5B2EA

N,n'-diacetylchitobiose deacetylase from pyrococcus horikoshii complexed with its inhibitor mpg (acetate-containing condition)
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
267
structure length
267
Chain Sequence
FEDIDTFEEAFNKLLREVLEFDLQNPFKDAKKVLCIEPHPDDCVIGMGGTIKKLSDMGVEVIYVCMTDGYMGTTDESLSGHELAAIRRKEEEESARLLGVKKIYWLNYRDTELPYSREVRKDLTKILRKEQPDGVFAPDPWLPYESHPDHRRTGFLAIESVAFSQLPNFSNTDLDIGLNPYNSGSFIALYYTHKPNYIVDITDLMELKLKAIRVHRSQFPDDIWEKWEPFLRTIAMFYGEKIGVRYGEGFRIMPGLFYHITPFTDLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Putative uncharacterized protein PH0499
publication title Substrate recognition of N,N'-diacetylchitobiose deacetylase from Pyrococcus horikoshii
pubmed doi rcsb
source organism Pyrococcus horikoshii ot3
total genus 99
structure length 267
sequence length 267
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02585 PIG-L GlcNAc-PI de-N-acetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10320 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold LmbE-like 5b2eA00
4XM2A 3DFMA 3WL4A 4XM0A 2XADA 4XLZA 3DFFA 5BMOA 5B2FA 4EWLA 3DFKA 5CGZA 1Q7TA 2IXDA 1UANA 1Q74A 3WL3A 3WE7A 2X9LA 5B2EA 3DFIA 4XM1A
chains in the Genus database with same CATH superfamily
3C6ZA 3BE8A 5HRAA 4MPJA 5KWVA 4X00A 1FZTA 4QFBA 1SHLA 4G25A 3ZDZB 2H1LA 2OWEA 4IICA 4PHTA 5C9ZA 2RGUA 4H35A 1U0TA 4CM1A 1ELOA 3FW1A 1XPJA 1YA8A 3EMKA 4KBYA 4ZYZA 1LCIA 5CW2A 1TAGA 4CDGA 4ZICA 1OPXA 2QRGA 4MR9A 4EJSC 1ZN9A 3NZEA 3K1TA 2Y2VA 1C8VB 3GLRA 1V7CA 2OLKA 4PQRA 2XWPA 1ADYA 3K1ZA 1RXYA 1F17A 4X7BA 5HE8A 1U2DC 1MVOA 3RBVA 3D3JA 2EFGA 3OMWA 4JSYA 4GWGA 2CNNA 4Q66C 4TSRA 3ROQA 2IXAA 3DHEA 2OQ2A 2QN8A 5KJFA 4LWQA 4G0WA 3AW8A 1XJCA 1XRSB 1YS4A 4H0NA 4JYBA 4GI2A 4OV6B 4F91B 2WVHA 2GT1A 1SZPA 2IF0A 4MQ4A 4EO4A 2JFOA 2CT8A 2ECKA 1YU9A 4HAWA 5DTIA 2Y27A 1GM5A 1M8PA 3ENNA 4NZNA 2H8GA 1LPOA 4JVLA 4O4HF 3T54A 1R4ZA 1XELA 2JGAA 4ENQA 1GTSA 1JIXA 1H2WA 3LQ4A 5HGXA 1SD1A 2CF5A 3USES 1BH2A 4RFVA 4BASA 1IAVA 3DXFA 2G67A 2IE8A 4OIFA 1VGVA 2EERA 1LI5A 3CZAA 1HK7A 4ASUD 2YX1A 4OOEA 2ODTX 2EQAA 3B5IA 1PEDA 1BU5A 3DSRA 3UTDA 3CF4G 5LN1A 4BWYA 2R00C 1B73A 3S2FA 1LNSA 4XM0A 1RHUA 1X1EA 4I08A 1E1DA 4RAOA 4CFYA 3NJRA 1QYXA 2XQFA 4JC0A 4CLRA 1J2YA 3NDRA 1J2RA 4HWGA 4Q34A 2VBCA 4M0EA 4TVKA 1I0LA 5JBIA 3D8UA 5KVVA 2VH1A 2Z98A 3PDIB 1S2GA 5E8RA 2F8MA 3A7DA 1OWOA 4XRRA 1L5WA 2OBYA 2YXPX 3I4LA 3OPMA 4Q3NA 5T3UA 4CLOB 4HVTA 4MEJA 3KKQA 8AT1A 2Z9DA 1F2TA 1JSRA 2ZB3A 2WMYA 3QOFA 1VL0A 3Q3HA 2WG2A 1XZAA 2OG1A 4R54A 1DAKA 5EMLA 4B46A 5EMHA 2AOWA 1JKIA 2QRVB 1ZDMA 1XALA 1QP7A 2CBZA 2QAGA 1HX7A 3WNCA 2ORWA 2YIVX 2LP4Y 5HJ7A 2A35A 1TT5B 2X6QA 2LKDA 3AERB 4AS1A 2OCYC 3QXGA 4ZMBA 4RS3A 5CDSA 2IPXA 1ABEA 3FROA 4MWSA 4CKBB 5IBQA 2OAEA 2RHBA 3QG1A 1NUUA 1SBZA 4G8CA 4YCNA 2YN2A 1K6MA 4FOOA 1E1YA 4LCBA 3KM0A 4KAXA 4PYIA 4CV1A 5BV8A 3A1UA 3KSZO 3KDPA 3UXEA 1EDBA 3L0DA 4GMGA 1XRNA 4O5AA 1P9NA 4FMCF 2Q1XA 4YXFA 1QRSA 3K70B 1H2RS 2QRUA 3ENQA 1KEEB 3RC3A 3UY4A 4C4TA 2OVFA 5KDOA 4BFZA 4MPTA 1X7XB 2HT1A 3L07A 5GINE 1KZ9A 4PLHA 1VIYA 1TPYA 1QIDA 1U7XA 2ZSFA 2Z2IA 3QE0A 5HXAA 4E12A 