5B2EA

N,n'-diacetylchitobiose deacetylase from pyrococcus horikoshii complexed with its inhibitor mpg (acetate-containing condition)
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
267
structure length
267
Chain Sequence
FEDIDTFEEAFNKLLREVLEFDLQNPFKDAKKVLCIEPHPDDCVIGMGGTIKKLSDMGVEVIYVCMTDGYMGTTDESLSGHELAAIRRKEEEESARLLGVKKIYWLNYRDTELPYSREVRKDLTKILRKEQPDGVFAPDPWLPYESHPDHRRTGFLAIESVAFSQLPNFSNTDLDIGLNPYNSGSFIALYYTHKPNYIVDITDLMELKLKAIRVHRSQFPDDIWEKWEPFLRTIAMFYGEKIGVRYGEGFRIMPGLFYHITPFTDLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate recognition of N,N'-diacetylchitobiose deacetylase from Pyrococcus horikoshii
pubmed doi rcsb
source organism Pyrococcus horikoshii ot3
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Putative uncharacterized protein PH0499
total genus 99
structure length 267
sequence length 267
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02585 PIG-L GlcNAc-PI de-N-acetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10320 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold LmbE-like 5b2eA00
5B2FA 4XLZA 5BMOA 3WL3A 2X9LA 1UANA 3DFKA 1Q74A 3DFMA 3DFIA 4XM0A 1Q7TA 4EWLA 3DFFA 3WL4A 2IXDA 4XM2A 4XM1A 5CGZA 5B2EA 3WE7A 2XADA
chains in the Genus database with same CATH superfamily
4XAQA 1HFKA 5JBNA 2GF9A 1XP5A 2FZGA 2WLSA 1SXQA 5E1BA 3V32A 5E1MA 2A5DA 2WP8J 2XQIA 3E22A 1C7RA 3Q3JB 4OP1A 3G8AA 1DAKA 4F8JA 3DZBA 2C9CA 4A91A 1Y5IA 3QTTA 3DV9A 5IEBA 3AVQA 1Z5OA 2ZWIA 4G0PA 5KJ1A 1QG4A 2Y1OA 2DBZA 1WJGA 4MYUA 5CPBA 1K2WA 2CNLA 3WYAA 2HCJB 3BA1A 3LYUA 2PGOA 3W6ZA 3KSBC 1OT3A 1BE1A 1KH3A 2CD9A 3A04A 1C0KA 3JYQA 4MZXA 4V0OA 1RRCA 2A3NA 3V2HA 2KBEA 4GPBA 2EW8A 4LGYA 3PRJA 4K2HA 1ZGHA 3LX5A 3UMBA 3GH3A 3IMKA 3V55A 2ZVQX 3PRYA 1PX2A 1RADA 4FLFA 4RIIA 1E4YA 5DBHX 1U9IC 2CDCA 1OIWA 1M34E 2CBGA 1YBHA 2FZWA 2PUWA 1BRMA 3AP3A 4HKTA 2YICA 1AKWA 3GJ8A 2BZGA 3V33A 4RTPA 1VE6A 4MOWA 3DKVA 2X8JB 5I7EA 4PHFA 5LB4A 3D54D 1L1FA 3KQNA 5CNKA 4V24A 2OBXA 1V48A 1KEZA 3PHIA 5E0KB 3FE2A 2VJQA 5JAHA 4JOCA 2CUKA 3SD7A 1EFRA 4KODA 3THWB 1FPQA 4OQZA 1XQYA 2R00C 1D1SA 1HK7A 2WFZA 2X6QA 2Q4BA 1M7GA 3ET5A 1EIZA 1PL8A 2ZIXB 2R8EA 1F8FA 2UVPB 2ZKLA 3SHFA 3T9AA 3TNYA 1JQ5A 3CEAA 2WJVA 5EGNA 1UMCA 3GHYA 4PTZA 2G28A 3QOYA 5C4IA 1CNFA 1DKLA 3K09C 1Y5NA 3LY9A 3ZYCA 2I2CA 3QF4B 3QXHA 2X13A 3DFMA 3SG0A 4FJ1A 4BJ6A 1YBFA 2I4RA 4B0OA 1BOOA 3HNOA 1L8XA 2BFPA 2NWQA 3MGBA 5EWMA 1JG7A 1QZXA 3OWHA 5JS7A 3K94A 3DEKA 4LYJA 2UVQA 1C4WA 4B5KA 1JR3A 4AWXA 1QCZA 3H86A 3TQRA 1DG3A 1S2MA 5TQJA 2GD2A 3C1OA 4E2ZA 2AUTA 1GNLA 3M6UA 4UZSA 2EP7A 1A50B 2JS7A 2IP1A 4KDFA 1WXDA 2GBGA 3ZDDA 1JDTA 5B2ZA 3F7NA 4M98A 4YV7A 2NUPA 4LBYA 4CGZA 2I3AA 2WQ7A 1RHRA 1T0BA 5EZQA 1P7WA 4IGFA 5BNTA 4FIDA 5JZSA 2XD9A 1Y81A 4YJGA 3WGOA 4DCPA 1UPCA 4RF4A 4BCDA 1ZK0A 1YS2X 3ZVRA 3VUFA 4DUPA 3D2LA 4F04A 1R16A 5CFPA 4HNTA 1EXWA 3G2NA 2GK7A 3Q8KA 5K0FA 5HMMA 4Q7MB 3L7NA 3G5MA 3JPWA 2KMLA 3BCRA 3R6GA 5L7TA 1YKGA 2I4TA 3NWJA 3V8EA 4YY3B 3MT9A 2X2EA 4HH4A 2YL2A 2ZYGA 5EN4A 2V54A 1GN8A 5ITVA 3AWDA 5DYNA 1FK8A 2GM9A 4Q3OA 4Q9LA 1KWGA 5EZ6B 4S1OA 3BWMA 3C3MA 2E87A 2CZGA 3GT0A 3RVPA 3ZCPA 3RROA 1GY8A 5L3RA 3ZY5A 4D9JA 2WB2A 1LNSA 4K05A 2ZI6A 4FGUA 4MKFA 5HJ7A 1WB6A 3IPCA 1C9EA 3NV7A 1KZ1A 2ZITA 4ISBA 4ND1A 4ZV7A 1G6HA 1Z8NA 1T3SA 2EGHA 1Q77A 4J07A 1U31A 1ZU4A 4TKMA 3U48A 3H8SA 3TB6A 2ZS8A 5A6SB 1JA9A 3RLFA 4TSKA 4WINA 4WA8A 3UH1A 3U80A 2O5EA 1ZNXA 1N9KA 4I5FA 4BN0A 1M76A 1E4EB 4J7XA 5JJCA 1GD1O 3E0QA 4OHRA 1L5HA 3WQRA 2D4AA 3PQFA 1QMGA 1ZNYA 1ZWLA 4C7JA 5E2BA 1D2RA 3UKDA 1UH5A 3IALA 5IN4A 3KT8A 2BE7A 3VYVA 3AHEA 2SKDA 1GDDA 2W2MA 5FPPA 3OFJA 3USCS 5AI9A 1VTKA 4FMDF 4O3FA 4CLHA 1D3AA 2GHQA 2BIFA 2YXNA 4HUTA 1WULS 2JK0A 4JJZA 1UT5A 3ISVA 3QFFA 5DK6A 4FOOA 5ALMA 4M88A 1UBTS 1SXIA 3IP3A 1HQDA 2C9YA 3CS3A 3Q6NA 4CL2A 1HE4A 4YGYA 3RCBA 3EQ8A 2OYSA 2EGGA 2KI5A 3LU1A 4CQLB 2ZRKA 4ED9A 1NNEA 2UV8A 1BDIA 1KU6A 3ZH2A 3K0AA 1W96A 1AE1A 2P69A 1QOZA 5DP2A 5TB5A 4BO4A 4DLRA 1Q17A 1ZBQA 3Q12A 2XOKA 4CNBA 4AYTA 1MXFA 3QV2A 4LF8B 4NJOA 3TD2A 1G66A 1W4LA 2DPLA 5CVCA 1DEXA 3CSDA 2C4VA 3T3PB 3KS9A 3ONNA 3NMUF 1ATZA 4UM7A 5CEJA 3DW3X 4EA8A 5I7HA 3AEQA 3LQKA 1RC0A 1R5NA 4BVGA 4QYTA 3IOBA 3A26A 4XWGA 1NYTA 2XWQA 4WXRA 1I1NA 1WKCA 3PPYA 4RQAA 5B6JA 2QT9A 3K8ZA 3N5CA 1C3EA 2PWBA 3GGCA 1LX6A 4FHCA 1HE3A 4UNQA 5B1IA 4EYOA 1GFWA 3QQ5A 2Z09A 4MR9A 1HLGA 3JZMA 4CMBA 2XV1A 1KYYA 1RCUA 1CR6A 3VSAA 4PSDA 2OQRA 1YQUA 2NW6A 1GQ2A 3P0JA 4NFLA 2RBEA 3RC2A 2XB8A 1Y7LA 2QZJA 1F2DA 3TGWA 4CEHA 1HNZB 4H15A 2H4XA 3SPXA 4JS0A 2WKPA 3DZJA 5KDLA 1CJUC 5MN5A 1Y37A 3OIYA 4N48A 1FPMA 2CLKB 5BSUA 2FUEA 1V71A 1CZOA 1XJ5A 1XL0A 2CLIB 1N2OA 3KR0A 1Z13A 5HDQA 3QPWA 1T4BA 1UC9A 1ZW1A 2A5YB 1H66A 1WUIS 1FMJA 2XVZA 3C5EA 4JBXA 4XB6B 3E82A 3TI9A 3EK2A 4DR5B 1KEPA 2PLRA 4C0AC 2NVWA 4DV1B 3DD5A 3VKWA 2PX8A 1V4NA 1CY0A 1PO7A 1TQDA 4CDMA 4EITA 5M3BA 8ATCA 1SB9A 2VJKA 1IB0A 2X0NA 4RIGA 3VHLB 4FEYA 1U7WA 3DZHA 4L78A 4TTSA 4FJ2A 5IJXA 3A25A 4AKSA 2FMIA 5LMZA 4OQNA 4J9UE 3UMSA 4P4SA 1X7ZB 4RTQA 2E4XA 1GQFA 3CEPB 3PHCA 5FR2A 4C21A 5JDIC 4XQ0A 2X5OA 1YIAA 2XRMA 3HGTA 2DQZA 1LI5A 1T9CA 1KZ4A 1A76A 2JHCA 1NKTA 