1I3LA

Molecular basis for severe epimerase-deficiency galactosemia: x-ray structure of the human v94m-substituted udp-galactose 4-epimerase
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
347
structure length
347
Chain Sequence
AEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAMGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNVVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords UDP-GLUCOSE 4-EPIMERASE
publication title Molecular basis for severe epimerase deficiency galactosemia. X-ray structure of the human V94m-substituted UDP-galactose 4-epimerase.
pubmed doi rcsb
source organism Homo sapiens
total genus 126
structure length 347
sequence length 347
chains with identical sequence B
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 2001-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1i3lA02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1i3lA01
1J5PA 1N7GA 4Y9DA 4XIYA 1EMDA 1X0XA 3OIFA 2WE7A 1XKQA 1EK6A 5IAAA 2VYND 5B37A 3DR3A 1D1SA 1O8CA 4TRMA 1PJBA 3SVTA 1CETA 3MEQA 5JDIA 9LDBA 4JIGA 1DFHA 4XD2A 1M6HA 4F46A 1AXEA 4AVYA 2EKPA 4MINA 1I2BA 3HDYA 3PIDA 2Q49A 3GY0A 1E7WA 4N5NA 4CUZA 3Q9NA 3O03A 4G5HA 2GZ2A 3WMWA 1OOEA 4DYDA 3V1TC 5I9MA 2FY8A 1T2CA 3HADA 2JFGA 3QVOA 1QP8A 4BNIA 2FP4A 3DBRA 5AVOA 3ZWVA 3G3EA 3RFXA 4AJEA 3ZWBA 1WMBA 4Y8VA 1I5RA 5BR7A 2I65A 1O89A 5ER9A 1E3SA 4CM5A 5L40A 1F06A 3DQPA 5K9ZA 4CV3A 5EN4A 4PLFA 4YAEA 1U5CA 1DHRA 1ZK2A 1OZAA 3L9XA 1H0KA 1ENPA 2Q4EA 3QWBA 4OKIA 3AFMA 4PG4A 4W9NC 3JQFA 4WGGA 2PGLA 2B4RO 1IL0A 4FDAA 2ZTLA 1LSUA 5DP2A 2Q99A 4B3IA 3KYDA 3F5QA 1SB8A 3C7AA 5JC1A 4CPDA 3ZNQA 1Y1PA 2UDPA 1C1XA 3QVWA 1Q7GA 3UICA 4CLRB 1U3VA 3PQFA 3H6KA 4IDDA 1T24A 2GCGA 3WBBA 3NGXA 2DBRA 4BV9A 2CF5A 4DPMA 3IAHA 3TL3A 1GQ2A 4CM3A 4DL9A 3NYWA 3H5AA 2PNFA 2VWQA 4JJIA 1H6BA 3VDRA 2IODA 3WIDA 3RUFA 1Q0LA 4IMRA 2A4KA 1M6WA 4MKZA 4NG5A 4JBIA 1EDZA 3I4FA 3ROQA 5ENDA 4WK6A 2DBVO 4W82A 5HS4A 4R3NA 2OOSA 4H15A 4BKPA 3RROA 1ZBQA 4GKVA 2WMDA 4JN6B 4ESOA 3NEPX 5COAA 2HMWA 1NPYA 5JAQA 3OMLA 1PZGA 2O23A 7MDHA 1P1HA 3AUTA 1JA9A 2YW9A 2Y93A 4N5MA 1LLUA 1HYGA 2DFVA 5CDUA 3GMDA 4NNJA 5CDTA 3RJ5A 4HFNA 4EDFA 2IXBA 5COBA 3RKUA 2GPTA 4FPXA 3ZH2A 4Y6SA 4J90A 4E33A 5L95A 4WE3A 2YQ4A 4E2YA 2ZATA 3RBZA 1V35A 2WYUA 4WEQA 2JD1A 3FTNA 3DZGA 5AYVA 1KVUA 2D8AA 5CPFA 1N92A 4GKBA 3B6ZA 4P22A 4ND1A 4J9UE 1BMDA 1SO8A 1E77A 2HK8A 3ZV5A 3K9QO 4Y6RA 2IZ0A 2BD0A 4PLTA 1IZ0A 2XXJA 1QYVA 1G1AA 2HMUA 5T6BA 1MC4A 5L4LA 3HG7A 3ZWNA 3LLSA 3PYXA 4NJOA 2XPCA 3RUHA 4KUHA 4W4TA 4RF5A 1X7HA 3AUUA 3D7LA 3GHHA 4CUJA 2J5KA 2X4GA 4E2ZA 1ZK0A 3NT4A 3WYBA 1BTOA 1BHSA 3KEOA 3ULKA 2WJPA 1A5ZA 1LLDA 1M66A 3AU9A 3NGLA 4NPCA 3TF5A 2FOIA 1GR0A 2BH9A 3W8FA 5IZ4A 4YT5A 1JN0A 1GU7A 3RUDA 1E6UA 3JQEA 1QYWA 4Y67A 3VH2A 5COQA 3MJ4A 4MVJD 1AUPA 4BVAA 4DMLA 3FNHA 1JWBB 3BTVA 2V6FA 3OICA 4OIMA 1EQ2A 3JQ9C 1DIHA 3VH1A 1HRDA 3IKVA 3CKYA 5A9SA 2VTDA 3TJRA 2HJRA 5G4KB 1QSGA 2B36A 3BMOA 2YHIA 4U0KA 3KM0A 5A4DA 3GRKA 1IZ9A 3HN7A 3E5MA 4H3VA 1LX6A 3VZRA 4BO1A 4DBVO 4Q39A 2B4QA 4BO9A 2C0CA 4BO2A 4KZPA 3RC2A 3WGIA 1PJ2A 2AQ8A 1UXKA 3PIIA 4UUPA 2PGDA 1Q2XA 4B8ZA 1P0CA 2B83A 4PLZA 3VKVA 4XJSA 5DOZA 5KVVA 4K6FA 2HQ1A 5A9SB 2I9PA 1BRMA 5LDGA 1KVTA 3WBFA 1LEHA 4EJ0A 2UUPA 1E7YA 1DBVO 3L77A 1I8TA 1IHXA 3L4BC 4RGBA 4A27A 1ADGA 2HSDA 4R4JA 2DT5A 4MP6A 1DJQA 1UP6A 4U5QA 5C37A 4I5GA 2J6IA 1XELA 5TF4A 1GFSA 1IYZA 5ADHA 4NBUA 4WCFA 1XG5A 2YDYA 3WNVA 2GASA 4J7XA 1H6AA 1LDBA 4OQYA 2VHYA 4N5LA 1PIWA 4CUKA 3DZFA 4MVJI 3BHIA 3GPIA 1HDOA 3HDQA 4LW8A 1I3NA 1ZMOA 2B0JA 2GN9A 3GRPA 5IF3A 2BFPA 1H6CA 4WECA 3IKTA 1K5HA 2F00A 4DYVA 3OETA 3IQDB 8ADHA 1DC3A 1Q1NA 1EFKA 1ZXBA 2HCTA 4GBJA 2RBEA 2P91A 2Z5LA 4WCFB 4IDEA 2ZJ0A 5FI3A 3HB5X 1PGOA 3IMFA 2CMDA 4M89A 1RWBA 4P4NA 2O4UX 4UEJA 1H5QA 2XAAA 4YXFA 2VWGA 4ZQGA 4I5FA 1NWHA 3MWDB 3NX4A 3H9QA 5AXAA 4CMBA 1GY8A 1KY5A 1U1IA 1FDTA 2FZWA 2OHXA 4Z6KA 1Z7EA 4AJ4A 5C7OO 1ML3A 3ANMA 4UULA 4IDGA 4O5OA 4UEOA 1LQTA 3Q1LA 4CMEA 1HDYA 1I3KA 2DBZA 2HMSA 3L6EA 3TZQA 2GERA 1ZW1A 4DIOA 3L6OO 2HKIA 1PZEA 1GZ6A 2AQIA 3QWFA 1KC1A 4AJNA 1QLJA 1FXSA 4AJ2A 5TLSA 1HE4A 1P74A 2EWMA 3EYWA 3UW3A 4NBWA 3I1JA 4GPD1 4NBTA 1PR9A 2P2SA 1DLIA 2D2IA 3RVDA 5B1YA 4E5YA 3Q6IA 1ISMA 3FR7A 3PHHA 4H7PA 5K6AA 1E1NA 1LSSA 1UP4A 3I9JA 4IIVA 5H81A 4K1LA 3ZW9A 4D3DA 1U7TA 4ZHSA 5KJ6A 5T8KC 1CERA 4D42A 2XF8A 3WYCA 4QXMA 1B2LA 3WGYA 2AEFA 3ITDA 3IOYA 3LQFA 3GHYA 4X54A 4R9RA 3LT1A 1QYXA 2OP1A 2AQKA 2FR8A 3WXBA 3OQ1A 3I5MA 5TNXA 3Q11A 2V6BA 2JJYA 3FWNA 3NTOA 4ILKA 1MC5A 3DB2A 3GZNB 1Q0HA 2AE1A 1UP7A 3FI9A 2AEJA 1WNTA 3ZZNA 3RBVA 3PZBA 4KP7A 2YYYA 1LQUA 4IDFA 4GGOA 3JQAA 4Q3CA 3LLVA 3E9NA 1LRKA 4B4WA 1I2CA 1NQOA 3K6JA 4RZHA 3JD3A 1XQ1A 4HX5A 1ENZA 5KJEA 2ZTUA 2HMTA 4YR9A 4DLBA 1U4SA 2WYWA 2VT2A 1UAGA 2YFHA 4WLNA 3PQEA 4BNYA 2V6MA 5G0TA 3DXFA 3BHMA 1NFFA 1HDZA 3TOXA 1VRWA 3BMCA 1LC0A 5H82A 2QX7A 8LDHA 1V0JA 1LUAA 1AE1A 2WWRA 2D5CA 3EVNA 1PSDA 5L7TA 4MVJF 5TGDA 1ISIA 1W0CA 1RPNA 4PG6A 3DBVO 1GQQA 2R00C 2DLDA 4LISA 2DKNA 4IZIA 5U9CA 4YJDA 5JAIA 1CJCA 3QRWA 4J91A 3BTSA 3TZCA 1F0YA 4WPGA 1Z74A 4XGNA 1PS9A 1OC4A 1XSEA 2HRZA 4BO4A 