4ON9A 3FPJA 4OI4A 5DSXA 1DFIA 3E9EA 1JBEA 4JI2B 4ZYUA 4X61A 5IJZA 1H8HA 1LU9A 4ZU1X 3D4NA 1AKMA 1LVGA 4AJKA 5HZGA 4B3DA 4X7MA 3UB2A 3GJ4A 1BTOA 3GFSA 3IVCA 4FIDA 4KXLA 3CVYA 4MAFA 2J48A 3OA2A 4MGEA 1GN9A 1P7WA 4Z9FA 3TNLA 3S0JA 1OASA 4EHKA 1H9CA 2ON6A 3DVLA 3N2GA 2D8AA 3DWFA 4C0SA 2HR1A 1RRGA 1MBZA 2QT0A 3A11A 4IX1A 2ORVA 1UC4B 2C3PA 2Q4DA 2VO1A 4JP8A 5CMLA 4W5TA 3R44A 2PKRA 1BE1A 1NLYA 2HPAA 3A1WA 4WNAA 1JE0A 4LNAA 1GLGA 1E1CA 3VO1A 4HLCA 1RQ2A 3DJFA 2XDAA 5JCZA 3WWEA 4K9DA 2QQ0A 2RAPA 4OB6A 5A5DA 1N1MA 3EXIB 1QLWA 2PEYA 2UYQA 3QUSA 4B75A 1EIWA 2EVWX 4EY4A 4AKTA 2KWIA 2EATA 4MVYA 4QREA 3ZWMA 1CZLA 1YQGA 3HDHA 3QKRB 3VR3A 5F9HA 3D5EA 2NUTB 4FOTA 3VSDA 1KIFA 3C7AA 5LP6B 2OCDA 3KQVA 2PA0A 4WXRA 1CHDA 2CXTA 1WEKA 4OHBA 2OV6A 4ZPXA 3EGIA 1CY6A 1JDNA 3W90A 3BGVA 4CVNA 1Z4NA 5I7VA 2C3UA 2R6DA 5BSKA 1TECE 5I5GA 2WYHA 3MTJA 1RDFA 1T8RA 2W6JD 3IR7A 4ISBA 1EFKA 1IONA 2C9BA 3DAOA 3GEPA 3TIIA 4CMAA 2P1RA 3QX7A 1YOBA 3DOOA 5AI9A 5KYXB 1IN8A 1Q5PA 3PFGA 1I33A 4PRLA 2AEJA 2Z1NA 1EKXA 4OQ4A 4B3FX 5A5FA 1W0CA 2G6BA 1Y6GA 3PXEA 1HFEL 2A2ZA 3OE7A 1RNLA 4MAAA 1P3JA 5DCUA 4FT2A 4BB0A 1QE0A 2PHZA 3L7DA 2ZRGA 1ZNQO 2QTVA 1GV1A 2D13A 4QTZA 2XYGA 1M2OB 4HFJA 2EBUA 4YYZA 2V0NA 1YHYA 1E1QD 3R9IA 3QWBA 3SYNA 4DR1B 1QYRA 4QNRA 1JDJA 1QLHA 4X7PA 4JBNA 2A1IA 4Q3DA 4Q3KA 5E9WA 4EKNB 1D1SA 2X1LA 4GT1A 1LI4A 4OHZA 2OCPA 4N82A 4RXTA 2QL6A 3IIKA 4J94A 3ESRA 1WCXA 1ZKMA 4WQMA 2RGNA 1U28A 5TF0A 1VLMA 1ZD2P 2BZ0A 1O96B 1S8AA 4LMRA 2GYWA 1A9TA 1M7HA 2W8ZA 1E69A 1WEHA 1U7TA 3RYFB 2QVBA 1YE8A 1F1JA 3IE2A 2XA9A 4F72A 4FYJA 3JATA 1CIPA 3LCJA 5JYBA 1IDOA 3B20A 2YXBA 5J4VA 2FNAA 2BY4A 2RBEA 3FCYA 1TVEA 4FS8A 3UMBA 3V1LA 4E5DA 2WQZA 4MDEA 2H7XA 3ABOB 3PV0A 1ZW1A 4QX6A 1RM3A 2ONZA 3B70A 1TM2A 3HVHA 3I9FA 3OM1A 3OUTA 4JOQA 3SC3A 3U81A 3EGDA 1MO6A 5AKIA 1GOTA 4PO1A 2GAOA 1KR2A 1J49A 1OY1A 3DE6X 5GZ1A 3F5SA 4OXRA 4Y0NA 4F8EA 4AQ7A 1ZOPA 5GIPE 2XT0A 1RYYA 3DDUA 4YASA 5FH9A 5IT9A 1Q1GA 5ALUA 1RRMA 1WP9A 3ITDA 4ZTZB 2VRWA 2Y8EA 1OGIA 2ZRNA 3H1GA 3WK7A 5GVSA 3TQCA 2J5RA 3UJBA 4LMBA 2FHPA 4ZVRA 4JXKA 1YCHA 2YHIB 3CRQA 3KTFA 1GL6A 1USIA 1PYGA 3CW8X 3O38A 5IVDA 3ZDQA 1A3CA 5CJJA 1JR4A 3ZHBA 1FYEA 1HV8A 4F9EA 5E0KB 1DFGA 5EHXA 4HDKB 2HAEA 4PHCA 1GLVA 2X0EA 5LQJA 3MWFA 3H4IA 3G88A 5KYYA 2QRPA 4LKRA 3H2HA 3K16A 1UXIA 3HN2A 4AURA 1RZUA 2MINA 3REFA 3RIXA 1JKJA 4C5AA 4X66B 4IHJA 2B36A 3U3XA 1M5TA 1N5KA 5IH3A 1MOPA 2P78A 4B33A 5KJ1A 4FCVA 1EGVB 1IG3A 3CKKA 3B3AA 3KOXA 5K3OA 1JWLA 2F90A 2PUCA 4L51A 1O6BA 1JAIA 4GNRA 3WL8A 4A9AA 4DNXA 1SFRA 3KT6A 5GJVC 3TVYA 4CKXA 1W5EA 1FLAA 1HO3A 2JD0A 1DQZA 2XQGA 4JOCA 5DLYA 3T4UA 2AKAB 4ZDJA 4CETA 4CEIB 2BFAA 4FCWA 5D3MB 2IYXA 2VIIA 3IEIA 1ECBA 2Q6IA 3JZAA 2BDUA 5K3FA 2NZVG 4ALLA 5KX5B 2OCXA 4MJ7A 1OD6A 1CLEA 1LDNA 3AV0B 2MSDB 1V16A 4H3KB 2QL9A 3AEXA 4J3NA 3RIEA 3A37A 4NHOA 2Z8YM 2FPGB 4N5DA 4OLJA 3RGGA 1V1RA 4CGYA 3P52A 2A4MA 2VWGA 1PI3A 2XOKD 3DZGA 4BJ1A 2ZVPX 2RHRA 2PIDA 1AA9A 2NV2B 1YOVB 2QLNA 2VP4A 3BUSA 3H8SA 4HH0A 2PMDA 1MO2A 4HNRA 1AKWA 4YRCA 3OT5A 4AIIA 3TGLA 2JKVA 1ZD5A 3MELA 5LYYA 1VRCA 1KMHB 4TWJA 2WIFA 1OSNA 1Q7GA 1XCOA 1L4NA 4JWKA 4RPJA 