1VI2A 3AXTA 3BZUA 3JYPA 1M83A 3GJ3A 3MCAA 3MWDB 2CYBA 3BMQB 1GSIA 1QC5A 2E4WA 2P2NA 3PX2A 4PZPA 4IIVA 4J8PA 3AHIA 1P4JA 2RKWA 3Q4GA 1E5DA 5ILOA 4MGIR 1NFQA 1N75A 1QGOA 2A86A 1KRHA 3JWGA 3PD1A 4PICA 4XR9A 1LK7A 4CHTA 2YKGA 4JI4B 2G9VA 1GRVA 1S3GA 2K2WA 3A3NA 4DADA 4Q9AA 2RGBA 5ANRB 4G9EA 4I6GA 1SHJA 1I5OA 4M1WA 1WTAA 2CMKA 3IKJA 1YR3A 3LH5A 5CM2Z 4DBLC 2GZDA 1IM8A 3O2SB 1FMTA 4ND7A 5G1OA 3V1TC 1ILEA 4L02A 2O8BA 4NBNA 5B4UA 1A4XA 1EHYA 3VR6D 3ETNA 1RR6A 2IYEA 3WZLA 4LF4B 1OFGA 3RBXA 2AKEA 4Z86A 3VPHA 4FYMA 1P1HA 4L8FA 2IYNA 2FR1A 1MMFB 1WSDA 2PRIA 2Y92A 4EZEA 2ZJYA 2CSXA 5CFLA 4OSPA 1SJ9A 5JLAA 1DC7A 5F51A 2OXEA 1GLGA 1X0VA 1YR6A 2XTJA 4Q9KA 1UCFA 2K87A 2QF7A 3NHMA 2D0PB 2ZJOA 4HGRA 4KVGA 3I8XA 4RPIA 2OOKA 4D45A 2HA0A 1PJ8A 1SOWA 1RYEA 5TPZA 4TTIA 5FD8A 1BDHA 4I5IA 1CZLA 3C6BA 3HKDB 4IFIA 2MSNA 4G1BA 4W7HA 2XUKA 3IAM6 5E6RB 4B4UA 2ID8A 3VZPA 3A9CA 3PR1A 4OKSA 4H1UA 4HP8A 4WLNA 1BA2A 5FLEX 3K92A 3FTCA 2UXCB 1IY8A 5JXIA 1XV5A 3ZGYA 3LFHA 2IWHA 4D9KA 2AWNA 3D81A 1COWA 4LXQA 1UAYA 4IWNA 5ILQA 4BZPA 3NIGB 4PIPA 1RYFA 1THMA 4AULA 4F5EA 1M67A 2GM5A 3UENA 1EFLA 1RXSA 2HBRA 5FLXA 4N7MA 2HV8A 4LQCA 2CMGA 4A8TA 5A4MS 3L5KA 4Z4IA 1CQJA 1DUVG 3WIVA 2CFOA 2ECKA 2NXWA 4CM6A 5BWBA 121PA 3FHTA 2BMAA 2QX8A 3PXXA 3WGYA 4MJ3A 3RAGA 5JMWA 1GADO 3LI2A 4WKCA 1Z7YA 3ZV6A 3LX8A 1FDSA 3GQBA 1COWD 2QTZA 1RDFA 1Z4JA 3HQ4O 4TKUB 4Q47A 3LXUX 2EJWA 1QANA 1C4OA 3A0RB 4CLXA 2JD1A 3FJYA 2RGUA 4M1SA 4RD4A 1WXFA 5LXTA 4UAJA 2ZTMA 3HRIA 4FFRA 1GT6A 3L7DA 2Q5FA 2QJRA 2YRFA 3LA6A 4YP0A 4RV9A 2QJFA 4HS9A 2X3FA 5DYYA 3VMFA 3VZQA 3O1HB 4FKMA 4ZEXA 2H1CA 2DTXA 2BHSA 3O03A 3SFTA 1BNCA 1CEQA 1EMDA 2CK3D 3B1JA 4MKHA 5FV7A 1DAIA 2NTEA 3PBKA 3U49A 1CYEA 3INGA 1GKYA 2ECQA 2ZCVA 4Q9NA 4JXJA 4TSFD 1K68A 4L5IA 3FFAA 4O0LA 5ARBA 4UD2A 2EW1A 4HNAB 2GNAA 3IOCA 3TIFA 1RLUA 1ULBA 3A3OA 3E7FA 3H19A 4RQUA 4U2FA 4B76A 3CUEF 5E7IA 1Z15A 2GUWA 1KDRA 1F9EA 1A8UA 1OBHA 2QOEA 4MAMA 4AZ0A 2R85A 1K63A 1XMJA 1MN6A 3K32A 1QR2A 3R6LA 2D7CA 1MJ5A 3E9EA 4F46A 1CZNA 4REQA 4WE3A 5K0SA 2FZVA 3KQOA 4F6CA 3R0ZA 1E3SA 4LRUA 4DZZA 3PXCX 4BFVA 1KQPA 1VPDA 5DLYA 4UU1A 2OFOA 4FCVA 2AOUA 4BYMA 3BH7A 1KHTA 4O4JB 1QG2A 1TYDE 5K5EA 2P6RA 2FP4B 5L95A 1ZO8A 3HPQA 1VKOA 3IP7A 8GPBA 3C98A 5LWQA 4WACA 4PG5A 3ODPA 4M83A 4FNMA 3ILXA 1OKKD 1U2ZA 2DLNA 1WF3A 3N0TA 3NM4A 3O4VA 4KO8A 4Y7DA 4ZQGA 1C1XA 2CGEA 1MLDA 3HP7A 1UBKS 2BFCA 3FMVA 1AZTA 4OLFA 1BXKA 3QXGA 4C04A 1LVHA 2F17A 2OHVA 4HDKB 1Y82A 2IOQA 3MUOA 3NBAA 4I7EA 5K3FB 1JV2B 4JMPA 4K9LA 3JQAB 1MT3A 3OCVA 1MB9A 1NT4A 4URWR 2QENA 1TT5B 3AUTA 4FYXA 3DBOB 2LKDA 3RVQA 3T5PA 1R27A 1YFZA 1CJVC 1TB4A 3S2FA 4BE7B 4C29A 3FR8A 1OFHA 2W22A 1J2UA 1QM5A 5D2CA 4R2IA 4P4NA 2JFHA 4AO7A 3CX7A 2WYUA 1R64A 5JNVA 1UQRA 3IIKA 1ECLA 4L0MA 4U3JA 1YB5A 5EJ6A 3Q72A 3WB9A 3M33A 1GR1A 1HLDA 4TZ6A 3A27A 4XLTA 4A6DA 1N1EA 3WK7A 1BCRB 2BOVA 1QO0D 1TYZA 2QKYA 3FTDA 3PIIA 4JENA 4JU9A 5SICE 2XKBA 5AKZA 3WGQA 1YTLA 4CM4A 3PL5A 2BISA 4DYHA 2V0GA 2VWPA 1WMEA 1UDCA 2B4KA 1F8YA 4BTEA 1SZPA 1JFTA 2ZIWB 3MTBA 2FWRA 3LVFO 3W34A 4BLPA 4TV8F 3VHXB 2QL7A 4R3NA 4HPWA 4Q3LA 3VYTB 4DLZA 1NYLA 1NIJA 1PZEA 5EP2A 3H5AA 1TTTA 2IPOA 3I8SA 1YZYA 3EX7C 5J59A 1N6PA 2QROA 2RHWA 1AHIA 4FK8A 4H17A 4IILA 3ZJUA 1MD9A 1SHUX 1Z4PX 1KRWA 4IHJA 1IMOA 1AU9A 1MC8A 1RQXA 5D6NA 4RORA 5KNCD 5KOJB 3TDMA 2XMPA 3F4KA 4V0SA 1VECA 1RQRA 3EFBA 3IPRA 4KV7A 3ZWBA 5K6RA 2W4QA 4WEOA 5EJ2A 2CFRA 3AM3A 1R0RE 2P9FA 3MCVA 4MQBA 4CQMB 3PNKA 1MFZA 4D9BA 5L4SA 1HF3A 1MDFA 1VL1A 1XQ6A 1ZIPA 2O1XA 2FUG6 2YHBA 3T3GA 4OQXA 1MA3A 1SQGA 5K20A 4NBWA 3WLJA 2DMRA 4Q3DA 2INGX 3GO4A 2Z4TA 3ERCA 1E94E 1A8QA 3E5HA 3G82C 1GU7A 3O0DA 4G85A 3DLIA 5FIUA 1OF1A 1DX6A 3A6DA 1DIAA 2B82A 5A0TA 1IONA 3MJEA 4HEA6 1Q0RA 1YU6A 3I9KA 3TTUA 3RVRA 4JC8A 2I22A 1FMCA 7MHTA 3DFZA 1PRYA 1SG0A 5DISB 3EWNA 4GL2A 4EHHA 3BD7A 5H5JA 5K8CA 1ZOIA 1JIKA 5ISMA 1A96A 2I8CA 3FOWA 1XZEA 2ORED 4QOSA 1XPOA 4IXWA 4R2LA 1RP7A 4I2NA 5FWYB 1R00A 4TTJA 2HA5A 2PX3A 1P0MA 3T4EA 4CN9A 2B8WA 5BORA 3D6NB 3VGPA 3ZZ0A 1I0ZA 2YV1A 4NBUA 8MHTA 2BMJA 4C4PA 3BGVA 5E3HA 3DG9A 2AFVA 2X2PA 3EPLA 1SCDA 2AOTB 2CYAA 2H5JA 4A6EA 1FRQA 1DCTA 2GBLA 4GMXA 4GSKA 5I4IA 3CCBA 5C53B 1CLEA 4BFLA 1Y42X 1NJFA 1L7VC 1JHVA 3Q7PA 2QAJA 4K6OA 5EKXA 2PLWA 1E6MA 1GCOA 4D9NA 5CDTA 4BAUA 2E37A 1NUQA 4NYMQ 3RFXA 4AX8A 1KJ9A 1RWVA 2AEEA 2P62A 3IHKA 1ZCZA 1U7TA 2VP6A 2OT3B 4NR0A 5KSOA 5CLIA 1M75A 1SBCA 4JKIA 1RE0A 4P81A 5DLDA 2GBFA 2MIIA 4DEXA 4JI8B 4N5IX 4OLJA 4U2KA 1I3LA 2Q62A 1EK2A 3N7TA 1YAJA 1Z7WA 4FDLA 1ZD4A 4MITA 1WQ1R 3C7KA 1EI9A 3FNHA 4DG5A 5EJ9A 3WA7A 1VZ3A 4KXWA 3R7SA 5DLPA 3FDZB 5AW2A 5AD1A 1O2DA 5C8ZA 1PF7E 3AVXA 3R7LA 2I6GA 2DKFA 2H2IA 2JF0A 3EXEB 2PV0A 3DDOA 4HDMB 4TTTS 3TNDA 3ZXUB 5BWOA 1Z0ZA 4BTLA 2UXBB 1E9FA 4X62B 1C9DB 3F3MA 1A9TA 4XJVA 5K99A 2MSWA 3Q8XB 5REQB 4RTJA 3KYCA 4RF2A 1E20A 4QREA 3LL4A 2XXAB 3CXUA 4QJBA 3UWPA 1IQUA 1XRJA 4OIFA 5EMNA 5DM2A 2Y93A 3KETA 5LMUB 2XZDA 5ARCA 3VTAA 3IIJA 1PL0A 1LPPA 3DNMA 3G2MA 1BJTA 3KVVA 2PMEA 5I7VA 3QKWA 5KPDA 4FN4A 2VT2A 1EX6A 1QH0A 1I6LA 1GGHA 3UZUA 3P2EA 5K0TA 4ZGGA 5G53C 3FI0A 4ZVNA 3F7TA 3FNBA 1VBMA 2C2MA 3IAS1 3SDBA 1E58A 1OUMA 4XM0A 2GZHA 3PYXA 