1N9ZA

Integrin alpha m i domain mutant
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
184
structure length
184
Chain Sequence
b'CSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQLKKSKTLFSLMQYSEEFRIHFTFKEFQNNPNPRSLVKPITQLLGRTHTATGIRKVVRELFNITNGARKNAFKILVVITDGEKFGDPLGYEDVIPEADREGVIRYVIGVGDAFRSEKSRQELNTIASKPPRDHVFQVNNFEALKTIQNQLREC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrin alpha-M
molecule tags Cell adhesion
source organism Homo sapiens
publication title Engineered allosteric mutants of the integrin alphaMbeta2 I domain: structural and functional studies
pubmed doi rcsb
total genus 65
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2002-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 1n9zA00
3NIGB 4HQLA 5KYUA 2ODQA 1T6BY 1LFAA 1MQ8B 1MJNA 4UM9B 3BQMB 2VDLB 3K72B 1FE8A 1ZOPA 4O02B 1MQAA 4Z7OB 2VDRB 4A0QA 1QC5B 3V4PB 4MMYB 1JEYB 4WFQA 3TXAA 1M10A 3EH1A 3ZDYB 5E6RB 3PPVA 2XGGA 5HDBB 1M2VB 2O7NA 3F74A 4WK2B 2WINI 4CNBA 2ICAA 3EOAI 2B2XA 3E2MA 1IDOA 3EFOA 1U0OC 1DGQA 1IJBA 3RAGA 5KYYA 4NEHB 3K6SB 3F78A 3TW0A 1MF7A 2XWBF 1U0NA 1CK4A 2QTVA 4WK0B 4HQFA 3ZE0B 2IUEA 3BN3A 1BHO1 5KYWB 1V7PC 4C29A 1RTKA 5KYUB 1QCYA 4G1EB 4WK4B 1JV2B 2NVOA 4DMUB 4UM8B 2NUTB 1M2VA 1MHPA 5KYXB 3PPWA 3QA3E 1SQ0A 1QC5A 3EGDB 1CQPA 3HI6A 3PPXA 5KYNA 1XUOA 1RS0A 1M2OA 3TCXB 2X5NA 4HQKA 1AOXA 3BQNB 3NIDB 5HGJA 4Z7NB 3EOBI 1XDGA 4UM9D 4XW2A 2VDNB 5KYYB 3K6SA 2XWJI 3K71B 1PD0A 3EFOB 1DZIA 2VDQB 3Q3GE 2ADFA 1N3YA 4BJ3A 1U8CB 2NUTA 4C2AA 1FNSA 5KYXA 4WJKB 4JDUA 3HXOA 1IDN1 5LN1A 4F1KA 3NIFB 3EGDA 1M1UA 2NUPB 1ATZA 1UEXC 5ES4B 1JEQA 2VDPB 1YVRA 3FCUB 4HQNA 5E6UA 2I6SA 1XDDA 5E6SB 3EGXA 3IJEB 3ZDZB 1RD4A 2VDMB 4Z7QB 4NENA 4PN7A 1PT6A 1ZOOA 4FX5A 1Q0PA 2ODPA 1MQ9A 3ZE2B 3ZQKA 1N9ZA 3V4VB 3EG9B 3GXBA 1YVPA 4HQOA 3N2NA 3IBSA 2M32A 2NUPA 1L5GB 3T3PB 4CN8A 1T0PA 1SHTX 3M6FA 4IGIA 1PCXA 5HJ2A 1TYEB 1SHUX 5E6RA 1AO3A 3T3MB 3VI4B 3ZDXB 3ZE1B 4G1MB 3HXQA 3TVYA 1RRKA 2VDKB 1JLMA 5E6SA 1JEYA 3EGXB 2I91A 2I6QA 4CN9A 1AUQA 1IJKA 1OAKA 1PD1A 1JEQB 1ZONA 5E6UB 4M76B 1BHQ1 2WW8A 3VI3B 4C2BA 2VDOB 1NA5A 2VC2B 3EH2A 3EG9A 4IXDA 4MMZB 1M1XB 4MMXB 5BV8A 3PPYA 5KYWA 4NENB 4F1JA 4IHKA 3FCSB
chains in the Genus database with same CATH superfamily
1N2CB 4D4KA 1E5TA 1LFDB 2EKQA 4RD6A 4XGNA 3GFPA 2HRCA 2FPOA 2XNHA 4KXVA 3E0XA 4MAFA 2XB9A 4KGXA 3T0IA 3LD9A 5CPFA 3WO1A 3MJTA 1I1HA 4K05A 2H5LA 1NJSA 1C3OB 1TAHA 5J4KA 2IPXA 1YA4A 2BFFA 2EL7A 4IKPA 4OTZA 2UZ1B 4ACAA 3CVOA 4E5DA 3F74A 3L82B 5P21A 3TFQA 5B1SA 1HDZA 5DNVA 2ZTMA 3QVXA 3EAQA 1Z25A 3GH1A 4MO2A 4RC9A 5HUHA 1TKBA 3PRKE 5DTEA 5BXYA 3SU8A 2Y66A 2P35A 3C6YA 4TV9B 1BWSA 2H0AA 2OZEA 1THMA 3D7NA 5D51S 1DLJA 3S4YA 3GJ5A 2CYAA 2GF9A 4YV2A 2QTVA 4IEIA 1HY3A 2YJ4A 3EA4A 2VATA 1F2DA 3FNBA 4X66B 2R48A 4ND8B 2F3SA 1YDHA 5ITWA 5KQMA 1C1XA 2LCIA 3HVUA 1PI3A 3HCAA 2QGFA 2Q4DA 1Q0LA 2QAIA 3KFVA 3M6UA 2F3QA 4M1SA 4Q18A 4C21A 4GI7A 5MHTA 4JV5B 2V9ZA 1J90A 1MO5A 2JH9A 1CUGA 2JIMA 3SFZA 1N1EA 4R83A 4MV4A 3FNIA 3B38A 3M2PA 4UBLA 5ETJA 1G3MA 3RRBA 1IN4A 5H7XA 2WRZA 2SCUB 2JD1A 3ZY2A 1YT5A 4Q9IA 4WX2B 3FUWA 2OHXA 2A5YB 3WBKA 2JDIA 1GZDA 3AM3A 3FIUA 4D46A 4FX2A 2HQBA 1SBYA 3RC3A 3HUUA 3A04A 1XLVA 2AZMA 1IB0A 3I5MA 4NFHA 1TA9A 5H3LA 4CL3A 5KYXA 1R8QA 1UBEA 5JNSA 1OGYA 1ULHA 2YTZA 5A0VA 3NWJA 5K51A 5LQKA 2IYUA 4C0JA 3BFKA 4OG2A 1G4UR 4D3FA 5DI3A 2O8FA 2EKBA 1NPTO 5JC8A 3I3SR 1EE2A 2R87A 3LT5A 3D8SA 1ONBA 4B6SA 3THYB 1HDGO 1KFJB 2WPDA 4XIJA 1M3SA 3IQDB 1FTGA 1U2PA 2DCMA 2F1OA 4HDSB 2ZRAA 2EDAA 4X97A 5DISB 3MGCA 4A3SA 5AJVB 1VFPA 4R40A 4X8HA 1SU8A 1DMRA 4KQIA 4LK3A 3SDBA 2RHJA 2AG6A 1R64A 3WXMA 1WQ4A 3PFCA 5GIPE 3PFWO 3DW3X 4GLFA 5HDQA 1A98A 1JIJA 2OEPA 1SCNE 1W4BA 1WVMA 2YVLA 3MCTA 3MILA 4RF3A 4RD0A 1ZH0A 2ZE7A 1WB5A 2NG1A 1HLFA 4B33A 4F45A 3IYLW 1K68A 1SWWA 3ZV3A 3I6MA 4E88A 5BOSA 5C8ZA 2PSHA 3ACCA 4TWAA 4J2OA 2HR1A 1X9IA 3L8ZA 4NZMA 1L4NA 2FMXA 2HEGA 5D7NA 1T9ZA 1R9MA 1V43A 2VDJA 4OL0A 4F85A 2JW5A 3I83A 1YNSA 4MW9A 4Z49A 1PSZA 1Q7CA 2WJ3A 4G07A 4ONEA 1IEQA 5LOVF 2IEYA 4G0XA 2IYRA 2JHCA 3O38A 3MD9A 5CB4B 3SFVA 5EQJB 5T64A 1UFQA 1GPYA 5IH3A 1ETUA 3IUSA 2JIDA 3WNDA 1Y3FE 1GL3A 5L3VA 3S2YA 1QYIA 2VO1A 3K53A 1RMTA 2WT9A 1XNJA 5H4HA 1I6KA 4I1VA 4MB2A 4QGGA 4E4RA 4F8JA 1XHFA 2QGNA 3E1SA 3UAGA 2DFVA 1N0WA 4PAOA 5E4YA 1P7YA 4BO4A 2JLUA 4IQ8A 4XPZA 5EWLA 4H1HA 2O2SA 4Q7KA 4HV4A 3I9OA 4CM8A 1Z5WA 1LU9A 4FYXA 2FLVA 4A0SA 1U0OC 4HNAB 1JFSA 1MO6A 4XX0A 1OAOC 4CDGA 4JI8B 1JBKA 1L7OA 2O8DB 4KWIA 2HYIC 2PN1A 1GV0A 2QVYX 4A8JA 1QDEA 3ZLTA 2ODAA 4IQ4A 2A0XA 1TD1A 2PMEA 5CB6A 1RCFA 3AZPA 1FW6A 3QE4A 3KPUA 2UYYA 3DBIA 1VJRA 4YXFA 4URXR 1LSUA 1JFLA 5E3HA 2ZYHA 2YXBA 1SGWA 3CF4A 1F7VA 2W6ID 1OKKD 1QK4A 1NWCA 1OI4A 2CJFA 2V6FA 1YIAA 3B60A 3GEIA 3NBQA 1IWOA 2GPNA 3PPXA 4G65A 4M9ZA 5EZYA 3WQSB 2ZB3A 1MB3A 2QL7A 4ALIA 3K2EA 4L8YA 3DE6X 3FE2A 3F5MA 1R0CA 3PE6A 3TVDA 2H52A 4J3FA 3GRKA 3W8EA 2PYZA 3GLKA 2ZB2A 1E3SA 4P3OA 1QYCA 2E0IA 3FDZB 5EFZA 3BTOA 1SHLA 4GPTA 4NEQA 5EKTA 3VU9B 4BNIA 1KSHA 2W11A 4LY9A 5ILQA 3NIBA 3NWBA 3JVDA 4DLLA 4NXMB 2DLNA 2P9CA 1M1UA 3WJAA 2J67A 3ML1A 1EK6A 1W35A 