1I3LA

Molecular basis for severe epimerase-deficiency galactosemia: x-ray structure of the human v94m-substituted udp-galactose 4-epimerase
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
347
structure length
347
Chain Sequence
b'AEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAMGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNVVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-GLUCOSE 4-EPIMERASE
publication title Molecular basis for severe epimerase deficiency galactosemia. X-ray structure of the human V94m-substituted UDP-galactose 4-epimerase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 126
structure length 347
sequence length 347
chains with identical sequence B
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 2001-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1i3lA02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1i3lA01
4ZQBA 4AJOA 1I24A 2OUIA 3VDRA 2CVOA 3WJAA 5EL0A 3WSWA 1Z75A 4PG8A 1Q1NA 1PGJA 3RSHA 1DRUA 1Y8QB 5DULA 3AM4A 1EDZA 4I5FA 4IS2A 4DIOA 4IQ8A 4MJLA 3Q6IA 3ULKA 3GFBA 3U49A 3OIFA 1QV6A 2QHXA 3TQHA 4XYGA 4YT8A 4YXFA 3GRKA 5I7FA 5A3JA 7MDHA 3ZWVA 1XA0A 3IUPA 3FR7A 3VPSA 4J91A 2PD3A 3N58A 4HX5A 4W7HA 5THQA 2HK7A 2AQKA 1NR7A 5JY1A 3DC2A 3WIDA 3V1TC 3RFVA 4Y98A 1EQ2A 4URFA 3OQBA 1QKIA 4I5EA 1H6DA 4DPLA 4GX2A 3EW7A 4XQEA 1ID1A 2R2GA 4BNXA 2QX7A 2D8AA 1HT0A 2VTEA 3D4NA 5DOZA 3RUHA 1KS9A 2I67A 2JHGA 4BOYA 4P4GA 3AY7A 4S3MA 3HNPA 2NACA 4RPJA 4XB1A 3JD4A 1ENZA 2FZEA 4J1QA 2D1YA 4J4TA 2VYVA 2W90A 3V5NA 1BVRA 4OXNA 5A3VA 4BO7A 3HE3A 3WS7A 1BXGB 3SC6A 3OICA 4D0SA 3CIFA 2C5EA 5KJEA 2JAHA 3ZGYA 3G0OA 3PHGA 4CLXA 1GU7A 4CQMD 5K6AA 3B1FA 5IG2A 5JBIA 3DAGA 3ZU5A 1DFIA 2OGUA 3OM9A 4BNVA 1C0KA 3GUCA 3QVTA 4E3ZA 4ND4A 4WK6A 2EGGA 3VDQA 3GK3A 5JDCA 1DIRA 3N7UA 5FWNA 2J5RA 3C24A 4MVJG 1TXGA 1G6KA 4ID9A 3I4CA 4XGKA 5KVQA 4HADA 4E2XA 3DOOA 1Y5RA 4EEXA 4NBTA 1ISHA 2QZZA 3FCOA 1ISIA 3OEYA 3ZWAA 5TJHA 4R3NA 5BSFA 4E32A 3OMLA 3D0OA 1X1TA 4CL8A 1T24A 1HSOA 1BDBA 2Q2WA 4BNYA 4H7PA 1AE1A 1UP6A 4W9NA 4CMEA 4MDHA 5K6AC 1QLJA 2OXIA 3CMMA 1K6IA 3WFIA 2Y1OA 5L53A 1T2FA 5JDCC 1K3TA 2QRJA 1J0XO 1QORA 1XELA 2D5CA 4L9RA 5JW6A 1L7DA 3QV1A 4DPKA 2VYNA 3WGZA 1E5LA 1ZVMA 4NK5A 1SEPA 3DAFA 1N1GA 4MP8A 4RDHA 4PLZA 3IKTA 2WM3A 5GZ1A 1MG5A 2YY7A 1I3KA 4D46A 3E9MA 4JJFA 4PLWA 2YQ4A 1SB9A 5TT1A 4W9NC 4O5OA 4CMEC 4M87A 1PEDA 1RYEA 2PKQP 4WKGA 1VSVA 1Y6JA 1EVYA 2JKVA 4YA6A 5C7OO 1QV7A 2DC1A 2JCXA 1QRRA 2HMWA 4NBWA 1JAXA 3NV9A 1MB4A 4U0JA 4CR8A 2EEZA 3ONFA 1U4OA 1ORRA 3DZFA 2YUTA 1D1SA 3ONDA 3NJ8A 4OHUA 1IPFA 4MKRA 5FYDA 3LSYA 1E3SA 3FWZA 4RF4A 3KYBA 4NFSA 1VJ1A 1BXZA 3E48A 3TOXA 1LLDA 3Q9UA 1QYWA 4CQLA 3RIHA 1ULUA 1UZMA 1H9AA 1YS4A 4CV0A 2BRUA 1N2SA 4GMFA 2OO5A 5ICMA 2J3IA 5IDWA 4I8XA 1P9LA 4NPCA 3O9ZA 3OJFA 1HDGO 1GL3A 1HTBA 4ZICA 2Q1WA 1Z73A 2FSSA 3U62A 5BNFA 5F1PA 1AN9A 3EDMA 4TQGA 4BGUA 2PFGA 4MVJF 4LCEA 2VUSA 1WMAA 4W82A 4IGEA 2Y66A 2Q4BA 3OIGA 1PL6A 3IUSA 1DC6A 3PYMA 2BGKA 4R9SA 5EN4A 1SMKA 1XQ6A 3D5QA 2AEJA 1GY8A 3ZHZA 2JAPA 3ZDFA 4AICA 3BA1A 1V6AA 1NBOA 4AJ4A 4XX0A 3WWYA 5DZSA 2Y0EA 1YBAA 3DTTA 1YDEA 2E49A 1IHYA 1WP4A 2GERA 1JAYA 1V0JA 2YHIB 3GNQA 3WBFA 4E0BA 2OL4A 3UKOA 2PV7A 2X0IA 1YOVA 5T64A 2EW8A 3GHYA 3G1TA 1ISGA 2DTXA 5CDGA 2XOXA 1R66A 3HB5X 4YJDA 3GC6A 5L51A 5IAAA 3VZPA 3WTBA 3GVIA 1LRJA 3DONA 4IINA 4J1NA 1O6ZA 3BTSA 3HN7A 1C1XA 4KUHA 1IHXA 5C7LO 3RU9A 4AJKA 1PTJA 3IIEA 1OAAA 1ULSA 2BFPA 2O50A 4NIMA 4WLEA 2B36A 3ZHBA 3DXFA 1SAYA 2C7GA 4BHTA 1EVZA 3DZGA 4WASA 3ZHXA 2JFHA 4D45A 3E5MA 3TL3A 3PJGA 3QE3A 2BFOA 2ZCVA 2WYVA 1U28A 1BMDA 3I52A 1F14A 3F47A 4R41A 4WGGA 4OH1A 3IS3A 4QX6A 3G3EA 3JQ6A 1W0CA 3Q11A 1NVGA 2V6GA 1DFHA 3I9LA 4CM6A 3KYCA 1HL3A 4R5HA 3RUAA 4M89A 4OM8A 3MZ0A 2X0JA 3VPFA 1HDZA 2HJRA 2DQ4A 1O9BA 5AVOA 3T4XA 2G76A 1XLTA 4BVAA 3I9NA 4CMKA 4YJHA 1MP0A 1X0XA 1UDAA 3H2SA 3VVBA 3WDSA 1LDYA 3P5SA 3IP1A 3WMXA 4A27A 3QQPA 1CYDA 3TDKA 2X9VA 2CDCA 4PIVA 2ILTA 4D3FA 4EBFA 4WLFA 5B4VA 2BHLA 2I99A 4P4LA 2TMGA 3GNSA 3F6YA 1DFGA 4L8VA 2AG5A 1P1HA 3LC7O 1D1TA 3F1LA 4IBOA 4K6CA 3X2FA 1ZH8A 3RASA 1JWAB 4Y6SA 2NU7A 2Y05A 3ADPA 2ZTMA 4NFHA 2FN7A 1YB5A 1ZJZA 3K31A 4KZPA 4H16A 1M75A 1UH5A 4KWIA 4WEQA 2PKRA 3MOGA 1P1JA 2ZCUA 3I23A 2E82A 3B6ZA 3DBRB 3QVXA 4Z9FA 4KMSA 5FI3A 1ISJA 1FXSA 5CG2A 4YJGA 1T2CA 1NQOA 1LQTA 1ZSVA 2CY0A 4M86A 3WICA 4NQZA 1ZK0A 1EVJA 3ETEA 1PR9A 2EERA 3OIDA 5FFFA 4AJLA 4J3FA 4JK3A 2BKAA 3GAZA 2PKQO 5FF9A 2J3KA 3A28A 4A03A 3NDRA 4KOAA 4BS9A 1C0IA 2HMUA 4ZJUA 4YRBA 2IZ0A 3OQ6A 1LC3A 1R4MB 3GAFA 1E92A 3R3JA 2P2SA 5TC4A 1VPDA 1DBVO 4RDIA 1P44A 4IIVA 1D7OA 3ANLA 2PA3A 3DHYA 3NKLA 5TIIA 1PJQA 4FB5A 2EKQA 1V8BA 3MJVA 2XXJA 2X9NA 4ALJA 2G0TA 1SOVA 1P45A 1P74A 5DOVA 4D44A 1VM6A 5H82A 1XDWA 4YJFB 2FZWA 3C1TA 4UEOA 5CFZA 1EQUA 4EGFA 3F5SA 1LJ8A 3H9GA 3H9EO 3MEQA 3UCEA 1DRWA 3RJ5A 5KNLA 1GQYA 5ENDA 4JP3A 2PWZA 2GDZA 3I1JA 4RF5A 3JTMA 4TZKA 1PZFA 4P4NA 3DBLA 2ZTUA 3Q9NA 2G1UA 1AHIA 4WCDA 2BF7A 2VWHA 3JQ7B 1PX0A 4Z3KA 3PEFA 1IZ9A 4D79A 1I3MA 3KLMX 1XU7A 4PZEA 3STHA 2EV9A 3O03A 3LLSA 4EDFA 3EGOA 4QT0A 2DLDA 2VWQA 3K92A 1PJTA 3OECA 1NHWA 4YPOA 