1CRZA 2P2ZA 2ZRLA 4E1VA 3VKHA 2VDUE 1FOEB 2J67A 4HMPA 4M9ZA 3EWIA 3IKTA 1ISPA 5PNTA 3BGOS 3MFYA 3OE7D 3KKQA 5HILA 1C9KA 3CX4A 2J85A 3S6JA 1AKUA 2XE6A 1OLXA 1PNTA 1Z35A 3WX0A 2PUDA 4P7KA 2R7MA 3KVOA 1M3SA 4R3UC 4BQEA 3G8YA 1CQZA 1U2GC 2I03A 2PWAA 4MVWA 4I55A 4Z0TA 1P39A 2NT3A 1LH0A 4KOEC 3T9DA 2YXLA 1ADCA 2BDEA 5I6DA 4Q6BA 5KTPA 2X23A 1J1ZA 3L92A 2PL1A 3N2GA 2CMDA 1VPVA 4D81A 4BVAA 2XTNA 3P4YA 4BX9A 3DNPA 4HB0A 3F6YA 1ZGAA 2R5WA 1MDBA 1DBVO 2J4DA 1MW9X 4G4SP 4TOIA 3NV9A 3NDPA 4JCOA 3OQMA 3GPLA 2JLCA 3REOA 1T5LA 3VNQA 3PR2B 1Z2CA 1T5DX 1GQOA 3RPEA 5JSZB 2EFHB 5IVDA 4DY4A 3RNLA 2JH3A 1TAHA 4WK0B 4FYPA 5A3SA 2FDRA 4Z7JA 3UJ8A 3MS2A 4CKCB 1XA0A 1OGYA 2X9LA 4M9UA 1K8QA 1H8HD 3B89A 4JVMA 1HM5A 1KSGA 5LQUA 2WSSA 2DECA 1Z4OA 1YS7A 4U0KA 5F77A 4CTNA 1C30B 4G6ZA 1O57A 1X8XA 5NULA 3U7EB 1B0UA 2CJXA 4CKWA 1JMYA 1E1DA 1RAAA 2VXCA 3OP1A 1EGAA 3OZIA 4JA2A 4BMVA 3ICQB 1GAEO 3CKLA 5HGJA 3V8NA 3UK1A 1T1RA 3CMCO 3UQYS 3ANMA 1HH4A 2YQ4A 1Q7GA 5TC4A 3RREA 4FGLA 3ZK7A 1DKQA 1RPJA 4E09A 1EA7A 3RHFA 3WHLA 4BV9A 3HL0A 1RZRD 1YJBA 1LBIA 3HO1A 1JT2A 4AN4A 1O1YA 4B31A 4US2R 3HZHA 3ZE7A 2VAMA 3EBOA 2CLMB 4IIDA 3MIIA 4TZTA 4NU5A 1N7IA 1PT8A 1Y9ZA 2ROQA 1TUBA 4EYKA 1LBQA 3IR5A 1S02A 2C4MA 1UBSB 2PEZA 3N8HA 5MFZA 3TZKA 2Q6TA 2GJ4A 1FDUA 3DMPA 1SXPA 1AZWA 2EZUA 4JA0A 4DSAA 3S1AB 3FPGA 4F3CA 4ENRA 3VR3A 1RYHA 4KN8A 3LT1A 2J6HA 1WCYA 3CF6R 5MDHA 3GW8A 3NDBB 3IUYA 1WKBA 4NCXA 1OBCA 4QARA 2GAFA 1E59A 4BUZA 2RBKA 3JATA 3RJTA 4AY3A 4W5QA 3CKKA 3T4UA 5AVZA 4MW4A 2QR5A 3H2ZA 1WOMA 4QYWA 3STTA 4FBGA 4ZAVA 1YR9A 5BMOA 2P0YA 4XWYA 2BGJA 2WSIA 2NUAB 3I6ZA 3JQFC 4NMWA 3PXGA 2DY1A 3UA4A 1O7JA 5HQJA 3O8DA 1KMCA 1QLJA 3AM4A 4RD0A 5DI9A 2FOLA 1AQNA 3D0KA 4CUKA 3M49A 1VPTA 1Z37A 1C3LA 3OLYA 3UV3A 1XVVA 3AERA 3GPDG 4YAEA 2M6KA 3UCFA 1F2TB 3B9BA 1WUYA 2OGUA 2B8JA 4M6WB 4PWZA 3CX8A 5B58C 3WRYC 2PKWA 3LLCA 4GMDA 3KPJA 2VKQA 4D8VA 3CZ4A 1JF8A 4DIUA 1EZ1A 1E2DA 3KPWA 3BRWA 3R9IA 1DT5A 3ID6C 3W9BA 5K4GA 4HX2A 5LZ4A 4DB4A 3D7MA 1HYQA 3RVLA 1L4YA 4GXTA 1T5BA 4R1PA 1IN8A 1SC3A 1VSBA 1U0HC 1U4NA 1E79A 2QNIA 4X92A 2BAGA 4WJKB 2P1RA 4FDUA 3GA0A 2PBFA 4G0XA 4JT2A 2YFKA 5GVRA 1WSBA 5JH7F 2M32A 4DFDA 4FB5A 1ESEA 3MWGA 4FFSA 3K16A 4EWLA 4EL0A 1JQKA 1C0PA 1CULC 4JR0A 5BMVF 4I9HA 3QLUC 5AI0A 4Q1DA 3AYXB 1QOQB 3LTEA 5DRYA 4ACAA 4FZJA 5LR6A 4D8XA 2HDOA 4CIBA 2Z6QA 4LYDA 5T3UA 2AMVA 1X1TA 3O8OB 4I81A 3JD4A 3O75A 4G97A 4OMFG 4ZJYA 5A3JA 3I62A 2HWWA 3SC4A 4HRAA 1FDTA 1D03A 2GK4A 3S2UA 3EQ7A 2OFFA 4YC7A 3R20A 5A02A 1H9AA 5D87A 1UBMS 2GWRA 1Y33E 4RM3A 4C03A 3CF0A 1E8DA 3E2IA 1AGNA 5DP1A 3WAJA 5JSUA 4TYWA 1G1MA 4JOQA 3DFUA 5AICA 3WADA 3S8MA 4EHFA 3QIVA 3ES9A 4LYGA 4QULA 1NV8A 1XQ1A 3EF3A 4PCVA 2GEVA 2O54A 3TR0A 2IXBA 3C3EA 3ABIA 2AJ8A 4TWAA 4AZ3A 2C96A 3GC6A 1RJ9A 2PKCA 1KMHB 3CW9A 3WIEA 3RSZA 1CRPA 4X6XA 3WL4A 1OWMA 3MYRA 4DARA 3OEHA 3FH0A 5F1KA 1WRBA 2P2CA 3PTZA 4YAUA 4TLDA 3HKBB 1Z8DA 3KUDA 1CV2A 5HKBA 1G5FA 2JL1A 1I1HA 3MUFA 3OUUA 1NNI1 4G36A 2WZCA 1PP4A 1G9TA 5DF1A 2BBTA 2VRCD 1YT5A 2ZXFA 3FGOA 1R8XA 5K7SA 3ZWNA 4KLNA 4B0PA 3ASVA 4PHHA 3F6CA 2NGRA 4NOKA 5ICSA 2XMSA 2GF0A 1J07A 2OHXA 1I2CA 1KYWA 1VIAA 1Z82A 1GZ5A 2FP3A 3DM9B 3HP1A 1KQNA 4BGEA 2CCJA 1WMDA 3DYVA 4IGEA 4IUBS 4YP5A 2QRJA 2ALJA 3FPBA 4GQAA 4EI7A 2YYSA 4G1VA 4G0UA 4B33A 4YAFA 3LCVB 5JBQA 4I55F 4RS3A 5A03A 3KXKA 4LJ7A 3OVMA 4G25A 3H0CA 2HMYB 4BJ1A 5AW8A 1HFJA 2P77A 3FAKA 3TLMA 4B6QA 4H18A 2VNHA 2O7NA 2QX6A 2VNKA 2G1JA 2J9XB 3FKSA 4EVSA 1L8QA 4Y1RB 5IN5A 4DWVA 2GJ8A 1SXJA 3R5HA 4G8CA 3DDUA 1O5IA 2C3UA 3BHMA 1UOQA 1Q12A 3AVWA 1O95D 4Y2JA 5KX5A 2VIIA 4Q12A 2QPLA 4E3ZA 2Z6UA 4YJHA 1VSVA 4BC1A 3QZUA 4P83A 2C88A 5A5VA 1ML4A 3OQBA 1HT2E 1G8HA 3FB1A 3NH6A 1L5YA 2YN4A 1TMGE 2YY5A 1UF9A 2XUIA 3TO5A 4RHFA 4CLRB 1ORIA 4YUYA 2P2SA 2EHDA 1G16A 2R00A 2ZRGA 4K9DA 2W6ID 1FS5A 4HNAA 3D1JA 3ZE2B 3KCQA 3GLGA 2GCEA 2ZJ1A 4X3OA 1OHHA 4X1YA 2VP0A 2JLYA 5EJMA 2OCBA 1CZKA 3SEAA 4MKXA 2H4JA 4FFLA 3MD0A 4HDNB 1E99A 2JEYA 2RAPA 2NZWA 3KOWA 1ENYA 1FP1D 1OD6A 1DBRA 2VUSA 3LCMA 1KJYA 3G8CA 4ERNA 3W2GA 2CL7X 1XWWA 2NU9A 4OUDB 1N6OA 1J9GA 3AESA 3OIUA 4HX5A 3VO2A 5LNK1 3RVOA 4W1QA 5C51B 3R41A 3TMYA 1NZDA 3DDSA 1CJTC 2XYPA 3OICA 1USIA 3JTEA 4XUDA 2BP7A 2JGLA 3W5IA 3ZZMA 1ADJA 2B94A 1SUEA 2ZBUA 1KZHA 1LWOA 2V0CA 4YT4A 5ADVA 1ZCFA 2AFIE 5E8JA 1J7JA 4KE6A 1ARZA 2YMLA 4LC1A 5EIBC 2Y2UA 3VJLA 4RSRA 2EKLA 2ZSEA 5IAJA 1DI0A 2FWNA 1WBDA 3NDJA 2IHBA 3DAHA 3DV2A 2HMSA 1ZONA 3N2KA 2AR9A 1YC2A 2D2EA 4JGGA 4W7SA 4XFJA 3UJ6A 2WF7A 3FNRA 3S99A 4MB0A 1DRKA 3E9MA 5KNCH 3WLFA 1PVVA 2PVCA 3ZVMA 3A6GA 1L0BA 4ZJZA 4JODA 1EUDA 1OFTA 2FPLA 3CR3C 4RNDB 1PWZA 2CHGA 2OV8A 3OQVA 4DA0A 3EXHB 3FGPA 2FE4A 2RB4A 3P9NA 3L02A 4M8NE 4DIDA 4CM3A 4DUGD 5LSAA 2J3EA 4DWWA 1X70A 1A27A 1LDYA 2TS1A 3S5JA 1MABA 3AVUA 4R6XA 4BE9A 2YVUA 4WT7A 1AXRA 2P27A 1EVEA 3CE9A 3LX6A 3LQRA 1M2NA 1JALA 2V5VA 1KVSA 4YRTA 3O9ZA 2BDUA 4PQEA 5E3IA 3O47A 5J4HA 4MV6A 2CEAA 5ALLA 1EJBA 1VKJA 4M0UA 4HLUC 4WDQA 2AR0A 3V8RA 4J1SA 2HRBA 1P2SA 2FEMA 1W29A 3O91A 3M6IA 3U37A 1DHRA 1JAZA 4JXXA 2FE1A 2CE2X 2RIRA 1AUXA 1C3VA 1FUEA 2DUMA 2ZR7A 3ENVA 1WB4A 2JPDA 3HJUA 2JIBA 4JR2A 4HYTA 1HA3A 4TSFA 2AG1A 1QPBA 