1I3LA

Molecular basis for severe epimerase-deficiency galactosemia: x-ray structure of the human v94m-substituted udp-galactose 4-epimerase
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
347
structure length
347
Chain Sequence
AEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAMGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNVVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-GLUCOSE 4-EPIMERASE
publication title Molecular basis for severe epimerase deficiency galactosemia. X-ray structure of the human V94m-substituted UDP-galactose 4-epimerase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 126
structure length 347
sequence length 347
chains with identical sequence B
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 2001-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1i3lA02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1i3lA01
4X54A 4JBHA 1NWHA 2O2YA 3MOIA 1RM0A 1E7YA 2Q2QA 2ZATA 4AJIA 3GZNA 1A9ZA 1K89A 1LXCA 4GKBA 4IPTA 2AG8A 1PU2A 4JJIA 3WGZA 3HUDA 1ZO8A 2IEBA 2NU6A 3KYCA 1AE1A 4B7CA 2VYND 1DB3A 4WASA 4XKJA 4DYVA 3RC7A 3I6IA 1G6KA 4XX0A 1DJNA 4YT5A 3IL2A 1M76A 2AQIA 4DBVO 2O2SA 4DPLA 1NAIA 4M86A 2X0IA 1E5QA 4AJPA 5BR7A 1AUPA 4PG8A 5KJFA 1HDCA 2Y1GA 3W6UA 4K28A 2I67A 1E3WB 1ZK2A 1YGYA 2X8LA 5DDIP 3FSRA 4TVBA 1CJCA 4Q3CA 1X13A 4GPD1 1BXGB 5JAZA 3CKYA 4K26A 5AOVA 5GMOA 5IZ4A 4M55A 1C1DB 5IN4A 3GT0A 1UP7A 4RF4A 4NK4A 3C8MA 1MC5A 1J0XO 2ZKLA 1Q7CA 3ZGYA 3PK0A 3SX2A 1J4AA 1R4NB 1E3EA 3CINA 1AHHA 3TFOA 2C0CA 2WE8A 1X7GA 1ZNQO 2X9NA 1PGPA 3AI3A 3ZU3A 3TN7A 2OBYA 1WMAA 4CM9D 2GPTA 1IYZA 3F3SA 3P2YA 1HE2A 4ZQHA 2CDBA 1WW8A 3L4BA 1PJLA 3WIEA 5C37A 4MO2A 4NMHA 3FWZA 3S2FA 1F0YA 3ZW8A 3HWRA 4NFHA 1PZHA 4LCEA 1ZBQA 4PFJA 4BV8A 5KJEA 3TZHA 2P9EA 1YO6A 4HY3A 3ANLA 5AVOA 1Y81A 4IUYA 4Z0TA 1O5IA 3PDUA 1F8GA 3LT1A 1NR7A 1NVTA 3LU1A 3QRWA 3IUPA 1QYVA 4IXWA 4MP6A 4U0KA 1H9BA 1GU7A 1EFKA 3OSUA 2HDHA 2IXAA 4WGGA 4YAEA 2B37A 3CUKA 1PS9A 3HJAA 4YBZA 4R68A 1MLDA 3K6JA 4PRLA 3DZIA 3NT2A 3ZNNA 4EI2A 4DPKA 1XSEA 4CUKA 1Z6ZA 4QT0A 4RZIA 5CEFA 5LDHA 7ADHA 1JLLA 1U9JA 4B4WA 5JW6A 4AG3A 2HAEA 4S1VA 5GZ6A 3NKLA 4RVFA 3BAZA 4JQCA 1I5RA 2CMDA 1JA9A 3LYLA 1NVMB 5IDYA 5BNFA 1GAEO 1F06A 1U7HA 1UJMA 2BI7A 2W2KB 3VPXA 1PGQA 1VI2A 4HBGA 4LRTB 3L4SO 5L7YA 5KVSA 4NDNE 1LBEA 3KLPX 3DOJA 3KTDA 3TPCA 4J6FA 3GHYA 3AM5A 4Q3DA 4UVGA 1SZJG 1FDWA 1YBAA 1DEHA 4MVJH 4PVDA 4NBRA 4OL9A 3ANMA 3D5TA 3NV9A 5BSHA 4GAEA 1HE5A 3NTOA 3H65A 1P74A 1VL0A 5IXYA 3WGTA 3DL2A 1WLYA 2ZTMA 3X2FA 2AXQA 3GVIA 1H5QA 3MOGA 3WWYA 1DC5A 2O50A 3JYQA 1YBMA 3JQ9A 4J1NA 5COBA 4GVXA 4TWRA 2X6TA 3AY7A 3EAGA 3GVCA 3VDRA 4R16A 4TVOA 3WGQA 4MVJM 3V5NA 1J6UA 4BQRA 3F5SA 4I1IA 1XU9A 5JBIA 4LVCA 2IE0A 1HYHA 2NACA 3KEQA 2UV8A 4PLGA 1PR9A 3GGGA 2FMUA 3H2SA 3OEYA 1BVUA 1I32A 3EZYA 3D4OA 4FDAA 4DIFA 4ND5A 2IRWA 4OYRA 1JVBA 4BNIA 2FY8A 3PRJA 1K5HA 1ISMA 1F17A 2Q50A 4GSKA 4EZBA 1CETA 1HF3A 2PKQP 4YXFA 4AFNA 2NQTA 3FPLA 4W4TA 4MVJE 3NJ8A 1N9GA 3WBBA 3ZU2A 3PJEA 5I8WA 5BSEA 2IYOA 4MPDA 4YJHB 1ADGA 3W4IA 3ZWXA 1GR0A 4R5MA 4DLLA 2QRKA 1LDMA 4WLVA 2OMEA 5DP2A 3KUXA 4TQGA 2O48X 3L0DA 3V1UA 1TA4A 1PJBA 4BO4A 5I7FA 4CMJA 1YL7A 4RPJA 1DFHA 2PGJA 3GH3A 3KBOA 5JCJA 3E1KA 3V2HA 1P77A 2FZWA 1KVSA 3S1LA 3JQAB 4HNHA 2A35A 4Z0PA 1LDEA 3NT4A 4PG4A 2NADA 4H16A 5FWNA 3OIGA 4YVFA 3DMTA 1IZ0A 2VWGA 4YCAA 1SMKA 4RZHA 2P4HX 3QW2A 2EKQA 4YEDA 1X1EA 2VHXA 4YJGA 4D3FA 4F45A 3VZRA 2ZYGA 4W6ZA 5GY7A 5F1KA 3U5TA 1LSSA 1RM3A 5L4NA 2GF2A 4EUHA 1OZAA 3W4KA 5A9RA 3NYWA 3PIIA 3HDYA 3PQFA 4NJMB 3TL2A 3I9MA 5B4UA 4N5MA 3T4EA 2E48A 1HSZA 1T1RA 3DO5A 3C7DB 4LISA 4C7JA 4JJFA 2I66A 5KTKA 4MOWA 4C4OA 4L74A 2DC1A 2E49A 3FBGA 1U3TA 4RCVA 2NTJA 2PV7A 2R6JA 3DWFA 5CAEA 2PFGA 4J1TA 2OOSA 4HV4A 4I9NA 3BTVA 2DU8A 4PN3A 1B7GO 3L6DA 3P19A 1LSOA 4HNGA 1FXSA 5A02A 3RUEA 4Z6KA 1WNTA 3U62A 4IDEA 1XQ6A 2BI8A 3KSUA 4DXHA 3M1AA 4L75A 1BG6A 3ONEA 4J3FA 2RIRA 3UN1A 1Z7BA 3Q1LA 4BO3A 3F6YA 2E82A 3K8ZA 4BOYA 5EL0A 4J2OA 5G4KA 1A7KA 5HWSA 4Z9YA 5U9CA 4BVAA 4CLOB 2Q99A 4CUJA 1YVEI 4IZHA 1B14A 1F14A 3SLGA 4CQMD 5LCXA 3GRPA 5C3MA 2DUWA 2XOXA 3DFZA 4L4SA 3JCZA 5B37A 4DGSA 1A5ZA 2G1UA 2GN6A 4Y6RA 5AXDA 1NTOA 2GD1O 1I0ZA 4WNIA 1P1HA 1K6IA 5JMPA 5T64A 4Q39A 4OMUA 3D3WA 2DPHA 3QIVA 4BNNA 3QVXA 3OQ1A 2OZPA 4LMRA 3WJ7A 1PQWA 1YRLA 1ISGA 2NWQA 3QWIA 4MKZA 2FN7A 3OJEA 1HDOA 2HMVA 2VHVA 3LT2A 3DAPA 2DLDA 2HCTA 2P91A 4RQTA 4DC0A 3GNSA 3RC1A 4XR4A 2I3AA 3SLKA 3WFIA 4H15A 3Q2KA 3TZ6A 1M6HA 3VPGA 5CEJA 3STHA 5F1PA 4AJ2A 1QSGA 1UAGA 1WDLA 1H93A 4BMNA 1PX0A 1U3UA 1LI4A 4B3IA 1BDBA 4TSKA 3LQFA 3TQHA 1A72A 1C0PA 2ZQYA 2VYNA 2CVOA 2OUIA 1V9LA 3ZDFA 3BA1A 1RYEA 3BTOA 2A4KA 4Q9NA 4GVLA 2ZB8A 4E32A 2VQ3A 1FJHA 4BNMA 1KEUA 3IS3A 4UVHA 1T2CA 1YL6A 3IUSA 1T1SA 3LK7A 3PEFA 4GGOA 4JP3A 5F3RA 2XPCA 5IF3A 1HWYA 3TZKA 1VC2A 4YAKA 1GTMA 3WSWA 1VRWA 1V6AA 3ZWVA 1G1AA 2LDBA 4ZQGA 1WDMA 4TROA 5CDGA 4QUKA 5I9LA 3FR7A 4J0FA 3BTSA 4E5MA 2VRCD 1E6UA 1X7DA 3DHEA 3PYMA 4R1SA 5KKAA 3LT0A 3OA2A 3HHPA 2GZ1A 4OSPA 3OIDA 4XYBA 1GYQA 3PWSA 3H6KA 4NH4A 5G0SA 4AJLA 4WUVA 4GLOA 3ROPA 1V3TA 1Q2XA 1YBVA 3ZU5A 5ITWA 1YDWA 3RCBA 