2VHYA 1NQAO 2NTNA 3GG9A 4MVJH 4NMHA 5L45A 2WD7A 2OBYA 3VPXA 4PZCA 3KSDO 4GPD1 1B8PA 5A4DA 5KVVA 3QSGA 4XKJA 2C20A 3FF4A 3SLGA 4UULA 2GN8A 5GZ6A 5MDHA 2WYWA 4RVGA 4O6VA 4FGSA 1HSZA 1I10A 1U3TA 4YRDA 2GD1O 2VWPA 3NGXA 1LDBA 4H3VA 4L74A 3WNQA 1W8DA 4FFLA 2RH8A 4E2ZA 1E6WA 3H9UA 4IPTA 3ZZNA 5JDIA 4DUPA 1M66A 3BMCA 2DM6A 3ZNOA 3QIVA 2B37A 1YL6A 2EGHA 4JQCA 3LDHA 1RKXA 3S55A 2UV8A 3TN7A 4BL5A 1KC1A 3GN2A 3K6JA 2FPPA 4AG3A 1A9YA 4GGPA 1WMBA 5B1YA 4RV9A 2AA3A 4CLOB 4C7JA 4OYRA 3JYNA 4OQZA 1TVEA 2A9FA 1LDEA 5T5QA 2GPTA 1CERA 3T4EA 1ONOA 3H5NA 4PLGA 3TZCA 3FHLA 2ZB4A 3Q0EA 1PJ2A 2EKPA 2V6MA 5L9AA 2X8LA 4E4YA 3RBVA 4AJJA 1RYDA 1Z7BA 3NDJA 3Q2IA 2B0JA 2AXQA 2CF6A 4CMCA 5JDIC 4N18A 3SX2A 4IDDA 1B14A 3SC4A 1PWZA 4NU6A 4XRRA 5BR7A 2JD1A 1CQIA 1FDVA 2PD6A 4L0QA 2DBZA 4R1TA 3ENNA 1KVQA 1RM4A 5ES3A 5EINA 1TT7A 2EXXA 3K96A 4S1VA 3V2UA 5A02A 2W4QA 1B16A 1UP7A 1ZEJA 3FTNA 3NUGA 1OOEA 1TA4A 1K5HA 2CVZA 3OJOA 2D2IA 3SLKA 4CQMB 1P3DA 4RPLA 3WXBA 3GR6A 1UXGA 1P33A 3RVDA 1HYEA 3CZRA 4M49A 2X86A 2CDAA 5BSHA 1XKQA 5ICSA 1F12A 3M1LA 5GY7A 3DMYA 4D41A 4OKNA 5JYDA 2E4AA 5IXYA 4QEDA 4TMFA 1Z7EA 1E1NA 3QLJA 4IDGA 3UCFA 1YB4A 4J4HA 5JE8A 1KVUA 4Y67A 2PZMA 4FCCA 3R0IA 3C7CB 2JFFA 4IJKA 4XGNA 3TZHA 1D4FA 4AJHA 4LRSB 5A05A 2B83A 2NVWA 4Q3NA 2XAAA 5THKA 1EBUA 4FJ2A 2NADA 3TJRA 2IRWA 4HKTA 3GEDA 4NBRA 1KC3A 3W4JA 1O94A 3LT2A 4AVYA 4GI2A 1TB4A 3H9QA 3JQGA 3GNTA 1NWHA 5DCYA 4FPXA 2YDXA 3L4SO 3O8QB 5G0WA 3UN1A 3LC1O 1BXKA 1VKNA 4XB2A 2HK8A 3WWZA 4FD3A 4IDEA 2VRCD 4LSMA 4Z9XA 3UICA 4NJMB 4GAEA 1EDOA 1NP3A 1KYQA 3WQSB 1GV1A 1D3AA 3ICPA 4R3WA 1N9GA 2PTGA 3I4FA 5G0VA 2DFVA 2W8ZA 5F1KA 2Y67A 1NM5A 5KOIA 1TEHA 2IXBA 3AM5A 4R16A 3I5MA 4TKMA 3RC7A 4A0SA 4BO8A 4D3SA 3LT0A 4PLTA 3AOGA 1J6UA 1SOWA 3VTFA 4FW8A 4E5PA 1B8UA 1BWSA 3GUYA 1QYCA 4AJ1A 4YAIA 3GZ4A 2Z1NA 5BNTA 3NTQA 2HMSA 3PYLA 1H93A 3G49A 2PH5A 2DUUA 4MVJD 5DBFA 1E3EA 1ZIDA 2CD9A 2EP7A 2IE0A 1E7MA 3QY9A 5U9CA 2I9PA 2NNLD 3AUAA 3N74A 3MTJA 2PGLA 2Q1TA 2VHWA 4L73A 1U3UA 1PZEA 4GKBA 3T7EA 1YL5A 3H8VA 1EBFA 4K6FA 1PL7A 1GCOA 1SBYA 4FC6A 3IL2A 3RD5A 5JC8A 1ZXBA 3EY4A 1RM0A 1R6DA 4FBGA 3V1UA 3WGQA 4CM8A 1DHRA 3I3OA 4JNKA 4Z0PA 3PGJA 1QR6A 2DU8A 1GTMA 4IDFA 4OSOA 2WTBA 1WNTA 1EUZA 2C7VA 2I5PO 2CSUA 4TWRA 1PGNA 3K8ZA 4CLRA 1T4DA 1KBZA 4UUMA 4WUVA 5JXWA 1I33A 3ANNA 3UOGA 4UVIA 3RKUA 4CMBA 5JAZA 2UDPA 1U3WA 1XHLA 3GMSA 4CMJA 2HU2A 5EESA 2B5WA 5ITWA 3BZUA 4LMRA 3AK4A 4OOFA 3FI9A 4CM4A 3AFNA 1YDWA 1HZJA 5TT0A 3HSKA 5JAIA 5KCZA 5F5LA 4K1LA 3NDIA 3KBOA 4FOSA 1J49A 1ZKMA 1X7GA 2Y1DA 3D4PA 1H94A 2FR1A 5DBGA 2EHDA 4J7CA 2E48A 4E5NA 1PS0A 2FR8A 4B3JA 2UYYA 3ZWPA 2O4UX 3DAPA 4YCAA 3GDFA 4WCFB 3DQPA 1EMDA 3F46A 3W1VA 4H15A 3BIOA 3IJRA 1EFKA 3SEFA 4EEZA 3LT1A 1K2WA 1J5PA 3PZBA 3R1IA 4OXKA 3U4DA 3GF4A 2VHZA 1CJCA 4LN1A 4CR6A 1Q0HA 1U5CA 2C5AA 5JCXA 1ADBA 1E3LA 4O59O 5HRUA 2WYUA 3ST7A 1C0PA 4JGBA 3VPHA 4DVJA 2LDBA 2QQ5A 1R0SA 2SCUA 4FFMA 5IN4A 5G0UA 3E8XA 3CMCO 3ZV4A 4YR9A 3BMNA 1EVIA 3BXXA 5BQFA 1E7WA 4EUFA 1Y8RA 2YQ5A 3BMOA 4N5LA 1OFGA 2QIOA 2J8ZA 1A71A 1QYVA 5EPOA 4HXYA 4PZDA 2HCTA 5AXAA 5L7YA 1R4NB 4DREA 1C14A 1B26A 1A7KA 2X0RA 3WJ7A 1V3UA 2C07A 2ZQZA 4I5DA 5DDIP 2BI7A 1YQDA 1KY4A 3GZNB 2EKLA 4WOJA 2HKIA 5LCXA 3TZQA 2W2KB 2LDXA 4PG5A 4AJEA 2AQ8A 5MGBA 5HTOA 2AE2A 3MWDB 1XG5A 4MO2A 4TRRA 5L7TA 3H6KA 3JYLA 4ESOA 2VCYA 5LC1A 2TMDA 3F1KA 5G4KB 1H6BA 2GYYA 2VUUA 1JQBA 3ICCA 4HFMA 2NWQA 3RKRA 1WW8A 2RAFA 3QVOA 3ZWWA 1FF9A 2A35A 1YE3A 4RVFA 4R69A 1R12A 3HUDA 2BH9A 2ZATA 3FD8A 2QRKA 3VH4A 4IDBA 4ZQGA 2I3GA 1LC0A 4BV9A 4CV1A 1DLJA 3ASUA 4XQCA 1SO8A 3IQDB 4OXYA 3IOYA 2X5KO 3C1AA 2RHRA 3GRPA 4RPGA 2GN9A 1DLIA 4RO0A 2AQHA 1WDMA 5JNLA 1JN0A 2HDHA 2P91A 3BTOA 4B3IA 1Y9EA 3TWOA 4E5MA 2X5JO 5KKAA 3WTCA 4K9DA 1PJLA 4ROSA 4WOKA 2NLOA 3A1NA 4DXHA 2Y68A 1ZMTA 4TVOA 2X0NA 5CDUA 2VT3A 4CLEA 1X0VA 1VL8A 4BNLA 3FPCA 1BW9B 3F4LA 4GVXA 1OZAA 2ZQYA 1JTVA 5A06A 3DOCA 4LVUA 5JYEA 3K2BA 1Y8QA 3MTGA 3OP4A 3C7DB 3WQRA 3WX0A 4R51A 5A04A 3U5TA 3RUFA 3MJSA 1Y5MA 4YB8A 1YVEI 2DFDA 1I32A 2JFGA 3F3SA 4XYEA 5DNAA 3UCXA 3ZI0A 3ZNNA 3DWFA 1PSDA 4MKXA 4BO9A 4TRMA 3ZN2A 4CM1A 5BNIA 9LDBA 4KTVE 4A2CA 3S2EA 1C3VA 3WIEA 3BAZA 3QVWA 3GGOA 5DF1A 1M76A 1PS8A 2JD2A 4WLOA 1PQUA 4E12A 2D3TA 3PGXA 5CPBA 1HE5A 2P4QA 2UUOA 3FR8A 3H5RA 2D59A 4XYMA 3H3JA 4Q39A 4ALLA 1NHGA 3O38A 3C8MA 1IUKA 1SB8A 4I5GA 3HDJA 4ZRMA 2AMFA 3D3WB 4BIIA 4OSPA 3ZWBA 4A10A 4YAKA 3PLRA 4AJPA 1IOLA 3TZ6A 1GZ3A 4UEJA 5JLAA 2B4RO 1ENPA 4Y6RA 1R16A 3S2GA 4PLFA 4E6PA 3JYQA 2UAGA 3RUIA 4HP8A 4MVJM 2XF8A 3HHPA 3M1AA 3KZVA 4BNIA 2GF2A 3GMDA 5JCJA 4YT2A 3FTPA 3KETA 3RC1A 4OL9A 3M6IA 3ZV6A 4G81A 1SZJG 1XQ1A 2DBVO 4U0KA 2FHSA 3PRJA 1DIBA 3BTVA 4BB6A 1UXJA 2BMAA 4Q9NA 2JJYA 1G1AA 4D7AA 5A1TA 4MVJE 5U4QA 2NVBA 1ZEMA 2HO5A 5DT9A 1L7EA 1U1IA 1B3BA 3TF5A 3JQ8B 3CH6A 4FFOA 1GEEA 2Q1UA 3NGLA 4DLBA 4DA9A 1GADO 1KIFA 4QTZA 3CKYA 3KEOA 1NPTO 2VNSA 1B0AA 2IYPA 4TSKA 5T67A 1N7HA 4ZQEA 5ILGA 1HLPA 5JPIA 4DYDA 5IDXA 1SEVA 2ZJ1A 3ZNPA 1SPXA 2WDZA 5TLSA 1MA0A 4CM5A 1X7DA 4O0LA 4AJNA 3QHAA 3AU8A 1F0YA 3DBHB 4CM9A 1LLQA 3PJFA 5F21A 3HG7A 3RQSA 2O23A 3KYDB 2Y1FA 3OEWA 3ITDA 4BO3A 4B8ZA 3UH1A 