1I3LA

Molecular basis for severe epimerase-deficiency galactosemia: x-ray structure of the human v94m-substituted udp-galactose 4-epimerase
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
347
structure length
347
Chain Sequence
AEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAMGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNVVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for severe epimerase deficiency galactosemia. X-ray structure of the human V94m-substituted UDP-galactose 4-epimerase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords UDP-GLUCOSE 4-EPIMERASE
total genus 126
structure length 347
sequence length 347
chains with identical sequence B
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 2001-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1i3lA02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1i3lA01
1ISGA 3W8EA 1GEEA 3ASVA 3V5NA 1QV7A 1U8XX 2JAHA 4NJMA 4L73A 3MJSA 3JD1A 2NU8A 4HFNA 1ML3A 3WNVA 1H94A 4PLZA 2VHWA 1WVGA 3EDMA 3OFSA 1Q0HA 2VWGA 1WNTA 3QJ5A 5IDQA 1GCUA 1P45A 4ZRNA 3V1TC 2OHXA 4A27A 3VPXA 4XR4A 1ARZA 1RPNA 1UAGA 3BMOA 1KY4A 2HMUA 3I52A 3L4SO 4ZD6A 1G6KA 3WOHA 1Z6ZA 4AJ2A 5L4SA 3OIGA 4PG8A 3O4RA 1CF2O 1MUUA 1MB4A 3RUEA 3VPFA 2P9EA 3AI3A 4B4UA 4DREA 1ADGA 5F3RA 5KTKA 4CL3A 5GMOA 4KP7A 4IDFA 3C3XA 4NBUA 4WUVA 1X13A 3ZU2A 2FN7A 4WPGA 1QYDA 5IAAA 1C1XA 3EZLA 4ND5A 1EVIA 1F0YA 4B7UA 3K6JA 2LDBA 3DC2A 3JCZA 5H82A 1FDWA 4UUMA 3SEFA 4KTTE 4HXYA 4BO4A 4JCOA 5MDHA 5IZCC 3GHYA 2FPGA 1HZJA 3NDIA 2HMTA 2Y1CA 5DP1A 2QYTA 1CIVA 3ZWCA 4YPOA 4XGKA 1LRKA 3QV1A 5I8ZA 2OZPA 1EUCA 3PFWO 1B8UA 2X9VA 1L7EA 4QTZA 3M1LA 4HFJA 4BNWA 4OKNA 2O50A 4XGIA 1RJWA 4R54A 4QFCA 3EVNA 3KBOA 3JYLA 4BGVA 4JBIA 5BNTA 3SLGA 7ADHA 3INTA 2DLDA 4II3A 1H6DA 3RFTA 4UVDA 4ALJA 4MVJD 3JQ8B 4CMCA 3ENNA 3I9LA 3V1YA 3ZW8A 3GRKA 4E30A 2X0NA 4IIUA 1JN0A 4BNTA 4MKRA 4QO7A 5J23A 2I5PO 5ICSA 5JFOA 3WYEA 1NPYA 3L0DA 1LJ8A 4TSKA 4B3IA 6LDHA 2WD7B 4PZEA 3RVDA 4Q3NA 2BFAA 4GX1A 1HEUA 5G0TA 4QT0A 1K2WA 3DBRB 2YFHA 1PIWA 5KVVA 1Q2XA 3IOYA 5JAQA 1YRLA 2HLPA 5I7FA 4W7HA 2VWHA 3JQDA 3O9ZA 1MP0A 2CUKA 4WASA 1JWAB 1YQXA 1KVTA 4YXFA 3QWFA 2R6JA 3BMQA 2I65A 3PLNA 3KYBA 4GVXA 4YJFB 3WIEA 5TJ9A 2DBQA 3OQBA 4CQLB 4IJUA 4RVDA 2DTDA 5L4NA 1H5QA 1D8AA 3CTMA 4W82A 3OA2A 4KQXA 1GZ6A 1U28A 2V6FA 3DZKA 1O0SA 4Z9FA 4UEOA 1NQAO 3AUUA 1Y9AA 2YY7A 5G2OA 4BO9A 4CM1A 2QG4A 3HFSA 3V8BA 3K9QO 4YJHA 4Q3DA 2A94A 1BXKA 3GA0A 1CETA 2YHUA 3DZJA 4RLHA 1ENPA 1HE3A 1MFZA 2O2YA 2UUPA 3S1LA 1LLQA 2X1HA 4NI5A 1C3VA 3E5RA 3I83A 2IEBA 2D1YA 2WD8A 5DOZA 3HNPA 3LC1O 3VPGA 4DYDA 1P33A 4E5MA 3GT0A 2ZIZA 2G0TA 3DZBA 3FR8A 3H9GA 2W2KA 4I5EA 5IDYA 2O3TA 1U5AA 3QVXA 1XQ1A 4CLEA 4D46A 3QP9A 3GG9A 3I6QA 5EQFA 4DLLA 1RKXA 1PL8A 2PZLA 1VL8A 3T7CA 3WTCA 2X0IA 4XD2A 5JYDA 2X9GA 3H9JA 4HBGA 1MGOA 2O48X 4S3MA 4NHEA 1GTMA 4BO8A 4R3WA 2D2IA 3T7EA 1V3TA 1H93A 2B69A 2JCXA 5FI5A 3AUSA 2PZKA 3DEYX 4WNIA 2D5AA 2D8AA 1YQDA 4BMSA 3JQ7A 4EJ6A 2D5CA 2A9FA 2I76A 4OYRA 2VRBA 1VL6A 1N9GA 5IF3A 3MZ0A 5F1PA 2J3IA 3WGZA 3AWDA 1ONOA 4F6LA 1KVSA 3WWYA 5L4LA 3UXYA 2CY0A 1YBVA 3KLMX 2NACA 4Q3BA 4E32A 1PQUA 1KEWA 4XWYA 2GZ2A 3OH8A 3KRTA 1DHRA 5JC1A 5COAA 3GNSA 1HL3A 5JNLA 1ZEMA 4J9VA 4NIMA 3QA9A 1NVMB 5AXCA 5EJ2A 3TZKA 5A3JA 1BSVA 4TKMA 3DR3A 5LDHA 4E21A 4PZDA 4OAQA 2D59A 1Y8QA 1KS9A 3E9QA 1NBOA 1HLPA 4L74A 4BOYA 4DPLA 4B3HA 3WDSA 2ZATA 4YAEA 1IL0A 2AW5A 3DOJA 4IXTA 1N7GA 2C59A 4Z3DA 4AJKA 4M87A 4AICA 1JTVA 4UREA 2XPCA 1PL6A 9LDTA 2EP7A 2BFOA 4YR9A 1T4BA 2HUNA 4O63O 3TWOA 3ANLA 2IE0A 3B6ZA 4M49A 3GOHA 1V0JA 4PLPA 4BB5A 2V6BA 2NLOA 2JFHA 3EYWA 5A04A 5KOIA 4BNUA 4GMGA 4ALMA 1ZSYA 1F17A 3RBXA 4MP8A 1N5DA 1E1LA 4ND4A 1T24A 2RCYA 3H4VA 3UHAA 1XKQA 5LCXA 3ZV6A 1O5IA 3GN2A 4PVDA 2NTNA 4E3ZA 3U3XA 2C0CA 1HDYA 4DC1A 5IJZA 4KUEA 3UGKA 5KJ6A 3K73O 1HZZA 3VPHA 5A02A 2O23A 1DJNA 4P22A 2B5VA 1NAIA 1P1HA 2QQ5A 3F46A 1R12A 3AM5A 4D3DA 2YHIB 3K8ZA 3MWEB 4FN4A 3JD2A 3NX4A 4WNCA 2SCUA 4BNYA 1JWBB 1NWCA 1DPGA 5KJ1A 1CEQA 1ZXLA 2BELA 4LCEA 1Y5MA 2X23A 1RYDA 5TT0A 4R1UA 1DRVA 5DCYA 4URFA 4CUKA 1P74A 3NEPX 3H2SA 1K3TA 3H65A 3SC6A 3JQ7B 1WAMA 3OEWA 1RM4A 3OMLA 1J5PA 4CLHA 3U4IA 1DIAA 4BKPA 5C3MA 3OJLA 3I6IA 4RPLA 5TS3A 2W4QA 3X2FA 4YACA 2GO1A 1ZO8A 2Y99A 3BZUA 4DA9A 4FJ1A 3DFUA 1ZMTA 1RM3A 3WWZA 5EN4A 2IYPA 1LQTA 4MIOA 3FPCA 4MPDA 2E6UX 3SLKA 4R9RA 3VH1A 3ZU3A 4GAEA 4NDNE 1PX0A 7MDHA 3GFBA 1ZMOA 2POQX 3Q9UA 4G81A 4ZQGA 4TRNA 1NAHA 1J49A 4NU6A 1PZFA 3S2GA 1YB1A 5DBIA 4W9NA 1PS9A 1BGVA 2VHZA 2GDZA 3BTVA 3GDGA 3WS7A 1PJLA 2FMUA 3N58A 3EC7A 4JJIA 3WMWA 2NWQA 3PJFA 4G5HA 4XGNA 1UXJA 1PS8A 5KJEA 3FBGA 3PIIA 4BQRA 1I0ZA 1ZNQO 4GBJA 4OSPA 4FFPA 4PLVA 2BGKA 2P9CA 1VM6A 4XQ9A 2C7VA 3ONDA 5BSFA 4Q39A 2BKAA 1BMDA 2GERA 1U4OA 3H3JA 4L9RA 4YCAA 3K2EA 4A03A 4F45A 3UN1A 4XQCA 5A4DA 5LDGA 1HTBA 5T57A 1Q0LA 2C20A 4CMEC 1LTHR 2Y1GA 1EZ4A 2AQ8A 5A5EA 1V3UA 3D5QA 3TOZA 3UW3A 3OP4A 1W4ZA 1QYVA 3KYCA 2ZCVA 2VYVA 1A5ZA 1QKIA 5AXAA 1GY8A 3NDJA 5B37A 4BVAA 4CMHA 4NBVA 3KSZO 3TRIA 1A27A 3ROPA 1GZ4A 4JLWA 1QYWA 5IXSA 2GASA 3HSKA 2ILTA 3FNHA 1UAYA 1A9YA 1LQUA 5JSFA 3VZPA 1L1FA 1A7AA 