1PGNA 4GLLA 1TXGA 4CPDA 1D1TA 1AGNA 3K92A 5FI5A 3U49A 4W82A 1H6DA 1XIVA 3G17A 3Q0EA 4JROA 4UEKA 1ENPA 2BKAA 5BT9A 4CMEA 4CM9A 3AUSA 3UCXA 4KDFA 4YJDA 4ZU3A 4GQAA 3DXFA 3QSGA 4CLXA 4K6FA 5CHEA 2QRLA 2V65A 2J8ZA 4XRRA 1DIRA 5HRUA 1J5PA 1K6XA 1UXIA 1T2DA 3H8VA 1L1FA 3K30A 5IXSA 5JDIC 3DHYA 3LLVA 3DAFA 3K9QO 3KYBA 4WLEA 2PH5A 1P45A 5EPOA 1P1IA 4P4GA 4FS3A 4N18A 4XB1A 1EK5A 3HNPA 1EQUA 2EGHA 4FFMA 2V6GA 4MVJD 3GUYA 5C7LO 3D4NA 1E6WA 4RDHA 5ER6A 4CLDA 4MKRA 2D5CA 1JKIA 3BMNA 2C20A 1ZXBA 2JCVA 1KC1A 1U5AA 1U2DA 5A3VA 2IZZA 1U4OA 1P9LA 4II3A 3WTCA 2YV3A 2OP1A 4HP8A 4YAGA 1SCUA 2BGMA 8LDHA 2CD9A 5TC4A 3DEYX 3DBLA 2B69A 3FRJA 4PLHA 5T6BA 3ZWYA 4CM8B 2C2XA 2CF5A 2VHYA 4GI2A 2GN8A 3GVHA 1WP4A 4N5LA 1A71A 1YS4A 2PD6A 4RO0A 4IBOA 3ULKA 3JQGB 1KVQA 4KOAA 1LLQA 4JGBA 4G81A 2X0NA 2PZMA 2R00C 1SEVA 4WCFB 4BKOA 3ICPA 4Q3AA 4GWGA 3WG9A 4W99A 4Z0HO 2WYVA 3U9LA 3F4LA 1OOEA 1DOHA 4BNTA 3RAJA 2VHZA 1RM5A 1SO8A 2Q1UA 2NU8A 1UXKA 3L9XA 3FNHA 1LNQA 2EWMA 1SOWA 3HB4X 2XAAA 3V1YA 4YPOA 8ADHA 2PKQO 5L53A 2RCYA 1PWZA 2PZJA 4NJOA 3RVDA 4R1UA 3OQBA 5A04A 3EGOA 3SC6A 3WJAA 2Y1EA 4OSOA 4CQLB 4OQYA 4AICA 5LC1A 3QLJA 4RVHA 4WLUA 3QE3A 3I52A 2X7HA 1T26A 3AOEA 3NX4A 3UH1A 2YHIB 4OXKA 3KVOA 4PLTA 2UVDA 4JBIA 2GZ3A 5JY6A 2QG4A 3O38A 2PK3A 2X5OA 4NHEA 4QFCA 3JQEA 4RVDA 1B8UA 2PH3A 1HL3A 1NQTA 3AM3A 4O59O 4ALLA 2X86A 1NQ5A 3QVOA 2O7SA 2X5KO 2HRBA 3B70A 3LVFO 4FQ8A 5MDHA 4CV3A 3PHLA 1KIFA 2VTDA 4L4RA 1X1TA 1HXHA 2VUSA 5JCJD 1GCOA 4IJWA 2NV6A 2WYUA 2BH9A 3BMNB 2GSDA 2YUTA 3QWHA 5I8ZA 3V8BA 1R4MA 1PS8A 4EDFA 4UEOA 7MDHA 5JO0A 2GCGA 1IE3A 3DBLB 2FOIA 4DMMA 1MV8A 3ASUA 3H7AA 1QLJA 2JD0A 1Y5RA 1Y6JA 3AOGA 5B4VA 1UXJA 3ZHBA 4B7UA 4E21A 2DTDA 1VL8A 3H5RA 3HG7A 3AUTA 1YQDA 1NBOA 2AW5A 3QVSA 4OXNA 3ZWWA 2GGSA 4U6SA 1LQUA 3GVXA 2WTBA 3QJ5A 3RJ9A 3NDJA 4BMSA 5AQ1A 1DPGA 2YV1A 3ADOA 1H6AA 1H2HA 5K6AA 1B3BA 4CM4B 4QTZA 4BNFA 4N54A 4TRNA 4XJSA 4F3YA 2P9GA 4CMBA 5HS4A 1UP6A 5A06A 1Y8RB 2UYYA 2JD1A 3ZNOA 1YB4A 4RVGA 3INRA 5DN9A 5COAA 5T8KA 1LEHA 3CXRA 2EKLA 4MJLA 5BQFA 4PLPA 3DZGA 3JD1A 4KWIA 5DBFA 3UXYA 1SC6A 4YTEA 1ZVMA 5LDGA 3ZN2A 4FFOA 2Q4BA 1B16A 1UXHA 2YFQA 5DCUA 4U8GA 3Q6IA 2IEDA 4BNZA 3FPCA 3H9GA 3W8FA 4YT8A 3O9ZA 1A4UA 2SCUA 1C14A 4ZRMA 3I4FA 2NVUA 4XQEA 2ZJ0A 4EJ6A 3JQ6A 1I36A 1PZFA 3FNFA 2QQ5A 4BL5A 1LRJA 1B8VA 3BMQB 4FOOA 5K0ZA 1H2BA 5G4LA 2I65A 2VYVD 1WAMA 1XKQA 1NP3A 1H94A 4BO5A 5DBGA 3C1OA 3S55A 2GN4A 1DRWA 4BS9A 3AY3A 2JD2A 1Q0LA 3OJLA 3N58A 4B7XA 3KETA 1CRWG 3PHHA 5ICSA 2PD3A 3EDMA 2AG5A 3WFJA 4IMPA 5ILGA 1O9BA 4YA6A 3VC7A 2C54A 2JHFA 3E5MA 5U4QA 3GGPA 3Q9UA 5CP8A 4ALNA 1R4MB 3EC7A 2E37A 1EE9A 4JJGA 1MXHA 4WEOA 1EZ4A 4K9DA 1RM4A 4B4UA 4CQMA 4JIGA 2RHRA 3GMSA 1BSVA 2G82A 2QRJA 3KXDA 1B15A 1C0LA 1OBFO 1OC4A 1SBYA 3B1KA 3QV1A 4D0RA 5I7EA 1BGVA 4IIUA 2WEKA 5JC8A 3FI9A 3PIDA 3WTBA 1A9YA 1ID1A 3H9JA 4D3DA 3PGXA 3BMOA 4ZQBA 1N5DA 2OO5A 1NPDA 1UDAA 1I24A 4WK6A 4UREA 5TT0A 4CM6A 3LSYA 4ALJA 5CDUA 2QIOA 4QFDA 2QZ9A 1O8CA 3UUWA 3AY6A 2J5KA 3DB2A 4PLZA 1EDZA 4FGWA 2H1SA 5IZCC 4B3HA 5TJ9A 2H63A 4PLYA 1UP4A 2X58A 5THKA 4U5QA 2HK9A 1LC0A 3WB9A 1VPDA 5TJHA 3OP4A 4DL9A 4BO7A 3IJPA 3HDQA 5A1TA 4O5OA 5GZ3A 3JQ7A 2DBVO 2PLAA 3DBHA 4BNLA 3U0BA 1NPYA 1XLTA 2CY0A 3QVTA 4EEXA 1KY4A 3E8XA 1RPNA 2DPGA 3OA0A 4R9RA 5H82A 2C07A 2W2LA 3HN2A 4DYDA 4O63O 4DWVA 1DLIA 2HMWA 1NR1A 3E9NA 5A05A 1ADBA 1TT7A 4BO1A 4A27A 2P68A 5ITVA 1HSOA 2OP0A 5L45A 2Y0DA 1K3TA 3K5PA 2B35A 5JMWA 2Y67A 1TEHA 2X23A 3TFQA 3ONFA 4HXYA 2JAPA 3ZNQA 1ULSA 1RJWA 5JCXA 3AI1A 2OXIA 4BNXA 4OJNA 4Z3DA 3O4RA 2VRCA 2EJVA 4XD2A 2BD0A 1IY8A 4NPCA 1DC3A 3BYZA 3UOGA 1VJTA 3AUAA 3E6AA 2B4TO 3CE6A 4GX0A 4M54A 2Q4EA 3E9QA 2G0TA 2C7GA 2O3SA 4MVJG 4WPGA 4BO6A 5DCWA 1ZUD1 3GZNB 1LJ8A 4D3SA 1U3VA 3PZBA 1PL7A 4KUGA 1EUDA 3DZHA 1CQIA 1V3UA 2P2SA 4FC7A 2PGLA 3KHUA 2Q1SA 1YWGO 3GEGA 3JYOA 3KYCB 2GUGA 3V2GA 4ND1A 3H2ZA 4NU6A 4U6QA 3H9EO 4J91A 3VPSA 4BKUA 3DZKA 5CDYA 4E2XA 5B12A 3EHEA 3JQFA 2OBNA 4GMFA 5IN5A 3TRIA 1LLUA 5T5QA 4PG7A 4EUEA 1ADCA 1N1GA 1PQPA 2BLLA 2GDZA 4D41A 3ZH2A 1T4DA 4B8ZA 3SJ7A 4LCJA 1NAHA 1P0CA 1ONNA 1IHYA 3A28A 3PVZA 2AEJA 4R4JA 2B0JA 3JQ8A 2J5QA 4MIOA 3HZZA 1GV0A 1DRVA 3C85A 2PZLA 4MVJA 5JSFA 4YR9A 4UAGA 4D44A 3JQBC 2C29D 4CJXA 3R0IA 3Q3CA 2QZZA 1P0FA 1HKUA 1FF9A 1WZEA 3ZHZA 4OGWA 4IZIA 1UZMA 4HFNA 1GZ4A 1MC4A 2WSBA 1E3IA 4I9UA 3GPIA 1KC3A 1TLTA 2HQ1A 1Q0QA 3JD2A 1QP8A 1ZKMA 3FHLA 3GC6A 1QYDA 2FP4A 4XYMA 4BKQA 4NI5A 1BDMA 1M6WA 4DPMA 1I8TA 4WCFC 3HDHA 4ZQFA 4I08A 5H83A 2X4GA 3ST7A 1C0KA 4KMSA 4CV0A 3MTJA 4IJVA 3ON5A 3T7CA 5HBRA 1BW9A 1KVUA 1HETA 4J9UE 1UR5A 4OO3A 4DQUA 3GEMA 3VTZA 2OL4A 5TT1A 3MEQA 4IMRA 3OHSX 3T4XA 2Y1FA 1Y7TA 1FDSA 4Q3EA 3A06A 4XRGA 3VH4A 5KVVA 1YDEA 1P3DA 1BTOA 3GF4A 4XA8A 1EEHA 3H9UA 3PQEA 5FI3A 3I9NA 4NR0A 4KQXA 3WBFA 1GPDG 2YFHA 4HFJA 2Z5LA 5JDCC 1DIBA 2FR8A 4IGFA 2NUAA 1A27A 4W7IA 4GH5A 4Z9XA 1VSVA 2Q3EA 4OHUA 1DAOA 4W9NA 1Z82A 1ISIA 3IDSA 4PGFA 1E7RA 1ZFNA 3RUHA 2CZCA 4GMGA 5KNLA 3QVWA 4G5HA 2NM0A 1UXGA 4RL6A 1IL0A 4YAJA 2I9PA 3JD0A 3HDJA 2X0RA 3OICA 5JFOA 1ZMTA 1LLCA 3DBRA 3ZHYA 3O8QA 1LRLA 3C7AA 2ZQZA 4JXKA 2YQ5A 3GAZA 4OIMA 4NFYA 2PKRA 2WDZA 