3FNHA 2WD8A 3GG2A 1NFFA 2ZB8A 4M8SA 1YXMA 1QYDA 1PL8A 1T25A 2VYVD 2QZ9A 3WMWA 2ZTVA 4FIZA 1I2CA 1U4SA 5I9LA 2B35A 3UAGA 1O0SA 1YGYA 2DT5A 2AEFA 1VL6A 1K89A 3B1JA 3FNFA 1GYQA 1YRLA 3ASVA 1T1SA 2D0IA 3KHUA 5KVSA 2J5KA 3C3XA 2I65A 3QW2A 3QRWA 4JBGA 3NYWA 2AE1A 2NU9A 4MIYA 3NT2A 3JQEA 1BVUA 1JVBA 3VH1A 3EZLA 1HDOA 2ET6A 3EMKA 1HYGA 4W4TA 3ZWYA 4JN6B 4OO3A 1DOHA 3E82A 4PLPA 1FJHA 3H7AA 3WBBA 1A7AA 1Y7TA 1NNUA 4UEKA 2VQ3A 1B15A 2Z95A 2IYOA 1ZUD1 3K73O 1NTOA 5EQDA 4I9UA 3GVXA 3AUUA 2C0CA 5L7WA 3GEMA 1UDBA 5I8WA 3HADA 3JD2A 3L6DA 1HKUA 5C7IO 5HA5A 2PD4A 2VYND 5DN9A 4XQ9A 2HSDA 5L4NA 4UREA 4MOWA 1M6HA 3D5TA 4F6LA 3WGHA 4BV8A 2X5OA 3D4OA 5COBA 3VC7A 5U1PA 3P2OA 4A73A 4M1QA 3PIIA 4KQXA 2G82A 4OGWA 4J1SA 4ZHSA 3WGIA 3WYEA 3INRA 1FMCA 2GSDA 4NR0A 4NH4A 3WNVA 2OHXA 1VJTA 4XYLA 2NTVA 3ROQA 4HV4A 4HNHA 5JO9A 2YHIA 4J9UE 1ADCA 3LYLA 4HNGA 4IXWA 3B70A 4YACA 3AW9A 3P7MA 3W8FA 4PFJA 1ONNA 3K9QO 1NX6A 5CAEA 3GGPA 4FDAA 2GLXA 1U7HA 3KSUA 5TS3A 4TVBA 2WE7A 3TOZA 1U3VA 4CV2A 3RC9A 3IP3A 2AQIA 4JBIA 4NK4A 3E6AA 1F8GA 4Q3CA 5GMOA 4ND3A 3FWNA 3BMQB 1KERA 3H65A 3PTZA 2DUWA 3JD0A 4Q3AA 1FDSA 1MLDA 3W6UA 4EJ0A 1X1EA 3PQDA 5IXSA 5BSGA 1PJBA 2D5AA 3HDQA 4XWYA 3UFXA 3GFGA 3FBTA 3HFGA 4OOEA 4E2YA 2YYYA 3AI2A 4KUGA 4ITUA 1LSOA 2W2LA 4UVHA 5ER9A 5F5NA 4WECA 2NU8A 4LCJA 3BHJA 1B3RA 1LA2A 1R0KA 2ZYDA 1PGQA 3BYZA 4HWKA 1PR3A 1XYGA 4M54A 4QFDA 2R6JA 3LK7A 4PCVA 4J4BA 5COQA 2YFHA 3AM3A 4OIMA 1QP8A 4IS3A 4CM3A 4FS3A 1ZW1A 1F8FA 4RVHA 3UGKA 1NFRA 3AWDA 4ONEA 3UF0A 4G5HA 4I1IA 4BQRA 2PZLA 3NTOA 1BG6A 4HBGA 5B4TA 1MUUA 3U3XA 1NQ5A 2NVUA 4KDFA 4FFRA 3JQAB 4IJVA 4PVCA 1H6CA 3JQ9A 4JLWA 1U8FO 4UVEA 3AI3A 1JWBB 4BO4A 4R01A 2Z1MA 2XXBA 3GOHA 4EJMA 4F6CA 3PIDA 1SC6A 1CF2O 2BFMA 4L75A 4QO7A 3OJEA 3DBRA 3PVZA 4X54A 4B7CA 3U4IA 3RUCA 4QUKA 3MCVA 4HUJA 4BKUA 4RVSA 3M2TA 1U9JA 4RJTA 4JIGA 3V8BA 2B5VA 2X58A 1ENYA 3DEYX 5IN5A 3VH3A 3B20A 2ZKLA 4DC0A 2RCYA 3GY0A 1U5AA 2FPGA 3RFXA 1R4MA 3WYCA 1WVGA 4GVLA 3JQ9C 3I83A 2QRLA 5I7EA 4CUJA 1H6AA 1LBEA 2O3UA 5A9SB 2O3SA 2CDBA 2NQ8A 2BFAA 4NI5A 5IF3A 2ZB7A 3BHMA 3WR5A 1C1DB 3GVCA 4K26A 1E3WB 1JLLA 3QWIA 3LZ6A 4IMPA 4BKRA 3L6EA 2Q46A 5A9RA 2X7HA 4ZRNA 4UVGA 2YW9A 4DQUA 4YJFA 1TT5B 3EK2A 3RAJA 3FSRA 2R00A 1E77A 1XR3A 4IMRA 3ZV3A 5IDQA 3ROKA 3U0BA 3LQFA 4GWGA 1ZJYA 2CF5A 1IZ0A 4OJNA 4JP2A 1R37A 2PGJA 1ZZEA 4XRGA 2CNBA 2IEDA 3KXDA 4L4SA 2G17A 5C3MA 1LDNA 3KOUA 2A94A 3JQ7A 4R1UA 2VHVA 4MIOA 1QMGA 2X22A 4QO8A 2YZ7A 1VC2A 1ISFA 3DDNA 4W6ZA 1B8VA 2C2XA 4YVFA 3PHIA 4LK3A 3NT5A 3ZW9A 2RIRA 1YJ8A 4XGIA 3PYXA 3FRJA 2O4CA 5AXBA 4BKOA 2WE8A 1EK6A 3DZJA 3DZHA 2R00C 4WNIA 4DTIA 4C4OA 2EG9A 2X23A 4WEOA 1HDYA 4UUOA 3AI1A 2HRZA 4NG5A 3I9OA 3HDHA 1PQWA 3SJUA 4DQVA 1KEVA 4U6QA 3CXRA 4D0RA 5EQFA 2C29D 2P9CA 4YAGA 3OF2A 1QXSA 1CRWG 1DJQA 2C54A 5LDGA 2AHRA 4WLVA 1ADGA 5TX7A 5HBRA 4NZ9A 4NU5A 2E37A 1DO8A 4YDRA 4I9NA 4EJ6A 3IAHA 3FN4A 4TRJA 4F45A 3CZMA 3PI7A 2HAEA 2IDZA 1YONA 1YL7A 3IC5A 3VZSA 5ILOA 5TF4A 2PZJA 4BGVA 5JSFA 1ZK4A 4D42A 1P0CA 4ZVVA 4BNTA 4E33A 4CLOA 3OHSX 4L76A 5TGDA 1V3VA 3GEGA 4BNUA 1KVSA 4DWVA 3ZWMA 3OFSA 1F06A 2H9IA 4XCVA 3MJEA 4DBVO 2X1HA 3ROPA 2AG8A 1HLDA 2BD0A 2O48X 1ZK2A 3BHIA 5EERA 1NVMB 3WQQA 1HWYA 3G79A 5B12A 4DIBA 3HZZA 3SBOA 1BDMA 1E0DA 1LDMA 3VKVA 3IDSA 3GA0A 4TKLA 4A5OA 1XWFA 3PFWO 4EZBA 2PLAA 3JQBA 5JC1A 1SCUA 4XJTA 4RGBA 4WLNA 3H9JA 3PJDA 3AJRA 1L1FA 4EUHA 3ZWOA 5CHEA 4CQMA 1Y9AA 2IEBA 4XD2A 4BKPA 4P22A 1T1RA 1XIVA 1SNYA 5JO0A 2GRAA 2Y1CA 4Z0HO 3I9MA 1DXYA 1Y1PA 3AOEA 1ZCJA 1EUDA 1GUYA 3L07A 3WYBA 1PZHA 3JD3A 3KV3O 3WGTA 2Q49A 4J0EA 1GYPA 3AY3A 2EJWA 2YJZA 3OETA 2O2SA 3X2EA 3I9KA 3VH2A 1DB3A 1E3IA 4NFYA 4Y8VA 2VOEA 1JDJA 3H5AA 3V2GA 3L9XA 4HFRA 5ITVA 1UR5A 1Z45A 1U7TA 2GZ2A 4HFNA 2P4HX 4RLSA 3GGGA 4P38A 5IJZA 4MINA 4OAQA 1LU9A 1NR1A 2BGLA 1ISMA 1DSSG 3FPLA 3O8QA 4MKZA 1XU9A 4NBVA 3AOEC 4E5YA 1B7GO 5KWEA 4PLYA 3ZNQA 4FJ1A 1LLUA 1MC5A 1Z6ZA 2DBRA 4GBJA 4NJMA 1I3NA 2F1KA 3A4VA 2PNFA 5L4SA 3DZIA 4LMPA 3MJTA 2IZ1A 2V65A 1ZBQA 1A9ZA 3KB6A 4JXKA 3ROMA 3GVPA 4U8GA 4YQZA 3PPIA 1ZK1A 4DC1A 4TZTA 4BNHA 4BKQA 4RZIA 1I36A 1GDHA 3GT0A 3ZW8A 3JSAA 3VAZA 3OH8A 2GUGA 1ENOA 1KEPA 5JFOA 1ZNQO 4XDYA 2Y1GA 1YKFA 7ADHA 4PLHA 4N5NA 3RJ9A 3ZU4A 3QWAA 2HMTA 4FJ0A 3HFSA 1PS9A 4B8WA 1A27A 1EE9A 1KY5A 3H3FA 4FC7A 1V3TA 4QFCA 1YO6A 3TL2A 3VKUA 1GFSA 4XJSA 3RBXA 1UUFA 1YQXA 4BNMA 4A26A 2D4AA 2HLPA 1UDCA 4NNJA 3HQ4O 4GMGA 4N7RA 3COSA 2VNAA 1DDOA 3M2PA 3PQFA 3RUEA 3E9NA 4EYEA 1FDTA 3ITKA 5I9MA 3NX4A 1MV8A 5G0SA 3L77A 1JKFA 2O7QA 4GH5A 4UAGA 4L4RA 4J16A 2B69A 1J4AA 2WMDA 2WWRA 1RWBA 4AJIA 2ZB3A 3VZRA 3ABIA 4Y9DA 1PJ4A 3HB4X 3DTYA 2HQ1A 2FWMX 2POQX 2CFCA 3WG9A 2P9GA 1NWCA 4CMIA 5AXDA 3ANMA 5G2OA 5CDTA 1Z82A 3ZU2A 1PQPA 2V7PA 4CR7A 1DEHA 3TZKA 4MVJP 1A4UA 4IDCA 3KM0A 2HJSA 5K0ZA 4YRAA 2PY6A 4W99A 3VOSA 3LF2A 5KJ1A 1PU2A 1HF3A 4ALMA 2NM0A 2IODA 4WLUA 5EMHA 2YDYA 1GUZA 4JX8A 1B2LA 5B37A 2OZPA 3WOHA 2YV2A 3GDOA 4J7XA 5HM8A 2CMDA 4R4JA 2JD0A 3AUSA 1H2BA 4R5MA 3LF1A 4YT5A 2W98A 5BT9A 3A06A 3DBVO 4I9HA 1EK5A 4BB5A 1T2DA 3KUXA 1AGNA 4XIYA 5CG1A 4INAA 1GYRA 4HFJA 3CINA 4NJOA 4ND1A 1W4ZA 4WNCA 4JCOA 5GZ3A 4M55A 4WCFA 