4MI1A 4L0MA 4WN9B 3W90A 1P8AA 1A1VA 4BLRA 4EUEA 3OZTA 4Q1CA 5A9SA 5DIFA 2OHFA 1P81A 3L07A 1O94A 1CUXA 5HS6A 1GU7A 1WD5A 3I8OA 4QUDA 4Q01A 5FT9A 1FQKA 2HX1A 3S2EA 4ZGBA 2ZE5A 5DKFA 1KI9A 5FOSA 3EMDA 5HE9A 1I2BA 3UT5A 4LCEA 3W05A 2QTMA 4P8RA 5FUMA 1O3YA 1PZGA 1A2OA 3TS1A 4B71A 4OHYA 1RCTE 1ZCJA 5IJ0A 1GPUA 3V4RA 4CGZA 3L40A 1CF2O 2EHDA 1HOXA 5LD2C 4RTOA 5K3CA 5JPDA 2C5FA 3C8DA 3VPCA 3WWCA 3U61B 5D3MB 5F4BA 2ACWA 3HR8A 3P0RA 1B0AA 1O9HA 4GE3A 4DCNA 5DLPA 5K6AC 1HG0A 3GPBA 2FWAA 2C3PA 4L57A 3ZE1B 2IPMA 5J63A 2GJ9A 4CF4A 2ZYWX 3A7EA 4INZA 4ZT3A 3T5TA 3WKAA 3MGKA 4E7OA 1F0NA 4EF4A 1E9SA 4KSYA 1LH0A 2LE0A 4KQ1A 2OSBA 1TJ5A 2ILTA 2ATXA 5BW5A 4M1WA 2C2KA 5E1BA 3BFPA 5LSAA 4RSMA 1HT0A 3S70A 2W22A 2GJSA 2YZKA 2P2LA 2P77A 4ZU1X 4DIEA 4EJSC 4BCBA 2F90A 1TYAE 3LHIA 2QRLA 1E9EA 3ZWPA 3KSAC 1B8OA 3VVCA 4DQUA 1T8RA 1OZFA 4HWGA 1APBA 3C4VA 3D6JA 1PR2A 4DA8A 2F62A 1P6UA 3GRFA 3KQLA 2JI8A 4DC1A 5DEIA 5JW6A 3JY6A 3IP1A 1IQPA 4GOLD 2VJNA 4WKBA 3ROEA 4AURA 1E2UA 3VDMA 4I0WB 1Z15A 2H2GA 2ZT7A 4UHHA 3N0VA 4UNNA 1DKLA 2EQAA 4JUIA 4RVFA 4GFDA 2Z6UA 5KUTA 1PZFA 1FA9A 2I7CA 2LBPA 4U6QA 3TLKA 4ZJYA 4OJKA 3PVZA 1XEWX 1N5MA 2UVPA 2XW6A 3I2GA 1B2RA 3LC7O 3VFDA 5BMVB 1QE3A 3AQIA 1UFKA 4I1OA 2HA0A 4JP1A 1B0PA 2YXLA 4YRPA 4PHTA 3ASUA 4DN6A 1VYHA 1B74A 1NVEA 2A88A 2C9ZA 2W43A 2X4LA 1FUUA 1RADA 1Q1AA 2WQZA 1C3LA 5DT9A 2IU0A 3WLNA 4TWJA 2QD1A 3MFYA 4ALNA 3DD1A 3Q9SA 4YCAA 4R2IA 2O8EB 4J0KA 1XNHA 3T7EA 3M4ZA 3S28A 4DUGD 4OFXA 1KTIA 1AS3A 1Q77A 2FW8A 2EFEB 4L73A 4PG7A 4TTJA 1GGEA 2C5EA 3A06A 3G7SA 2XUJA 4KH1A 1R5OA 1F9EA 1ATIA 1M66A 4X54A 2BGTA 4ZO6A 2FW0A 1B1CA 3BILA 3H86A 4D4JA 2VHUA 1NY6A 1SQ0A 1M6YA 3N87A 5KDOA 1FDRA 1RZVA 2NZVG 1I0ZA 1QB8A 3BXGA 3PRHA 3UJHA 1Y0BA 1M6HA 3SIRA 3GAAA 1D6MA 3C7KA 1K8QA 1KZ1A 4DLAA 1J70A 2PUWA 4AKGA 1C4XA 3EDYA 1J33A 4I5DA 2EGGA 2IXAA 2XTMA 3SQMA 2C94A 1TJYA 1T1GA 4FUTA 4E1BA 1U2SA 4YT5A 1EM6A 1G3IA 3U26A 4ALLA 5H68A 1P1BA 3NLLA 1YR2A 1R4MA 3LK6A 1J7JA 4JBLA 2PH1A 2NUTA 3STXA 2I29A 2XZLA 4DM3A 1XU4A 1QUFA 5J5AA 1BX3A 3MM4A 5H59A 2ZIEA 3B3AA 1K5DA 1ECCA 2ZGVA 5L3RA 4MQ6A 4B43A 4EHKA 4G0VA 4DTIA 2I7TA 5E2AA 2PQ2A 1ZITA 2NSDA 3AFHA 3IAS6 1XF1A 1W0KA 3IUJA 3H2YA 5B7QA 4JX9A 1P9WA 2VNIA 2XOXA 4KPGA 4TMVA 5AKYA 1XNGA 3MJFA 4Q4DA 1JWLA 3KHSA 3AXSA 4E22A 1KMHA 1XU9A 4C7MA 1R6XA 2RAVA 3WL8A 5DHQA 1D0IA 3IQHX 2B0JA 1X7ZB 2AR9A 2I4RA 1CETA 3IAM1 3IEXA 3KWLA 4MV9A 1AGXA 5CVEA 5BW8A 5M29A 1U9IC 1WXIA 1BH2A 2VT2A 4A2CA 1WP4A 3K1AB 1F5NA 1SU6A 1CJBA 1YACA 4U5XA 5GJVC 3UUWA 2RCNA 2J1LA 3PIIA 2C4TA 1QOQB 3UATA 1TEHA 1MG0A 4KWHA 1P2SA 3PR2B 1LPPA 4HLUC 4XJTA 5EZQA 3UH0A 1HZZA 1VIDA 2JPDA 1S8FA 3FW1A 4X7MA 1AV6A 3QH4A 1UAGA 3LUGA 4R54A 2BGNA 1SJ9A 3H1FA 2PD4A 4DMFA 1VYTA 3LY5A 4Q47A 1OVMA 3PFKA 4DCOA 5CFMA 2BMJA 5K3FA 1TJ3A 2X3YA 3SN6A 3UMVA 4CRWB 1T9HA 3HN7A 3USCS 1JDZA 1NXWA 2UUCB 3DG9A 3DOCA 1TA4A 1X70A 4CI0B 2NV6A 3D31A 5CDFE 3O3MB 4ZC8A 3SEFA 3JQAA 4HNVA 3GGGA 2VN8A 3PS9A 4ZARA 1U3TA 2QN9A 1NP3A 3IDZA 1EB8A 3H4VA 2QD3A 2BBWA 2YZ2A 3IV6A 3COWA 4QFMA 3GAMA 4W8OA 3LVQE 5LLTA 1XTPA 2X0JA 3PDUA 5ECYA 1EEXB 1EXNA 1YZUA 2FWJA 1E20A 1RBMA 2ANBA 2CL5A 5JTTA 5DBEX 1A9SA 3VBEA 1YHYA 3PEUA 3KAKA 1J2EA 1MOQA 2XQKA 3KSDO 4ES6A 2EIXA 4NOKA 5MN6A 4KIFA 5CB4F 1WSBA 4IGAA 5BYBA 4KMOA 3T61A 4R1LA 3M6VA 4MH0R 3TNFA 3W1WA 1OXXK 2RI1A 2G8LA 1U0TA 3I2JA 4LRSB 3WLIA 4LUCA 3GMDA 4XXHA 3ANYB 3PUWA 2FHSA 3DC7A 4QBGB 3G2NA 3GLIB 5CB8A 1H8HA 2NZXA 2GVDC 1ZLYA 3CZMA 5KNDH 5KSPA 1WUTA 3CE9A 5E9JA 3WNCA 1SQGA 2LXNA 1U2RA 4UXHA 2D1FA 3DEKA 2J30A 2ODWA 4P2BA 1VSUA 3V2GA 3MRXA 2I2FA 1EUDA 1JAHA 1KQPA 1X9GA 4G5YA 2HPVA 1II8B 3H9UA 2AR7A 4Y0VA 5LP6C 2HBYA 4BFTA 2OHIA 1SG0A 3E8MA 4UAJA 3NM5A 5KTSA 2VG8A 4JWKA 4D9FA 2CJPA 4J29A 5JYEA 3R5JA 2IDJA 4LBZA 3WB9A 1H1DA 3BD9A 2GBFA 1TD9A 2UZ1A 2BTQA 4UHEA 5EXPA 2W6ZA 2FPSA 1U9YA 3T35A 3U62A 1N8TA 2MR6A 3LK7A 3GJ4A 3PWTA 3QFHA 4RQUA 4OM7A 5GAJA 3REOA 1WZCA 3G2QA 3FD8A 4RZ3A 1VLJA 4LGCA 4A9AA 2ZDGA 5CNIA 3GUHA 5TVKA 2XA2A 1MOSA 3CU5A 2FPLA 6YASA 1OTYA 5CK5A 4RGQA 4N5HX 1EU1A 1K7YA 1WQ3A 3JSAA 1WB9A 3PXEA 5K3EA 1UMDB 3F9CA 4LJ6A 5G0SA 3QLEA 1W85B 1ENZA 4ZAVA 5H02A 3THWA 3ZTTA 3B9RA 5JSHA 3W5DA 4D8YA 1MH9A 3IHLA 5AVVA 3C39A 4LYFA 5JCXA 2AYYA 4YRDA 3R6TA 3QFTA 4FNGA 2BTOA 1YB5A 3LBYA 3JXEA 3KETA 3UXEA 5JZVA 1GDTA 4G37A 1G9XA 3L8EA 4Q1FA 3KKZA 4TZKA 4AYXA 1L1EA 5ENVA 1P0PA 2WM3A 3ZCXA 3FLAA 3GRAA 4B3JA 3ZNOA 3WHLA 1AUXA 1C3XA 2YIVX 3ROKA 1QP4A 1NXOA 2XMGA 4KVZA 4UEKA 3RVRA 3EY4A 1E1RA 5HHTA 3H1EA 3T3MB 2ZRDA 3ETLA 4ZV4A 3WP1B 4B32A 3P4XA 1GGKA 3PXUA 2PZAA 1E0DA 3EGOA 2HJGA 1NULA 4YQZA 3SIPA 1JG2A 2RH5A 3RAPR 3VKHA 2FE1A 1C9JA 1GY8A 2GZ3A 2O8FB 5K05A 3H5IA 4WZBE 4YB8A 2GRJA 4OH7A 5ELXA 2IXTA 1V1RA 4JQOA 1QLWA 1K5GA 3KDPA 1Q14A 3GHHA 4Z0HO 3W8NA 1SXHA 1ZW1A 1B0ZA 1UIMA 3UWPA 1LEHA 4IWXA 1UBJS 3AKCA 1J9GA 3AV0B 2CMDA 4N12A 5KHAA 5DGCA 1HH4A 2WKPA 4MITA 5I7AA 2ONYA 4DNPA 2Q3DA 1CULC 2MHCA 2KYRA 3CPJB 5CB0A 5JHGB 3QZUA 3OOJA 3MOIA 2I6TA 3FTFA 1JA9A 1BW9B 2GK3A 1VL8A 5E3IA 1BE6A 1YQQA 2ATEA 4JP2A 3RIXA 4TSKA 1N5DA 1QFSA 1F60A 5DRTA 5B57C 1E1DA 3IAFA 4DBZA 2EAUA 1XQ6A 4WT7A 5TQ2A 4GYJA 