5DB4A 1U4OA 2PGJA 3R3HA 3C97A 1CUFA 1KEUA 2J9XB 3OCCA 4FPXA 3E18A 5DHPA 3P4UA 4ER0A 3L7OA 2WWTA 2AOVA 4C7MA 2QNIA 3FYUC 2QORA 3PQ4A 4MB2A 3CEPB 4M83A 4F4CA 4UCXA 1LTKA 2PJRA 1JH8A 5CA1A 5I7OA 2FSVA 3OEEA 4M37A 2O52A 2SCUB 4OMDA 1YNSA 4CQNA 2QTHA 2CHGA 3P45A 2BSAA 1FFAA 4ZHSA 1F9AA 2Q5HA 3RKRA 4DGQA 3LWDA 1RQLA 4KGVA 4GGPA 3WNQA 2QDXA 2FN7A 2J67A 3V4ZA 2IXFA 1JB1A 3BPSA 4Q7QA 2QX8A 1LV7A 1U9JA 3IXLA 3C41J 4JT8A 1AGXA 5A04A 1AHIA 3GMTA 3L41A 3N0TA 2Z8XA 3PNMA 3I9JA 4U5QA 2MSCB 3CCBA 3QVVA 5FR2A 2Z5VA 3IMEA 1LJUA 1NVFA 1VMAA 3CLSC 3R8CA 3O0TA 3TLXA 3LM8A 4C4AA 2FZ4A 2VL7A 2RMKA 4NAHA 2HTEA 5JMOA 4D46A 4WFJA 2JKYA 1AKTA 1HYHA 2R97A 3O47A 4OXNA 1N6IA 3U80A 5AW4A 3CVXA 4DEVA 1ZNZA 4L6AA 1EM8A 1DXOA 2JFZA 3GRVA 3PQFA 4KFUA 1HTTA 1QZZA 1RZVA 1Q92A 1ZGJA 4F12A 3MYYA 3FNEA 1DTSA 1DS6A 2GD1O 3ETLA 2Y6VA 3CBGA 4I7EA 4IIGA 1T6ZA 2F3RA 5JYEA 4MWEA 4BNUA 1L4YA 1AMOA 4AKEA 3HKEA 1M2EA 4IVNA 4D25A 3MINB 3CKYA 3LTNC 3PQEA 3PC6A 5DTEA 1I3OA 4P2BA 1Z5VA 3AEQA 3G2NA 5CR9A 2GYVA 3C1TA 5DOVA 2AMYA 2HIMA 4R1NA 5IF9A 3VZPA 2BYTA 1P80A 3T1YB 4CFZA 1T25A 1DEXA 1DT3A 2QLTA 1RRFA 3NB0A 4NCHA 4HFRA 5DYWA 1MMFB 1G20E 4I50F 4NE7A 4AP9A 2JCGA 1I5EA 2O2EA 3OIGA 4KG7A 4W8HA 2GR9A 3F5DA 2W90A 1GITA 5AUPB 3LUGA 4MPDA 4ECAA 1T8TA 3UHPA 5A71A 1SOWA 1Y98A 2C9DA 1XGKA 1K86A 2ROQA 3L06A 4OEHA 3JWGA 4RC9A 5BV2P 1X2BA 4G5SA 4RFSA 5FTKA 4JLKA 3K30A 1R8QA 3A4LA 3N8NA 4OH1A 4F3CA 2Z4TA 2GPAA 2ILTA 1TTHA 3D02A 5A6SB 2PUVA 2WNIA 1E61A 4UHJA 1V4BA 5FUWA 1UK9A 3K71B 2ZITA 1CUHA 4YS6A 1GARA 3FNQA 3JQGB 3K1AA 2I55A 1S01A 1ZH4A 2Q0HA 3THWA 1F14A 2X4GA 4RF4A 1YASA 1VG1A 4CM8B 3ZD7A 2IHTA 2YXEA 1DAGA 4B2IA 4RA6B 1X7ZB 2IYOA 1BG6A 1BX0A 1H2AS 2QT9A 2XV1A 2HCBA 3NM5A 5EWLB 3KFXA 3WQSB 3FUWA 2ZU6A 1Z4JA 4PZEA 5ICGA 4CMBA 2X8JA 4NPHA 2YRFA 3PUXA 3FPLA 5EJ4A 4Z8XA 3GFGA 1ES9A 4EA9A 1XQWA 3ZY4A 4RPIA 4C78A 4YMSA 4YACA 4M22A 3U7EB 4G0UA 2UAGA 1E3TA 5IVPA 1VCIA 2DZDA 1QTRA 3OZWA 4M0KA 3RTBA 1W93A 1CJVC 1GNPA 4JLJA 4B84A 4DSZA 1KZ1A 4IIBA 3CTPA 1GSIA 1H1LB 1K63A 3I23A 1L4GA 5JBNA 1W36D 4ZYTA 1G20B 1VLHA 2JFBA 5LC1A 4B3XA 3DHWC 4AM8A 1JBKA 1TEHA 3P0EA 3P0JA 5TF4A 3D4LA 1OAOC 3PD1A 3CNEA 2ZIEA 4LNUB 1XZPA 2B99A 3G85A 2VP9A 3LPLA 4GC5A 3WGQA 2ACWA 1XFAA 2PWAA 1Z6XA 5HJ5A 4L74A 3DMTC 4BN4A 2X5KO 1P1FA 3CFYA 1DRUA 4H16A 3TRJA 4Z53A 5BPHA 2W00A 4UTZA 1WUYA 2XY4A 2E55A 1U63A 3D6UA 4D57A 2ZBPA 1QHSA 3KQNA 2EAUA 4FE7A 4YT2A 4LJAA 2D5LA 2N42A 3A1VA 5LM3A 4TTJA 2PD6A 2VQ3A 2Q5JA 1A95A 2XT6A 4Z51A 1XZBA 2JI6A 2VWPA 1Q7EA 4NNJA 3W04A 4M8IA 2JS7A 4JUAA 4IIUA 2C95A 2EJUA 3VR6D 4IDOA 3IAAA 1SMKA 4JBIA 1C1XB 4HG2A 3OQMA 2Q5EA 3UV3A 3IERA 4CG3A 2J9ZB 1G5RA 3GA0A 3Q9SA 2QYOA 1SVKA 3CX3A 3WYCA 4U9UA 4B6PA 1SY7A 1ZM7A 3ONWA 3KQHA 1KQOA 4ZPJA 5G02A 1O7JA 3P9XA 4MW0A 1QKJA 3FSEA 4P5PA 3UFXB 1QRDA 2Q3BA 4MW4A 2D0DA 4KPUB 3HG7A 4QQFA 4ZZ1A 3QFCA 4TV9A 2IS4A 1L8AA 4Z4EA 3T1OA 1Z07A 3DOEA 2CDBA 1H66A 3EZ6A 3N2IA 5A0TA 5DKFA 2QQFA 4R9NA 3EXG2 2Q7XA 4XSVA 5JADA 3RU7A 2QMYA 4BFCA 2E49A 1RCFA 3NG1A 1EGQA 5IAGA 3VKFA 4DMUB 1NG9A 3JQ7A 4BMXA 2WM8A 1UDXA 1V8OA 1PBTA 1E79A 4ESHA 3ANLA 1M75A 3SQXA 2WKRA 3SNKA 2HJVA 4LY0A 