1N9ZA

Integrin alpha m i domain mutant
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
184
structure length
184
Chain Sequence
CSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQLKKSKTLFSLMQYSEEFRIHFTFKEFQNNPNPRSLVKPITQLLGRTHTATGIRKVVRELFNITNGARKNAFKILVVITDGEKFGDPLGYEDVIPEADREGVIRYVIGVGDAFRSEKSRQELNTIASKPPRDHVFQVNNFEALKTIQNQLREC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrin alpha-M
publication title Engineered allosteric mutants of the integrin alphaMbeta2 I domain: structural and functional studies
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 65
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2002-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 1n9zA00
1IJBA 2IUEA 4HQFA 3EOAI 1JEQA 3NIGB 4HQKA 1MQ9A 1TYEB 2WW8A 3HXOA 3EG9B 1JLMA 4UM9D 3TW0A 4WK0B 2XGGA 1UEXC 3EFOB 3EGXB 1IJKA 2VDNB 3TVYA 1T6BY 1RD4A 5KYXB 4Z7QB 1PCXA 1PD0A 3BQNB 4XW2A 1YVPA 3EOBI 5E6SB 4C2BA 4NEHB 4F1JA 4MMYB 1PT6A 5E6RA 5KYUB 4NENB 4CN9A 1FE8A 3HXQA 3EGDB 2VDOB 3EGXA 3ZE2B 1MHPA 1JV2B 2VDMB 1AO3A 3PPWA 1QCYA 4C2AA 3BN3A 4O02B 2ODPA 4Z7NB 2VDLB 4G1MB 3F74A 5E6SA 4WK2B 5E6RB 4BJ3A 1XDDA 4G1EB 1M1UA 2VDQB 1U0OC 5KYUA 4NENA 3T3PB 1N9ZA 3K71B 3EGDA 1L5GB 1YVRA 2NUPB 4HQNA 2QTVA 2VDRB 1AUQA 1Q0PA 3K72B 3M6FA 1MQ8B 4MMXB 3V4PB 5KYWA 1V7PC 3BQMB 3V4VB 1ZOOA 5LN1A 2ODQA 2I6SA 1RTKA 1RS0A 3N2NA 1AOXA 1N3YA 3PPYA 2X5NA 5KYNA 1IDN1 2VC2B 1SHUX 5HDBB 3TXAA 4HQOA 1MF7A 4JDUA 3QA3E 5KYWB 3VI3B 1QC5B 2NUPA 3ZDYB 3HI6A 4M76B 2ICAA 4Z7OB 3ZDZB 2B2XA 2XWJI 2WINI 1FNSA 1NA5A 3K6SB 3Q3GE 3EH2A 5KYYA 1RRKA 4IXDA 5HGJA 4UM9B 4CNBA 1ATZA 1LFAA 3ZQKA 4WK4B 1DZIA 2VDPB 1SQ0A 3VI4B 1QC5A 3PPXA 4IGIA 3ZE0B 2NVOA 4UM8B 1JEYB 2I6QA 2M32A 1M10A 2XWBF 3IBSA 4PN7A 1CQPA 1OAKA 3PPVA 5BV8A 1MQAA 4IHKA 5KYYB 1M2VB 1SHTX 2O7NA 3K6SA 1BHO1 4C29A 4F1KA 5ES4B 4HQLA 3NIDB 1ZOPA 1ZONA 2NUTB 3TCXB 4CN8A 3NIFB 3FCSB 1DGQA 2ADFA 1XUOA 4WJKB 1IDOA 1T0PA 3T3MB 1JEYA 4MMZB 5E6UB 4A0QA 1M1XB 3ZE1B 1BHQ1 1XDGA 4FX5A 1JEQB 3GXBA 5HJ2A 3F78A 1M2VA 1MJNA 4WFQA 1CK4A 2I91A 1PD1A 3FCUB 1U0NA 1M2OA 2NUTA 4DMUB 3EG9A 3ZDXB 2VDKB 3E2MA 1U8CB 3EFOA 3RAGA 3IJEB 5KYXA 5E6UA 3EH1A
chains in the Genus database with same CATH superfamily
2ZPTX 1OKKA 2ZJYA 2RGBA 2ODEA 3EOAI 3Q1KA 5ALEA 1GSAA 3M5PA 1U8EA 1YZFA 1KWKA 2ZLBA 2OA0A 1X1CA 2HJHA 1KOGA 3ECSA 3E9DA 1Z83A 3QV2A 2A3RA 4P92A 5CGZA 3N6VA 1E2QA 1ZD4A 5EA2A 4DA9A 4U8HA 5DSZA 1FXWA 2YN4A 5EJ4A 3PWTA 4IMJB 2NO0A 5DK4A 3RVQA 2PGJA 1RC8A 3E48A 1NDHA 4J0HA 2RB5A 1LI4A 4WN9A 3VZCA 1OLUB 3OEED 3TLMA 4PAMA 4XWKA 5KYUB 5FTJA 5E2BA 1JR4A 3NT2A 3U3JA 2DTDA 2Q2NA 1NF2A 1U0LA 3VM6A 3LF1A 2VPYA 3JQAB 3QM1A 5JISA 3EXFA 5K0FA 4B85A 1V2GA 1CD5A 1N7JA 1W2HA 2I4IA 5GM1A 4CTKA 5IVKA 5TARA 1NMZA 3F2IA 4H31A 1T9KA 3D2CA 1LDMA 4KQGA 5FADA 4HXFB 4LSWA 1SBQA 1Q0SA 1RQPA 2JIOA 2ZI3A 3I37X 1U0BB 1LS1A 2I87A 1O54A 3I9MA 1EQAA 5B2FA 3D3QA 1QV6A 2BFCA 4JXKA 3WWDA 1XZBA 1G6Q1 3HNOA 3PNQA 2AOVA 4F6LA 1PR4A 1FRFS 2R6JA 3JTEA 4R8LA 4RS3A 3WB2A 1N5OX 4NC9A 4YCNA 4AY4A 2PD4A 1RRMA 2QTFA 2R8YA 1NVAA 2WTXA 2ORVA 3IOBA 4JP3A 3WBKA 4RJTA 3R3ZA 4EGJA 3PXDA 1ZC4A 2VPXA 4EG5A 2HMAA 2RHJA 3K5HA 1OB2A 3ONNA 4KVFA 4W8HA 3WOVA 4YYEA 3UPTA 1YZNA 3SHWA 4R2KA 4NK4A 5CDGA 4UFNA 1CZNA 3CG4A 2JI8A 3K0AA 3PP8A 1LEHA 4C7OA 2BYTA 3W9UA 1JVNA 2X5KO 2HEIA 5IJAA 2DT5A 2X58A 2IXGA 4IHQA 3AUAA 2VZEA 2PJDA 3PQEA 2BGWA 4MXDA 3RS8A 5EHNA 3NO4A 3PZRA 1Y1KE 1TUBB 4ARZB 2G5CA 3CKKA 1UBLS 2EJVA 2R7KA 4UTPA 4MDHA 1HF3A 5FRDA 5KKCA 1CJBA 1REQB 3GGPA 1JH8A 1JEYB 1D0IA 1YQXA 2M32A 2BHRA 5EY5B 1J8YF 2FPRA 2JI7A 4HXYA 3BERA 3QOWA 2I2DA 3B48A 1P3Y1 3GBPA 3LQQA 5FORA 4QTYA 3DB1A 2J3HA 3H65A 2IYLD 3TXXA 1W5SA 3OZRA 4L4YA 2EV9A 3ZW9A 3KYDB 3EQ6A 5ALTA 1NVKA 2QZ9A 1EP2B 2JGEA 4YTEA 5D7NA 4BB9A 4JDPA 2IDJA 4B3TB 4B6GA 2X9NA 4EG7A 3NEAA 3GUCA 1Z17A 5AJZA 2WAMA 3TSZA 4HT3B 4DV3B 5ITSA 1WHSA 4MYDA 2EARA 4IJUA 4H3SA 1MP0A 2G1PA 3R8FA 5IT5A 1XVUA 4N7BA 3ESZA 3EMBA 3Q6IA 4DC1A 2QRMA 4JT9A 1FQJA 1VZ3A 4L57A 4DWOA 5HP4A 3OP1A 5HDQA 3PHJA 5JMWA 2R65A 3MJHA 1XKTA 5CAEA 1DJMA 4MOWA 5K8VA 1N2GA 2QZJA 1NN3A 4JYAB 3RYTC 5AKJA 3W2EA 2VHEA 3K2QA 4FWIB 1JVSA 4HK4A 3D6TB 4M0LA 4X20A 2ZT8A 4XQEA 3RV4A 2PSFA 5JRZA 1TVCA 4G5QA 1QHSA 1YFLA 1U5BA 5JBQA 4AQ7A 2XEXA 1K97A 3Q5EA 1YI0A 1RM5A 1SG0A 2FUNB 4QBGB 3PV0A 1N2BA 1K7CA 1IY0A 1AKMA 4ZD6A 5HKBA 1Q7CA 3P9YA 3ETGA 4XYGA 1E63A 3WNDA 2A84A 1S7GA 1I0IA 2OGSA 3KUCA 1EFCA 4PR0A 3RM3A 4C4TA 4OU5A 4OSPA 5IZCC 3KYIB 1OBOA 3H1GA 1Y8QB 4P5EA 3IT0A 3WGYA 4FJ0A 3QKRB 4YHHB 4LRWA 2NUAA 5B58C 5HIKA 5IULC 4UE6A 2G6BA 3H5WA 1TADA 4B6SA 4CIBA 5BSHA 2F59A 3ZGZA 1L5FA 5THXA 5FNVF 3DV2A 1O6CA 4O02B 5TV2A 1DKOA 4DTCA 2GMWA 4ZXFA 4Z3DA 3OFNA 3UMMA 3D8RA 2MINA 5TQ2A 2Q41A 1N2CB 4ML3A 5JAHA 2HXSA 5BWMA 2BD0A 2AE2A 1V6SA 1W87A 2QN7A 4UXHA 4P2GA 4W1RA 1PDWA 3KB8A 4YH1A 5BR7A 4R2MA 3FTFA 1E1QA 1ESNA 1UEIA 1HH4A 3DYIA 1FY2A 2R8RA 3NXKA 4MVJH 2ATEA 3LXXA 3GGOA 4LOKA 5AI9A 4DV0B 1W49A 3FKJA 3GEEA 2CXOA 2RI1A 3LKZA 4ZHQB 5K3OA 1L5LA 4Q4DA 1CLUA 2AC4A 3RIXA 3TZQA 3DOEA 2HA0A 5EINA 3W3AH 1B1AA 1ZH8A 4B6OA 2PLWA 4BNNA 4Z2YA 3LDAA 2CK3D 