2R6R1 4F46A 1BTOA 2HIAA 3D2CA 3DFUA 2MT9A 1MO2A 2PO7A 3EQ6A 3QVGA 3U4IA 2D59A 3PCRB 4ICIA 5AYVA 5BVHB 3BORA 3WRXC 4F04A 3LQFA 3RSSA 1WXQA 1E59A 1UAYA 4B4DA 4AJKA 4C04A 3EZYA 5HOQA 4CKCA 4Y6PA 3PLAE 2R7AA 3FWKA 1XHEA 2EWMA 4R3NA 4ZKEA 5DHTA 4ERNA 5KO2A 3B6IA 2KHZA 4NC9A 3BHIA 2AUMA 3K70B 4WKGA 4MWGA 2I1WA 3QUQA 1HDIA 4ZJZA 1IMJA 1NJ8A 1QAQA 3LPCA 1UT8A 2CE2X 1VDMA 3HI6A 3QEMA 2HNAA 3GVHA 1CQJB 3UV7A 2I8LA 2XT6A 4PZCA 5CX1A 3E82A 2JHPA 4L8LA 3PJGA 2WIBA 4QVIA 3ETHA 1L5HA 1DC5A 4B7UA 3HWSA 4HH1A 4PLTA 2PVSA 1K6EA 4RAQA 2ODTX 3S2FA 1DV2A 4PSKA 3OE1A 3AB3A 1CUEA 4CM8B 4CMJA 2EDCA 3DVRX 5HWSA 4KFRA 3ZW7A 1N4AA 3R6DA 1VGRA 2C29D 4MVWA 3TZHA 3VKUA 3EDRA 1KPHA 2Y6VA 2DJIA 4RVSA 4ZZ0A 2RD2A 4CWAA 3TLBA 1W4AA 1OBOA 4CKEA 3MTAA 4OB8A 5CD9A 2VTBB 2AEFA 3VSBA 2G25A 2W6PA 2B2CA 4D6PA 4W7HA 2XCQA 4JJGA 1NNSA 1NTOA 2Y8EA 2ZJZA 2DM6A 2OYSA 3GIDA 3V2HA 2G83A 4KI0A 4QT0A 4B80A 2H1VA 1II0A 2ZVJA 2CVOA 2Q5HA 4HX2A 1X87A 3QXGA 2BD0A 1ZMOA 1NN3A 3L7OA 4ZYZA 3ODPA 1EGAA 1FLDA 4FSXA 3E1GA 4H4DA 4IFBA 1O95C 1V7CA 1OYOA 2QMQA 2REQB 1QOZA 3F6RA 3IUNA 4M7WA 3OJOA 1AIPA 1NVTA 3PGJA 4PIMA 3ISJA 1PFGA 1GAQA 4QXQA 4X1YA 1QAOA 4QARA 3W9BA 2ZJ6A 1WLSA 3GVPA 4IR7A 1JR3E 2NYUA 3GJZA 3OLXA 1PIWA 3KQVA 2AJTA 1OXKB 2GASA 2GUWA 2ZAGA 3QFRA 4Q4JA 4BDSA 1SB9A 2XKKA 5ALEA 4ZEWA 1V0JA 2AG8A 3BKXA 5EYPA 5F35A 1XYGA 3TB6A 4M9UA 3DE1X 1ZO8A 4PR0A 3ER9A 1BFKA 1KYZA 3K5IA 2AN3A 3CR7A 1U4NA 3GH3A 3K09C 1U6JA 3HJHA 5TPZD 1SEVA 2ZATA 1ENYA 2OQIA 1RM3A 2FZLA 5T8KA 3FVRA 1PP4A 4TS4A 5JYCA 1O6GA 2OC9A 1VZ3A 2JAQA 1LNZA 2VJCA 3X3HA 3RPEA 1SUAA 5EMHA 4DCVA 1VFNA 1VSTA 3OJXA 1HG1A 2V6MA 4FCWA 2O3QA 3UKJA 3V42A 2HLDA 3JQBA 4PO1A 5K6RA 8MHTA 4RDIA 3Q6IA 2BCJQ 3HKDA 3JZDA 1E2HA 4DLTA 2RGBA 3EARA 4ZFNA 1QYDA 5CH8A 3PD0A 5HDBB 1Z13A 3KV1A 3WX0A 3W5AA 2HUPA 4NFLA 2WINI 3BBPA 4I08A 5MGNA 1HRKA 1KSGA 2IZ5A 4ALMA 1TZCA 5HQ3A 3C8MA 1XRMA 2XUHA 3DFIA 4RCYA 4YP7A 1F6DA 2GXSA 2P75A 3IUBA 1PFKA 1Z4PX 4FEYA 4XAQA 3WNVA 5JSQA 3LBNA 1V7ZA 2DWQA 3PKZA 4TSFA 1W4RA 3WMEA 1KEEA 4IDFA 2K4MA 2CXRA 1N2HA 1PS0A 2NZ2A 4UZSA 3T34A 4MW7A 1BWRA 1DFHA 5TQVA 4G5HA 4N40A 1K75A 4EPVA 3B89A 4R69A 1C3EA 3OTOB 3TNLA 4EKYA 4BATA 3MS4A 3FY4A 2GPAA 4WKOA 1XVUA 3LYLA 3KB8A 5E4TA 3ZKWB 4P86A 4R1UA 2V7PA 2GO7A 4P4TA 4YMWA 3SKVA 5T4FA 5GGYA 1HT2E 2XQJA 2Q5JA 2QZSA 3HU1A 1VJ1A 1A8UA 1YBMA 3LLVA 1XUOA 2VZLA 1XZAA 4RHUA 4F12A 3QMPA 1GQRA 4GPBA 2PT5A 1JGTA 2YWHA 2BZ0A 4CR6A 5J58A 3E9YA 4AK9A 5EVCA 5B1EA 5DM70 5JQGA 4D4MA 4Z53A 3CIOA 1V1MA 1UC5B 2BP7A 4M83A 2CYCA 2AC4A 4UM9D 5K0SA 3OEYA 1H9AA 3AMVA 3VNQA 1L5VA 4G9GA 4OHPA 4CIWA 3CFYA 1GUAA 3BX1A 5T4BA 3DPUA 1PQWA 4O6VA 2X1HA 2X42A 1MPTA 1SB8A 5DGXA 1JJFA 5BR4A 1HKUA 2EWVA 5EQDA 1QYXA 5C8YF 3E81A 4B85A 1E6EA 2O3JA 3T4EA 3TPZA 4CKXA 4P36A 3P94A 3PNQA 2HMUA 4JR0A 2QUIA 3GEPA 4UHJA 4KQHA 4G5OA 4J90A 1RW4A 4PQEA 5EI5A 5ICCA 1L9XA 5FFMA 2BFCA 3I6ZA 4DRXB 1ZNYA 2PU5A 3DT8A 1HTTA 3A1CA 3U9SA 2QLTA 3H5WA 3PC7A 2NVWA 3F1LA 2IU4A 3X2EA 1V8ZA 3OZBA 3PYXA 4IP0A 3WMFA 1W4LA 2VPWA 4QFCA 2I9PA 3K73O 3M34A 4OYLA 3ZHBA 1O87A 4P0PB 4MK4A 1M0SA 5FP0A 2FWRA 4JA2A 2IE0A 2RHLA 1OD6A 3NWEA 3EZ7A 3I23A 3CJRA 1B2LA 2XUAA 4Q1VA 3RRJA 2QJWA 4QO8A 3QKTA 2APJA 1N2SA 5L9AA 3ZZ0A 5LWQA 3AESA 5ILOA 1PJBA 2PVPA 3A3PA 4LNHA 1MKYA 1KDTA 1UUFA 2DT8A 1UJMA 2F1RA 3MERA 1NW7A 3N05A 4RKQA 1CFZA 1G8JA 4RPJA 1U63A 2YHBA 2YW2A 5KTYA 1TYZA 2CDAA 1E6UA 1RWBA 3KUCA 5FO0A 4KR3A 3TB4A 2GZDA 2ZSKA 3AH8A 4L4UA 2VTDA 1QQ5A 4O4JA 2IYQA 4DV4B 3WKEA 5D2CA 3WYCA 1BEEA 2RHTA 2VKQA 4IDOA 3VYUB 3W4IA 5B1YA 4Z6KA 1KMHB 2JJQA 4JBHA 2G09A 5JSYA 3OT1A 4L5IA 5TS3A 3W7VA 3PQ6A 4KO2S 5NULA 4OYHA 1M34E 4HAYA 1CZUA 3FFBA 3W5HA 1Y3HA 5FOVA 1NUUA 4DBLE 2JZOA 4RCVA 3VPSA 1F38A 1YZQA 2OO5C 4BC1A 1NUAA 4CDMA 1HXHA 1DEKA 1D0VA 4BFXA 4XQEA 4OY3A 5I9BA 4Q4HB 3KR0A 4L2IB 1CYDA 4K1LA 4QUAA 1P45A 3OKPA 1GRNA 3WJ2A 4PIVA 1YK0A 3PCTA 3F49S 1TAUA 3L02A 8ABPA 3PTZA 4UVIA 1UBLS 2AW3A 1A72A 3MRVA 3L7MA 3R74A 3CH6A 3ZWWA 3LI2A 1HDOA 1BJTA 2RH4A 4MDYA 4TSRA 1ID1A 4LGYA 2XTZA 4B2LA 1BU8A 2JANA 1CY7A 1YJCA 4DWJA 2D8AA 4J1NA 4GEKA 5E9QA 1R9NA 1YQEA 3DUFA 4L9RA 4XQCA 1JUDA 2EJBA 3JS5A 2X77A 3RJMA 3OQJA 3NAGA 1EZZA 3DBHB 4M1TA 2JIOA 4IQFA 7REQA 1ARZA 1M34B 2PBZA 1SVOA 2GILA 2VP9A 3IA2A 2BYTA 5K4GA 3BMOB 3U56A 3CNBA 1ND5A 4PPGA 5TY0A 1RHUA 4LPSA 3VR5A 1AMUA 4KXMA 4L5JA 4RYLA 1I2CA 1N3LA 2O6LA 4NAHA 3ZY6A 1SA0B 3DHEA 3KC2A 3P9IA 2OBXA 4C9BA 1L7EA 1PZHA 1XDGA 5B3KA 4XW2A 1UC9A 1TTPB 2UYOA 1YJBA 4OLJA 4KQKA 1J09A 2NZJA 4ZOLF 1OFIA 3LUKA 3WYBA 4KIUA 3CNQS 5JY1A 1JR3A 3AHEA 3TD6A 4QTXA 4WY8A 1ZAKA 4MJLA 4CM3A 1M72A 4BVJA 4RTPA 2R751 3ELDA 3UXMA 4CL0A 4OI4A 1NDQA 1S2NA 3EWAA 3VR5H 2ZVPX 4KQFA 4ZJPA 4PC2A 1YAHA 1N92A 1U0SY 2NXJA 2P11A 1NBHA 1C9KA 2ZP1A 4TLCA 3UOGA 4F06A 3ZHOA 4A0HA 2R1TB 5CGZA 1O7JA 3GJ8A 4A92A 1ULZA 2PWPA 4M1EA 4QFDA 2HKIA 3MSCA 1DIRA 1R5BA 5K0ZA 2A0UA 3R41A 3EULA 5AXCA 3FPSA 4TWIA 1EJ0A 1OB2A 3PIRA 2JGMA 2R8BA 5JFOA 4FW9A 3C7CB 3LY9A 1Q3TA 3ZDDA 1E3MA 5JROA 4A0GA 1HDRA 2JKVA 4OO3A 4ZRDA 4RKYA 3WL4A 1JPJA 4WASA 4OBXA 1FRZA 2AQHA 2OORA 4YDSA 4DLNA 1KWKA 4IV0A 1NU8A 5G40A 4PBTA 3STVA 4W5OA 