2VZ0A 1MXHA 4CQLB 4DIFA 2VOJA 1VL0A 5KJ6A 1EE2A 3MJ4A 4QQRA 3PXXA 1JA9A 2I3AA 1DC4A 3TRIA 3UW3A 3EC7A 3P2YA 4F46A 1ZMOA 5JMWA 1QYXA 5EIOA 2FOIA 1VJ0A 3PHLA 2E6UX 4IDAA 1K6JA 3PP8A 3U9LA 3VHRA 3A9WA 4MPDA 4BGEA 1RPNA 5FEUA 1NXQA 4IZHA 2ZYAA 4U6SA 4U7WA 4CPDA 4CM7A 1MG0A 3HWRA 3WGOA 3W6ZA 2Q99A 4BNNA 4CUZA 2FP4A 3IKVA 4J7UA 4JBHA 4FFNA 2ZK7A 3AUTA 5I8ZA 5J23A 2OORA 2VUTA 1Z74A 4KQWA 5BSEA 4WCFC 1CEQA 3B1KA 1H2HA 1R4NA 4CL3A 4DLAA 3JQFA 4CMGA 3CUKA 1NAHA 4EW6A 5ER6A 4EI2A 3TSCA 3OJLA 1HXHA 4BNZA 3QA9A 5DCUA 1UP4A 4RF2A 3GZNA 4ALIA 4UVDA 3E5RA 3DB2A 1KVTA 5HS6A 2W2KA 1YOVB 1P0FA 1EFLA 2ZYGA 3JQCA 4FN4A 4YBZA 1S6YA 3GN1A 1N5DA 1ZK3A 3QWFA 4J90A 4J0FA 2Q3EA 2JCVA 4PGFA 4TROA 2OMEA 5G4KA 1PGPA 1U2GA 1YQGA 4EITA 1HDRA 1C1XB 4LRTB 3GQVA 4G2NA 5T57A 1Q0QA 3JQFC 4D43A 3DHEA 2YFQA 2GCGA 1BXGA 1E1KA 3L6OO 4ZQHA 4BNKA 1NASA 1UZLA 2B4TO 2I66A 4DQXA 4IGFA 4RCVA 4GL4A 4PRLA 1IULA 2RBEA 1X13A 3WSVA 3HDYA 1K6XA 5DCWA 8LDHA 4YYZA 4ZGWA 1PJCA 1LXCA 2C59A 4RZHA 2O2YA 2Q50A 2C2YA 1T26A 3WB9A 2ZIZA 3KYCB 5CDYA 5CP8A 4WPGA 2Y0DA 3ZWCA 1LSJA 2B4QA 3NJ4A 2PK3A 1GZ4A 1DAOA 2A92A 3PWSA 4YJHB 3DZBA 1P1KA 5JAQA 4FOOA 2OP1A 2DTEA 4E21A 4QSMA 1BW9A 1NPYA 4R68A 1AHHA 5TQVA 1TLTA 2GN6A 3QJ5A 4Q3DA 2VTDA 1VI2A 1D8AA 3KEQA 1HEUA 1VLLA 5C5IA 3VZQA 4J49A 4IQGA 3JV7A 1Y81A 4ZA2A 4QXMA 3Q2KA 4GLOA 4JJIA 3EVNA 5IZ4A 3WLEA 1CETA 1RM3A 2QW8A 3PWZA 1DC3A 3PZRA 4IM7A 4RL6A 2P68A 4LISA 1ZXLA 3GVHA 4Q3BA 2GZ3A 3ZCXA 3UUWA 1H5QA 5I9NA 3DMTA 1GQ2A 1YJQA 4R1NA 1WPQA 3ONEA 2J5QA 4YJGB 2PR2A 2V6FA 1LX6A 2DKNA 4BO6A 4RQTA 4Q3EA 2DTDA 2I76A 2WSBA 4OQYA 3PLNA 4P8RA 4YQYA 1WZEA 2P9EA 1E6UA 3KTDA 4BMSA 3DL2A 5TNXA 4ZQFA 1ADFA 5B4UA 2ZJ0A 2OBNA 2HMVA 2QYSA 5KVCA 4CODB 1DJNA 3PFFA 4PLCA 5JMPA 1N1EA 1WWKA 3D3WA 4QECA 2J3HA 4NBUA 4RPHA 4IY1A 3CSDA 1ZSYA 5FI5A 1LSUA 2YV1A 3E1KA 1CIVA 1LRLA 5AYVA 2VZ8A 3NAQA 1A4IA 1HE2A 1QSGA 5I7SA 4XR9A 3DMTC 3C7AA 2O3QA 3RU7A 5KJCA 1XGKA 3UXYA 1F17A 4XQGA 1PJSA 3GHHA 4YAJA 1LDGA 1PIWA 3TFQA 1BHSA 4CLHA 3K5PA 3RFTA 4XYBA 2P5YA 3H2ZA 4GKVA 4IQ0A 4UUNA 1U8XX 4CJXA 4E2WA 1H0KA 1O89A 1UJMA 1Q7GA 1Q0LA 3KRTA 1NYTA 2YV3A 5AOVA 3SJ7A 1E7QA 3ADOA 4FSHA 3ZWNA 1PJ3A 3W4KA 4BQPA 1G0OA 3CEAA 2ZTLA 4CLDA 5L95A 3DBLB 3PJEA 1T2AA 3JQ8A 5DP2A 4LVCA 1YWGO 3KSZO 4ALNA 1JU9A 4GWKA 1OC2A 1XCBA 3W8DA 3NT4A 4B4UA 3INTA 3F9IA 5T8KA 1VSUA 4FGWA 1E3JA 1W73A 2VWGA 1M6WA 3PDUA 4J6FA 3WFJA 3AFMA 1TI7A 3L4BA 4GX5A 4BNJA 5IDYA 4R9RA 4F3YA 4RVUA 2NVUB 3K30A 4JROA 3DBHA 2HK9A 1Q7CA 3INGA 2WD7B 2GN4A 1OC4A 3KYDA 1U2DA 1LRKA 4BNGA 1MC4A 3DO5A 3JYPA 3A14A 3RBZA 1NVTA 3OBBA 5G4LA 1BRMA 4AFNA 1DIGA 5COAA 1DIAA 4KDEA 1UAYA 3F5QA 2J6IA 1C0LA 3O26A 1N8KA 4D3DA 4DYVA 1UZNA 2VHXA 1P1RA 5T8KC 1M2WA 1X15A 4Z9YA 4ZU3A 3CTMA 1HETA 5LDHA 1A5ZA 3OA0A 1ONPA 1P77A 1N92A 2GO1A 1E1LA 3OJ0A 3L4BC 3ENKA 4J9VA 3CE6A 3BMCB 4LGVA 5JCJD 3JCZA 1WXDA 1JKIA 3R6DA 3I9JA 3SVTA 4J2OA 2G5CA 5CEEA 4K28A 4DL9A 4B4OA 1I5RA 4XR4A 4DLLA 5L4LA 2IZZA 3KO8A 4PN3A 5ADHA 5AXCA 1IPEA 2O3TA 1GZ6A 3NEPX 2X4GA 4BGIA 1E7SA 4MP6A 4DRYA 3TPCA 4MP3A 4N54A 2H1SA 4CUKA 2UUPA 2VRCA 1BGVA 3LU1A 3QWHA 1GD1O 3D3EA 3ZU3A 1HE4A 3QWBA 3S1LA 1GR0A 1T4BA 2PZKA 1X14A 3S8MA 3ZH2A 1XEAA 1HDXA 4RPKA 4CM9D 1E7YA 4B4VA 2EJVA 1R15A 5DBIA 4ALKA 4IZIA 2GGSA 3V1YA 2IXAA 2OP0A 5CDSA 3EVTA 5HWSA 4BO5A 1LTHR 5HS4A 5TJ9A 1HRDA 2Q2VA 1MX3A 1IL0A 2Q2QA 4ILKA 2FMUA 1ZO8A 3LLVA 2DVMA 3DFUA 4GSKA 5AQ1A 1OI7A 3LT4A 4NHEA 2EWMA 4GX1A 3LC2O 1PZGA 2WJPA 1UAGA 4Z0TA 1KETA 2RH4A 4MVJA 1IB6A 2X6TA 1E7RA 1ZFNA 3MJCA 5TRTA 3IMFA 5EJ2A 3DR3A 3D64A 4XIJA 4IUYA 4WE3A 3DZKA 3FNEA 3FBGA 4XA8A 1LUAA 2UVDA 3F4BA 4FR5A 4KP7A 3E03A 3WGYA 4B7XA 3GLQA 1O8CA 1ML3A 2Y93A 2JCYA 2GNAA 1BSVA 2JHFA 3HN2A 2FY8A 5CPFA 3S2FA 3U4HA 3I6QA 4Y6PA 4ZD6A 4E5KA 2CUKA 1DHTA 1WDLA 1KEUA 3DOJA 4W7IA 4RVDA 2EW2A 2RHCA 1S7CA 3JQDA 2PH3A 1I2ZA 2NUAA 1NQTA 4OMUA 3JQGB 4RQUA 5TSDA 5I7VA 2DBQA 3BMQA 4DMMA 2BI8A 3TFOA 3HJAA 3D1LA 5CEJA 2VT2A 1E5QA 1GV0A 4CV3A 1UXIA 4B4WA 4PG4A 4XZ3A 4WJZA 4C7KA 3KVOA 2J3JA 2Q4EA 4YWJA 3IJPA 2FR0A 8ADHA 1W6UA 1WDKA 3QP9A 1N9GB 3G1UA 1DAPA 1PWXA 3BTUA 1GAEO 1EZ4A 2XPCA 1N7GA 1GPJA 3PHJA 1ARZA 1IY8A 3EZYA 4YEDA 4KTTE 1Q2XA 3EUWA 2FRDA 2O3JA 3PQEA 4RORA 4U5QA 4UUPA 4BNWA 1CDOA 1I01A 1ZSNA 3ETDA 3OQ1A 1IYZA 3VTZA 1EEHA 2YHUA 2HRBA 3ETGA 2CZCA 4LW8A 1HZZA 3U4CA 1DPGA 3C1OA 1DRVA 1P31A 4DBZA 4RLHA 1IE3A 3JQAA 1VRWA 3O4RA 1A72A 1YBMA 4J2HA 5C37A 4R54A 1T2EA 5A9TA 3Q1LA 5L40A 4II3A 3EYWA 5KJFA 3H4VA 5KKCA 2GASA 3MWEB 3UHAA 6LDHA 3P19A 1V35A 4O63O 4EUEA 1UXHA 1XSEA 4IJUA 3RC2A 2NU6A 2NQTA 3ZWXA 4CMHA 3L9WA 1HE3A 4MIEA 2HUNA 4NDNE 3WGGA 3VVCA 3ON5A 1LI4A 4GLLA 4CM8B 4BMNA 2OFPA 4YT4A 1KVRA 1P1FA 3FNGA 1AXEA 3NRCA 4GSLA 3ZV5A 2BGMA 1JVSA 4GQAA 3D7LA 3R3SA 2QG4A 2X9GA 4DMLA 4O1MA 1QLHA 4FQ8A 4CLRB 5KTKA 2VRBA 4B79A 1QG6A 2W2LD 5A9SA 2DPGA 1I0ZA 3RI3A 1RM5A 1DC5A 1AXGA 4MVJI 5T6BA 3T7CA 3EAGA 4AJ2A 2H5LA 4YTEA 4IIUA 1VE9A 3K2EA 3CPSA 5A5FA 1CQJA 1CWUA 1MFZA 1NFQA 1C1DA 2VN8A 2AW5A 1E3WA 4J1TA 1E1MA 1LNQA 4CM4B 1RJWA 1BTOA 4I08A 4HY3A 1I2BA 4DPMA 1GQQA 4E13A 3VPGA 2C82A 1P1IA 4II2A 3SXPA 2Y1EA 3S2IA 1TT5A 1WZIA 1LLCA 1MGOA 4IJWA 