1EE2A 3HZZA 3FR8A 4D44A 3QWIA 1PQPA 2PZLA 4J1TA 2RIRA 3H9JA 2W8ZA 3VH3A 5DNAA 3DBLB 2CZCA 1EUDA 2CVZA 1B3BA 1M75A 2QZ9A 4UVHA 3JYNA 1GADO 5HWSA 1CRWG 4XX0A 3L0DA 1XLTA 4NIMA 4K9DA 1PJLA 1DRVA 1I0ZA 2QIOA 1IE3A 4OSOA 4GX1A 2OUIA 2UYYA 3DC2A 4U6SA 3AUAA 3N58A 3H3FA 3PJFA 4AFNA 4DBZA 1KEPA 3KV3O 3NDIA 2CNBA 1X15A 4ZQEA 5I9NA 2OL4A 5CHEA 1EFLA 4CM1A 2G76A 1GCOA 4MP3A 4PZEA 2J3HA 4JBHA 4Q9NA 5FFFA 5EIOA 2PWZA 3D5TA 5TJ9A 1NYTA 1T4BA 3FTPA 2NSDA 3ZCXA 3HUDA 1F8GA 1DFIA 2V6GA 3DWFA 3PWKA 3CMCO 3DOOA 2DC1A 5B4TA 5A3JA 3OQ6A 1X13A 1VI2A 4TZTA 3TPCA 1YL6A 4PG8A 2YZ7A 2ZYGA 1GUYA 2EW2A 1NVMB 5IJZA 3FPLA 2I66A 3ZNNA 2QYSA 1BWSA 4HADA 4RLSA 1PU2A 4FBGA 1PX0A 2O7QA 3JYPA 5IZCA 4WUVA 4CM8A 1TT5A 4J7UA 4ROSA 3JD2A 1B8UA 1PTJA 4RVDA 4MIYA 4I5DA 3S2FA 3F4LA 1VM6A 3WNQA 1MG0A 1E0DA 2YV2A 1N7HA 2B4TO 1EEHA 2P5YA 4EZBA 5J23A 2E48A 2Q45A 1U28A 3JQGB 1U3TA 2P68A 2W4QA 3DAGA 3ZHYA 2UV8A 3WICA 4YRDA 1VJ0A 3ZWXA 1P31A 2PA3A 3ST7A 2VN8A 1HKUA 3PZRA 3SLGA 1SAYA 1TT5B 4MKXA 4JCOA 3SC6A 1UXHA 3P2OA 4XKJA 4DLLA 1PL8A 5JNLA 1R0LA 4BL5A 3GVXA 1I30A 3ZW8A 3DHNA 3KO8A 4TKMA 5DP1A 1ZVMA 4KOAA 4GAEA 4BO3A 3H9EO 3ZI0A 2O3TA 3H4VA 1C1DB 3JQCA 1OMOA 4H16A 3TN7A 2FRDA 5HA5A 1B26A 4GWGA 1A9ZA 2BHLA 3NV9A 1X7GA 2AXQA 4B3HA 3PFFA 1ENYA 5JYEA 4O1MA 3F1LA 2VNAA 1NR1A 2GR9A 2O3JA 4AL4A 1WVGA 3TFOA 4Z9YA 4D41A 4YB8A 3ZWCA 1YDWA 4QTZA 5DCUA 3GVHA 5DN9A 4C4OA 2ZQZA 4YVFA 5FF9A 3H7AA 1ONNA 3TZ6A 5JE8A 3NDRA 4FQ8A 4I08A 2ILTA 4JP3A 3U9LA 3UXYA 4NFHA 1TEHA 3SEFA 2Z95A 1P1IA 4XIJA 4YDRA 2DUWA 1DXYA 3RU7A 2PD3A 5JO9A 3D3EA 2P4HX 1YOVB 1QR6A 1O6ZA 4W9NA 2EW8A 2HJSA 3H5RA 4XZ3A 1ZUD1 1ADCA 3QHAA 4NMHA 3BXXA 3EK2A 1P9LA 2CF6A 4J1NA 4IIUA 4M55A 2PZJA 4BNZA 4EJMA 1KETA 1OI7A 4J0FA 4R01A 4XCVA 2AQHA 1SCUA 1MX3A 2PZMA 3IC5A 4EUFA 4GH5A 4YCAA 1E6WA 4NK5A 4FJ1A 4CMKA 1XDWA 4TSKA 1YBVA 5F5LA 2VTEA 5GZ3A 4NK4A 2C2XA 4FOSA 3I9OA 2A94A 3HE3A 4IPTA 1XCBA 4P8RA 2GSDA 2VYVD 3T4XA 4GMGA 4XB1A 3A14A 1JQBA 5JY6A 4RZIA 3MCVA 1C0LA 2ZCVA 2Q1SA 3A28A 5JAZA 3C1TA 4RV9A 2QRLA 1NFQA 3FBTA 4IY1A 3ZHXA 3CTMA 2HRBA 2BLLA 2E49A 4BO8A 3KETA 3E18A 1WW8A 1PR3A 5KIAA 4FFLA 3UOGA 3ROPA 4JLWA 5G0SA 4E30A 5TRTA 2JKVA 3VPXA 2VUSA 4ND3A 3ZWOA 4NZ9A 4U0JA 3QWHA 2DFDA 3JQBC 4S3MA 3JQ7B 4KDFA 4BNNA 3O4RA 5DOVA 1VPDA 3C7CB 1YB4A 3LT0A 2JAHA 4YPOA 2P9EA 3QP9A 2Y1OA 2GRAA 4UREA 5A03A 2X9GA 3WTCA 1I3MA 5KNLA 3A9WA 4R41A 3QWAA 1HETA 4BMSA 3CSDA 4GSLA 2EP5A 3D5QA 4NU5A 4QSMA 4WJZA 1V3VA 4C7JA 3K31A 4LMRA 4YEDA 4XR4A 4YAGA 1ZJZA 3PHJA 1P1JA 5JAMA 5AOVA 4RF2A 3NTRA 3WSVA 1ZK1A 4DA9A 4EYEA 2FN7A 6LDHA 5L51A 4Q3NA 4RPGA 1R66A 4DMMA 1DOHA 1HF3A 1KVQA 2B5VA 4CM4B 1HYEA 1MFPA 3WGHA 5DCWA 4FB5A 3ENNA 1WDKA 4AICA 7ADHA 4CLXA 3M2TA 4CMCA 4MJLA 1B0AA 3RKRA 3RAJA 3JQ9A 3KLPX 4ZRNA 3B20A 4Z9FA 2ZTVA 3E1KA 4XYGA 4U7WA 5ENVA 3V1UA 4HP8A 4BMVA 4OQZA 3HN2A 1H6DA 1R15A 2YQ5A 2BGLA 2ZIZA 4AJKA 1NP3A 4PIVA 5I7EA 2AEMA 4R3WA 3F3SA 4R9SA 3AUSA 2AHRA 1U3UA 1BGVA 4BO7A 3DBHA 1TVEA 3KRTA 4NQZA 5AXCA 1QORA 1ZXLA 4OMUA 1W73A 3HFSA 1RM5A 1UXJA 1T2FA 4Z0TA 1E92A 1K6XA 4TMFA 3EC7A 4HWKA 3UGKA 1G6KA 3OEYA 3GN2A 1P44A 3T7CA 2CY0A 2Q1TA 4N54A 5GY7A 1YQGA 1HLDA 3L4BA 2DM6A 2E37A 5HTOA 3WX0A 1YB5A 1SOWA 2EJWA 4PLGA 3NTQA 5FWNA 2HDHA 3DMTC 3FBGA 3FF4A 4NFSA 5JC8A 4JQCA 3R0IA 4G81A 5HS6A 3RFVA 3TFQA 2W90A 3AY3A 2FSVA 1XWFA 3N7UA 4R68A 1BXGA 3DBRB 4E5PA 1EBFA 1GUZA 3GDFA 1PS0A 4WEOA 2YFQA 2D4AA 2VWPA 3RCBA 4A2CA 5I8WA 4TZKA 1NBOA 1VE9A 3BMNA 3CINA 5JDCC 4CV2A 5KKCA 2PV7A 2EHDA 3ZGYA 4QECA 4A26A 4EJ6A 4N7RA 5KVSA 4OOEA 1H93A 1QV7A 1NX6A 1KVRA 4UUNA 2CVOA 5I7VA 4J43A 4YJGA 1I36A 3RBXA 1LDNA 2X5OA 2VZ0A 3H8VA 3OIDA 4JNKA 4E2XA 2OBYA 3RUCA 1ISHA 4MO2A 3FWZA 3PJDA 2H63A 4E3ZA 5JFOA 4L76A 5BNIA 1ZO8A 2RH4A 3NJ4A 5CP8A 3UN1A 3PGXA 1WPQA 3BMNB 3C24A 3FCOA 2GZ1A 4OO3A 3GF4A 4KTVE 3AI2A 3VKUA 1Y9AA 1NNUA 3KYDB 3QSGA 4CL8A 2ZJ1A 3CPSA 1LU9A 1C1XB 1V3UA 5JW6A 1X7DA 4CMHA 4XQEA 1E3IA 3OJOA 1KC3A 1LLQA 2BGMA 1KY4A 1BW9A 2GYYA 3L6DA 1O95A 3C3XA 1QKIA 4CR6A 5IFLA 3NKLA 2RAFA 1E7RA 3LF2A 4Q3BA 2VQ3A 2CSUA 1GV1A 2O3QA 4KQXA 1PJQA 2HLPA 1GCUA 3HSKA 4DVJA 4NJMA 4PG7A 2XXBA 2Y1DA 2VRCD 4D7AA 5T8KA 4DIFA 4K6CA 4JBGA 2I67A 4M49A 1P0FA 1U9JA 1BW9B 4CMIA 3RFTA 1PZHA 6ADHA 4YJFA 3GK3A 1G0NA 2EGHA 1RKXA 1R0KA 1O9BA 2Q1UA 3O38A 1KIFA 3ASUA 4BNUA 4ND4A 3MJVA 3VPFA 2X0IA 4CL3A 5CPBA 3RD5A 5AXDA 2HAEA 4CLOA 5EPOA 4G2NA 2OXIA 3OFSA 4IJWA 1X0VA 3Q0EA 1T26A 3E9QA 2JFHA 3UAGA 5JPIA 5I7SA 4YACA 3GZ4A 1F17A 2BI7A 4URFA 1NTOA 3EMKA 1ORRA 4U8GA 1DAOA 2R2GA 1DIBA 4F6LA 4R1NA 2CVQA 2VOJA 2W2KA 3TSCA 3FN4A 2NADA 5L4SA 4PRKA 1JKIA 1O94A 3ZWMA 2WD7A 3X2EA 1PWZA 4D79A 4WNIA 5BSGA 3GEMA 4FSHA 4ZD6A 5DULA 5KJFA 1QYDA 2ZK7A 1EVJA 3AWDA 2R00A 3GOHA 4XYMA 1UZNA 4NI5A 3PYMA 3CXRA 4OYRA 3AY6A 3BMQA 5CDYA 2PD6A 3PYLA 2GF2A 2JFFA 5CEEA 5A3VA 2BKAA 2Y66A 3IIEA 2QYTA 3D3WA 4TQGA 4S1VA 5A04A 2PFGA 2ZB7A 2GN4A 1EVZA 3COSA 2WD7B 3K8ZA 1RJWA 2QHXA 3GGOA 3W4IA 4N18A 4RPJA 1E5LA 2Q4BA 3BMOB 4MVJE 2YHIB 3TQHA 1WZIA 2GLXA 3GA0A 4RPKA 1UDAA 1WDMA 1RYEA 1LSOA 3S2EA 4J4HA 1Z73A 3WLEA 1GD1O 1D1TA 3D3WB 3QVSA 3JYQA 3ZHBA 3DMYA 4D45A 2PLAA 1YB1A 4FD3A 4RF3A 4Q3EA 1WWKA 