1O95A 3BS4A 1U0NA 3N75A 1N78A 4YDHB 1DMRA 2CZQA 3AP2A 3DZCA 4CCYA 1XVUA 3G02A 4XB2A 2VT7A 4WGGA 1C9DB 1U1DA 2RH5A 4HWOA 5KOIA 4F3TA 1SD2A 2R6ZA 5G4LA 3FUVA 1A9YA 1VLLA 3MTEA 1MABA 3O1LA 3CH6A 1SG6A 3I72A 1KORA 2D0OB 5MHTA 4PLPA 1KEWA 3JWEA 5EP3A 1PR3A 2COUA 2BUBA 4NXNB 1R5OA 2NO1A 3UKJA 4B9EA 4BRWA 3OZ7A 3W8NA 3K31A 3C5VA 3GOHA 5CNJA 3MSCA 3W2GA 3L6BA 3RF7A 3L18A 3HU3A 1A4XA 1JZSA 1SR8A 1UBUS 1J1ZA 1JGTA 4HDSB 5FORA 2E4VA 1E66A 3IUSA 2AWNA 4TPKA 4MW6A 3WTBA 4B2PA 4YHHB 2DR2A 3FG9A 1Y7PA 2CUNA 1S8NA 3DEFA 4J4HA 2IPMA 4HNTA 2W58A 5EHZA 2IYYA 1RJDA 2ZT6A 4N3BA 4PVCA 4ZEXA 4RK7A 4M60A 2EC5A 1SXJE 1R00A 1IDN1 5JU6A 4ZARA 4UOEA 1YVPA 3SEZA 2HW8A 2XYVA 4AULA 4BWVA 3H42B 1IVYA 4K88A 4D81A 3HDVA 2Y1CA 3USCS 2YS7A 3HWWA 3IBTA 4NCIA 2IOYA 4O4HB 1GKKA 3V1UA 1J09A 2BFCB 3JCZA 2DOKA 2VHJA 2Y9PB 3S7TA 1RI3A 1USWA 2WSIA 3AZOA 3KUCA 3B1WA 4PFSA 4XLZA 4JUCA 2XMQA 3AUUA 1R6XA 4DQKA 4M76B 3QVSA 1Y6JA 3HU1A 4EAAA 3IE1A 1KH3A 1ZK0A 5JFOA 4KWEA 1U1FA 3EBLA 4EG1A 4HATA 3V4FA 5FYQA 1UXJA 4I55F 4JSRA 2O07A 1SC4A 3C3EA 4YWHA 4ERXA 4YTEA 4M7RA 3L8CA 3QGMA 3QXSA 4FGZA 1WPGA 4UHCA 3RUDA 3UJCA 4D5GA 4DTCA 5DBOA 4RVNA 3O74A 3D1VA 3ESDA 3OJFA 4B5KA 4AIRA 4RIIA 4V0LA 3PXDA 2P0AA 4KNWA 1A9PA 1FUUA 2ZUCA 5H82A 4GC9A 2BL4A 1T2NA 2OL4A 1XC7A 2ERYA 1XLTA 3OZTA 2H4JA 4FMPA 3FY4A 1DHRA 1RZ3A 3EVEA 3MAGA 1JYSA 3D6FA 4IAOA 2XKBA 3F67A 1F2DA 5KHOC 1QHIA 3PE4A 4HOYA 2IXTA 1BD3A 2FETA 2XTAA 5GTDA 5L53A 2J0UB 1ZGAA 2WTAA 3BFXA 3BD6A 5KYWB 1FDWA 4EQ6A 3OECA 1Y34E 1RKUA 4FEAA 3U5ZB 3LTEA 1EHCA 3ZE8A 4MCJA 2WD7A 1Q1BA 4J3FA 4AY4A 4RTLA 4BZZA 3FTEA 3IJEB 4NCXA 2ZUTA 4DLBA 3TF5A 4EY5A 1LC0A 2Z9BA 4G89A 1J22A 2CHUA 1SXJB 4RLQA 2P40A 1E9DA 2D0IA 3R6TA 4I6GA 5EWJB 1KTVA 1FTSA 1QS0B 2ZE6A 3KOWA 2XW6A 5E6SB 5I7FA 1SG0A 3C74A 5A5VA 1PNOA 2HO5A 2JJMA 2V7BA 3JALB 5DW3A 5F64A 2V45A 2ZI9A 2FPSA 5I9NA 3QVLA 1LWNA 5BSMA 4I66A 4JU9A 5JSZA 1LSUA 5HTKA 2VR1A 3SICE 2AL7A 3GROA 1JHMA 3E82A 3S2IA 1JR3A 4J29A 4QXRA 3VC2A 5BQXA 2H1SA 2YFKA 4JZKA 1M6VB 1ORWA 4N3NA 4X1OA 4XUGB 4EBBA 4V2IA 3ZHRA 2VT3A 1WX1A 3STTA 3R0IA 2QTAA 3F49S 2B20A 2D0PB 3QF4A 3U3MA 5HKOA 1YR8A 3BB1A 3Q7EA 4JYAB 3HCAA 4Z4HA 3QKWA 3PHJA 2YS6A 5CCBA 1YCGA 3H2SA 4B6EA 1EAYA 2VUTA 4E51A 5FLYA 4GBGA 2IV7A 3ZGXA 2NPIA 2JCSA 5A62A 5FWYB 1GNQA 4FX2A 1PV1A 2WUVA 1DIHA 1FXSA 4BC1A 3JU3A 2NN3C 4AMVA 4POOA 4BXOB 2AGVA 1J2JA 1JFVA 2NYVA 1ND6A 3CZRA 2ZBEA 3F5FA 1DB3A 3H11B 3LL7A 4GMDA 2YJNA 4X8OA 4ENUA 1G3IA 5JJBA 3B1JA 2IP2A 4KE8A 1Z17A 3WSVA 3HTXA 1THTA 1GUAA 4R8LA 5LUBA 4FB5A 2XYRA 1DC5A 4Q4AB 5ALGA 1IAQA 3BG5A 3O1HB 1QDEA 1KMMA 5AOCA 1V8DA 3L0OA 3KOOA 2OO5C 2IIQA 3IAXA 3DWGA 1LZLA 3NJ4A 4C5CA 1F20A 1KAOA 4Y1RB 5KNBA 1FLVA 3TZKA 5EE0A 3DKIA 3TG2A 2C8VA 2EZ4A 2PXHA 3M1LA 3CNBA 2QTRA 2HRQA 3PXCX 2W48A 1IM2A 4IBOA 3WKAA 4KXNA 1QC5A 1EJBA 1THGA 3DULA 2G5CA 3TSZA 5BW6B 1P1IA 1KYTA 2RJ3A 3H2JA 3UWDA 1KBOA 2AG0A 4EPRA 2ZPAA 2FE4A 3OJEA 3PFBA 7ABPA 5CAEB 4EKDA 4U7PB 1W44A 2H5LA 4C6RA 3R3YA 2ACEA 4BLPA 4OY3A 3ESZA 4MPPA 1L5NA 2EZUA 1CJUC 3VYWA 3PRJA 1IN5A 3KJEA 3IEKA 4G0QA 1N5DA 2P2YA 1I1OA 2DC1A 1IG0A 2V7PA 3KEFA 3NRCA 3GOQA 2VJQA 4JLOA 4QBTA 