4A 3IX7A 4FHDA 5IAEA 5L45A 4IL5A 4NH4A 1T0IA 4XB1A 4EYGA 2HADA 3UWPA 3VTFA 1E0SA 1PE0A 4JJ4A