2GN8A 1E5QA 5ILOA 4AJIA 1J6UA 2EKLA 3I83A 2VHXA 1E6EA 4XYBA 1MG5A 2Z1NA 3PRJA 3U62A 3OJ0A 1X1TA 1ZJYA 4ZA2A 3A4VA 3MJSA 5CDSA 1XU9A 3ETDA 2Q2QA 4JXKA 2RHRA 4BNLA 3U09A 1R4MA 1Y5RA 1MFZA 3D1LA 4TRJA 1ARZA 4ZQFA 3F47A 2NU8A 4BS9A 1I32A 1YBAA 3VH4A 5CG2A 1XR3A 2Q1WA 5EQDA 2WSBA 3NUGA 4IQ0A 1D4FA 1ID1A 1N8KA 4BO5A 1JAYA 4DQXA 1EUZA 1NHGA 4HFMA 1E3WA 1T1RA 2DBQA 1UXIA 3G1TA 4E6PA 1YBMA 5KJCA 2HK9A 2IE0A 4LCJA 4D43A 4IINA 3WWZA 4PCVA 5G4LA 1NAIA 1NQ5A 3L07A 4R1SA 4XWYA 4BNXA 3KB6A 3WLFA 5TT1A 3I9MA 4QEDA 5JS6A 2NVBA 2ZB8A 3OBBA 3C7DB 4A73A 4R16A 1ONOA 4IJUA 4TROA 4GX5A 4ALJA 2PY6A 1ZZEA 1TLTA 2O50A 3F9IA 4YRBA 3KBOA 1NWCA 2W98A 1QLHA 2BFAA 3G1UA 5I7FA 5EQFA 2X5JO 3DTTA 2DAPA 3PHLA 5EJ2A 3H9UA 1E3EA 1EVYA 3ZDFA 3GUCA 2G17A 2CDBA 3QE3A 2FPIA 4MVJA 5C3MA 1V9LA 3WJAA 3ICPA 1SNYA 5A5EA 4ALNA 3NT2A 4B8WA 5BSEA 2P9CA 2BFOA 1J0XO 2QRKA 5ITVA 3Q3CA 3AM3A 3A1NA 4GLOA 3LDHA 3F46A 3T7EA 3KUXA 3DOJA 4XRRA 2X7HA 5MDHA 4BKRA 4L74A 2B69A 4OJNA 3DAFA 2P9GA 1FDSA 5EERA 4M8SA 4UEKA 1LRLA 1PGQA 2X86A 1VLLA 5TS3A 3RASA 1E1KA 2WM3A 2PTGA 4ONEA 2OFPA 5LC1A 3U0BA 1OAAA 1JAXA 4RQTA 5EMHA 3ZWWA 3OHSX 2JL1A 1QV6A 4GSKA 3MOGA 4OHUA 4FIZA 1ISFA 3Q2KA 1U3WA 4LVCA 3UHAA 3PI7A 3TZKA 1W6UA 3U4DA 4B4OA 4KMSA 4IM7A 2I6TA 5JO0A 4BMNA 3D4NA 2CFCA 5I9LA 4ID9A 3RWBA 1UUFA 3W1VA 3AOGA 2B35A 4LGVA 1IY8A 3DZJA 3ANLA 3JQAB 3MZ0A 5JCJA 3PGJA 5KCZA 4NR0A 2YY7A 4JX8A 4J3FA 3OJEA 2YV3A 1UR5A 1XIVA 5JYDA 5TIIA 1NQAO 4BNFA 4BNWA 2D59A 1HWYA 5LDHA 1E1LA 3EAGA 3UUWA 1R6DA 2WE8A 3BMCB 3JCZA 4MPDA 4R1TA 3S55A 3JD1A 5BNFA 2EERA 4II2A 3AW9A 2ZB4A 4QO8A 1JLLA 5HBRA 3E03A 5T57A 1WZEA 1SEVA 4R5MA 3F4BA 2W2LA 2J3KA 4L4XA 4LCEA 2Q46A 2IZZA 1YJQA 3A06A 3HFGA 1IB6A 3ADPA 4WLUA 3I23A 3G79A 3TOZA 1ZKMA 2FSSA 4JK3A 4D0SA 4DPKA 2GO1A 2WD8A 2YDXA 4FCCA 1LDGA 4CM9D 4P4LA 3ITKA 1XQ6A 1YL5A 3RC9A 1IUKA 3PWZA 3UFXA 2AE2A 1B3RA 3JQBA 4BKOA 4L9RA 2WYVA 1P1FA 1ZIDA 4EW6A 5IDWA 5KVCA 4LSMA 4QFDA 3RSHA 4OAQA 3ETGA 1ZK3A 1NASA 1HDRA 1UAYA 3OQBA 4KDEA 4FS3A 4UVEA 4J2OA 3VTFA 1I3LA 1CIVA 4MIOA 5GZ6A 4IBOA 1DSSG 3I9LA 2VRBA 1DLJA 3HHPA 4BGEA 1MB4A 1NPDA 3AJRA 4LN1A 3AI3A 4WCDA 2JHGA 2FR0A 4RJTA 2J8ZA 1NQTA 2PR2A 2FZEA 4DREA 3QA9A 4OXYA 1MXHA 3LC2O 3ADOA 1N1EA 1Q7BA 4A10A 1CYDA 4XB2A 1DC5A 1AXGA 1BDBA 5GZ1A 4KTTE 3X2FA 4RQUA 5C7LO 3W8DA 3OA2A 4L4RA 1C3VA 1GYRA 3GDGA 5HM8A 3D4PA 4ZU3A 4FFPA 3IP1A 3VZSA 3DHEA 3GAFA 4AJOA 2YUTA 1M2WA 4HFRA 3W4JA 1U5AA 2Y0EA 4IUYA 3DO5A 4ZQBA 3HQ4O 4CM8B 4BQRA 1QXSA 1I2ZA 3MJCA 5THKA 4E2WA 4PLPA 3KEQA 4I9UA 1YRLA 2DU8A 4YT8A 3E82A 1XGKA 3WWYA 3ORFA 1JKFA 2Y99A 5K0ZA 1ZSNA 1VJ1A 2NVUA 3IJRA 4Z0HO 2P4QA 1GQYA 1HDGO 1I01A 3CMMA 1GPJA 4F45A 3JYLA 3GGPA 3QV1A 4KUEA 4A5OA 1XA0A 4PZDA 3VTZA 1A4UA 2NQ8A 4MOWA 3WOHA 3GEGA 4BNTA 1R16A 5AQ1A 1NVGA 1VJTA 2A9FA 1TA4A 4UUMA 2GD1O 2NLOA 3KYCA 3QVTA 4XYLA 4AJJA 4IJVA 1N9GA 2JCXA 3G17A 4CQLA 4INAA 2NVUB 4WOKA 4EUHA 3PXXA 4W7IA 1S7CA 3E48A 3EVTA 5TSDA 4BIIA 5JXWA 2A35A 2O3UA 2ZTMA 4I8XA 3VVCA 5KKAA 4J16A 1Y8QA 3DMTA 4ZJUA 2O48X 1BDMA 3WGOA 4MP8A 3RI3A 3WGGA 3KYCB 3M1LA 2QRJA 3WSWA 3IUPA 1Y7TA 3P5SA 4I9HA 1B8PA 1UJMA 3PQDA 4M86A 2IXAA 2J3JA 4BUCA 3CIFA 3V2UA 1T2AA 5JDCA 2QZZA 2TMGA 4QO7A 4HKTA 4D3SA 4CV0A 4NBVA 4I5EA 5JMWA 1OBFO 2QQ5A 3JQ8A 3KOUA 1UDBA 4NHEA 1KERA 3B1FA 3GNSA 3STHA 4XRGA 1MA0A 2VHVA 4J1SA 4RO0A 3PHIA 1JTVA 5TX7A 4EEZA 5F3RA 2V65A 3GR6A 2C2YA 3ICCA 1JVSA 3GFGA 3M1AA 5A5FA 1CF2O 1DRUA 1PL6A 1Y9EA 3RUAA 3OM9A 3AU8A 3WGTA 1NPTO 1YGYA 3I6IA 4XQGA 2FWMX 1SOVA 1W8DA 2XOXA 5KOIA 3EGOA 4PVCA 3LU1A 2Y0CA 3BAZA 3K92A 2RCYA 4IGFA 1K6JA 3PFWO 4M54A 3JQ8B 5TQVA 1UDCA 1YQDA 2C29D 3DAPA 4YJHA 4GWKA 4EUEA 4XQ9A 3IL2A 5A05A 4Y6PA 5C7IO 3AK4A 3KYBA 5IN5A 4WLFA 2IYPA 1PJSA 4O6VA 3EHEA 4YQZA 1XEAA 1PQWA 1WMAA 3WGZA 4IQGA 1K0UA 2BI8A 3AOEC 4G65A 4CQMA 3UCFA 1Q0QA 2DTDA 4K26A 1GYPA 1GEGA 2C59A 1ONPA 2NU6A 3GG9A 3ZV6A 4GGPA 2E4AA 1DC4A 1PL7A 3C1AA 4GLLA 1HDCA 4J4TA 3DFZA 4CODB 4OM8A 3U4CA 5F1PA 1HTBA 1KYQA 4JROA 1R0SA 3DL2A 1DIRA 3JV7A 1L1FA 5A9RA 3QY9A 1KEUA 4YAKA 2HU2A 1R4NA 3ZNOA 2WDZA 2O3RA 5CFZA 1FDUA 1U7HA 2C20A 1R12A 5ER6A 4GVLA 1YDEA 4PLCA 1DHTA 3VAZA 4FFRA 4ZGWA 3JQDA 4PVDA 1CQJA 4Y98A 3O8QA 4P38A 4BNKA 1HE3A 3WB9A 1Y5MA 3PWSA 3GT0A 5T5QA 4PLWA 2X6TA 3QLJA 5B12A 4HUJA 2R6JA 3SJ7A 4E12A 4ZN6A 1WLYA 2DPGA 1VC2A 5KJ1A 3W6ZA 4L8VA 4B3JA 4CR7A 4M87A 2NNLD 4KWIA 1IULA 4OGWA 4CMAA 1PJ3A 1YO6A 1NHWA 1AHIA 4IS2A 2Y1FA 1F12A 1SEPA 3R3SA 2Y1GA 2EG9A 1UZLA 2NTNA 4L73A 1IHYA 1NXQA 2H5LA 3AM4A 3V5NA 3I3OA 1C14A 3I52A 1PJTA 3MTGA 1FDVA 1P33A 1N5DA 3WS7A 3VOSA 3G49A 3INGA 3BIOA 4ND5A 3RUEA 1T2DA 5T64A 4BNJA 1JW9B 1YKFA 2EV9A 1YWGO 2NU9A 1MUUA 5BSHA 2X1HA 4RVSA 4A7PA 3GVPA 1EZ4A 2JD2A 1A9YA 1EVIA 4ALKA 1O0SA 2VOEA 3V1YA 4MVJH 3WFJA 2FR1A 2Y67A 3D4OA 2DTEA 1DDOA 1LJ8A 3DZIA 1ULSA 2PGJA 1QG6A 4BGVA 1K2WA 5C5IA 4YBZA 2NTJA 4ALIA 3QJ5A 4DQVA 2Q50A 1FF9A 1FJHA 3SC4A 5LCXA 3MJEA 1T1SA 4E4YA 4DWVA 1V8BA 3HWRA 3KTDA 4QX6A 3DZHA 4PLHA 2O2SA 3DBHB 1GUFA 3G0OA 3HB4X 4LRTB 3WGQA 3GH3A 1D8AA 3VZQA 4ITUA 1B16A 1RM4A 1TXGA 2VYVA 1B15A 1LRJA 3RC1A 3GUYA 3BZUA 1XYGA 3ZHZA 3TDKA 4CLDA 3PTZA 5TT0A 1U4OA 3M6IA 1HLPA 1SB9A 1MGOA 