4RK4A 6REQA 4MQEB 5ICEA 4D41A 4EYGA 2RD2A 1LRKA 4REQB 3ZJVA 2UXCB 2HM7A 1SVOA 4MSUA 4C01A 4JXJA 2PEZA 1IBSA 3OLZA 1J5EB 2R8RA 1G55A 4XWGA 4FFLA 3RT7A 3U3ZA 1ZKDA 1QYVA 5JD3A 3JQ9C 1KKMA 3WL7A 2I54A 3KETA 4EATA 3FRIA 4A3SA 2Q1WA 3BQMB 2P41A 4F2HA 5GP1A 1CS0B 2IYSA 4OHUA 2IP1A 1KRWA 1M6YA 1ZRHA 1JAXA 4EPYA 4CKEB 5M7EA 3RYIB 1NW8A 4MDFA 4DV7B 4Q1DA 1C3EA 1BWPA 3EA0A 5EJ2A 521PA 2V7XA 3BMNB 3W1WA 1O57A 4BMDA 3D8BA 2WKPA 2I2CA 3LHSA 1EX1A 4NZZA 2YQZA 3ZTYA 1QH8A 1FRQA 4D4JA 4AUKA 1VMEA 1GZDA 3HEMA 1U0HC 4HN9A 3DBLB 3NBXX 3K72B 2NTVA 1VL1A 3D3WB 3IP5A 3G1UA 1RZRA 3LHDA 3E8SA 3ZHYA 2ZI3A 4JC8A 2W2KB 4ZDWA 3AESB 1N1GA 1CF9A 1F0PA 1R6DA 4C0JA 3U7RA 5GONB 3F3SA 1KYXA 2GJKA 2XXJA 4UVEA 2J7PA 1TB4A 1X1SA 3M1IA 4BWGA 3KJQA 3BWDD 5JY1A 5L3VA 3HK2A 2C1XA 2J9YB 3CLTD 1HE3A 4YGYA 4DXHA 1CY0A 1N1EA 3GVPA 1CUGA 1JI3A 2YFQA 4FGSA 3N2LA 3QHPA 1ZHHA 2G4LA 5SZIA 3ZR4B 4EFMA 4M6WB 4DJJA 1MEJA 3LQKA 3LGAA 3QKTA 3QBDA 3EFOA 3IP1A 1T34A 3LYUA 4ZU6X 2JIZD 1Y8CA 4GICA 4JDPA 4NI5A 4RYDA 4M54A 3VNRA 3THXB 2IYAA 2HYDA 3ER9A 2ZWAA 3E1KA 3B78A 5KCZA 2V8BA 3G7SA 5AVXA 3VZSA 1GG8A 1V3QE 1WJGA 3O7WA 5ALPA 3I2GA 2ODPA 1R27A 1MG5A 5F4BA 3KJGA 1Q1NA 3TQIA 3ECSA 3I1FA 4F5WA 3A2LA 1NVBA 3DW1X 1R9NA 1B15A 4CMIB 5HUHA 2I2BA 2XKJE 4MWCA 4C89A 4BZXA 3OZXA 4BQSA 3WAJA 5FL7D 5DH9A 3EC1A 3GFFA 3K9CA 3DBVO 1UC5B 3WO0A 3DCYA 2XEXA 3B1ZA 2XDQB 4I4TB 4PS1A 1QCDA 1CKEA 2VRCD 4LOKA 1LQUA 1ZD8A 2Q3FA 3RS5A 3BMOB 5D01A 3QYFA 1KBQA 3ELWA 1FB5A 4DRYA 4A8JC 3OLQA 4FFRA 4NTZA 4UVHA 2AZDA 3BE4A 1MV8A 1UUFA 2WJGA 4ETIA 5HRCA 5IH7A 3R7WB 3EXFA 2CXPA 2IYPA 2WU0A 3AM5A 1VHJA 2J3IA 1NQ5A 2CJXA 2OMKA 4LHEA 1V47A 1VHQA 4Y6GB 1NVWQ 3OBBA 5T4FA 4DLVA 3WX0A 1NBHA 5K99A 3QQ5A 3TQHA 2GNPA 3E48A 2JLCA 1HOTA 5E9JA 2OZKA 5DM4A 1GPNA 1PR4A 2GBCA 1AGPA 2NNLD 2VNHA 3BIOA 3SBXA 3SWWA 2X2FA 3A6GA 3J7AC 1ISPA 2BGUA 4HGZA 2A9QA 2PSSA 2RC5A 4PSUA 4ZIRA 4A2QA 3VZDA 2QMUA 2JK0A 3VPFA 4RLSA 4ND6A 3DB1A 1NXTA 3UOAB 4UCFA 4JQZA 3CCCA 4N7RA 3HDQA 1YIAA 4YUWA 2QRKA 3GRAA 1FMCA 1XLVA 4ZI7A 1XRMA 1V96A 4YEDA 1U8UA 5BURA 5JY6A 3OIWA 4TWAA 1T9BA 1SKYE 5LCXA 4FEYA 2VDWA 3WNZA 4ESEA 4TOIA 4IQ8A 4TL7A 2O8DA 1EEXB 4QELA 1QNFA 1TK2A 2C20A 1BWSA 2IUTA 2FZKA 2Y0BA 3ZX5A 5C80A 4CLXA 1BMTA 3GGDA 4BMOB 2UVPA 1CF4A 3PX2A 4BNGA 3Q3CA 1HE1C 4LGYA 3A1TA 4EO9A 2GEFA 4KJZA 1WDTA 3VJRA 4EHBA 5F9MA 2VN8A 3EEIA 4JLDA 5HQJA 3DAPA 1AQ6A 1E3WA 4XDHA 1H65A 2PLNA 4MP6A 1HNZB 1N32B 4LJLA 5ALRA 4LRUA 4JLWA 4B7AA 3JWPA 2HADA 5KQLA 1JAHA 4G84A 2ADMA 2I22A 4JI4B 3CH4B 3QMVA 1Y89A 4NZOA 5AW5A 4GRIA 1V5WA 3GU3A 4MKIA 1DG1G 3RQIA 5FPKA 5EFOA 3W8RA 2BGTA 2WPDD 5LZ9A 2MCFA 1ONSA 2X0NA 3E6AA 3AQ4A 1Z06A 4AN4A 2PGDA 2AOUB 1SZDA 4X85A 3P96A 1QIKA 3ECAA 1FRFS 4OXIA 3GFVA 3LOUA 5CM9C 3G2HA 5F7ZA 3ONDA 5F3DA 3PUZA 4OQQA 4U7WA 4IDDA 2H48A 1RLUA 3A0UA 3DVAA 4AYTA 2GZ1A 3SYRA 1CE8A 1U6KA 2PBLA 4CIVA 3BTVA 2OKCA 3TIFA 4I50B 1KZ7B 4HXYA 2G1UA 2PKQP 3I2JA 4PC6A 2AI3A 4OJTA 2BGLA 2R47A 1LSSA 1SQSA 3S2SA 3WJ2A 4GVPA 4CUKA 3GN1A 4LF9B 3VHLB 3BE5A 3RODA 2XB2A 2ZRQA 2JHAA 1Y4DE 2KW5A 2RH4A 4YCAA 2R6R1 4BNFA 1N2JA 4UTNA 1SKYB 2PMBA 2DBZA 4Q7EA 3HWRA 2OXTA 1Y48E 3OTOB 