4YJHB 1Z5NA 1Z2CA 4FGLA 1XD8A 4HATA 2DAPA 4G5SA 3HYCA 3GRZA 2D2VA 3IVRA 3KYCB 3ADPA 5JR3A 4OX9Y 3WAKA 4D9CA 5JQGA 4JI6B 2AMYA 1G17A 3PE6A 3C74A 1J6UA 2I8LA 2ZAYA 1Z28A 4MUKA 4X84A 4ZVUA 4DADA 5EPUA 2FRXA 2PSHA 3LUPA 4MA4A 3Q7EA 4N9WA 3LXMA 2Q5EA 5IABA 3T9EA 3WLSA 5T8KC 1C9JA 1AZWA 1FFBA 4I8XA 1LQTA 2RCNA 2P5YA 4NZZA 3SQMA 3TCXB 3E3OA 2NVBA 5LP1A 4O2RA 3WLKX 4WLOA 4B35A 3N2KA 5ALPA 4K9RA 3MC1A 3D4LA 3CA8A 3VU1A 1T34A 4X6LA 2OCDA 5DGHA 1DMRA 3VPSA 1RYYA 2W6ID 3SG0A 3TAHA 4P5DA 2FKNA 4G4SO 2PUVA 2WFLB 3L8GA 5EAIA 5JBNA 3A06A 1XCLA 4J8PA 2ZPUA 1G3IA 4NAVA 4OGGA 1KA9H 1P4RA 1SUCA 3C1TA 1EZZA 3H1PA 4J0QA 1LDBA 3BGSA 2Y0PA 1A76A 5T57A 1E2BA 4XCVA 2XTZA 4W5HA 3MTIA 3WFZA 4O2AA 1M6VA 5LBUA 1EUDA 1SBTA 4UHEA 5BYJA 4KLNA 2WD8A 2OMKA 3I3SR 1ENPA 1NT2A 1J4AA 5EFZA 2Y1XA 3QEJA 5HMLA 3W8DA 4ZU1X 1S3GA 4J9UE 1KWGA 1KYQA 4P31A 3T1YB 2JFHA 5JAUA 1CUJA 4ESEA 5JZVA 4YQEA 4HO1X 4L0CA 4WZBB 4F3NA 2WV7A 2GX6A 2PYIA 5EUQB 2FR1A 1YS7A 4N3BA 3W05A 4KPEC 1D09A 1R8YA 3GPLA 4QM6A 2OBYA 1JGTA 3LA8A 3MGKA 3HB1A 1NP6A 1FX0A 5FLKA 1DSSG 1MB9A 4BVJA 1NU6A 3VVCA 4OTZA 4RV9A 4KPYA 3B2QA 4HG2A 3L0DA 4D26A 1U99A 3EGDB 2BHLA 1OBFO 3FZGA 2WWVD 3I73A 3SR3A 3LHKA 4LDZA 4WINA 4CODB 1UM8A 5IXYA 1X1QA 2RH9B 3RODA 3FN4A 4C3UA 1QZZA 1ACMA 1WW8A 3CR3C 3WO1A 1U28C 2NSJA 3R44A 1N4DA 1QYWA 4K9DA 4CHTA 4NBTA 3RS5A 2XT0A 1XZFA 4MVJI 4QDUA 1XCGB 1ZCJA 2B94A 2C9DA 2ZVJA 4RPJA 1J5PA 2DBYA 2ZVDA 1WDTA 4F4UA 5AW1A 2R79A 3V6MA 3JVUA 4DSZA 4ZDKA 3JQAD 1ZUIA 4FSDA 4JLMA 3TGPA 2P9FA 4I0WB 2VNAA 3DLAA 5IASA 3I1YA 1NNI1 4RD6A 2GLUA 1MGPA 4U2KA 4ZJUA 3PNPA 1AN9A 3JYQA 4PC2A 1NX6A 2OL4A 1QIIA 2ZWAA 5FNZA 3G5TA 2IYOA 3WWEA 4RFSB 1BA3A 3ROGA 2NMVA 4MV9A 4NXMB 1JZSA 4KB5A 2PUGA 5CH5A 4IJ5A 1NWCA 3V2GA 4BV3A 4CF3A 6LDHA 5LB4A 2WWTA 2JFXA 2Z1MA 4IIXA 3NU1A 4MW9A 4CTOA 3PGJA 3I64A 2PO5A 7MDHA 3RT9A 3FI0A 4M49A 5HZKA 2X7XA 4C14A 1CBUA 3S8EA 2BMDA 4TZTA 5JTTA 5NLLA 1OAOA 3FZYA 2EXXA 4F92B 3BZBA 1GT91 1C3VA 2Z1NA 2QLBA 2G1AA 4Z0NA 2X4IA 4RD3A 3VBCA 2V54A 3OZIA 3MJVA 4FCCA 5SY9A 3S5UA 1KR2A 4XGNA 2FG6C 3KJGA 4LCJA 1JEJA 2VSYA 4AZVA 2K7ZA 5AJYA 3RS4A 1ISFA 5B3LA 1YQTA 3ZDQA 4WADA 4NV0A 3SLRA 4AK9A 3A6DA 2ACEA 3WK6A 2OXTA 2GSDA 3I1JA 3O73A 2P8SA 3WIEA 3DMPA 2WAOA 4CDMA 2JDID 1RJ9A 4PAGA 2GQ0A 5CVUA 1QIJA 4LRQA 5E3JA 2NSYA 1PBNA 4IBOA 4DLYA 5IJWA 4RTNA 1X87A 3R3UA 5BYKA 2XTJA 3REOA 2QLNA 3O82A 3K31A 5KNCA 3ZHXA 5BSGA 1T1RA 5KYGA 4Z4FA 5EVCA 3KSDO 4W5RA 3FJOA 2I55A 3KJEA 3ZK7A 1DQZA 3L6EA 4KR0A 1I7SB 4PS0A 1I24A 4Q6BA 1QHNA 4DTIA 1HG0A 4AJEA 3EISA 3S7TA 3EJ6A 1MB2A 1U8FO 4OM8A 3AY7A 2D59A 2XDWA 3GRPA 2XGGA 4NFHA 4XYBA 4AWAA 1X8LA 3NQ41 2H1VA 2OO5C 2WI8A 4RVSA 3NHZA 1NUTA 5E95A 1OHHD 3TD9A 1ZFNA 3WG9A 3UK1A 4Z1MD 2XIJA 2XSZD 2QTGA 3A4MA 5BSFA 1JDPA 1IIBA 3ACBA 3AIMA 3T7KA 1L6IA 1FVXA 3EE6A 3K9BA 3AVXA 1F8UA 1TIPA 3IQZA 5FBWB 1Z6XA 4P7GA 3UN1A 5AVRA 1EM8A 4OQPA 2RKOA 2IZ7A 5LMCA 2PFKA 2B4TO 5C3MA 1A4UA 1JLKA 2GBPA 2HSDA 2K6GA 1GTSA 2NYAA 4Q1FA 3SEAA 2IH5A 4Q1VA 3BVPA 2L69A 3DLIA 4A23A 2Y3IA 3GEBA 1SG6A 4NESA 4N39A 5H68A 1X74A 2YMLA 2ZUCA 4KPUB 3N76A 3NBFA 4JJGA 4MV5A 4LSGA 3EEQA 1B0UA 1CUHA 1WS6A 1WDLA 1X92A 3HC7A 1CSEE 1L7BA 5CT9A 5CG1A 4ZU6X 1C0KA 4QAJA 5B6IA 3HDYA 2HA5A 3GRFA 4PGGA 4CEHB 4B81A 3ODPA 2OLEA 2W37A 1YS6A 2B20A 3C97A 4M8IA 4N12A 2ZB3A 1GARA 2Y0EA 4O2BA 1YGYA 1AK9A 2HQBA 3CMMA 1SU7A 1QRAA 1HE3A 2YJZA 3T4PA 1QSGA 1TFRA 3TQHA 4RD0A 3DOHA 2DFVA 1R4NA 4BN5A 2O1XA 3AIIA 3LT5A 4EYGA 2UZ1B 5HKKA 3U48A 4CR7A 2IP1A 1HFKA 1B8OA 1Y6ZA 2L82A 2VJKA 5J2TF 4BEVA 5BR8B 2XCRB 3WLJA 3PUIA 4LZAA 4Z6KA 1ZKMA 2RKWA 1CP2A 3PFCA 4CXMA 5JNUA 2YW9A 1FP4A 1RRKA 1YDEA 4KCGA 5AI0A 4JP8A 4ZAWA 3SC2A 1CTQA 4ZYTA 1C29B 2Q5QA 3CGWA 2ONYA 3TE6A 3DP9A 1W0JD 4WLEA 5KQMA 2G83A 2PD3A 5B5SA 4EI2A 3IBSA 1X7WA 3Q5GA 4QTTB 4IIJA 2ECFA 1DKUA 1FFXB 2XUPA 2AJ8A 1Z5VA 3G9TA 4DC9A 1EQ2A 1H9AA 2WIDA 3IXLA 3RSZA 2ZJAA 3VV3A 1PUXA 3S1SA 1JG6A 1RLTA 1JFSA 2GHRA 2RJ3A 3RSCA 1T15A 4ZKEA 4G24A 1KI3A 4Q1BA 2A4MA 5DX8A 3DVLA 3P4UA 3TINA 3UENA 5C7OO 2WEKA 2FWBA 2JFZA 4MMZB 5B3AA 3PC2A 4TM7A 4E22A 1PJZA 2DUNA 2XXJA 5IT0A 2ZQZA 2C2WA 2WVHA 1ECLA 2O4CA 5EVJA 4EFNA 2X42A 2GEDA 3VA7A 1XJ0A 1JJIA 2BKLA 3TX2A 4X63A 2ECKA 4P22A 1ZNQO 3P0IA 1YNSA 2BSAA 4FW9A 3SJZA 4DLTA 3L8YA 4L3VA 4DLRA 2F6RA 2IBMA 2IXTA 1SZPA 1EJ2A 1HO3A 1S7CA 2HCFA 1XCBA 4WN3A 3TIVA 1ML4A 4JI2B 3CS3A 1AXGA 1R8XA 3E18A 3LQYA 4S1TA 3TE7A 5MN5A 4BY9E 4HQFA 1K86A 2F1JA 1EB8A 3W1EA 1M2OB 4FBLA 1ZM9A 4O8CA 4JKOA 1R64A 4JYCA 1KVQA 4DMRA 1R8SA 1X80A 3C7AA 5HRAA 1U1IA 2GYYA 2VHXA 4PTZA 1U2DC 5DCYA 5A3QA 2P9TA 4J0EA 2REQB 4ZT3A 1GGVA 2YHSA 3KEMA 3COJA 1EXNA 2WIJA 3DE5X 3UOAB 3AP1A 3ZW7A 4QUGA 4D79A 1DIHA 1FNBA 2IPLA 5JNSA 3B85A 3AR8A 5ADVA 2VHCA 1DC6A 4PHGA 3BKXA 1RRGA 3K35A 1KHTA 2H0QA 2R25B 1ORWA 3DT8A 4UUAA 3V7FA 3IUJA 3V1KA 3LUCA 3CLTD 3EGXA 3L6BA 3QG1A 1DBQA 1R0ZA 2HHHB 1TJYA 1KPHA 1P6QA 3R0ZA 5CVCA 2WNSA 4BMOB 3UHPA 5MFPA 3HDHA 1ECGA 4H77A 1JWAB 3V7YA 1EHYA 1VBMA 2OD7A 1U3GA 5AJXA 4IVPA 1GPLA 3DWIA 5BOSA 3UT5A 4G1EB 5I48A 1SVUA 3H97A 4RPGA 4NYMR 1M2NA 2FB9A 3THWA 2O20A 4Q7EA 5IH3A 5DTQA 4FFDA 1UBSB 2A9VA 1KBOA 1RMYA 