2ZB4A 3A4VA 3FRJA 4L4SA 3AK4A 1HLDA 1Z7EA 1XWFA 4BO0A 3PDUA 3C1OA 3E48A 3U4DA 3TZCA 5BSEA 2WE7A 5GZ1A 5B1YA 1MX3A 1MXHA 3STHA 5TX7A 4P8RA 4FPXA 2AEMA 1EQ2A 4R5HA 4IMPA 5IZCA 3PXXA 4NFHA 2GN9A 1BRMA 4PRLA 3ZV4A 1LDNA 4DIOA 1YQGA 1SOVA 4DC0A 2GF2A 4JX8A 4U7WA 3WNQA 1M6WA 1PQPA 1PU2A 1SB8A 2CF5A 2FZWA 4FQ8A 4YTEA 3UUWA 5A9SB 2J6IA 3F5SA 5K6AC 2Z5LA 3JYNA 3NKLA 4E0BA 2VYNA 4KWHA 1C1DA 1YB5A 2DBRA 3WQSB 2OOSA 3JQGB 3NTRA 4E4YA 3E03A 5TQVA 5BQFA 3ETGA 1N92A 4IQGA 4KZPA 2P2SA 4CMIB 2P91A 3OQ1A 1WDKA 4Q9NA 4N5MA 4YJGB 2J5RA 4FGSA 3BAZA 2DT5A 4BQPA 4IINA 2ZB8A 4NZ9A 4BO1A 4ONEA 3D3WB 2HU2A 1TLTA 3TSCA 1Z73A 1SBYA 1IPEA 4LMPA 4OXKA 1LDEA 4EZBA 2AE2A 4YQZA 3H9UA 2Q2QA 3I1JA 2IYOA 4WKGA 2WDZA 3RUHA 4TRRA 4U6QA 1ZBQA 1C1DB 3E5MA 4CM6A 1LDYA 1GUFA 3A06A 2NSDA 2VT3A 3U62A 3ZHBA 5JYEA 1TI7A 2X0RA 3L4BC 3PQDA 1ZH8A 2AMFA 1CQIA 4O1MA 1A71A 4XYEA 3WICA 4Z0PA 5COQA 2Y05A 1Y1PA 2F00A 3CEAA 1Y7TA 4R5MA 2NV6A 3PJDA 1QLHA 4N5NA 2W2LD 2VUSA 4KTVE 1DXYA 4I5DA 4YAKA 1T25A 2A35A 5U9CA 2YUTA 3VHRA 4B8WA 3PFFA 1GQQA 2XF8A 2VHVA 1NP3A 3RUAA 2DFVA 3ETEA 1GPJA 3ZU4A 4E2WA 3GRPA 5DZSA 3TL2A 3GPDG 5JE8A 3FF4A 1FDVA 5L7WA 5T8KA 4NJMB 1RYEA 3KZVA 4MVJF 1RM5A 1WZIA 1PGNA 3VH4A 4YA6A 3RD5A 4FFLA 3LLVA 5CEJA 3ZW9A 4H15A 3PTZA 1YB4A 1ZXBA 3AM3A 3DHNA 3EUWA 2VOEA 5C7OO 1KVUA 4AJPA 2HRBA 1M67A 1X1EA 5TRTA 1UH5A 1GR0A 4PLGA 5EESA 4J2OA 3WBFA 1WMAA 4CMKA 4YAIA 5JCXA 4ZU3A 4XIJA 3GC6A 1E1MA 3ITKA 3IDSA 3I9KA 1J0XO 1P0CA 4FFNA 1ISIA 2VN8A 1C0PA 4ND3A 5CDSA 3Q2KA 1R0SA 3IP1A 3JYPA 4YEDA 2Q1UA 1LDGA 2EKLA 1BW9A 1EMDA 1HT0A 4ND2A 2VTEA 4PLHA 4PCVA 4D45A 2EF1A 4EBFA 4D43A 2G1UA 4TKLA 3H5NA 4WGGA 1UDBA 2CNBA 3BHJA 3NJ4A 3WYBA 4XJTA 4RJTA 1EEHA 2DPGA 3AI1A 4XZ3A 2ZKLA 1OMOA 4HX5A 4OJNA 3VKUA 4DPKA 4RQUA 1R66A 4PG4A 5IN4A 2VHYA 3NJ8A 1WLYA 2NTJA 3GUYA 3JQ9C 4TZTA 4GGOA 3ROMA 1DIBA 3ZU5A 2FHSA 3EZYA 3LU1A 4WCDA 1OC4A 5L53A 3ORFA 2WEKA 4YVFA 1KC3A 3A9WA 3RQSA 3WGOA 1UDCA 3WGIA 4W7IA 1XR3A 5JO9A 3WBBA 3MWDB 4A5OA 3NT2A 1EBUA 4J1SA 3H7AA 1TT5B 4GL4A 4OXYA 1Y8QB 4GMFA 1KBZA 1E6EA 1JU9A 3GHHA 1M66A 1W73A 4X54A 2BMAA 1ZEJA 3QSGA 4J91A 1B2LA 1LLUA 3F5QA 3UFXA 4BUCA 1ZK2A 4KDEA 1VKOA 4CL8A 1LA2A 4IDDA 4Z0HO 3I9MA 1IE3A 4YT4A 4AJ1A 3DFZA 3C7CB 4AJOA 1DLJA 1PJ2A 4C4OA 1B15A 1U3VA 3KEOA 1DLIA 5AOVA 3D4NA 3B1JA 3FWNA 1ZK1A 2YDXA 4XIYA 5B4UA 2PFGA 3TOXA 4MINA 2VUTA 4EEZA 5A3VA 4RPKA 3GLQA 4BNKA 1I8TA 1PGPA 4J4HA 3EHEA 2PV7A 1DEHA 4G65A 4PLFA 5ILOA 1GQYA 5JAIA 4BS9A 4YJDA 3Q3CA 5G4KA 1EUDA 1QXSA 3CPSA 2A92A 1TXGA 1I3KA 3OICA 3L77A 2BI8A 3KYCB 5ER9A 1IYZA 2HK8A 3RUFA 4ZVVA 5IDXA 1EDOA 1NQ5A 2BHLA 2X9NA 3I9NA 1I3MA 3R3SA 4CM7A 5L40A 1Z82A 3JQCA 4IY1A 4RVSA 3I3OA 4N5LA 4CMIA 8LDHA 2VOJA 1V9LA 4KWIA 3KSUA 2JD1A 3VVCA 1U9JA 4XA8A 2V6GA 4IDBA 1Y6JA 5F1OA 3RIHA 3BTSA 1DC4A 2G17A 3PIDA 2HDHA 4Y67A 3FSRA 2R00C 3IIEA 4S1VA 4FFOA 4I08A 2I67A 4CM4A 4CMAA 1U3UA 3INGA 3DHEA 4L4XA 2QZ9A 4ROSA 4JXKA 4DMMA 4PN3A 2R2GA 3PPIA 3LQFA 1JKIA 3P2OA 3PYLA 3OBBA 3ICCA 1E3WB 1VJTA 2GRAA 4NH4A 2ZYAA 3ZWWA 1ZFNA 2J5QA 3TNLA 1JA9A 3VOSA 3HDYA 3GVIA 3RUCA 5T8KC 3ZNPA 2J8ZA 1KC1A 1T2CA 4BNXA 3F3SA 3D5TA 1O95A 4ZQEA 1YL7A 5AXDA 3EMKA 3QWAA 1VI2A 5F5NA 4DMLA 1E77A 3FBTA 3GMDA 5JY1A 5ADHA 2RH8A 3ZWAA 3JQFC 2BF7A 2Q4BA 1N9GB 1ISMA 2EV9A 4NPCA 2YW9A 3TF5A 2HJRA 3FCOA 4FSHA 4BNVA 2B35A 3WGGA 2FR1A 3H5AA 3LF2A 4CQMD 3H8VA 4GX5A 3T4XA 1HE4A 1OZAA 2B83A 5EERA 1SNYA 3KTDA 4E5YA 2OP0A 4R4JA 4EJ0A 4YT2A 5G0SA 4U0JA 1MC5A 2W8ZA 4PG6A 2NU7A 2NUAA 3AI2A 5FWNA 1DFGA 2PWZA 3QQPA 2EGHA 2AHRA 3RUDA 4NNJA 3PJGA 1W0CA 4KQWA 3RI3A 2VWPA 4H16A 4ZICA 4R41A 4W6ZA 1BHSA 3ETDA 3JD3A 1Y8RA 4NFSA 4CV1A 4XCVA 2AEJA 2VNAA 1HWYA 5BNFA 4BKOA 3KOUA 1HDZA 3JQ8A 3R3JA 3UH1A 1T2AA 3V2HA 4CUJA 3WQQA 3LC7O 3AU8A 1V35A 4MP3A 2FSSA 2DVMA 4R16A 1XCBA 1VSUA 1HF3A 1PR9A 2EHDA 1H2BA 4E2YA 2FY8A 3HJAA 1ZVMA 4W9NC 4QO8A 5CPBA 3K96A 3GH3A 3FTNA 1D1TA 3GDFA 5CEFA 2P68A 1R16A 4J0EA 3DWFA 1SMKA 1TT7A 2WMDA 4WLFA 5I9NA 4KUHA 4WLEA 4RLSA 5JW6A 3AW9A 1DB3A 2ET6A 5ENDA 4DQVA 1YDWA 3I9OA 3ZH2A 3F1LA 5DT9A 2JFGA 3D0OA 3JQBC 1U5CA 2GPTA 2YHIA 3ZNQA 1KY5A 4ZN6A 1Q0QA 5JCJA 1EQUA 2HAEA 3W4KA 4PZCA 1KOLA 1XYGA 3Q0EA 3UKOA 4D44A 4QEDA 1PJ4A 3BHMA 1G0NA 3CZMA 2RHRA 4JK3A 3PEFA 1GQ2A 4HV4A 4L8VA 1PSDA 1O6ZA 3LYLA 3FN4A 1JKFA 4R1NA 4CJXA 3HB5X 2Q1WA 3MOIA 3S2EA 4L4RA 2WTBA 3IKVA 3L4BA 2C82A 1IY8A 5HTOA 4J90A 4ND1A 2NU6A 5CDTA 4E5PA 4J43A 4E33A 1ENOA 1F14A 4R1SA 1GADO 2FPPA 5B12A 3INRA 3Q2IA 3AOEC 2DBZA 4Z3KA 2NQTA 2P9GA 2PH5A 4ZQBA 2DBVO 4RL6A 3ANMA 1P1RA 1OFGA 3TN7A 4OGWA 3BMNB 5A9RA 3OEYA 2X7HA 3LC2O 1LC3A 3KV3O 4O6VA 5CAEA 1LSJA 5AYVA 2E48A 1HKUA 4Q3CA 4B4WA 1OOEA 1V6AA 3DTTA 1CDOA 4LISA 2OO5A 1R0LA 1S7CA 4J49A 1T4DA 2GYYA 3DB2A 4IIVA 4CV3A 3ZHZA 2RIRA 4N18A 4PVCA 5BT9A 1X0VA 2O3QA 1UXIA 4M55A 5K6AA 1YBAA 3DZFA 1PJSA 1XG5A 1QORA 2BGLA 4OKIA 4PFJA 5KJCA 4ALIA 3M6IA 1DIRA 4JP3A 5ENVA 3ZWMA 5DULA 1ZCJA 2QIOA 1EVZA 2QRKA 2I6TA 4J4TA 3I4FA 2YDYA 3D1LA 2EW8A 1ENYA 4XQEA 4B7CA 1GYRA 3JYQA 4JGBA 3QRWA 4GQAA 5L51A 1QSGA 4FIZA 2PZMA 1K6JA 1F8GA 2HO5A 2QHXA 2NU9A 2EJVA 3DDNA 3IP3A 4DTIA 4XQGA 2BH9A 3OJFA 2UAGA 3PHIA 2IEDA 4IBOA 3HZZA 