5HTOA 3RGWS 3FWKA 4A16A 2P62A 2DXIA 4MV4A 4OVKA 2PBZA 3T3PB 2WZBA 1B74A 1KQPA 4OFBA 2DLCX 4BMPB 4FXOA 1KJIA 4DA8A 1YR6A 3HFSA 4P86A 3QUCA 4FE3A 2Q5FA 3NX4A 4OF4A 5CITA 4Z3OA 2ZAMA 3LG2A 1C7ZA 4RK6A 4C4RA 1JXMA 2BR3A 1DKUA 4LTNA 1VRWA 4LF5B 1E96A 4DCUA 1EG7A 2VDPB 3DVSX 1FRVA 1KO7A 5IDYA 3SR4A 3O8LA 3SHWA 1N8KA 5ALWA 2C0QA 3KTOA 3SKXA 1PKXA 1GYPA 2WKWA 2X76A 3KWFA 5KINB 4X1IA 1ZZEA 1SZJG 1MT3A 5ARBA 4MR7A 3P2OA 3EG9A 3PDHA 1XOIA 3UXYA 1GZ3A 1LSJA 1F4PA 2BM0A 1ZQ9A 2GAAA 2C92A 2ZR8A 1PQPA 4M36A 3ZIDA 4D8UA 4J9UE 1KEVA 1J70A 2GA9A 2QK4A 4EUKA 4P4TA 1TEZA 1QE3A 2VZ8A 2Q1SA 3GAAA 4G1BA 4D7AA 1K0UA 3A4VA 4JT2A 3UWPA 5F73A 3D4PA 2ZWOA 1FSFA 3MUEA 4RZHA 3U0BA 4Z9BA 4JMLA 4DLTA 2JEZA 3U7FB 1CJBA 1O77A 5HFJA 1L7VC 3TL3A 3BKXA 4KXXA 4LZPA 3TOXA 5EJEA 2ZTHA 1KO4A 1RRCA 1VFPA 5GVRA 3I9MA 3U40A 3PWZA 2XLBA 4QDOA 2C98A 2GZRA 2ENUA 4HMQA 2CF6A 1RC1A 3UT0A 1N2OA 1A1VA 3OLVA 4MR8A 4UNIA 2EDCA 4BNMA 1YS7A 3EZNA 2H08A 2JHFA 4H4DA 4WDQA 3RRFA 4RPKA 4E31A 1A4IA 3L0PA 1LNQA 2H2IA 4RIGA 4EKIA 1UZLA 1EI9A 1ZISA 2QN6A 1AKNA 2ISSD 3L77A 4JA0A 4WNYA 2D2IA 3ZCTA 2P79A 2J0SA 3DMNA 3QELB 3M5PA 1T2CA 3DMRA 5DHFA 2DHCA 2B7CA 3FDFA 1YZYA 4XAQA 1XI2A 3TW0A 3HRIA 4MYTA 2EW2A 3KEQA 4ZO7A 5BN3B 4YWJA 1USKA 1Y9AA 3WMEA 1SHZA 4DT1A 1P6QA 1T2EA 4EG4A 3BB3A 3GN2A 3SSNA 2AUMA 1KMCA 3F9IA 1GNVA 1CUZA 2ZUUA 3KDAA 5FULA 3OEHA 1WDLA 2FOLA 4LBVA 1JRLA 3NEJA 1EESA 1NT2A 1IUPA 1T0IA 5P8WA 1C14A 1UBHS 4EMTA 3EGWA 2DBYA 4RD6A 1BXRA 3CGGA 4TX1A 4BX8A 3C1UA 3QEMB 4QWMA 3FVWA 5CH8A 4PN3A 2R86A 1YDFA 3EUFA 2XZDA 3HPQA 4Q21A 4RSGA 3DP7A 4MRPA 4S04A 1Z62A 2PIAA 4Y9TA 2W4MA 2QL7A 3CXUA 4PRYA 5LZ7A 1YJBA 3HA7A 1ACMA 3ECCA 4L0DA 4C2AA 1DINA 1B26A 1AKYA 3HYSA 4UUBA 1CLUA 1P74A 3FJYA 2NU8B 1Z7GA 1JEQB 1LDYA 5DNVA 5DT2A 5B58T 3ZDXB 1TQ2A 2P7HA 2XUAA 2WZQA 4AX8A 4P22A 3KYCA 1J42A 3PPYA 4LUCA 3ZWAA 4KR6A 1W49A 4E33A 2JLQA 1L4UA 5K8TA 1VPDA 4CIYA 1E20A 1BXGA 1GA6A 3DBRB 1RYFA 1QBGA 4RS4A 2O2ZA 3FN4A 8MHTA 3GEBA 3CSUA 4R5HA 3HBJA 3R5KA 4G9EA 4B2YA 3RT1A 3GWGA 1BEEA 2O48X 2FFJA 1RTTA 1RWXA 3NXSA 3Q9NA 3WOHA 3VM6A 5HYVA 1EMDA 1ZVJA 4OXXA 1HDEA 3KQLA 2ZE8A 1OXBB 4WUVA 3PA8A 3WMWA 4ZDKA 5HOEA 3EIFA 3ZHTA 5JISA 5AW6A 3EPKA 1U0RA 3DCNA 1A9OA 1CUEA 4RVSA 2Q45A 3HVKA 3R3UA 2YNMC 1LXCA 2WUFA 4PAMA 5DYNA 1O94C 1QAOA 2JGDA 4LHZA 5C7YA 1KVRA 4V1CB 4MTCA 5DU2A 4JJ6A 2D62A 4XCVA 4FK8A 3LKBA 3DAYA 4TZ6A 3OUZA 3P9NA 1J6UA 3VDQA 5IBCA 3KTAB 4X60A 2O0HA 3JAKB 2ZJBA 1BGXT 1PJ4A 5NULA 1P1BA 2EP7A 2VEDA 1QR2A 2N47A 2ONCA 5AW2A 2QY6A 4DA7A 5L6LB 3OJXA 1N5MA 4A82A 3CLHA 3OQNA 3VPXA 2WZCA 1G4AE 1HPLA 4KIGA 3H19A 1GIAA 1L5FA 2A5YB 2VXBA 3P2EA 1DC3A 1F4VA 5TR9A 4O1IA 4Z1OA 2C31A 2FPXA 2WWHA 1WXGA 3EXG1 3MGCA 2AFVA 4U5XA 2ZSEA 3ZCRA 1KO8A 1DP4A 4LHWA 3RRNA 1ZMOA 4I1OA 4WOBA 3PI6A 4MIKA 5FI3A 4NARA 2GEUA 3ZV5A 4HZUB 5IDWA 1I80A 4U6QA 3FLBA 1JQJC 3TLCA 4ZAGA 5BWLA 3KLNA 4A6XA 4KODA 4LI3X 4XQEA 2FFHA 1PYOA 2GRJA 1RAGA 1VCMA 4URFA 3AOGA 1T5TA 1Z0FA 3D3EA 4M46A 2XQKA 3BWEA 5K8VA 5DCYA 1JIVA 1KKUA 1NJSA 3WGUA 3MCZA 3VR4A 3T5AA 1RKXA 2AYYA 1NVTA 1IOLA 4I55B 5EHIA 1CVRA 4OMUA 3KCQA 3SGLA 2HMYB 4G0PA 3KUDA 2A33A 3IYLW 4RL6A 