2BGLA 3KEGA 5ALZA 4B71A 3OJCA 4DDHA 4ZI3A 2FW9A 3KB2A 1ZNZA 4RW0A 5DYTA 1U80A 2JZCA 4TMZA 3K9NA 4JOCA 3LUDA 4AI6A 1MH9A 5KHAA 3R9XB 4BCDA 1IBSA 2ZS9A 1KVTA 3ZXSA 3BSSA 3OMWA 4L9SA 2IYTA 1QH0A 4R0MA 2J9FB 1CR4A 1HL7A 1KYYA 4ZOQI 3RLFA 5LIRA 4N0DA 2HSJA 4FSHA 1ESMA 1L1QA 3UVEA 4FXOA 3II6X 4QC2A 4RABA 5KTRA 4YN3A 2ZTHA 2RC5A 3CNLA 1MJ5A 3JXEA 3WADA 5ER6A 3PC4A 4RHFA 4WFKA 3GF4A 3IR6A 4L73A 3ODGA 1O1YA 4NOJA 1KAQA 5ALQA 4EKEA 1LPSA 2WWFA 4UMEA 3A28A 1PJ4A 3GV0A 1JFTA 2E48A 1MDFA 4DMKA 3ZWPA 4Y1EA 4EG6A 1DC7A 2H0AA 1VG9B 2PUHA 4X1KB 3USES 1IHUA 2ERCA 4EHBA 5AFSA 2DSTA 3UMRA 1E7RA 3MGGA 3EPKA 1JH9A 1TLFA 1JBKA 3LQ4A 2JHCA 4ZCIA 3RVNA 4FOSA 5CB4A 5DN6D 3HYTA 2P2LA 2VDJA 4MK4A 2Z3WA 3WLMA 1PFQA 5ALVA 1E7MA 1LCIA 2YCLA 1B8VA 2F64A 1AKTA 3ZLTA 3RYCB 2VLIA 1ISMA 2XDYA 1G3QA 1GZVA 3KBOA 3EZLA 4PWZA 4EJSC 3WMEA 3RR2A 3NW9A 2Y1GA 2VJCA 3AMVA 4OBBA 1NMSA 1THMA 4HNHA 5AKLA 4CCAA 4BAGA 3KKLA 1OJ7A 1RXUA 1RXCA 1D0VA 3I2KA 3HSSA 2AMJA 3OTGA 3AESB 1J8DA 2E49A 3NORA 4L8WB 3AVQA 4W9NA 3T94A 3Q2KA 4FKZA 3IR7A 4AJLA 1TIBA 1V3TA 4Y6RA 2OYRA 2RAPA 1A50B 3K73O 2CXHA 2NT4A 3SEQA 2HPZA 3L7AA 4MI9A 3V2IA 3ENNA 1JHPA 1WXXA 3MB8A 4PLFA 3BWDD 4EUFA 1IJBA 2XVAA 4YUWA 1UJ2A 1DIAA 2I7VA 3O75A 3JQ7B 4NCIA 1UPUA 4HDCA 4G9EA 1N5KA 1MGOA 1XAHA 3TQTA 1LBHA 1QGUB 3FYDA 4KQHA 3H9CA 3PGA1 3T8YA 3OJEA 4CQJA 1PR6A 3NHLA 2Z58A 1L0BA 1Z2DA 1NW5A 3PJEA 4PLHA 1UFRA 4K2AA 1I3KA 1V8BA 3LX8A 4GDMA 1YCHA 1DBVO 3O9VA 2H63A 5HFAA 4F8EA 2B2CA 4BP3A 3ADDA 2FUG1 3LC7O 3NKLA 1GPMA 2BISA 3K1AA 1KYWA 1UJMA 1BWQA 4NABA 4CEJB 1KSFX 2VWQA 5AHKA 3V2HA 3KALA 2YWEA 4X3OA 5JARA 5KSZA 1G1MA 4L95C 1I1NA 1ZMBA 4X7BA 3K70B 4HWTA 5HKAA 4XD7A 3TWOA 1DZ3A 1HTTA 4DLZA 4NAHA 3HJAA 1K3FA 3RJ9A 2QRVA 3PUZA 4DVGA 1BHJA 1JKIA 1R27A 4DGQA 5E6RB 4OXNA 1ZCZA 2QV0A 5KU7A 2J4DA 5H5JA 3T41A 2XA2A 3E1SA 3PEYA 2K5UA 2XJ9A 1GQFA 2XBMA 2W2KA 1PS0A 2YVAA 3PEVA 1XMVA 2CY0A 2FHPA 1V16A 1FSSA 1ZJYA 3AVOA 3NG1A 1H05A 3O2QB 5D5PA 3W9YA 3KVVA 3MJ4A 4F5EA 1ZIXA 2GGSA 3TKYA 3FOEC 3JRWA 2PKWA 4QGHA 4DKXA 3FFAA 1KK2A 2KI5A 4B8WA 2FU5C 3LL7A 4BFTA 1VSTA 1K6MA 5AVZA 4GXNA 4AULA 2XD9A 5DHUA 3OJXA 1IRXA 1RZ3A 1VKRA 4S1OA 4JBLA 1NC1A 4UQPA 5EWJB 1UBNA 2DUMA 3CCFA 3DWEX 3UF0A 1AURA 2FEMA 2VP9A 1TQ4A 4AVYA 3W9SA 4AP6A 3D43A 3ISTA 3MERA 2J3LA 2ZYSA 4HLQB 4QNRA 4WEQA 2VSFA 4F4HA 4F3TA 4RL4A 5FJIA 2C96A 5TMPA 1CZUA 2P79A 2RAUA 5AW8A 1JT9A 1ZVJA 4CTNA 5HPYB 2BFBB 1SUDA 4KMMA 4B40A 1HEUA 4JGBA 3L7DA 5FPQA 4FHDA 2R9VA 3O9ZA 5KJ1A 1ISIA 1LPNA 1CJVC 1PR2A 1D7OA 2OC9A 3D5QA 4WBNB 3IEMA 4JP1A 3CTMA 4D97A 4DL9A 1YRBA 2C2YA 3G2NA 3DVQX 5KTKA 4ZOAA 1BTOA 2C5BA 2RHWA 1LGYA 3FMFA 5LP6A 4JYMA 2Q1WA 2VHQA 4KI0A 4XZ3A 1ZGCA 2NIPA 2O7NA 2ZSIA 3NWOA 4IAOA 3DEFA 3PVZA 2FGKA 3FHJA 4KPFC 3VR1A 4D8VA 4DNFA 5JCPA 5JLJA 1P5RA 3MJRA 2OZVA 4BFUA 2XQFA 3I2IA 1N5JA 1QGED 3K8QA 3THXA 3WXBA 5I45A 2ARKA 2QUKA 3A0UA 3G0GA 5A6SB 3FGNA 2Z3ZA 1U8UA 3KBBA 3OM1A 2PA3A 2XI4A 2J48A 4U9HS 3CWZA 3T3NA 3GJQA 1R5NA 1D03A 1RKVA 4NMHA 4NG4A 4E31A 4TYWA 3H9UA 3SS8A 3GU3A 1AE1A 3ASUA 4C4PA 2PUCA 1ADBA 3ISJA 1IEWA 1YJ5A 3KR0A 4BWVA 2COUA 1PJLA 3HHPA 4WCFC 3GEGA 5TRTA 1E3SA 3RSHA 1LDNA 3VUFA 2J0EA 3MHPA 5BY2A 2FPOA 2HGSA 4PTLA 5P8WA 1YFJA 1QPZA 1FJ2A 3COVA 4MR8B 5IAOA 5GV7A 4ON9A 4JWKA 1GXSA 1E18A 2QW0X 3P5BA 3QVGB 3V3KA 1L4LA 4URWR 1O87A 1GNRA 3H6GA 3AW9A 2QTAA 3ICPA 4HFNA 1WTCA 4DCTA 1TZCA 4IWXA 3CF2A 4ZZ2A 5ICSA 5IK2D 5HJ5A 2C2GA 1GPDG 4U39A 2Q3DA 2KSQA 2D8AA 4B9EA 1GU7A 5CD9A 2GXQA 3LFTA 4B8ZA 1Y6RA 1QQ5A 3UJCA 5A9RA 4X24A 1Z7WA 2AEJA 3PDWA 4RU1A 4F85A 3JX9A 5LLSA 2PH3A 2XCUA 1TU3A 1C2TA 2VFAA 3NBYC 4TXMA 4CIDA 3N0RA 3P32A 5EMMA 5HBGA 3ETJA 3WGNA 4HUQA 3PXXA 4MYSA 2QUJA 3BCSA 5AK5A 3R8XA 2FWAA 3R4CA 4IFBA 3TEJA 5L3ZA 3TMAA 2R6DA 3VYSB 4BNMA 2Q5CA 1HURA 4NCHA 3KSMA 2BGTA 3VDRA 1GL7A 1AT1A 1ODKA 2H3HA 3M6MD 2JGKA 3FOZA 1STOA 1V2HE 1YR8A 2FX2A 2O07A 2O14A 2Q6KA 4FFRA 5IDQA 2C4MA 1H22A 2A58A 5ULLA 4BNJA 3S3TA 5A9SA 1QFMA 4Q9DA 1SUSA 4ETNA 1KDTA 1PYOA 3UGJA 3ER9A 3KSBC 1XQ6A 2D2XA 2PMKA 3G79A 2J08A 3GNLA 1IM2A 3NNNA 4RVDA 2YIVX 2H11A 4POOA 2HY7A 2VC2B 1AHIA 1JDUA 3AWDA 3MMZA 4EEXA 2Y27A 1P8AA 2XZTA 1FLDA 2LD4A 1A9PA 3MCWA 5LZ2A 3TTVA 5IVHA 4UBNA 5IDWA 4DKJA 1VHTA 4IDNA 4Z9AA 4YRFA 1KQPA 2Z4SA 2O3RA 2O1SA 3PJRA 1UBUS 2ZU0C 4A7PA 3IUEA 4HBGA 2CDAA 3MS4A 3CVOA 3QY9A 3WSWA 2ZATA 1SCUA 5FBRB 3RSFA 3VPCA 1FTSA 4HP8A 1NR5A 1N7HA 1Q12A 4REOA 1DJLA 2IEBA 3D4BA 4WA8A 1SQ0A 4MIEA 4EHAA 1VBNA 5JXIA 1M2JA 4FYHA 1XPUA 5KUTA 3A1TA 1SVWA 4RIHA 3RRZA 3ICEA 2E1PA 3ONVA 2CFSA 4HDKB 3U6BA 5LQDA 4BVAA 2O5CA 1NSTA 3R1IA 2WY2D 5KNDD 4MHOA 4HJRA 1CQXA 4RA9B 5I4BA 2GK7A 3AR7A 3H2BA 1NUUA 4R2HA 4H9GA 1DGQA 4RYLA 2WP0A 4H1WA 4M9SA 1QZXA 4H3KB 4IVRA 4NEGA 3F6BX 1XN4A 2BF7A 4X65B 2NZ8A 3BTSA 2PRSA 2V6MA 5IVDA 2EHJA 2REOA 4M1WA 1MOSA 1WO8A 3KZCA 3ED5A 3PF9A 1POXA 1ZMOA 2ID7A 4IHJB 4TX1A 5E7JA 3NKVA 3UHOA 2E7ZA 4IDEA 4MTCA 4D9HA 2ZANA 5H83A 4ZZIA 8ADHA 3BHMA 4PGAA 3KQYA 3OQVA 3UH0A 3H9QA 1CW2B 1QX3A 2D2FA 2C3MA 3ETDA 4NZOA 5AI8A 3BD6A 3R7LA 5L51A 2XE6A 1NLYA 1TUGA 4UEJA 4ABTA 1PK8A 4P4UA 5FL7D 5I8PA 2XT9A 2IYUA 3PTLA 3VO2A 4KXNA 1I51A 