2DAPA 2OOSA 4PLVA 2NV6A 3ZHYA 5ENVA 4LSWA 2VZ9A 4RF3A 4G65A 1GEGA 2NSDA 5JS6A 1KEWA 3NTRA 3JYOA 4PG6A 5A5EA 1YH3A 1FDUA 3RCBA 4BMVA 1E6EA 3W4IA 3RROA 4Z6KA 1NAIA 1I3LA 2Q45A 4GGOA 1HDCA 3RUDA 2V6BA 2H63A 1AUPA 4KUEA 3L0DA 5K9ZA 3OSUA 1GPDG 1O95A 4GX0A 3C85A 3Q3CA 2AEMA 4N5MA 9LDTA 3I6IA 4B7UA 1FK8A 4TRNA 3BMNB 1DIHA 2F00A 4ND2A 5H83A 2GZ1A 3UVEA 3QVSA 3G17A 3WLFA 1Y8RB 4YAEA 5A03A 2PGDA 1HYHA 1JW9B 3BMOB 2EP5A 2GR9A 1YBVA 4BUCA 5IZCA 2H6EA 1LSSA 4PG7A 2WEKA 2I6TA 2A4KA 1H9BA 4A7PA 4BNFA 3JQBC 3PK0A 1V9LA 4FFPA 5JY6A 3PDJA 1WLYA 3W8EA 5L3ZA 2BELA 3GPDG 4BO1A 2Q1SA 4DGSA 1I30A 2FPIA 3KLPX 1LEHA 1OMOA 2NTJA 1NPDA 3PHHA 4L4XA 1VKOA 4JJGA 1LQUA 1WAMA 2BLLA 4CMIB 4R1SA 3RWBA 3ORFA 2EIHA 3E9QA 5F1OA 1K0UA 4ND5A 3AY6A 5H81A 1KOLA 1UXKA 4BO2A 3EHEA 3V2HA 4E31A 4CMAA 3JD1A 2FSVA 2P5UA 4KWHA 5IZCC 4B3HA 1M67A 2QYTA 2O7SA 4ZN6A 2Y0CA 5CEFA 3DHNA 4BO0A 4PRKA 3TNLA 5KIAA 2Z5LA 1GCUA 5DP1A 5G0TA 1GUFA 1O5IA 3GPIA 1I8TA 3OA2A 1X7HA 3LVFO 5F3RA 3GDGA 4PVDA 2CVQA 4J43A 2O3RA 4OKIA 4XDZA 2DPHA 5IFLA 1OBFO 3MOIA 3DFZA 3GH3A 3PWKA 3AU9A 1FDWA 1EUCA 1MFPA 6ADHA 2Y99A 1MXFA 4E30A 3JQAD 1R0LA 5JAMA 4Z3DA 4XEHA 1Q7BA 3E18A 2JL1A 1YB1A 4IXTA 2EF1A 3U09A 1PGOA 1G0NA 1JKJA 4AL4A
chains in the Genus database with same CATH superfamily
3IVGA 4G8DA 2LPMA 1LW6E 3QKWA 5JEDA 3T5MA 4OHCA 1HE8B 1Z75A 2ANBA 3IQFA 4FGJA 4ASUD 2A84A 2VDUE 3I72A 3OJCA 4BFWA 2P0YA 4F93B 1Y4SA 4Y2GA 5CA1F 3J81A 1LS1A 4I5FA 3CG4A 5ITZB 2R8RA 4IQ8A 2WVHA 1TF7A 1VECA 2OAEA 3ULKA 5TQ0A 2O8DA 3O4JA 3OIFA 4MARA 3VTKA 5BN3B 3GCXA 4XYGA 4JYAB 4G0OA 4R8LA 4P7JA 1SBTA 3QKIA 4YNBA 3RV4A 3ZWVA 5BPFA 1CIJA 3URMA 4RS3A 2BEJA 1E6CA 2PJRA 1Z4QA 1B8OA 4GUAA 1BS2A 4LQ4A 1E2LA 5FLEX 1GQSA 3WL4A 4J91A 2RGWA 4HX5A 5EYPB 2FWBA 1JQEA 4FBMA 5E1MA 4GEKA 4PSAA 1T3TA 5THQA 2DWQA 3T3HA 4B46A 2AQKA 4TWBA 1W5AA 1B6SA 1G9SA 2FQYA 2J7PA 1PNOA 4MV7A 1FLVA 3WIDA 4MJ3A 3V1TC 2A5YB 1PEKE 3H7IA 4F1JA 2UZ1B 3G7UA 5K3FB 2ID8A 1H6DA 3M3HA 1CUYA 5C4MA 4KSBA 1W19A 1GNTA 3B36A 1SKQA 1V48A 3KJZA 1CRLA 1VIDA 2QX7A 4NX2A 4RHCA 5K3AA 2QRUA 3AERB 3AR4A 3EVEA 2I67A 4CG2A 4CKCB 4S3MA 2W42A 2NACA 4B5KA 2CBGA 3CIOA 3D6UA 1QYRA 1ZITA 3V5NA 4J4TA 1RLOA 2F7SA 3LCRA 5G3ZA 4Q7KA 2VHQA 3H97A 3ETHA 4TQAA 5CIWA 4AECA 2EFJA 1DBRA 4HDAA 3EQ6A 3SXUB 3SC2B 2PS1A 3OWXA 3ZHOA 1DP4A 1FLDA 3CIFA 2C5EA 4PHCA 4Y2VA 4A5SA 3FUVA 1GU7A 2TSYB 5EHNA 5K6AA 4UW9A 3PPWA 1DI0A 4IZOA 2JIPA 4QVGA 4NPAA 5F64A 3WKAA 2IDKA 1KTVA 3GUCA 3MBIA 4DDWA 4MTCA 3VAAA 2H52A 4LXUA 3N7UA 5FWNA 1QKJA 2ZR9A 1EGQA 1RKBA 4F4CA 1XZJA 3EMDA 3CHYA 3ETLA 3W5CA 4BAUA 4OBWA 3BL6A 2FFJA 3EDRA 4I1SA 5BN4B 1F2TB 3PRYA 4PW0A 2HX1A 1TXGA 4Q3LA 521PA 4GZ3A 1FLAA 4ID9A 4XGKA 5KVQA 4AWXA 1D5WA 2W58A 2QLBA 3DOOA 4IIJF 4BFVA 1Q0SA 4P84A 5HF6A 3VZCA 1ISIA 1IH8A 3TTTA 5B3LA 1ZRSA 1GNQA 4R3NA 5EIFA 1L5NA 1Z5VA 4E32A 3PQ7A 2PBFA 4CIVA 3P2KA 3T9BA 3MERA 4D57A 2QP9X 5LQKA 1X19A 5AJWA 1AZLA 3NPAA 4FDTA 2W2TA 4PX5A 3ZQKA 1W0KA 4H7PA 5FJIA 2CXOA 1UP6A 4BVGA 4G1CA 3WGLA 3WQBA 3LPAA 1NW3A 1QLJA 3L49A 2QTCA 1K6IA 3DXZA 1ZINA 3N2YA 4GRIA 1T6YA 1FP1D 4QOHA 3WFIA 3SS8A 1P3Y1 5JS1A 3V9PA 4OQPA 1E1RD 5BWNA 1Q7TA 1K3TA 1XCPA 1NVFA 2CFSA 3B1WA 2QRJA 1J0XO 1QORA 2H92A 4YCMA 5A1JA 1QH0A 3DVAB 2CJFA 1QQBA 4ZI7A 3SYLA 4QXAA 4OUKX 1VE1A 3NPMA 2I2CA 5EWJB 1G20E 4Z9AA 5JS8A 2D62A 3G6WA 1OCEA 2Z2YA 1X7YB 3QBEA 4A82A 3RGWS 1MG5A 3KFVA 1E96A 2XZLA 4BLUA 1O97C 3LUBA 1H2YA 4RIEA 1CUCA 4QXRA 5EJMA 1ZOOA 5BUQA 3ZOZA 3I2JA 5D2CA 2YQ4A 4LWQA 1SB9A 2GBFA 1T13A 3GJZA 4PO3X 2VO1A 4Y2TA 1H22A 5LN1A 4FU0A 3P0FA 4M87A 3OD1A 3QUQA 1RYEA 3O93A 2OK8A 4DR5B 4KJZA 1Y1LA 4U2CA 1QV7A 2DC1A 3U4GA 5JQGA 3L3BA 1ZUNB 3F7MA 2FZKA 1CYEA 5IAOA 1WHSA 4X94A 1R6AA 4XOIA 1SUSA 2VLIA 4U0JA 2HA6A 2EEZA 2I7CA 1ORRA 1OV6A 2YUTA 5GONB 4BB9A 3ZD7A 2FEOA 2QIPA 1NBMD 5AHOA 4WKCA 3WWCA 2EHJA 1KZGB 4OP2A 3LSYA 1OLOA 4DANA 4OFZA 3ZCTA 4RF4A 4GKKB 1V6SA 4ZZ0A 5KTNA 1IXZA 1IY0A 1G8MA 3R09A 1N25A 5IUKC 3NVAA 1BXZA 1Q84A 4L0MA 1GWNA 1LLDA 4JOCA 4O2BA 2GKSA 3VNAA 4IIEA 3RIHA 1ULUA 1CZKA 2V97A 4ZAZA 2ONJA 4OXRA 2OCBA 1JQ5A 1Q6ZA 3P2JA 4Y2UA 2OXFA 5AW2A 2F3QA 4K3UA 3RFUA 1N8TA 2QDKA 1HDGO 1GL3A 1HTBA 2E18A 2ZIXB 3OTGA 4PAGA 1D4ZA 4KXXA 3CEMA 2QVGA 4RDCA 1TIKA 1MTZA 1Z12A 1AQLA 3O8OA 5F1PA 3U62A 4MB0A 1C41A 3EDMA 1LBHA 3CLSC 1XZMA 1KJZA 2PFGA 2XYRA 3GP3A 3NBKA 3OX4A 3PFGA 4U4AA 5DNCA 3UUFA 5EJ9A 2B92A 4I55F 1YZFA 4W82A 3PQ8A 1G18A 4LHWA 4IGEA 1KJJA 4UAUA 4JVOA 2Y66A 4KIGA 1DNPA 4FTWA 4IIHA 1KR2A 3OIGA 5JCPA 1LWOA 1Z38A 1KK2A 4EY3A 2CVPA 5G1NA 4PQYA 1TM1E 1NVUQ 2G7ZA 3GYBA 1IHDA 2WWWA 4RNDB 3B89A 5FWDA 3W7AA 1WQ1R 4A8JA 4R9SA 3ZCSA 1SMKA 1ISPA 3LS2A 1IZYA 3A9RA 2Q5CA 1TLFA 1JKMA 1ATZA 5KYYA 3OCYA 3HDVA 3W34A 2JAPA 1WJGA 1KR5A 4ISBA 5BSMA 4AJ4A 1EWKA 4V0SA 3ZE6A 1GU0A 1MOPA 2WMOB 5ADVA 2AI2A 4R2JA 1WP4A 2GERA 1V0JA 3GNQA 3Q85A 1M83A 5GOZA 2OL4A 4KHZA 1LV8A 2PV7A 2X0IA 5DHTA 1FFYA 2EW8A 4HHEA 2ETXA 4EPWA 2KB0A 3FAKA 2PT5A 4XOUA 5CAEB 5KUTA 1VE3A 1T8SA 3DP7A 1VHWA 3QU2A 4BX3A 2OLJA 2WKSA 3EPRA 3P27A 4J1NA 5AVRA 3D8TA 2LD4A 5C8DA 3F6SA 1C1XA 1ZJ5A 1T8PA 2VJMB 1QFJA 1E1YA 4QTXA 4UNQA 2ON6A 3RU9A 2ZZMA 5HZMA 4MQLA 2VJYA 