5JVDA 5F1YA 2ZRKA 2V1XA 3H97A 4Z9XA 4CTMA 4YWJA 1P7PA 3HDJA 5B1IA 1EFRD 1G38A 1K6XA 1PD1A 4BTLA 3P0IA 1F2VA 3OC0A 2VPZA 2UYHA 3WWEA 4DW8A 1VMIA 3SQNA 1PRYA 2VCEA 1K97A 4HS4A 4EHAA 4ZQEA 2B99A 1TU3A 1KIMA 1OZAA 1U2QA 5HR5A 4KTVE 1XZPA 2Z8ZA 4ATNA 4ARIA 4LHVA 4XGRA 3FOFC 1PJTA 4K0KB 2OE2A 4UM9B 4JI3B 1OASA 1TO6A 3QNWA 4FEAA 3VTAA 1ZVVA 3FSGD 3ZQJA 2VYVD 1LKZA 3KTAB 4ENRA 4Z4HA 4NNJA 1UP7A 4UCXA 5KYTA 4WN3A 4YAFA 4D41A 1V1JA 4DR3B 4OX9B 1PG5A 2VDUE 2EBUA 4PM4A 3RR2A 2WUDA 4J0JA 1U5CA 3DJFA 4EG4A 5KU7A 2C4HA 2UUOA 1ICIA 2PO5A 3H2BA 4PLWA 4BC0A 2QG9A 4BQFA 1O5TA 1ZBQA 3KSRA 1Z4QA 2IXFA 2QWXA 3EOAI 4IX1A 4AUNA 1OLUB 3C16C 5C1OA 1JKFA 1WG8A 2R6CA 3Q2KA 1OR8A 4KQ2A 5G4LA 5SZJA 2CNLA 3V1UA 4J7CA 3THOA 3RAGA 3EVGA 4AL4A 1KRWA 3I28A 4H9GA 1K3TA 3OFND 1DRKA 1IVSA 3B8HA 2BBOA 1E4EB 1RJGA 2W4IA 2ZYSA 4PSAA 2F1KA 2V97A 1VBNA 4ZHSA 3IE1A 2EVWX 1UMBB 2PUVA 4FYHA 4WCFB 1T4CA 1I1QB 5JMPA 4OMCA 1E0KA 1W48A 4NV3A 2C3YA 2O1EA 2QMHA 2GAAA 3NNDA 5A5FA 1K4YA 3HB7A 1T2UA 4RHYA 1E6WA 2HH9A 2P5UA 2Z2XA 1ODJA 3P2KA 5AKLA 2JK1A 3UYKA 4GWLA 3W04A 4YVFA 1QK3A 4EFDA 1U65A 1TE2A 1MFZA 4F9TA 2OHJA 2E6KA 1XFAA 4UJ3A 3A3OA 3ZD7A 4XYEA 2E87A 5FV7A 3GDOA 3SHOA 5E0KB 1Q1NA 4GX0A 5CVTA 1G9SA 3DPIA 1R10A 3URMA 5BVHA 1VJTA 2Z58A 2XMSA 4P38A 4QO7A 1UWKA 3MCWA 5F51A 2O5VA 5FUBA 5D8DA 4PGHA 1WP9A 3JWEA 2NGRA 2QI9F 4KC0A 4QSHA 1NMZA 3INGA 4P5PA 4P4LA 1EGMB 2AI1A 3TZLA 3IPYA 4TLLB 4B3CA 3GUYA 2DGDA 3R77A 4QUIA 1Z5VA 2PTGA 4CDRA 2ZIFA 1D2AA 5ITZB 4BJHB 2R68A 5CMLA 3RT9A 1AUVA 3BA6A 1H2WA 2MMGA 3MTEA 1WHTA 4OLBA 4C0LA 1CEEA 4HDMB 1CZHA 3C3DA 1GAEO 1SBQA 3QEMB 1G21B 2VSFA 4GOMD 1NJGA 3AETB 4M98A 5KAMA 1L5MA 1TUBB 4ENQA 4WZ6A 4FNMA 5DTMA 5B2ZA 4EPRA 3H7AA 3B70A 5BW6B 3T54A 3V4VB 1YS6A 2G40A 4FNOA 1NBME 3B6ZA 2C88A 4HCJA 4F86A 4AROA 1EBUA 5LFAA 2JFXA 3VJKA 1WVIA 4JOBA 3U7QB 4CT0A 2D5IA 3B9PA 2RSLA 8OHMA 3FIJA 1P0IA 3KUKA 1NBEA 3D6AA 3KEOA 4X71A 1E7QA 4HGQA 3SYKA 3TQHA 3F73A 3NR2A 4C5CA 1KC1A 3R3XA 3UBMA 2GHTA 2Q2VA 5GJWC 2EW2A 3H11B 4WXMA 4B45A 1D2GA 1Y7TA 4HMPA 3F7NA 4MZDA 3V8EA 3ZY5A 4ZI7B 3TOCA 2GNPA 3KK0A 3KR9A 5LBTA 1T3HA 4WIAA 1MDFA 3PQDA 4ND1A 4L3WA 2D1YA 4MIYA 3BYZA 3AX6A 3UJ3X 4COKA 1SUSA 3MAAC 4KR6A 1FU4A 4O59O 1D4ZA 1X3LA 4QNNA 2KQUA 1GTMA 2DTXA 1Q2XA 1W9MA 4LMAA 4DQLA 1VE1A 3Q1LA 2O23A 4QBFA 4KN6A 4TN5A 3V4PB 2ZE8A 5LU8A 1E5VA 2G7ZA 4H0CA 2H1SA 4TZTA 4HNUA 3B48A 2I22A 3M4XA 3NT5A 5ALNA 4QYSA 3AL0C 4X1YB 4XM0A 5JS2A 1T29A 3IV9A 4IH4A 3PUJA 5HPYB 1XTJA 2PMWB 2VF4X 1KMNA 4DZZA 1A71A 3QE3A 4F2GA 5KJ6A 2CUTA 2IYEA 4KEAA 5ALTA 2P9TA 2EOAA 8ADHA 2IH2A 4RM2A 3DE5X 4LW8A 3ZDCA 2PANA 1I10A 5HMLA 1PFVA 3PX2A 1KZGB 1Z26A 2FPPA 2XWBF 2OKGA 3USES 5L3QB 4C0HA 4YJHB 5FORA 2HWXA 1C50A 1ZJJA 2ERCA 2R00A 5TE9A 3BBLA 1ZGAA 4Z5XA 1HNXB 1ABFA 4KGZA 4KRYA 3TIFA 1RQ7A 2VBCA 1UEIA 4A26A 4BNKA 4TL6A 5B3AA 5EIWA 3DZFA 4G8DA 4LJKA 4ZHQB 3LNCA 2Q3HA 3ZNPA 3I58A 3IJRA 4OHZA 3PHGA 2VP0A 3HE3A 1PNQA 1QUEA 4HQKA 3PPIA 1V11B 1WB6A 5AW2A 2B8NA 1PE0A 3RYCA 2G17A 1OCEA 1SKMA 2KS6A 1JU4A 4CMGA 2IYSA 3DDWA 4AMVA 2GPTA 5A3VA 1W5SA 1QRRA 2YS7A 5A7FA 5HRAA 3VYWA 9LDTA 3LV8A 1ADGA 4R8KA 3DFZA 1X2BA 3EK2A 5CA1F 4X7RA 3OUTA 4W9MC 1CLEA 2QY6A 1QNLA 4PTZA 4L6AA 1B93A 2B30A 4HDNB 1RJEA 3RT7A 4CV1A 1P3JA 4GD3Q 4WXYB 4YR7A 1M2KA 1HETA 1ZK0A 3D81A 3P4YA 4MGIR 4M0FA 2I8AA 4JJ4A 4HWTA 5C34B 1F6BA 4YJGB 2JK0A 2XIQA 3Q12A 2QK4A 3FDJA 2ECFA 1DQPA 4J0EA 4YP9A 4CEHB 3QUCA 1E2GA 1SBZA 1Y5RA 1B43A 2EKZA 2X8WA 5IMBA 2VLIA 1GITA 1KS2A 1TGVA 1U5BB 4KACA 4P9NA 2GXQA 1Q0PA 2E7ZA 1YSCA 3ZH2A 5DULA 4G1UC 4CODB 3SJUA 4DM7A 1UBOS 1CUBA 1EM8B 2DTEA 5BURA 1X7YA 1Z7BA 3BWMA 3WLAA 4ER0A 2E5LB 4DANA 2RJOA 2BHTA 4QJ5A 1QR2A 4K9OA 2FAXA 5GADl 4AYTA 5HOEA 1FFXB 2E4XA 2AIRA 1G8YA 1WOYA 4GP7A 4RL6A 3E9QA 1FYWA 2X7JA 3PDWA 4N0MA 2XDAA 2CLIB 3C0KA 4PFQA 2YXPX 2MMCA 3MXTA 1R00A 2WPNA 3IPLA 4R2JA 2DUWA 1BXZA 1KPGA 1KP2A 2BFCB 2VFAA 4CMIB 3WMGA 1VLQA 4P3NA 4ESVA 1M8KA 4EB8A 1U8YA 3ZCQA 4LJ4A 1LSOA 4F60A 1NVVQ 3G8AA 4TMYA 1JKJB 1DDIA 3C6KA 4IXDA 4ZP1A 4IIDA 1LF5A 1SOVA 2GEKA 3NDPA 3LYHA 5I3ZA 2JLQA 1M67A 4FSHA 3H2KA 1W73A 1FVXA 2JVKA 4NJEB 1TEXA 2ABWA 4BNVA 1FFEA 5JU6A 3RS7A 2IJGX 2VHCA 1WETA 4ZOLA 2MSKA 1LBHA 3A1DA 3JWPA 2D54A 1TECE 2VQFB 1S2GA 4R9SA 4RCZA 1E92A 4TV8F 1NHWA 5IEBA 3AESB 3RVDA 3LUFA 3W5CA 1NVKA 3Q0IA 1HEUA 3WQHA 4ARVA 4ZMSA 1MG5A 2FRDA 3RU2A 4BRSA 4PS0A 5INTA 1ZEJA 1NW4A 1C8LA 3AHDA 4LYJA 2B7BA 4OGGA 9MHTA 2Z57A 3TD2A 3M8KA 3AUAA 1Q5PA 3I04A 1D09A 4FGUA 5BN3A 1JECA 2I3ZA 4NULA 4ZALA 1PJ4A 3AHGA 3U81A 3NJ4A 3A1UA 3THRA 1O4VA 2IHZA 3IEPA 3OT1B 3V2IA 4QRIA 1S0UA 2HL6A 3GA7A 2UUAB 5MGBA 1DV1A 3IHWA 3K05A 2P0YA 4DILA 4BRUA 2D0OB 4BGIA 4N5LA 2R9VA 4NAUA 2C00A 4JU8A 4PYMA 4IFIA 3RS0A 1DUIA 4MVYA 4E3WA 1O89A 2FWBA 2WPDD 4HZUB 4QEKA 1EBFA 1B8UA 2VOEA 4L5YA 4MIKA 4WOCA 4C1BA 5KSZA 4I4TA 2YMMA 4UUMA 3O8LA 3O90A 4G25A 1ZN2A 3QG1A 5A4KA 1FFDA 3LBAA 3G85A 1GXSA 3LUPA 3LDFA 4JL5A 2XRZA 1Z6QA 3Q7IA 5HIJA 4QWWA 3TSAA 2X3UA 3W5SA 3QQ5A 1P2DA 2B1GA 2FZGA 2W9XA 3AOGA 4HTFA 3CF4G 4BIMA 1DAFA 3A6KA 4Q4AB 2PTHA 2QUJA 7REQB 1XNQB 2EGUA 3TL3A 1BD3A 1CPYA 5JXWA 5AM1A 1IJEA 1CP3A 1V39A 