2ETVA 2O06A 1HQDA 3O8BA 2F8MA 1E92A 1F06A 1R0SA 1TUIA 2Q2QA 2YOFA 1JE1A 2Z9CA 1K0FA 3BK1A 3LIPA 1P9NA 5AOAA 1KRXA 4LSMA 5ITZB 4U7GA 3VX4A 4I6GA 2IE8A 3NXSA 1UPXA 2FK8A 2HOQA 1V8ZA 3DD1A 3FPAA 1Y4ZA 1P9LA 3KUUA 4LDQA 1VI5A 3LPDA 4IDQA 2BKEA 4JH0A 1O5TA 1R7RA 2RSLA 3QGMA 1WPQA 2GF0A 4C7KA 2P75A 3JQBC 4N01A 2RHBA 4R2XA 2PXXA 3VUEA 2Z2KA 2KS6A 1OILA 1B00A 1G6KA 3T1OA 1ORHA 3UWMA 1S2GA 3FY4A 5ICCA 2X8JA 4E2XA 1ADGA 4MZDA 5BV0A 1BFKA 4RMNA 2O0HA 3OKPA 4PSCA 4MGKR 3JCZA 5DXFA 4CFZA 3MTAA 4MDYA 3QUTA 4LV8B 3LIIA 5IM4F 3FYHA 3PUXA 1GPJA 4RGQA 4G1FA 1MR3F 2WICA 1TLLA 1V41E 1IWOA 3OOYA 4JN6B 3DUFB 3H8VA 5EC8A 3A9WA 4WWHA 2N3ZA 2O0MA 2PNJA 3VC2A 3CZCA 3K70D 2ZR9A 4II3A 5LOVF 4M54A 5A4IS 2OPHA 5HUQA 4EAAA 1O0BA 2WD9A 3BD7A 2HRRA 2OBLA 3GL9A 4Q3CA 1IZZA 1N0WA 4PQGA 1DINA 4RGVA 4ZV7A 4D4IA 2BCEA 1WP4A 4GW3A 3R24A 3OQIB 4KQ1A 4XLTA 2BGJA 1U2RA 4XQ9A 4FSXA 4TRNA 4YBRA 1XVLA 2NO1A 3MA0A 3AUTA 5BMOA 1KF0A 4ILKA 4R05A 4WXRA 4GKVA 1N2ZA 3AFOA 4L7QA 3A3OA 1Z35A 2ZTSA 2RG7A 3E7PA 5I5GA 3U7JA 3UJNA 4X9XA 1VA4A 2DJ5A 2I6TA 4J07A 4DPMA 1VGRA 4CYMA 3CTPA 3JWJA 3M33A 1ENYA 2F43B 5K3FB 3HU1A 1E5DA 1SCDA 1ODTC 5EJFA 1N1EA 1CNEA 3B2EA 3ONWA 4YCBA 1MAWA 2QP9X 1DU4A 3BRSA 5AMXA 3RJZA 4E5SA 5C1BA 2EP5A 2ZIGA 4MB6A 3TCKA 2V7GA 1KEPA 5CX1A 4TTSA 2HHCA 4LXHA 3V4FA 4CM7A 3LX4A 4D4MA 2A59A 2QX6A 3PPVA 2ZK7A 2UXDB 1FUKA 2CVFA 2EDAA 4CTMA 3PUWA 2PAFA 1BN6A 2CXTA 4NEQA 1FFAA 5DLDA 2C7PA 1J5EB 3IE2A 1CUVA 1AV6A 2CDNA 4BTEA 4GOLD 2EFJA 3BQ9A 2BZSA 3DL2A 4L8YA 5IFLA 4OPMA 3OQOA 1YA4A 3LK7A 4QTUB 2QGZA 2PR2A 1T9DA 1ZGAA 1DV2A 3ZX4A 4ALJA 2OM6A 4B17A 1BKSB 3G02A 5KYTA 2I65A 2Q4BA 3T95A 2KYRA 4KJXA 2VDWA 3VYRB 3S44A 4G26A 3EVTA 3O21A 4YT5A 2OQVA 3S1LA 1SD5A 3W06A 3IPXA 1C0PA 3IP7A 4GBJA 1XNRB 3G2OA 2DU8A 4XJSA 1M1NA 5KAPA 1V11A 2ZSAA 3PLAE 1OZAA 3G5UA 5I8ZA 4CI0B 1FYEA 3OT4A 1KYVA 1C1XA 3GGJA 1ZU4A 3BSYA 4FZJA 1U4SA 4MVXA 4N3GA 2VVTA 1LC0A 1ISHA 2DFNA 3LRPA 4DR3B 4ZMRA 1RRPA 1BJKA 1Y1QA 1YL6A 3DUWA 3F6EX 3IE1A 4FYIA 5DOVA 2IVZA 2Q6IA 4PICA 3OC0A 1MEJA 2BTOA 3K0HA 4C08A 3P0JA 2SICE 4PZPA 1WSAA 5GJBA 1ZP6A 1ZVKA 2QV7A 5IMBA 1E6UA 1ICIA 4DMCA 4QOEA 1KI6A 2HQOA 3F4BA 4OG2A 1EFDN 3RE1A 3WBBA 5DTMA 1NVBA 1BG6A 1YVEI 3L8ZA 4TLLB 1BNCA 2O2XA 1KEUA 2ZXEA 4QICA 3FKSA 3OIVA 5KNBD 1JPNA 1UKZA 3O4VA 4U2FA 4FEYA 1DNPA 2CZCA 4BO1A 4OMDA 2WDPA 4U0KA 4JKYA 2VP0A 1XTQA 2GRAA 3UXEA 4Q9LA 4G4SP 1SMKA 3RHFA 4RTJA 1IN4A 4QU9A 3K8YA 4DNOA 5TLSA 2CWDA 3FROA 2BBTA 2VPIA 3HR8A 1DRVA 5D1HA 1EK2A 1VCHA 1PL0A 2ZDGA 3EXEA 4FUTA 4WK2B 3TIGA 4KKXB 1QBGA 1SVLA 2I80A 5BQXA 3TW4A 4R8KA 4C5CA 2ACKA 2O2ZA 1T3HA 4XRGA 2FY8A 2NAPA 4LHXA 3VKVA 4IL5A 1T1GA 2FMIA 3E9MA 4HWOA 1LZKA 4YJFB 2DFPA 5HCIA 4RAQA 4BUJA 3K4QA 3QU7A 5TPWA 4GE0A 3WHPA 1GVNB 2R8XA 2QIPA 3A7DA 1VCOA 3BQMB 3KK0A 4KODA 1JTFA 4C0JA 2X8AA 4HAOA 4DY6A 3I6MA 5LUBA 4MJLA 3QH4A 3Q7RA 3UWPA 4PLYA 2AQHA 2KLHA 4YP0A 1SQFA 2EFDB 1KDRA 2WWXA 4X6UA 2ZJ6A 3ZDBA 4MVJM 4O1MA 4KFSA 3UA3A 3COYA 3GLIB 2XB2A 1SOUA 1KJIA 4IJKA 1JR2A 3SX2A 3K6JA 3L4KA 8ATCA 1PL7A 1U3CA 3C8ZA 5JAMA 4N6GA 4GVXA 5KYKA 3KOWA 3F8WA 4KFRA 1COWD 1JDBC 3HM9A 1SXQA 3ML1A 3L6DA 4P3KA 2Z56A 2P6UA 4IHAA 3C1AA 1FUIA 2VQDA 4DDMA 1T9AA 3WYNA 3BSFA 4BO2A 1O4VA 1XYGA 2WYUA 2XOKA 4EPWA 2RGWA 1QZUA 1XJWA 1H2ZA 1JSZA 2PZ8A 1W5FA 2G40A 3W8FA 3ZU4A 2OYSA 3BD8A 5CURA 2BSXA 2FSIA 2V6IA 2UUAB 4ZPJA 3OSZA 4RGBA 1AC5A 3NBMA 1QGOA 2Y1CA 1N9KA 5C4MA 2UU9B 1CY0A 3B8HA 4IW3B 3UBTA 3ZHVA 3VNVA 1IYZA 1C41A 2W5UA 4YWHA 3MT8A 1KI7A 3M1LA 4H0FA 4FOPA 3FHLA 4XB6B 1M0TA 4S04A 2NO5A 3KHSA 4M0EA 3B36A 4BE7B 1KHHA 2W6OA 2XECA 1GGKA 4P4TA 4FE3A 5DHTA 2FSSA 4YNBA 4CKCA 4O2LA 2FZCA 2YKGA 4M0UA 4MI3A 4M7OA 2VHVA 2CBXA 2HSGA 3DTYA 3ME5A 4IG9A 1UBFA 2IK8A 2YJTD 3W3AA 2ZBQA 4P53A 3I9JA 2C7GA 3E81A 4AIRA 2XGMA 2ZEJA 4MUHA 5BYBA 1OZFA 1SIUA 3D6JA 1EDEA 5EE3A 2GBLA 5DBGA 1KMCA 3OECA 4CEIA 4JR2A 3DXXA 3ZKWA 1VI6A 4FI3C 1QLWA 5B6PA 4DRZA 4DCUA 2VWHA 2WKPA 2PHZA 4ZVOA 1VLLA 2BN4A 3CUEF 3KQPA 1LF5A 4C4SA 2MSNA 2A33A 1PL6A 1V5FA 1QS0B 3MIIA 3HFGA 2ATCA 2W70A 1U5CA 3QX9A 3LX6A 5F9FA 5FL3A 1UADA 5CHYA 1UKVY 5F1OA 3S81A 1P62B 1G2IA 4FINA 4HI0E 4RCZA 1OBHA 3GLFE 2G82A 4V0KA 3GT7A 2FN3A 3BL8A 5BT9A 3QVWA 4JUCA 2G0NA 4ER7A 5AM3A 3W04A 1KDOA 2DYKA 121PA 1HDGO 2ZT5A 2GPNA 2HK9A 3OJOA 4L0QA 4NVRA 5GIOE 1AH2A 3FPFA 3M4XA 3K09A 3M9XA 4E1BA 1SU4A 4EVRA 1SQ6A 1RQ2A 3H5IA 4AAYA 1KMMA 3ZWBA 2BY4A 2Q6TA 1WZ2A 1D2GA 2HF8A 4J7CA 5SV2A 4G81A 1UMCB 1XDDA 2I2CA 4B47A 3GDFA 1A9XA 2B4YA 4MI1A 4IH4A 1BWSA 2YC4C 3BS4A 4B45A 1EAYA 1J39A 4GQAA 1CQIA 1OYOA 2YXLA 5BT8A 1E7WA 3F9CA 5L8VA 1GQ2A 3W5BA 5J2UA 4YRSA 4MCHA 1WVGA 4OJQA 4E1AA 2WTNA 4MZXA 1NI5A 2V4UA 3VC1A 3GMSA 3F5SA 3KFLA 4J2TA 4MS1A 2A67A 2VP2A 3DF7A 5LWQA 3T3EA 4INOA 1A72A 3BD9A 1VYHA 3SWWA 2QRHA 2ZRNA 3IIJA 4JEMA 1MOZA 1DE0A 1M34B 1U9IA 4MQEA 2Y1KA 4YBZA 4AW9A 3TG8A 4HLUA 2EKDA 2JFPA 5HUHA 2YICA 2O6LA 3N87A 3DMGA 4ZEXA 2IXEA 4YI3A 2GT1A 2HUNA 4R7ZA 3A6GA 2ZJ8A 1WLYA 4A0GA 1N36B 5IC6A 1WZIA 2YX1A 5LCXA 4BQPA 4PANA 4DT1B 1Q1QA 5L9AA 1VI2A 3G5AA 4L3OA 1BYIA 2M6RA 3OOHA 3ZWMA 1TKCA 2GKSA 2BMJA 1I2MA 1ISPA 1EK5A 3U0VA 4EX6A 3GFQA 1B8NA 