4ZO4A 1PTJA 3B7GA 3EZFA 4HCJA 2HNKA 4UBKA 2JGKA 5EJGA 1ULSA 1MJNA 1USVA 3OLWA 3UPUA 1H2AS 4I99A 3RTAA 1SAYA 2C7GA 3WHPA 5ALQA 4BHTA 3RSZA 3ND9A 1SHLA 2JFHA 3E5MA 4MR9B 3I58A 5LBUA 1VG8A 3OZDA 3ZHXA 4D45A 1UFRA 1FFDA 4HWRA 3PUJA 5A6SA 2C9CA 2R751 3RS7A 2E6KA 4DQ0A 1ZMXA 3G2IA 2JJ1A 3HBJA 4Q48A 4R41A 2FTKE 4OH1A 4WGGA 4XUDA 3BFPA 3G3EA 3JQ6A 3UFXB 3ZX4A 4AKSA 5HJEA 1I2DA 1W0CA 2IJGX 3GUVA 4UCXA 5CXXA 1EINA 5PNTA 5KSPA 4LC9A 1RWWA 2Q7XA 4CM6A 5JI3E 2BW0A 4IICA 4OM8A 3SHVA 5EXSA 4HGZA 4LJYA 2YXLA 2G6TA 1Z4PX 3GLVA 3PX2A 2BUCA 2JAWA 2G76A 4ZCIA 3C2QA 4DJAA 2VR1A 5CFRA 1SURA 1UDAA 3P5SA 4C6TA 3ICWA 4BECA 1JHOA 3K0HA 4BLTA 2X9VA 1SHJA 1KMIY 1R8JA 2CDCA 2G36A 2O7RA 1P18A 3DH0A 3NEAA 3QKRA 4RU1A 3UYKA 2I99A 3SZOA 4EGQA 5B4VA 3UJAA 3KELA 1BA2A 4Q9HA 3ER9A 3C39A 1ZJWA 2FETA 7REQA 1DFGA 2X3FA 5H4GA 3RNLA 4KFRA 5FLKA 2QUHA 3AESB 4IBOA 5FBQB 4ZCPA 4Y6SA 1P9RA 4W8GA 3QE9Y 3KD3A 2UYGA 4F2HA 1I1NA 1K7EB 1NXWA 2C5HA 4MX8A 5FNZA 3O1LA 1V8FA 1ZJZA 3ROTA 2VF5X 1KSGA 3FKQA 5KNCA 3EQ9A 5GJBA 3W6OA 1UH5A 1C7RA 3FYUB 4FS8A 2B7BA 1TKBA 1XLTC 1YQ9A 3NG1A 3KPWA 4LTMA 2CFOA 4P3XA 4ETIA 4JITA 4DN6A 3EPKA 3DBRB 4Z9FA 2BT4A 2VTKA 4QBHA 5FI3A 4V0LA 3Q6MA 1T2CA 1XNHA 1NQOA 1LQTA 1ZI9A 1ZSVA 2NO7A 2IVFA 3MJRA 4EFNA 3LCMA 4NQZA 3SEAA 3BT7A 1ZK0A 1SCJA 4DNQA 4DLSA 2QUZA 3S40A 1DQRA 2KQUA 3MQFA 4REMA 4JK3A 2BKAA 4ZVSA 2J3KA 1Z29A 3A28A 3KR0A 4FI3F 4ZQIA 1GT91 3I2HA 4MGEA 4R2XA 1PR4A 3NDRA 3LHIA 1P80A 5E0KB 3UK1A 4A03A 2BKXA 2HMUA 5BYKA 4YRBA 5KZMB 2FPGB 1M2VA 4CIYA 1BCRB 3GAFA 1E92A 3R3JA 1TUBB 4Q19A 4URUR 2IHJA 2P2SA 1VPDA 4M36A 1Q3HA 2Q8NA 3H1EA 4RDIA 3STVA 4C0XA 5BVGA 4KB5A 2XODA 4IJ6A 3NKLA 1OX4A 2PA3A 2E89A 4FGZA 2QAGC 3QXGA 1GPMA 4JB2A 4JB0A 4RZ3A 2AUMA 2H11A 3MJVA 5LXTB 4KNVA 4M0LA 3K8OE 1P0IA 2QGFA 2XXJA 5AI0A 4C4AA 2V6IA 5C35A 2CSXA 5ELLA 5KSYA 3DMFA 1P74A 3FMFA 4D44A 1VM6A 2FZWA 3N8NA 4I5IA 3BJZA 2I4RA 1V71A 3L1VA 2C31A 1X80B 2WDPA 1E8NA 2JGDB 2ZRCA 3MEQA 5A0VA 3PNKA 1D04A 1CDDA 1DRWA 3GGDA 3NBQA 1SXJA 1QGAA 3CWZA 3U1TA 1MMFB 2CCJA 1Z26A 1UMBB 2PWZA 2P2YA 3I1JA 3B9QA 1AKWA 4Q4AB 3ZE0B 1U0GA 5DKFA 4DCVA 5BWMA 3CUUA 1YJBA 1LB1B 2OE2A 3G6KA 2YWXA 2EL9A 5JXHA 2OVBA 1YR2A 2WILA 3PEFA 1Z6AA 1IZ9A 1I3MA 1UF9A 3AHFA 1UC4B 2F3RA 1IZ7A 1QZUA 2EV9A 3STHA 3O03A 1G9TA 4XIFA 4DM7A 4EH1A 5KYUB 3QELB 3GBSA 3LLSA 5LDDC 1UBGA 1I1QB 2H3HA 2O54A 4B9EA 2VWQA 4HR7A 2Q4RA 4OU4A 4EHHA 4DDVA 1CZUA 3OQIA 4L5BA 1Z47A 2PMWB 4OP1A 3OECA 5ALIA 1Q17A 1Q77A 3A9VA 5E8JA 1MV5A 3K9GA 1O4VA 1W4AA 5L45A 4OXQA 3DKIA 4JI2B 2H1LA 2W2NA 2WWHA 3GFQA 3N0WA 4RY2A 4ADSG 3RRBA 2FPWA 2XSZA 1YU6A 4PZCA 1FZQA 3FYSA 3H2GA 3IXLA 3KSDO 3LFTA 4DLRA 3J80A 1B8PA 1EFPB 1V45E 5A4DA 2GHQA 3I92A 1ZGAA 4MUMA 3CF0A 5JJ5A 2UXDB 4UULA 2LR0A 5CDHA 1QO0D 2Z2JA 4UD2A 4JEHA 4RVGA 4KDRA 5AUOB 1SA0A 2XEDA 1V11B 2VWPA 2VJLA 1ZH2A 1RE1A 2A14A 1LDBA 1ZN9A 2VDLB 2VZLA 3GJ7A 4REQB 5J4KA 3KIPA 3WNQA 3ZHTA 1W8DA 2V55B 1RHRA 4DLNA 1E6WA 5JDIA 1URPA 3IEUA 3E9CA 3B6EA 1RHJA 4EG6A 2BGNA 3KOZA 4A0RA 3ED1A 1DEKA 4QNMA 1XZCA 3KQNA 4UDXX 4JSYA 2H1CA 4U9HS 1JG2A 3UIEA 1R0RE 4R8KA 5M34A 4BL5A 3GN2A 2FJPA 4AG3A 1QIFA 2F1HA 1W35A 3EDYA 4CLOB 2G0AA 4IF6A 2H7XA 3OE7A 2NG1A 4OQZA 4OYRA 3ZBUA 4HVAA 4A92A 1F2UA 5TMDA 1TZCA 2GPTA 2EZTA 3O91A 1CJMA 1QZZA 4PLGA 4FX2A 1CUGA 5EPUA 1MRZA 3W2HA 1HNXB 3Q0EA 4C5BA 2V6MA 3VR5A 5L9AA 3BB4A 3IPXA 3A6ZA 5ARDA 4AJJA 1MJGM 1G5FA 4LTNA 3Q2IA 3KPUA 4M0EA 2B0JA 2J0EA 4C88A 3BD8A 1JIXA 4ZOAA 5AO9A 2PKEA 2QMOA 3SC4A 5JHGB 1GPWB 4NU6A 3I9V6 5KWVA 1H4TA 4L0QA 1V8OA 3ENNA 4UU8A 5GGYA 2QTWB 5ES3A 2EXXA 3K96A 4S1VA 4D3ZA 4B5LA 3LIPA 2W4QA 2PUVA 2R85A 2R25B 3TLXA 3G59A 4JLOA 1YB7A 4S2UA 4P32A 2IS2A 3NHRA 1P6QA 2H65A 1BWQA 1JI0A 3ZJTA 2CVZA 4TTVA 3WLSA 2W4MA 3SLKA 2ZRAA 4M49A 2OV6A 2G25A 1M5RA 4K0KB 2PKYX 3VA7A 2Q1YA 3M1LA 2CUZA 3VV2A 1QDLB 2V74B 4QLBA 1PUJA 1QC5B 1ULZA 4XASA 5IXYA 4TMFA 2LNDA 4HJRA 1T29A 5DO9A 1E1NA 4ER0A 1M1XB 1TO6A 1EJ0A 4KBFA 3RHZA 2WAAA 1KVUA 3OCUA 2H59A 2PZMA 4Y67A 5G3YA 2AJLI 2VIIA 3A6DA 4X3CA 3T6KA 2HR1A 2JFFA 3FFBA 3HMKA 4XGNA 3ZJ4A 1L4NA 1I7PA 1PFVA 1IC6A 2A0KA 3OQHA 1JH8A 5FTJA 1GGHA 4LRSB 5B7NA 1AV6A 2PZEA 3RK0A 1BJTA 2ZI7A 1L4FA 4JU9A 1D2NA 2HCBA 2IRWA 2W6JD 3VYTB 4EF5A 4KLCA 1Y8AA 3H4IA 1KC3A 2MYUA 1X2EA 5E7QA 2C7PA 4ZOEA 1GRVA 3B1YA 3GNTA 4ZZ2A 1NWHA 4IR7A 2GTPA 3O8QB 5G0WA 1ZW6A 3UN1A 3MAGA 1VKNA 3L1UA 4LXQA 3ZE7A 2YMPA 3WIVA 1FFWA 3TAHA 4BIMA 2XX3A 2NZUG 2YIVX 4CGZA 4Z9XA 1U1EA 3I32A 3UICA 4GAEA 4OV6B 5E6SA 5HKBA 2L42A 4X7MA 1W2GA 4NJEB 1VPLA 2ZJYA 1TCBA 2DFVA 2QU8A 5KKNB 1U2QA 1KYTA 3SSMA 3UQZA 1XE3A 3ICVA 3ADDA 2IXBA 3HI6A 4R16A 3TUJC 3VRHA 3S5UA 3ZWKA 4D3SA 2IXEA 4CW7A 3L7JA 5BVHA 5K0NA 4EUSA 2VPQA 1J6UA 2FDXA 2NVOA 3IMCA 4M1MA 3V3TA 3GUYA 2BL4A 2B98A 5FORA 4AJ1A 4YAIA 2O1XA 2WWGA 3U4MA 2CXNA 1QCDA 4KPUB 3CKLA 2F1RA 4BC1A 5BMOA 3NVKI 2HMSA 5L3QA 3DTVB 3PYLA 2FEAA 5FL7A 4UEWA 3BULA 4MVJD 1XAIA 4B3MB 1E3EA 4R0MA 1E7MA 3A32A 1G6HA 4C4TA 5U9CA 2NNLD 5DHPA 1QU2A 2LGJA 4Q18A 3N0RA 1Z2DA 3DS8A 1VHDA 1SUCA 2QKYA 2WZQA 2ZOSA 4JDUA 1VMKA 5FL3A 2CXSA 4JJ7A 1FTGA 1NY6A 2E5LB 1PK7A 3V8PA 4KN8A 3S3TA 1RLUA 4D6YA 1NN1A 4CEHA 4PONA 4X7BA 