1W6RA 1B6GA 2BKVA 3H6GA 2NU8A 5LXTA 1N9GA 2R2AA 2YIDA 3U9TA 2B61A 4Z7QB 4ETWA 4Q3LA 5TGZA 5A4AA 3RT1A 3Q9NA 3G3EA 2OYRA 3TIIA 3OA0A 4DTCA 4FIDA 1RKBA 2FSVA 3GLVA 4MVJP 5CURA 1XYYA 4IWYA 3AYZB 4LZPA 2O07A 5DI9A 4OI0A 1YOVB 1WBJB 1RRPA 1CUAA 2HQ1A 1XALA 3BJRA 4NJMA 5TT0A 1ZD9A 3DD5A 1RI1A 1VZ2A 2BPOA 3MINB 4GLOA 2EHJA 4NBKA 3DL2A 3ZHQA 1D2HA 4KKVA 4G1MB 3MTQA 1X8LA 1ZJ4A 4X9XA 5JAQA 4C5BA 4ZK6A 1YS7A 1PT7A 3GAZA 3E9RA 7ABPA 1DKNA 3L0DA 3F8WA 2OLJA 3HQ4O 1LB1B 3TJRA 1UQRA 3A36A 4NXNB 4DV3B 2XNDA 1RPJA 1GFZA 2VH1A 2PX3A 4Y2TA 1DJPA 3NKLA 5E2BA 1SBIA 1EINA 4NE7A 4BNDA 1H3EA 2AA3A 2ZR7A 3NHBA 3TQQA 1QHGA 1NVBA 1A76A 2VC2B 3BJMA 4MMZB 4DDKA 1Q17A 4K6CA 1N4DA 1X0XA 4YT2A 3V7NA 5KNBA 4TS9A 1VG9B 4TQAA 2WZCA 3OZGA 1SWVA 3CEMA 4QTTB 3FCCA 3RODA 5D5QA 1L5ZA 1U6KA 2QE6A 3ZHSA 1EP1B 1WU8A 5FTMA 3AERB 1M1YE 2BE9A 1P5FA 1Z33A 4N5NA 1AC5A 4UNPA 2B34A 4HNRA 1X9HA 3GFGA 5FBVB 1RBYA 2JI9A 2R4UA 1H5QA 1OC2A 2XNJA 4EYEA 1O57A 2QVGA 2W6OA 4PSCA 3U3OA 1EHYA 1ORWA 3VKWA 1EIWA 2HA2A 1FNNA 4RABA 3U16A 1Q91A 3IOEA 4R81A 2A9KA 5SZIA 3VMFA 3HK2A 1ZNWA 4F96A 2WVGA 2HI0A 1IL0A 3TEJA 1G8PA 1F0YA 1EFCA 1AN9A 2QMYA 4OSPA 1BXGA 2DWPA 2VH2A 2NU6A 4EZEA 1M2GA 2OECA 2VWGA 1RPZA 5EWJA 3KOUA 3KEFA 3UMJA 1QIKA 3GOHA 3RHSA 4DCJA 4DSZA 3PVSA 4QRHA 3OOHA 3QE9Y 3NPAA 1JPNA 3ZZUA 5AW8A 3PEWA 4DABA 2NXEA 1JQ5A 3N8NA 1A82A 2A9QA 3U4DA 1ZYUA 2CVPA 2GZ2A 1YQGA 1JJBA 3KPWA 3E5RA 4RVNA 4K9KA 2F8LA 4UAUA 1JI3A 1P2TA 2C7VA 4WLEA 4DL9A 2H1OA 1KH1A 4OYYA 5IAAA 2NXCA 5K0TA 1DI0A 2V7QA 3R3JA 3WLLA 1FS6A 3CA8A 4C0BA 2NUAB 2BFMA 1DAGA 3QLTA 3MMNA 4CMHA 3DMYA 2P67A 3NKFA 4Q34A 3WLPA 2ZWIA 3LDUA 2QX7A 2YHIB 3CEPB 2P0AA 3IODA 4FWBA 4LZWA 1DKMA 4DDTA 2VYCA 3RRNA 4KG7A 3KB1A 5BUCA 5TMEA 2H4HA 3BVPA 4RPKA 3M4NA 4LVCA 3DB1A 3X1ZA 1E9CA 4TZ0A 5ICMA 3ELYA 4JDPA 2AFIA 1XRNA 1I8TA 1TEZA 5KHOC 1AZLA 1L2TA 3RFVA 1WXHA 2GD1O 3G59A 4DLRA 5BN4B 1ZM2A 3A1EA 4JLDA 3MVEA 1M6EX 4UCFA 5J5VA 4P31A 3ZLUA 4YUWA 2R3SA 1AB6A 4QASA 4KSBA 2IV7A 5ALPA 4JL8A 2WVAA 4KDEA 3RK0A 2GUGA 1XDUA 3M6AA 2V7TA 3ON5A 4LJSA 3VV3A 2H8KA 4DV6B 5JNWA 2C1EA 3SR3A 4H7PA 2DZDA 1AKMA 1NF8A 3C1TA 3CZ4A 4IO1A 4M9RA 2CUNA 3HXTA 1YZNA 1ZIYA 4YR9A 4ZQGA 4CHTA 3S99A 2JFNA 3G8DA 5JXJA 1REQA 3AV3A 2Q1XA 1W46A 1DBIA 5EESA 2NMVA 3N39C 1CUUA 1B23P 2Y05A 2A2ZA 1NMSA 1Z6XA 3S5UA 1JALA 3O8NA 3N3BC 3M33A 3CE6A 3NFRA 4V0LA 4BB0A 2H4FA 2WD9A 2Z9CA 2H11A 3B52X 3N7AA 3IUMA 4R9UC 4Z0PA 4ZAGA 5GPBA 2EKLA 5A03A 5ADHA 5M2QA 1YDMA 2KBFA 5BVGB 3OTGA 5CVUA 3AVUA 3QPCA 1RAGA 3PZRA 2QSJA 2V7XA 3CLTC 3SCZA 4ODIA 4MMXB 4Y7CA 3HHEA 5AKXA 1G0OA 4G6ZA 3FKSA 1Y6GA 4DXDA 2FPGB 2X40A 3OQPA 3V80A 2YV3A 5BV1A 3WYDA 5FUQA 3GLFE 4KFSA 4LNUB 5M3BA 1H5NA 3JD0A 1R0WA 4HB2A 4NU6A 3JPWA 1ZDMA 5HZHA 3QPVA 1AQ6A 3QKRB 5DE3A 3K9FC 1S7GA 3PD1A 1NASA 3CCBA 4LWZA 3KJFA 2VHTA 1I2DA 1J0AA 3TZQA 3AB7A 3P5BA 2YJ5A 1EDBA 1TZBA 2HJHA 4AP9A 4EI8A 5KYKA 4PAMA 2FN4A 3W3AH 3IL2A 2PZLA 2VP2A 2JJYA 3H8SA 3L6DA 3O83A 4P7KA 4WKCA 1N33B 4ZCSA 2AJBA 2QG4A 4D26A 2A9OA 1KI1A 1ZUIA 3X1JA 4P3PA 3L8GA 4CIDA 1EGQA 1RQPA 3GLGB 4KJZA 4IDHA 2Z1NA 1LLUA 3KT8A 4TOIA 3F78A 5AK0A 5BQOA 4OQPA 2Q5LA 4G5QA 1PZEA 3LA8A 2GPYA 1MAVA 3OZDA 5TPZA 4HR7A 4ZODA 5JWRA 5KNDD 3EXIA 3X0DA 5CNMA 1KEZA 2OVFA 5SV2A 1E0JA 3T3IA 2K7ZA 3K5PA 3RSGA 1VIAA 3GUVA 1H6DA 1G18A 3D5EA 4WECA 2QMUA 3OPYB 2E49A 2QRJA 1NMQA 1QHEA 3TW6A 2PFSA 2GPSA 3DZHA 3AW8A 4GPD1 4UU8A 1H9BA 5A2QA 2OCPA 2I2XB 3IO5A 4KPUB 4TV9A 4Z9AA 1SXJD 3PQ5A 1TOAA 3HJNA 1ZSYA 4MCIA 1YJAA 5KBYA 2CDRA 3AVQA 3ZCTA 4MKFA 1FBNA 4EJ2A 4V3BA 1PHRA 2NPIA 2YW9A 3IP8A 4Z4EA 4KO8A 2QPAA 1PBTA 3JZMA 3I5XA 2JCVA 3FROA 1PK7A 2BE7A 3RSOA 4MYHA 3B1FA 3WGNA 4MQEB 4I5FA 1KDOA 4G1VA 3MMSA 3FYCA 2FPPB 3HV0A 4YK7A 1O0BA 5F2KA 3QXSA 2BRUA 2WAMA 1AN0A 2ZI9A 3K5HA 4AECA 3DYBA 3URKA 5CA1A 5JCZA 2XB2A 1PVOA 3G0HA 2WA1A 3KPVA 5IT5A 2A9FA 2XTJA 3PG5A 1J9ZA 2C61A 2TMKA 5FLKA 4EI9A 2F8TA 5JZSA 4MQLA 1IHYA 3RAEC 3E4CA 1TQ6A 4A03A 4JU9A 2RGNA 4EYGA 1PJAA 4I1RA 1X3SA 4MVXA 1FLAA 1Y1TA 1UK9A 2JGEA 3QU7A 2Q9BA 1XCGB 2FCAA 4M0KA 3TXYA 4I46A 1XTQA 4WY5A 1CS4C 4F92B 4RBNA 1BQEA 4C01A 1BWPA 3MJSA 1GPBA 3C5VA 1SG9A 4LF5B 4JXZA 3AUKA 3BTVA 2Z9DA 1QO0D 4NHEA 4XX1A 4H0FA 1NG9A 2B1IA 3OPMA 3WDLA 1Z06A 3ZI7A 2IPLA 4RADA 2PH5A 2Q5CA 3PUKA 4ZICA 1W88B 4RH1A 4OBWA 4S04A 2SKDA 3TUIC 1HTWA 4HMQA 4K2HA 1I3NA 3CISA 3EISA 4EJSA 2G9VA 2XQFA 4UBMA 1E1NA 1IVYA 4IIBA 1ZZEA 1DPGA 5JAZA 1ZJWA 2RJNA 2XOKD 4GMGA 1Z5PA 1IUNA 2B25A 3FYUC 4UW9A 5C7YA 1VHTA 2RHRA 3D0QA 4WCFC 3OPYI 1U98A 3RE1A 3UT6A 3BXXA 2DHCA 3N53A 5DBHX 2CK3A 3LFTA 3F6EX 3OJ0A 1U5BA 1KI2A 1RPTA 2OCGA 1P2FA 2E3JA 3IBTA 2E4ZA 2BGRA 4FI3C 2CDNA 1H93A 3IP9A 4BCCA 1CSEE 1N5JA 2CF6A 5CM8B 4CVNA 4EMSA 5BOSB 3WBBA 2PKCA 3O94A 3B7GA 4OF4A 2H18A 4FZRA 4S0XA 4AF8A 2CNNA 5FPTA 1PEAA 5JS6A 4KU4A 2FG6C 1CRLA 5AJTA 3L06A 1M2VB 5FBRB 3UJCA 2Y4NA 1V6AA 3N58A 4B34A 4DSTA 3OTQA 2H5IA 2NADA 5IUKC 4TTQA 1KGSA 4AI6A 4W7IA 2B2XA 2X0KA 4TVOA 1ONSA 5LQMA 1B8NA 1KAOA 3X1YA 5D3ZA 4WA7A 4S1PA 4IZHA 1FNBA 5HRCA 4UARA 1O97D 5KCZA 4ZEMA 4AZWA 3UK7A 2IIPA 4PRYA 1GNLA 4B31A 1W2GA 4MUHA 1GSOA 4Z0NA 3O0TA 1PLKA 1O4WA 4AY6A 1JHMA 2H65A 