1JSRA 1Y82A 3WZMA 3BMOA 1ND5A 1PFYA 1NYTA 1EWQA 3LZCA 4FBMA 3FVTA 2EJBA 1WCIB 3KKZA 1E5XA 3FTCA 2VL7A 5CA1A 1JKJB 3KOXA 5HF9A 3IT2A 3UCEA 5J1SB 2JVJA 3DVSX 3K0FB 1YMUA 5KS2A 4WESA 1U0JA 1XJQA 3ONFA 1E0AA 4WRRA 1PE0A 2WJZB 3A9TA 3ST7A 5DLEA 3PKIA 4QO7A 4EABA 5FUWA 3VYTB 2P0AA 3M4NA 1BW9A 4XX0B 5CTAA 3BWCA 1PVOA 3LT1A 2WJHA 4GPIB 4KVAA 4WY2A 3V1YA 2QBYA 1UCFA 4GVLA 5EZQA 3A2MA 3MYRA 4X61A 2SCUA 2PZEA 2EW1A 5IDYA 4OSEA 1YE8A 4YS6A 1J20A 2HLNA 1XG5A 1KDPA 3K16A 3TZCA 3AUJB 1GGJA 4CDRA 4FTWA 1O6GA 2REXB 3HJBA 3EDYA 3BPSA 4RK1A 3COSA 2MJLA 2OZEA 1L2TA 3HH8A 3N8NA 4ZVNA 3H1TA 2C1EA 2FPPB 3ZWKA 4A4DA 3PXUA 4Z8XA 5CG2A 1ZUNA 1SKQA 1KERA 3AVPA 2J9RA 3ITDA 4ND5A 3EFOB 2P2YA 5CLGA 4QBKA 3CH5A 3NTVA 4K9SA 3SNHA 3ZU6A 2ZRQA 1WB9A 4X6YA 5A0FA 4AS2A 5JEEA 2OMEA 2RBGA 3R7WB 4LFCB 1B4DA 3NASA 1QHXA 2R5WA 4H4EA 2HJVA 4UREA 3V55A 1A4IA 16PKA 1XPOA 5FFFA 3EXHB 4AO6A 5EP4A 3RC8A 2L42A 2PL1A 4UD2A 1S8FA 4DOMA 1N78A 2DUJA 5EEGA 5DV9A 5KOJB 1H5QA 2I8AA 1YMQA 2B9EA 2WF8A 2B2NA 5JSZB 1LV8A 2WK1A 1GRCA 4L07A 2QDXA 3AGPA 3LWBA 1U0EA 2AN3A 4GU5A 1E96A 1QTIA 4HEA6 4S0ZA 3ZYCA 5JHGB 1RZRD 3WHIA 1USKA 4N48A 3KR2A 4N1AA 5FWYA 2VLBA 2HJWA 2YQ5A 2FPMA 4HDNA 1K5PA 3PZBA 3TD6A 4HZUB 5ICGA 2OBNA 4HAWA 2CV2A 1FFYA 3BGOS 4QATA 1VJ0A 4OB8A 3SICE 4PY2A 3WGTA 2FEWB 1GL6A 1VYUA 1KAHA 3OTQA 4I9FA 1IPFA 4TL6A 3JTMA 3JVVA 3FNEA 1MO6A 1LSSA 4N9QA 3X3HA 1TYBE 2C9OA 1EYZA 3SI7A 3VO1A 1P3DA 2GYUA 1CR2A 4BP1A 1E3IA 1P44A 4LV6A 3UNXA 3VH1A 4R1UA 2YMPA 4U6NA 3U60B 4J16C 3CHYA 2AG6A 2JEOA 5A4DA 3CN9A 1VIDA 3H4MA 1ZL0A 1NAHA 1RP7A 1V9CA 3AKEA 4GG1A 1GGFA 1QQ6A 3PNLA 5LZ4A 2D5AA 2JFFA 5E7QA 5C5IA 3MBKA 2H1HA 4MKHA 4B7XA 1UPFA 5IH7A 1Q1GA 1Z3IX 3W78A 2OILA 3S2UA 3SJBA 4CIVA 4A15A 4J29A 5AK6A 3HKBB 4GEKA 4CG0A 3HKDB 2CLHB 1Z4OA 1PW5A 1U98A 2W2LA 3B51X 4ND6A 3WGUA 2JH8A 2X13A 1VKNA 1GIAA 1R4MA 2I3GA 2BT4A 3MW8A 4X8OA 5J4KA 2MMCA 4FS8A 5HYVA 3TO5A 1LA2A 2O7VA 2FFQA 1ECBA 4DG5A 3RK4A 3GEPA 4CG2A 3QLTA 3TL2A 3WBJA 5EJ6A 2XRZA 5J23A 4WAUA 5BV8A 5K0EA 1TUEA 2G8NA 4W5OA 2AQIA 2GBIA 3UICA 1AN0A 1PFUA 4PNZA 1K5DA 4FDTA 4FB4A 5DNEA 2XKBA 1H8HA 3FPJA 1FRVA 3B5IA 4QPJC 1OI4A 1XOIA 4XSGA 3ZUGA 2EFHB 4CQMB 3RB8A 2ZBVA 5AK0A 1I6LA 1OE0A 1H5NA 5C8YA 4JI8B 5B64A 2BOVA 2RBKA 4OMUA 4C6RA 1TMYA 5HUJA 3NWJA 5K20A 2R0QC 1G59A 1S9HA 1GG5A 4GOND 4MWGA 1QE0A 1IPHA 4KOEC 4AX4A 3EC7A 2FDRA 2YRWA 2PTGA 3BL5A 1ZUWA 1ZMXA 3AEUA 1AA9A 4V0QA 4RVOA 4DMLA 4O4LF 4C76A 2AS0A 3SC4A 2FLWA 1DAEA 5KTYA 5F1KA 2OFXA 2OGWA 5IUKC 1Y1SA 2TMKA 3IAFA 1U9JA 3TLCA 1S2DA 3RYFA 3TOVA 1FP7A 3KXDA 3RC2A 4ZIRB 3CNBA 3E5MA 4TL8A 1HQKA 3K94A 1U7WA 3F49S 2ZW9A 3K9FC 2W6MA 3BHNA 4ZO8A 4DUPA 4ZCQA 3SPXA 2WQ7A 5I7WA 2H59A 3I1FA 3MUNA 1IHOA 3A1WA 3N74A 2OCBA 3NTLA 3U4AA 5LFAA 4MAMA 3BQNB 1OWLA 5JCJD 1J1IA 3I5YA 3K32A 2VH2A 1J49A 3EYWA 3UKJA 1AGPA 3GZ4A 1OV4A 3I6QA 4II2A 4LOJA 4YXWA 3LV8A 4CMEA 1IOLA 5KDOA 3EDOA 3OCVA 4R1PA 4V3CA 1FCJA 1G16A 3OZSA 4H1UA 3GUUA 4MVWA 5IN5A 1AMNA 3E6AA 2XVXA 5C5CA 5I5EA 2G72A 3QVLA 4FQ7A 4Q1DA 1R6UA 4PQFA 5H0IA 4MH0R 4DBZA 4GZ5A 1NVVQ 2GN1A 2V5UA 4AROA 1F9AA 1I2AA 1W35A 2QRQA 2RJOA 2AOUA 2ZJ4A 2OCPA 3D4PA 1T0JB 5CT8A 4CCYB 1XRPA 1HETA 3AOGA 3E4DA 1RXEA 1USUA 1XLTA 3Q2OA 2XKAA 3JQ9C 5BXQC 2BFPA 3K9GA 5DASA 5TF4A 4QVIA 1LJ8A 3GQVA 3Q0IA 1ODSA 2I66A 2XBUA 1GQYA 2YMMA 4LE0A 2LCIA 4ZVPA 2O8FA 3NETA 3V4PB 2ZTUA 4WDQA 4MGIR 2Z5VA 2PM8A 5ERYA 2E4ZA 1IXKA 2PKCA 2ZG6A 1RTKA 4O5AA 4JT4A 2X2OA 1YS9A 3JZDA 5IDVA 5I9NA 1JIJA 4QGGA 4TQGA 1H2BA 2QUHA 3PPYA 1LKZA 2XCOA 5SYMA 1IQRA 5CDTA 4M86A 4RV5A 4ZO9A 5BN4B 5T64A 1NSFA 2BUAA 3LNTA 1J5XA 2JIZA 2ZIVB 4MWBA 3VI3B 3U49A 1LW7A 1UBKS 4YRGA 2I7DA 1PDOA 1HYEA 1T4BA 3MUFA 3QPCA 1M9NA 1RFGE 2QN1A 2UVPA 1QH1B 3RT7A 1U2GA 1AHHA 2QLLA 3UMJA 4BNFA 1X9IA 3UMVA 5F64A 3HP4A 1UF9A 4MGHA 4A8PA 1QYIA 3GRKA 2FRDA 2CNNA 4KLAA 5EYPA 4E5YA 5DYNA 2XXBA 4B3IA 3AIKA 2I0FA 2YIDA 3LOUA 3E84A 3PGMA 3V80A 3ERCA 1HZJA 2VZLA 4DUGD 1YCDA 3AEXA 1RWXA 5NULA 3L84A 4PWYA 3ZQUA 2AF3C 2VSOA 2IF2A 5ECDA 5TNXA 2QMEA 4I19A 3V4SA 4OMCA 3VOTA 5KYYB 4C0KA 5CDHA 3L0SA 1NMXA 3GJ0A 2CMGA 1LLQA 4XYEA 4LI3X 3U61B 2NXNA 3WYFA 3KEFA 4KXQA 3FUCA 3TI9A 1XP8A 1SCBA 4JODA 1MV5A 4KIJA 1JE0A 4GMGA 4MIKA 4JLBA 4TV8A 5GGXA 3VR5H 2C42A 1Z6PA 1EEHA 2RI0A 4YJDA 4A0QA 1JFRA 4LHZA 2QXYA 5HBRA 1CJSA 1PQUA 3RK1A 1KJQA 2R44A 4L4SA 3GXBA 5EXXA 4CR6A 2HA4A 3A58B 3MSCA 3UJAA 1TJ5A 2R62A 3AR4A 3H0EA 3PQ7A 3EWNA 1JBQA 3GNTA 3OD1A 1V4BA 3IA7A 4LWPA 3BGIA 4AWXA 1E77A 2AYYA 2YMQA 5FUBA 1FDWA 5JU6A 1HOTA 1T24A 1UC5B 5G53C 2HLHA 2V6BA 2Q7DA 3U56A 5KYVA 1HFJA 1W76A 1U2TA 2B4QA 4U2EA 4EMUA 5AIBA 2INGX 5HE8A 1HLFA 1TVEA 4X91A 1FS6A 1W25A 1E2NA 3E7DA 1QM5A 2SKDA 1GITA 5ALLA 3TLGB 5AW4A 2JLBA 2PV0A 1QK5A 2ZJ2A 3BIFA 1I8TA 3TSWA 3NLLA 4WJZA 1SQ5A 3D0RA 5H9WA 2C7OA 1ISGA 4JQSA 3RANA 2WJ4A 2P40A 3VYVA 1AV7A 3ZV7A 2YDXA 4DLKA 4ZYLA 1FVOA 1TT5B 2KLBA 1NW9B 1AQ6A 1OIVA 3L82B 3O93A 2YZMA 1LK5A 2YWBA 3GJ3A 4UCFA 4HVCA 4G2TA 4B8YA 5H59A 5D7BA 1Y3IA 3AFNA 1KH2A 1QRRA 1V37A 5F5LA 4ZA2A 3U4DA 3UKOA 1KJWA 3IKJA 1C7EA 1RWOA 1A82A 1HTBA 4AMZA 1ZH0A 1W36C 3WLOA 1WQ3A 4KGXA 1HEIA 3FH0A 3UMFA 3PTAA 1IAQA 