2I3GA 2J3IA 3VZPA 3W8EA 4QUKA 4DC1A 4ZVVA 2VHZA 3V2GA 2D3TA 1S6YA 1PGJA 2EP7A 3RC7A 1LNQA 3GAZA 2NVWA 4GL4A 1BSVA 2X0JA 3HNPA 3L9WA 1PZFA 3WJ7A 4R5HA 1BXGB 1EE9A 4YTEA 4CLRA 3VPHA 3AI1A 4HNGA 3O9ZA 1ZSYA 4TVOA 3GGGA 4LSWA 4NH4A 1LXCA 4XJTA 1DJNA 5KVQA 1HT0A 2IEDA 2JCVA 3BYZA 4DXHA 3EZLA 4BB5A 3T4EA 1WDLA 1EDOA 3B1KA 3LSYA 4BQPA 5IG2A 4TWRA 2VUUA 2ZB3A 1OFGA 4YJGB 1JVBA 1HE2A 3R6DA 3ZU2A 3VVBA 1GPDG 4XYEA 1F8FA 3H2ZA 1EK5A 3CUKA 4CLHA 2FPGA 4MVJM 3FRJA 2G5CA 5ICSA 2IYOA 2OMEA 4QT0A 2NUAA 3HDHA 4R1UA 3ZU4A 4BB6A 4O0LA 1XU7A 5DBFA 4BGUA 2X0RA 5CEJA 2PKRA 3PDUA 1H2BA 4JGBA 3OH8A 5JMPA 2RH8A 1HXHA 2D5AA 3RQSA 3VPGA 2X5KO 4ALMA 4KUGA 5L7WA 4ZRMA 5THQA 2C7GA 1ZH8A 1GZ4A 2H1SA 3RU9A 2RHCA 4R51A 4Q3DA 2QG4A 2H6EA 3ROMA 2G1UA 2O3SA 1OC2A 2Q2VA 1YJ8A 1RM0A 5DT9A 3ZV3A 2JCYA 1W4ZA 2VYNA 2VHWA 3GN1A 3U4IA 1YE3A 5GMOA 2Y05A 4IZHA 3U5TA 4GVXA 2UUOA 1ZNQO 4YWJA 1T4DA 4MKRA 1GYQA 4NJMB 1BVRA 3SLKA 5F1OA 2C5EA 4FGSA 2G0TA 4PLYA 5G0UA 3SJUA 3WMXA 3INTA 1YS4A 2BGKA 2C7VA 3IP3A 3NT5A 3PVZA 4C7KA 1Z45A 2BELA 4CM7A 4NBRA 4ZQHA 1VSUA 3GVIA 4MIEA 4HNHA 4CMIB 1I24A 3B70A 1LI4A 4JP2A 3I9KA 1A7KA 4MDHA 4YJFB 3E6AA 5A02A 3PJEA 3S1LA 3I9NA 3S8MA 4E0BA 1GTMA 1U2DA 3D64A 4M1QA 4DUPA 5EESA 2AW5A 1I33A 1HYHA 2JHFA 4CLOB 1NR7A 4R54A 5JBIA 2VNSA 5MGBA 2F1KA 4UAGA 5DCYA 3LK7A 4HV4A 1R37A 3DHYA 5G4KA 3BA1A 2NTVA 3SXPA 1PGPA 1RM3A 3WYEA 5IXYA 3NAQA 1MLDA 2VWHA 2W2KB 3AFNA 4NU6A 3H65A 4XR9A 3GPDG 4TVBA 3WTBA 3QVXA 4NDNE 4BNVA 4PN3A 5L45A 1YQXA 1EQUA 3GDOA 4PG5A 1Z75A 4RL6A 5A1TA 4IGEA 3R3JA 4BKQA 1M67A 4IQ8A 4B7UA 1H9BA 4GX0A 2X23A 1NVTA 2HK7A 1BXZA 3DDNA 3MJTA 4XDZA 1ENOA 4XGKA 5JDIC 3KSZO 2OORA 3EUWA 3BMQB 4CV1A 1IOLA 1F14A 1Q7CA 5TC4A 5KWEA 3PLRA 5ITWA 1PQUA 1Z82A 2OBNA 4RDIA 3IJPA 2PH3A 3RJ9A 3JQAD 2PD4A 1ZEMA 2B37A 3DZKA 2O2YA 3H9GA 4FFNA 3UVEA 5IXSA 3W4KA 4B79A 4PGFA 2AA3A 1E3JA 3HJAA 1C0PA 5DDIP 2Q3EA 5IDXA 2IZ1A 5EL0A 5JLAA 3K30A 1ULUA 4XGIA 4XA8A 4YA6A 1NFRA 2ET6A 2GGSA 4IMPA 4KWHA 1SZJG 2ZQYA 1BXKA 5A9TA 5JCJD 4FC7A 3DOCA 1CWUA 2G82A 4IJKA 3VC7A 2VRCA 1LDYA 2I76A 3F6YA 1P77A 2ZYDA 2JD0A 3JQFC 5U4QA 1V3TA 2Y0DA 3ZU5A 3VDQA 2TMDA 5BSFA 1R4MB 5F21A 3ONEA 4GI2A 1LTHR 3E5RA 3UF0A 3WR5A 4FFOA 1VL6A 4BKUA 2BMAA 4J6FA 1B7GO 1E3LA 1ZMTA 4MVJG 1A7AA 1HE5A 4LMPA 4CM6A 3BHJA 3C1OA 1TB4A 3OJFA 4J49A 4CMJA 1KBZA 4ALLA 1E3WB 2W2LD 3ONDA 3ABIA 2P5UA 2DUUA 2IEBA 1DAPA 1FDWA 1E7QA 2QW8A 5IDQA 4YAJA 1CDOA 3ENKA 2BFMA 1DB3A 2FHSA 2OP0A 3ZWPA 4TRRA 1H2HA 3LYLA 3WFIA 2O4CA 1HZZA 4FGWA 4IDBA 1RYDA 4EBFA 1X14A 2HUNA 1QMGA 1VL0A 2Y68A 1A4IA 2X8LA 3OSUA 1A27A 1DIAA 1P1KA 2UAGA 1DIGA 5BNTA 3TL2A 4JJFA 3IDSA 1JDJA 5AXBA 4J2HA 3TNLA 2AG5A 3H3JA 5G2OA 2D1YA 5ILGA 4B4UA 3GZNA 2VZ8A 1N2SA 2DQ4A 3SBOA 2GUGA 4YYZA 1O5IA 1U2GA 1UXGA 3NRCA 1YXMA 1YL7A 2I3AA 1Y81A 2WTBA 3CZMA 3DEYX 1CQIA 5DF1A 1U8FO 2GNAA 3PPIA 4OOFA 2VUTA 3GVCA 4RVHA 3DTYA 2UVDA 5F5NA 3F5SA 5FYDA 3RUIA 5I8ZA 5CEFA 4RORA 4J0EA 5CDGA 3BTOA 4I1IA 4L0QA 4DIBA 3NDJA 1Y6JA 3BTUA 1JKJA 5F1KA 1BVUA 2AMFA 1EBUA 1LDMA 4L75A 1MXFA 4RLHA 2V7PA 5L9AA 1LSJA 1KVSA 4WLEA 4BOYA 3CEAA 1Z6ZA 2YV1A 3WIEA 1VSVA 1WXDA 3ZV4A 4BNGA 5B4VA 1ADFA 4QFCA 2NQTA 4HXYA 5CG1A 1VKNA 3DONA 1YVEI 2HMVA 4J9VA 1WAMA 3GG2A 3FHLA 3FNGA 1L7EA 4B4VA 4EEXA 3DBLA 4FJ2A 3AY7A 4J7CA 1HZJA 1L7DA 1DFGA 4R69A 3RIHA 3WQSB 2YJZA 4CR8A 3TZHA 1GZ3A 1LA2A 2FPPA 2PKQO 4WLVA 4PFJA 3AOEA 4D3FA 1DRWA 1EUCA 1ADBA 1J4AA 3LVFO 3KSUA 3UCXA 4FN4A 3GFBA 3PHGA 1LBEA 3OIGA 1CEQA 1ZFNA 4PRLA 4AJPA 4U6QA 3OA0A 3Q2IA 2B5WA 3QQPA 1ZSVA 4XDYA 4YT4A 4RPLA 3W6UA 1KOLA 4YRAA 3S2IA 3M2PA 3K2BA 2C82A 3ON5A 3EZYA 5BT9A 5JY1A 2IRWA 1FMCA 2SCUA 3PJGA 3V2HA 3TWOA 1K3TA 4OXNA 4RVFA 3LT2A 1D3AA 4Q3AA 4OH1A 4E5NA 4GX2A 4F6CA 3GMSA 1VKOA 2BF7A 3KHUA 4WCFC 2X58A 3WG9A 3DZBA 3IS3A 4D46A 3PP8A 3R1IA 2O7SA 4W99A 4B7XA 4RPHA 1DC6A 4UUOA 2VZ9A 9LDTA 1XHLA 1MV8A 3OP4A 3WQQA 4D0RA 2OGUA 4EGFA 1ISJA 1E7MA 2PK3A 4DPLA 4FJ0A 1E7SA 4E21A 5BQFA 4ZICA 4K28A 1NM5A 4TRNA 1HEUA 1DO8A 2X0NA 3NJ8A 3P19A 4FW8A 1UZMA 4QQRA 5CAEA 3OEWA 4BO0A 1K6IA 2DVMA 3ROKA 2PKQP 4NFYA 3JQGA 1IPEA 1Z7BA 3JD4A 1GAEO 5U1PA 4GMFA 1TI7A 2A92A 3O26A 2DPHA 3N74A 5TJHA 4CQMD 1P3DA 3K5PA 2GZ3A 5G0WA 2J5RA 2VCYA 1C0IA 2X9VA 3FSRA 2LDXA 5FI5A 3MOIA 1LDEA 3JQ6A 4LVUA 1H94A 3KSDO 4AG3A 1SMKA 3ZWAA 1PS8A 4A0SA 3C85A 2I5PO 4RVUA 1ZK4A 4CMEC 2C07A 1Y8RA 3H2SA 3UH1A 4Z3KA 2EXXA 1PJ4A 2CD9A 2D0IA 1H9AA 4AJ1A 3B1JA 1C1DA 3EW7A 3FD8A 4YAIA 2NV6A 3D0OA 4RDHA 3ZWYA 3OF2A 5KTKA 4OSPA 4UVIA 4DQUA 2EJVA 4DC0A 4II3A 4LK3A 1P45A 3GNQA 3U49A 2EKQA 4E13A 3V8BA 3K73O 4RCVA 4A03A 2OO5A 5K6AC 4WKGA 3EY4A 1Y8RB 1TT7A 4W7HA 4JJGA 2H9IA 4WOJA 1ISGA 2ZKLA 1QYCA 3UCEA 4CLEA 2CDAA 4DGSA 1BG6A 2NACA 2POQX 3ONFA 3ANNA 3FNFA 4UVGA 3U3XA 3JD0A 5IDYA 1N9GB 4CQLB 1JWAB 1KS9A 3P7MA 1LLCA 1YOVA 1AGNA 4FR5A 3WDSA 4BGIA 3PDJA 3S2GA 4HBGA 1V6AA 3QW2A 1D7OA 4PZCA 2Z1MA 1Y8QB 2E6UX 4E5KA 4AJLA 4CM9A 1C0KA 5EINA 4DTIA 5L53A 3LC1O 5B4UA 2VT3A 3GQVA 2NU7A 2C5AA 2CDCA 3INRA 2YHUA 4LRSB 4PLVA 4YQYA 3E8XA 2HO5A 1KEVA 4ND2A 3CH6A 1K89A 1PGNA 1I10A 2ZYAA 4O59O 4Z3DA 4W6ZA 3DFUA 1AN9A 3K2EA 3OECA 4OKNA 3GLQA 2AG8A 3ETEA 1FK8A 4KQWA 3GEDA 