5HM6A 1L4BA 5LYYA 4UBOA 4KRFA 2YJ3A 3RTBA 5JISA 4Y9DA 2J6BA 1LQ2A 1SK8A 3K20A 1N2IA 5FADA 5BSVA 3JQ9A 3OT1A 2NU6B 2PIDA 4ILKA 4URYR 2XBMA 1NM5A 2CXNA 4BWFB 1F8UA 4F7WA 4QBHA 3I05A 3BX1A 2E4ZA 3BL8A 2W6NA 3AH8A 3IV6A 4GMGA 5JD5A 1YCHA 2ONYA 4J6EA 2BR3A 4IFBA 3WQQA 4DQUA 3V4VB 3IUQA 1GRNA 1ZC3A 1KP2A 4E7PA 4FFNA 1Y5LA 4BMDA 1JJFA 2AJLI 3QVXA 1KDPA 3L49A 3A4NA 4AUEA 1CRLA 3E9RA 3K70B 4UCQA 3NEJA 5A6VA 2C2OA 5EKDA 2J9FA 2P9CA 3MPUA 3QX8A 1EGQA 3V80A 2V7EA 4LVCA 3WB2A 3SC6A 5ALZA 1CB7A 4DYVA 4PX5A 4FYYA 2V4ZA 1JIUA 1ENOA 1EYZA 1J70A 1EKXA 5CYOA 1C7FA 3V7NA 3HWRA 1VXRA 3NVMB 3ITEA 2W11A 1UDAA 3IAEA 3LRXA 5SY4A 4LY0A 1LRKA 1L1RA 4LWOA 1FFDA 1SBHA 1KKMA 4YI5A 4ZOEA 1UWLA 1ZD2P 3MLAA 1F0NA 4RFSB 1Q0SA 4EUSA 1OI7A 3RAEC 4G86A 1PNVA 3QVUA 2WAYA 3TKYA 2Y1KA 1QFSA 2BY4A 1PWHA 2FRVA 1T15A 1UJ2A 1WM1A 2OC4A 4FT4A 5EQJB 1UBHS 2IP2A 4INPA 5HF9A 3EVCA 2C5LA 1E4OA 4D6PA 3D7LA 1X9HA 4B74A 4BNDA 3TBFA 4Z3KA 1RJWA 2HSGA 1ORRA 3AKEA 4JLSA 4ZO8A 4EG8A 2ECPA 4IVPA 3PPIA 4CMEC 3TW0A 3DDWA 3TRKA 4RK0A 1P31A 2OD7A 4QO8A 4F9FA 1AF7A 1CHNA 1Z0AA 2ZRBA 3GU3A 4ZOLF 4DDTA 3LOUA 2QRKA 1YZ3A 3G2LA 1N2GA 4BO6A 2D5BA 5CH5A 5MGNA 3DVQX 4IOLA 2PX2A 3GEDA 3ON5A 1IM2A 1DS6A 1K8YB 1XKTA 1ZYUA 3P0IA 4Z1MD 2XXAA 3SMQA 3AF5A 3I42A 3R6DA 4HAUA 1T8UA 1XXHA 5KCZA 4JSTA 3UGKA 1S2GA 4H35A 4KYUA 3QLJA 4IJUA 5CITA 1FFSA 2FZEA 4B43A 1DO8A 4L3WA 2WV7A 3E1KA 1ZA1A 2B0JA 3TR5A 3WHKA 3HUEA 3WGKA 2VUTA 2ORIA 4RGVA 1WX1A 5MF6A 2H17A 3NRJA 3RE1A 5DTEA 2G8LA 1XLWA 3NUZA 5DOZA 2BBWA 1NMEA 1DQZA 2J6CA 2HJRA 2YRXA 3SZRA 1FDRA 3KXLA 2UUBB 1DKPA 1KFKB 1UINA 2XEXA 2XGMA 3AOGA 4WN9B 2O0MA 4HN9A 3KQYA 1G5IA 2IEDA 4J1QA 4BIMA 4BY9E 4EF4A 1M5RA 3LZDA 4FDAA 1WPXA 3LBNA 5CB0A 3W2IA 4ACBA 2EF0A 4MH0R 4MMZB 1AO3A 3C7TA 1F5SA 5HOQA 5I8WA 3AG6A 3R9XA 2AZMA 4B3SB 2OEPA 2EP8A 4OXQA 5KYYA 4MHTA 1E3MA 2JAWA 4IQ0A 4M99A 3FJ1A 1CERA 2FWAA 4B48A 2CN1A 3EJWA 2HB6A 5DBEX 5FWAA 3T34A 4IM7A 4Z0PA 2ZJAA 4KI0A 2HYDA 1K7XB 2HO5A 1ZJYA 2PMCA 4Q48A 3EISA 5HK9A 3PCXA 4MUNA 1NVXQ 2HFJA 2L2QA 3P0HA 4YT5A 2YC4C 2CBXA 5IT5A 1FLDA 1RAFA 4J91A 3GLHB 3U3OA 3IV9A 1FBNA 1LDGA 1H23A 1QV6A 1U3FA 3HV0A 2B2XA 2FXIA 3PGA1 4UEQA 3TW8A 1CNEA 3CZMA 3VNAA 3OTIA 2QZZA 4JI1B 4RF3A 2ZRQA 4A2PA 5ITZA 5AQEA 4AP9A 4O59O 2VSYA 1OXVA 2B34A 4GZ6A 5A5EA 1ZUIA 4MVJG 4QQ8A 2AYXA 1M2KA 1S2OA 3K6RA 3OPQA 5AI8A 2ZT5A 5SZJA 3HR4A 1KJJA 4NZ9A 3OHMA 3WLKX 4HGOA 4S04A 1XDBA 2O07A 3HH8A 3KTAB 3Q7SA 5BOSB 4OKNA 2O52A 1E18A 3SIPA 2HBQA 2O2XA 5CAEA 2JBWA 2RE8A 4Q01A 5EOVA 2DPHA 4JK3A 3VR5H 3T9FA 4NZZA 1K86A 1CP3A 3UTDA 1ZKMA 1J39A 1F0PA 2QLNA 3BL6A 2WLTA 3AVOA 3JVDA 1WKVA 3PVSA 1DOZA 2NQ8A 2QTVB 4B3MB 2WSBA 3I12A 1ZXBA 2XMQA 3BFKA 3MWYW 5ENZA 1DVRA 3CWZA 4UBNA 4JZYA 3HVJA 4XD7A 1EH5A 4MUKA 4LTNA 3JQAD 4J3NA 4CR7A 5A06A 1KHHA 4WXHA 5HIJA 2R44A 2QXTA 2AOWA 4BNUA 5BQ3A 5KYKA 3CRZA 1U0BB 1B41A 4NDZA 1K3FA 4DRXB 4FWIB 4BZXA 4OXKA 2WSMA 1MUUA 2XF2A 1XRQA 1M74A 4LZNA 2JB9A 1LRJA 1T25A 3F3SA 3LQ2A 2RHOA 4R1TA 5EIBD 1F06A 1KBZA 2RG7A 3HVRA 2HQRA 1GNTA 1E4VA 3W7VA 4X71A 1AUVA 1V8FA 3DPSA 4OI4A 2YN2A 1V16A 4ZPJA 1WW8A 2GVZC 4N0DA 4QA9A 2X4LA 1HX7A 1BGWA 1V25A 4W1SA 3IUPA 3V7WA 4D4JA 4JIMA 5IBPA 1ES9A 2C8KA 2X3YA 1SN7A 2J4CA 3ZS9A 3OZWA 1DHTA 3H4VA 3ZCVA 4GG1A 1N78A 3MS7A 4YR7A 1ONOA 1UM8A 2J09A 3IIEA 1BEUB 2JHGA 4YXWA 1CS0A 4DQVA 1C9JA 4FS8A 4XPIB 3LAWA 1XZGA 1M6WA 1BFKA 1V47A 3ZY3A 3MS4A 1RACA 3UG7A 3O1JC 2GOYA 3DOCA 3LHFA 5C5EA 5JS1A 1LSOA 2BFEA 4HUQA 2M6RA 2OHOA 3C8ZA 4YRLA 2Z30A 4O1MA 4X90A 3S3TA 4MW7A 1G21B 1XROA 4X44A 5D6OA 4HN4B 2PYIA 1NUUA 3PV0A 1IPEA 3TYXA 4RXMA 1NN5A 2VBIA 2OM6A 2A9KA 4C0LA 5BQFA 4IS2A 1LC3A 1WIWA 2I7CA 1O77A 3JALA 1FQOA 4PX2A 4DE5A 4RZIA 4EMSA 1XEWY 4MV7A 4QO7A 3V4SA 1WOYA 2HF8A 3JYNA 1Q3KA 1YI1A 5DX1A 2CFCA 3SF8B 3GZNA 3O4JA 4YDRA 1E77A 2BTEA 4OL0A 2HC9A 2FG6C 3FW1A 5EUQB 4F4IA 5L53A 5J2UA 1YQTA 1ONSA 3K9FC 4ZVSA 5HR5A 3WZMA 4A8HA 4B6SA 3P0RA 1BN7A 1IC6A 3T1TA 1SCQA 1BMTA 1Q84A 2RCYA 4IIBA 3K71B 4Q4DA 4BECA 1SELA 1L7EA 3U39A 1NQTA 1KRXA 1UBLS 3VV3A 4Z9AA 2I29A 2JDID 2QN3A 3EGDB 3IO5A 2ZM5A 3IHTA 3CZAA 4JLAA 5G4KB 1OA1A 1HG1A 1GPKA 3B1WA 2BKUA 3H9QA 4QBTA 4WCFB 1Y3FE 4I1SA 4GPTA 3K35A 2G4CA 3EOZA 4HN2A 2P9BA 1TT7A 3DO5A 1ONPA 2QYHA 3H16A 4IFEA 1YB6A 1AKEA 2BEJA 2UZ3A 4TKLA 3IUEA 3OLWA 5GADl 2CJPA 3AV3A 2B7BA 3WLHA 4RD2A 2K2QB 2HT1A 5H02A 2OKGA 1ZM2A 3AJRA 4YV2A 1DX4A 1NOIA 3B20A 3O3OB 2R6R1 3INTA 3AGQA 4G0NA 4BBAA 2POCA 4W5RA 1M1NB 2WJZB 3EDQA 4NHOA 4Y6RA 3TIGA 2F55A 2AZXA 4FWBA 4M49A 2ISQA 5DJ5A 5E6UB 5C3MA 2FPSA 3NALA 1R4ZA 4F4FA 2BEVA 3WZ2A 2W98A 2WINI 1RABA 3PLNA 4FVTA 3CBQA 1P60A 3ND5A 3BVPA 5LWHA 4ZI3A 1JWBB 3PP8A 4GD3Q 1Z45A 1XJ0A 1FNMA 1NX6A 4C88A 2GDJA 2ISSD 2Y66A 4E0BA 2DBVO 3BXEA 1JVSA 2CVPA 4Y30A 4F85A 2P3QA 3QGMA 1E3WA 4II7A 5IH3A 4BX2A 1XOIA 2VF2A 5T57A 4QGHA 3IUJA 1C9NA 1COZA 3BDVA 4RMHA 3PU6A 2QI9F 3V7YA 2XUDA 1SHLA 3ZDXB 3SR0A 3HKBA 4DJAA 4W6QA 1EFAA 1WV0A 3M7IA 3J81A 3K6KA 1LF5A 1UZLA 3PS9A 4U9UA 4G5HA 1MPTA 4B6OA 2HJHA 4BVBA 3QX7A 5JJ5A 4W5NA 1P0IA 1TK9A 2BN4A 2NSHA 4RMJA 2IDMA 3KOXA 1WHTA 2EX0A 3L1UA 5D3MB 1J8FA 2C1XA 3CJTA 3D7RA 5G0WA 3H5VA 3JWIA 4NBKA 3NTLA 1J1IA 2W48A 4B3DA 4KFTA 3SXJA 