2IYYA 1TM3E 1UCFA 1Y8RA 2W98A 4TROA 5DHAA 2I34A 3GJ3A 3EIUA 1QRDA 1YRYE 4UXJA 4E46A 4OXXA 3ACBA 4HNAA 4EUSA 3ZUGA 3FPEA 5HGJA 5GQSA 2O0JA 1G6HA 2O8DA 1UK6A 5A4IS 3FUCA 4A8JB 3BJIC 1Z0JA 4GXTA 2UYQA 3LRPA 2ZSBA 4KPFC 5EE3A 4RGYA 4Z4IA 4HLUA 1L1FA 1YRAA 4TTSA 2PLNA 2R5FA 2XA9A 2E4VA 2H08A 3KR1A 3RHZA 2IHJA 2ZZNA 4QNRA 3BIXA 3PXDA 1VJCA 2ZSJA 3HYCA 4TKLA 4O2BF 1AMNA 3NMUF 4RSHA 1E0AA 1LTKA 4QXPA 1W93A 3L8DA 3DFMA 5IDQA 1W96A 4PU0A 1CR6A 4RPGA 1O8BA 1XJCA 1A9YA 3HCCA 4G0PA 3IHKA 1JQDA 3IPCA 4M9XA 4KPEC 1XLTA 2GNOA 2I1QA 4R2MA 1L5SA 2ZUWA 3FCXA 4JIMA 4DLUA 3KE8A 2VHEA 5JUWA 3GMIA 4B48A 1NONA 3NT4A 4I55A 1W4CA 4WADA 1MQ9A 1ISRA 1H2RS 2H17A 2HCTA 3NP7A 2GHRA 2IY8A 2RH9B 3WV5A 3ZHYA 2AG1A 4FN4A 1SRRA 2ZWPA 4RS3A 5F1OA 1EX1A 2WLTA 2M32A 5FFFA 2OOSA 3KKOA 4OQDA 4TM7A 3R76A 3G2KA 1E1QA 5KZMB 1GXSB 2VXYA 1TZ2A 2HWUA 3A25A 4J7AA 1QPBA 4JI4B 2F3RA 4UEJA 1P3DA 3W7BA 3TR5A 2YXNA 3UZUA 3VPFA 2AE2A 2X4DA 4D8XA 4NDZA 4Z3KA 5GVSA 1RVDA 4JXKA 3W6NA 5C9ZA 2N1BA 4X62B 1M7BA 3MMXA 5FI3A 4XWGA 4K9QA 4BFWA 3I6YA 3GEGA 3B6EA 3FH0A 2QW8A 4R84A 3D6FA 4N76A 1M1YA 3NIWA 4QDJA 5CVJA 3TDKA 3LCRA 4LAFA 1BXRA 4ML3A 2RBKA 4RDHA 4C6HA 1V96A 1OFGA 3B1JA 1EFPA 2EC5A 2Q4BA 4Y2HA 3GDGA 4D45A 2VJDA 1CJUC 1P60A 1E5XA 4JB2A 2R8OA 1XQXA 4DCMA 4GIBA 4MRMA 4DIUA 1N6RA 1MABA 3CB2A 1WU7A 2W6MA 5K3OA 5D3QA 2X5KO 3HEMA 4TLMB 1N6IA 3Q87B 4Z7OB 2O4UX 3MOSA 3DWGA 3GFOA 4KUEA 1SY7A 3ZGLA 3KQOA 1TU0A 3WDMA 5MN4A 3K0KA 1DAIA 1XSEA 2XQGA 5A3JA 2QN7A 5EJMA 2JI7A 1ZWKA 3ZQ6A 1T6XA 3LWNA 2FRXA 3I42A 4MAAA 3BMXA 2FZVA 3TX6A 3GMTA 1B8VA 1U7ZA 3JQRA 2G77B 4PQRA 4YWHA 1PJQA 3CGGA 3KP1A 1MQSA 3MGAA 1QZZA 2RGWA 3ZDQA 2CUKA 4EBBA 3E9CA 2GTIA 3CQ9A 4G86A 4DAOA 3AR2A 3I01M 1D04A 1DXHA 1U3WA 1JG7A 3KUXA 2XCTB 1Q0QA 4L5BA 1NYQA 2OBMA 1XTKA 2PGIA 4AN0A 1YJ8A 3TJMA 1YS2X 2XZPA 1RTKA 2PLWA 2FN8A 3NI2A 4A36A 1JG6A 1LF0A 5BMVA 4M36A 4OJMX 5E95A 2PAAA 1VP3A 3GN1A 1KO4A 2ACKA 2D7DA 1ENPA 4ER6A 1BCSB 1JDJA 1WCIA 3M2TA 4GWKA 5G0VA 3R44A 1WMEA 2M1ZA 3QJYA 1Z2NX 2O8EA 4D0RA 4Q15A 2WSLA 2O7QA 1FYXA 1H0RA 2OZLB 3R5SA 1U99A 4LRYA 4WZAA 5IS2A 1XZMA 5G53C 3TAHA 4XB6B 2BMDA 2NU7B 2HDWA 1I6WA 4IWNA 3H5TA 3RK4A 4I1YA 3EEYA 3IO3A 5BSTA 4NBUA 1M1NA 1OV6A 4UDOA 1UR5A 5TJ9A 2Y9PB 3B36A 1VIVA 3NRBA 3ADCA 1GVNB 4PGMA 5FX2A 4BKUA 2G9ZA 2QQ5A 5LMCA 1MRNA 1MW8X 3WVNA 3DM5A 2XCRB 1HE4A 3IAEA 4I19A 1DKOA 4CNQA 2Y67A 4PLCA 3RREA 1IAQA 3P7MA 1CF9A 1VCHA 1WXEA 1SXGA 1LWOA 2A92A 3EVFA 3GFQA 4GMXA 4GXRA 4JK3A 4JL6A 4BQEA 4JYAB 1ZSVA 1H0KA 1NF9A 3IBGA 3FWNA 3KYCA 1HT1E 3G2JA 4HJRA 4UHKA 5L7YA 3UHPA 4UOZA 2VQSA 5B4UA 1X7XA 2J45A 2XV1A 4JVSB 5DLEA 3ZX4A 4QULA 1R4MB 4NE2A 1R9JA 1DEAA 4TT3A 4WW0A 3TKYA 2Z8YA 3L7IA 1I3CA 4DJAA 3TTXA 1P1HA 4J0FA 1KGDA 1ZN9A 2AOUA 1CD5A 2ESRA 3ZWVA 1A88A 4HDOB 2JCSA 1Z7WA 2UDPA 4TS1A 3UK0A 1MAAA 3ETGA 4P53A 3FR8A 3K70C 4ILEA 4IQGA 4AO6A 2J6CA 4EUFA 2IVZA 4FLFA 1EUQA 3IQWA 1G20B 3Q3JB 2WOOA 1XRRA 1UZNA 3R6WA 1QIMA 3GLTA 3L7YA 1KJNA 4PHGA 1E8DA 2IXEA 4M4SA 2AFIB 3PQFA 3ZHCA 1LLCA 4ROSA 1GILA 2VHJA 2AQIA 1XDWA 4CQMA 1D1TA 1T9DA 2RGYA 2BEUB 4Z8YA 3INNA 5AVYA 1PGJA 3H1BA 3QBVA 4BYMA 5CA0B 3UJNA 5LP1A 1OWPA 2FNAA 2P2DA 4GI1A 3SQDA 2UZAA 1V16B 2X5JO 3R7WA 1U02A 1RHQA 4KGDA 5GIOE 2Q07A 1OLSA 2RK6A 3W4JA 4PLFA 3EPJA 2X2PA 4MJXA 2P4UA 1ZZGA 4PLPA 2OV2A 3KOOA 4OQQA 5JSKA 2FU5C 4L4RA 5AOAA 1O6FA 5GV7A 1G291 2A57A 5CTJA 4OLHA 1J56A 2VNAA 4TTRA 1LC3A 3U7HB 4YCNA 2CEKA 4YAOA 2VSQA 3DEHA 4G36A 2DWOA 1I3MA 2C83A 3EIHA 3JQFC 4FDLA 4NPCA 2XVZA 1M2OB 3CRNA 4LMPA 4R7TA 4Q3AA 3E3NA 3BB4A 4AICA 4KVFA 4AJIA 4BGEA 2QKYA 1RWXA 3F2VA 1Q3KA 1RRFA 2RE8A 2DRIA 4XVHA 4B75A 2XBMA 3G89A 2J5KA 4MYSA 1UXGA 1RWMA 1ZISA 1A9ZA 1L3IA 1T0IA 1XG5A 5D6NA 2POCA 4S1NA 3ZE0B 4UOEA 4GDMA 2FPGA 3KZMA 4L15A 5KSOA 5CXXA 1MEEA 2BEVB 3GB9A 2JASA 3ROPA 1ZPDA 4PFJA 3ZQUA 1IM8A 4M99A 4BRZA 1RHKA 3OEEA 1ADYA 4FGLA 4DEXA 1VIMA 4E0BA 1E96A 4XARA 3PU6A 5C53B 3G8YA 3AHIA 4UULA 4WMLA 4R9RA 4ZYTA 1R8XA 1JBEA 3AHFA 1VM6A 1JVSA 2VP5A 2PRSA 1KQNA 1HSOA 2OM6A 4RTKA 3GR6A 3P2MA 4FFVA 4MR8A 3ISTA 4ZT7A 5I4CA 1K4KA 3CEJA 2C92A 4GKAA 3SZUA 1KO8A 3R5FA 4FMDF 4X8MA 1VL1A 2LPMA 2W2LD 1NLYA 2JFGA 4PV7A 5L7WA 2XJ9A 1L4FA 1VLLA 2ZI7A 4KLCA 5LLSA 5AHWA 3DHVA 3SC2B 2PUEA 4NZZA 1DXQA 2QJOA 5CHEA 3HB1A 2FOLA 3C15C 5AQEA 4JI5B 4QKQA 5IVKA 3AG6A 3E2PA 2FMUA 4POOA 2YC4C 4QOJA 1O95D 4B4UA 4H1WA 1YQTA 3L9WA 4BO6A 1IQRA 3VNRA 2GR9A 3TDMA 3VHLB 5JJLA 3NP9A 3F6YA 1JIUA 4KAAA 4B7AA 2Z4SA 2WAAA 4WWHA 3TLAA 2PZGA 1EI9A 1ZVQA 1DWOA 2NM0A 1U0FA 2BEWA 1D2RA 3LCUA 1VC2A 5KJEA 4K9DA 4AQ7A 121PA 1EB9A 4XLZA 1UPUA 3PL5A 2VT3A 4FDTA 4JJFA 3RU7A 2VOJA 4B3DA 5KX5B 2C4NA 2PWAA 4HNTA 1NNUA 4YRRA 3HP1A 1W85A 3VDXA 2VPIA 4I1UA 3H65A 2UZ4A 1UAAA 2GSWA 5LWHA 2BY4A 1TIBA 2P91A 3I9JA 1IUKA 3QW2A 2JLWA 3UMRA 3FCAA 4LJLA 3DQZA 1KJIA 1GU0A 4JI6B 3DAOA 4BUJA 5IWAB 4MDEA 2QNIA 1X8JA 5CA1B 1ETHA 4O3MA 1GPJA 3C7TA 3F9IA 4MS3B 4W1PA 3ZZ1A 5JNVA 1E2KA 4FMCB 4EB3A 4PVDA 3GRCA 3KQUA 2IQIA 3G5AA 1M54A 3PPYA 3ADKA 1IRIA 2BHSA 1EFLA 1B00A 1RJ9B 4YC7A 4E1AA 1GL6A 5DXJA 4C07A 5EMKA 3H19A 4O02B 4XKJA 1IN5A 3RV4A 2PR2A 4DCCA 4N5DA 4JEUA 3NC1C 2Q2NA 3UOAB 