1R37A 3OX2A 4XWAA 3I9V6 1P60A 5TC4A 1DTEA 1T5BA 3GDOA 2BMFA 1FX0B 3TNFA 2GEDA 2YQ5A 1FFDA 3K5HA 1NI4B 1RRKA 4PICA 1T4MA 1U6JA 4PGHA 3RRBA 2GRAA 4LFBB 4NDNE 4R1QA 4KQEA 2F64A 2JCBA 4M1QA 2BBSA 2UZ1B 3N07A 5K2OA 1H1DA 1VB5A 4TT3D 3W5DA 2JLZA 1U3FA 5JAOA 5IARA 3RS7A 4A23A 4KRGA 1PGQA 4XW2A 1AHHA 3AILA 1QFSA 4O4LF 3HB9A 5BUCA 1Z4LA 1NM5A 2IZ7A 1ZVVA 3N8DA 4FQ8A 2BI4A 3PHBE 4FR2A 1IY1A 1E6LA 3R76A 3BCRA 1MA3A 1TYEB 2JJ2A 4BNKA 1I8TA 2YV3A 3AGQA 4Z0TA 4JYCA 2OFWA 3F73A 2AN4A 5DHRA 3KT8A 5DGTA 4R2XA 1Z75A 2ZRCA 1SCDA 3IDSA 5L3QA 4BJ6A 2GHIA 3PVSA 4K6CA 5ALHA 4BKRA 3VKGA 5DNDA 1VI6A 4QM6A 1MN6A 4KXQA 2H16A 2I2WA 3SKVA 1AQNA 1PGPA 4LECA 2ZTLA 4TZKA 1SURA 4IG4A 3UXHA 3VH1A 1E92A 3RF6A 3DEHA 3K2QA 3G0DA 5JIBA 4CHGA 3H1AA 2FX5A 1A9XB 3GPDG 3GH3A 3IDFA 4MYDA 4WZBB 4GLOA 1OFUA 2PX8A 3LS2A 1V4VA 3NNSA 2K7FA 1OFUX 4Y7DA 3MPUA 5ALFA 4J7UA 3IQFA 3RK4A 2Q3HA 1E8MA 3GNSA 2EIXA 2G0NA 4UE6A 4ZEOA 2ZSKA 2J9FB 3KJXA 4LTDA 3AUKA 1DPGA 1PL6A 2C2MA 1FP4B 2EW1A 2KE5A 3G9XA 1QR6A 3RANA 2PDAA 2WM3A 5D8DA 1ZRSA 1KOFA 1OLSA 1A82A 1PS0A 3H9BA 3EQ8A 5D87A 4CTJA 4CODB 4IIFA 1UPTA 3QPUA 1CHNA 3T3OA 3NAZA 2RKOA 4R41A 3ZZ0A 3V2IA 1CRWG 1E2QA 1T5HX 1Y33E 3M5WA 3VU3A 4OQFA 8ABPA 3PTAA 5GWXA 4JNKA 3SF8A 2GH1A 5F2NA 5I9TA 4C03A 2NV6A 3TIGA 1OXUA 3MYRA 5I7AA 3CMCO 4B35A 5JCOC 2XCOA 4TKMA 1FJXA 4QU9A 3ITNA 5KDDA 1EK1A 1NNUA 4RJIA 3UATA 2HQRA 3B6JA 1T1GA 2P68A 2PNFA 3FXAA 4D4IA 1SH7A 2ZYWX 3V48A 1D9XA 1ZA2A 2DFLA 2XT9A 3WYDA 5ALNA 3NVKI 4O29A 2NZ8A 3LD9A 4FE4A 4KRXA 4PLVA 2FMUA 1AK9A 1X8KA 4LCEA 2B1RA 4AY6A 3VKWA 2HK6A 1GEEA 1FLNA 3AONB 2CFOA 4YJ2B 1VL5A 2O2JA 4Q7LA 4D4MA 1ENPA 4NS1A 1NBEA 1SKQA 1J8YF 3TAXA 1XMIA 3OQPA 3HA5A 2Y0CA 4MVJD 2ZBQA 4EK9A 4ZOLF 3RYTC 3P9CA 3EZFA 3AYXB 4S1OA 4FW9A 4JC4A 4CF5A 4K46A 5JSKA 4DLWA 5TNXA 4ZXFA 1EQUA 3AUYA 2Q4BA 4CMEA 4F2WA 4D82A 3LKDA 1VYHA 5G0SA 4EPTA 1YQWA 4FSHA 3RG8A 1KEKA 3EX7C 3DDZX 4C0XA 3U1BA 1Q16A 2C7GA 3D2BA 4UUPA 4ZRDA 721PA 1O8BA 4MUJA 4LFCB 5LDDC 2V7WA 1SULA 1HYGA 1VKOA 2YY7A 2XZOA 1RC8A 1XNJA 5G3ZA 3OWOA 3K6SB 2ZREA 3QEAZ 3IDQA 1M76A 1LTQA 3ZE7A 5A06A 1XQXA 1T0PA 1OYYA 1I1QB 4DMKA 3P20A 4GYWA 4IHJB 2PQMA 2FZVA 5HA5A 1Q0SA 3SQOA 5JAIA 1JZTA 2LDXA 4RTRA 4DCJA 3IIIA 2J3LA 1IXSB 1PE0A 1ZJ4A 3W9YA 3PC2A 1U7WA 5MN5A 1B3RA 1JG2A 2MYUA 3EFBA 1BE8A 2ERCA 4MRMB 4NQRA 4YJKA 1R10A 4NMWA 2LCQA 4E3ZA 5IANA 1RXCA 2V7GA 1J99A 2E85A 4JR0A 1ESMA 1RYBA 1NLZA 2BIFA 3LX5A 1CRLA 1IZ8A 3GLTA 4DQVA 3OPYB 2P6MA 2ORYA 3GJTA 3VPGA 1LDMA 5KOHA 5AIAA 2IYZA 3IS3A 5CA0B 3EULA 4IW3B 1LC3A 2ATXA 1JVBA 4NIMA 1SXPA 5BUQA 4D6YA 2W2VA 4B7XA 5JEDA 3VNUA 1JX6A 1X1DA 3A6EA 1YGYA 2WY2D 1V8BA 3REQA 9ATCA 3UTCA 2GHRA 1RWQA 2VYND 4G0OA 1KY2A 4AWAA 2FQWA 1RAFA 3ED5A 3TRFA 3D0KA 2WYOA 3QLVC 1BDIA 1RYZA 4DMGA 4YP9A 3B85A 3ETNA 5B4UA 1BD4A 3D5TA 1OLXB 3EGVA 4CL3A 4Y2RA 4DR6B 4NMLA 5IF3A 2GCOA 1S02A 5JNVA 1ODKA 3A4IA 4F56A 3EXAA 3FYDA 3GJ6A 3FAZA 3HRHA 4KKVA 4OHWA 4C7BA 1CYDA 1B23P 2C82A 4QJ5A 3UMFA 2LIVA 3X1KA 4MV0A 4HAXA 3IJ5A 1Q2UA 1EWRA 3VH2A 2PUEA 3FJOA 2FSGA 3VAYA 4YRZA 4TYNA 3X2EA 3T1QA 1P8AA 4DDWA 3U9TA 4US2R 3TCXB 1XZJA 3ANSA 4ZD6A 2P6PA 4B17A 4WAUA 1M2FA 