2IXTA 4I9UA 4L72A 3W79A 4GKJB 1H69A 3INYA 1E3IA 3EIHA 2ACWA 1EEHA 3PGJA 4IIGA 3ZG6A 2CXQA 2NT4A 3SQMA 3VZBA 4OBXA 1B73A 4Y0AA 3UGJA 5KKAA 3C3AA 1QZUA 2VJCA 4OHPA 1WABA 3OFNA 4UTZA 4CYMA 1Y4UA 4I6JA 1PAUA 1WNFA 3MWLA 1V39A 5ALEA 3RRJA 4XSGA 1W30A 1NF9A 2X4IA 4JB3A 5EEGA 3QW2A 1J2TA 2BGRA 4MS4B 2C2HA 2IWRA 1JR2A 3DV0B 3OFVA 4OLAA 4R0MA 2VO1A 4DXAA 4IDNA 1NW4A 2JFZA 3WLAA 3JAMA 2ANBA 1PIWA 3ZGLA 1U02A 3AVPA 1VYVA 4AJHA 2BI8A 1YV9A 1ST2A 3K5PA 1EU1A 1M2FA 1V8PA 2RGCA 2WOJA 2WZBA 4MUEA 4PC3A 2VTBB 4IVRA 4R81A 1RYMA 1C1HA 5HOEA 3IERA 2CXUA 3W6NA 4ETIA 1G1AA 5LP6F 3C1UA 2ZI7A 2DBQA 4FPXA 5KBYA 5CDFE 1RXEA 1GYPA 2BM0A 4KYVA 2ON6A 1UXGA 1BWSA 4JIGA 4ZVUA 2OV4A 3OC0A 4N39A 3FY4A 3ORHA 5FUBA 1PT6A 3RIHA 4Q9IA 1PT5A 1YXMA 4D0LB 1NQXA 2UYHA 3HRHA 1EM8B 2FSHA 3A3YA 3GI1A 4OK6A 5C81A 2XOEA 2HHLA 3DQPA 4RKFA 3A1NA 4LJAA 4MR8A 1Y4ZA 4RABA 5E2IA 4ZT6A 4CM8B 2BE9A 3OEHD 4TXHA 5C5DA 1N0UA 3ER6A 3PEFA 1T35A 4C7MA 4ZZ2A 4E22A 2OGSA 1JLLB 1QU2A 2Q9CA 2CUNA 4NK5A 4LF7B 1KO7A 4V0LA 4RD3A 1QHEA 3ZLBA 1Q14A 1YWGO 5THKA 4QQRA 1AOXA 2VH2A 2OENG 2ZAOA 3C5VA 3H65A 3SZUA 4K2AA 4F60A 1PTJA 1GCUA 2JHPA 3DF7A 3ZDYB 1E9SA 1E0KA 1JSRA 1JEDA 3I73A 4Q4CA 1ZUNA 2ZP1A 3PICA 1O94A 1B14A 1NF8A 1PUJA 4TT3A 5CCDA 3VNSA 1KMIY 3K2EA 5J2TB 1TM5E 1TKBA 3NLLA 1QE5A 1M5UA 2CSUA 3A1CA 3FUVA 2LKCA 2DFKB 4IZHA 1ID1A 2DPGA 2IYAA 1X80A 2HA3A 5EZYA 5KZMB 5JLJA 3U40A 3SXUA 1NSYA 3JVIA 1KTVA 3ROXA 5HVNA 3UJ9A 3N2GB 1XTTA 2C20A 4MGYR 3TOSA 1DO2A 1LBTA 4BNKA 2GBPA 2OE2A 4PM4A 2XMRA 5DSZA 3OUZA 3SQOA 1QRAA 4QVKA 1IDN1 3GX1A 4P6VF 1YCFA 4DA7A 3H9UA 4BMXA 1KYIA 4MHOA 5DB4A 4R9VA 1L4UA 4UOZA 3CY6A 1E0JA 2O2IA 2Y1FA 4GOLD 4NBSA 3UXMA 4COKA 1D4FA 4HH1A 4NCNA 1UANA 2BKXA 2GQ0A 3PFBA 4D4GA 1HRKA 4R1MA 2VEDA 1ZLYA 3CNBA 3DFIA 4LQDA 2C5FA 2SBTA 3ORYA 5DBOA 1DSSG 3KUUA 3B3FA 3IMEA 3P4XA 3PDUA 4YAWA 1HSZA 3TZHA 4AJKA 3H9BA 4E4YA 3LNTA 3RVNA 3N70A 4BPRA 2V98A 1XCOA 4CBVA 1VFNA 3L7BA 4N65A 1WXGA 4N3CA 4OATA 3OQHA 1SHZA 1QV7A 1E2HA 3FIUA 1YK0A 2MINA 3A6JA 3MIZA 3IR7A 3JWEA 2WOOA 1M2OA 1C1DA 3WRWA 1LPOA 3R76A 4Q9HA 1JDNA 4JNCA 3NJ8A 5KINB 5ESWA 2C2ZA 2JFBA 4WLEA 4TMVA 1R5JA 2GHRA 3UAZA 2KWIA 3V3TA 1RWBA 2OUIA 3HXLA 4NH0A 1GYQA 1RM3A 4LHSA 3TZQA 2AOUB 4OHVA 3M1IA 3WA6A 1A0OA 4DDWA 5IM5A 4Q7LA 4MULA 1RRMA 1V7CA 2FN7A 2FW8A 4RYDA 4TMYA 4TZKA 4HNUA 4D74A 1Q7TA 3A8TA 3NWBA 4PO1A 3UHOA 1RCTE 2GD0A 2LBPA 4BO5A 2L0XA 1JA1A 3GRPA 3EWAA 3K30A 4LHWA 4MGHA 2IU0A 3ZCUA 4S05A 2JLXA 2YVQA 3R3YA 2FTKE 3TMKA 1WXHA 1DIRA 3WIDA 2RHBA 1H0KA 1U8ZA 1Y8QA 2E6KA 3GDOA 4W5JA 3U1TA 5A4JA 2M98A 5F12A 4HNVA 1ZMXA 3ZXSA 4AU1A 4YAGA 1YZUA 3GJRA 4D1YA 3L1IA 4DV2B 1JS1X 4RJIA 1LF0A 4LJ6A 4QGFA 2OPHA 2HA4A 3DHWC 4UTVA 2DXIA 3IUNA 5ERYA 1E2JA 4G09A 4OHXA 5C34B 3ZOKA 3DFKA 3L0ZA 3PRHA 2QTRA 5AKJA 1M8GA 4HCJA 3ETHA 1II8A 1JU3A 1V8BA 2YFYA 2Q4DA 1M73E 3LPMA 3HA3A 4HGNA 5CB4A 2FHSA 2HGSA 1SCNE 4P35A 3Q6IA 4X7MA 1I7NA 1KI6B 7REQB 3QV1A 3C3JA 1MRZA 5D1HA 3TPZA 3ETCA 3GNTA 1M8JA 2DWQA 2P67A 3O1LA 4O5OA 2WUDA 4QYMA 2IYLD 3RUDA 2AK3A 1SOAA 1IOLA 2JJQA 3T7JA 2XADA 1OLSA 4UUBA 3LPDA 3SIRA 4UTRA 8AT1A 2RI0A 3U4GA 3DULA 2JIQA 3THXB 3C15C 4CTOA 4KIUA 4LXHA 5AKXA 3ZHOA 2AYYA 1XWIA 1S01A 4POAA 2EP5A 1X7XB 4PF1A 2YVKA 1FXWF 1PLKA 5CB4B 1YS4A 3B51X 3OZUA 5ITWA 4RFVA 1X7ZA 1NRIA 1W7AA 2X7HA 1PTKA 2VHWA 2QY9A 5KTMA 3LHKA 3P9IA 1FP2A 7REQA 4ECAA 3NS7A 4DG8A 1U2GA 2BHRA 2JA1A 3T06B 1GCGA 1TTHA 2M6LA 4RULA 4I99A 1UJCA 2OM2A 1E1CA 4FYKA 4IJMA 2OXTA 1I7SB 4NATA 2R8XA 3AY3A 5IPFA 4ZGBA 1CUHA 3TM5A 5K9ZA 4ALNA 3TGPA 3L82B 4JB0A 3LXXA 1G8SA 1XMSA 2A58A 3EIXA 2FJUA 5TQ2A 2J87A 2HBZA 4UHDA 1MIOB 3T9BA 1TZKA 4KIJA 3GNSA 5KVQA 1F38A 1QK3A 5KS2A 1CDEA 5I5EA 1O54A 2DPMA 5LQKA 4LVUA 3RYHA 3PTAA 1QCCA 3D8HA 4ATNA 1V5WA 4CETA 3FLMA 1HI9A 1JJ7A 4J4BA 4WZZA 3BJMA 1QV9A 1OWNA 1G2PA 3T61A 1O95C 1QPZA 4FB4A 1VE9A 1GYRA 1WXXA 1ZJJA 4EHAA 3RVKA 1RIIA 1Z16A 3NAGA 2WQZA 2Q5LA 4L0DA 1DE0A 2FR8A 3BBPA 3JXEA 3TH5A 1X38A 3KQLA 3CO0S 1U2QA 2IXAA 4EJ0A 2XCUA 3CRVA 3K0SA 2ZUTA 5HQ3B 1B3RA 1R6XA 1FYWA 1GNQA 2VSOA 4ZEVA 1P1FA 1Q15A 3RG2A 1SC6A 4EYGA 4EBBA 2ZYSA 5IYZB 3RTDA 3DA8A 1MTZA 1VLJA 3K0FB 2CXTA 4N8SA 1Y4DE 2W9XA 1QQBA 1W48A 1JQAA 4BC0A 4QUBA 1O96A 2ZI5A 2HXGA 5DYIA 2BJHA 1TA0A 2RGAA 2LW7A 1ORHA 2G9NA 5JJLA 2HMVA 1A9RA 2XA2A 1D9ZA 5BY2A 1T8TA 4NG4A 2HJGA 4DLBA 1CUWA 5TPWA 2AUNA 1HZZC 3BQ9A 1U8YA 3R40A 1FNBA 1RI5A 3Q9SA 3ESAA 1FDOA 2H3EA 2GN8A 1G9XA 1MAWA 4Y1RA 1O0BA 1QOPB 1SUIA 1GGKA 1XDUA 2VBGA 3EJ6A 3JQBA 1U8EA 3ONVA 3QUTA 1CUCA 4O2AF 3ZUPA 4RENA 3ZU4A 4JKYA 2Q3CA 1NU8A 3KZMA 3Q7EA 1N4AA 2ATXA 2B4TO 2WSLA 1G4UR 3N2YA 4ZU1X 4IWYA 1NUTA 2ZTSA 5BR4A 1VE3A 2OAP1 5HUQA 2Q3DA 3VR2A 5JDCA 1GEEA 1H2HA 1FCJA 2VHYA 4J0FA 1ONBA 4ZDKA 5EIFA 3CT6A 1YH3A 4DEYA 1BOFA 5LOVF 3AMVA 1WG8A 4BO9A 1NAHA 2CXSA 2Q5QA 4JQOA 5AM0A 5K4HA 4J94A 1Y6FA 4OEHA 3ROKA 5L40A 1RLMA 1P7CA 2GCGA 4C07A 2GBCA 2FA9A 4BNXA 4O4LF 4RSMA 5LP6C 2B4AA 2IPLA 3CEJA 3TTWA 4U7GA 1Q0QA 3AHCA 5E3JA 3T94A 1VOTA 3QVWA 4NEGA 2OORC 4NYJQ 2X86A 5CVJA 5GONF 5HQTA 2JVIA 1JPVA 1PFQA 1FVFA 1SU4A 2F1OA 3DVLA 4PQYA 3SLGA 4BLUA 4CI0B 3C24A 4DV5B 1ZPDA 4O33A 3OPNA 3GXOA 2RC6A 1E5TA 3UW1A 2EYQA 2OZVA 1ZCAA 