3OJLA 4WNCA 4FFMA 4DLAA 2CUKA 3P2YA 5DBGA 5ICMA 3IUSA 3MWEB 1N1GA 3KVOA 3PEFA 5L7YA 2IDZA 4O63O 3EDMA 1MP0A 2BRUA 3KLMX 1M76A 1YONA 5H83A 3AM5A 3QIVA 2EGGA 3ZU3A 3K96A 4F3YA 2Q2WA 2GN6A 4OL9A 3WQRA 1A71A 5ES3A 2EIHA 3UKOA 1DPGA 4FOOA 2ZCUA 2NM0A 1HSZA 1VL8A 4EITA 3HDJA 1HSOA 4FC6A 4TKLA 4BV8A 4YJHB 3H5NA 3MTJA 4HY3A 4MVJP 1ZEJA 3CE6A 2EF1A 3LC7O 2PH5A 4WASA 3KZVA 4OXKA 2X22A 3GC6A 4EI2A 2EEZA 1T2EA 4P4GA 5DBIA 2LDBA 1X1EA 1GL3A 4RF4A 3JQ7A 4IDAA 3LT4A 4UVDA 1PJCA 4IXWA 4HFJA 1GDHA 4WLOA 2FMUA 3U4HA 4E32A 4L4SA 4CQMB 1ZCJA 1PWXA 1B14A 3ASVA 1B8VA 3VPSA 4BO6A 4CJXA 3I4CA 5IN4A 4DRYA 1UH5A 3F1KA 5T67A 1JU9A 5A06A 4CMGA 2PZKA 1SPXA 4Z9XA 2DTXA 3GNTA 2J5QA 3E9MA 1A72A 3FNEA 1IPFA 1T25A 1R4NB 4XQCA 1HDXA 4BNHA 1E1MA 3FPCA 2C54A 3PLNA 1NAHA 2E82A 1LC3A 4YT2A 3JYOA 4RVGA 3TRIA 1U8XX 3L4SO 3PK0A 2Y1CA 3O8QB 3JSAA 3ZN2A 5HRUA 5L3ZA 4IDCA 4J4BA 4IXTA 1QRRA 1KEWA 4CM4A 3KXDA 2OZPA 2JAPA 4B7CA 4E5MA 4E31A 1AHHA 1YH3A 4GQAA 5IZCC 1HL3A 3I6QA 1GV0A 4AJHA 5L4NA 4BNMA 2NWQA 3ZNPA 1J49A 2WEKA 4BHTA 1WP4A 1G0OA 1P1RA 2I99A 3SX2A 3LZ6A 5JCXA 5DZSA 4I9NA 3LF1A 4IS3A 1DEHA 5JSFA 1GEEA 1SC6A 5G0VA 5FEUA 3C8MA 4J1QA 1PEDA 4Z0PA 4XEHA 3JTMA 2GDZA 3Q9UA 3CZRA 1SBYA 2Y1EA 3VHRA 2X9NA
chains in the Genus database with same CATH superfamily
2K7ZA 1F60A 4HWTA 4XIYA 3A05A 4LZOA 2QN8A 2NU9B 1RPAA 2CKMA 5LJIA 1G6Q1 3QJYA 4RCZA 3TOCA 3FUTA 4CDGA 5HIKA 5IVPA 3UAOA 2ZT5A 4TRMA 4HLDA 1ZJWA 3MEQA 1BC5A 5ERYA 3WK5A 4JIGA 3B1ZA 1M6HA 5T6MA 3I01M 5D5QA 4BFYA 2YNMC 1V3QE 5CDHA 2QLLA 4PYNA 3PIDA 1TM7E 3QGMA 1AIPA 5J40A 5CB4B 1ODIA 3W6NA 5A6SB 3Q8WA 1E61A 2GZ2A 4KRYA 1WUYA 1NUAA 2JJ8A 5I9MA 1BCSB 3V1TC 1TCUA 3A6HA 3PE6A 2VDOB 1DUVG 1QP8A 3LXRA 4Q15A 3W05A 4BNIA 4DG8A 3JY6A 1GPWB 1PG0A 5EIAA 3G3EA 4OGGA 4IF6A 4JJAA 3ZWBA 4YPVA 3TEFA 1BGXT 1GWNA 4FWTA 5E7JA 2EJCA 2OPBA 2PMFA 3LY9A 4BATA 1E3SA 3DZCA 4Q1AA 5CLFA 2NUPA 2CWWA 2XWPA 1Y98A 2P41A 1C8KA 1EFDN 2PUJA 3C0KA 4RK6A 1L5GB 3RSSA 4WN9A 4AKHA 3I8OA 5CA1A 4DDUA 3UUEA 4I46A 4RIIA 4BDTA 4HL6A 3CW9A 2JKYA 3DVSX 5HHTA 3KZMA 3MMZA 2DSTA 1B6GA 2FW6A 3HP4A 4OKIA 2OGWA 1IDOA 3AFMA 3TW4A 5C5EA 2ZR9A 4KR7A 1KL7A 5NULA 3T5DA 5J2UA 2PGLA 1I0LA 1IL0A 2JFOA 2O14A 2BFWA 2YWCA 2EWVA 1LSUA 3QE0A 2Q99A 5DP2A 2BSQA 4B3IA 3STVA 1VB3A 1BYUA 1U0SY 4JA2A 1XCLA 3C7AA 1XLVA 4MKIA 1XNHA 3SSMA 3J80A 4UHKA 4N03A 2RHWA 1NDQA 1C1XA 2UDPA 3H9BA 4ZCIA 2GM3A 4ZCRA 2ADMA 3EBOA 3PQFA 3SX0A 2TECE 2BKUA 2GCGA 4BV9A 1KTIA 4DPMA 1IVNA 1MAUA 3IAHA 3M5PA 3N2EA 4KRXA 3TL3A 4CNBA 1FUYB 4AF6A 5BXQC 3TVTA 5GADl 5SY4A 3VOBA 1ZHHA 2YL2A 4JJIA 5AUQA 3N5KA 1GAJA 1L4LA 1Z5GA 1M34B 1Q0LA 1YZUA 4RH3A 2A4KA 5CGQB 4MKZA 5JFTA 3LC0A 3OC6A 3G23A 2DBVO 2I2XB 2XUPA 4W82A 3S2SA 4BKPA 5HS4A 1R9MA 4J0CA 2IIVA 2ZPUA 4PWZA 1ZBQA 4GKVA 2NG1A 2W37A 2WMDA 5CTAA 3WRWA 5COAA 4RYDA 4IP0A 2GBCA 3T9EA 3IUEA 3SQDA 1PZGA 3IBSA 3PHCA 4IJSA 3AUTA 1A98A 4ZEOA 3QG5A 1XRSB 2BFDB 3B12A 4H4CA 1HYGA 4N5MA 1GL6A 1HFEL 2DFVA 2P8SA 3B51X 3BG5A 3IKJA 4DCGA 4FMPA 4A2PA 4QU9A 5CDTA 4TXLA 1ODCA 3M9LA 1GXSB 1JQDA 2K7FA 2BM0A 1G9SA 4EVRA 3GCGA 4D4IA 2OCLA 4AQYB 2Q3HA 5COBA 1Z2NX 4E33A 5L95A 4Y6SA 2Q5CA 3QYJA 2C5HA 3LY7A 4WE3A 3A1FA 4R8VA 1NQXA 4D8WA 3IJEB 3WBKA 4B1FA 2OM2A 2FEKA 1V35A 2RONA 4FHFA 2GBFA 2CZQA 4Q1CA 1QIHA 3L6UA 5EE9A 4F5DA 3BKXA 5EJ8A 2VQSA 2D8AA 4JMLA 3COJA 4RK4A 1N92A 1VE5A 3GLKA 3RODA 5F4ZA 1SBIA 2QMEA 5JECA 2ZI4A 2AVDA 2YIDA 1Q50A 3M6FA 1TQ2A 1TLFA 5CVEA 4B3FX 2IZ0A 2K5UA 4KLNA 3F3MA 4W5HA 2EBUA 1BIFA 1NVEA 1WHSB 4PLTA 2XXJA 1UBNA 2FW1A 5EYPB 4I99A 5T6BA 4UM9D 4PO1A 4P2BA 3ZWNA 3LLSA 1SXJA 2XPCA 4MGHA 5JRJA 2H31A 1T8YA 4JODA 5CA0A 2B78A 1X7HA 4U2CA 1Z5UA 2D13A 2H29A 3AUUA 2PNJA 5EJ6A 2DQYA 2PUBA 4WZ6A 2OZLA 1Y6ZA 3GHHA 1RYMA 4D4LA 3KSAC 2V59A 1VHJA 1K7CA 2P2LA 5KC8A 3NT4A 3WYBA 5I4BA 4YRPA 1Y4AE 3AU9A 4YUZA 3NGLA 3FDZA 1GR0A 2NXWA 4S12A 1T35A 4YT5A 5A4AA 5BWNA 1UQUA 1E6UA 3VH2A 2GF9A 2I2FA 2NO0A 1LD3A 3GEPA 1JLRA 1SUAA 2CUZA 5COQA 1B8NA 1JIIA 2RB5A 1HT2E 4G1UC 4P5EA 2WK1A 3CGWA 2YS7A 3RVNA 2PZFA 3V8RA 2GM4A 3LSTA 3BTVA 4O4JA 4WT7A 4DE5A 4O4HB 1AK1A 1JDTA 2Y3IA 1EQ2A 1DIHA 1SQGA 2F3QA 2ZYUX 3KX2A 3IKVA 1QKJA 1X9GA 1JSCA 5BPFA 2VTDA 4V0NA 1G98A 4K8RB 4I8IA 2YFKA 1SVSA 1NN0A 2YHIA 1GNTA 5CBKA 1NJ5A 3DWEX 3P9ZA 1F51E 2VXYA 3HN7A 4H3VA 4Q39A 2G88A 2J7PD 4GDFA 2WT4A 2VDPB 3QK7A 4BO2A 5L3QB 2XUJA 4QBFA 5E6UA 2JGFA 4DAEA 2IS4A 1PUJA 1PJ2A 5B3KA 4LVNA 4E46A 4L95C 4PO8A 3PIIA 1OW3B 1URPA 2Q5EA 2VXBA 4B8ZA 4ZTZB 2R6GA 5FUXA 1JT2A 1CUXA 1WUKS 1MW8X 1ADJA 1P6UA 1HQCA 4K6FA 4MEJA 4WA8A 2DSNA 5KVVA 1Q1AA 5LDGA 3TG2A 4LDNA 3WBFA 1LBHA 5K3BA 1NVVR 1O5OA 2EJBA 3I01A 1O4VA 4YUWA 1A96A 2H11A 3TVYA 4BVLA 1E7YA 5DHAA 5FR1A 3ZS9A 2NZ2A 1PKEA 1TVCA 1I8TA 2OXCA 1IN8A 4C4PA 2EBWA 2QTTA 1BS1A 1IHXA 3L4BC 4ZT5A 1RE0A 3P2KA 1IN6A 1ZGGA 1R0RE 2A5LA 4ZT6A 5FCDA 5J5AA 2VP6A 1UP6A 1CY1A 2ICAA 3DXXA 4Q1DA 2AH5A 5TF4A 1E2QA 2NXJA 1OUMA 2PT5A 4HAIA 1P29A 1JXOA 1XG5A 2FSVC 3E53A 3MN1A 1OT5A 1LDBA 1QHYA 4OQYA 1P3JA 3SR3A 3ZDXB 3DUFB 2X14A 4HAWA 5KQMA 1OFUA 4N0QA 3RAFC 1HTTA 1LS1A 4M0KA 3HDQA 3QFRA 3T1OA 1JHQA 1I3NA 2X19A 3RVMA 2PL1A 4YRQA 3ECSA 4WCVA 2CLOB 3CE9A 3GRPA 