4RF3A 1JN0A 5T57A 4U7WA 3ROMA 1HT0A 3UVEA 2J6IA 2CVQA 2BELA 3M6IA 1E7QA 3C1AA 3I9JA 4DQVA 5IJZA 4FJ0A 4Z9FA 1GZ6A 1CQJA 4RDIA 3RI3A 3TOZA 2CVZA 4XYGA 3MCVA 1E92A 3GG2A 3VAZA 2WJPA 2EG9A 1PIWA 3IIEA 1CEQA 1MFPA 2D3TA 3PJGA 1QRRA 3PLNA 3TOXA 1H6BA 1B2LA 2OORA 3CPSA 4A10A 5BNIA 5CG2A 3TF5A 5DOVA 2FR1A 2DKNA 3LDHA 3B1FA 1DRUA 1R37A 4D42A 3ZWPA 1IUKA 2YQ4A 4YT2A 1N7HA 1EDOA 1ZXLA 5JS6A 3QA9A 1U5CA 4ZVVA 1CF2O 3I6QA 3IMFA 4BMVA 1PS0A 1K2WA 1MP0A 2QW8A 1BW9B 5L4SA 2DUUA 3PWKA 2DBRA 3ZZNA 4BB5A 3HFSA 4QXMA 4ZJUA 3ZI0A 1GQYA 4GSLA 4GBJA 4BGVA 2FZEA 5DULA 1C1XA 4CMHA 5BSFA 5IFLA 4DREA 5L7WA 1FMCA 1DHRA 1QKIA 2HKIA 1ZH8A 4J1SA 2VT3A 3ZV6A 2Y0EA 2VZ9A 9LDBA 3PYXA 3VHRA 2CUKA 1M75A 4KP7A 1YOVA 3IJRA 1VJ1A 4I5FA 4AJOA 3RBXA 4QX6A 3B20A 4NK5A 4PIVA 1VSUA 4NQZA 3EUWA 4ZRNA 4BUCA 3HFGA 4ZD6A 3WQRA 4E5YA 1N9GB 1K0UA 3LZ6A 2WD7A 4J4TA 3TZCA 1ONOA 4AJ4A 1G0OA 3WSVA 3AM4A 3N74A 4BNHA 2D2IA 2JHGA 2RHCA 1IPFA 2VYVA 1DFGA 4ND3A 5JO9A 4P4LA 5L4LA 2X5JO 2DM6A 4F6LA 4GX2A 3PZRA 4ND4A 3F47A 1QV6A 4QSMA 2W4QA 5JPIA 4GGPA 3I23A 3PHGA 3U3XA 2X9VA 4G65A 3QWAA 4QQRA 5ES3A 4BKPA 4RLSA 2GR9A 3RKRA 2GNAA 2YYYA 4J49A 5JE8A 3RJ5A 4FN4A 5H81A 1XU7A 2HSDA 1I10A 3R1IA 2FRDA 4XGKA 3ZWNA 2RH4A 3CMCO 3K2BA 5AXCA 4XQCA 2YHUA 4FGSA 4OXYA 3W8EA 1UDBA 4CR7A 1BMDA 1W8DA 1YJ8A 4IS3A 2CSUA 4KQWA 3K31A 3RUCA 4YJGB 1UH5A 4RQUA 4B4VA 1V35A 2YW9A 2I99A 1IHXA 3DTYA 2ZK7A 4WEQA 4WLFA 5K6AC 2VZ0A 1EBFA 4GX1A 4DBZA 2BRUA 3VZPA 2W2LD 4KDEA 3M2PA 3GN2A 3HN7A 4L8VA 1D1SA 1GD1O 5ER9A 4DUPA 2O23A 3HSKA 4EUFA 1O94A 5A3JA 1C1XB 2G76A 4OKIA 4J7UA 4AJHA 1KVRA 3GDFA 3IAHA 1YH3A 4RORA 4M87A 1UDCA 1ZSNA 2FPIA 3KSDO 2Y05A 1PJTA 4OH1A 1ZMOA 2BFAA 4HWKA 3H4VA 3EW7A 5F1OA 3PHIA 5EMHA 1TT5A 4WCDA 1NHGA 1HYGA 3ETGA 3K73O 3OH8A 5COQA 4YRDA 3VVBA 2CF6A 4PZCA 1R6DA 5G4KB 3LT4A 1VJ0A 3TL3A 1NXQA 2O3JA 1NQOA 1GUYA 2NU7A 4E13A 1ZJYA 3JSAA 3OF2A 3PXXA 5C7IO 3TNLA 1VKNA 4E12A 5IDWA 4IDBA 3ZV3A 5IDQA 2UUPA 3TDKA 1ZK1A 5CFZA 1B8PA 1W0CA 3RIHA 4CLRA 2AE2A 3G1TA 4BO9A 3X2EA 2IDZA 3G3EA 2EKPA 3D3WB 1R0KA 3RASA 1I2CA 1T25A 3L77A 4JX8A 4D7AA 1LSJA 1Y9EA 1PL6A 3JD3A 4G2NA 3CZMA 1W73A 2BGLA 2NLOA 4Y67A 4ZHSA 1T4BA 4XGIA 2V6MA 2C5EA 3SEFA 3IP1A 3KYDA 3S2IA 3VZQA 4BV9A 1O6ZA 3B6ZA 1YL5A 1ORRA 4RPKA 4UUMA 3S2GA 2WYWA 3TJRA 4J7CA 1NYTA 5TNXA 2C7VA 3FTPA 2P4QA 1ONPA 2PTGA 5KVCA 2J3JA 3MJVA 3KOUA 1NVGA 2P5YA 4MP8A 4UULA 3O26A 5TS3A 3GEDA 2JFFA 4II2A 1JWBB 4P22A 3ZNPA 1JKJA 1E7MA 3D5QA 1ZSVA 3F9IA 4TRRA 5KVQA 3ROQA 3BMCA 3F4BA 4LRSB 3JTMA 2NQ8A 3I83A 3MJCA 3U09A 2Q1WA 1PJ3A 3C1TA 1SB8A 5CPFA 4GKVA 3I4CA 1E5LA 2HLPA 4IDDA 4YJFA 2AEFA 3JQAD 3HQ4O 4O0LA 4PCVA 5EINA 3UCEA 1V0JA 3JYNA 1WZIA 4ILKA 3WYEA 5TSDA 6LDHA 4O6VA 5A5EA 1MUUA 4TKMA 5DZSA 1QG6A 3L07A 4HADA 2VCYA 3CEAA 4WNCA 1XEAA 3SXPA 1U7TA 3AFNA 4IDCA 2Y0CA 3AWDA 4IIVA 5EIOA 1GEEA 1JU9A 2Q49A 5JNLA 2QHXA 3QY9A 1P1RA 3L4BC 1N8KA 2VRBA 4YWJA 3K2EA 4CL3A 4TMFA 1WPQA 1S7CA 5CDSA 2ZTUA 3DZJA 4RVUA 4ZGWA 5A9SA 1Y8QA 5DP1A 1F12A 2ZTVA 4PLWA 1U8FO 1LQTA 2DFDA 4LK3A 2DBQA 4A26A 1T2AA 1DHTA 4PRKA 3PHJA 3WNQA 1DJQA 2IXBA 4J1QA 2GERA 1I3NA 2JKVA 1HDZA 3EVNA 2J5RA 2ZB4A 1H0KA 2VWPA 2JJYA 1DIGA 3LLSA 1LDNA 3EVTA 2HJRA 1PJ2A 1OFGA 3EMKA 3PI7A 2Y99A 4CMIA 5KKCA 2ZCUA 1CDOA 1HE3A 5JAIA 4RF5A 1OMOA 5ENDA 2G5CA 3VDQA 5CDTA 1YQGA 1DIHA 1P1KA 4F6CA 5EESA 3WIDA 1LRKA 1U3WA 4KWHA 4R51A 3PJDA 3DONA 1P33A 1TI7A 3U4IA 1KBZA 1Q0HA 1T2FA 3ENNA 1KOLA 4NU5A 1WDKA 3NJ4A 5JAQA 2CDCA 2VUTA 4ONEA 1GZ3A 3KRTA 4CMAA 4XIYA 2NVBA 4IINA 4D43A 1DC4A 3M1LA 1WVGA 5TQVA 2A9FA 4ND2A 5FEUA 4XR9A 5F5LA 2Q2WA 2VUUA 5TF4A 3WYBA 4FJ2A 4L76A 5L7TA 4J4HA 2BMAA 1PTJA 1QR6A 3CZRA 4QEDA 3BZUA 4OQZA 5DF1A 5L51A 1DBVO 2IZ0A 3TWOA 2Y1DA 1HEUA 3JQ9C 4XWYA 1QORA 5L9AA 3M2TA 1EFLA 1U2GA 2H6EA 3DMYA 4ZA2A 4BHTA 2BF7A 2O4UX 4FW8A 2FPGA 1HE4A 4TZTA 1T2EA 3DBVO 3GN1A 2B5WA 2C82A 1GEGA 1ZZEA 5I9MA 1YB1A 5HS6A 5EQDA 5G0VA 3H9QA 4UVDA 4XZ3A 3WGIA 5ILOA 1QV7A 2B4QA 2HK7A 3JD4A 4DLBA 1N7GA 4WKGA 1V8BA 1H6CA 4S3MA 1BXGA 2VNAA 4OOFA 4U0JA 1S6YA 3BHMA 4E4YA 3SC4A 2HJSA 4DC1A 1C1DA 1ZW1A 2XXJA 3EZLA 3ZV4A 2UAGA 2ZYDA 1CYDA 1I3MA 4E2ZA 3S2EA 1LX6A 4KUHA 6ADHA 1EVZA 1D3AA 2PR2A 1GDHA 1R4NA 2G17A 3OBBA 4JP2A 4KZPA 4YQZA 3V2UA 2NTVA 2Z1MA 1Q7BA 2DQ4A 2XXBA 2O4CA 1DXYA 1WXDA 3AW9A 3OIFA 1LTHR 2Q46A 3UAGA 2Q2VA 2EXXA 1W6UA 3W6ZA 1YQXA 4XYLA 3IOYA 4CM5A 3I9KA 3R6DA 3RROA 3MWEB 1XA0A 1Z45A 4LN1A 2I76A 4E6PA 3Q9NA 4WE3A 2AA3A 2J3HA 4CMCA 3GG9A 3RFVA 4N5NA 2QYSA 3PJFA 4HUJA 1AXEA 3P5SA 2EV9A 4R9SA 2R2GA 1E3LA 3O03A 2Z95A 2D8AA 4HKTA 1X14A 3RBVA 3RBZA 1IOLA 2XF8A 2BFOA 3C3XA 1P31A 3DMTC 4TRMA 2P9CA 1LC3A 3RUDA 2PWZA 1KEWA 1M66A 2I5PO 3H3JA 4DMLA 5JDIA 2X0JA 2YDXA 5L95A 4FJ1A 4AJEA 2TMGA 4IJUA 4A2CA 4Y8VA 4IXTA 3MTGA 4FFNA 1IULA 1LSUA 3AU9A 1HLDA 4FFLA 1U28A 5F5NA 4DA9A 4E5KA 3GDOA 3QWFA 4BKRA 3ZWAA 4P38A 5DBIA 4EITA 2WMDA 5KOIA 2NVUB 1YKFA 1RKXA 3R3SA 3ZWBA 2W2KA 3E5RA 3PWZA 4EJ0A 4TRJA 2JFGA 4NBTA 3ZW9A 1NWCA 1Z74A 3WR5A 3E03A 2YV2A 5TGDA 1MGOA 2CNBA 3LC7O 1GYPA 2Y1CA 1HDRA 4LVUA 3VOSA 3WLFA 2ZB7A 2R00A 3D7LA 4YQYA 2WM3A 3QQPA 2D59A 2GRAA 4PLVA 1Y9AA 3U4CA 3ZCXA 2X9GA 5EN4A 1A7AA 1GFSA 4NBWA 