3DSRA 3S8YA 1SXJB 2C9YA 1DBSA 3DZKA 4KP7A 1GUFA 2IV7A 1NJ6A 2OAEA 2JJ2D 1JLLA 1LI7A 2BEUB 2NZJA 4F1WA 1U8AA 3NHAA 4EY4A 1UFQA 5DX1A 5BNZA 4DIMA 5J63A 1H6BA 4HAVA 2WG1A 1YR2A 2GJKA 3IC5A 4GPZA 3ZLUA 1PGJA 4HH1A 3NH6A 4MW5A 2VAVA 2XMGA 4G97A 5CW1A 4QOSA 2AV6A 3HB4X 3G88A 3CZ5A 1IRIA 2V7QA 2QTMA 3M82A 4PPYA 4XWGA 4Q9JA 3RVBA 3UFXA 3VDQA 3L0BA 5GWXA 3E9CA 1P4GA 4RNDB 2V9CA 4Y2SA 4OOFA 3FYUA 3TNLA 2QUBA 1X1SA 1XTTA 2IXBA 2OXEA 4RVUA 5H80A 3B52X 1IXZA 2P9YA 2V55B 3OM0A 2V03A 3P9CA 5FTLA 2YY5A 3G0HA 1WIWA 2JJ1D 1Z0UA 1EX7A 1I7NA 2O2GA 4BNIA 4GYYA 2VXBA 3GR6A 2ZBUA 4ENPA 3OQNA 2R4TA 1F60A 2WINI 1FXWF 1RWNA 2C59A 4A5SA 3AF6A 4XR4A 3FHCB 4WQMA 3LPCA 3ENVA 3WLRA 2P27A 3OCWA 4DILA 3O90A 1L7AA 4AMUA 4KBGA 5C8DA 4UARA 3ZQKA 1FNMA 2YJ3A 4P6VF 4EVSA 4ZOLB 4FGWA 1HKUA 2N9UA 2PPLA 2RGCA 2FOLA 2YWHA 4LQCA 4PHFA 4V0MA 4V24A 2ZCUA 3AF0A 5CH3A 3TRKA 4B84A 2AJTA 1M10A 1BRMA 1HWYA 1XU7A 1YIDA 2G80A 2NGRA 5H82A 3CUWA 4CU5A 1LVHA 3A4NA 1YFKA 2SBTA 3IEXA 1NNEA 3C5VA 3KE8A 9MHTA 4LQDA 4RLSA 4AS3A 5JSFA 3DTNA 5EZYA 5GAJA 3EZGA 4JCCA 4P2BA 4M8NE 3ZH2A 3TBFA 4ENSA 1THTA 2PZBA 4EZIA 3H2IA 3M2PA 3OMLA 4GP6A 4WXPA 2ZDHA 1CUDA 4MS3A 3L43A 4RORA 5SZKB 3VR6D 2RE8A 3ITEA 1XDUA 3HACA 5EJ9A 1XFDA 3MBOA 4HNGA 3JYPA 1PHRA 2DQYA 1PT5A 4BX9A 1I5EA 3F2VA 3DE4X 5BO5A 5FPKA 3OF3A 2NU8B 4X71A 3QKUA 4ARIA 4CQMD 2YXBA 1L5YA 3B38A 1Y9ZA 3B9PA 4K46A 3L40A 2IL1A 3FB4A 4UUPA 4ALMA 4L72A 3ILHA 4K1LA 3RABA 3REFA 3LCMA 5K4HA 3SKVA 1CUXA 1H3EA 1KIAA 1MEEA 1V95A 1WDWB 1TCVA 1F0YA 2BHTA 4AYWA 2NN3C 5JVDB 3GJXC 4K26A 2FGJA 2HXYA 1AXEA 2OGUA 2W8BB 3CVJA 4UM9D 4ERNA 2PUBA 1OX4A 2A5YB 2X15A 1G55A 2X5XA 5EIFA 4UC0A 1V6AA 3NWBA 3PDHA 4TYQA 2NO6A 3Q98A 1F48A 1FW8A 1UM9B 5E8RA 2D1QA 3FLMA 1UZLA 2RK6A 5EP1A 1TK3A 1R18A 3A32A 3JZMA 4XYLA 4MR9B 4IZIA 1QYVA 1V47A 3OEEA 2HK6A 1RU3A 3TNJA 4NJMB 4QUJA 3WSTA 4RPIA 4AJ9A 4K9QA 1OAAA 4YCCA 5LLTA 2EFCB 3BH6A 4EL5A 3ZLBA 3ZE2B 4DFDA 3CIOA 4QNMA 1EVEA 1E7YA 2H2HA 3IKMB 2YC2C 4I3FA 5FBLB 3C3PA 3N86A 3M89A 3FMGA 3BOSA 3OLXA 3HKCB 1S2NA 1OB5A 3D2AA 1CDOA 1EFPB 3PI7A 3DNPA 2QZZA 2JIRA 1Y0BA 1HE5A 4YT8A 4R9RA 4RVFA 4R4JA 4E5NA 2FEXA 1W85A 4GQIA 3I09A 5CEFA 3LOPA 3R5KA 5H70A 2Z4RA 2CLEB 2G5TA 1M7BA 3HO6A 2WTMA 1N6NA 1Z26A 3O8DA 5CT6A 5GZ3A 3O0TA 2LTAA 3M5WA 5F5NA 3FGOA 4KFTA 1E2UA 4AU1A 1DKPA 3PQ4A 4YJ3F 1N7IA 3B3AA 2QVGA 5TR9A 2WILA 5DGIA 1J33A 4ZT7A 1M67A 3HY3A 2JIMA 3U7QB 1NR7A 2OV4A 1E4EB 1G8YA 3BXXA 4D9MA 1G6OA 4ZI7A 3CINA 2UXBB 3VNAA 1GCAA 2BR3A 1R0BA 3QVJA 4JI5B 2BMAA 3OD5A 1G19A 3MBIA 4C4OA 3QOFA 3TNFA 4DM7A 4DLLA 5IAAA 3SR0A 1ES9A 4YT4A 1M8GA 1OAOC 3NR2A 3QMMA 3IUNA 3RF6A 1K0UA 1FRZA 3PHBE 1TM2A 4MUEA 3B20A 3VISA 2PKXA 4BLRA 3S2ZA 4V0OA 5JXHA 1SQGA 1CY4A 3BE5A 3TUZC 1GG2A 2A0WA 4Q1EA 1CDZA 3ZTWA 4MTLA 2JH3A 3ABZA 5DNCA 3ABQB 1IJEA 1KMIY 1KEKA 1IQPA 4UTXA 1BH2A 2AX4A 5A4FS 4UDYX 5BW8A 4MWTA 2AT1A 3BK7A 2XB4A 2J0UB 3GVPA 2VO1A 1UQTA 2W43A 3KD3A 4QD3A 4ZK6A 4E33A 1E99A 2B69A 5CBPB 2CXXA 4O4HA 3CJTA 3B9RA 3ETNA 4Q3KA 1RT9A 5E9AA 1XYVA 1MABA 2W9XA 3REQB 1UZMA 1P4SA 3A70A 4YP6A 5U4XA 3M49A 1PJSA 1A9TA 3D0KA 3UHJA 2GILA 2YWGA 3K7EA 1QHFA 4UM7A 3BCHA 3JARB 4G5HA 5EP3A 4CMAA 2FR8A 2G25A 1KKMA 2J3IA 5REQA 1CY8A 2XRMA 1ZI6A 1GN9A 4UAJA 1J1ZA 4ACAA 5CJJA 3HM2A 1SGWA 3GA7A 1IY8A 3GCWA 3ND5A 5EJ2A 1QQBA 1XZ8A 1K6JA 2XF2A 4OHPA 1ADJA 2O7RA 2R6AA 4YMWA 3JQRA 5EMJA 2JJYA 2ORIA 2HFKA 4WUVA 2QAGC 4NMMA 4QLOA 5A1TA 3N3BC 3NWEA 4QX6A 5E4FA 3PUHA 2O8DB 1UOEA 5D3KA 3U31A 2ZYUX 4YAJA 1Q22A 4W5TA 1E2KA 1SEVA 1R6BX 2CVPA 4M89A 5SY4A 4CFYA 1ZGHA 2W90A 2XDQB 3EA4A 4E09A 2AJLI 2X8BA 3LUHA 3NDPA 4F2GA 1CR1A 3I30X 1DAKA 1VPTA 1TX4B 2XRYA 1NHWA 3C6YA 3P45A 1CS0B 2VNIA 3QJ5A 3WMWA 5GZ6A 2O2CA 4XARA 3L0PA 2RHHA 4DHWA 1SZDA 4MPTA 4JGIA 1J42A 3UANA 3VNQA 1UBOS 4BNYA 4YXFA 1LDEA 1GDHA 4ZQEA 1WNTA 1T6ZA 1EVKA 3PQ8A 4JXJA 4TVBA 3UO8B 1R6TA 4KWHA 3X1YA 1QCCA 1XEAA 2N1BA 4BNDA 1HGXA 1Z16A 2OHOA 2YQZA 1BMDA 3FRIA 4XDGA 1NFRA 3M4JA 4TTJA 1YJQA 2FMFA 3M9LA 1O9GA 5ECGC 1SK9A 1YWGO 3SFZA 3ORFA 4MQFA 3QHAA 1EWTA 2I4TA 4V0ME 4BYMA 1JLSA 4S12A 1FF9A 1WAMA 1KBQA 1YD7A 1OXXK 2DPLA 4NULA 3VOBA 4M0FA 5DXJA 2DEUA 1GWNA 4HQNA 1WEHA 1KDVA 2DR2A 2C7RA 2PKRA 1E6WA 5BVHA 3KQWA 4O2AF 4ZQGA 1VE7A 1F8XA 4IEEA 1DO8A 3SBEA 1XXHE 3AU8A 3RS0A 3S2SA 5LDDC 5LYJB 1FQOA 3C48A 5EJAA 2W4MA 1H6AA 4FZ3A 3C3CA 3RAFC 1VKZA 1YUNA 4WGGA 4UHJA 4XWTA 4CCSA 3AY6A 2ZS7A 3DA8A 4JDUA 4LVNA 3RVPA 3P9NA 4DA6A 1SKMA 3DZ8A 3QF4B 4FFBB 1RXIA 2X23A 1BHSA 4NZNA 2CK3A 4TT3D 2CLCX 4FLFA 4BEWA 3NZEA 2WD7A 3IB6A 1UFKA 1XD2B 2H2GA 2HJRA 4LVUA 3KEQA 1ZWLA 3EVCA 4OO3A 4NV1A 4RA6A 5L45A 5JJLA 1GTG1 3OF5A 1Y8RB 4LYEA 2IKQA 4UNSA 1SBIA 2J30A 2V7UA 1FP2A 1IC6A 1AGRA 2JBAB 2AFIB 2QSYA 2WIFA 3I6YA 1DQYA 2HSZA 4Q9AA 1PYDA 2ZRJA 5LVAA 3TL3A 5CM9C 4ASUD 2N75A 4XWWA 3H1BA 2JHAA 1N6KA 3K53A 2B82A 1U1FA 2J8ZA 1DKQA 3U3DA 5DYIA 3CNQS 3V97A 3TLEA 2FPUA 3IQHX 1TJ3A 2A57A 1U3WA 3E03A 3WL5A 4AXXA 3LW7A 4HFRA 1U3TA 2J9GA 1Y8CA 3H99A 2ZB7A 4FMDB 3RUAA 3TSOA 3VTZA 4MQBA 3VU3A 3KS9A 3CSSA 4XGRA 1Y4UA 1Z6GA 3LC2O 3CLKA 4Y1GA 4EG3A 2C3YA 3A1DA 5A2QA 5KBYA 2VRNA 4M0KA 4QE3A 3HLKA 1JALA 1PGNA 