1KYTA 5IF3A 3IKTA 1K5HA 4U39A 1BRTA 5DM0A 3OETA 3IQDB 4DYVA 5K03A 1KI4A 1BWPA 2ON6A 1R0WA 4Q21A 2OUKA 3ETLA 2EW1A 8ADHA 4JXXA 4RDCA 3Q7PA 5C35A 2QU7A 4Q7EA 2QD5A 4FE3A 4QM7A 2RBEA 2Z5LA 3UFBA 1H3NA 1ZHFA 4ZK2A 4IDEA 1RAFA 5FI3A 1OLOA 2I2DA 5DGDA 2ZJ7A 3IXMA 2CMDA 3C1UA 4CIXA 3A4YA 3IQZA 5DNCA 2ACWA 3QUCA 4QTYA 5IABA 3HO1A 1NVAA 4YXFA 5J63A 3GXBA 1TCCA 4B82A 3I73A 4I5FA 1B74A 1NWHA 1S2OA 3OHMA 1VPEA 4ENTA 3PCRB 5AXAA 1RWQA 1YZLA 2QVCA 3UMJA 3KKPA 2FZWA 2OHXA 1ZOLA 3BWVA 4COKA 4BXOB 4EECA 1UEXC 3EEYA 1FLVA 1G21A 4UULA 4WNAA 4LZPA 4LKRA 4CCSA 4Y7DA 2XRYA 3L6EA 2AOVA 1KSFX 1D8TA 3LL4A 4B3DA 1EB9A 1CS0A 1P72A 3CLHA 4HDAA 4HAVA 1Z0ZA 2HKIA 5DTQA 2AQIA 4JDUA 2R65A 2RIPA 2IKSA 1SKYB 2ZFUA 4C4TA 2XCSB 4DQKA 4AJNA 1KEKA 4FN5A 1FU4A 1PNTA 1HE4A 2GTHA 2H5JA 2UVQA 1YS9A 3UW3A 4B83A 1RHJA 1ZJ6A 2E5WA 1WXXA 1PR9A 1XPJA 2R87A 4GPD1 1UPTA 4NU0A 2VJDA 4E5YA 2CXQA 2H5IA 2P79A 5F78A 1PUXA 1ZITA 3RS2A 3FR7A 2V7BA 2NTEA 1X77A 1HT3A 2PRKA 4BECA 1NW6A 4CDRA 3HEBA 1X7WA 4KR3A 1U7TA 4KPFC 1TO1E 3Q8LA 1W36C 2V7EA 2XX3A 4QYIB 1QIKA 3GJXC 3HTXA 3WYCA 1YB7A 4QXMA 2O8DA 1JR6A 2CXSA 5GVSA 2ZG6A 3SHVA 2AEFA 4H59A 3RR2A 1JPUA 1SGWA 4FKZA 1HTWA 5K8IA 3E7XA 1X39A 3SC2B 1VYHA 3LT1A 1QYXA 4Q82A 4RK5A 3ZQ4A 3Q8MA 2AQKA 1GSAA 3WXBA 4MUNA 3I5MA 2YHSA 1BX1A 3OQPA 4N3NA 2FG5A 1L4YA 4TMZA 5E0OA 5EHGA 3SD7A 3B6MA 2WC1A 3ANXA 3OFNA 3LX4A 4HDSA 4HJRA 3NAMA 1MTZA 1UOPA 1WMDA 3FI9A 1LFDB 1RJ9B 1WNTA 3CX7A 5E38A 4HAYA 5T4EA 1JH9A 3UPUA 4RVCA 3EBPA 1LQUA 3DNPA 1U63A 1FFXA 2QXYA 2JGJA 4PAMA 1ESEA 3FMIA 4L4YA 4E15A 4HQNA 1LRKA 3VMFA 1F20A 2BOVA 3OE4A 2HBQA 4UE2A 4ZT3A 5SYMA 1XQ1A 3K94A 4HX5A 5KJEA 3JVEA 2HMTA 1T34A 1T0HB 3Q87B 1XZJA 2YFHA 4Y9SA 2QQ0A 2C95A 2IFTA 1K97A 3H5WA 4X1KB 3OTWA 1REQA 2V6MA 5EZ5A 3DXFA 5G0TA 2ZYVX 2HIAA 1AKYA 5J9FA 1IEQA 3X1ZA 1CHNA 4EW1A 1FQKA 1BFKA 1HDZA 5AWFC 5SICE 1XRQA 1LC0A 2H2WA 1LUAA 3MRTA 1IZYA 3JATB 4Y1RA 1AE1A 2WWRA 3KUUA 4MIKA 1PSDA 1U2PA 3G82C 3ZJ4A 5L7TA 2VDWB 1ISIA 4KV9A 1W0CA 4JNGA 1WNFA 2A7XA 2JK1A 1CLUA 2A5DA 2ZSJA 3B7PA 2BGRA 2H9AA 5U9CA 5JAIA 3I30X 4JVMA 1A4RA 1CJCA 3QRWA 4GI1A 5BVGB 1ECCA 2AJBA 4MV9A 1AG9A 4ARSA 2PYDA 1N0UA 4PIPA 3D4LA 2GO7A 1NUHA 3HZZA 1LPNA 5FNVB 3QWIA 4YLEA 2VC2B 2PUHA 3HU2A 2W42A 4ZVNA 3VDMA 3GZJA 5DNAA 3OKPA 4QXRA 5AW9A 1MMFB 1EUDA 2CZCA 2M1ZA 2VBCA 4QU8A 3IAFA 3ND8A 2QZ9A 2WJIA 4UVHA 1GADO 3CJTA 1V95A 1I7DA 1CX9B 2WFLB 5FX2A 3D7SA 3O21A 3BRWA 3CWZA 2ZRFA 3AC0A 2C3PA 3L0DA 4FZVA 1IN4A 4O8ZA 4XVUA 4K9DA 2ZP1A 2F90A 2COEA 1J99A 2QIOA 2W2TA 3GYBA 4B3XA 3QVLA 2H7XA 3AUAA 3PJFA 3H3FA 4WKOA 1RZRD 3KAQA 2VDJA 1KEPA 2WSIA 1QJCA 3N0WA 5D3MB 1YUNA 5CHEA 5I9NA 2OOKA 3ZJUA 2G76A 3DE3X 5E1DA 3V33A 3W5JA 1RP7A 2XZLA 4ZI7B 3JTEA 5EIOA 1ODTC 2SKEA 3NXSA 5TJ9A 4YAFA 1G59A 1NMYA 3IVGA 1T4BA 2HSWA 3FTPA 1R6UA 1SC9A 3HUDA 1D2HA 2ZAYA 1Y3CE 1F8GA 2PZGA 3P71T 4LJ6A 1R0XA 3ZPXA 2V6GA 1OF1A 3PWKA 2DC1A 3NOQA 3K70D 3Q7RA 1P7PA 4ZHQB 2P3SA 3OQ6A 1VDZA 1X13A 1UZAA 2GAFA 2XCTB 4M9XA 4FHGA 4Z49A 4NOLA 2DFTA 5A4FS 2YZ7A 2ZYGA 1GUYA 1A2OA 2GN2A 3ZHUA 4BLOA 4Y2UA 2ODBA 4FNOA 3RT7A 4FNAA 1UPBA 1W4AA 4KIGA 4ZOLB 5DNEA 2I66A 3VR6H 3DZ8A 4AY5A 2CVPA 3CG4A 4J0IA 1BVHA 4TN1A 4HADA 4RLSA 4FBGA 3FPSA 1EVEA 1PX0A 3JYPA 5IZCA 3M89A 4CM8A 4EFLA 1TT5A 4BVHA 4ROSA 3R4CA 3L6RA 1PTJA 3TXXA 1JALA 5LFAA 2VKQA 3HH8A 4I5DA 3S2FA 3IEVA 4XJXA 4IEIA 4KR6A 5BVHB 3F98A 3DEZA 1LVUA 1KOGA 1ORTA 3DLTA 3NC0C 4F92B 2WV9A 2LBPA 2ZETA 3QJGA 1U3TA 2P68A 2W4QA 1ODJA 3DAGA 3HUTA 3NP7A 2D4HA 5A1JA 4EG4A 1P31A 4F6RB 1E1DA 1XP5A 2FFJA 3PZRA 1WB5A 4C5AA 1FFDA 4PV7A 1SAYA 3AGQA 4JCOA 1Y1RA 1V1RA 3OY7A 3P2OA 4JVOA 1S9HA 3GT4A 3RSZA 4HT3B 3BD6A 4XKJA 3I9V1 1MIOB 4F38A 3B6JA 2DF8A 3TD6A 4BL5A 3GVXA 1BDJA 1NA5A 1Z13A 3EHDA 4KOAA 3ZKWA 3H9EO 4IOKA 1H1DA 3T0GA 3AIKA 3JWJA 4RKQA 1OMOA 3GMTA 4TV8B 5CVCA 1SWWA 3TN7A 3CVXA 3KQOA 5LYJB 1B26A 3BIFA 3UJNA 2BHLA 1W88B 3QUSA 2AXQA 2G07A 3OZRA 1SVOA 4B3HA 3MJHA 1ENYA 2Q0XA 2VNAA 4G1EB 4JFRA 4L27A 2B8WA 4OM7A 1WVGA 4Z9YA 4Q4HA 5EJAA 1UFQA 3JZDA 4BLUA 1XRPA 2ZQZA 4NV3A 2O5VA 1L3IA 2IK8A 1B43A 1OVMA 2R5WA 3K35A 2P0YA 4FQ8A 4DOMA 4ZO6A 4EJFA 4LFAB 5KTSA 1PNOA 3HL0A 2ILTA 2D0DA 1TF5A 2J3EA 2VH1A 4I08A 3U9LA 5L3VA 2GWRA 2GWHA 3HR4A 4I7EA 5ALNA 4EKEA 4KRFA 3HB9A 4ISCA 4YDRA 2E6KA 3RS9A 1YOVB 4KN8A 5M2QA 4DADA 3A3NA 3OCJA 5BXYA 4XZ3A 1VBFA 3PUWA 3R9XB 1S2LA 3W5HA 1C7JA 1JFLA 5EG5A 1A97A 3G7SA 4OXQA 1PT9A 1ZUD1 2EYQA 4EUNA 2RGRA 2NV2B 3GLGB 1HY3A 4HNRA 2J6HA 3ERCA 5EKTA 2PZJA 5D85A 1EE1A 5T7BA 4EJMA 1GA4A 1OJ7A 1KETA 4RD2A 1ZL0A 2H4JA 4J0FA 3R6LA 1YZHA 4R01A 4XCVA 2AQHA 4TLLB 1SCUA 3UW1A 4YCAA 1E6WA 5K4AA 3A25A 4L8WB 4PSCA 1QF9A 3A9SA 1XDWA 4TSKA 2QPLA 1W76A 3UAZA 1T2UA 1R6TA 2PG3A 2DWQA 2VTEA 3JZMA 1CDZA 4TMTA 3RS8A 3TLMA 1H9CA 5C31A 4FOSA 2PKXA 3TPZA 2YJ6A 3THXA 2ISSD 5KQGA 2GSDA 4OQPA 4PGMA 3T4XA 4PC7A 3FNBA 1Y3HA 3A14A 1JQBA 4UHCA 4RZIA 2LP4Y 4R0MA 5JY6A 2P9BA 2WZCA 3CV3A 4HGZA 3ESXA 4RV9A 3V00A 4GRAA 1NFQA 3FBTA 1NMQA 3LUJA 4IY1A 4NAHA 2QOEA 4OJYA 2XBUA 3CTMA 3ZHXA 4Q1BA 3UKDA 2VEDA 2GBIA 2QSUA 2WLTA 3NZEA 5ALDA 1KK2A 3ZJTA 3HXTA 1PR3A 1MABB 3UOGA 2G6BA 4JI6B 1UIRA 5G0SA 4GD3Q 3PKJA 3UJHA 2D54A 