3QP9A 1FDUA 4YRBA 3IKVA 1HLPA 3WGOA 3W1VA 3OM9A 4CQMB 3DZFA 1MA0A 2EW8A 1MXFA 1OI7A 1GUFA 2RBEA 3BHIA 3OJFA 4BNKA 3GRKA 4L0QA 4AVYA 4MKXA 1I33A 3BMOB 1V3VA 1OAAA 3V1TC 2C2YA 3E48A 3KSZO 1MFZA 2DFVA 5AXBA 2W90A 3A14A 1N92A 4R01A 3E9MA 5K9ZA 3KZVA 3Q2IA 4BO8A 3D64A 3ANNA 3H5NA 3JQDA 4W7HA 3WOHA 3BHJA 1P44A 4MDHA 1E1NA 4FOSA 4FB5A 3GR6A 5G2OA 1JTVA 1R15A 2JFHA 5C7OO 4Y6PA 1XWFA 4PG6A 1KS9A 4E31A 3A4VA 3INTA 4RLHA 3GOHA 3NAQA 5I7SA 3JQ7B 4EYEA 1XQ1A 3MWDB 3DBHB 3VH2A 1D7OA 2X1HA 2UUOA 1LDGA 5JXWA 4YJHA 1P1FA 5G0WA 1VLLA 3RU7A 2O7QA 1L7DA 3W4JA 1DDOA 3D4PA 4FPXA 4DLAA 1QYXA 3RSHA 4OKNA 4NBVA 5JYDA 2B5VA 2AQHA 2ILTA 1XHLA 5A4DA 3ZWOA 1EVYA 3CSDA 4H3VA 4XB2A 1I3KA 3JQAA 3UCFA 5I9NA 1RYDA 1C3VA 1KERA 1ZK4A 1MG0A 1KVTA 1HDYA 4NBUA 4YAIA 5FF9A 2FSSA 2Y68A 2HU2A 3DC2A 3ZV5A 3QHAA 4J90A 3COSA 4E33A 3WQSB 4HX5A 2HK8A 3EY4A 4CMEC 4NJMA 1UUFA 2QX7A 3F1KA 3UF0A 3G0OA 4XGNA 3UKOA 1EUCA 1NFQA 4XYEA 4IDGA 2CFCA 1NPTO 2VWQA 4R5HA 5DCYA 3GNTA 3JYLA 3WICA 2IZ1A 4A7PA 2NTNA 2B36A 2E6UX 4FCCA 3AI2A 3AJRA 5TX7A 2DBZA 4ALMA 2ZIZA 5JYEA 4E3ZA 1U4SA 4I5DA 1LUAA 1JWAB 4CMKA 2DT5A 3DOOA 1WWKA 1X15A 1PZEA 4QO7A 3GDGA 1E0DA 3DFUA 2TMDA 5F21A 4BO2A 4E5PA 1PL8A 2OGUA 2EF1A 1Y5MA 4PG5A 5IAAA 4AJNA 2D1YA 1M2WA 1GL3A 4WLOA 1XCBA 5U1PA 1AN9A 4ZICA 3F5QA 1GY8A 3JQ8B 3RC2A 4CM7A 5CEEA 4XIJA 2VOEA 1SPXA 4PLCA 1N1EA 1YJQA 4CLOA 1JKFA 2JAHA 2Z1NA 3P2OA 2DAPA 3LF2A 1ENZA 4PLFA 1Q7GA 4N7RA 5G0TA 3NRCA 3WLEA 1C0IA 2D5AA 2WWRA 1HRDA 4P8RA 4XDYA 3UHAA 3D1LA 5C5IA 3KB6A 4M89A 4Q3BA 3SBOA 2EP5A 4Q3NA 3RQSA 5B4TA 1UAYA 1E6EA 2DTEA 5L40A 3U4HA 4IJKA 4Y9DA 4OM8A 5IDXA 2GN9A 1E3JA 4XJTA 2V6BA 3HE3A 1DLJA 4O1MA 3VH3A 3P7MA 3VKUA 3RFXA 4FD3A 4HFMA 4FR5A 3GUCA 1ZK3A 2VTEA 3BTUA 5KJ6A 3ZU4A 1SB9A 2FR0A 5BSGA 4B79A 2QYTA 4OAQA 4QECA 5IZCA 1A4IA 3A9WA 3DTTA 4HFRA 4PVCA 5BNTA 1DFIA 3GQVA 1ZK0A 1H9AA 3RU9A 4E0BA 4CR8A 1GQQA 1AXGA 4ZN6A 3JYPA 4Y98A 1FDVA 3ZWMA 3WGGA 3PFWO 2EIHA 1XYGA 2JCXA 3AOEC 2DTXA 1PJCA 3PFFA 1Z7EA 3CTMA 2VOJA 4BB6A 4DRYA 3F1LA 4RV9A 1DSSG 4CMGA 2JCYA 1I3LA 4R1NA 1YONA 1TVEA 4RVSA 1MX3A 9LDTA 1FDTA 3IP3A 3FN4A 3NGXA 2PA3A 4J4BA 2FSVA 1BHSA 1JW9B 3H5AA 2Y66A 3GA0A 3OJOA 3WYCA 1EVIA 1XELA 2YY7A 3FTNA 4YT4A 1PR3A 4WOKA 3WMWA 4EW6A 3DBRB 1R66A 3O8QB 4LMPA 3WS7A 3DDNA 1O89A 3HB5X 4EEZA 3KM0A 3RUIA 3KV3O 4D79A 1JQBA 3FBTA 4E2WA 4GL4A 3ROKA 4JLWA 2OFPA 5FFFA 4CUZA 1BVRA 3ITKA 4WECA 3D3EA 4J2HA 5ENVA 3GPDG 1ZJZA 5KJ1A 1CIVA 4B3JA 1EMDA 4M1QA 1PSDA 2Q1TA 2O3QA 1GUZA 2GASA 3Q11A 4A73A 4WLNA 5HA5A 3OJ0A 3UGKA 4CODB 4FFPA 2GO1A 2YDYA 4QO8A 4R3NA 2J3KA 4IGEA 1BRMA 1VE9A 3ORFA 2IODA 3CIFA 4MP3A 1ZIDA 4AL4A 3TSCA 4PZDA 2B4RO 2HMTA 2ET6A 2NSDA 3AFMA 4ALKA 2A92A 3MJSA 4RGBA 1NASA 3RWBA 3VPFA 2NNLD 3GFBA 1ZSYA 3I3OA 3ONDA 4UUNA 3AU8A 1MG5A 5T8KC 3OETA 3VKVA 2HRZA 3GFGA 1KEVA 1SEPA 4H7PA 2C59A 3GMDA 5A9TA 1PZGA 3ETEA 3RFTA 2BGKA 4YYZA 4AJ1A 3H3FA 4TZKA 1KYQA 4JK3A 5MGBA 2RAFA 2RH8A 3FNGA 5EQFA 3ZWCA 4DIOA 1O0SA 1YOVB 3A1NA 4A5OA 4C7KA 1T24A 3R3JA 3FF4A 1JVSA 3WMXA 4BGIA 2FPPA 3JQBA 4GX5A 3S8MA 5TLSA 4R3WA 3N7UA 4PZEA 3NUGA 1NFRA 4CM8A 3L6EA 2EP7A 1HTBA 2P5UA 2Y93A 3OECA 5AYVA 3WGYA 4AJKA 4LW8A 2F00A 4LSMA 4A0SA 5DT9A 1IZ9A 2WD7B 2GYYA 4DTIA 3JQGA 4EGFA 3PGJA 3PDJA 2VN8A 3E18A 4I5GA 4ITUA 2H9IA 1K6JA 3ITDA 1O95A 1U8XX 1PEDA 4UUPA 3DOCA 1DO8A 4WCFA 3UFXA 4BNVA 4BO0A 2CDAA 3OQ6A 4E30A 4K6CA 4J16A 1B3RA 2UDPA 1DC6A 3GK3A 4RF2A 1NNUA 1PJQA 1I01A 4L73A 3DHNA 4R54A 4IM7A 4UVIA 4RPHA 1VL6A 3PQDA 1I2ZA 4NFSA 1TB4A 1ZCJA 4OOEA 4Y6SA 3MZ0A 1E1KA 1LDYA 1YB5A 2ZYAA 2HUNA 4CQLA 2C5AA 4BIIA 5CG1A 3LF1A 1N2SA 4I9HA 4TKLA 1JDJA 4FSHA 4P4NA 4CLHA 4XEHA 3IKTA 3AK4A 3VPHA 3BIOA 3PPIA 5A03A 1ARZA 1ULUA 2IYPA 1I30A 4J0EA 5JDCA 1KEPA 1GADO 2WE7A 2YHIA 3DZBA 1EBUA 4XCVA 3KEOA 3KO8A 1Y1PA 3GGOA 4I5EA 1GYRA 4E5NA 1B0AA 3SJUA 3INGA 3I5MA 3JQCA 1W4ZA 4FC6A 3ADPA 4NIMA 4R1TA 3VH1A 5ICMA 2YZ7A 1SOVA 3G1UA 1KETA 1Q1NA 3MJEA 4FIZA 3T7EA 4F46A 1BXZA 4LGVA 1CWUA 3G79A 4B8WA 4BNWA 4XQGA 5FYDA 3ZHXA 1HYEA 5DNAA 1X7HA 4LSWA 1UZLA 1NM5A 2AMFA 4E2YA 2FHSA 1X0XA 1FK8A 3FNEA 1QMGA 4INAA 2O3TA 4KUEA 3K96A 4MIYA 1Z75A 4UUOA 2I6TA 4WOJA 4DQXA 4UEJA 4YB8A 5JLAA 3GLQA 1TT5B 2AHRA 4RJTA 4CV1A 5A5FA 3GVPA 3OFSA 4EBFA 2WD8A 3OMLA 5TIIA 4JCOA 5JC1A 3GY0A 1QXSA 3NEPX 1ADFA 1ISFA 1NHWA 5KCZA 1R0LA 3C24A 3F46A 2NVWA 4IY1A 1NFFA 1VKOA 2VNSA 4CM1A 1J49A 5THQA 5KIAA 1EK6A 1L7EA 4CLEA 4YACA 4MVJF 4YRAA 2PGDA 1ISHA 2PD4A 5AXAA 1E77A 1P1JA 1PGOA 3ASVA 3WGHA 2A94A 1NX6A 4CLRB 4IDFA 4R69A 4CM4A 2EHDA 2POQX 2ZB3A 5HTOA 3LC2O 4UVEA 1GV1A 4IDAA 3FWNA 2AQKA 1Y8RA 3GHHA 4RPGA 3CMMA 3GNQA 4DVJA 1EVJA 2B83A 4M49A 4URFA 1ENOA 2O3RA 2YJZA 4IS2A 3IQDB 4L4XA 4ID9A 2AE1A 3KYDB 4WJZA 2D0IA 2VZ8A 3JV7A 2Q45A 2F1KA 1QYWA 2PNFA 3W8DA 4Z3KA 1QLHA 3FD8A 3FR8A 1EUZA 4BNUA 2HO5A 4NG5A 5HM8A 1I2BA 3DQPA 4ALIA 2NU9A 3WDSA 3QWBA 1R12A 4K1LA 4CV2A 3CH6A 5GZ1A 3JQFC 5B1YA 5J23A 3UW3A 1VM6A 3UICA 1KY5A 1E7SA 5ADHA 1LU9A 3BXXA 1IPEA 3BMQA 1E1LA 3I9LA 1M67A 3RC9A 3NTQA 1QYCA 1F8FA 3DR3A 1DAPA 1IB6A 2H5LA 2PY6A 4KTTE 4R41A 1XGKA 5DOZA 5G0UA 3BMCB 2FWMX 1XG5A 4ZQEA 1YE3A 3GAFA 4ESOA 2O3UA 4IQ0A 1E7WA 3VVCA 1JAYA 