1GYPA 4EJMA 4OM8A 4DVJA 2UV8A 3FR7A 3WYCA 3E1KA 3KB6A 3BHIA 3OQ6A 1B8VA 1U2GA 1MG0A 2QZZA 3HUDA 3SX2A 1U7HA 3WGQA 4E13A 2VCYA 4IDEA 4U6SA 3RJ9A 3MEQA 1FDTA 2ZK7A 4XR9A 3RFXA 1OC2A 2CVQA 3LT4A 2VTDA 1WMBA 2HK9A 3JQ9A 1YGYA 5THQA 3K5PA 5T67A 2GZ3A 3IUSA 4BNFA 1LX6A 4O59O 2YV2A 2B4RO 2D0IA 4DQXA 4F6CA 4LRTB 3FTPA 4UVHA 5DNAA 5JBIA 4P4NA 5JXWA 3CUKA 1UZMA 3KM0A 4HKTA 1U1IA 5GY7A 3CMCO 4JP2A 3RC1A 1C0IA 3QVWA 2GD1O 3C7AA 2V6MA 2ZJ1A 2GN4A 4XKJA 4MJLA 1A4UA 1WXDA 8ADHA 4BO7A 2OGUA 4BNMA 1YE3A 4AG3A 1ZK4A 4AL4A 3GN1A 4R9SA 3TFOA 2BRUA 3BMNA 5ES3A 5TIIA 2Y67A 3WJAA 3K30A 4HY3A 5JMPA 4WEOA 5TF4A 4CR6A 2CMDA 1H0KA 4RF2A 1WW8A 2BLLA 4KDFA 4FJ2A 4ZA2A 4EW6A 1GEGA 3HFGA 3D7LA 5KKCA 1P77A 3BMQB 4FW8A 4CM5A 1XEAA 2AG5A 1HYEA 5KNLA 1JVBA 3F47A 4HNGA 4LK3A 3Q6IA 1DAPA 1EE9A 4R1TA 3WGHA 1B26A 1CQJA 3CXRA 1U3TA 4ITUA 1E7MA 1P1IA 4IQ0A 3W1VA 5U1PA 1XU9A 5JDCC 1DJQA 1O9BA 1AUPA 2OUIA 4XRRA 4CM8A 5KVCA 1HYHA 2WD7A 4GPD1 2PGDA 1XDWA 4RGBA 1B3RA 2XOXA 4UEKA 5DOVA 4CQMA 3PHJA 5IXYA 1E3LA 4NFYA 5C7IO 2Q99A 1AHIA 1K5HA 1IOLA 1I36A 1HDGO 2ZYGA 3PVZA 2VRCD 3QWHA 4KOAA 2J3KA 3ANNA 1CRWG 3QWBA 2Q4EA 5JO0A 3OM9A 3NAQA 1CWUA 2YJZA 3RWBA 2XAAA 4QX6A 5DCWA 4DLBA 2X4GA 3SC4A 4ZQHA 3TZQA 1SZJG 2EWMA 4JN6B 3D3EA 4D0SA 3WGYA 4IMRA 1NVTA 3HWRA 5L45A 2ZB7A 4P4GA 5L7TA 2EP5A 4D79A 3BIOA 2C29D 4LGVA 4UVGA 1ONNA 2VT2A 4YB8A 4W4TA 5TC4A 1ZUD1 1KIFA 1PGJA 1ZK3A 3ZNOA 3WSVA 4F3YA 4RDHA 3FPLA 2HMVA 2JAPA 2Q50A 4BNNA 1SC6A 4B3JA 4CM9A 2H1SA 2V7PA 4IJWA 4N54A 4BGUA 3RU9A 1IUKA 2X86A 4P4LA 1E7RA 4NJOA 1JW9B 3D4OA 4M86A 5L7YA 4XX0A 1R4MA 5B4TA 1PTJA 3GZNA 3U0BA 4CPDA 3GPIA 3F1KA 2PKRA 3V2UA 4Y6SA 1MV8A 1N1EA 5JLAA 4XYLA 3G1UA 3IKTA 4NR0A 2OXIA 2I3GA 5A06A 3JQFA 3LT2A 4IZIA 2AE1A 3ZWBA 3ASUA 2FP4A 4H3VA 3TQHA 3RAJA 1EVJA 3EY4A 1NR1A 2B5WA 2BFMA 1DO8A 3U4HA 4TZKA 3B20A 2PZJA 3AFNA 2YQ5A 4QXMA 4WCFC 1GYQA 4EI2A 1U4SA 4NBRA 2IXBA 1NQOA 3GVHA 3M2TA 1ULUA 1C0KA 4OQZA 3T4EA 3PGXA 1NHWA 5A9TA 4MIEA 3FNFA 3AU9A 4UUOA 1AHHA 1U8FO 1YL5A 4R69A 2FZEA 4XJSA 4WEQA 4YRBA 5CDYA 1DAOA 5COBA 1SOWA 3DXFA 1KVQA 2Y93A 3QWIA 4OOEA 1PWXA 1XGKA 4A2CA 1NQTA 4FGWA 4TVOA 1BG6A 1UZLA 1YO6A 1EFKA 2PLAA 1PEDA 4FFMA 4RF5A 4DIBA 1Y9EA 5C5IA 9LDBA 4D7AA 3DAPA 2X8LA 3NDRA 3O38A 4FJ0A 4A26A 3A14A 4RO0A 1E3SA 4JBGA 4PG5A 4R68A 1H6AA 4FR5A 4GLLA 1MC4A 2GZ1A 2VZ8A 4BMVA 2O3SA 3KO8A 4YRAA 3JQAD 2NTVA 3PWZA 1E3JA 2HQ1A 2WWRA 4B79A 3VTZA 3JQBA 1GFSA 1QRRA 4UUNA 2Y1EA 2BFPA 4M8SA 1EFLA 5L3ZA 1EE2A 3GK3A 4I9UA 4AJLA 4E6PA 3TPCA 3C85A 3P5SA 3O8QA 1NXQA 1YKFA 3QIVA 4DBVO 1SCUA 3L07A 4MDHA 3MJEA 4IPTA 3QVOA 1BDMA 2EW2A 1LRJA 1YBMA 3BMCB 5L9AA 2WSBA 4BKQA 4OHUA 4BL5A 5G4KB 4DRYA 1IULA 1J4AA 3DMTC 4E31A 3G79A 4D3SA 2PH3A 1T1RA 4GSLA 4EUFA 1YVEI 2O3RA 2VUUA 2UDPA 1LI4A 1UXHA 3WGTA 2FPIA 2EG9A 5K0ZA 2PGLA 3KXDA 3G3EA 1E3EA 1PJCA 2P4HX 3P19A 1E3IA 3PLRA 2XXJA 3ZWYA 4TROA 2WYWA 1AXGA 3HN7A 2EKPA 3UOGA 5G0UA 1NM5A 1H9BA 1E3WA 4ESOA 4IS2A 3JV7A 3GF4A 1DC5A 1I5RA 1X15A 5DN9A 4EGFA 4NQZA 3JQEA 4OIMA 4LRSB 4TQGA 4A7PA 5JDIC 2HSDA 1OBFO 3GEGA 5TT1A 1SPXA 4CM4B 2Z95A 3WX0A 1TT5A 1AGNA 1UXGA 1VKNA 3PWSA 4U5QA 4RPGA 3GEMA 5HWSA 1MG5A 3ZWVA 4TMFA 4B4VA 5BSGA 4BHTA 5KJFA 3ZI0A 4AJJA 4IJKA 1SO8A 2XXBA 3IS3A 5CG2A 2ZQZA 4WJZA 4IQ8A 3SJUA 4J7XA 4XYGA 2FSVA 5IFLA 4GKVA 1T1SA 4Q3AA 3BTOA 1BVRA 4RQTA 3H5RA 2GN6A 3ON5A 1X7DA 1YXMA 3CKYA 3RJ5A 3RC7A 3BYZA 4AJHA 4EEXA 4HUJA 2TMDA 1E7QA 2DU8A 5K9ZA 3FI9A 3E6AA 3ITDA 2AG8A 1QYXA 3R1IA 1FDUA 4GVLA 4R01A 1RWBA 1I10A 3HE3A 3PYMA 2CDCA 3RCBA 3WJ7A 4OMUA 3KUXA 3C1TA 3B1KA 1ZK0A 1T26A 3RKUA 4O5OA 5CEEA 4HFMA 4OXNA 5CFZA 3LZ6A 2JCVA 4A0SA 1NHGA 4BNGA 3M2PA 2ZB3A 1AN9A 2IZ0A 3U5TA 1UXKA 1M2WA 1D7OA 4BNIA 3GGPA 5CDUA 4NK4A 3MJCA 2HJSA 2HCTA 3PDJA 4J7CA 3VZQA 3W6UA 3BTUA 2EKQA 5DF1A 4EDFA 4UVEA 3ADPA 1VRWA 1W6UA 1YS4A 2V65A 4DL9A 1MA0A 1ZSVA 4YAGA 3TFQA 2Q49A 5CG1A 1FF9A 1X1TA 1EK5A 1RM0A 1XIVA 4CR7A 1SB9A 4LN1A 2X0JA 4CLRA 1HDXA 2OBYA 5GZ6A 5I7EA 3G0OA 5HM8A 5I9MA 4BV8A 3PRJA 4HWKA 5I7SA 5IZ4A 1JAXA 3TL3A 1Y5RA 2JHFA 4QUKA 5ILGA 4WECA 4CLXA 5EMHA 3JTMA 2H6EA 3VDRA 1ISHA 1TA4A 5HRUA 3FD8A 3VH2A 4GLOA 1E7SA 3V2GA 3Q11A 2AA3A 2DAPA 3AY3A 3BA1A 4RDIA 3RASA 3AY6A 4II2A 4CMBA 3Q1LA 1EUZA 1O94A 3GGOA 4PLCA 4BGEA 4XDYA 1VPDA 4YDRA 2I99A 4FFRA 1FK8A 3VPSA 3IL2A 2C5EA 2JHGA 1R37A 3F6YA 3EK2A 4NG5A 3U4CA 4ALLA 4IGEA 1R4MB 4GWGA 4K6FA 2HK7A 4IUYA 1O89A 2YV3A 1UDAA 3E9MA 4IDGA 3ZCXA 1PJQA 1DFHA 1WZEA 3D64A 3GZNB 2CVOA 1NPTO 3DMTA 3CE6A 3ZWPA 3DAFA 3MJ4A 3U09A 1U2DA 3C24A 4WE3A 2YZ7A 3I23A 1DOHA 5CHEA 1EBFA 4INAA 1LBEA 3F9IA 4K1LA 3WB9A 4D42A 1WPQA 1UP4A 3GGGA 3VZSA 5CPFA 4GI2A 5EPOA 1NNUA 1XLTA 1MFPA 1B3BA 3DBVO 4H7PA 5TSDA 3LK7A 5TLSA 1HSOA 4O0LA 2QRLA 1PJBA 3ICPA 2Y66A 3PYXA 4E5KA 2X6TA 4CODB 1DSSG 1PZEA 4OSOA 4UUPA 1OAAA 2DTXA 2WJPA 5A5FA 1ADBA 1ZJZA 2F1KA 5T64A 1I2CA 3WQRA 5BSHA 1R6DA 3DZHA 4FBGA 3HHPA 3PHLA 2H63A 3E82A 3OIFA 4IGFA 3RFVA 3EGOA 1KYQA 4DQUA 2ZQYA 3S2IA 1BXZA 3GAZA 1Z7BA 3VZRA 1XU7A 4TRJA 1KERA 2ZTLA 1NFRA 2IXAA 3CSDA 1Q7CA 3DBLB 1D3AA 2Y1OA 4R3NA 4CQLA 5JS6A 1U3WA 3RU7A 4IS3A 3WXBA 4A10A 2H5LA 2PNFA 1JVSA 3WLFA 4MKZA 4J0FA 2GCGA 3NUGA 3OECA 