1JIQA 4AZTA 5LA6A 5IXJA 1HZJA 4P2BA 4RY8A 4IIXA 4AXBA 4ZOQI 2HIHA 1N9ZA 2BHLA 3GLQA 3D2BA 4OU5A 2HWYA 2XWBF 4AW9A 1JR3E 3B3JA 5EHNA 5F21A 3JATB 3RIMA 4DLYA 1H0SA 2XNKA 1Z2EA 2Z3VA 4R9SA 4OX9Y 1RZ3A 4L4RA 3DAYA 4D0SA 3MGKA 1K08A 3N0WA 3QEJA 4OG2A 3RV4A 3T4XA 3TJRA 2VDLB 4YMHA 2WJYA 1LTQA 1U5AA 3GZNB 3GIDA 1QDUA 3RFTA 4FUTA 4G5QA 1GA6A 3DEAA 1BVYF 4RFLA 3CR8A 1VI6A 1Z7BA 1XKQA 3IDOA 3LYLA 4ASUD 2FVYA 5KCMA 2VT7A 4H3KB 1CIVA 3NASA 4MB6A 1JI0A 2IF2A 5JXWA 1HKUA 1IEXA 3BFPA 2GTHA 4PAQA 5EHGA 3NT2A 3A1EA 2VYVD 1HV8A 2P6PA 4ZYUA 4M36A 2NUTB 3EEFA 2GEJA 4GM4A 3NTOA 3N3BC 3H3FA 4S2EA 1Z9BA 4XOUA 4ZHQA 1WP4A 3A10A 4FOPA 2X3UA 4MK4A 3RSLA 4H3HB 2FETA 3FCAA 4HS4A 1K88A 1VG8A 1KEVA 1A9ZA 2NPOA 2VDQB 2ZJBA 1CR1A 1A71A 1DRUA 3NO4A 4R3WA 3SSNA 2B4QA 2V55B 2XSZD 5F33A 1VPEA 5AK5A 2R4TA 2PGIA 2QAGB 4ZVMA 3EXFA 3VPGA 2XLCA 2OYCA 3DUWA 4J2TA 4G84A 1E3LA 1EXDA 1UMKA 2GZRA 4RVHA 5AOVA 5CA0B 3WO1A 3TBHA 1R8YA 3Q5DA 3GF4A 1JG6A 2R751 2VWQA 1I4TD 4J7UA 1FXWA 3KVYA 4YRGA 3K6SB 2VNSA 4G67A 1O03A 3RJ5A 3WC4A 1FTYA 1P7YA 5JMOA 4P22A 3WDKA 2OXCA 4OFXA 5HCNA 1LDBA 3WMWA 4WBNF 4Z54A 1C7EA 4IV8A 2WPDD 3HR7A 4LISA 3OKFA 5D3MA 5FPHA 3UA3A 5AUPB 1D2GA 1G8KA 3IH5A 2EZTA 3PT9A 5HKOA 3NDRA 4GGOA 4Q66C 1U9JA 2OVBA 4GAEA 1JG2A 2NAFA 3LGXA 3L4KA 5B1SA 3W0LB 1N0WA 2DFLA 2N1MA 1KQGA 3TJZA 4X5OA 4UHEA 3G49A 1XCPA 3E3AA 4H4EA 4ENTA 1K7FB 1TUGA 4KFRA 4F1KA 5JHGB 1XEWX 4AYXA 3QEMB 4Y7CA 3VM6A 3D5EA 4G8JA 1Y3BE 3GJ6A 5DI3A 3PF9A 4RVDA 3T3NA 3REFA 2VWHA 3T7TA 4J9VA 4FD2A 2MYTA 4BNLA 1RRVA 2H6EA 2ZGVA 2QN8A 3QA9A 4I1YA 2O5RA 4ZKDA 4MR7A 4O4IB 3SZOA 2EG9A 4K0KB 3UMVA 5KQLA 4KQJA 1FSSA 1YDHA 4QFBA 4QQFA 1XLTA 5BT9A 1E98A 3E8MA 4ZAGA 4OBWA 1QGAA 4RHCA 4ARZB 3CF4G 2FLWA 5TIIA 3A3PA 2PMKA 2A14A 5U4XA 1S89A 2FF5A 1EFVA 2OHJA 2W6OA 3GLSA 5AVOA 2GCNA 2ONJA 3SX2A 4B8YA 2B2CA 5IC6A 1W49A 3D6AA 3KQSA 4NABA 3SP1A 4DANA 3R9WA 1MVLA 1UOPA 3PI6A 2GJAA 1XYVA 1O6ZA 1DT3A 1SEPA 3C1AA 2MSDB 4UDXX 5T64A 5E4YA 1FFYA 1GKUB 5EYPA 4IG9A 4KVFA 1PFVA 4P34A 3ICPA 3E3MA 2B4RO 3QLTA 4PSVA 1UFOA 3B1XA 3DP7A 4EG7A 3QEAZ 2IHKA 5EP3A 2IH4A 1L1QA 4KP7A 4IO1A 4MV5A 1OWLA 1WS6A 3SSOA 3HLYA 3EDOA 3QEBZ 5KQGA 2F8TA 1DU4A 2QB5A 5E4TA 4ZCIA 4ZKEA 1Q1EA 1U3GA 3IBYA 3HHPA 3CLRC 4HATA 5JQGB 1NW5A 5D01A 3RVMA 3BULA 3JQRA 5CH8A 3GLGB 3H11B 4JASB 5J40A 1QLWA 2I80A 4XYBA 4Y2UA 3THSA 3K15A 5JYCA 1P9LA 1I2ZA 1JDVA 1USKA 4HEHA 2JHAA 2XNSA 4MV1A 4UULA 3O7MA 1JB9A 3R7AA 2PKQP 4UUOA 3H2BA 4XFKA 2J9FB 2NQ2C 4C7BA 1JKXA 3AR3A 5T5QA 2HDHA 4FONA 4Z0NA 4G1CA 4N8EA 1MJGM 1VB5A 2VP9A 1S1MA 1L5GB 1KZ6A 3RJMA 4EQ6A 3UYKA 1NPTO 4NCKA 2FFBA 1KERA 1MQ8B 2X77A 5FBRB 2D5CA 5G3ZA 5HDBB 3U7QA 4B79A 1NWCA 1BMDA 1IZ9A 3II6X 4W9NC 1RC1A 3KJXA 4MVXA 2FEWB 4A16A 1E2QA 5IVKA 3QBTA 2ZEJA 4XIJA 3UK0A 5IK2A 2AN9A 2O2CA 2AEFA 1IZYA 5TPWB 2GZAA 3SVZA 4P4LA 3K1JA 1IAVA 4EP1A 4POOA 4KFSA 3DT6A 3ICOA 3BWCA 2D1TA 4M9CA 3NHZA 3AWIA 2QAGC 1OIVA 3DE1X 4YAJA 5F98A 1Z39A 4RTLA 1TM7E 3PC6A 2CFSA 4KV9A 3TB4A 4IQFA 2PAFA 3H83A 2Q2WA 3N8NA 1USWA 4P7FA 3NHUA 2WVHA 3DEHA 3OJOA 2RHHA 3SNKA 1ZCBA 4X1KA 4YAKA 2H0QA 1XZIA 4JL6A 3DS8A 4YROA 2PDAA 5LYJF 4DM3A 3V4PB 3U7QB 4QXRA 1KZ9A 4DR7B 1BHJA 3F5FA 3QXSA 4PLFA 4E4RA 1SCUB 3O95A 4LBZA 1FP4A 1P4AA 5TE9A 2PXAA 4DJFC 4E33A 4BP9A 2HYIC 2ZB7A 2QUAA 4PN7A 2J5XA 2IPNA 3D6JA 3KZNA 3GFRA 1HORA 1NW8A 2O7VA 4GHWA 4HDSA 4IP0A 4XRGA 2XWSA 2QVGA 4RXTA 4A7PA 4RESA 4R1SA 3UIEA 3ZLJA 3GYBA 3E81A 1BRTA 4V2UA 1AN0A 3ZZTA 3QEKA 1K1EA 4QFMA 2Z4RA 3F96A 2PKEA 4HJXA 4HXGA 3QVTA 4OY3A 2DBRA 3BJIC 3V4ZA 4QGSA 2ZJ6A 2HW8A 2PFSA 3DT9A 2ZWPA 4I4IA 4C5AA 2HIGA 3NDIA 1XA3A 3NANA 3BFXA 4MS4A 2GN4A 1DTWA 3A1DA 5ETJA 5J63A 3TVYA 4FYHA 1XHEA 3V97A 4US1R 3H5WA 4GM1A 4D3DA 3UKJA 1U8FO 1ZCJA 2O48X 4C76A 2ZRFA 2NO4A 4EHNA 1Y1QA 4I9FA 4MYTA 2EZ8A 1SG9A 3GVXA 4YCDA 5BVGB 1MO3A 3AW9A 4C22A 4WESA 2NZVG 1PNQA 2YH2A 1K8ZB 3SHWA 5FNVB 3WGGA 2VT3A 2ZRCA 2BDTA 3OH8A 4U7WA 4DJJA 2PUGA 3FKSD 3R0XA 2RGNA 3IB6A 2PHZA 1DLJA 5JXHA 4EIWA 3ANSA 1YC5A 2BI4A 1AQ6A 3HM2A 3LC0A 4S3MA 2HXYA 1SRRA 2IE8A 1JMKC 2XUPA 4D57A 4Q18A 4BFZA 4D9MA 4M0PA 1E9AA 1HEIA 2IUYA 3RK4A 3AB8A 2GTPA 5JZVA 1X1EA 1XEXB 2BBSA 1GL6A 4GRIA 1Y89A 5BNFA 1HXHA 1OJ7A 3FNEA 1ZUD1 3KYDB 2PD6A 5K8TA 1U2EA 1CXZA 3E61A 4HWGA 1L5ZA 3I5MA 3IC5A 4U7JA 1VSTA 2ATEA 4KACA 5FNVA 3IBFA 1N5RA 2R6DA 3H9EO 3UN1A 1DQRA 3EA0A 3BGSA 2ZBQA 3ZK9A 4FT2A 2PZEA 2QVXX 2ZE8A 1AV7A 3L7AA 3WBJA 4D2IA 5JT1A 5JXJA 1PG2A 2CHEA 1P62B 1V3VA 3SC2B 2MMGA 4PO8A 5JECA 1PU2A 1V41E 2QMYA 3AC0A 3RV3A 2Q4TA 4B4DA 2NO1A 4IX1A 3SY8A 1MKYA 1XPRA 3R77A 2VI5A 1XF1A 4W5TA 1OASA 2XOKD 3TGLA 4CF5A 4QNRA 2P3OA 1EK6A 3C3KA 4JB8A 3U3DA 2QAGA 3R9XB 3E35A 3GLFE 2B78A 3NHYA 3RRZA 4WOBA 1C7JA 3GAZA 3ZNQA 3LLSA 1NMYA 2FRDA 2YZGA 3D0QA 2DCMA 3K1YA 3IE2A 4KAAA 5K8VA 4MDFA 4RZSA 3U0BA 1EFKA 5JAPA 2FFJA 4RKWA 1KZ7B 4ME6A 4DWOA 3FPSA 5MN6A 3F9IA 4BB9A 3AHJA 4IJ5A 4F97A 3C3WA 2WUGA 3QTBA 4CODB 2G4VA 1I3NA 4C0XA 1K9SA 2EWMA 1V5IA 1PFKA 1ZINA 3J7TA 4ZCLA 2KLHA 1J5XA 2OXRA 3KV1A 1HDOA 1IXYA 2HREA 2ZDGA 5A04A 3G88A 2HLNA 3KAPA 3N87A 2OV1A 2Z2JA 3UMRA 4FZ5A 4GDFA 4MDEA 2P11A 2PU7A 4R1NA 1BVUA 1I51A 1T6ZA 3IJEB 3Q3EA 4G56A 2VDOB 4R54A 4FZVA 2ODBA 