4DIBA 1LDBA 1PGJA 2BFMA 2OHXA 1Z73A 4YJFB 2DVMA 2VWHA 3NDIA 3WX0A 2EEZA 1EE2A 4J7XA 1LA2A 3LC1O 4JNKA 4KTVE 3C7CB 4B4OA 3IC5A 2AQ8A 1NQAO 2J3IA 3NDRA 2EERA 4BNGA 1PWXA 4EJMA 2HMUA 4JBGA 3EYWA 1G0NA 2AEMA 1B26A 4GWKA 1DIAA 1R16A 3RUAA 2HMSA 1ZEMA 3MJ4A 4NZ9A 1GPJA 3EK2A 1WMBA 3PYLA 4IQ8A 5I7VA 4FBGA 2BFPA 2ZJ1A 5IG2A 2VHWA 3GZ4A 1HDGO 1ISJA 3NT5A 5T67A 1UZNA 4MVJI 3FCOA 3VTFA 1AHIA 4L9RA 2Y1OA 4MIEA 4FFRA 3TZQA 4BGEA 3U4DA 2I3GA 1OC2A 1GCUA 5JY1A 1HZZA 1SAYA 3PLRA 3WWZA 1BWSA 3B1JA 1GQ2A 2VT2A 2GZ2A 5A9SB 1Y8QB 1EQ2A 1JAXA 3G49A 3NGLA 3L6OO 1E3WA 2W8ZA 3DAGA 1ENYA 2EGGA 2BHLA 2V7PA 1PJSA 4M8SA 3SVTA 3WXBA 1E3SA 2V6FA 1XDWA 2LDXA 3PP8A 1MB4A 3MJTA 5KJCA 2JL1A 3OEWA 1HZJA 3NTRA 3I9OA 5KWEA 4MINA 3AUUA 3WNVA 2ZTLA 5TRTA 2GLXA 3I1JA 4ROSA 4AJJA 1HDXA 1YXMA 4W9NC 3VZSA 1D4FA 3E82A 3HADA 4CR6A 4CMIB 2W98A 2X22A 3L9WA 4XDZA 1U1IA 1R0SA 3ICCA 3KLMX 4XQ9A 4BQPA 4BNJA 5EJ2A 5JAMA 4D45A 1RWBA 4NNJA 5L3ZA 1PJ4A 3ENKA 1SNYA 2EW2A 3RKUA 3RD5A 4CM3A 3WQQA 5EERA 1CERA 4I8XA 4MVJP 1E1MA 3RUFA 4CL8A 1ZEJA 1PQUA 1XR3A 3PTZA 4BGUA 2D4AA 4YDRA 2E4AA 4BNYA 1D8AA 1ML3A 2PZKA 1BXKA 1X0VA 3D0OA 4D46A 3ABIA 4IQGA 4RPLA 1LLDA 4D0SA 4A03A 4JN6B 4J9VA 4J43A 5CPBA 2ZCVA 3ETDA 2EJWA
chains in the Genus database with same CATH superfamily
2M6KA 5FI0B 2BONA 2GM4A 2H1OA 2TYSB 2IEIA 4YMLA 3SWWA 1D2NA 2O2YA 4P9NA 5HMMA 3MOIA 1RM0A 1SUAA 2QRQA 1K92A 2Q2QA 2ZATA 2HTFA 4UQOA 4C20A 4FFBB 2QVXX 4GOLD 2ZSAA 1FS4A 1JG3A 1NRJB 4LQDA 1Y6FA 5EXPA 4GKBA 1PU2A 4XSVA 3WGZA 2P8JA 1QTRA 2ZBFA 2NU6A 2IEBA 2HI0A 3T9BA 4K6GA 1ITZA 3BERA 3QEMA 2F90A 4GNKA 4EMBA 1YJBA 2ZIEA 3UMGA 1OVGA 5JJKA 2QYOA 2R4QA 2ZM6B 3RC7A 1N2BA 1G6KA 3VR2D 2FPGB 4URUR 1QTQA 2LUOA 4ZODA 3FUTA 3DAOA 1RWVA 4F9FA 1IAVA 4EX6A 5LIPA 4DBVO 4HAVA 4DPLA 1NAIA 5J4VA 2X0IA 2P2GA 4KBYA 4K9MA 1EP2B 1CY0A 2J09A 2RBKA 2W6JA 1W1UA 4NBLA 4JC4A 4TXLA 5K0NA 3UK2A 3Q8MA 2Y1GA 2QZJA 2JZNA 1F0PA 2GAJA 2JASA 1BCSA 4I3GA 4BLTA 4CNBA 3GPBA 4RCYA 2ZJ3A 2FFQA 3J81A 1OLXB 2QB5A 2WC1A 1CJCA 1Q1QA 4BU0A 4QELA 2GD2A 2X0DA 1JV2B 4MGYR 5JAZA 3CKYA 5ALUA 3ZIDA 4HNUA 3I04A 5IZ4A 2ECPA 1G3QA 3GUUA 2NPOA 5A0TA 4NV3A 2PH1A 5IN4A 2R62A 1KI3A 2KLHA 3AJ9A 4PC3A 4I2VA 3CZPA 1LPBB 3OJCA 1U8TA 4X5OA 1I7DA 2XYRA 2A6PA 4DJEC 3RO7A 3ZGYA 3PK0A 3HP4A 1AKYA 1XTTA 4I55F 4WT7A 3TFOA 3IP9A 3UGQA 3C6XA 1FQJA 5JH7B 1ZXXA 2A1TS 1I94B 1JXQA 2ZRIA 3BE5A 4H1VA 1LPOA 3KSBC 5FI1B 1ZNQO 3I9V1 2J07A 3CRQA 2EF0A 3BRCA 4PSKA 1PGPA 3G9ZA 3X1DA 1VZ3A 3ZIUA 1WMAA 2RI6A 1WKCA 1C4KA 1GGEA 2QN2A 3LW7A 1UZAA 1E4EA 1T0BA 1SZPA 1WPGA 2F1RA 2GPTA 4KLNA 2P62A 1UJ2A 2D1SA 5DHSA 4ZQHA 2CDBA 2C2BA 1Q77A 4ZVKA 3WIEA 3A9UA 5C37A 4NMHA 2XB6A 1YRAA 4QDZA 2P9YA 1F0YA 3ZW8A 2QUIA 2GZHA 4LCEA 4F4UA 1FCJA 2FRDC 4PFJA 1LTQA 4BV8A 3TW6A 3H05A 3SYKA 2IYUA 16PKA 3GL9A 4KR9A 5AVOA 3ANXA 1Y81A 3V2IA 3L41A 1EFDN 3PDUA 1K7FB 1F8GA 1IZ7A 1WPRA 2GI4A 2VNJA 2VDRB 1NR7A 3LU1A 2WNIA 3QRWA 1GSIA 2AOUA 4AULA 3A7DA 3V9PA 4MP6A 2O2XA 3AEKB 4FOPA 4L27A 3H18A 1Y6RA 1SHJA 2CGEA 3G0CA 4GPIB 4YAEA 1PFWA 1RKQA 1RRKA 3CUKA 1XFDA 2Q5IA 3HJAA 5H4HA 1S7GA 3AUYA 3NEYA 4P84A 4YRNA 1I2DA 2WB2A 2E7ZA 3A32A 5JSZA 5GJBA 2O52A 3BXPA 1NUAA 3K6JA 4PRLA 5EHXA 4GUDA 1OAKA 2E0IA 1DQSA 3REGA 1XSEA 2G1AA 1HKHA 1RPAA 3AEUB 3QG1A 1Z6ZA 2QM8A 4RZIA 3WKEA 5CEFA 2C4MA 3CQ9A 3P9PA 2HFJA 5LDHA 5C52B 1JLLA 1U9JA 3AO0B 4ZAFA 3BWMA 2PLFA 4AG3A 4S1VA 3FB1A 1WXHA 3PX2A 3MYRA 4B6QA 4QLOA 1Z7YA 3MGBA 3P9IA 1I5RA 3B3QA 5G1NA 4F7DA 1MIHA 1U8UA 4QXAA 2NUTB 2ZIXB 1Q1EA 1EM8A 1IQPA 4ZU1X 5M5BA 1KAMA 3TH5A 2FPMA 1PGQA 3DOFA 1VI2A 2H4ZA 3VPXA 3CE9A 1QYRA 5EJ7A 1RZUA 2FFAA 2IW3A 3L4SO 4MAFA 3IEIA 3LXXA 2GEKA 3KLPX 4NDNE 3S5JA 3ZDYB 3DOJA 5IXJA 3TPCA 1VRVA 3IE1A 4DF3A 1YB2A 1BHQ1 5DVZA 2YFKA 3S2UA 1IZ8A 1JXMA 1Q7EA 3AM5A 2JJ1A 4MR7A 5BVGB 5I5EA 1GG5A 3AKYA 4ZKEA 1TC1A 4PYLA 1XAJA 3KR9A 3W3AD 4PVDA 3KE9A 1P62B 1IH8A 3ANMA 3FRIA 5BSHA 4GAEA 4KZKA 2J0EA 1SOUA 1VL0A 1Z18A 2OTCA 3PENA 4LIPD 2EJCA 3LX6A 5BXQC 3X2FA 2AXQA 3KUCA 2O2IA 3GLFB 1TMGE 4FHEA 3X1WA 4RPCA 1WSWA 3QOWA 1TEVA 1QCCA 5J2UB 5COBA 5DPMA 3K5WA 5KTYA 4MQMA 4N01A 4O4IB 3K8OE 3VJMA 4R16A 3JX9A 1U6KA 5BNZA 2MDTA 4P5EA 5HMLA 3PCXA 2JGEA 3V5NA 3K0KA 5DYGA 2ZB2A 4PS1A 1KDTA 4F4HA 5AVQA 3MM4A 2B8NA 3TLKA 4BKMA 2B1QA 3LCUA 5FWAA 1B8NA 4F3TA 2X8JA 4K8RB 4WBNA 3H1TA 1C7IA 2O54A 2Z58A 4ZV4A 1RJ9B 5LOVA 5LSAA 2UV8A 1V4BA 1X7YA 1VHDA 3GGGA 1C41A 4L50A 3BXGA 4DIFA 1Q0RA 1T1IA 2WVJA 2IP2A 1U7DA 3S28A 1IWBB 3L0BA 2IHZA 2IBTA 5DGHA 4Q3KA 3FF1A 4POAA 3W1WA 2RGYA 1CDEA 5EE0A 2J67A 1E9VA 2JIBA 4RJLA 4LF4B 4IDUB 1MOPA 4YXFA 2VJAA 1R9NA 4X0EA 3NVMB 2VBIA 1H4QA 3KG2A 3TINA 1RTTA 3NJ8A 3U44B 1N9GA 3D9QX 4YRLA 1GPNA 4UMEA 4DNOA 4KXXA 4FB4A 4PAGA 2JIPA 5BN3A 3ZU2A 1MJGA 1W52X 2XBLA 3NHJA 4PYNA 5BSEA 2E87A 4ED9A 4V0ME 1PG5A 1QPZA 3TUJC 5H59A 1GITA 1OKKD 1GR0A 1I6WA 2JI4A 1GPH1 2GARA 3ZKWA 3D4IA 3ZE2B 2JGIA 5DLQC 1CQZA 2J33A 4ZJPA 5DP2A 4MUIA 2TECE 3L0DA 3W8RA 3V3TA 2QU7A 4HK4A 3T9FA 4CMJA 1V9CA 3QELB 5FL7A 4KGXA 1QHSA 3N70A 1DKUA 8OHMA 2NO1A 3V2HA 2Y6VA 1P77A 1DTWB 2EBUA 5HCNA 4H17A 4QM7A 2A35A 4Z0PA 1VECA 2A8YA 2Z8YA 4PQGA 2P4UA 3OE7D 3HYTA 4H16A 5L6LB 3OIGA 