3Q9NA 3WTBA 2UYYA 1LUAA 4CM8B 1OI7A 3IJPA 5HS4A 3ROQA 3MTJA 4NU5A 1N2SA 4XRGA 3BMOB 4KMSA 3G1TA 1C14A 3IQDB 5B4VA 3BMCA 1P44A 2GGSA 3HDHA 1Z75A 5DCUA 4I8XA 1PJ3A 5AVOA 2NM0A 3GG2A 1PJTA 3GR6A 1B7GO 3I9JA 1Z45A 3O8QB 2CZCA 5EL0A 4Q3EA 1KEUA 3WG9A 3TZ6A 2IRWA 1IZ0A 3IC5A 2O4CA 2X5OA 5JCJD 5EQDA 3DL2A 3VAZA 1Z74A 3AUAA 2H9IA 1UP7A 2NVUA 2X5KO 4GWKA 4HADA 4LW8A 3ZDFA 3ZZNA 3W6ZA 2OFPA 5LC1A 1V8BA 2EXXA 4AJEA 1D4FA 2QX7A 5AQ1A 1B0AA 3KYDA 5CDGA 2PR2A 4MVJA 1PL7A 4K6CA 4EITA 1PGOA 1IPFA 4LCJA 3IJRA 2PKQO 4FC6A 1WDLA 3SVTA 4RVUA 3HN2A 3ZV3A 3PWKA 5BNIA 3CMMA 3ST7A 1B14A 3K2BA 3PZRA 2OL4A 3QHAA 3AOEA 3SBOA 4YT5A 3GY0A 2RBEA 2DUUA 4RF3A 1E0DA 3O26A 3ZN2A 3DONA 3CINA 1I3LA 5EIOA 4BO2A 1F12A 1BVUA 2PD6A 4GH5A 3MOGA 2D4AA 4J1NA 2DTEA 4IDCA 1KEPA 1QR6A 5TNXA 2J3JA 5JC8A 4Z9YA 4CV0A 1HE2A 2NVBA 3LDHA 2VHXA 5FI3A 2JKVA 3DZIA 3GNQA 1P1JA 1YWGO 3N74A 3R0IA 3V1UA 1LLCA 3GVPA 3DOOA 5ITWA 4TWRA 4G2NA 4LVCA 2E49A 3GDOA 3ZWNA 1E7YA 1K0UA 3OJOA 3GAFA 1TEHA 2Y0DA 2PA3A 2X5JO 3O03A 4ZGWA 4K28A 3PJEA 2DC1A 3DBRA 1I2ZA 2O3JA 2P5YA 4E2ZA 1M6HA 2BD0A 4MP6A 4CMEA 3R6DA 4FC7A 4LMRA 4RV9A 2NNLD 4RORA 1VJ1A 4RPJA 2CVZA 1BXGB 4M89A 4KUGA 4YRDA 2ZTUA 4WCFA 4CLOA 4Z9XA 3VDQA 4C7JA 4OL9A 2HMWA 1HDOA 4HP8A 2O7QA 3KSDO 4NK5A 2RHCA 1QYCA 4RVHA 1XQ6A 3VC7A 1DIGA 1Q7GA 4IM7A 2I9PA 3GFGA 1A9ZA 4P38A 3K92A 2ZYDA 2E4AA 3N7UA 4YJHB 4LSWA 1VC2A 2WM3A 4PG7A 1K6XA 3DZGA 2B37A 4PRKA 1DC3A 3ABIA 3F4BA 2EERA 1PS0A 2Z1NA 1H6BA 3COSA 4BNJA 4CMGA 2G5CA 3UAGA 5I9LA 1B8PA 3FWZA 2ZTMA 4UVIA 5HA5A 2DFDA 2PD3A 4U0KA 4IZHA 5JAMA 1ADFA 3RKRA 4J6FA 2ZJ0A 4XB2A 1WP4A 1E7WA 5IN5A 4CR8A 1NYTA 4JJFA 1W8DA 4TRMA 1C1XB 1A4IA 2B0JA 5JY6A 2GLXA 4CQMB 1IB6A 3DOCA 2YQ4A 3JYOA 3OHSX 3DTYA 3ZGYA 2AQIA 4BGIA 3DBLA 1FDSA 1ZSNA 4D41A 4DUPA 2E82A 4D0RA 2P5UA 1ZKMA 4XDZA 1DBVO 2A4KA 1ORRA 1GU7A 1H9AA 3E18A 4L75A 4RPHA 1YL6A 3AOGA 4OH1A 4WLOA 2GNAA 5IDWA 1A7KA 4GKBA 1KEVA 1PWZA 1LDMA 4MVJE 4XB1A 1P0FA 3JQAA 3JQ6A 1P9LA 1YDEA 3SJ7A 3DO5A 3WSWA 4E5NA 4AVYA 4DWVA 1P3DA 1E5QA 2J3HA 4W99A 5JDCA 1N7HA 5KIAA 1ISFA 3GEDA 3QY9A 2UUOA 3F4LA 3A1NA 6ADHA 2Z1MA 1Q1NA 2R00A 1DRUA 1WWKA 3G17A 4IJVA 5IG2A 1GUZA 3L6OO 5TGDA 4BKRA 4CM9D 4TVBA 3MCVA 4L76A 5G0VA 4ZRMA 5I8WA 5THKA 4WLVA 3NT4A 4BNZA 1NR7A 4BMNA 4WCFB 1Y8RB 3LF1A 4DBZA 4OQYA 2RH4A 4I9NA 3HDQA 4BO5A 5HBRA 4GX2A 3KYDB 3RROA 4A73A 1HE5A 1GAEO 3ZNNA 1E1KA 3QVSA 2Y0EA 1GPDG 4CLOB 5C7LO 3KETA 4UEJA 3PP8A 2Q46A 5L95A 3EW7A 1JLLA 1BXGA 5FF9A 3QE3A 1LNQA 1LSSA 1VSVA 3P7MA 3VKVA 4UULA 3RC9A 1GZ3A 3OSUA 4WOKA 3C8MA 4GX0A 1JKJA 1FXSA 3H2ZA 3E8XA 3MJTA 4BO3A 2VYND 4ALKA 2B4QA 3I5MA 1UZNA 2D3TA 1CYDA 2EEZA 3OETA 4PIVA 3RC2A 1I32A 3HG7A 5ER6A 3AM4A 4I1IA 5T6BA 5DP2A 3GVXA 1NWHA 4CM3A 1VJ0A 4FDAA 1YJ8A 1LSOA 1EK6A 2DQ4A 3DMYA 1FMCA 2JD2A 1G0OA 2OP1A 3L9XA 1LU9A 1VL0A 3OF2A 1D1SA 5T5QA 3TDKA 3B1FA 1QG6A 5H81A 1NFQA 5F21A 4DGSA 1F06A 1B16A 2DPHA 5FYDA 1UR5A 3WFIA 1EDZA 4E2XA 5MGBA 1GDHA 1GV0A 3PQEA 5A05A 2W2KB 4JBHA 4WOJA 4B8ZA 4DXHA 1SEVA 1T2EA 1U7TA 2Y1FA 2EIHA 3H6KA 4Y6PA 4B7XA 1UP6A 1R4NB 4M1QA 2IZ1A 1BWSA 3ZWXA 4BV9A 1H6CA 3E9NA 4IXWA 1H2HA 1NVGA 5H83A 3GNTA 4B4OA 2VNSA 3SXPA 4BIIA 3W4IA 2FRDA 3HADA 1IHXA 4RCVA 2B4TO 3PQFA 5U4QA 1PZHA 1XELA 4FS3A 4AJIA 2NVUB 3LSYA 1DFIA 2Q2VA 1M76A 1I30A 2IDZA 4ALNA 4MVJM 1LC0A 1LLDA 1LSUA 2YFQA 3JQAB 4MVJI 1BDBA 1I01A 1JQBA 4JNKA 5ICMA 1HDCA 1HETA 2FR8A 2O2SA 1X0XA 3C7DB 3RBVA 2Q3EA 3PK0A 2Q1TA 2PK3A 4IDAA 2AQKA 1MLDA 2VZ9A 2FWMX 4YJFA 1ZZEA 4MVJG 2VQ3A 4CLDA 2OMEA 3NGLA 3JQGA 4JJGA 2TMGA 3VH3A 4I5FA 5F5LA 4DLAA 1I3NA 3C1AA 4J1QA 1ID1A 4RF4A 3GZ4A 1WDMA 5TJHA 2C7GA 4ZHSA 1MXFA 4CV2A 1R4NA 4FCCA 4MO2A 3UCFA 4YWJA 3RUIA 2Q1SA 4CUZA 4FB5A 3P2YA 3OA0A 4GSKA 1R0KA 3A28A 3DAGA 1HDRA 3U49A 3JSAA 1E1NA 4LVUA 1KETA 3WFJA 4YBZA 2YV1A 3GUCA 3ZV5A 3H9EO 3D4PA 4ZQFA 2I66A 3OIDA 4ILKA 4Y8VA 4OOFA 3KHUA 4XEHA 1NFFA 5EINA 3GMSA 5F1KA 3L9WA 3ULKA 4E12A 1TB4A 2DUWA 2QRJA 4DIFA 1UJMA 1YOVA 3ONEA 4CLRB 2BGMA 3LVFO 4FD3A 2CSUA 4ID9A 3PI7A 2AEFA 3AY7A 4NMHA 2X58A 2Q45A 3S55A 4J9UE 1HXHA 3UVEA 1DRWA 3DQPA 3W4JA 2OORA 4WK6A 5JDIA 3KVOA 2X22A 1GUYA 3S8MA 2AQHA 4QFDA 3OJEA 3WLEA 2FR0A 4DYVA 2OBNA 1Q7BA 2LDXA 1P1KA 2VZ0A 4XYBA 1ZIDA 1R15A 2E37A 3I4CA 3JD0A 4Y98A 1P31A 4BKUA 1AE1A 2Q2WA 4HFRA 4RVFA 2G76A 2NADA 3EVTA 5C37A 2VYVD 1EVYA 1C0LA 1ENZA 1I33A 4D3FA 3CIFA 2WE8A 1E92A 3NT5A 1I24A 1E6UA 5DBGA 3NRCA 1E6WA 4J3FA 4NBTA 4EUEA 3QLJA 5KWEA 2JL1A 1VE9A 2QW8A 2DM6A 1YOVB 2VRCA 3FNEA 2JFFA 3RSHA 2NQ8A 1AXEA 2G82A 2Y68A 4RZIA 1QLJA 5JMWA 5DDIP 3CH6A 5A03A 2CDBA 5AXBA 1Y81A 1NX6A 3ENKA 3LT1A 2FOIA 2ZTVA 1CJCA 3OJ0A 4PLYA 4QECA 1L7DA 3L6DA 5KCZA 2JJYA 4Y9DA 2PD4A 3KEQA 4AJNA 1TVEA 4J1TA 4OO3A 3ROKA 3ONFA 5FFFA 4YYZA 1GV1A 2GSDA 2PY6A 3QVTA 4F46A 2CDAA 2RAFA 3VTFA 1ZJYA 3UCEA 2C07A 3NGXA 4JIGA 2BI7A 4I9HA 1IZ9A 2JCYA 3AJRA 1ADCA 2HMSA 1O8CA 3PHGA 2B36A 4NBWA 5CP8A 3GQVA 4R51A 1T2DA 1XHLA 4J4BA 3NYWA 4JQCA 2P4QA 3U9LA 2GUGA 3IAHA 3IMFA 3NTQA 1A72A 3L6EA 1LRLA 3MTGA 1I2BA 5G4LA 1P1FA 4ZJUA 1LEHA 4WLNA 2YYYA 3DBHB 5JPIA 4AJ4A 3ZHYA 1F8FA 2NVWA 1ULSA 1NPDA 3B70A 3D3WA 3IUPA 2J5KA 1ZW1A 2HKIA 2O4UX 3JD4A 1BTOA 