2VDQB 3CPEA 2V4MA 2VUSA 1T0BA 4MLCA 2HIGA 2GN0A 3VPXA 4PXAA 3IPAA 3OZ7A 4LBZA 4NZ9A 3VV2A 3ZWOA 4KQCA 3U19A 3JQBC 4S3MA 3JQ7B 1HBJA 3OIUA 4ZVOA 1WPGA 1QQAA 1T3ZA 1UL1X 1B2RA 2DQSA 1HORA 2OV1A 2QW1A 2JAHA 3LT0A 4G26A 5DJ5A 3E3OA 4PTZA 2ECKA 1IY1A 1YIAA 3RIYA 3H5LA 5JNSA 2IXEA 4C0HA 3AUXA 3G5MA 5I5GA 1QPBA 2C7PA 4C2BA 1XTIA 4MRSA 4R41A 5IXJA 3QU5A 1GGMA 1HETA 2HCBA 3M4ZA 4BMSA 4JJ8A 3U5ZB 4JJ4A 3FIJA 2IEIA 4QSMA 4WJZA 1Q17A 3VR6D 2IYSA 1SKQA 2WTMA 4LMRA 4DJTA 4FEGA 2X0EA 1QGUA 3R0QA 2BMVA 1NVVQ 1P1JA 4YAOA 3C5VA 1R8JA 1GT6A 2DCMA 5AOVA 3DAHA 3M5WA 4RF2A 1JU3A 1VMIA 3S8YA 1XO1A 4WDRA 5JVDB 4FQ7A 1SFRA 3K9FC 4IUBS 3OZUA 1F4LA 4AC9A 3M1YA 1N34B 1NKSA 5MFZA 1HQYE 1V7CA 2GK6A 4J75A 1MORA 4FINA 1JQAA 4LZAA 4Q3NA 4OU4A 4RZUA 4KFCA 2R6R1 4U8HA 1DOHA 1HF3A 2QLJA 2B5VA 2PT6A 4ZDWA 4C3UA 4CM4B 4F3KA 1MFPA 3BH0A 4FB5A 2AC4A 1Q19A 3DTNA 3P5BA 1EFUA 2EX1A 4ZEVA 1ZUHA 3NHBA 4RAQA 3W5BA 2G06A 2R62A 2O8BA 1FMTA 5NLLA 4L3VA 4LVOA 2BFCB 3RAJA 3FKQA 3QVGA 1M2GA 4Z9FA 4XYGA 2YJNA 1XNRB 1AQUA 4WESB 3ET5A 3HN2A 4UTOA 4X6YA 1NF2A 1R15A 1W0JD 3RYCA 2VP4A 2C88A 1Z26A 5IPFA 4PIVA 1NDHA 4A6XA 1DKOA 3PC4A 2O57A 4KN9S 5I47A 2I0FA 1CDEA 2BHTA 2DUMA 1XJWA 4WZAA 2Z3VA 2DQKA 1BGVA 2X4DA 4QGAA 3RABA 5CM2Z 2BMDA 2GVNA 3OG9A 4EHBA 3NPAA 5JSZA 1UKEA 3W1WA 1ZDMA 1GG5A 1FNNA 4OMUA 4RS4A 3HFSA 3G9QA 4RZSA 4B46A 4RESA 1Z3IX 2XTZA 4DZZA 4JYZA 1I1NA 2R44A 5HCUA 3HKBA 5BUSA 4HWKA 2WW8A 2PAAA 3OU6A 1DAFA 1WULS 1NUSA 3ES9A 3UGKA 4CKZA 2H2HA 3B5IA 1Y7IA 3OFVA 3T7CA 1QHNA 2MJLA 1NI4A 1RHRA 2G9VA 4Q12A 5DTIA 3QXGA 1OIXA 4KQGA 6AT1A 1ILWA 2ZPTX 2E37A 5ECDA 1L8QA 3MERA 4L2IB 5E1OA 4EI7A 1YB5A 3QNUA 4PCLA 2EJWA 1VIVA 1SQ5A 3NTQA 4RK0A 4WVFA 1EM8A 3ORYA 3U40A 3FF4A 3WB2A 4NFSA 4OVKA 4HVLA 4O3FA 3ROEA 1CEXA 4JQCA 3BXEA 2M9MA 2YV4A 3B1WA 3GWZA 3TFQA 3BICA 1Z7YA 1XWFA 2R7NA 3IDFA 4TLDA 2X76A 1M0SA 4N0MA 4CKWA 3A36A 1PV2A 1CDDA 2QM7A 3K8YA 2YFQA 5FUMA 3H8JA 3U80A 4A2CA 3CINA 5K3FA 3H4MA 5BMVA 2GKSA 4X65B 3HVRA 5EAIA 1GZDA 1HKHA 2BDEA 2QY9A 4TQ9A 4A26A 4G1VA 4ZZ0A 4WIAA 1N32B 5D5PA 2NUPB 3WO0A 4ZJPA 1NVWQ 1H93A 4DQDA 2FPUA 4WN9B 2WFZA 4EFKA 3IAUA 1KVRA 5IVDA 1GRRA 3U44A 2FZLA 2OY0A 1VJGA 3QX8A 1M10A 2N9UA 1LDNA 2FQ1A 2X5OA 3DMPA 3OIDA 4RM2A 3RBXA 2OBYA 4C0AC 4E2XA 2VEOA 1GGHA 2ZJBA 4MO2A 4ACAA 4PQGA 3O3MB 3PJDA 4UPVA 5A4JA 2JLVA 1E2BA 5JFOA 3HI6A 2AK3A 3R5SA 1YTUA 3DW3X 1D04A 2X8BA 4D9IA 5J2UB 1RYZA 4Y0AA 4GPZA 3FCOA 1C9YA 3D3NA 2HX1A 4OO3A 3PFIA 2C7BA 4KTVE 2H1FA 5D00A 4X45A 4FZJA 1D5WA 1XZAA 4LC9A 2XIJA 4CL8A 4D0NA 1LU9A 1TCVA 1C1XB 1SWVA 1YRYE 2QMHA 2WRZA 4JOCA 1NIPA 4N39A 2FYTA 2ZSDA 2QL9A 5JW6A 3EDOA 1M1NB 2JHPA 4DSTA 4CEJA 1JIUA 2GSWA 1X7DA 2AOTA 3UQYS 3TR6A 1T13A 4LV6A 4LHEA 4B31A 4OJTA 4RLQA 1Q57A 2C2ZA 1E3IA 4BB0A 2BGMA 3TSOA 4MXDA 5KPJA 2BLNA 3WWCA 3IXLA 2GYYA 2O0LA 3CYFA 3L6DA 1O95A 3M6WA 3MINA 4QATA 1CG6A 5KEIA 3KQTA 4PGAA 7MHTA 3EISA 1ZNZA 3NKLA 2RAFA 3FGPA 4Q3BA 4BN5A 3CKMA 2H7CA 1AS0A 3C3MA 1GV1A 5ULLA 1SKUA 1L5KA 2HLPA 2OV3A 3RK4A 1AKEA 3HCFA 2Y1DA 4ZXFA 1G3IA 2VRCD 3DDUA 2BBOA 3F5DA 2ENWA 4AX8A 1TZBA 4BQSA 1JMKC 3RRNA 4HF7A 4HNAB 2IIQA 4YCSA 4J1GA 2ZSAA 2BDUA 1CY8A 1W9HA 3BWCA 1F6DA 1LBSA 2ZSHA 3DYVA 1GSIA 2QSZA 3RG2A 4C2UA 1YDFA 1TM1E 4KIFA 4MUIA 2FUG6 1FNDA 1D2CA 1GGJA 1G1MA 1M2HA 3ESDA 4I1YA 5F9MA 1M0EA 1N0VC 1DWUA 1INLA 1RKXA 1R0KA 4X1YA 3O38A 2XNDA 1BWRA 4B3BA 4BUZA 7GPBA 3N2NA 1M5TA 1R50A 4ZARA 4ND4A 3SQWA 3D3QA 1G5QA 3VPFA 3B53X 2X0IA 4HYTA 3UA3A 2D1SA 5AXDA 2HPHA 1KSHA 4FE4A 2LUOA 4AB1A 3VR5H 1PD1A 5TGTA 1DRJA 1T26A 2FGJA 2JFHA 5JPIA 3GZ4A 1MEEA 3WGUA 1ZIYA 2IYZA 5FBHA 3T9CA 4TTAA 1Z2AA 1YZTA 4FYVA 1WZCA 2X9LA 4JVNA 1DAOA 4U8GA 4MQ4A 1AKQA 1YACA 2QRUA 2CVQA 1SXJB 2EARA 2VP3A 1DBQA 2VOJA 4LWOA 3RV4A 4D8UA 4UCWA 4KQEA 2ASEA 5L4SA 1SR8A 1YZVA 4OY3A 3AKZA 3ISVA 2IUFA 1L5SA 4XDHA 2WD7A 4BZWA 2WIBA 2AG6A 1PWZA 2JAWA 4JOQA 3ZHVA 2ZJOA 3GEMA 3OU2A 4AQ7A 4FSHA 5TPZA 1X9HA 4YV7A 4LZZA 2VF7A 4BVFA 3ILVA 3FDZB 1A3CA 2OWDA 2ZK7A 5E7QA 3U7EB 1NY5A 5H0IA 1C9KA 1WKCA 4MLPA 4PX5A 4XYMA 2AR7A 3MGAA 2OESA 3Q85A 3TLGA 2HBYA 1OREA 1G2IA 3NBUA 5CDYA 1I1HA 3PYLA 4UXHA 3VR3A 3D8RA 4ZWNA 2BKAA 2FWIA 2I6SA 4QNMA 4O4JB 4QREA 4I2NA 4ZJYA 4TQGA 4MGZR 5A04A 1GTZA 3Q98A 5BYKA 2ZB7A 2GN4A 3H1TA 4CRWB 1WB9A 4KXLA 1SBZA 1TFRA 3IALA 4EPYA 4JR0A 3W4IA 3KE8A 4RPJA 2IYLD 2Q4BA 2YHIB 3OE7A 4K9PA 1WZIA 3PD7A 5JCOC 1M0WA 1JHXA 2QAGA 1GN9A 5LIRA 2GLXA 3BCHA 2WUFA 3GA0A 4RPKA 3ABQB 2AUTA 2ZUCA 2P77A 3KYJB 4LF8B 1HURA 1USWA 1E3MA 3S2EA 3E3AA 5E6UB 1CQWA 1LF0A 1TJYA 4QBTA 5KHLB 1NG9A 4D45A 4DLPA 3DMYA 5IKEA 2QF7A 4QARA 4Q3EA 1WWKA 4MWDA 1Q11A 2HI0A 1E5QA 1XAJA 2FMHA 3L0CA 1QBKC 2RG7A 3GJ8A 2I7TA 2OVBA 5GWXA 2AFVA 3COWA 1Q1EA 3K15A 4MZXA 2EQ5A 3I2FA 1ILEA 2JVKA 2PO7A 2YCBA 3W3ZB 2V55B 2BFNA 1BO6A 1OPRA 4D9NA 5AVQA 4KX3A 1NXVA 2QRGA 4BUJA 1EG7A 2ONJA 5CLLA 4NL4H 2VNIA 2OZVA 1R4MA 2QEQA 2EHJA 2Z57A 1EA5A 1MFZA 1H23A 2WKRA 4ZQFA 3TCNA 3LY8A 1YZ3A 3AESB 3ZWKA 4B44A 2ZSIA 3F47A 5JBNA 3TGLA 4G0QA 2OXTA 4BS9A 1WJGA 2VP5A 4HRAA 3VH4A 4YYEA 2C4UA 1XR3A 3HGTA 7YASA 1OTYA 3NUGA 4CG3A 3OEED 4IQ0A 3IHLA 2R8BA 4URXR 2PJUA 1N8KA 2L19A 4CIWA 5INTA 3FOFC 3ZCRA 