4YVFA 5ELXA 2JJ2D 1PV2A 4R7ZA 2VWGA 4YCAA 1P81A 2P4HX 2PGAA 4YEDA 4AQDA 2VHXA 4F45A 5CFNA 3JWGA 2Q9CA 3BXEA 1ZX1A 3KPJA 5GY7A 3VZRA 4BNDA 4D3FA 4KGDA 1EPUA 1J0DA 4M9ZA 3EGDA 3HP7A 2BBWA 5KTKA 3VU0A 3OCYA 4FD2A 2GKSA 3I9MA 4JMLA 4C4RA 3HBMA 1JFFB 1GGHA 1Y5LA 4N5MA 3PUIA 1N1MA 2VHCA 3DO5A 4ZIRB 3P20A 3ZTYA 3HKBB 2QLLA 4MOWA 1UINA 5I9IA 4WK2B 2E49A 4ATNA 1U3TA 3EXHC 4JLNA 2PV7A 2X3UA 5CAEA 1UKBA 2POCA 1OX4A 5L8VA 3DJFA 3PKZA 3L7YA 4ZOLF 3BTVA 1AU9A 3AEYA 2P9FA 1N0UA 3B1WA 4L9WA 5KTMA 2BSQA 3L6DA 1A2BA 1QRSA 3OIWA 4DC9A 3RU2A 2R8OA 4KNYA 2COEA 4UOEA 5FPHA 1RRGA 1KMHA 3PC2A 3U62A 1QP4A 5B6IA 4IDEA 1I7QB 1UT5A 1ORHA 5DNEA 4KACA 4MLPA 1UC9A 3HBFA 4W8OA 2XXAB 4NS1A 3FNBA 4NY1A 1HT1E 4J3FA 3QK7A 2C88A 2QTAA 3RNLA 4K0RA 3O4GA 2E5WA 2FSIA 1CUAA 2E82A 4IHAA 3UYLA 4ZOQI 5KEIA 2FDCA 3PL5A 4AF7A 2QAGC 4J2OA 4JYCA 1RAAA 1IM5A 3GYGA 3V7FA 4CU2A 4HMPA 3PEEA 1U0BB 2YCBA 1Q1BA 4IZHA 3E84A 4C0WA 3RG8A 3SLGA 3GRPA 2CE2X 2DUWA 1TM5E 4UC0A 4ARCA 3JCZA 3OVMA 4ZEXA 1L7QA 2NAPA 5HKOA 5AFSA 2K4MA 2Q3BA 1UWVA 4ZV9A 2QE7A 2WHPB 3U48A 4ZZ0A 2SKEA 2DPHA 3QIVA 4BNNA 2BL4A 5GM1A 2H31A 3IRVA 4MDFA 4HTAA 3QVXA 1HNZB 2G9QA 2OZPA 4DR3B 4LMRA 4P3KA 3WJ7A 1DX6A 2H51A 2CLCX 4N9WA 4WK4B 2KYRA 5ALHA 3ELWA 3OJEA 1EJ0A 4LJAA 5FADA 5KS2A 2RHBA 3DCIA 2FB9A 2DLDA 3OPMA 2P91A 3T35A 1RJFA 1Y6ZA 5DMXA 3BQ9A 3RC1A 2I3AA 4OQQA 3VPGA 1YGPA 5L6MB 2R4UA 3HWWA 4RY8A 3ICEA 3Q6NA 3A3OA 1IFXA 4AJ2A 4QFMA 1U2GC 1QSGA 1KYXA 5HYVA 3AI7A 4B3IA 1PN3A 9ATCA 4EABA 2HU7A 5ECWA 3LQFA 2FFJA 3BJMA 5AW7A 1SBTA 1W85A 3O84A 2V5UA 2PL1A 1QE0A 4JI5B 4U7PB 3ECAA 1OXSC 1Z29A 2OUIA 2MMCA 1NYLA 2QPTA 2CXUA 3DHVA 1OYYA 3GLTA 4RVNA 3WKAA 3AP3A 1L5MA 3SHVA 4D9JA 2QUJA 4C6TB 3KLBA 4B75A 4GVLA 2ZB8A 4X6UA 1GFIA 3AVTA 1FJHA 4IJMA 2YOGA 4H0CA 1D9XA 3FDZA 2AYZA 1T2CA 3IUSA 4TMTA 1T1SA 4GGOA 5IF3A 2XPCA 2NSHA 4WFQA 2YMPA 3E53A 5CA0B 3U4MA 3E3MA 4MKFA 1QC5B 1VC2A 4YAKA 3USES 1CHNA 3KVYA 4ZEWA 1Z22A 3ZWVA 1EK2A 3VR0A 4BTEA 3HJNA 2A7QA 2FQYA 5CM9C 3COWA 3OM8A 4I46A 4QUKA 2BDUA 5F35A 4IXMA 4LXXA 1M8FA 4Q16A 4DILA 2WQZA 3UK0A 1SBIA 5JMOA 3A9VA 1G2QA 1VHQA 2ZJ2A 5JEEA 1AA6A 1TZBA 4EA6A 1SIUA 3ZK8A 1MOSA 1T4CB 3HHPA 4R1MA 4OSPA 1JR4A 3EZ2A 3GI1A 1UBCA 4LZPA 4BHHB 4WUVA 2IEGA 2JLRA 2L18A 3MELA 3R74A 1GZUA 2OE2A 1YDWA 1NVXQ 4GLLA 1XRSB 4WKNA 3V33A 3PDHA 2O7NA 3CUWA 3SP1A 2ATEA 1JBEA 1HLFA 4W82A 1ID8A 2HO4A 4UEKA 1TO2E 2Z98A 3TG2A 3C3DA 1NT2A 3AUSA 3BHNA 4YRQA 3UCXA 3LL4A 3O4HA 4GQAA 4BQNA 3QSGA 1C1HA 4CLXA 1V96A 4K6FA 2M9MA 4PPNA 3CLUD 5E7IA 4CIXA 4HLQB 1EFHA 4ON9A 1NMEA 3QTBA 5CLLA 3VKGA 2FN4A 3FTCA 1XQ9A 3RTEA 2ZYHA 3PUJA 2CDRA 2VJMB 1Z25A 3VC1A 4F6RB 2Q9UA 3IODA 4LG1A 3H8VA 3I30X 3K30A 3OF5A 2P9ZA 5CBPB 5JDIC 3DHYA 2D3WA 5AW1A 3W5IA 1GXSB 3K9QO 3FCXA 4G97A 4ZYZA 4PQYA 2B0CA 4A1FA 2V7UA 3W5BA 3ISJA 1XRRA 3M1IA 1YJ5A 3BWEA 4Q03A 3RDPA 4NDZA 1CUFA 3TRKA 3HNPA 4ZAYA 3L2OB 4AG5A 4AT1A 2OVBA 3BWVA 2V6GA 3OTHA 5JZBA 5LQRA 4KRXA 3MS4A 1Q1GA 3BVPA 2GJ4A 2HT1A 3GOQA 1FW8A 5JTTA 4RDHA 1Z26A 3K0AA 4UHEA 1QZUA 3BMNA 1ZM2A 3PEVA 2DY1A 2XIJA 1NXVA 2WYHA 5A3VA 2O57A 2IZZA 3FNQA 1U4OA 1P9LA 2PANA 1WW3A 2YV3A 3FPGA 4II3A 1Y4SA 1X92A 4M0KA 2ZIAA 1SCUA 4HH1A 1KZ9A 1VLMA 3BJEA 4MW6A 4YJ3B 5KHAA 3ZWYA 1ODLA 4AUEA 2Q7XA 3EH1A 3X1JA 2QD1A 1ACJA 1WXEA 2CF5A 3LBNA 1TLFA 3TLXA 2BYTA 5BYAA 1RZRA 3PUZA 4BVLA 3HRHA 2P6NA 4N5LA 3E9YA 1FS5A 1MT3A 2V7VA 3KB8A 2AFIB 3VSAA 1LLQA 4HLCA 4R9VA 3RVNA 3G2JA 4XW2A 4G81A 3LUKA 4OA8A 1NUUA 3D6VA 2XVYA 4MARA 2FSGA 2G5PA 4IWYA 5KTSA 2ERXA 3UFXB 5TQ0A 1M74A 3UWOA 2Q9AA 2WF7A 3BFPA 4FLEA 3T3EA 3TLMA 1OOEA 1QZ3A 1DOHA 4WSOA 4GQBA 3RIGA 3RAJA 3ZE8A 5A5GA 1RM5A 1SO8A 2QX8A 3RTGA 1YQUA 4Y2JA 1U8ZA 2H8KA 1UXKA 3L9XA 3E5HA 2QL5A 3FNHA 2RHJA 3LM8A 2H57A 3I2JA 5I9SA 1SOWA 1VG9B 3RKSA 2P7IA 2P11A 1N25A 3A7EA 4JBWA 3HV2A 3BIFA 2RCYA 1PWZA 3M4JA 4UD6A 1TEZA 3RVDA 4DM7A 1SURA 4HGNA 1M9NA 4R1UA 4NF2A 5A04A 1TC2A 2AKEA 1WS6A 1P1CA 3EQ8A 4QDXA 1JUDA 3AT1A 3MLAA 4JP1A 4OSOA 4ZWNA 4CQLB 5DASA 4ZCMA 3K9GA 2B21A 3BC1A 3QLJA 1A8QA 4PX3A 4X1KA 4EGJA 4BZWA 3OEHA 4JKYA 2GK7A 5CNMA 4D98A 5MFZA 1E3MA 1T26A 2ZSDA 3U56A 3TEFA 3SQLA 4PLTA 1O6BA 4BC1A 1YA8A 1FDRA 3O38A 3N2GB 3O90A 3ME5A 4H7JA 3OPYI 5GV7A 4X8LA 3RTDA 3D8SA 1BGWA 4JL5A 4MLCA 1CR4A 1XEWY 4EHNA 5B64A 3G2QA 1NQ5A 1PHRA 3I8XA 3CX7A 3KUKA 3NM6B 3QVOA 4G4JA 4A8JA 3LVFO 2MSLA 4G0UA 3BB1A 3PHLA 2VTDA 1KSJA 5LKRA 1W4AA 3GJRA 1NUQA 3FMGA 3ZY2A 2WZQA 1WHTB 3G7NA 1WO8A 5BW6B 2F3TA 2GF9A 1BVYF 3GA5A 4MCJA 4Q7MB 1EQAA 2XTAA 4WY8A 3KZOA 4C4PA 4CFYA 2P9HA 1MPTA 4XVRA 1PNQA 1Y8CA 1EX9A 3AV0B 1JIJA 3V4RA 2C99A 3FW1A 3QWHA 2EARA 2ZROA 4EY3A 3LVBA 4EL5A 2BTQB 1JG1A 1PS8A 1EXWA 4GICA 7MDHA 2HY7A 4Z86A 3PNPA 1ND6A 5ERXA 4QG7A 1MV8A 3ASUA 2EZ9A 3GLGE 1BWRA 1Y5RA 1Y6JA 1YULA 2D5IA 2YIDA 4Y18A 4Y2SA 3N3AC 3JY6A 3MCWA 3AH8A 1D4AA 2DTDA 4P34A 5KYVA 1YRHA 3PNVA 3AUTA 5FTMA 2IVFA 1NBOA 3ZWWA 1MABA 4PO1A 4BEBA 3MBIA 4R7GA 3M9XA 3L1UA 4ZO4A 3LVRE 2C7PA 1H6AA 3U17A 1H2HA 1PBTA 2JEOA 2OK7A 3OFJA 1PZXA 2WYIA 4DRZA 3L5OA 4XJSA 4F3YA 2QRVA 1UP6A 2P41A 4ABYA 4MUKA 5CXSA 5A06A 2BCJQ 1YB4A 3PXGA 5T3UA 5DN9A 3OCWA 1PFKA 4GKJB 3HWX1 3VQTA 2R86A 2V8OA 3PXBA 