5I4KA 1GG2A 3DVAB 4DV7B 4WGGA 4JJIA 4EHHA 1B41A 4DHEA 4YAKA 5HEKA 1CY4A 1T8UA 4KV9A 5T5QA 1T0JB 1DBPA 3FLBA 1NP7A 3N86A 1CRQA 1KBOA 1T10A 2PVCA 3MF4A 3VJLA 1QTIA 2W37A 2BC9A 2ZE6A 3BEOA 3DMHA 3OM9A 2BF4A 1RKXA 2VT6A 5DCWA 4KE6A 4N9QA 3HEAA 2ZI3A 3QKIA 4YRNA 1JWBB 1ZG3A 2FGKA 5ALHA 5JXHA 3RYTC 4DEVA 1SULA 2C5LA 4FEGA 3CG4A 1JIQA 3GD5A 1SXJA 4YRCA 1AF4A 4YFVA 1S2DA 1YBHA 5TR9A 4JEHA 1F8UA 1NVWQ 1SUWA 3JVVA 4LOIA 3S2GA 1KO7A 3TI9A 3NOOA 1YAJA 1CEXA 3R3YA 4E15A 4ZIRA 3DV0A 1YL6A 4DMUB 3U4MA 3G23A 2P1RA 3ZXIA 2YWCA 3SK0A 4BUCA 3BTUA 3E5HA 4AS1A 1FY2A 3DZGA 4KREA 1J8DA 1CUIA 4J8PA 2Y1GA 1GRCA 4J0HA 2Z1DA 3R0XA 3AJRA 1NPDA 2ECPA 2IYPA 1P7VA 4OREX 4UJ5A 3FR7A 3WI7A 4QG3A 4YI3A 1X7DA 3LT0A 3QK7A 4ZTBA 1IN8A 4NOJA 4ZO7A 1K3FA 2NOAA 3F1KA 3MCAA 1IOZA 1DBRA 1IE3A 1RYYA 1XZKA 2I3DA 3LE8A 2FRDC 2AOTA 2G28A 3HXKA 3L0YA 4WNAB 1MJHA 1IY8A 1E1CA 1ZOIA 2IYTA 3LJKA 1QKKA 2VJMB 1KDZA 4ZO8A 3FWZA 3HLKA 3WGUA 2JKYA 3H84A 4RTSA 4FGSA 1T5TA 5AJZA 4AVYA 1YL7A 5EJAA 2JGNA 1OWNA 5JSUA 1KWGA 5EIBC 3BXEA 2PSSA 3SXJA 4OQMA 1L5HB 2ZUSA 3GVIA 3RVJA 5LCXA 2AS0A 2GPJA 5EIHA 3ROXA 3ZIAA 1QGZA 2VRBA 3PA6A 4MQBA 1VGVA 1KOJA 4KE8A 4YDRA 2CXTA 1EVZA 4YMLA 2EZ9A 1M2JA 4X8OA 1HLPA 2PD6A 3S6JA 3KDAA 1O77A 5IFKA 2PLAA 3UMMA 3MMZA 1JAYA 5BYAA 1Y1KE 3GXBA 3INTA 4P34A 1N6KA 3H1GA 3IBSA 5JMOA 3ZDAA 4EELA 2RAPA 2I4OA 1BJKA 4DY4A 3AZOA 4N0QA 1TYEB 3H4MA 5TEWA 2GEBA 4R31A 1HE3A 3DWFA 5DNAA 1OY1A 4OHUA 1L4LA 2P6NA 4NQZA 5JAHA 1UXJA 2IYFA 4YY3B 3T3HA 3FLMA 4IGKA 1PZNA 1TPZA 2B3DA 4IINA 4RLFA 3LC0A 3VMMA 1AK9A 2PQ6A 3TJZA 2WW8A 3AP3A 1SIUA 2Y1OA 1W0JA 2G5CA 2DH6A 1WPGA 1ISGA 1FK8A 2ZWAA 4CF6A 3T5AA 5HILA 4B3XA 5LQSA 2G72A 2GF2A 4FPXA 4KE7A 5I7WA 1EUYA 1AM4D 4KKXB 1QRTA 3M82A 2ZIGA 4YAJA 3ILHA 1UKAA 2PUTA 2UXDB 3AI3A 5JXGA 1FZTA 1FRNA 3HXQA 4GGMX 2YZGA 2BEJA 2I66A 4UCWA 1AZTA 1FX0B 1N7JA 1TM4E 2XPCA 4O2BA 5BUSA 2QU7A 3WDKA 1SN7A 1UPCA 2V6GA 3P0JA 5REQA 4PXAA 5FL3A 5E1DA 4WQMA 1YIOA 5DBGA 1KNXA 5KI6A 5EYPB 3D64A 2ZUCA 2GYUA 5AVQA 1VI2A 1CDEA 1ZNQO 5AVUA 1AQIA 4HYQA 4AWXA 3G8CA 3FF1A 1L7MA 1BCRA 1EH5A 1RI4A 3UMCA 7MDHA 1LK7A 4L28A 1DO8A 5DM60 3T38A 5IC4A 3OM0A 1KEUA 1M7GA 2BGKA 1D1PA 1CZRA 3VNBA 2BFAA 5CFPA 2QI9C 1FU8A 4G9EA 4MB0A 2PX6A 1DIGA 1JIIA 2FSFA 2NVBA 3N74A 1QE5A 2FEWB 2L17A 4NDNE 3V2UA 4PF1A 2WUWE 3W6ZA 4AJ1A 3V6MA 1P6XA 3OZWA 5LZ5A 3T7DA 2QORA 3IDSA 3PWKA 4QOGA 4F7WA 2A1UB 2Y3IA 5F7OA 3DA8A 3A6PC 1LX6A 2C4VA 3IKJA 5FQOA 2WP0A 3FUXA 3HCRA 3SZGA 3GCGA 3OZEA 1W76A 2CLLB 4P4SA 2DJ5A 3A9SA 4XCQA 3G0GA 3PGVA 4C03A 2IEBA 3EPLA 1L4HA 4ARSA 1YK1A 2OSVA 4HFMA 3GDWA 1Z4NA 1MAHA 3ANSA 3W5JA 1GO2A 2QRNA 1GEEA 3KV3O 4XDHA 5AKIA 5CCDA 1WY7A 1SCAA 2I80A 3QPAA 2VK8A 4GR9A 5IYZA 3KG2A 4BBJA 1B6TA 1ZRHA 4EW2A 1A7JA 1IOVA 1NOKA 3AIKA 4G4SP 3OLCX 1BVHA 2YZ7A 2YV4A 4L6IA 3ZKWA 2PUCA 1HQKA 4AT1A 5FWNA 1JVBA 4B73A 5LN1A 3MW8A 4RLHA 4EG8A 2A3RA 3BE4A 2DFTA 2R25B 3R3UA 4R6WA 2R6DA 2YY6A 13PKA 2PZMA 5FOQA 5JYBA 1GSHA 1NC3A 1XIVA 3P9YA 2VDPB 1ONPA 4EO4A 4F4FA 4D4GA 2F00A 3MQ2A 1EMDA 1V1MB 4NCNA 2B82A 4WA8A 1VRWA 5E7IA 2H1CA 3I2KA 3OQMA 3SXUA 1ILEA 1TYDE 4RJ2A 5AM3A 5DNCA 5EKXA 4B6QA 1LTQA 2PE5A 4OEHA 3K0AA 5EUCA 3GEBA 4LF8B 3WQQA 4Z4FA 1XZIA 5DCYA 2LDBA 3FHCB 4UTNA 5F73A 5D85A 3BJZA 1R27A 1J06A 1MTZA 3EG9B 3JQ7B 1GLNA 1SMKA 2PZKA 3UPTA 4YV7A 4UEOA 3TLGA 4ZT5A 2WWYA 4NBTA 4EPXA 5K0GA 1Y37A 3VYVA 4M1QA 1A95A 2GTHA 1W8DA 1U9IA 1Y6QA 2Z08A 3A1VA 3C2QA 2BDTA 3BMQB 3PGLA 3BWYA 3ZV7A 2GKOA 1NV9A 2A1TR 2C2GA 2ZJ4A 2QL9A 4C0SA 1I4WA 1IJKA 1SUPA 3HPRA 4PPQA 4BEJA 2F3TA 2K5UA 1Z5NA 1E2BA 4K3UA 4CLEA 1OFUX 5AI6A 1G1AA 3UVEA 1Q1ZA 5C3MA 3GRPA 2IBTA 1P9RA 2IIBA 4HNHA 2Z3WA 4Q3NA 1MLDA 2ZTHA 2O7RA 1BIFA 4DWWA 5C32A 3UMGA 1USWA 3ZD6A 1QVRA 1WMAA 4QJIA 3O0DA 1JAXA 4JYMA 5IC5A 4BNMA 2G08A 1NSTA 4YJDA 2V45A 2PMFA 1O08A 4TMKA 4Y1RB 4DRZA 3K0BA 3SJAA 1TAQA 3CKLA 3LY8A 4XA8A 3RJ5A 1SC6A 1E63A 1H42A 3GFRA 5F52A 4B4KA 4WH0A 2JH3A 4Q7JB 1UQTA 4G56A 2RGAA 3GLUA 3L5KA 3I39X 3IR5A 1UODA 4UEQA 5EMLA 5IEJA 1RYHA 3NWPA 2ZUTA 1P4GA 4LZAA 4FGWA 4A8TA 4HRAA 4BFCA 1FYEA 2XY4A 3PNBA 4MV6A 1YMQA 5HIMA 3OLZA 1IDOA 1N7IA 2BFNA 2BEUA 1F14A 2JHFA 2VYND 3AR5A 3E05A 4KAJA 4KLRA 4M88A 5F2OA 2G5PA 3BXHA 4DCPA 3PK0A 4OIMA 1CJTC 3E9EA 2AF3C 4PAWA 4FFMA 4EB6B 3HJFA 2VK4A 3KTOA 1LZKA 1W0KD 2DAPA 2VWHA 3FBWA 3NGXA 2O3RA 1V16A 4RK7A 4CR7A 4R7ZA 4RPHA 1ZIDA 5DGIA 2QVLA 2LDXA 4D9CA 3LXXA 3AFNA 1GZVA 1GPMA 4FIZA 3ZCRA 4OGLA 4CT5A 2CWWA 2QN2A 1N78A 4M8NE 4EY5A 1E7SA 2C58A 3V8QA 4D4IA 1XDBA 2QXYA 3PP8A 4RV9A 3DB2A 4BU1A 1GR0A 2PV7A 1ACJA 1DDOA 2WYHA 3AF3A 5CLGA 1ISPA 2E82A 4TRJA 4KNYA 4ZWNA 2BCGY 4AO7A 1LRLA 3LF2A 2Y2VA 3ABRB 2WTXA 2P9JA 3DUFB 4Q3BA 2BFDB 3HFSA 2Q1TA 1DIHA 2BUAA 3GJXC 5CH3A 5ILGA 1OH8A 1ZHOA 4Y1FA 4PZ0A 3KT6A 4N6GA 5DT2A 1JDPA 2H7XA 1Y8QB 3K0CA 3ORYA 4C3ZA 3UWKA 3BSWA 3HU5A 4IIHA 1ECGA 1E1QD 2VTVA 4RTMA 1M34A 2ZJ8A 3KNZA 2IWRA 3TCNA 3UMSA 5DM2A 3S81A 3L1HA 3LUCA 4EFKA 3HEBA 2X5XA 3L79A 3WZMA 1C7IA 4G2TA 4EAQA 1UBNA 3FFTA 3EVBA 3L43A 3VKFA 3QYFA 4K6HA 2I6FA 5J4VA 1WBDA 2C9OA 2DFLA 2P4HX 2XUIA 4ZOBA 3HNPA 4PYKA 3W3AD 1GGJA 4PYNA 3PDHA 4C0QC 4RK6A 1KDRA 4WL0A 3L41A 