2DPYA 4WBSA 5T4BA 4CLRA 2W6IA 2H85A 2IPNA 2IPAB 1E1RD 2PWZA 4Y0VA 5DNWA 1U63A 1OFGA 1UP6A 3U44B 1LBTA 4B4OA 4BO0A 4BAZA 5FA6A 5FV7A 4IGKA 2WNHA 2D5LA 1Q7GA 1BCRA 2Y0CA 1C7FA 3I9LA 3JSAA 3K1TA 2FFHA 3UMGA 2XYVA 3AHJA 3IEPA 3R3HA 5D84A 4ARBA 5TQ0B 2DFDA 3A1CA 3KO8A 1Z29A 2IODA 2AWNA 4QNNA 2CHGA 2LGJA 4B4VA 1HE4A 3QX3A 3MMXA 3DAFA 3BWEA 3AEKB 1UPCA 1Z7EA 2P6NA 3PXBA 1Z13A 4A1FA 5JS8A 3GFPA 5JD5A 3DLPX 3EXG2 1CRQA 1F14A 3FDIA 1EM6A 3ZVMA 3O4JA 3TVYA 5L4LA 1QYXA 2HV8A 4V39A 1WPGA 2V1XA 1CQWA 3ZEAA 3DMTA 2XCLA 2Q0SA 2AQ8A 3FFWA 3OZVA 4YUZA 4YJ2B 1DCMA 1KH3A 1NJ1A 1IMJA 4NICA 4RVNA 5GV8A 3AVWA 4ZICA 2IUTA 2WT8A 5J4YA 2GXAA 2HNBA 1ULBA 2VHTA 3KOZA 1O9BA 2GZSA 1RI1A 5T7BA 3RFTA 2X86A 4WSOA 4AQYB 3QVKA 3OLQA 4D7AA 2Y68A 2JFNA 4O4JB 4IXTA 3ZEIA 1ZN9A 4FEGA 2QAIA 5K3BA 4RTLA 1YMVA 2DQ4A 4KE9A 1EESA 2CE7A 1NATA 4H27A 2Q9UA 1A9ZA 2ZJ5A 1K92A 3H2SA 1WRBA 5EE0A 5LMUB 2GPAA 2AG8A 3E23A 5EWLB 1KZ6A 3ROTA 1WU8A 4D96A 2NSDA 1H8ED 3JRNA 3LXRA 4MA0A 3RIGA 3GT3A 3IJRA 1HDIA 3R0QA 3DFIA 5KYUA 4Z86A 4YB8A 5HGXA 2EZTA 5LR6A 1MBZA 4TYNA 3EDQA 2WJYA 1UKYA 2P9HA 3ZIAD 1PV1A 5DO9A 3HXPA 3JQAA 1JFLA 1KFCB 3B6MA 4HPJB 4HTFB 3V8EA 1MZPA 2HW8A 2G9UA 4ZDWA 3QU2A 1KZHA 2DHCA 2Z0MA 4WXHA 2BJWA 4AUNA 1PFVA 3R40A 2RDMA 4X93A 1QFJA 3PNVA 4AUEA 3GLTA 1Y4DE 3MTJA 1I7DA 1PEAA 1G8MA 2R85A 2W42A 1WBDA 4DNQA 3WB1A 3NHUA 3SQWA 5T41A 3Q9SA 4DUZB 1TAQA 1XRRA 1WY7A 4MQ5A 1FDSA 5JNRA 3GLGA 3D0OA 5AHXA 3T7RA 3WTCA 3AL0C 3CH4B 1SR8A 4ADSG 2H54A 3AI2A 3JQ8B 1Z0ZA 2MDTA 5BVGB 1T1SA 1JJVA 3RNOA 1OD6A 2WU0A 1I14A 4NH0A 4HYTA 3FLEA 4Z0PA 2FMKA 3WVNA 1YRHA 3ZGLA 5LNK6 2OFPA 4XTRA 1Y3FE 3N2YA 3D7RA 4X64B 3ZY5A 2FPLA 3CW9A 1AKQA 4ARZA 3D2LA 2VJDA 1QOPB 4YUVA 3ANXA 4G25A 3KTOA 3W7AA 3KVYA 4IKEA 3GXOA 1P4HA 2JLCA 1A7AA 1REQA 5FKJA 4DQ0A 5IHXA 3DOUA 4F2DA 1JEYA 3MELA 1TAHA 3KHUA 3EB9A 4IDFA 1F1BA 3H8SA 4QHTA 5I01A 4UQOA 2UZ0A 1P6XA 2IVFA 3D1JA 1PTKA 3KX2A 4C0LA 1XU4A 4WZAB 4Q9NA 1ZD2P 4PHCA 5B1HA 3OY7A 3EULA 3KYDA 3UATA 3EIWA 1FSZA 4YLYA 4ENRA 3DZFA 1N33B 3H1AA 3A7EA 2J3KA 2O5EA 3IJEB 2Q29A 4KUHA 2H7CA 4DCGA 4EECA 4ZDIA 5JI2E 4KGDA 1RM3A 2IPOA 4BX8A 4DCJA 2BBOA 3LQ2A 1KY2A 1SWWA 2V96A 4AKSA 2I3ZA 3SIRA 5LQNA 3EXIB 1T9GR 3SZLA 2O8VA 3DNMA 4JBNA 1OHHA 1ZGZA 5EMNA 3AETA 1U8ZA 2XSZA 3I76A 3KZOA 5CJ2A 3BXHA 1SKYE 4M38A 2F9MA 3KYJB 4KNVA 1VJGA 4TTTS 4IINA 4ZOBA 2PZGA 5AVUA 3FCOA 4IIJF 1W2WB 1A8IA 2ZI6A 1WSBA 4YALA 1GEEA 5JXJA 4JEUA 3LA6A 2JLZA 5JWRA 3VPDA 1E3MA 3GFTA 5CH8A 2P2ZA 2IHKA 2RGDA 5HJEA 1GAJA 5ARDA 2JG3A 3SKYA 6AT1A 4J90A 4P4SA 5AKHA 5JO9A 1FP6A 3LWNA 3D6FA 1FSGA 4CQNA 4I9NA 2OENG 3EIUA 3UJ3X 4A2WA 1SVIA 1Y8QA 5GMOA 3PFGA 2ZZMA 4HNUA 5IHPA 3WYCA 2XHZA 3EGCA 1JIQA 4ZV4A 2JAQA 4ZVVA 4EYKA 2Z8XA 4ZPXA 3O7WA 1EDZA 2QN8A 5AXBA 5AW6A 3C24A 1ZYUA 1GYQA 1MA0A 1XL0A 4KAFA 5K45A 1N2CA 2VT2A 4TVOA 3Q3CA 1FXUA 1LSUA 1BGWA 4LY3A 4KR3A 2XT6A 3DO8A 1XI2A 2ACVA 3PGLA 4R6WA 4ZDJA 2PT7A 2QN9A 5LNK1 2PZKA 3MRSA 4CLOB 3QJGA 1VG1A 3N53A 5AI6A 1YJBA 1WE2A 3GC6A 4RXTA 2PRIA 3VR2D 2D54A 2AG1A 3D59A 4V2IA 4ZHQA 3WB0A 3AM5A 1FS5A 3EW9A 1M33A 1F4LA 5DOZA 2Z6VA 3VOSA 5JRJA 3FIUA 1CERA 3VI4B 3SR4A 4MEAA 1OT3A 1TAUA 1O5OA 2WSBA 4KMSA 1WU7A 4Q6WA 3CF6R 3KE9A 1YZGA 4C4ZA 5B57C 5IJ9B 1FMJA 1EWRA 1G9TA 4ECEA 4PSUA 4PONA 1DEKA 4N5HX 1P5HA 4IXMA 4LN1A 4ZVMA 1QOZA 1MTOA 3W5DA 2ZXFA 3C87A 2P68A 2P9EA 1CUGA 4NE9A 3TQCA 5MFZA 1ESCA 1F6WA 4M88A 5DTEA 1O95A 1Z45A 1M1XB 3KG2A 1LPOA 3AB3A 1BA2A 5G4KA 5HEKA 1NDUA 4WECA 4XVCA 1MRNA 3LX5A 4HDMB 1YB1A 2H8KA 2HH9A 3HXKA 4R1QA 5IFKA 1A8QA 3IT1A 4MKFA 3C8DA 1XEWX 4GBMA 4C7BA 3I9V6 2UZ4A 4J2HA 2R1UA 1I2ZA 2WA2A 3EDRA 4G41A 4IIBA 1L3CA 2PYZA 3Q5DA 1GDTA 1K89A 3DEKA 3T9CA 3UV7A 3FHTA 2WFLA 1EG7A 1QQ7A 3PQ6A 1C2YA 4QWWA 3EC1A 2OO3A 4FS3A 1YZKA 4XXHA 1TM5E 1Q50A 1PDVA 4R83A 1EWVA 1PJRA 2FSGA 3BREA 4Q0MA 4MWZA 4PSVA 3QXSA 5A9TA 3LHFA 5LKAA 1BQ3A 5DH9A 4PLGA 2PWYA 3MOSA 5G4LA 4E5PA 4ENUA 2BMEA 1E1CB 5KI6A 4WCFB 1G7SA 4B2PA 2BLNA 1H1DA 2ISQA 1JHYA 3UB4A 1KE2A 1KAMA 3TZHA 2Q46A 4ZAXA 4U9UA 4AYTA 5CB4F 2NZYA 3IPLA 3U26A 4WZBA 4B3BA 4F8YA 3AP2A 4UEWA 3GRCA 3H7IA 4B4WA 4BNVA 1M6NA 4B0PA 1QGZA 4CU2A 2Z9DA 4QPZA 1X19A 2Z43A 2RD2A 2WVJA 4HAXA 3M5CA 4BZQA 1C81A 4Q4HA 2D4HA 2ZRKA 1K6EA 4FNMA 3PC8A 4C6HA 1FXSA 1EP9A 2IJGX 3EGDA 4G0XA 1PJTA 4ZC8A 4JI3B 1USVA 5JOQA 2WMOB 1E5VA 2FAXA 2YFHA 3S0JA 2B1IA 3UH1A 1HX7A 1FDVA 3K2BA 1JXMA 3VZSA 3OHMA 4PRKA 5FEMA 5K0SA 2PUEA 3DE1X 5M34A 2B61A 1OW3B 1T2UA 1KOFA 4KXVA 4MKRA 2CEKA 2EYUA 2Y1OA 2Z98A 4JUIA 2C4TA 3X2FA 3UV6A 1K8ZB 3GD5A 1MJGA 1VGQA 1NONA 2HV9A 2PDAA 3QEMB 1NN1A 5KOYA 2NYVA 3K2IA 4RVGA 3QA3E 2QRPA 2UUBB 1UP4A 3HWRA 5JYDA 2QMUA 3JATB 9LDTA 4QDXA 3A9UA 3THRA 2Y71A 1Z8FA 2UDPA 1WBJB 3EGOA 3IH5A 4CT5A 2XWJI 4HQ0A 3W5AA 2E5LB 4EEZA 2VF4X 4J91A 1GCOA 5AUPB 4F60A 3IDSA 2GVZC 2J41A 2AD5A 2YASA 1PKEA 3L02A 4B74A 1KE1A 2W2XA 5FV4A 4EUSA 1RCTE 3HTXA 4L16A 4WK4B 2VDPB 3KL4A 1NBOA 1WULS 4OQDA 2FW8A 2I62A 4RFSA 4X1IB 1G4AE 1CETA 4FPXA 5MDHA 4LIPD 3TTXA 5CW2A 3MWGA 4BB0A 4FJ1A 5TB5A 5DN6A 5CVDA 1ZG3A 4C30A 4CGYA 1UAYA 2VPQA 4EI7A 3WQRA 3ESQA 3CR7A 4MWCA 1YI1A 3TEFA 1WXHA 3V00A 4BO5A 3V2UA 4D0NA 