1J6UA 4YJGA 3AUTA 2W98A 1PZGA 2UVDA 1DIHA 2WYVA 1HYGA 1QP8A 3H3FA 4BNLA 3HB4X 4XYMA 3TJRA 3W8DA 4MKXA 1JAYA 1QV6A 1XSEA 1PQWA 2C2YA 3UF0A 3M1AA 4MIYA 2GN8A 5FEUA 4QSMA 1HRDA 1GD1O 1S6YA 1X7GA 4DPMA 1DHTA 1YH3A 3K31A 1YONA 2CD9A 4HNHA 2IODA 3PZBA 4M54A 4N7RA 1LXCA 2I3AA 3W8FA 3UICA 3ZHXA 4JROA 1ISJA 3S2FA 1E5LA 3BXXA 3RBZA 1V3VA 4MVJP 4RZHA 4BNHA 1HSZA 2PTGA 1JDJA 4WLUA 5KKAA 4MVJH 3WIDA 2QYSA 1N1GA 4PLWA 5A9SA 4K9DA 2O3UA 3AFMA 3MJVA 2WYUA 4Z0TA 3UCXA 4QQRA 1SEPA 1DDOA 1T2FA 1VLLA 3ZWOA 2ZCUA 2EJWA 2Y0CA 3NV9A 3WMXA 4RVGA 2EGGA 2O7SA 4K26A 1QMGA 3TZHA 5KVSA 5DBFA 4J16A 4Z6KA 3DHYA 2W90A 3FNGA 1NASA 2PGJA 3KLPX 5GZ3A 5I7VA 3ADOA 4Y6RA 4PLTA 3G49A 4EYEA 4MOWA 4LSMA 1IHYA 2C5AA 4C7KA 1M75A 1KVRA 4AFNA 2AXQA 4YAJA 1G1AA 3H9QA 3VVBA 2VWQA 1ONPA 5HS6A 1PR3A 5A1TA 2PKQP 1CERA 1GL3A 1LDBA 2JD0A 3PHHA 4L0QA 4U8GA 3QW2A 2CFCA 5BR7A 5JAZA 5G0WA 2Y1DA 3LT0A 3PGJA 1N8KA 2HRZA 4EUHA 4GGPA 4BO6A 2C54A 1BW9B 1K89A 4I5GA 3X2EA 3WR5A 3HDJA 4YQYA 1X7HA 4J2HA 1DC6A 1FJHA 1NTOA 2DKNA 3DBHA 1K6IA 4FOSA 1SAYA 1UUFA 2GR9A 4YT8A 3LLSA 4J7UA 5ITVA 2IZZA 4BB6A 2CF6A 1XA0A 3HQ4O 3EAGA 4FOOA 3FHLA 2C2XA 1YJQA 4UAGA 1PGQA 3NTOA 4CMJA 2W2LA 3CZRA 1GCOA 4PGFA 5KVQA 3GVCA 1X14A
chains in the Genus database with same CATH superfamily
3W8EA 5KQPA 4N48A 1GEEA 3H1AA 3NVDA 4RU1A 3V5NA 2Z30A 5KYGA 2JAHA 2IYQA 2VPQA 3LY8A 1MB0A 2VFAA 2HQBA 3AFOA 1YZHA 3KHSA 2NU8A 3VR5D 3IMEA 2F3SA 4HFNA 5B1IA 5SV2A 1H2WA 2VHWA 2VDPB 2WTEA 1G7TA 2P9ZA 4PLZA 3PL1A 4G8DA 2FPRA 5JFTA 2WT4A 2P2NA 2RHBA 1OWOA 1YRHA 2O0LA 2A1TR 2VWGA 1WNTA 2XYVA 2Y1LA 4XPIA 5FYQA 5B1DA 3FWYA 4M1SA 1L8LA 1U2ZA 2I4LA 2QD4A 4H7HA 5KNDA 3OQNA 1P45A 4ZRNA 1JQDA 3KFLA 3AKYA 2OHXA 3X1YA 1VMIA 1FYEA 3I52A 3BMOA 4CQLA 1KY4A 3WOHA 1YQUA 4B0OA 3C5WP 5D5HA 3STUA 4IH9A 4AJ2A 4C1NA 4LYHA 4B46A 1YDMA 2Q4DA 2XUZA 3O4FA 4TLMB 1FNCA 2WJJA 3D0QA 1MUUA 5CVCA 1MB4A 3NUZA 1N3BA 1NT4A 1A7JA 5ERXA 5HQJA 2M6KA 3AI3A 4IVNA 4JEMA 1ADGA 2DPXA 1IB0A 2VP2A 2XGGA 1BO6A 3I58A 3UOWA 1PHRA 4D8YA 3K0KA 2P1DA 3HDVA 4X95A 5DH9A 3RRMA 3TXAA 4KP7A 4QNRA 3RNOA 2ZXFA 3N87A 4QJBA 3ETNA 5DGXA 3EPJA 2V55B 1XE3A 1BHO1 2BAGA 1GKYA 3SFTA 4HWOA 1QIMA 4UAUA 4YRCA 3BGOS 1X1QA 3K6JA 3PX3A 2LDBA 3V1NA 4B7UA 2NZWA 1UEJA 4XVHA 1TCAA 1FDWA 2W37A 3HUFA 2DG2A 4GMKA 2C8JA 1V8FA 1W0KA 3TQCA 4BO4A 1AH2A 2V7TA 4WXMA 4XCXA 3D8UA 2H0AA 3S1SA 2QBYA 3L0BA 5IZCC 2FR8C 2FPGA 4MPRA 2PIAA 1SOUA 2PL1A 2E5WA 4J1GA 2QYTA 5KTYA 4RD6A 1A0OA 1W48A 3ZWCA 2OCDA 1D9XA 4XGKA 3ZX4A 1LRKA 5KYUB 2G8NA 5I8ZA 2FW1A 4MW9A 3R23A 5BYJA 5L3VA 1ZWLA 2PWPA 3PFWO 1B8UA 3ZVKA 2X9VA 3TR6A 1L7EA 3K70B 5U4XA 4NL4H 1RJWA 4FW9A 1XN1A 3CN7A 4ABTA 4EG6A 1X2BA 3EVNA 5EXSA 2IT1A 3O73A 4AMUA 1P4SA 1PE0A 3HWX1 2AXEA 5BNTA 1SVMA 2DLDA 4II3A 1STOA 4YV2A 5CB8A 3RNLA 3S3TA 1U8CB 2XEXA 1SQ5A 4CMCA 2RCNA 4BMCA 3ENNA 1CV2A 2R1VA 3P2EA 4E30A 1UPCA 2FH5B 3R6WA 1TDJA 4LHZA 5KYWB 4BVEA 4FX5A 1E8NA 2HXGA 3FOZA 3TIVA 1EM8B 1X1SA 5HF9A 4B34A 1L4YA 4UD2A 1K8ZB 1XDGA 3EGCA 3WYEA 4YCMA 2DWUA 1ZQ9A 6LDHA 3TAXA 2KBEA 4COOA 4DLRA 1WETA 2OM6A 1TQ4A 4JL5A 4LC1A 1F48A 1T9ZA 3WRXA 4Q3NA 3T7IA 5AM2A 3F2VA 3RRFA 1LVUA 3FMVA 3HXPA 1QYRA 2RG7A 2WP8J 3W9SA 2EDCA 4C0BA 1PIWA 4M9XA 5KVVA 3GLIE 5JAQA 4JXXA 1VG9B 4XM0A 1K7YA 1T4CA 1T8PA 2LTAA 4W7HA 2VWHA 4URWR 4BBJA 2PSSA 4YQFA 5CDHA 1GTG1 4A36A 2B78A 2CUKA 5B7PA 4GRAA 4U6NA 3IAM6 3TDNA 2R6JA 3NB0A 5JI3E 2I65A 3TB6A 3QXXA 3S28A 2Q5JA 3H7IA 4CQLB 1P4GA 4PAOA 5DGTA 1R8YA 1PG5A 3OA2A 4KQXA 1LPSA 4XPIB 1U28A 1Z18A 2NT4A 2O6HA 3BQMB 4ARIA 3VYWA 1V39A 2EKDA 3CWCA 4Z9FA 1M74A 3TIFA 5FWYA 3D6VA 1DCFA 4F5DA 1NQAO 3EPPA 1Y9AA 2AOTA 3GLGB 2HADA 3NYQA 3E58A 1GCGA 4R2JA 3DKPA 3IVGA 1ZX1A 3LUJA 2JLUA 4DR2B 5DI3A 1TW2A 1HA3A 1NBEA 1BXKA 2A94A 3H9BA 1CETA 3EF3A 1G5RA 2YHUA 5FR1A 4RXUA 1ENPA 1MFZA 3HGTA 3MLBA 4FZJA 3V7UA 2ROQA 3G2JA 4RMGA 3NALA 3AIIA 4FNAA 1MO5A 3I83A 1KZ1A 1HDIA 4YROA 2CB9A 5DOZA 1J2YA 3HNPA 4EL0A 5EEHA 1V8OA 4IMIB 4E5MA 5F4ZA 3U1VA 3R7WB 2QZJA 1UBHS 5CT5A 5EMKA 3FROA 2C94A 5HIJA 2W2KA 3ZDYB 4YS6A 2HEIA 5E1OA 3HEMA 3FYDA 1LZKA 4D46A 3QP9A 4CIBA 1EP1B 3SC2B 1VL8A 3T7CA 1UPUA 2Q5IA 3WTCA 3BUSA 2X0IA 3R0ZA 4FDVA 4X9XA 3NYIA 2O48X 2BN4A 4NHEA 5K0JA 2D2FA 4BO8A 4F85A 5CTAA 2ZAGA 1IUNA 1FQJA 2GN2A 2D2IA 2YASA 3VPBA 5FI5A 1P5RA 1H4VB 4Y2PA 5CVDA 3OHMA 3AUSA 1PFUA 3D2CA 3GCXA 4BV2A 4BFLA 1Q11A 2D8AA 3OKAA 2I2BA 2D5CA 2A9FA 2GA9A 2IYYA 3AI7A 1SC1A 3QPCA 3QYAA 4OU4A 5AICA 4EG5A 2YJTD 1NI3A 5IF3A 1P4RA 1OA1A 3R0VA 1DKMA 1YCDA 5CIQA 4F6LA 2V0NA 5L4LA 1YZGA 5LB4A 1OLXB 1T1JA 4UQOA 1JEDA 4KAJA 3ORYA 1VE6A 1KEWA 3HKBA 5CLHA 2DMRA 4F86A 1EINA 2NX2A 2BKVA 2E89A 3UG6A 2JH8A 4IIJF 4MMXB 5JNLA 3RSCA 2J0UA 2MMCA 2ABWA 1ZEMA 3DXXA 4J9VA 1AD2A 5DWDA 3LTNC 5AXCA 3ZJYA 5EJ2A 4DZZA 1F0KA 2QI9C 1AKYA 4ATNA 1VZ3A 2GTIA 4EHIA 2Q9AA 1C0EA 3JVEA 2LNDA 1GA1A 4INJA 1OXBB 1RIFA 3CH7A 4BC1A 1HMPA 2PXXA 4TWIA 2R1ZA 3WIUA 4E46A 4J29A 4I5IA 3OM0A 1Y8QA 1A2OA 1N2ZA 1ULBA 4H1WA 4DPLA 1PDWA 3EVBA 5EVCA 3G2QA 3UJBA 1CB0A 2ZATA 2GUWA 4YAEA 2VG8A 3GLFB 3TOVA 1XMSA 2E2WA 2GVNA 2O2IA 3O2NA 3KJFA 1SC4A 2XKJE 3DE1X 4GZMA 4IXTA 5KQGA 3A6PC 1CVRA 4TXLA 4RTMA 2Z2KA 4EMSA 1JTVA 