5KNCA 1QNFA 1VE7A 3GNLA 5CR9A 3ZE2B 3H5AA 4BQNA 4MARA 3O8OA 3ZWOA 4NK5A 5AOBA 4QYXA 3D4NA 421PA 1RWVA 3IULA 3Q15C 1NW9B 4WOJA 4JXXA 1Z0SA 1NR7A 5EVJA 4AN4A 4KQMA 5F7ZA 4KQEA 3TLMA 2Q1UA 4YUZA 1QKJA 2BWJA 2WF9A 3WLKX 2GJ4A 2CWDA 5FA5A 1IRXA 5EPUA 1Z37A 3C3BA 3FSEA 3SVZA 1H8HD 1HEIA 4EA6A 1IPHA 1HDCA 2JIQA 3P2YA 5EC8A 1GQOA 2ZCVA 4LVUA 3MFQA 4INPA 2CUZA 3LS2A 4JELA 2CDBA 4DG8A 1SOMA 2OAGA 2DUNA 1XC7A 4QQNA 4FS3A 1JQJC 4QGAA 3QBTA 1PKXA 3K0CC 3W5IA 4L27A 1LDNA 3EIXA 3DVQX 3VPDA 2WKRA 3TM5A 1DUSA 3BMNB 3GEHA 5KYUA 1JZQA 3SVLA 1WPQA 1JU3A 1E69A 3LKVA 4FS8A 3QFCA 1T4BA 3AF5A 4ZAXA 2HBQA 3TQIA 4QPCA 5KX5A 2HN9A 3V7YA 3PDJA 4KH0A 1NKTA 2Y77A 3DSRA 1RWPA 1SBCA 1XK7A 5DYTA 1CNFA 3YASA 1JXAA 3KS9A 1KVSA 4N41A 1AGYA 2O0MA 1M0WA 2QUHA 2WHEA 2ZAYA 2ZKIA 3AUFA 3C87A 3EXG1 3P9ZA 5EZSA 4ZVLA 3VPXA 3W79A 2HPHA 4JYBA 2XGOA 3MTGA 3DS8A 2VSOA 1GEGA 2IZ6A 4K26A 1H0SA 2FKNA 2R8RA 4BAZA 1NAIA 4R0MA 5AHXA 4AY2A 3U3XA 1PSDA 2O2GA 3QBDA 3RYIB 3TQRA 2R00C 4W9NA 5CDTA 2VZ0A 5MF6A 1HMYA 1BX0A 4LZZA 3BQ9A 4BWVA 4CKZA 4DR6B 1Y6ZA 1Z6TA 2CFCA 1K9SA 3PEVA 2NNWB 4ENWA 4BLSA 4MV5A 4W1RA 1JILA 1Q0UA 1XCLA 3D9QX 4KVAA 4BO5A 1UDAA 3WA6A 2W2LA 1H6BA 1GR1A 2RG1A 1JG4A 1F6WA 3VO9A 3VZPA 2AN1A 3C45A 3HFJA 2AZDA 3OJFA 1Z0FA 4NYMQ 4RW0A 4UUOA 2NWQA 5KTPA 2P90A 3JV7A 2ENWA 4QEZA 5CT5A 1FVHA 1RXSA 2FYTA 4HWSA 2YV2A 3FKJA 4IH1A 4F6CA 5IT4A 3K15A 5LZ4A 3GDFA 3MLAA 5BR8B 1X7WB 3WOHA 5E1MA 1HKHA 4EX7A 5KQRA 2PRKA 3S1AB 3IIKA 1PNTA 5G41A 4F2DA 2OV6A 5G1PA 4A5SA 5HS4A 5KTTA 3V5NA 1XMVA 1F0PA 5AXDA 4C4RA 5IXYA 2ZG6A 1T4CB 1JSXA 4A0FA 2R1VA 3FN4A 2J48A 4LY3A 3R8XA 4S1OA 2XE7A 3RANA 4A16A 4DKXA 3I9KA 3P2OA 1HTBA 5LNK1 4DG9A 1OE0A 2OBNA 4NBLA 1YC2A 1YVRA 1Z45A 1QS0A 2BM8A 2PM8A 3BTSA 3FF4A 3PXGA 3D4LA 1N32B 3WGKA 3C85A 5DW3A 2R60A 3DLHA 4UVHA 5DO9A 4W9NC 4UDYX 4MWOA 1GCOA 3TFWA 3WLTA 5F5XA 4ZI7F 2YWDA 4TYYA 4Q4LA 4MGZR 4BN0A 2CJWA 3ESDA 2VH5R 3Q88A 1JLRA 3QV1A 1Y81A 1FSPA 1JHYA 4X8LA 5IJZA 4C7OB 3K1YA 1KO1A 3EZGA 2Y0EA 3WK6A 3F67A 3SS9X 4ARZA 3KQTA 1O1YA 2IUFA 2OXCA 4TWZA 3THXB 2Z6QA 3KWFA 1KYWA 2VJMA 4PWYA 3LT1A 4ITVA 3R3SA 3HU3A 4B6JA 4RJLA 5K8JB 3FETA 1HYBA 3FMIA 2G6TA 4LTMA 1GAJA 1M0TA 3KJGA 3FRHA 2I7XA 5IBRA 4Q1BA 5FHRA 2YOFA 2ZUUA 4P82A 2W2XA 3CRW1 1YRHA 2HU7A 1CVLA 4NX2A 4YUXA 3S27A 2O3TA 2YY5A 1TF2A 1J2UA 2ZYIA 2FPIA 3DLTA 3QWHA 2ODQA 3S2SA 1QSGA 3HBFA 2Y1KA 5J4LA 3ZK9A 2WTAA 4GLBA 4RD3A 1YCHA 5KNBH 1OLXB 4D3YA 3VR6D 4XWKA 3B51X 5JH7F 1PR5A 5CLJA 4QG7A 5T4EA 1Q1BA 3ABOB 3ZNNA 2J5BA 5LUBA 2AV6A 3WGIA 3I2YX 2JD0A 3H11A 3A4VA 3PXAA 4BE9A 3JQBC 3CLUD 4AJPA 5DYGA 4CIXA 2WLSA 1SQ5A 3K2IA 2E21A 1V3UA 2ZUFA 4KO4S 1E6KA 2HTFA 2Q4EA 4H4CA 4QC2A 1TUIA 1NX9A 2ZAOA 4P84A 5CLLA 2VYVA 1H8EA 2V55B 3NATA 2R62A 5ABPA 1N6OA 2YS6A 1K5PA 4TQGA 5TGTA 4FYYA 3G1TA 4YGYA 4D1YA 4DMMA 4R5HA 2D2VA 4KODA 3F4LA 2PWBA 4EGAA 4QVGA 3PZBA 3CLSD 4ER3A 1SC9A 3BZWA 3D7RA 3LSTA 4FFNA 1VTKA 3HS3A 3FPFA 4ZVUA 1HT3A 3H5OA 4RVOA 4X1KA 4ZREA 1UDXA 3MJVA 5C8YA 1WVGA 4RQBA 4F71A 1VP9A 1GG5A 1WMSA 4JI7B 4M6WB 1P0CA 3R5HA 1TUEA 4D6XA 1ECLA 1KSJA 5DYYA 3TI7A 2OPBA 5CLIA 1A7AA 4C20A 4QOFA 3TE7A 4DDMA 4DMLA 5B36A 1DWUA 4KFTA 5FLXA 5EKDA 4JJZA 3QKSA 3L9XA 3AVXA 5KNCD 5DMXA 5G0UA 3LO8A 4X3OA 3GCZA 5L3QA 4WI1A 3K9GA 3A6GA 3WYAA 1QV9A 1YCDA 3BXZA 2I3AA 3IAM6 1I5RA 4G8JA 4BJ6A 1ZGGA 3H4TA 1Z8FA 5KEIA 2A59A 2H4ZA 1QX3A 1E77A 1FDUA 4M1KA 5F2NA 4MVJF 4GR5A 2E37A 1OAAA 1RQ2A 1YOBA 2B7LA 3OF5A 4ZHQA 2G4LA 2YYSA 1Z2CA 4E5NA 5AVWA 4IKOA 1PX0A 2QE7D 3OX3A 2P3QA 1U1GA 5C18A 4FCCA 1E18A 1SVIA 1N7GA 5B53A 3A9CA 3MTBA 1RAAA 1MT3A 4N7MA 5IKMA 2CCKA 2TYSB 5BSEA 3N2KB 2KX7A 1PVVA 2ECKA 2QW0X 3RTAA 3ZWAA 3MQ4A 4JSTA 4M0LA 5FTJA 3B2NA 2DSTA 4O63O 2J9GA 3ECCA 5KSYA 4BMDA 3QU5A 3P9SA 2DBRA 5DHSA 3A4YA 4NICA 3RBVA 4AIRA 1TI7A 4GMDA 1FIUA 1QQ7A 2VRCA 3AJ8A 1F7UA 5CNJA 4D80A 2V4UA 1IHUA 4ZZ1A 3PJRA 3L49A 5IYZB 1TMKA 5AKHA 3I2HA 4WDRA 4RDXA 5A4DA 4U7GA 4RHFA 2PSJA 3UK2A 2H29A 4L6CA 2KI5A 3BAZA 4QPNA 3LOPA 1I4DD 2XCSB 1FP4A 3RO7A 2H0RA 4D9IA 1CZKA 4IJVA 4OPMA 3X1XA 4D96A 821PA 4KMMA 1C80A 3DKKA 1BA2A 3GFVA 2FSSA 2NO5A 1Z63A 2HHHB 2SNIE 3VPGA 1WCYA 5AKJA 3RTBA 3HCEA 4E5VA 5K0JA 2PGJA 3EFBA 1FSSA 1GKKA 4IV8A 1TKAA 4DADA 2IHNA 1XGKA 1GAWA 4JOSA 4ZAWA 3WQRA 1NVUQ 3RSFA 3VZBA 1LBQA 1LFAA 2XDYA 4N3BA 3TE6A 3TN7A 1RZRA 1ZOPA 3RVSA 3TPFA 3MZ0A 4JJEA 4RIHA 4PQYA 4BFVA 3NX4A 2YX1A 4RZIA 2C9MA 2H2HA 2SICE 1EFVB 3FDXA 2HHAA 4L5AA 1VI6A 5JADA 2Y9MB 3OJWA 1KKLA 3LQ4A 3EIQA 4Z9FA 3F7TA 5IKEA 1BG6A 1V47A 2Y1DA 2FRVA 3OFJA 2E48A 1RRMA 3RVQA 2G4VA 2Y68A 3FVVA 4OUDA 1UT5A 3DO8A 5CT8A 4N18A 3QWIA 1JR3D 4YRAA 1ECFA 3H04A 3MUNA 1EFDN 2VJAA 5H83A 5IBQA 4NEHB 4ZV9A 2KPOA 1A3CA 1GD1O 2JCGA 4ZOLB 4C3UA 1HMPA 4G3XA 1RBQA 1AA6A 1I3KA 1L7RA 5KNBD 3HLTA 1X1CA 3QXJA 5EZ5A 5B4VA 4I9UA 4Q9JA 1JAZA 3IMKA 3KXLA 3KSUA 1VCMA 1Z6PA 3A6JA 1HE8B 2X2OA 2XEDA 1A1SA 1K89A 2UAGA 1NZDA 1RDFA 3B9QA 4KWEA 4N01A 4UMDA 5DWDA 1UOOA 5KQGA 4B4OA 2VUTA 2QN1A 3T06B 2Z30A 4DLSA 1T8TA 4QYTA 3AFMA 1YA6A 2V74B 5EHGA 3TR0A 4MR9A 2J0EA 3NIDB 3FB1A 5ALUA 1UINA 4CKYA 5A2GA 4WCDA 8GPBA 2NP7A 3AQ4A 2JHAA 3P9KA 1L9KA 3I8XA 4XYBA 1U28A 5HKBA 1UOPA