3UMSA 1T3TA 4WACA 1WPXA 4GICA 4M1OA 5EXSA 3T3MB 4PG8A 5F9MA 3QHPA 3SX4A 4LF6B 2GESA 2BPOA 2X2EA 5C1IA 2PX6A 3SIXA 3WI7A 2VYVD 1ANKA 3CY6A 3WR5A 3E8XA 3HBJA 1RMQA 1FPQA 1MDBA 3AR5A 2PLFA 4G4JA 4HN4B 4Q24A 4PIVA 3LRTA 4QDJA 2FWJA 2XOEA 1LWNA 1A3CA 3I5XA 3RAGA 5EHXA 2VNJA 1F2DA 5CA0B 3BFPA 1VCMA 1N2OA 3M83A 1MC8A 2P4QA 5LA6F 1AQNA 3A3KA 4JELA 4EB6B 2WZBA 4DYVA 2H7XA 4KHPB 3JPYA 3DE3X 1GN8A 4P35A 2UUOA 1EE2A 1VL1A 2KM1A 4FM9A 2XMQA 1KI1A 3KFXA 4OGWA 5C35A 1N2CE 1NMEA 2GEUA 2M9MA 4U2BA 5GJVC 4EYEA 2H7YA 1VMIA 2GUWA 1P81A 2O3SA 3BEDA 4BQOA 3IVAA 4MWEA 3ER8A 1SJ9A 2I2BA 3AKDA 3CCCA 5LP6F 3T5AA 1P18A 4XIYA 3QV1A 1H1LB 3ED1A 3IRUA 1RWVA 3H5VA 3RFCA 4WVFA 2LKDA 3WIBA 3EUEA 1BDJA 1XEFA 2Q5IA 5GONB 4KX5A 3CLUD 4FHFA 3TZBA 4B9AA 1ZJWA 2VA9A 4GLOA 2V58A 3P9QA 2CHFA 1K4MA 3LTNC 1PO7A 1KK3A 4WFIA 2Y1FA 4JJFA 3AINA 4HXEB 5F78A 3QEBZ 1Z6TA 3BCRA 2HZBA 3IBFA 4Q01A 1U0FA 3ZNPA 2HDHA 4EJ2A 5K1ZA 3AHEA 5I9SA 1EBUA 2EF1A 4L85A 4JBYA 3DM5A 2IEDA 4TWBA 3RHZA 4I99A 2Q4EA 2B1JA 4KPUA 4U7PB 2V7VA 3JQPA 1QB8A 3ZHSA 1YQ9A 4PSAA 3UZUA 4HVAA 3PKJA 5KO2A 5D5HA 2F3UA 4KOAA 1DTEA 5A06A 2DULA 4CEHA 2DBQA 3T5BA 4WKCA 4F71A 5ILOA 3E0QA 3AKYA 1QE3A 3AF4A 3NX4A 4QDZA 3OE1A 1FQWA 3TKLA 4RHEA 3V46A 4DEXA 1DBPA 2VJYA 4TYYA 4M9XA 4TXHA 1MXHA 2TMYA 1DFGA 3B3FA 2CC2A 2NWQA 3EPPA 4RD1A 1QP0A 1X1RA 2UXCB 5CR9A 4OCZA 1M6YA 3RD5A 3QUCA 1I7LA 4CM4B 2BGIA 5HVNA 5DM2A 3RTGA 2UZ1A 1HE8B 3SGLA 2IHBA 1FYWA 4I1IA 3L1IA 1OTHA 1I1HA 5KVCA 2NLOA 1LNQA 1PWEA 2DPXA 2RGUA 5IX8A 2H4ZA 4WEOA 1E4YA 4QGSA 4I9GA 4ISCA 2CJFA 2PYDA 1GFIA 4ND8A 2CL0X 4X85A 4I46A 1XTUA 3OLZA 3KQSA 3S28A 3OCUA 3WYEA 1MW9X 2IYYA 2CVQA 1YDWA 1PX0A 1V25A 1E2JA 5TVGA 3ZU3A 2RK4A 2XB9A 5KPDA 4MHTA 1KSJA 4Q9KA 1BN7A 4BNZA 4JFRA 1E2MA 5U9CA 4D46A 3UJ9A 2FRVA 1CUYA 1I80A 2ZE8A 4WZBE 4R68A 1N6HA 1RQNA 1JB9A 4GYKA 4KXWA 9ATCA 4F93B 3FVQA 3K0SA 2QDKA 1T2EA 5ESWA 2O23A 2D7CA 3PC3A 4R8VA 3TLBA 3ZDEA 4OV6B 2WB2A 3N7AA 4IQ0A 3ROXA 3M9WA 5C8XA 1Z33A 1UUFA 5BYAA 3FDJA 2Q1YA 2Q6OA 1ZU5A 2XKJE 1JI3A 2NU6B 5E9JA 2QVLA 4GNKA 4URXR 2DG2A 2IU6A 2VTKA 5DI3B 3JQFA 5I4IA 1ULSA 2NPIA 1E1LA 3DQPA 4P7BA 4KXLA 1T9ZA 4JBIA 1G9XA 1X13A 4FMCF 4LHSA 3V8MA 3WHKA 5F2NA 2I7TA 3DCJA 4Q4AA 1DADA 5K4AA 3VJLA 4Y9UA 4DG9A 4NL4H 1NW7A 4AT1A 4BJ6A 4O3FA 4BKMA 4MDEA 2GXUA 1NM5C 3QKWA 4OKIA 3RSLA 2QT1A 4DMMA 5K6AC 5KVAA 4RKEA 2H8GA 2XB8A 2FETA 4CKZA 4IGEA 1ELOA 5HHTA 3B9BA 1QK4A 3EBPA 4C7JA 4WNCA 4GBED 1XALA 3SYKA 2R7MA 1EK0A 3WLEA 4YQFA 2ZTLA 3UK0A 1TK2A 1EFTA 1DHTA 4QUDA 1VL2A 3LBHA 4G8DA 2REQA 4LZWA 1NVTA 2BGUA 5J59A 3QVVA 4KH1A 2XYHA 3DTVB 3VR5A 3Q88A 2PSJA 2XA9A 3X1MA 3ZD9A 3R7FA 2R8EA 5AHOA 5ELLA 1QHIA 4LXIA 3CXRA 5FYDA 2BCJQ 3C85A 1H4SA 4BE4A 4IH1A 2XVMA 1BFDA 1DFIA 1AIPA 4G5FA 2Z04A 2VNHA 4HGZA 2VK8A 1PLLA 1YOVB 3WLIA 1JMKC 4FGJA 1G9SA 1P7PA 4ZJPA 1T5OA 1I33A 1NUQA 1W9HA 2FMHA 1TNDA 2OK8A 1BO6A 1WDMA 2X9VA 3BDIA 4J6EA 5E7IA 1NJ5A 2ANBA 3G7NA 3JVDA 4RK0A 5CHEA 3DH0A 3ICWA 2WHYA 1XNHA 1Z2EA 3CZMA 4I9UA 3PSHA 4JUBA 1XRJA 3MRTA 4FDMA 3TXAA 3U39A 1N7GA 3KU4A 3D2BA 1PZNA 4FHCA 1MX1A 3GEIA 3UAOA 2OFFA 3EEIA 3PT5A 1K27A 2QD4A 4IMPA 4I3HA 4DPKA 3FOWA 5IM5A 4GRAA 1A95A 1E2PA 2CFCA 2J5QA 5PNTA 3AVTA 2IUYA 2V4MA 1M5TA 4R7TA 2HPHA 3RAJA 4QODA 3R9XA 1K5GA 3ZR4B 1CZOA 4A2PA 4YAFA 3DEZA 3L7CA 4QVGA 1Z4PX 3JASA 1MJFA 2J9FA 2ODAA 2QP3A 2G28A 2GERA 2CYCA 2OCYC 4HQ6A 3VO9A 4GOMD 3Q2IA 4KQKA 4XWAA 3CC8A 3SHFA 2OT3B 4BQRA 4D80A 5JAPA 3FDFA 4L28A 4XGKA 4CKYA 1JFVA 3WA7A 2IEGA 1DEAA 3VR0A 4AZ0B 1B16A 1RLUA 1NYQA 5KNDA 2H1SA 1CNMA 1W36D 2YY7A 2QPAA 2XMCA 3KT6A 2IKSA 5K8LA 1ML3A 3WMRA 4HLDA 3B1YA 1XUOA 1FLNA 2IDKA 1JDBB 1PNQA 2NV0A 2HDOA 2OECA 3GZNB 4D3FA 4YRBA 5IG2A 1Q0UA 1EVQA 2G6TA 3CPSA 5KVSA 1VPWA 2IELA 4NQRA 4X1KA 3KAKA 2BZGA 2H4HA 1QRSA 3OIFA 3AOEA 5HJ2A 2VKQA 1XA3A 3GUHA 4J03A 4MV0A 4NFSA 1KK1A 3CONA 1A7KA 2VS1A 4QBTA 5SZJA 4LISA 1O94C 3U7HB 2JGDB 2E2WA 2ODNA 3EPHA 4JLKA 1QU2A 3RYCA 2QMYA 4P83A 4LE2A 1JF8A 2QRKA 3JYHA 3S27A 4X62B 5FL7A 3VTAA 4N0QA 5CLLA 4IOMA 5CT5A 2HU7A 3AESA 3S2EA 4OXRA 2ID8A 4KWEA 4UOQA 3V33A 3K9QO 4L74A 5CITA 1YRAA 1IVSA 1P0MA 3KSAC 5TJ9A 3RC3A 5KYXB 2Q5LA 1IONA 4ZGBA 5DDIP 2GUGA 2G5PA 4ZU3A 2ECOA 3WTBA 4YMVA 2FEOA 4LCBA 3SJUA 4YO7A 3K09C 4FGKA 5HS6A 3JQEA 4AJ4A 4CLHA 4GKKB 1YZYA 3JQ7A 1N34B 3VRHA 3B7WA 1QGUA 1EUCB 1YZLA 4X5OA 5JYCA 1PJ2A 1WUHS 1L5MA 2HBZA 1GV1A 2VK2A 4G1UC 4H7JA 4JAVC 1OBVA 2ZE7A 1PT8A 4DVJA 1GCGA 2EJTA 1KZ7B 4P5PA 2B8TA 4QUBA 2XEDA 4ZEMA 4TWZA 3UGQA 3OY2A 1XDZA 4TYPA 2CW5A 4ALIA 4DBLE 1L5WA 5I9LA 3I6BA 1NV9A 1JQLB 3KKOA 2C9MA 3V34A 4N3NA 3QXJA 2HDNB 3A9SA 3SBOA 4CEJA 4DQDA 2ZUBA 2JI4A 4M46A 4B3CA 2P2CA 3IILA 3FE2A 1L5GB 2CF5A 1PYGA 4C9BA 2H00A 3D6MA 4GT1A 2ENWA 1E0JA 1X38A 3MYYA 5DP2A 5G1NA 2ZSBA 1FU8A 3C3YA 4M53A 3WV4A 3G9UA 2LCQA 1U9IC 1KYZA 4CM1A 2H1RA 3EIXA 3GH3A 3BEOA 2CVHA 3OPMA 2NXWA 4LJSA 4LXTA 2EATA 3RIEA 1XBTA 5DT2A 3VVMA 3O4FA 2IX9A 1ZI8A 3HCFA 1EINA 1BS9A 3G5MA 4PLZA 4YQZA 4DE5A 5A5GA 2R7NA 1SC4A 2CNLA 1ZJZA 5FA8A 5FQNA 3WNQA 4OHUA 1TL7C 2ZIAA 4RM2A 4LDJA 4DIDA 4P7KA 3N7TA 4G37A 3AJ8A 3HDJA 1OTYA 2P5TB 3HCOA 2DGDA 1ZIPA 4ZT4A 4RGYA 1U90A 3CVUA