1LEHA 3Q5EA 2EKLA 1MO6A 1MRZA 1ZH6A 5DBFA 1G3MA 3UXYA 4AY5A 4O8CA 3C4JA 5J59A 2Z5GA 4YTEA 1ZVMA 4X24A 3ZN2A 5AM3A 2X42A 5IT9A 3ZK9A 2GCIA 4HDCA 3SIRA 4BNZA 1O96A 1J8FA 5KX5A 4N49A 1MZVA 4TV9A 4F9GA 1OB5A 3RYFA 1A4UA 4KPEC 3V4PB 1E9EA 1TVKA 2NVUA 3BSYA 2ZJ0A 4HAOA 1E66A 2WWVD 1QZZA 3L93A 3O0TA 1EGVB 1I36A 1XDDA 2JIDA 1A5BB 2YVQA 2OD7A 1JIIA 2ZJ6A 3LDFA 2OCLA 4B43A 2QRMA 5MFPA 2GB4A 1J39A 1ESCA 5JZVA 2I65A 2XZLA 2Q8NA 4KXWA 4Q1DA 3SI7A 4Y1FA 5IF9A 2AVNA 1NP3A 1QX4A 3F6PA 1W75A 3L8YA 4BO5A 5D2CA 4CCSA 4D02A 5DBGA 4EB8A 3EUFA 4JENA 5FQNA 4D8WA 1DRWA 4UZFA 4KQ9A 5PNTA 1Y7IA 4UM7A 4BPRA 2JD2A 1JU3A 3C74A 3W7VA 3AF6A 1CRWG 3CRZA 3U13A 2A9QA 2R751 1QOZA 3HU2A 1CUIA 4M2LA 3NGMA 4PYQA 3WFJA 1QHHA 1NI4B 4QUHA 4U5XA 2C54A 2LBPA 3Q2OA 4PPGA 4QTUB 5U4QA 1BKYA 1O77A 2JJQA 3KQSA 1ZD3A 3WL7A 3KQTA 3EC7A 3NP9A 4WCVA 5SYAA 1OYVA 2YMLA 3IIKA 3UXMA 1MXHA 1SK8A 2BKUA 4KQGA 4PXSA 4WEOA 4D9GA 1EZ4A 2HJVA 2ZFUA 5K0GA 1KMCA 3H1GA 4MR9A 1XJQA 3GMSA 4JIGA 4XIGS 2VT6A 2F67A 1C0LA 1OC4A 3B1KA 3IDFA 1YAJA 1RZVA 2W6IA 3KXDA 4NEHB 3COZA 5KDOA 4TZ6A 2VDMB 4BJ1A 5HJ5A 2R6R1 5JC8A 3HA3A 1NXPA 2GZRA 4V0NA 3KVRA 4D3DA 3R9XA 1B00A 2VJCA 1H5UA 3BMOA 4FMCF 4BU1A 4OF4A 3IXLA 3MGAA 4YRCA 2IV2X 4NOMA 1AUXA 5TT0A 1NPDA 1I24A 2QGZA 1L5WA 1EFCA 3LSYA 4ALJA 2B1RA 2KQUA 2QZ9A 3W9SA 5LPNA 1KGDA 1WVMA 4EF5A 5HF9A 4FGWA 4PFQA 1YS1X 5LXTB 2HREA 3AGQA 2IPOA 2PU7A 4X20B 1EFRA 4PLYA 1UP4A 2X58A 2ODEA 2FMKA 3R4VA 4BP8A 1H22A 3KJQA 3E9DA 5HW0A 1APBA 3IP8A 3FVQA 1V45E 3WB9A 2Q3JA 2XD9A 5T3YA 2XTJA 3OP4A 3M5DA 1OZ0A 3KWFA 4P33A 4QULA 3MPUA 5EZYF 2JA2A 1TIKA 3MUOA 4LDPA 4Z1MD 2P9BA 5K4HA 4MA0A 2QG6A 4CZ2A 3KQUA 4MV1A 3WRXA 4BXOB 2Z2JA 2L2QA 1XLTA 2RKBA 1E6LA 1XXHA 2DPGA 2QN9A 3KFXA 4S1PA 4TT8A 1JDUA 4G63A 2P35A 4LWOA 1N2XA 2DWPA 2WU1A 4E7PA 2NUPB 3B7GA 1XF1A 3RNOA 1MKYA 2FSVC 3ABRB 3P0IA 1FP1D 4FGZA 3C39A 1E2JA 4HUTA 1ZQ1A 2ZJOA 3H0KA 1RWOA 4WZBE 2QTMA 1K3TA 2P79A 1JHVA 3UAVA 5FPYA 4O2LA 2PT5A 1TEHA 4GPZA 3GCGA 4JT2A 3A11A 3C3CA 4I3HA 4DNPA 3RAFC 4HXYA 2JAPA 1YUMA 1E9BA 3AF1A 1EGHA 3WLQA 4L6IA 5JCXA 1RMQA 3S2YA 8ATCA 4LJ7A 2ZBEA 4Z3DA 5E1MA 5KNDD 3HCRA 4NYMQ 4MSUA 1AKRA 1NR5A 1TO1E 3KJZA 4G67A 4NPCA 2J30A 2V8BA 1DC3A 3BYZA 3JALA 4RENA 3UOGA 2B1GA 4E5SA 5TLSA 4TOIA 1QF6A 2A0XA 2NSYA 5LN1A 3CE6A 4M54A 2B8WA 3BKWA 3E9QA 1G20A 3N28A 4K6OA 3HL4A 4TTRA 4MVJG 4V0KA 2E89A 5K8CA 1JPVA 2ZR0A 1J20A 3G9QA 5LUBA 1N6PA 1EUDA 2EBWA 3DZHA 1CQIA 2J7PD 4IVNA 4OV6B 4FNOA 5IU6A 2GZDA 1XPRA 1DV1A 2NU6B 3GEGA 2J3EA 1FFSA 3QEMB 2Q6VA 1YS2X 2A2ZA 4AMVA 3H4MA 1DG1G 1JIUA 5CIQA 3VPSA 2ACEA 5DTRA 2YICA 5CDYA 1KH1A 3H3XA 3EHEA 2Z2YA 3JQFA 2OBNA 1EB8A 1R6VA 4OM7A 1UKVY 4YQEA 5IN5A 3WKCA 1ADJA 3IAM6 1VPEA 3CVUA 1ADCA 1N1GA 1PQPA 4D41A 3WDLA 2O8DB 1F3OA 4B8ZA 4I3FA 2Y2UA 4H4DA 4LCJA 1NAHA 3GARA 5B36A 3BKXA 1ODIA 1KL7A 1IHYA 1YJAA 1BCSB 1YS6A 4RTLA 4C2UA 1L8OA 3JQ8A 3IULA 1P2GA 3BIJA 3P9SA 4MIOA 1TIBA 1P2SA 4KR7A 2QLBA 3HZZA 2VJOA 1GV0A 1IM8A 5EP3A 5LWQA 5F77A 1Y1RA 1Q50A 3JQBC 4MLZA 3IEKA 2C29D 3UNXA 4TTQA 2OXFA 2PFKA 3R0IA 3VKHA 3Q3CA 4S1NA 3PNQA 1P0FA 1YK1A 1FF9A 1D7AA 4OGWA 4FYJA 1UZMA 1DV2A 1X86B 2BJWA 3NHSA 1UKEA 3ZLAA 5LQAA 1JS1X 2I71A 4HFNA 2WSBA 4ZD6A 1NY6A 2PLNA 3R7SA 3LBAA 5LZ8A 2DQSA 3B2NA 4EFLA 2GAAA 3GPIA 1KC3A 1TLTA 2HQ1A 3JD2A 2WIAA 3OJOA 3M5CA 4HWTA 2EW1A 2FW6A 4JFAA 4NI5A 2ZREA 4RK0A 4Q47A 3ZD8A 3KYIB 1G3RA 1I8TA 2NX2A 2Q0QA 3E70C 4P83A 3KOZA 4RE5A 4ZQFA 3UKJA 1AMNA 2YNMA 3N2EA 4FUQA 4K88A 4KMSA 1ZHHA 4CV0A 1ZUNA 2ANCA 3T7CA 5J63A 3SF0A 4MUHA 3OQIA 4XUCA 5IMBA 4F84A 4XM2A 2VJQA 4DQUA 3GEMA 3H1AA 4MWTA 2R48A 2WSIA 3VTZA 3WKDA 5CXUA 3EVAA 2B99A 2C2ZA 4IMRA 2DSNA 4Z4HA 4OGKA 2ECKA 2VR1A 3PX7A 2FK8A 5FO1A 1NQXA 5A5VA 3A1DA 3IPRA 3AP1A 4ZQCB 1VG8A 4BTVA 4XRGA 3P5BA 2XYPA 3VR5A 5MN6A 2O19A 3GF4A 1BTOA 3SSAA 2YWCA 3H9UA 3NBMA 3WLOA 3SQDA 3I9NA 2AOUB 4NR0A 3I58A 5DM1A 2ZUCA 4CT4B 5FFNA 3IO3A 4JZYA 2OOKA 4YMWA 4IRUB 4HFJA 3VR5H 5BUSA 5JDCC 1DIBA 3SR4A 3COVA 2P3OA 4YONB 4V1CB 4RHTA 3CF6R 4KCGA 1TJNA 1A27A 1JE0A 4GH5A 3AB3A 5J5CA 1VSVA 4JBNA 5CFOA 2Q3EA 4OHUA 1QIIA 4W9NA 1Z82A 4LUCA 3ESCA 3IDSA 1CEEA 4YAUA 3OLVA 3LTEA 3C6YA 5AESA 3RUHA 1IBCA 2CZCA 2VSYA 3EB9A 3KSAC 4N41A 4J0GA 1JLLB 1WKVA 2QMZA 4G5HA 1IL0A 1G4AE 1R5BA 3JD0A 3OICA 1PEAA 5F76A 5JFOA 4FCTA 2OWDA 3DBRA 1X38A 3HB7A 5EKSA 4HDOB 5DGXA 3W34A 4YX9A 4AO7A 3QFTA 2I2WA 3GB9A 1LF5A 1SD5A 4QUIA 4WVFA 1EM8B 2R11A 3GAZA 4OGGA 3NUZA 2QW0X 4TWIA 5AKLA 1JN0A 1NBME 2A9JA 3F3KA 3HJRA 3BAFA 4RZSA 1WRBA 1MZPA 3HUFA 1HT0A 2J6IA 3V48A 1NUTA 2BELA 4DIDA 2J9XB 4F12A 4JJ4A 4O3MA 2GYVA 5TXGA 5IJZA 4Z9FA 1FTYA 2JFUA 3I01M 1GZ6A 1WNFA 2CVZA 3F0TA 1QG0A 3G8CA 4IL5A 4MR7B 1E92A 4DLTA 1GPYA 4FGUA 4KO4S 2WJPA 3VAZA 1BU5A 2F8MA 1C3JA 1PIWA 4NBKA 1Z0JA 3IIEA 5DT2A 1RLMA 4Z2YA 4L0DA 3V7WA 4UNRA 1M1YA 3HYCA 2FETA 2D3TA 3CX6A 3E1SA 1QRRA 2W22A 3PLNA 1H6BA 1KZHA 4A10A 1QG4A 3CPSA 2HMYB 3LYUA 4ACAA 1PDOA 2FOLA 1ZIOA 1QIJA 2FR1A 1Z6PA 4RTKA 5IH7A 1DRUA 1R37A 1X2EA 1O2DA 3NDPA 3LG2A 3KQQA 2D06A 1GTVA 2KBEA 4Q9AA 4YT2A 1EDOA 4QC2A 1NU8A 2WFMA 5JS6A 4AJ9A 3WGMA 1GZDA 3I6QA 3S6JA 4K05A 1C3EA 4WNYA 1WB5A 1EGMB 2JG3A 1EP1B 1GTZA 1OTYA 