3Q7IA 1OFUA 2HQSA 4M7RA 2PVPA 4F4CA 4D82A 3PFIA 1RFLA 3HHEA 4EG0A 3KE8A 1PJBA 3AFOA 3VR4A 4ABYA 3EUFA 3CLTC 3GNLA 2A3RA 4FM9A 3AL2A 1VBNA 2Q3LA 4I14A 3TECE 5BQ5A 2G5CA 4MPJA 5DM60 1ZVJA 1VHJA 2HBYA 2PSFA 1JQBA 1V8DA 2ZBDA 3G85A 1OMOA 4LOHA 2QW0X 5HBRA 3AEZA 3L3BA 3TL6A 1CEXA 4BLOA 1MGOA 3WYFA 1G5TA 4L8VA 5EXDA 4A0RA 2AC7A 3NP9A 3P1JA 3JWPA 3AVVA 3IQZA 1FFGA 4UXIA 2V9CA 4N5DA 4B6JA 4YLEA 2ZOSA 3GAMA 2CNDA 1SA0B 3DJFA 2ZCJA 4FYJA 2JIZD 3ND6A 1NXPA 3V1YA 1F3OA 3W8EA 3NHFA 4LBWA 3LS2A 2YJZA 3EEIA 3VNRA 2BGGA 2CEKA 3VOSA 2Q8NA 1A82A 1E3QA 1KF0A 1ZJ4A 5ENDA 4CQLA 2OC9A 1V1MB 2HSDA 2X1HA 3INNA 1V6AA 4MRVA 4U02A 5DLEA 1NY5A 1IULA 5NLLA 3SAJA 2VNJA 5IFKA 2FMFA 3TQFA 1B42A 2WF8A 4A8JB 2WMOB 4IVQA 3TQIA 5LA6F 3EIQA 3KB2A 2WJHA 2PA0A 3WLOA 2ZSDA 1CFZA 1L4MA 4INAA 6NULA 4YQYA 3ZBPA 1D2MA 1C0EA 2JFYA 5FOSA 3MAAC 5CVTA 2FY8A 1L7BA 3OZBA 2WIDA 4IO0A 4EENA 4E15A 3O9VA 3O3NB 3QPUA 4L5JA 5L4LA 5DTJA 3ZQ6A 3UOWA 1DWOA 2GDZA 1YOVB 2P9HA 3OE4A 1FS4A 2AIRA 2ZREA 3QVSA 5EE3A 4YACA 3SLRA 1IZ0A 4J3JA 4L28A 3CW2A 4ZO7A 1IWPB 2IEIA 2YWDA 3RFUA 4CN8A 4GC5A 4WBSA 3N0RA 3TKAA 1QFZA 1VE5A 2J45A 2WR8A 4AP5A 1ZD1A 3ZVNA 2P6MA 1WETA 3W5UA 4L6IA 1SC1A 1AMUA 5B4VA 1IOVA 2W6MA 1FSZA 1M2WA 3BUSA 2ZI4A 3ZQUA 3ZW9A 2ZYHA 4M1EA 2BCGY 4QSMA 5EZYF 5C8YF 4G2NA 2DWUA 1XTUA 5I9MA 1L5QA 4P08A 4YRZA 3M83A 2YWEA 2V45A 3ZWKA 1O97C 4TYQA 2ZTLA 2ZJ3A 5FHRA 4BYGA 1G20B 2F00A 2Y2VA 3R0VA 4Z2AA 1L5LA 2QRZA 3LVBA 3ZIDA 1U1FA 4ICIA 2GPSA 1T8PA 3A9TA 3QPVA 4L5AA 4RA6A 5HXAA 3ECAA 4JMLA 1QAMA 3WWDA 3C6QA 1QIFA 2AS0A 4DIBA 4GBJA 3RUIA 1VL2A 1I33A 2FMTA 2BBOA 1UEXC 2E5FA 3PWSA 3BK7A 5CCXA 4M54A 3FJOA 3WRVA 5EVCA 2A30A 1GTG1 1YZVA 4HY3A 4YCAA 4D4IA 1EVQA 5BR1A 2QE6A 3PITA 3EVEA 4X1KB 3WK4A 1GL7A 1L7DA 4HFMA 2YMMA 1R4MA 4JJEA 4LVNA 1S2NA 3QFHA 4H60A 4Z49A 1C3OB 3ETGA 4PS1A 3ZGOA 1A5BB 4E70A 3AV0B 3E15A 4UUQA 5AWFC 2V7UA 3Q9LA 1CVLA 3EPPA 3N6VA 3C39A 3GMSA 4L9RA 4PG6A 3GPBA 4PRKA 1KE2A 3TRHA 1AJEA 1GTSA 2GD6A 4KWHA 1TFRA 2RBGA 2QUJA 3NM6B 4LJ5A 3FZNA 1BAPA 1U7XA 3O31A 3JYOA 4BLVA 1FB5A 5I3ZA 3G9XA 4G4JA 3HVIA 2YWJA 4M0KA 2X0EA 3E2PA 3VDMA 4C5CA 1EK0A 1SVKA 2CHVA 2Y68A 4WFQA 4TVOA 4RS4A 3BMCA 4BGVA 2GJ9A 5C5IA 3AZOA 2PL9A 4JEIA 3PDCA 5JQWA 4QASA 1A77A 4AUNA 2VNAA 1J0XO 1SXGA 1YD7A 1ZEJA 1V5EA 1PD1A 1OYVA 2P78A 2YW2A 3F98A 3GCXA 3L8CA 1QWSA 5CM9C 2HMWA 1CUZA 1MG0A 4FU0A 4QG7A 1YDMA 4IDAA 4DWJA 2HF7A 3FMPB 3B9PA 4OSEA 3U7HB 3D7SA 3OMWA 4DNXA 4PVCA 2P30A 4C4OA 2AKAB 3D4PA 4Z3DA 8ADHA 5JY6A 4IW3B 4CMGA 2C99A 3KQKA 1GT91 1PJSA 2VDVE 2QTMA 1L7AA 3OE5A 2IZ0A 4KR0A 2CBZA 1WBJB 3C3XA 2P5SA 4IH1A 4CL3A 1E1YA 4RADA 1G3IA 1UP6A 2IHZA 2ZVPX 3EFOA 4MWTA 1R8QA 1SUAA 4LJ4A 2E82A 2V4MA 1GGJA 3EBLA 4PTLA 1VHLA 1QJCA 1WA5A 1PG5A 3C5WP 1NVBA 3C5CA 3MINB 2IYVA 4GR5A 4RHTA 4A9AA 4F4DA 5H9WA 3U61B 1IQPA 1W0JA 4LRSB 4BQQA 4R98A 4WA7A 5AM5A 1Y7HA 1BWQA 1G7CA 3HDTA 1T3HA 3NOXA 4P31A 4EPRA 5CEEA 5CFNA 1OIXA 3F46A 3I04M 4YYEA 4IIJA 1K5HA 1WV1A 2YHSA 4LDNA 5GGXA 3ZCTA 2JVJA 4MW2A 1EUDB 5DK4A 1RLOA 1V6CA 2Q6VA 1B2LA 4LC0A 1XDDA 4PG8A 3PC2A 4NU6A 5KJCA 1U1EA 1MORA 6CHYA 2PY6A 3KIPA 4EFLA 4DUGA 1XRLA 1OV6A 1Z0FA 2PBZA 1LTKA 1KS9A 2FPXA 1JU4A 3BIXA 1MOZA 3DBHA 3O6VA 3KWMA 1J7KA 4L5CA 1B7GO 5JU6A 3PEUA 2P90A 2HY7A 4MJLA 5DPMA 2GK3A 1Z63A 1G0NA 2RCNA 4C14A 5B30A 5JH7A 6ABPA 2QN2A 5E0OA 5B6PA 5CK5A 2LV8A 2LIPA 4JVOA 4XD7D 5AOCA 4DPKA 3VSBA 1DFGA 2IZ6A 3IESA 1RYBA 3G9ZA 2P5TB 1QH8A 3HUDA 2VSNA 3L79A 3T95A 5BR8B 4JL8A 4NCBA 2E6UX 4M9RA 5JWHA 2O1WA 5BW4A 2W6IA 4PLZA 1CVIA 2AQIA 3BIWA 3PJRA 3ICEA 4DV7B 1T2DA 4AQDA 1O87A 5BYBA 3DP9A 4YUAA 1TVEA 2PD4A 1HL7A 4ND4A 2Y1GA 3IULA 3QW4B 1H2BA 2ZJ5A 3RIGA 1FFCA 1L7OA 5HZKA 3OU7A 5J5AA 3WGUA 3MGCA 1ND6A 3BWBA 1U0EA 3ESBA 3PFHA 2BH2A 1WHTB 4IHAA 5AW6A 4JLVA 3FXAA 4JQSA 1PJTA 1VL5A 4KGDA 3ZNOA 1DQPA 1PWXA 3QBVA 1T3ZA 1V7PC 4L7VA 2AZTA 1NVMB 2ENUA 4OGWA 4TKZA 4L4ZA 5CX1A 3KHSA 5FTLA 2AB0A 2F6RA 2W71A 3I0NA 2O1SA 4AT1A 1Q19A 1W8IA 1ZX1A 2Z9DA 3GCGA 4E1AA 3R3WA 4RMNA 1CD5A 1YKSA 2VL7A 3FN4A 3WR5A 3ZEAA 5HM8A 4FHFA 3EPJA 2C3PA 2OV2A 4BNIA 2DBYA 1WAMA 3G2QA 4XX1A 3IIMA 2ECFA 4NHEA 4OQFA 3VKGA 3MPOA 2HSZA 5IEJA 1X2BA 4UFNA 1JG1A 2TMDA 4QQNA 2E21A 3H5IA 4FGSA 4AUKA 3F6RA 1P29A 4JBLA 2ZIAA 4N6GA 2CV0A 1L5OA 4KXNA 4EGSA 1D7AA 4R9NA 2IBTA 5J4KA 1O6CA 4HZUB 5K45A 1V11B 4BVJA 1J20A 4GXQA 3VU0A 4BQOA 5TEVA 3VC3A 3X44A 3OT5A 4A82A 3CHYA 5BV8A 5AUNB 4G4SO 3A6HA 3ONDA 5H7XA 2XNJA 3W5VA 3DMYA 1D4OA 1SR8A 3CZPA 5DDIP 4CM1A 2PTGA 2VA8A 1T1EA 2W70A 1EHCA 3LBFA 1ZVMA 3LTNC 3IBCA 4V0QA 2EGUA 4WBNA 2OGTA 4GE3A 1H9CA 2VJPA 1CE8B 1WTCA 4MVJM 5B37A 1SGWA 4B84A 4KMMA 2DEUA 5KTSA 4YLGA 1OXUA 2XA1A 2XTAA 1LK5A 2C77A 2PS3A 4R05A 5KVSA 2OBNA 1Q11A 2AG6A 4MRRA 3SF0A 3SCZA 4IHKA 4JUBA 4NBRA 1JIXA 4CCSA 1ENZA 3UMCA 1JAHA 1QORA 1BYUA 1NPYA 1S96A 3FWHA 3H8VA 2REQB 4P92A 5AJYA 1LCIA 4MQMA 3PDWA 2AHOA 3UWOA 1QS0A 1ABFA 2GT1A 1FTWA 3MXTA 1HTTA 1RHKA 4NXMB 1YASA 3I2YX 2ZRPA 5ED0A 2QD1A 2YY7A 3CONA 3HFSA 1LW6E 3IMCA 1JLLA 3W78A 3E58A 1CG6A 2XB2A 5IS2A 1JXMA 5TS2A 1WF6A 2WF9A 4GLLA 4YDHB 3HZRA 1P3JA 1NXWA 4QPPA 3FR7A 3M1LA 3W5HA 4CMIA 1VCOA 4A0FA 3SJBA 3DPUA 3FI9A 1EFTA 2F48A 3IDQA 1I7PA 4CKBB 