1OXTA 2HMAA 1YNOA 4UREA 1QHFA 4FQ7A 3ZXIA 4YJ3A 1ZJJA 4DHEA 3WSTA 2XPCA 4FWIB 5KQRA 2EP7A 3PGKA 1X74A 1NE7A 2GAAA 3K3PA 3OTQA 4Y0VA 4YR9A 1DJOA 1WD7A 2JVIA 3ANLA 1UJ2A 5J3JA 3BE4A 3QOWA 1N57A 3IYLW 4MYCA 1K8QA 3O8CA 4BB5A 2R4TA 3EYWA 5A04A 3QUCA 2A5DA 1ZITA 4X0EA 4MW5A 3KEFA 1N5DA 2OR3A 3KYIB 1E1LA 4C7VA 4BGPA 5IWCA 1T24A 2PTHA 3OJWA 4YK7A 4LRWA 4MVXA 4ZCLA 3ED5A 3C3JA 4OL0A 3SHOA 5AVZA 3ZE0B 1YZFA 1O5IA 3NCHA 1JHMA 5KNDH 2JLWA 3KEMA 2WLTA 1QCCA 2Y4OA 4PVDA 2C0CA 4BVKA 4BRZA 5IJZA 2VH2A 3UGKA 3V32A 5KJ6A 3VPHA 2I4TA 4X8LA 1U0RA 4P22A 4CT5A 2B5VA 5JWRA 1GNQA 1QVZA 2PAFA 1GDTA 3DDOA 4D3DA 3FYHA 3K35A 1FPMA 3KUCA 2YHIB 3K8ZA 4J0IA 1MIOA 4EHJA 1U9IC 1EESA 1G9XA 4JEIA 4OFZA 4YASA 2VP0A 1GRQA 2NXWA 3ESAA 4IOMA 4BNYA 1JWBB 3E4DA 1G17A 1B93A 4OQFA 1O6BA 2B1QA 1QP7A 2JAXA 2NXCA 1CJMA 4QUJA 1E9FA 2XGMA 2BELA 4WK2B 2ZW9A 4AKGA 4JBLA 2H2HA 1CQJB 2GK3A 3OOHA 1NULA 4G67A 2OFOA 3CC8A 2BKLA 4R1UA 1PFGA 1QGAA 4H1VA 4JGGA 1NKVA 4JGIA 4OB6A 2JLRA 1TLLA 5JSKA 1P74A 3H65A 3VO8A 2XF2A 3ZXSA 1WAMA 3OOSA 3OEWA 4GYWA 1GA6A 4CLHA 3DQQA 3ZK9A 4EB8A 5H8WA 1S2OA 4C43A 2WK1A 3BA6A 2JCSA 3UYLA 1L4KA 4Q4AB 4MYRA 2V8OA 4OM7A 1TGVA 4YACA 2JCBA 4PHTA 4ZIRA 4DA9A 3GP5A 4DLVA 3DFUA 2QVGA 4J0HA 2NSLA 2P9YA 4HH4A 1EG2A 3C5VA 2EZ4A 3KQVA 3REFA 3RSGA 4P6VF 1RM3A 3HCOA 4OHZA 3KUKA 2ID7A 3PC3A 4H4CA 1UBEA 4PQFA 3BK7A 3W90A 4R9RA 1FFSA 2XVZA 3VH1A 3C3CA 3ZU3A 4EECA 4TLLB 4Q7MB 3FZGA 4M21A 1OHHA 1PO7A 4JSRA 4JENA 4NU6A 1PZFA 2A1UB 4GKAA 1L4HA 1NXPA 2GBFA 5DBIA 4D25A 4D9CA 2FEOA 3NVAA 1OUMA 1PR0A 1YBFA 2GDZA 3BTVA 3GDGA 3MRTA 3CZPA 4NZNA 4BZPA 4RHCA 6NULA 3N58A 3HYTA 3E61A 3V1LA 3T15A 2GRJA 3ZKWB 3RTCA 4IICA 1UXJA 4C6RA 4HDKA 3JR3A 3NHWA 4WY5A 4XQ9A 2BGKA 3MUFA 3PENA 2C7VA 4KPUB 3BICA 2OBMA 4KH1A 4TLBA 5BSFA 5FO1A 1U4OA 4PZ9A 2I7CA 2WG1A 3C5HA 4WXHA 4F45A 3W5BA 1MPTA 3HGQA 3A6FA 3MS7A 1RXUA 3H8WA 1G5PA 4MKIA 1Q0LA 2HRCA 5BW6B 1JIJA 2Y1GA 2BZ0A 2IWHA 2ZKIA 5A5EA 1U1CA 3W5VA 4YFVA 3WLOA 1DO2A 1E62A 1T9AA 1MAUA 1XZMA 3K5IA 4MJ7A 2QT1A 2HBQA 3ZDZB 3CLSC 3TOZA 5K8JB 1TM4E 4LEIA 3UW3A 3OP4A 2G5PA 4TXNA 3IMCA 4HDNA 1K88A 3KYCA 2ZCVA 3I9V6 1KTVA 4OI0A 1GGNA 1U1EA 3VU0A 1JEYA 2OVBA 4DA7A 3HP7A 4R8SA 1HT3A 1U90A 4V0SA 3G0CA 1GY8A 3Q4GA 3QG1A 3SF8B 3PXCX 4EGCB 1YIOA 2X3YA 4BVAA 1N0IA 4CMHA 4LFAB 4F04A 1A27A 3L79A 4M46A 4FFBB 4JLWA 5C8YA 3ROPA 3H5IA 3DKRA 4JBYA 4B80A 2ILTA 2QTWB 5FV4A 3P45A 2WIJA 2FPXA 2X40A 4ZAXA 1A9YA 1C9YA 1S8AA 1Z5WA 2AH5A 2OCGA 3FYUA 4H1HA 2VDQB 5JSFA 2UYOA 1A7AA 1C7QA 4MV8A 2YHSA 5HDQA 4L4SA 3KJIA 1G2IA 3O8DA 4BYGA 3FTFA 1XWFA 1M1YB 5TV2A 3H1PA 3E48A 3OZCA 3SE0A 3HXOA 2WE7A 2RARA 5B1YA 2HPVA 4W1QA 6AT1A 1MX3A 4YUZA 2R96A 4JQSA 2NSYA 4PSCA 2UU9B 2AEMA 4MWOA 4LXIA 3EQ9A 5JANA 1MNAA 3NHSA 2IBSA 2FXVA 4JSTA 4Q93A 1IIRA 1I4TD 4J0CA 3DE3X 3V7FA 2YYZA 3WGKA 3WK9A 4DIOA 2VJMB 5LMZA 1QIHA 2H54A 4DC0A 1B8OA 4NNPA 2GF2A 2QW0X 4U7WA 1OI4A 1RSZA 2W2PA 3OUUA 1PQPA 2CF5A 1SB8A 2FZWA 4FQ8A 2IL1A 3PGMA 4YTEA 3KJXA 2ZE5A 4YNBA 4ICIA 2Z5LA 3ESDA 4TXMA 2JAWA 3A4NA 1C1DA 3LCJA 3WQSB 2J9ZB 2Q27A 3ZOKA 3F5FA 3RRYA 3W5DA 4B6OA 1JFFA 1IHPA 5BQFA 2PRZA 2P2SA 2D00A 3DC7A 4HEA6 3P1JA 4CL2A 2O8CB 1FDRA 3ELDA 4CMIB 4P5EA 3HYRA 1KBQA 4LRYA 4C4PA 2GPAA 2QL9A 2GHTA 3ESCA 3NIGB 4NECA 4U02A 4YRLA 4HX2A 1XD9A 1XAGA 3T12A 4BO1A 2R8OA 1F1JA 3B3AA 3L06A 4DCMA 3TSCA 3MM4A 3PUIA 2VATA 3E27A 1IPEA 4OXKA 4F3CA 2FG5A 2JEYA 5B7GA 2H65A 5K0FA 5EJGA 4BMPB 3NU1A 3I34X 2PN1A 2WDZA 1Q1QA 3GQBB 3GUUA 3A6KA 4H6WA 4HAOA 1CUWA 2ZRBA 4U6QA 2HX1A 1WCIB 3QZUA 3QI2A 4XM2A 3E5MA 1C1DB 5IRCD 5KINB 1N6RA 4UHBA 2L19A 4DMCA 5IF9A 3DKVA 5JYEA 4FFDA 3HU5A 3L4BC 5HCUA 3WKBA 3KQKA 2XOKD 3FLEA 2R6HA 1A71A 3WICA 2QTLA 5COQA 1Y1PA 1Y7TA 2C1EA 3PNMA 3PJDA 2EFHB 4B3TB 1MA3A 4CIXA 2Z0MA 3ZBUA 5JATA 2W2LD 1TU3A 4PX3A 3ZY5A 2C97A 3OPYI 3OEHA 1YC5A 2C5BA 1QKJA 3G2IA 3M5WA 2B1RA 1CNMA 3O92A 1GQQA 1Y3BE 4NV3A 3KWJA 2VHVA 5FAXA 5HUQA 3ETEA 4QXAA 3IP6A 3ZU4A 3I5XA 3K5WA 1RQXA 3TL2A 1W30A 5JE8A 4FZ5A 5DRTA 3QVLA 4LFBB 4ZT4A 5L7WA 4UM5A 1ZP6A 4MVJF 1OIXA 4TV8F 1XEFA 3K6RA 2HLHA 2TS1A 2K7ZA 3OQIB 4U9HS 4EY4A 4FFLA 1TCCA 2QD5A 1SWVA 1J0AA 3T7JA 5LIRA 1JIQA 3URKA 4PHFA 1ZXBA 3DHNA 4F72A 1S01A 5ED4A 1Z5OA 2Q6TA 1VYVA 1H1TA 1GGEA 2FGKA 2QVCA 4MV1A 3UZUA 1N5JA 1C7IA 3C98A 5TRTA 1PNQA 4QPPA 2BFCB 3WBFA 4J2OA 1DKLA 3CHYA 2HM7A 2IIVA 1U80A 3SQXA 3D9QX 2QN7A 1E0SA 1CQIB 1E1MA 1I5EA 1L4BA 3FSGA 2GTPA 2ZIGA 3IDSA 3I9KA 3N0VA 1J0XO 2HV8A 1NJGA 4M4SA 3AYZB 5CDSA 1MRSA 4JD5A 3B1ZA 3VDMA 3V8QA 3KJEA 1CE8A 5EG5A 3JYPA 4X1IA 2AJBA 1JLSA 3QX3A 3LPDA 3HDGA 4MKGA 4YRTA 5BR1A 3TKAA 1C8KA 1IN4A 1HT0A 3DKIA 4D45A 3I1IA 2EF1A 1UBUS 4KR2A 1O6GA 4D43A 5TF0A 4EWLA 1YI0A 2IYRA 3L8CA 1ILWA 1IHDA 1ORHA 2PWBA 4LAFA 3N7AA 4TKLA 2FA9A 3ZH9B 2Q5LA 4JU8A 2QGZA 5ARCA 2A1TS 5REQA 4GO1A 2DPGA 2ZKLA 3EXFB 2IH2A 5ESDA 1XD2A 4W1RA 2A59A 2HHLA 2TMKA 3B85A 4K46A 1R66A 5CBPA 4ZDIA 2VHYA 1J97A 3ZVMA 4HRXA 4YCJA 3GUYA 2WICA 4RH0A 5FDFA 3ROMA 3UB3A 2PO7A 1JFSA 4JNGA 1DIBA 1UK8A 3FYCA 3ZU5A 1OC4A 3KT3A 1HY3A 1NY5A 2WEKA 1ZUWA 2QM8A 1L4NA 3OFVA 3PXDA 3IOCA 1XR3A 4G3XA 5K3DA 1XL0A 1BJRE 1JXOA 5JG7A 4Z1MD 1WVIA 2QTGA 3NT2A 2VLIA 