3CONA 1DMRA 4MCAA 2XVAA 4GP9A 4X6XA 5THXA 4BFUA 4H1TA 2OO7A 3MWEA 1VJCA 5SICE 4PEVA 2RBKA 3NP7A 1EBFA 2Z6VA 1MBZA 4K6FA 4YV2A 1WZ2A 3W0LB 2PIAA 1PL7A 5BOSA 1G8HA 3SD7A 3U2QA 1VMDA 3CY6A 5H3HA 4FC6A 3T5PA 4IDOA 5A5FA 1ZXBA 4FYVA 1KFEB 1R6DA 3ECSA 4KE8A 4UUQA 4UJ5A 4GVPA 7AT1A 2IYXA 3FOWA 4JFRA 3ZXXA 3E4CA 5ETJA 3RYFA 4CM8A 5IC4A 4Z0PA 2NV0A 1M2OB 1GRNA 4HEA6 1WNTA 2C7VA 1NXSA 4EG4A 4TWRA 1PGNA 1AG9A 1O9HA 3OBIA 4YI5A 4CLRA 1JV2B 2Z6QA 2FEWB 4NCIA 1I33A 4M1SA 1BDJA 3UOGA 4B6QA 2W5UA 5FWXA 3AJDA 1WR8A 4UVIA 3RKUA 3RLIA 1EXVA 1AK2A 5F7ZA 3V00A 5IT9A 1M2GA 1X8JA 1SIWA 1Z15A 2AN4A 5K8IA 5C4IA 2AFHB 1QTNA 3DNMA 2DHDA 4UNNA 5DK6A 2AZDA 1Z6YA 1JIIA 3UMVA 5ITWA 4XVRA 3H05A 1ZMBA 4S24A 3HA2A 3RSSA 3SQDA 1YDWA 1E2KA 3Q3GE 1HZJA 4HAXA 2X8BA 5KCZA 1YMVA 2HT6A 3NVMB 4IIBA 4JXXA 3FG9A 4B83A 4WY5A 1TZKA 3NDIA 4RZUA 3GIDA 4YK7A 4K2HA 4FOSA 4BLSA 4I1PA 3HEBA 1X7GA 4YS6A 5DYGA 5AI8A 2PDAA 5DXJA 4LRUA 4AF7A 2E48A 5FWYA 4E5NA 1PS0A 1XTTA 2EF0A 3NTVA 2X5XA 2UYQA 5CDFA 3BERA 4Q93A 2WV9A 4RK0A 3UT5A 5HZKA 2D0DA 4D5GA 4UXJA 2PR7A 2B61A 4YCAA 1TDJA 3DQPA 3W1VA 4H15A 1WHTA 3NOXA 4U3JB 4XLZA 2QRVA 3H04A 3OE4A 1JAIA 3L7CA 5EKUA 4IWNA 4FNGA 1KI7A 1PVVA 3HO6A 2G72A 2Y2VA 3U4DA 5J43A 3GF4A 3TR6A 2VHZA 1Q0HA 1U5CA 2QM7A 1XNRB 2CLMB 4O59O 1FJXA 5DBOA 3QMMA 4JGBA 3ST7A 3A1DA 2ZM5A 4BBJA 1O6GA 4X66B 1Q1ZA 1BFKA 2BTQB 2J30A 3E8XA 1NV9A 1TADA 3MCZA 4Q01A 2H31A 1NBEA 2DEUA 1GTL1 1HLFA 2YCLA 2XKJE 1MOSA 2PWAA 1EVIA 3D2LA 2Z58A 3EXEB 1JTFA 3UOWA 1E7WA 4EUFA 1Y8RA 3TG2A 2C9ZA 4PX3A 5C1IA 4EGAA 3BMOA 2OGTA 1NJ5A 1OVMA 1X7ZB 2QIOA 3RS8A 1QYVA 1II8A 3FOZA 4HXYA 4P58A 1BHQ1 2AN3A 2RGUA 2XW6A 2QZSA 1C14A 1GGKA 2A86A 2V54A 3DM5A 3FVWA 4Q47A 3OE5A 1V3UA 2C07A 4I5DA 3PDIA 1KKLA 4MUNA 2BI7A 3OZXA 1VL1A 1YE5A 2QUAA 1MU0A 1R3DA 2P35A 3LHKA 3FGNA 5CCEA 2UU9B 5IW8A 1FMLA 3H2BA 3ABSB 1XK7A 4ZODA 2ZTHA 2W2KB 4I1UA 4PG5A 5FBWB 2I7VA 3LDAA 5EUBA 3PEEA 1U1FA 2AE2A 4JI4B 2CMHA 1MZPA 5FTMA 2XWBF 4XWTA 3KSAC 4XFKA 3OZUA 4DYHA 4UHHA 4YRSA 2ZXFA 2Z98A 3EA0A 3RK4A 4BVLA 1Z6TA 1KRWA 2XB4A 1M8FA 3HJTA 4RA9B 3QYAA 3JZMA 3OO1A 1JLHA 3RKRA 1RQNA 3ESRA 1OXVA 3VBCA 2E7ZA 3A1VA 5BR1A 2XNHA 4R69A 3HGTA 2OFWA 4XAQA 3AF6A 2WIJA 4OEHA 1ISSA 1IZ8A 4ZQGA 1R5OA 4LF7B 2C8VA 2DFLA 1MPTA 3H8SA 4L6AA 4KYUA 4CV1A 1GSIA 4I66A 4F5DA 4FZVA 1DLJA 4QGSA 4DOMA 1SO8A 5CR9A 2Y4NA 3IQDB 5U4XA 1Y3AA 1ST2A 2BE9A 2JASA 5TQJA 1WDMA 4G63A 5JNLA 4BLRA 4N3AA 4ZC1A 3ENWA 2FPRA 1Y7IA 1WKBA 1Y9EA 2IYEA 3U80A 2J4CA 3K70B 1ABEA 1SIOA 3NHBA 2WU1A 4RCZA 1GLGA 4POOA 1DJMA 2Q3HA 5FLYA 2XTZA 4H6VA 4K9DA 4ICIA 1FFHA 1Y48E 4RV5A 5IBRA 1W29A 2E85A 1V37A 4G5SA 3B6MA 2JI7A 1PRYA 2Y68A 3G9QA 3KOXA 3FCCA 2N46A 3NRJA 4TVOA 1YQEA 3S2UA 1FP6A 4LJ5A 3RYCA 1RYFA 2VT3A 4YXWA 4EA7A 3D0QA 3E4DA 3DYBA 1BW9B 4GVXA 5AKGA 4HC4A 4U39A 3OT5A 3TX2A 5LYJF 3T12A 3DOCA 2GK7A 1I2MA 1RMYA 3CISA 3C5WP 4P35A 5KNDD 3A9TA 1QH1A 3RUFA 3MJSA 5AJZA 2ZE5A 3RADC 1CPYA 1P7WA 5DCLA 3B8EA 1BKYA 4F9TA 2B7LA 1BDIA 4NYMQ 1XTKA 3RTEA 2A67A 5DNAA 4QRDA 1RJFA 1UJNA 1MB2A 4LJKA 3AY0A 1U0LA 2QQGA 2OMKA 4ZCQA 1FTQA 3VO2A 1SFRA 4GG1A 2QJTA 3O92A 3WIBA 3MYYA 1M1NB 3ESXA 2K6GA 1C3VA 4KTVE 3RAGA 4A2CA 9LDBA 1WUYA 1R4ZA 3BAZA 3QVWA 2H1OA 4ECEA 2QROA 4NNOA 2JD2A 1PQUA 2D3TA 3OIWA 4MV6A 2V7EA 4D9GA 3PGXA 3AIIA 3VO8A 2W6ZA 4YV7A 1W59A 3O4GA 2A1TR 1EM8A 4X62B 4X00A 1P2SA 1YRWA 4NYIQ 4Q9KA 1N2CA 2VHJA 5TPZD 3V4SA 2XHZA 1ONSA 4O02B 4AXBA 4DZZA 5J4HA 4XYMA 5JSZA 5J58A 2P2DA 2IYSA 4MWCA 1P7ZA 3TECE 5F23A 4GU5A 4N0QA 1UM9B 1KU0A 3SN6A 4ALLA 3LT5A 1QFXA 1N3LA 3SMQA 5KEIA 3DAOA 3WLOA 2RHJA 1IUKA 4S0XA 4US0R 1SB8A 4I5GA 2J0VA 4WIAA 1SWWA 1M2JA 2PRIA 4AJPA 3S81A 3FOAA 4UEJA 4P3KA 3U7HB 5H3CA 2IYAA 2Y4OA 4HXGA 1AS0A 3RRYA 5EUMA 5TPWA 4CFZA 2JJ2A 5FULA 5LZ5A 4E6PA 5LZ4A 4YY3B 1J2YA 5AVJA 3KK0A 5DYNA 4ZCRA 2ANCA 4D9HA 4TMZA 1SWVA 1OWNA 1P0MA 3M1AA 5BV0A 4OQ4A 4JVNA 4EO7A 3KZVA 4Q03A 2YNMA 4MAFA 5ESWA 2YC4C 4YT2A 5AHKA 1OIVA 4CG3A 4P34A 1A7JA 5EGNA 4AZSA 1SZJG 1X70A 2V7QD 3H5TA 1FP4A 4Q1AA 3BTVA 3ND5A 5JQGB 4I2VA 2J4FA 2JJYA 3ZEIA 1AKQA 2HF8A 4IW3B 4MVJE 5CNKA 5LQSA 5KAMA 1XCLA 2W6OA 1ZEMA 2ATEA 2HO5A 5DT9A 1K7FB 1L7EA 2OM2A 3BJEA 2AXNA 1NXTA 3CH6A 1X9IA 2Q1UA 3NGLA 3OPYI 4DLBA 2C8JA 5CLGA 5FA8A 1DQZA 1E20A 8ABPA 1E64A 5FI0B 1N32B 3CKYA 5FBVB 4TSKA 1GG2A 1CZRA 4B34A 5ILGA 2KE5A 2IUEA 4EPYA 2VF4X 3DYVA 5JPIA 2ZR8A 1WF6A 5L3RA 2A0WA 4ZK6A 2ZJ1A 3VXKA 1SPXA 2WDZA 3T34A 5KHLB 5L3SB 4X65B 1QTIA 7REQB 3M83A 2YWBA 5D87A 4XARA 1X7DA 4G1MB 4O0LA 1EFRD 5C8YA 4AJNA 4ZYWA 4BYMA 3NYIA 1NRWA 1U0OC 5EY5B 4YCSA 4ZAGA 4CM9A 1LLQA 5T6MA 5F21A 4BTVA 2C00A 2QN6A 3RQSA 3KYDB 2I6GA 4DA6A 4CKWA 3PGLA 2Q9CA 5FNVB 3NB0A 3PXBA 3ITDA 3U7RA 4ZYLA 4B8ZA 1RLMA 2QTRA 3C6MA 5CD1A 2CK3A 4GQIA 2Y76A 2FSHA 1XZEA 2B78A 3F2VA 1YXMA 2QL5A 4GEGA 1I4EB 2QZ9A 1E2GA 1I2CA 4EVSA 1C8VB 3UAGA 1O0SA 1YGYA 1BN6A 1H8HD 1C3EA 1T10A 4LYAA 3U3DA 3FNFA 1MB0A 3HH8A 2Q7OE 3EAQA 1T1SA 1VGVA 2OV1A 1XTRA 3RIGA 5LP6F 2R8PA 3QW2A 4C2TA 1BKDR 2CV1A 3ZLAA 1L4YA 4JELA 2RHBA 2YHSA 1GSHA 2D1TA 2C96A 2KBEA 4L4ZA 1WRBA 1DINA 2OCIA 5FRDA 2P8SA 4URXR 1FSZA 3GUZA 3HO8A 5SZJA 3AP1A 4O2AA 3OCVA 3GROA 3GJ4A 1XEXB 5DX1A 