2UUCB 4UUMA 4X00A 2OHHA 1J90A 3NVAA 2OILA 4H7KA 4F56A 4LE0A 4Z7OB 1CQIA 5SZIA 3LIIA 4P3YA 2IHVA 2N9UA 4M38A 3TNJA 4KL8S 2KS6A 4RLQA 3L1HA 2ES4A 5DVZA 2IU4A 2NPIA 5CA1B 2FN9A 4LDQA 2YOGA 1N5IA 4TT3D 3SHTA 2PJZA 4X60A 2PUFA 1Q22A 1Z0DA 4C0QC 4EW2A 4UASA 3EFHA 1Q0LA 5J2UF 1BH6A 3C6YA 3F4LA 4AO8A 1C30A 5FTNA 2EKQA 4EO4A 1TGVA 3U3MA 4HT3B 3KCNA 1G7RA 4WY2A 1Z3CA 3UAGA 4EZBA 1DPFA 4HNQA 5FUYA 1U28C 4FR5A 3JWJA 4H3SA 5A4KA 1NQVA 2E49A 4ILEA 2IEZA 1TUEA 2P2LA 2XCSB 3HB1A 5JTTA 1ULHA 4LOJA 2EL9A 3WBKA 1V6SA 1KXZA 2ZU0C 3WGIA 2ZQ5A 4ZIRB 2X0RA 2HHAA 4A5OA 4HMQA 2O2EA 4BRWA 2YWCA 5A9SB 3ITDA 1DIHA 3I61A 4FQ5A 1M8KA 2H7VA 2XUQA 1NMQA 4AMUA 2XMZA 5LOVB 2GXQA 5G2OA 2Q0SA 1XJWA 3TVTA 4YP9A 1OU0A 5IAOA 521PA 3OY7A 2Z2YA 4XEUA 3GWGA 2PRKA 3P0EA 4Q1BA 4ARAA 3RADC 3UT5B 3G0CA 1YHZA 4TRJA 1XHFA 1GA1A 3R7WA 4IIFA 4XGIA 3I09A 4RMGA 3I1IA 3WYGA 2O2YA 1PJRA 3CB2A 3H5OA 3HCWA 5ES4B 1WU7A 4AY2A 2HEIA 4UVDA 5TT0A 3OTQA 3HK2A 4PC1A 3CZCA 2DPYA 3S81A 2O8VA 3KB6A 2Q46A 4LOIA 5KYTA 4IUYA 4CWAA 4R71A 1IZZA 1KI4A 2I6TA 3H5LA 3KAJA 2OO3A 3KYDA 2J7KA 4JSYA 3F78A 5HKKA 2AVNA 3C6ZA 5G41A 3KG2A 2R6FA 2QP3A 3NVDA 1KEEB 1TO6A 3STXA 2WT4A 1TUIA 2LCFA 3GFVA 2NG1A 3JRNA 1P1BA 4KBGA 4PFQA 4QWWA 4O2BA 4PO9A 2R8OA 2DQKA 3KKPA 2AC2A 2PYZA 1PJCA 1ZVVA 1YZHA 2C1ZA 2ZT6A 3FDIA 1JEYB 4QHSA 2IYSA 1A1SA 1W52X 1A4UA 3OA2A 2Q0QA 3OHPA 4PAMA 2XKJE 3H4IA 2WKWA 5M04A 1OXMA 3DOIA 2LP4Y 1HEYA 2EIHA 3IT3A 4OHWA 1H9BA 5DIFA 4JT9A 2WU8A 1OV4A 4KLRA 1G6OA 1VMEA 5FUWA 3VKFA 3WGMA 3ZWCA 2OBBA 1CZHA 3BD9A 3BD8A 1O4VA 4FE7A 1F5NA 1PWEA 4LXYA 5REQA 4ARZA 5T4EA 4DS3A 5B1EA 4JYCA 4BWYA 1N6RA 3T9CA 4R31A 5LCXA 2ZW9A 3FZYA 1DADA 1W1UA 2G82A 2C4KA 4NX2A 2JEOA 3DLPX 3V2GA 2VPIA 3CPHA 4F3YA 2PO7A 4TYNA 3FOZA 4KXXA 3EIFA 3D31A 1YZFA 1Y6JA 2QMOA 2AX3A 2EZ4A 2QG4A 3NAQA 3DBIA 4ZU3A 1XSEA 2IV7A 4TLLB 3UMYA 2Q1TA 2JAQA 4Y9SA 3N8IA 2PBRA 1E8MA 4AECA 1R18A 2C3YA 2XYQA 2XHEA 1I5RA 3GLTA 1U0NA 2AMLA 1ESCA 4F91B 2WIFA 3KBOA 2WT8A 3ZHRA 5CB8A 5AM1A 5FUXA 3W5AA 4AJ1A 1GXSB 2XW6A 1E92A 3IQIX 1N0VC 3G9TA 2PQ6A 1WXWA 2NV6A 3N76A 2PH3A 3IYLW 1JAYA 4HVLA 4XIYA 4EVRA 2X22A 5LQCA 3RF7A 3D6UA 3O0TA 1NDQA 5BQOA 1ZGGA 3UJBA 2H06A 4ZAXA 1SUBA 3PQDA 1XJCA 3GT3A 5F7XA 5CEFA 4ZZ1A 2HWXA 4K3UA 2YR0A 1XD9A 2O8FA 4KUEA 2PL3A 3H2KA 3IA2A 1DAEA 3R3XA 3TUIC 4B6PA 1TM4E 1Q1NA 2A1IA 2ASEA 2AUMA 2BEKA 1MB3A 3ZLVA 4Z53A 4X54A 4TL7A 2QRVB 4R1UA 5FCDA 4S2UA 4MJ7A 2E89A 3TZ6A 2QU8A 1Q2UA 4RCZA 2FFHA 1H1TA 2F3QA 2UYYA 2VCHA 3F8WA 3GK3A 3GZJA 3LSTA 1TF7A 3FSGD 3AUAA 5D3ZA 5JD3A 3TTVA 4P8RA 2B5VA 3VFDA 2XITA 2UZ4A 1F17A 2XF8A 2YJTD 1E6EA 4DNFA 1XMPA 4TWJA 4RTKA 2BZSA 4O1IA 3SSAA 1RI2A 5L3QA 1ICIA 2ZB8A 4IDOA 2QT1A 3K09A 2J5RA 1E6WA 4W99A 3AETA 1CX9B 3BKWA 2JGDB 3I52A 4HJRA 4MS3B 1XRMA 4R2JA 4RETA 4QTTB 4XSHA 5HE9A 2VYNA 2BEUA 2ZWMA 1ZIYA 2ZROA 3NHWA 4TRRA 4QJ5A 1KYXA 5H3CA 2DTEA 3I32A 1FTNA 3RFVA 1QH1A 2I2AA 4YMLA 3FMOB 3JX9A 2VSFA 1YCDA 2MYPA 3HDHA 3OTGA 4KBYA 1E6LA 1NE7A 5CYPA 4CFZA 1EDOA 2H5IA 2JG3A 4EEZA 2D2VA 2YZMA 1SQ5A 2CV1A 4U2CA 2HHJA 2A1TR 4WCVA 4RSHA 1LWNA 2BUCA 1DEOA 1EVKA 2ST1A 1WUKS 3O8NA 3FDZA 1UKCA 2B20A 4NEQA 2I4IA 3H18A 3AEKA 3ODGA 4WZBB 1EG2A 3IDAA 4BPBA 3U19A 2EKDA 2WVAA 3ESRA 1N4DA 2YHIA 3KSUA 3P9KA 1SUDA 4W8OA 4NTZA 1HBJA 2O9JA 3VDQA 2REBA 4GOOD 1I94B 1NBEA 2Q4OA 4U1RA 1QAQA 2JFXA 2JGEA 1W85A 1II9A 1U9YA 2HJ9A 1NMZA 1BU8A 1WDKA 1KI6A 1VSQA 2WG2A 1S3IA 3A4YA 4PLGA 2ZBGA 5J5CA 1DXQA 1L6RA 3WS7A 2AF4C 4FCTA 1JJAA 4NXNB 1YGPA 1XE3A 3NIWA 1OXTA 3VAZA 3P2KA 5BWMA 4S24A 4XSVA 1LQTA 3DF9A 2NSDA 3ZD7A 2Q1SA 1UK8A 1JZSA 6Q21A 3N05A 3EXFB 3ENNA 3TTSA 1NURA 1XNGA 4AN0A 2FNAA 4OYLA 4PZAA 1Y98A 4BV3A 3MG9A 2YV3A 4UPEA 4G0OA 4CV1A 1ZSVA 2UZ0A 2IOHA 4PAWA 3U0VA 2VP4A 2WHYA 1ZRSA 4B75A 3P26A 1W5BA 4BGIA 2OAQ1 2J4FA 1JEOA 3EIEA 4WUVA 3BMNA 4UTPA 1T2NA 2ZTUA 2PZLA 2YC2C 1ORDA 3SDZA 2B6HA 3E5NA 4FINA 2OHIA 3DEYX 1L3IA 3H6KA 3JZIA 1T9ZA 1NVKA 3LO5A 2EL7A 2XQVA 4DDVA 4OMUA 1X7YA 3N2IA 4CF4A 1XPUA 1YZLA 4J7AA 1RU3A 3FM9A 4DM4A 1TQ4A 2WB4A 5KTKA 4FMCB 1AVTA 3DE3X 4Q1CA 1Y3CE 2Z57A 3KVNA 3GFOA 5DYGA 4A3SA 2IS1A 3EGXA 2HQOA 4CKEB 2P3LA 5BOSA 1PR2A 3TOCA 1Y7IA 1AKMA 5T4HA 3WB1A 3TUJC 5F35A 3RUCA 5CLFA 1GQRA 1MIHA 2C7OA 1S4QA 4PV7A 2PZMA 4HQ6A 4NC9A 3SJ7A 3SVTA 3AI1A 4IGKA 1XDGA 3TOZA 1SRQA 3DL2A 5IM4F 4L2IA 2BUBA 1L8OA 4H1VA 3H5NA 4XM2A 3ECSA 4C4XA 2ZUWA 1D6SA 2FCRA 3M8KA 1K5DA 1BEZA 1RM4A 4XQEA 4S0XA 3OZRA 3W9UA 5B2EA 4FDVA 3S7ZA 1CQXA 3B38A 2RHLA 4KGZA 1CF4A 1PG0A 3DKKA 4N49A 3A4TA 3TTXA 3NKFA 3C3CA 2AI3A 2QL5A 1VJGA 5FNVF 5I9NA 3JQAA 4MUBA 1GUAA 1OFUX 3RSCA 3LW7A 4Q3KA 4ZT2A 3VH3A 4LX0A 2ZUUA 3WK8A 4W4TA 4KQ1A 3B78A 4FMDB 4MA0A 2FDCA 5HBGA 2Q1YA 3FUTA 4WAUA 5LZ2A 2CJWB 3L8YA 2X0KA 2GS9A 3IT0A 3VJRA 4LXXA 4F0JA 3T7CA 3AL0C 2FOIA 1JDPA 4YRKA 1Q1BA 2QN7A 3ORSA 3T52A 1SCUA 3EXAA 4G0VA 4ND8B 4JUIA 4QPZA 4U3JB 3HFGA 5AJUA 5HKLA 3HI6A 3KKMA 2FPPA 2J9YB 4HTFB 3O9MA 4Y2VA 1E1RA 2JIPA 2J41A 5CR9A 1Q1ZA 1NVFA 3AF0A 3AQIA 1Y1KE 3O90A 5TMDA 1RKVA 4DDKA 3N8KA 2PE5A 2CL0X 2GB4A 2C9BA 3O84A 3OJFA 2DSNA 2KQUA 3A1FA 4V38A 3ZS8A 4F9GA 1HFWA 4O08A 3W2FA 4GYKA 1FLVA 3KZVA 5E9AA 3GUVA 1Z26A 2AQKA 2HMUA 2CXHA 2SCUA 2J3QA 4EG6A 4BXOA