4TKZA 5KYKA 4IYRA 2V59A 3M70A 3UMCA 1PR6A 1PV2A 3ZCUA 3E2IA 4P36A 1E6EA 2QPOA 2JFYA 1JG7A 1Z34A 2BMAA 3AJ8A 2PAAA 1A9TA 2ZG6A 1XCLA 4ZT2A 1XCPA 1LLUA 1O3YA 5KTMA 1OLUB 1XK6A 5IVIA 2X8JB 1G8KA 3CVYA 1N0WA 2AS0A 2XCIA 1ZNXA 4IDDA 2IY9A 4S2UA 1WF3A 2G7MC 2JLCA 3I9MA 2AC2A 1FDOA 1ZM3A 4WBNA 3AHDA 3EYAA 5TGTA 2FUNB 4YT4A 2Z9CA 1RXWA 3DFZA 4G89A 1DLJA 1Z4KA 1FP4B 2D74A 3LYUA 1PJ2A 4G5YA 3H86A 1B15A 3KEOA 3CUUA 8ABPA 1J9EA 4K9MA 4DANA 1ZK1A 2BONA 3HRIA 5CCDA 2PFGA 4RDCA 2FPKA 2VUTA 4RE6A 4RPKA 4BNKA 5HF6A 4WXRA 1PGPA 1XTTA 4GP7A 4G65A 2PV7A 4IJ6A 3OQVA 4FOLA 1XV5A 2XT6A 5JAIA 3KSAC 3L04A 2AJTA 3TNYA 2XB2A 3JZAA 5J40A 2RGCA 2ATIA 1QXSA 1FVFA 1QGOA 4EB6A 4FGKA 2ZRMA 3OICA 3RC8A 3L77A 1CIJA 5ER9A 4M1MA 1ZHOA 5H4HA 1JR6A 2GH1A 2OXTA 2FWNA 2W93A 4WFKA 4WN9A 1NQ5A 4BDTA 2DUMA 1VMAA 1VOTA 3I32A 1I3MA 4TN5A 2YJ3A 2ATCA 4JI4B 1S8FA 1B43A 1T2UA 4KQKA 3HNOA 2WIKA 3V8VA 3N2NA 3WI7A 2O2XA 4LBYA 4EJSC 2XZLA 3AVWA 1MJ5A 2X9QA 4HLDA 2VOJA 4INPA 4KWIA 1GPBA 2JD1A 3B1YA 3ICWA 4Q19A 4AMYA 4ZMSA 4DV3B 4JODA 5JJIA 5BXQC 2B25A 2BHSA 1W4RA 3PIDA 4BC0A 2ENWA 3CVUA 3EISA 3FSRA 2R00C 1T4GA 2B8TA 3M49A 4S1VA 1VA4A 4I08A 3KDAA 4CM4A 3TRDA 2ZRHA 5AJWA 3DHEA 1QE5A 4ANFA 3PPIA 4HMQA 4QODA 5CT8A 4YMSA 3A1UA 1FZQA 5CMLA 2W42A 1Z26A 3WJ1A 5BSKA 2GZDA 3VYRB 1WW2A 3ZS8A 2OXFA 2ZYAA 2YS6A 2RAPA 3TNLA 1JA9A 3EVDA 4E5UA 2O07A 3RUCA 1RLIA 2PMCA 5T8KC 3NOOA 5BN3B 2JRLA 4YO8A 1T2CA 4N3CA 4N3BA 3EX7C 3F3SA 3AYXB 4BMDA 3ADBA 4QATA 2PZFA 1KI3A 1KJ9A 1X3LA 1E60A 2PH7A 2NO5A 4X44A 1AGXA 3B12A 1KO8A 1VI2A 2W6JD 1ZCZA 1D2CA 4PYOA 5CX4A 4DMLA 3TXYA 2P4SA 3CLRD 2OHGA 3R44A 4RK1A 3FBTA 4S0XA 4UMEA 5ULLA 1IBLB 2NPOA 4V39A 3EWNA 1LH0A 4ITRC 4Q1CA 3NEYA 3ZWAA 2VSNA 1SHUX 3LPAA 3KZXA 2GMWA 4YJ2F 1IAVA 2HJRA 4D02A 3BIWA 3RLFA 2B35A 5C3UA 1VBFA 3WGGA 4CCYB 3OTWA 5B5SA 1RJDA 2M6RA 2QSZA 2YUIA 3H8VA 3R5FA 1RQNA 2GARA 4ZN6A 1OXXK 1SNYA 4PZAA 4UMFA 4EJ0A 2QR3A 1FU8A 4X1YB 5AVVA 3BRCA 4U0JA 2VXCA 3DCYA 1Y3HA 4OU5A 1FY2A 2NU7A 2WNIA 2MSWA 4KPUA 3ZHRA 2XTNA 4QC2A 4NS1A 4O29A 4X93A 4O4HB 2PWZA 4UAJA 4WESB 3QQPA 3L1HA 2EGHA 2AHRA 2CJYA 3EIEA 4NNJA 4KQWA 1UKEA 5F76A 4RZXA 4E3WA 5M5BA 1I7DA 1FNNA 1XYYA 3JASB 4H16A 2ZUSA 4KSYA 4R41A 5IAGA 1BHSA 8GPBA 3WY9A 4NFSA 3HEAA 2V6JA 4CV1A 2AEJA 1J09A 3AINA 5BXYA 3WL7A 1L4MA 1P0MA 2A5YB 4Q1EA 1RFGE 3KOUA 3TW0A 1CKEA 2O1SA 3R3JA 3S7ZA 3UC9A 5C80A 1J0DA 4X60A 2ONYA 3AU8A 3GGJA 3OIVA 4Q4JB 4MP3A 4F3TA 2HLNA 4GOJA 1NN1A 2FJUA 1A7UA 3GLKA 5AHRA 2NP6A 1ZM4A 5BYKA 1Q21A 4YQEA 1WHSA 2W43A 1VSUA 4C2AA 3EARA 1HF3A 1PR9A 4HDCA 1BD4A 3W5CA 3PNYA 2NPFA 2FY8A 3MYYA 1CJBA 2PMFA 1N6NA 2WW8A 4KG7A 3T5CA 3GH3A 4URUR 4HAVA 4PQRA 1D1TA 2P6UA 5CEFA 4BVHA 1NVFA 4LJRA 3TG8A 2EZ9A 3BIJA 3RW9A 3NPAA 1TT7A 2H1CA 4KE7A 4KUHA 1TF5A 3ORRA 4ARUA 4WLEA 3HCFA 1CUXA 4RLSA 3RVMA 4KQHA 4EA8A 3RYCB 3AW9A 3OT5A 1JILA 3LBNA 4Q9DA 4EG4A 4MCJA 3F1LA 3JQBC 1DKOA 5CXUA 2EFDB 3IPAA 4RSHA 2Z2ZA 1U5CA 1G2OA 2OG1A 2YHIA 1K7EB 4HVAA 1Q95A 1P2DA 2Q1YA 3ZNQA 4D81A 1DCTA 1QGDA 4QELA 3VR2A 1Q0QA 1HE1C 4MYHA 2HAEA 4PANA 4ZWNA 2QLLA 3K1TA 3P2MA 4PZCA 3TOSA 3ROGA 3WGNA 5I6DA 2B6NA 3FFWA 4PR0A 1KA9H 2O8FA 1T0JB 1WXQA 1SCNE 5TQJA 1KY3A 1PJ4A 2XMQA 3BFVA 5JD4A 2CCKA 3B38A 2P4UA 2J3DA 3N8DA 3VR5H 4L8VA 5KPJA 1PSDA 5BQ5A 3ZHQA 1RPAA 3LYLA 5A3QA 3LCMA 1JKFA 1DAFA 2RJ3A 5KKNB 3IIIA 2V54A 1G8HA 2ZYVX 3GLIA 3HWWA 3VSCA 2R85A 1T5OA 3MGKA 4HDMB 2B4YA 5J4KA 2G9UA 2A5JA 1PUJA 4J43A 2QX6A 4B6EA 5IVPA 1XF1A 1JRLA 5DYTA 1Z2NX 4EPVA 3OTOB 4QT4A 3IUEA 1KP2A 5BR8B 1P1RA 1ATIA 2P0AA 5A9RA 3U37A 1GZDA 5CAEA 1F9EA 1OAKA 4RJLA 2QPTA 4S1TA 1LSJA 3KR9A 2E3JA 3MJDA 4OF4A 5GJBA 2E7ZA 5L3SA 3U56A 2O1EA 3UH0A 2EAUA 5CA1F 5HZKA 4Z4FA 3MRXA 3QKWA 1OOEA 1UM9A 1V6AA 3JAKB 1S3FA 4UM7A 3VYUB 4OQEA 2NO4A 4LISA 1S5PA 1HNNA 1R0LA 2Z08A 3LCRA 5EGNA 2NUTA 3DNPA 1AOXA 5A6SA 3ZHZA 1WMEA 1QX3A 1FP7A 2AT1A 5BT9A 5KX5A 1YJCA 4M55A 4NCXA 421PA 4OJKA 3KQHA 4BEBA 4FLMA 2J3QA 1MN6A 4OKIA 1GT91 1VI6A 2ZRNA 3PEWA 2IOHA 4NRDA 3SYKA 2AN1A 2YHBA 1DIRA 1VL5A 4JP3A 3HKBB 4C89A 2QIOA 1ODKA 4J4TA 4NCHA 5CH3A 3I4FA 5ICFA 3TXXA 2NW6A 2EW8A 2GJ9A 4XQEA 3JYQA 5DM1A 4F5EA 4AZTA 4B3XA 4F8YA 3F6SA 2PZMA 1K6JA 3KXPA 4BNFA 1NRIA 4X6UA 4ZTZB 3ZG6A 5I3CA 1SBQA 4E4TA 4ZCSA 1USWA 4WVLA 3EBOA 3EEOA 1R3DA 1WL8A 2B1GA 1RXEA 3BX1A 4P0QB 1JG3A 3LL4A 4EJMA 5LMNB 3NHUA 4HO1X 3F9CA 2NUPB 3LDAA 3TD2A 1W49A 3V4LA 3WLAA 2R7MA 3BHIA 5AJZA 2Q9CA 3OQ6A 5AIAA 3SXJA 1B8VA 1Z0SA 2JATA 3WGQA 3SX2A 1I7NA 1VPEA 1AKQA 1D5WA 1N5OX 2FCRA 3D8NA 3IP9A 4OG2A 2X9LA 1I6MA 1USVA 4ZYLA 1WSBA 2JIDA 3EIUA 3HXQA 1AKRA 1FDTA 4C4TA 2J30A 2ZK7A 3DVAB 3QUBA 2CVQA 3IKJA 2XA9A 1M2EA 1WMBA 2COUA 2CHEA 4HLCA 4DJJA 4Y2UA 1YGYA 5THQA 3NHAA 3FWKA 1ULTA 3N8IA 1XNRB 2VAWA 3I2YX 2O06A 4DWWA 5EAIA 3KR2A 2VAMA 2YZ2A 5H3LA 2I7DA 2RKOA 1FQWA 1GPNA 4LRTB 3FTPA 4X8OA 5DNAA 1Z6XA 4ZJYA 4CQNA 4AZSA 1UZMA 3KM0A 4HKTA 1Z68A 2AKYA 3CMCO 4N12A 4ERNA 3RC1A 4WERA 2GD1O 2WFMA 4G4SP 4IUBS 3RIGA 4DLKA 2ZJ1A 2FEWB 4IOJA 1N6PA 3S44A 4Z4QA 1A4UA 1RQGA 1X1RA 3OCCA 1T3ZA 3MAAC 4Q1DA 4WQMA 4G4SO 4ES6A 4BO7A 4G5RA 3W2HA 3AL0C 3COZA 2G25A 1HV8A 2H31A 4KJZA 1B00A 4PPNA 4XSVA 2O0KA 2HPAA 1ZK4A 