4L08A 2R1TA 4DQXA 4ENRA 2C9OA 1NHGA 1E3WA 2XDAA 5F7JA 5CMLA 3VR0A 3EEBA 3NTVA 1JR3A 3GFFA 3PNBA 4G1FA 5K3AA 2B4YA 1YBMA 4C4SA 4DUGD 5KJCA 2IE0A 3WRXC 2VF8A 4UU1A 3SSAA 4D43A 5B58T 5HQJA 5KYXA 2H2FA 1I6MA 3EQ2A 5G4LA 1NQ5A 4MJ7A 2NU8B 2V7QA 2YQZA 4R1SA 2EQBA 4GNKA 4XWYA 3TMKA 2GZHA 2IH4A 2WYIA 5AK0A 3OZCA 3S5UA 3VX3A 4B6OA 5TT1A 1T3HA 1XTPA 5KDOA 1ZA2A 1IN1A 2NVBA 3OBBA 4EY8A 5ALKA 4TZ0A 2CK3D 1ONOA 5B1SA 4I55A 1XVTA 1LK7A 1XDUA 2XA9A 3NEJA 4NF2A 3Q88A 1QKKA 2UU9B 1G2PA 1GFZA 1F48A 4Y2QA 3WQBA 2QLBA 5ITZA 4ENUA 3KBOA 1NWCA 5KDLA 3AWIA 3PXAA 1YZYA 5EQFA 4I4NA 2X5JO 3B6IA 4XWKA 1G21B 2GILA 4PBSA 1SG6A 2G17A 3K9BA 3ZC3A 5C3MA 1V9LA 1NVBA 1SNYA 1ZQ1A 2WMOB 2XD9A 4OXRA 4ALNA 1EEXB 5BSEA 1CS0B 1J0XO 1Z07A 2QRKA 3CISA 4OXXA 1N9KA 2M1XA 1AUOA 4L7VA 2G72A 3QITA 2FDRA 4YH1A 5KTOA 4CNQA 2DQZA 1BJKA 3UJAA 3C8UA 2QSYA 4XRRA 2IOQA 3PA6A 2HQRA 4DIMA 1C7ZA 1K4MA 4ZDIA 4ABYA 3W90A 3AUJB 3AHGA 3NQ41 4L74A 1KH3A 3DAFA 4KYIB 1MBZA 1JL3A 4R2IA 5EZQA 4R7ZA 4DJDC 1YCFA 4PFQA 1ULBA 3TIFA 3O7MA 4KIUA 1HYBA 4AG6A 4D81A 1X7WB 3QNWA 2YJ3A 5E95A 2X86A 1O9HA 2HFKA 3R5JA 4QJ4A 3RASA 2OAQ1 4ONEA 1QIDA 3F90A 3R5HA 2O8DB 3W2TA 1CUCA 4GE3A 3GP3A 3A1UA 2VLBA 2N75A 1IG3A 1TYCA 3CRMA 3RYTC 3VR5D 3LWNA 3MFQA 5EZYA 3VU8A 1WB6A 2DPYA 3ZKAA 1W4BA 1FYWA 4OLFA 4RQTA 4UBNA 1H2YA 2JL1A 4DV3B 4EFMA 1J2RA 1ISFA 2ZPAA 1A9RA 2WHPA 4H08A 4ZYTA 2JBHA 2P0AA 1KDPA 4G25A 2QVGA 2BZ0A 5K5EA 1Q7TA 4N0PA 2FXVA 1TUGA 2OA0A 4B4OA 3I37X 2OQIA 3RIEA 3MB5A 4CTJA 5DM60 2XTNA 2ZIVB 2RGCA 4JXZA 5LSAA 1YZFA 2PWBA 3IIKA 3CRQA 1XJCA 2CLCX 2VAXA 2IBMA 1PV4A 3DM9B 3H4IA 1SU4A 3RWBA 3W1VA 1FFXB 3FYTA 3LUPA 1GTL1 4LGVA 3FMFA 5B7QA 1NU6A 2O6LA 1Y8AA 2KBFA 3EOBI 3QKTA 2QRVA 3PJRA 4M53A 4DWOA 4J3FA 4TS9A 3D2BA 1XIVA 3Q4GA 4QAQA 1NQAO 3NBKA 1V71A 2C9MA 3C5HA 4YALA 2D59A 1XVLA 4QDUA 1JXQA 2XR1A 3RJZA 4YXWD 1QIJA 4CKCA 3WNCA 1FX1A 4JQOA 1CU1A 4MX8A 1XVIA 3JCZA 1DQYA 2WVGA 4C7MA 1AV7A 1L0BA 4ZU1X 4IJQA 4I1PA 2HW8A 1KGSA 4Y1RB 1EUQA 5HFNA 3V8PA 5BNFA 3B5JA 2MT9A 4K81B 1GUDA 2EERA 1X8KA 2QLMA 4PNPA 3S5JA 2NXNA 2E4VA 2OORC 1NBAA 1RR6A 1SEVA 2PMBA 3CBGA 3NHAA 2W2LA 5AJTA 1L7VC 1LK0A 1SVLA 4L4XA 4LCEA 5FFNA 2Q46A 4RTNA 4QHYA 1SOUA 2LPMA 1O0CA 3ZDAA 3A06A 1SURA 1TJ5A 2AR0A 2ROQA 1EFHA 5FBLB 2FMKA 2GN1A 3ADPA 1XUOA 4Q5IA 4LF9B 3T52A 3TOZA 1XTQA 2FSSA 4JK3A 4L6IA 4YCBA 3SYLA 3WP1B 2Z04A 1BU8A 1N6LA 1XDZA 2GDJA 4LJ5A 4TLEA 2YWHA 2YDXA 3LH5A 4U4AA 3J7AC 1UJ4A 3ITKA 1EUDB 2P11A 3RC9A 4MW4A 3B2EA 3MIIA 4ACBA 3QOFA 2AMLA 2UYQA 1VE7A 2RGBA 2VDKB 4KVFA 4XE5A 1ZU4A 4CT0A 4B0PA 4OLAA 4F60A 3R7LA 1ZIDA 3MWKA 2PO5A 5IDWA 4LSMA 2L0XA 1JIJA 2G40A 4ZT7A 3RSHA 4OMCA 3ETGA 1VPLA 3IEPA 2CE2X 4P82A 4M8LA 3AX6A 1SQ0A 1GKUB 3AEZA 1FP1D 4K0KB 2LZ0A 1RI5A 5GZ6A 3PTLA 2GK7A 2DOKA 1RJEA 4EUSA 1F5NA 2VRBA 1Q16A 1DLJA 4WNYA 4XJVA 1EK2A 1MB4A 2HM7A 4RMJA 3M4JA 1A8UA 1PG2A 2FEAA 2G1JA 2JHGA 3B52X 3VSAA 5EE3A 4RJTA 2KB0A 3TDNA 1NQTA 4JC4A 1R5JA 5FB3A 1EHIA 2ID7A 1N1EA 1J0AA 2F3PA 4GVPA 4XB2A 5GZ1A 4KTTE 4XIFA 5JISA 1T3TA 3ZK8A 1C3VA 2WPDA 4FYPA 3FDFA 4ZU3A 5EVCA 3NDPA 5JNRA 1F2DA 5KYUA 2JW5A 1Y1SA 3BE5A 3X1XA 1B76A 1SUBA 2WA1A 4YN3A 3A6JA 4ICIA 3T0IA 4CM8B 1JHVA 1QXSA 4KSCA 1I2ZA 1OVGA 2A84A 5THKA 4E2WA 3FUUA 4I9UA 1UBJS 2DU8A 3H04A 3R20A 5EE5B 1AZWA 3OCWA 1T10A 1XGKA 1CQXA 3WWYA 3ORFA 3URMA 3AR9A 2J07A 5D1NA 5K0ZA 3D6FA 1OX6A 1VJ1A 3A1VA 3L93A 1SD5A 5HF6A 4TGLA 4ED9A 4UNQA 4EG6A 3VKHA 2GEJA 2QP9X 3I05A 1MDFA 1IM5A 1HDGO 3CMMA 1JFFA 1GPJA 1HZZC 2HLDD 3G9ZA 2CLFB 4KDCA 4G36A 3MMPA 1LPSA 3OM8A 3TEJA 1J97A 3QV1A 4FFBA 4OFWA 4KUEA 3UENA 3GEHA 3RT1A 2NQ8A 1XCOA 4BNTA 4QPNA 4XVHA 3AJAA 2A1TS 2A9FA 1J2UA 1V1RB 3MQ2A 4I6JA 2VXOA 4E4TA 3ZZ1A 2Z6AA 1O1YA 1QCYA 4B6GA 4ER7A 4URUR 1VDMA 3KT6A 1VG9B 4AJJA 3G5AA 1N9GA 4XD7D 5HOQA 2NVUB 4EUHA 5CFLA 4KAXA 3NNDA 1S7CA 5FPHA 2MHCA 5BSRA 3E48A 3HFRA 5LU8A 1BROA 1NIJA 3LFUA 4WFJA 3NI2A 4JAVC 5AJWA 1YVPA 2ZJ4A 2DEUA 4I8XA 2Y6UA 1LK5A 4B6QA 3HYSA 5HKBA 4EQ6A 5JRDS 1BDHA 2O2GA 4J16A 4NEQA 3R5TA 3KDSE 1QVZA 1PEKE 2A58A 3DMTA 3KFVA 3T94A 3EDCA 3N6VA 3PE4A 4ZJUA 5I6DA 4MP8A 5KU1A 1N0IA 2R1UA 3PEUA 4D74A 1KHHA 5KSWB 1WETA 1I3CA 3CY6A 1OU4A 3S1SA 2ZAIA 3GFRA 1NE7A 3IUPA 5BW8A 3P5SA 4GMKA 3PQDA 4JIMA 3QF7A 2IBSA 3BXHA 2J3JA 1PFWA 4V02A 3U7RA 1WCWA 3IT1A 4Q4HB 2GXSA 5JDCA 1M33A 1ZIPA 2B2NA 4HXEB 4QDJA 4RXMA 4CGYA 1OH6A 4DSZA 2QZZA 5IUKC 5AI6A 3KS9A 5IEBA 1SD1A 5JMWA 1UBHS 3JQ8A 4ASUA 2ZR7A 1M1UA 3CLVA 1MA0A 1O4WA 5K4GA 1QGYA 3ZX4A 2VHVA 4J1SA 4RO0A 1Q20A 1JTVA 5TX7A 1LWNA 2V65A 2UYHA 3GR6A 3ENVA 1JVSA 5LB2A 3GFGA 1N77A 1EP1B 1SUDA 5GP1A 1I4WA 1NPTO 4YCLA 4GSYA 3AV0B 1XEWX 3I2GA 2QZPA 2ZBGA 3RS3A 5GTDA 4WKCA 4NRDA 4PVCA 1YHZA 2BFEB 1W0KD 2RCYA 3K16A 3SBEA 2VFAA 5TQVA 1DBIA 1UDCA 4DM4A 1PFYA 2K6GA 1N6NA 1W25A 1Y3FE 2C29D 2Y1KA 3AF2A 3DAPA 1SIUA 3BSWA 4QEZA 4UFNA 2WNHA 3FCYA 2WM9B 5A05A 4AZVA 1SCUB 3ZY2A 4Y6PA 4QFBA 3KYBA 5IN5A 2IUUA 1DQSA 2IYPA 2NYUA 4WLFA 5EHQA 4BJHB 3ELBA 1TAQA 3K53A 4IQGA 2GBPA 4G65A 1ZIXA 1QFSA 4X63A 2I80A 3E23A 4G07A 4JLVA 4YI5A 5KOJA 5DGTA 1K86A 1GYPA 3WB1A 3GG9A 3THXB 5IH3A 1K4KA 3ZV6A 2E4AA 1PL7A 3CG0A 3GFTA 2XT9A 3OPYB 3ZEIA 4DR5B 3DFZA 2XI4A