1G8YA 2DUUA 2P9JA 1EP9A 3OCUA 3OUTA 3PWKA 4UFNA 3ZZNA 4BAUA 2D13A 2OCDA 1N0WA 3HFSA 4NH0A 3I76A 1CUYA 1WUHS 1GQYA 2IHBA 3QLUC 4GSLA 2FZEA 4HQFA 5A4MS 2QOEA 1M2JA 1SVLA 2DUMA 2X8JB 4EPYA 5BSFA 4UCQA 3D3JA 4WBNB 2WU4A 1AM4D 1DHRA 2OGWA 2PX8A 2HKIA 1PT8A 4QBTA 4TXHA 1W1WA 1CUZA 1Y1KE 2RI0A 2VT3A 3M0EA 3QF4A 1X7YB 3ZV6A 4WY2A 4J6EA 5ALWA 3RPEA 4JJ6A 5D01A 4MPJA 4KP7A 3EJWA 2Z4TA 3MGGA 2H2HA 5G40A 3IJRA 2ZRBA 4JGIA 1VJ1A 1Z38A 3FROA 3GDWA 4I5FA 2P65A 4AJOA 5JJ5A 1XNRB 1BEEA 4K46A 3ZYZA 4NK5A 3H6GA 4HQ0A 3TOCA 4S2UA 1PBNA 4ZRNA 4KPFC 3WQRA 3RS0A 1N9GB 3CXUA 2UYGA 2O1SA 3LZ6A 4P54A 1KFBB 1ZGZA 4Q05A 4J4TA 1MD9A 3B13B 1FLNA 4FT2A 3TZCA 5BN3B 2WWYA 1SOAA 4G5GA 1PR4A 1RXEA 4JEMA 4GKAA 1YU6A 3FCAA 5DXAA 1GL7A 1ZLXA 3C6KA 3EEOA 1QX3A 2JHGA 3ZCTA 1XMPA 1USIA 1Z5ZA 1G7RA 2ZJFA 3HBNA 3MWLA 3ZKWB 1TCUA 4HNAB 1GQSA 2DM6A 2HHJA 1H2YA 2L19A 5L4LA 1CCWA 4HLDA 3VBCA 4HVLA 2PUAA 3H5LA 3U7QA 5ES3A 3QWAA 1Z8HA 4NZOA 2IS2A 2AF3C 4RLSA 3ZR4B 3MRVA 3K6KA 4LV6A 1CFJA 1HH4A 5CK5A 3RKRA 3QLEA 1VYUA 2DPXA 3F3YA 2QBYA 3IT3A 2PUGA 2NPIA 1OAOC 2Q6OA 1Z16A 2HRCA 3ZY5A 1H0RA 3B1YA 5AKIA 3RREA 2EZ4A 1RLOA 1QQ7A 1VYTA 3CMCO 3K2BA 1I7LA 1QF7A 3BD7A 3ZWNA 3MAGA 2W71A 2A0FA 3S1AA 3L8GA 4OYLA 4FGSA 4OXYA 1T29A 1UDBA 4P86A 5FOTA 4CR7A 3MS2A 5IJXA 1N36B 1SHZA 2I4RA 4KIGA 3K31A 5HF5A 1TD1A 2P2YA 4NKRA 1Z83A 2Q4TA 4KMMA 4NCKA 3KCQA 1HO3A 4R83A 1T0JB 4BNDB 4HTFA 4LWQA 3JYHA 3G0DA 1HZZC 4JVMA 5FR2A 3EGDB 4UBOA 1YZ3A 2YW9A 3I39X 2I99A 1FLVA 2ZK7A 3PF8A 4P7FA 5EMMA 4WEQA 2RBGA 5K6AC 1EBFA 3GRCA 3A10A 3LUHA 3A0RB 1N0IA 2G07A 2W2LD 4KDEA 1QHGA 1RCUA 4KR2A 3GN2A 3HN7A 1SFRA 3TZBA 2QD4A 2ZJ8A 2ARKA 1YIDA 1GD1O 4D3YA 4JUAA 1K7YA 2G70A 1S3FA 1OHHD 1X2BA 4JU8A 2Q7DA 2CJFA 5CAEB 4EUFA 1OX4B 4BB9A 2H7XA 4LMAA 1C1XB 3A6FA 4H35A 2PJRA 5HZMA 4YGXB 3I45A 1P39A 2JIMA 2V5AA 1TM1E 1OX6A 4JOBA 4IFEA 1W94A 1X74A 4AMGA 1DAGA 1KMHB 2YWEA 3LLUA 3M6AA 4M87A 5JI2E 4TYMA 1JHDA 1QGDA 3WOVA 1W93A 4IJSA 2ID4A 5EMJA 1DAMA 1ZMOA 2BFAA 1LFDB 3DCJA 4XDHA 5ALGA 5BN5A 3WWPA 1DWOA 3PHIA 2XGGA 2WIJA 5FX2A 2VBFA 4UM9B 1Z7GA 2OB1A 3OH8A 4YRDA 3OJXA 2CF6A 4TXMA 4PZCA 1NBAA 4EPVA 1KXZA 3ISVA 4KXUA 3DG9A 4EUKA 1YF3A 2FQQA 4G9BA 4Y2VA 1FUUA 1NXQA 5FA6A 1X9HA 5LB4A 2NU7A 3D6NB 5KINB 3OF2A 3F71A 2B8TA 1VKNA 1PNTA 4JJKA 5GGYA 3TNLA 3ZV3A 2AN5A 3T9AA 4N48A 3ZS8A 1T1EA 3TDKA 4GP7A 4BFCA 1ZYUA 2WTNA 1HORA 2YBEA 3JWIA 5FORA 1JR3A 2QJWA 1MJNA 5BYBA 1PR2A 2NXJA 2QM7A 2R66A 3ETNA 4HGPA 3RIHA 1MTOA 4BFXA 4DIEA 4BO9A 1KAHA 4QXOA 4YPFA 2DBYA 2EKPA 3WRYA 1R0KA 2QDKA 3RASA 4F38A 1PFQA 1QIFA 2I2AA 4RFSA 3Q7PA 5CB4F 1ULBA 3L77A 5K8TA 4W5HA 3GLIA 4ODIA 2VJDA 4X94A 5CGZA 5M29A 2JHPA 4J1JA 4CG2A 1SUWA 3NPMA 2BGLA 1XZIA 3PQ5A 4XGIA 4X93A 5CB0A 2C5EA 2AD5A 3IP1A 4FONA 1RNLA 3CLVA 1ZR2A 4UHJA 1PFUA 1O6ZA 2XNCA 3GX1A 1ORRA 4KAJA 2R9VA 2WYWA 2FDXA 4J7CA 3EMVA 3RHSA 3KYJB 3HP1A 3LOUA 5GQSA 1B42A 1ONPA 2SKCA 2RKWA 1JP7A 1WEKA 4H7KA 5IKPA 3O75A 4NVRA 2P5YA 4ZQIA 1DU4A 1NMYA 2ATIA 4LPKA 1V4VA 4MP8A 4Q1CA 1W85B 4XDGA 3O26A 5SZIA 5TS3A 4FDUA 3GEDA 5GVRA 3NW9A 4II2A 4DEYA 1VA4A 4EA9A 1QH9A 1MJFA 4M8NE 3ROQA 1GG9A 4D9EA 1IY0A 1CZHA 3BMCA 3BWCA 3EJ6A 4HGOA 3VZBA 1SELA 1QGAA 1VLHA 2C4UA 4IH1A 1DQNA 3D6UA 4LRSB 5TVKA 4DCNA 3IQGX 3MFYA 3EUAA 2DFNA 4KQKA 5AIBA 5L3SA 2NQ8A 4TSFA 1UDRA 3FDZB 3LFUA 4KE6A 1J0CA 3TLEA 3U09A 2C7QA 1SXGA 1SB8A 1IQUA 4RHYA 5CPFA 3QPVA 4GKVA 1E5LA 1LTKA 5BSTA 2Y9MB 3JQAD 4K8OA 3TJMA 1Z4NA 5JASA 3H17A 1IC6A 3HQ4O 2AF4C 2IEYA 2ONYA 2VHJA 2Z3VA 3IPLA 4HGQA 1V0JA 1PVVA 2FPIB 4RL4A 4W1QA 4ILKA 3V55A 3WYEA 3DEZA 4TMWA 1MTZA 4ZT2A 2DP4E 5DZSA 1K66A 4MUEA 4PC6A 4X8OA 3P97A 4HN9A 1HFWA 2NO4A 3ND9A 1N5JA 1SBHA 4KR0A 4EW3A 5FP0A 1GAWA 4GW3A 2Z9CA 4IIGA 4L95C 5HK8A 4G89A 4RMNA 3AWDA 1Q17A 4IIVA 5EIOA 1GEEA 2YINC 1JU9A 3M7IA 4B3XA 2XECA 3GAMA 4KXVA 2Q49A 4PC7A 2JCSA 4R8MA 2D5BA 4MV0A 4QPDA 5KO2A 3O9MA 3QSYA 1RDFA 4GM4A 4D8YA 3TQCA 2QU8A 4B6OA 1P91A 2FZCA 5F33A 2OV6A 2ZYWX 1COWD 4TMFA 4QRIA 1S7CA 2B6NA 1O9HA 2Q21A 3K2QA 4LC1A 4A4DA 5CDSA 3IXMA 3PFKA 1F6BA 2MR6A 4J75A 4LYDA 1KNXA 4NV1A 1F12A 2PLWA 4YLEA 2XVMA 2I7VA 1R5JA 4TZ0A 2EYUA 3K4HA 2DFDA 1FQKA 3F5DA 1ZOLA 1DHTA 3BILA 4PRKA 4DCSA 5AVXA 1JDPA 2IXBA 2C0PA 2XNKA 4U1RA 2IHJA 3LZDA 1ZOPA 1KK2A 3CUYA 4GXNA 4IGAA 2J5RA 1H0KA 2VWPA 1QAOA 2FF5A 2JJYA 1C50A 1DIGA 1IBKB 3ZX4A 5B3JA 3N0RA 4EF4A 3CY6A 5IULC 3L49A 3TIIA 5BV2P 3UEOA 5BWCA 4YASA 3GBVA 4DKJA 1Y3FE 3T7JA 1OFGA 5KKCA 1CKEA 4JQSA 1O54A 4ZU6X 1OPRA 3K0AB 1I80A 3T38A 4POOA 2ZUEA 3LHSA 1OFUA 1DIHA 1M5UA 2NIPA 5DM60 1P1KA 3F7NA 1PKEA 4M22A 4F6CA 1RRMA 3OZEA 4FILA 5ALPA 4IGKA 1SCUB 4I4TA 4S05A 1OR8A 2Y0PA 5DHQA 4DR7B 1LRKA 4X45A 1P6QA 4RJKA 3VPDA 4V1CI 3PJDA 4X7PA 1TVCA 1TI7A 1A96A 2E5FA 4HEHA 1T2FA 1YZUA 3JWJA 1ZRMA 1BOFA 3I2GA 3O74A 1KWGA 3VNQA 1CEYA 3IYLW 4PAQA 4DWOA 1XEWX 2CDCA 4ONEA 1GZ3A 2ZE6A 3KRTA 3W2FA 1UEJA 2H5EA 3KBBA 4L1KA 4GMXA 4BWGA 2H1VA 2R7AA 1VMDA 2GA8A 1J90A 3ES9A 2VUIB 2G67A 1WVGA 5TQ0B 2Z3ZA 4TYYA 2P7HA 4D4IA 3G8BA 5F5LA 5A1JA 1SY7A 2Q2WA 3CLRD 2O5EA 4FJ2A 4L76A 5L7TA 3DW3X 2C5GA 1E0KA 2BMAA 1SVSA 3NZEA 4DQ0A 4HVTA 5K3CA 3VYRB 4ZOLA 4Q4AA 2QE6A 1V2GA 4LXHA 1CUGA