3LBAA 3C14C 4RCYA 5DX8A 2XCQA 1Z6YA 4UHFA 3TFOA 5DK4A 1K68A 1C9KA 4KXXA 2X2FA 4FP9A 1W4BA 1E2DA 5DX0A 5GONF 5JMPA 4BFTA 2H0RA 6REQB 5CTJA 1XWWA 5TF4A 4Y6OA 2GSWA 4PHGA 2BLLA 3H3XA 4KDFA 5HKAA 2PRJA 3HM2A 3L7KA 3HFGA 1JPVA 4POAA 1HEIA 1QV9A 1XRNA 2GI4A 3AIMA 3PXBA 4FW8A 4X61A 5I7OA 2YINC 2VO1A 2AD1A 1U0NA 2KE5A 1QZXA 2ZI6A 1JVBA 2OCPA 3GRYA 1ZLYA 2ZGVA 3CJRA 4R2WA 5M3BA 3R0JA 1JH9A 1DAPA 1UEXC 3WGHA 3HB0A 1GPYA 4YMVA 4Q1BA 1B26A 4CEJB 4QGSA 6REQA 5JYCA 4MQBA 1CR2A 2PGNA 5H59A 1XU9A 2OTCA 4FDTA 1DJQA 2NV0A 1Y82A 3CX8A 1U0BB 1ILEA 3TLJA 4X64B 4XRRA 2AJ8A 4CM8A 4MCAA 4MYDA 5AW9A 1RCTE 4X94A 1JYEA 4M83A 1XRQA 1EGHA 2QY6A 4ZT5A 1H4QA 3DGFC 5DOVA 1VGVA 2XCTB 5JEEA 4TM7A 4X7BA 5HG0A 2FSIA 1E5VA 3VNRA 5KMGB 4ZVNA 3ZCSA 1USGA 3WYNA 3ANNA 3QVKA 2JIQA 3QWBA 4A9AA 5AJUA 1W2GA 4ECAA 3T7RA 2HFJA 4UM9B 2RGNA 1R5BA 1VGQA 1F0PA 2CLSA 2YJZA 4MS1A 3RWBA 2XAAA 1GSAA 4UXJA 3DZDA 4F60A 4MICA 2HA6A 2P77A 1ZR4A 4ZQHA 4EY5A 4F97A 4ZHQF 1IY9A 5JBQA 1Z0FA 3ZX5A 1L5WA 2IFTA 3CLUD 4JN6B 1T2VA 4K9KA 2CGEA 2IGTA 4IMRA 1RAEA 2XUFA 3TTVA 5L45A 1KFBB 3B13B 2ZB7A 3GJSA 3MW8A 2ZE8A 4FHCA 1CPYA 4UNQA 2NQ2C 2CHVA 2N0SA 2VT2A 4LMAA 4YLGA 5G40A 4JCCA 4Q4CA 2IUFA 4DIKA 1NNSA 3M9LA 5TC4A 3ZZ1A 5AD1A 1UDXA 3K9GA 4I1UA 4XD7D 3IJ5A 2CV0A 1KIFA 2FVXA 5BUCA 3H2IA 2ZM5A 4DMRA 3NJRA 3LVQE 4QHTA 4F3YA 5K8UA 4C78A 2QMYA 2Q50A 4BNNA 1MVNA 4IKEA 3LUGA 3THSA 1I5OA 4CM9A 1CYEA 4E07A 4RW0A 4QG3A 1DQSA 2XKAA 1GNRA 2V7PA 1OGJA 1U2GC 3G0IA 4L08A 4N54A 2GKGA 1IUKA 13PKA 2R7KA 4P4LA 3RU9A 4NJOA 1JW9B 3GH1A 4WZBE 4ZO9A 1QM5A 5EC8A 3MFQA 1PTJA 5JAUA 4CPDA 2N9UA 2BKEA 4V0ME 2WOJA 3ZY4A 2VF7A 2NN3C 3MBKA 3F1KA 2VJDA 2PKRA 3V2UA 1A96A 4NR0A 4FNMA 1QPGA 2I3GA 1BN6A 1QIJA 2XSZA 3MLEA 3BPSA 3PS9A 1JZQA 1F1BA 4FM9A 1C4KA 4U9IS 3U7HB 3AL2A 3PX2A 2IZ5A 3FNBA 4G37A 3FH0A 4MVCA 1DO8A 3NRJA 3U4HA 4ZK2A 1KOGA 1JYFA 1QH1A 5E38A 3AFNA 3VKFA 4LJ6A 1U4SA 1T3TA 2ZUVA 1NQOA 1SHTX 3GVHA 1OW3B 4E2FA 1EPUA 1W1WA 4YP5A 3ZDCA 1FFHA 2I3BA 1M0EA 1ZGZA 4JYMA 4N0EA 4OQZA 3J7AC 5IH7A 3AR8A 2KPOA 4KN5A 4YJKA 4Z86A 1II9A 3FNFA 3LQKA 1U8FO 3CLSD 1JAZA 1YS7A 3GLSA 2FZEA 4NEGA 3R3XA 1DAOA 1U8UA 2XUDA 3NAZA 3OU7A 5COBA 5GGYA 3RVRA 4EMBA 3QWIA 1PWXA 1ZJWA 2M32A 5HX7A 1NQTA 4TVOA 2PWYA 4X00A 1M5UA 1WCWA 1DPFA 1YO6A 1EFKA 4HUTA 1QRDA 4FFMA 4ZP1A 4Q7JB 3C41J 4C9BA 4DIBA 9LDBA 5AVUA 2YWFA 2X8LA 3NDRA 4LF9B 4ZOAA 2AR0A 3A14A 1JBQA 2EWVA 4CDNA 4BN4A 4GQBA 3NBUA 1XPUA 4JASB 4AY3A 4QQ8A 1SUWA 1XZ8A 2F3TA 1L4UA 2FMXA 2NTVA 2H1HA 3A3OA 2E55A 2FG7C 3G88A 3JQAD 4IIXA 1OWPA 2NO7A 2ACVA 3BSFA 3QKUA 2BFPA 3CVXA 1EFPA 5L3ZA 3GK3A 1IPHA 2TMYA 2RHDA 2ZYSA 3EUAA 3SJAA 5JWHA 3C85A 1WSDA 2IX3A 2XHZA 5WRFA 2OCKA 1DRKA 3SQWA 5DHSA 1HUQA 5DEIA 1NXQA 3QVGA 4DBVO 4DV6B 3L07A 4MDHA 5AVTA 4IPTA 2F3UA 5DLYA 2RGWA 1OFVA 2ONKA 2WSMA 1LRJA 4RPIA 2IBMA 4UU7A 4DLTA 4F1KA 2WSBA 4LG1A 3KOZA 1EUDB 3NGMA 4MWTA 4J7AA 1VLQA 1AK2A 4OQDA 4BKQA 2BF4A 5AOCA 1N3IA 4TL8A 4MEBA 1TO2E 1P8AA 1QVRA 3DDSA 1UADA 1CFZA 1D0SA 4U3JA 4ME6A 4U9UA 3ROEA 3ZQ4A 2E5FA 3DEHA 4D2IA 4R8MA 3GJ7A 5E9AA 4DY6A 3CZQA 4NBSA 2C7OA 3KB2A 2XUGA 4NMLA 2X0FA 4I4TA 3EIQA 3QXJA 1XTJA 1UXHA 4HSEA 1NLFA 1QJCA 2EG9A 4TLDA 4KHPB 3H2KA 2VDLB 3QUAA 3G3EA 3Q1KA 5LBIA 5C8DA 1G3RA 2ON6A 4Q03A 1IZ7A 1SU8A 2WWGA 4GM1A 3T9DA 4V0MA 5MFPA 1O4WA 1MTOA 1SWWA 2RK6A 2V7BA 3HXKA 3H0KA 4M37A 4H7JA 3SFZA 2O5EA 5LDDC 1KDRA 2WUFA 1T8YA 2B98A 3UOGA 5G0UA 3QFHA 4MQ5A 3ESYA 5KYYA 5CD1A 2Q3HA 1KK0A 5EY5B 1M34E 4IS2A 1DC5A 1PKXA 3ZOZA 2EEPA 4BB0A 4U4AA 3JQEA 1L7XA 3DW3X 4OIMA 4A7PA 5K3EA 5JDIC 1JPJA 2FZ5A 2HSDA 2I2CA 1YRWA 1QBKC 3LNCA 4CKWA 1TT5A 3FWHA 3G59A 1SBIA 5EUCA 4B4UA 1AGNA 1JXMA 1H5NA 3PXAA 4S0ZA 1X7WB 3PWSA 4U5QA 1R5OA 3V4ZA 1ETUA 4TMFA 3GPBA 4BHTA 2IZOA 2BUBA 1ZOSA 2MYNA 3AP2A 4AJJA 4IJKA 3K0FB 3IS3A 4QFMA 1E3DA 1GA4A 5GV8A 5CG2A 4IQ8A 3KL2A 4ZYXA 3UT6A 1RRMA 2ZBFA 2EZTA 3CNLA 1APBA 2CL0X 3LMKA 3H5RA 3K1YA 2F8SA 3L82B 4DZRA 2J3LA 3GAMA 3MB5A 1E6LA 2GHIA 3AMVA 3A1DA 5TQ0A 5EZ6B 3GGDA 3UXMA 4EFKA 3BBPA 3RC7A 1GSHA 4EEXA 4RTSA 1E7QA 4EKNB 2DU8A 4Z1OA 4L8YA 3WDMA 1BCSA 4KSBA 1M0SA 2MR5A 2P6OA 1G19A 1FDUA 4DR1B 1ZJ6A 2CDCA 1NF8A 3RCBA 4ZCPA 2OHVA 4OMUA 5A4MS 3SN6A 1T29A 1VYTA 3MQ2A 1ZK0A 1T26A 3L1IA 4M0EA 3DCJA 4HFMA 4A0HA 4D74A 1YAJA 5A2GA 4NDAA 3UMYA 4BAUA 1PN3A 2JCVA 4DUYB 1MENA 3NKVA 3AVUA 1NHGA 2RBKA 5GINE 5JJLA 3U80A 3M2PA 4YPVA 1QF7A 1RMQA 2VJMA 2J0SA 4PHHA 3FDXA 3GCDA 3Q3VA 5CDUA 3GGPA 4MV7A 3MJCA 4FCVA 1UOPA 3LX8A 4DLPA 1ICEA 4EG0A 3PDJA 3VI4B 3W6UA 5JYBA 2AMLA 1V71A 5DF1A 2L2QA 4QOSA 1FUKA 1U1DA 4K1XA 2XSZD 4EW3A 2IHNA 1MZVA 2F8MA 1YI1A 4N0DA 1HDXA 2GK4A 2OBYA 4F9EA 3CH5A 5I9MA 1E94E 4RMHA 4ZPJA 1V4BA 1C4WA 2BEVB 2J6BA 4OUDB 2WMOB 2GJ4A 1U0GA 2A5LA 4UBOA 4B3DA 5IZ4A 3DULA 1LW6E 3JY6A 3WKAA 4LVNA 4WECA 1T9CA 4BTLA 5F9FA 1F8XA 3BKXA 3RANA 5AM3A 5EMHA 3JTMA 3D7NA 2H6EA 3HL0A 5HRUA 2XWPA 4B7ZA 4ENUA 3R5KA 2Q0XA 4RAQA 5MN6A 4ACBA 2AA3A 3GIWA 2EQAA 5LYJF 2WYHA 1PV1A 3BA1A 1ECGA 1JS1X 2DR0A 3IT2A 4II2A 4RDIA 5AM5A 4DGQA 4JJ6A 1OU0A 3U4QB 4XDYA 2ISCA 3ZDQA 1NXSA 1Y37A 3NBZC 4FN5A 4IEIA 4IZOA 2PMWB 4UTZA 4NY1A 4YDRA 5A7HA 4DV0B 2VJAA 4BXOA 1WABA 3PUXA 1I51A