5HQJA 2GZDA 1WXHA 4ZT3A 4YHHB 2OCPA 1M2NA 2BSQA 3VH1A 5FUMA 1MO2A 4BV2A 4V0RA 5IYZF 1G8PA 4DA4A 3WK8A 1QVZA 3EMKA 1ORDA 4N82A 1MENA 2HDWA 3GLSA 4L3OA 3I30X 4OO3A 1RHMA 1C9YA 2C4UA 2UZAA 2ATVA 2QWXA 2HTEA 2VYFA 4PLPA 3V7UA 4D99A 4ITVA 5HXAA 4OJMX 3DA8A 3SF8B 5LR6A 4ZARA 2O0HA 1A7AA 3GT4A 5CIQA 1NNUA 4UEKA 4UPDA 3WKDA 5LQNA 1B15A 4N47A 3VSCA 1M6VB 2G6BA 2IYOA 1PBTA 3HCFA 2WU3A 3JW8A 3V6MA 4PYJA 2NGRA 5JVDA 4D8TA 1M1YE 3B9PA 1VIVA 4NCXA 2P77A 2C0CA 5ENZA 5K0SA 2GBPA 4ZAWA 1SXJB 1UPXA 3AB8A 1XU4A 5C7IO 1L1RA 3KNZA 5E3JA 5I8WA 2VYND 5DN9A 2PMEA 2HSDA 3KAKA 2P6PA 1Y3IA 5H4HA 1CD5A 4DV7B 3KR1A 5AVKA 4L22A 1TUIA 5BSUA 3NATA 2DF8A 2I3ZA 2VK1A 1FOEB 3PIIA 4FT2A 1WKVA 4NONA 4RD6A 1A1SA 4I4TA 1JAHA 1OXSC 2WF7A 3L40A 3JATA 4J1SA 4ZHSA 2AMJA 4DR6B 3WYEA 3SNKA 1WSDA 2QR3A 1OHHD 4Q7EA 3K09C 3F73A 1G42A 1CUHA 2BGRA 5CNJA 4NH4A 3WNVA 1BMFA 3FHCB 2W8BB 1GILA 1U7OA 3OQIB 2O07A 4LXTA 3KFXA 2WUEA 3EEFA 3ROQA 4HV4A 3LX6A 1NN0A 1IY1A 4YMUA 2Q6LA 3AW9A 1P0PA 3GJ8A 3RKSA 1PDOA 2O7VA 1E6LA 2NXEA 1TMGE 3MRVA 4B1FA 3ONWA 5HG0A 1NXVA 3R7AA 3TOZA 4MMZB 1DXOA 2J4DA 3PA8A 2JG3A 3UMYA 4CV2A 2YWDA 1QUEA 4R1PA 2HF2A 5IAKA 1SOMA 3RC9A 2EDCA 1TQ4A 3CUSA 4GXQA 3W78A 3SZLA 5AVQA 4RCYA 3AM1A 5GMOA 2WM9B 1FRQA 2QTTA 2IXDA 1M8PA 3BD9A 1D0VA 3MAAC 2GXQA 3JD0A 3KU1A 3O1HB 3PTZA 4PPNA 5IKOA 4UD6A 3EX7C 1M0WA 2BP7B 3NYQA 3N76A 1E60A 4X1KA 1OB5A 1YMQA 5CYOA 3KUKA 3SXJA 3U7FB 1TKAA 2B1GA 3GMTA 1X1EA 2QNBA 4JAVC 1JDNA 1C7IA 2DPMA 1PJBA 4GR9A 1DXHA 4HO1X 1CVLA 1Q57A 2BPOA 4B4DA 1CKEA 3GFGA 3IVMA 3BFVA 3N8KA 4JJ8A 3FBTA 4HB2A 3HUFA 4OOEA 3GJXC 2HXGA 3VNQA 4KXUA 4KUGA 3VSEA 2ACVA 1LSOA 2W2LA 2Y6UA 5ER9A 4US2R 2IK8A 4WECA 4NXMB 1GCGA 3FGOA 4CRWB 3VGPA 3VYVA 1I7DA 5CA0B 2V6JA 4ERXA 1PGQA 5D5QA 1PR3A 4QFDA 3SQXA 2YIMA 3LSTA 2OFXA 2OPHA 5JJIA 1KAQA 1AKVA 1F1BA 4EJSC 3D7KA 1QP8A 4IS3A 1Z0UA 5AH0A 2PUFA 4FS3A 4D8XA 3EW9A 3QX3A 4NV1A 4BE4A 3H0EA 4DCTA 3DLBA 3D4BA 4DKXA 2WTXA 2X0KA 4EF6A 3AYXB 4PC1A 3FZGA 4C07A 2IHUA 2NVUA 2XNDD 3EEOA 3NTUA 2CWWA 3D8UA 3FCAA 2WNHA 1EM6A 2FUG6 3QFSA 1J20A 1KPHA 4UVEA 1U8FO 5JNWA 1JWBB 3RVRA 2QAJA 4UBJA 4OB6A 3WMFA 2X76A 3GOHA 3QLEA 4CKYA 1RQPA 3RAEC 1FPMA 1UJBA 1N5JA 1OV4A 3BCSA 3PIDA 4CFSA 4S1WA 4W5QA 1DG3A 1CF2O 3O2QB 3C5HA 3OJEA 4G9GA 5HUHA 4X54A 3BL5A 1OZGA 3LY5A 3U4IA 4RSMA 1MHTA 2D1SA 4F6RA 3L0CA 1UBKS 3M9XA 1K5GA 1UPTA 2FPXA 4BKUA 4JUDX 2NU6B 3M2TA 4YCDA 4GRDA 4UBIA 3FSEA 4RXUA 4RTJA 4JIGA 2VUIB 3H2IA 2B5VA 5CT4A 5K09A 2XDWA 5IN5A 3SPXA 4HAYA 4LFCB 3I04M 4KQCA 4DC0A 1JRLA 5KYGA 5DLEA 3PR1A 2RCYA 3FVTA 4KGZA 4IXMA 1WVGA 3NQ41 2HBQA 2QRLA 3H1FA 4BUZA 3G8YA 4Z4EA 2JLXA 5A9SB 2O3SA 1H69A 2J5BA 3PPXA 4GFDA 4KE9A 1A2KC 2WR8A 1FNCA 4YFYA 4QBIA 3N86A 3VPCA 3G8AA 4L72A 4BQIA 2BEUB 1Q7EA 1XMIA 5BNWA 4PZ0A 1DWUA 4LYHA 1K3UB 3GVCA 4K26A 4N0DA 4BJ3A 1CZLA 3LZ6A 3QWIA 3TD6A 3THWB 5IHPA 4YRQA 1K7YA 2XY4A 4ZXPA 4EGSA 5A9RA 4AP5A 3VR5H 3BWVA 2FN4A 3NIDB 4C0JA 4DQUA 1F7VA 1QFYA 3ROXA 4R84A 4F3RA 5JG7A 1XR3A 4MZXA 4ENRA 1H1LA 1XTPA 2GVNA 1WSBA 1W6RA 3VR1A 4LOKA 3DGEC 5CM9C 1GPBA 2PLFA 4EG3A 3P97A 4OJNA 5DNUA 5HJ7A 3QVJA 2PGJA 5IJAA 4WZAA 5IBQA 1PZNA 2CNBA 3ZOKA 3MT0A 3ZBPA 5C3MA 3KOUA 5HRAA 3PSAA 2VHVA 4R1UA 2O8CB 4P1ZA 1J06A 1WU7A 4QO8A 2YZ7A 3EXHB 1JQ3A 5F9MA 4X63A 4YVFA 3Q3EA 4ENQA 1R5JA 3QGMA 3HMQA 2CLSA 3GLIA 2JLSA 2RIRA 3PXDA 3PYXA 1AD2A 1ZIOA 1J99A 3EBOA 3LDGA 4LOHA 1P2VA 4CT4B 1ACMA 4Q4JB 3U7QA 2PGXA 4PBSA 1PT9A 2R00C 3VZBA 1GDTA 1FFCA 4M1YA 4AMZA 3FHTA 4I46A 2GEBA 1XALA 2XV1A 1ODSA 3D1JA 1HDYA 2GAJA 2I7DA 3AI1A 2HRZA 3MT7A 1NA5A 2I6UA 3OFNA 4WXHA 4ZO8A 5C1BA 5LQCA 1C9KA 5LWQA 3T1VA 3TB6A 4X1OA 3SJUA 3UWPA 5AMXA 1MTOA 3ZCUA 4DMRA 4XVCA 1WXGA 2A33A 3MCWA 1K2VN 5CCXA 2XOEA 1AKNA 3WA6A 4I6JA 1QXSA 2C54A 4N9WA 5D86A 4QC2A 1U02A 2AHRA 2I2FA 4G9EA 1OBVA 1RWPA 1RXCA 1ADGA 1G3IA 1LFAA 1T0BA 3BILA 4WLVA 4RTQA 1NUPA 1N3YA 4HGOA 4RIFA 5HBRA 1NBWB 3ER8A 1KBQA 3AL3A 1L8AA 1DO8A 3G5MA 3FFTA 1CZHA 4XVHA 5TE9A 3D59A 1XXLA 1E58A 3O90A 3CZMA 3PI7A 2JVJA 3HCBA 3IHTA 5GOTA 3IC5A 5I4IA 1QPGA 1QAMA 4FYWA 1FA9A 1ZK4A 2JIZD 3QU7A 4D42A 1TU3A 3KOOA 4ZVVA 5HSGA 3HKEA 2DETA 2ZIGA 1KOFA 2FAXA 4E33A 5CXUA 5MFZA 2WQ6A 4AKEA 5A4AA 5TGDA 3PUIA 2BFEB 3M4JA 2HCJB 5HPYB 1KVSA 3EGEA 2XBLA 4KW7A 3N28A 4QDZA 4IV0A 1ZVQA 1HBJA 3OFSA 4P3OA 1QB8A 3PDHA 4XCVA 4YIKA 5KQRA 4KVFA 3DOFA 3HXOA 2AG8A 1D7AA 3N07A 2Q21A 4O0MA 4ZYUA 2PUBA 3S0JA 2HPHA 5DTIA 1OZHA 5LMUB 3BE6A 4OXXA 1YJAA 3HZZA 5EP2A 2CT8A 3GU3A 2XZTA 2EGUA 4HDKA 4N4AA 4TMVA 4UE6A 1EUCB 4HDNA 2CHEA 3H2JA 3QU4A 4LECA 3T9DA 3BQ9A 4TKLA 2H0QA 2WHPB 4Z51A 1AO3A 3B6JA 2ZLBA 4KR7A 2CXHA 4EZBA 2PLAA 3A31A 4AM8A 1C80A 3VKFA 4ZMSA 2VDRB 4XJTA 3DDCA 3WL3A 4ZI7F 5F9HA 3I09A 1LPNA 1RYZA 1XPUA 4KR6A 4EUHA 1L1FA 3ZV7A 1FX1A 1XZPA 2XMDA 4G6ZA 3WYDA 1MF7A 1ZONA 5CHEA 3R7FA 4XWGA 2C0PA 3ZWOA 2RE8A 2IEBA 4XD2A 1USUA 4BKPA 3OWHA 1SNYA 5JO0A 1Y6ZA 5J2UA 1GUAA 3AUJB 3HA7A 4ZTBA 3AXSA 5JU6A 1VBKA 3TQFA 5JFTA 3QK7A 1O6FA 5D6OA 4EFKA 4EHJA 3BHNA 1EUDA 1PQ4A 2XTMA 5K8LA 5AW5A 3MK31 3JD3A 4DJ5X 4JI3B 4W5TA 3LHFA 5ALHA 4I9FA 1W36C 1MC8A 3N2NA 1IMOA 4QLOA 2YJZA 1SQ0A 4KMMA 3IURA 4MW5A 4XPZA 2AV6A 1II8B 1FX0A