4X5OA 3TEFA 3NTVA 5EZYB 5CCXA 4NESA 1N3IA 4N7MA 4NJMB 1IXZA 3GVXA 2O2IA 4Q4LA 1XMOB 3HKDA 3J7TA 4GVXA 2JGFA 2AJDA 3B6IA 4WESB 4DLPA 2Q2VA 1EFCA 4INOA 4UJ5A 2HLDA 2KHZA 2Q3EA 2QSYA 1Y1QA 3NTQA 4FGJA 1Q3KA 2BEWB 2R1TB 3U4HA 1TU0A 3DNMA 1M2JA 4DR5B 1DAHA 2VXCA 3UW1A 3P9PA 1PEYA 4HAUA 3B6ZA 2R7NA 4FSDA 2Y4OA 4KQ9A 4MVWA 4EZBA 5LQAA 4DPKA 2E0IA 3KXPA 4LX0A 5KYNA 1A0OA 3AXTA 4ZT4A 1JALA 3AHJA 1PLKA 1ZX1A 1RWMA 3LVQE 4HWTA 2HHLA 1DOAA 3FE2A 1R6AA 4IIYA 2H3HA 4OYRA 1T9CA 5LBIA 7AT1A 3IEMA 1SHUX 2R5FA 1V45E 2IY7A 4JXXA 3JTEA 5FWNA 4OA5A 2WSSD 3GC6A 2PX3A 3IO5A 4HYYA 4L9SA 1H6DA 4JJ8A 2BBOA 3QXCA 5GQSA 3C7CB 3QYJA 6ABPA 3PHCA 1P0CA 4KQHA 2QVLA 2I4RA 4MWDA 4LA4A 2W6ZA 3N59A 4IVPA 3LQQA 4J1SA 2GZ3A 1T91A 4OQMA 1OKKD 3UM9A 2CJPA 1FDVA 2XUKA 5CLGA 1E2EA 5JJKA 2XGSA 4U9IS 2D5BA 1Y80A 2VYVD 3G2KA 2KX7A 4WLOA 1XYGA 4JLUA 1R8XA 4TWIA 1FMFA 5IU6A 4YLGA 1JIUA 3ULKA 4X54A 4KYIB 5E6UB 2DB3A 4HDNA 5EIHA 4Y2XA 1CZKA 2QAGC 2XR1A 2ZIWB 4LQLA 3UC9A 2FMTA 1Y9JA 3N3AC 2YYSA 3ASUA 3HV2A 4ZTBA 1T8SA 2Z6VA 5TRTA 3KB2A 4PHFA 4YV2A 4R3NA 5JC1A 5HQ3A 1XNHA 2F2TA 4UPEA 2X6TA 4X97A 4FDAA 1NW4A 3BMQB 4KLNA 4IYJA 4V0MA 5CPBA 5CX1B 1UP6A 1Z4KA 1Q1AA 3SC2B 3CNOA 1Z4IA 2NVUA 1CPYA 1WUKS 5EMNA 3AHCA 1T5DX 4E3WA 4ER5A 5K7SA 2Q6LA 4OH7A 1XU7A 2KJQA 1C8BA 1Z5OA 2ECOA 1ORRA 2PUGA 1T0JB 1QX3A 2XLCA 3MFYA 4JH0A 5PNTA 2CK3A 3LRTA 3K9WA 2VSQA 3IKLA 3IBSA 2B3DA 1NNEA 1YTUA 2NU6A 3LDHA 4FI3F 2I9PA 4RMJA 1TFUA 3OM0A 5IXYA 3BIXA 2O8CA 4B3JA 1K06A 1YBFA 1O5IA 3EXHB 1DE0A 5E2BA 3KSUA 5LVAA 2DKOA 4LXQA 3U7QB 4PNZA 5L7YA 1MA0A 4FNMA 4K9MA 4BNIA 3BCSA 3FGPA 2OY0A 2PZGA 5DSZA 2EL7A 4QG7A 1I24A 2RJOA 1XQVA 4MUEA 4DLZA 1RP1A 1KNQA 5I4KA 3KZMA 4RA9B 2CUZA 2G80A 1VG8A 1NBMD 2FEXA 1R15A 1ZCFA 3K94A 1WY5A 2D06A 2ZU0C 4M7WA 4OO3A 1XU9A 4PS0A 3SHFA 4KDCA 4QO8A 2DEUA 3FYSA 3U4QA 1L2TA 5AJYA 4R68A 4PCVA 3CZ5A 3DOIA 2AG8A 1C7FA 3NUQA 4LEIA 3KYDB 4DSTA 4LSZA 4ILEA 4DR4B 1KDVA 2GF9A 1AUXA 4TTVA 3L8GA 3UGKA 3ZKWA 2A94A 2W6IA 3DUFA 4MI6A 1IOWA 4KGXA 3B7PA 3E0XA 2R6GA 4ZVKA 3GGSA 2Q7DA 1J23A 2REQB 4EEXA 4YXWD 5AXDA 3R5FA 1AGYA 1NASA 1OZGA 4R7TA 3BK1A 5ICSA 1NMEA 3AVPA 2HA3A 4F6RB 2Y1OA 4IWXA 1J0DA 4E5PA 5C7LO 1KYIA 1TQ6A 5CBKA 4RKRA 2P0EA 4FGLA 2CNBA 1JF8A 4A27A 1I51A 4IJQA 2V7EA 5TMEA 3ZHUA 1KIAA 4PF1A 3S27A 2CJFA 4IV0A 1X0XA 3KKPA 1NBAA 3R3WA 4O2BA 4M9XA 4TRJA 2GA8A 4IIVA 5AO9A 3DXXA 2O2XA 1FNCA 5IHPA 3PGA1 4J16A 2FVYA 5ALSA 2OBNA 3LBNA 2PKEA 4XUCA 4BLOA 2H4XA 2QP4A 3C3BA 4IKEA 2O05A 4NE9A 1IZ7A 3EJ6A 5F3RA 3ND9A 1FUKA 3DFZA 5ADVA 2JBAA 3BXGA 4MZDA 2GI4A 2RGNC 4E1BA 3L0SA 1KDPA 1U28C 3ZVKA 2BUCA 3FWZA 1QVAA 2ORIA 1TJ4A 3FCCA 2PFGA 4BO7A 1QVVA 3ILYA 3OZGA 4RJJA 4QXQA 1YKSA 4JL5A 2IOFA 3G2JA 1CUJA 4CLHA 1DQSA 2IT1A 1OHHD 4OIMA 4KFRA 4N40A 1UCFA 1NXSA 5F2OA 2VK8A 5TDHA 5JI3E 1G21E 1G16A 1PN3A 4PZUA 4OHXA 4ZHQA 4HNUA 2BCEA 1SBTA 4MYCA 1AGRA 1HG0A 4JUDX 4FFOA 3W9UA 5K3EA 2Q2NA 3KHUA 3RHSA 1TUIA 2PSHA 1QP4A 2WV9A 3OLCX 5D86A 2HB6A 4J91A 4A1FA 4L0MA 3W77A 1L1RA 4MP8A 4WBXC 5L3ZA 5MGBA 4UM8B 3B8HA 1JDUA 4FZ3A 4TKVA 1CX9B 1G8MA 4DC9A 2E4ZA 4BB5A 3QENA 3BSFA 1YR1A 1HYEA 1UK8A 2CXRA 1DUIA 3O3OB 1GN8A 3WE7A 3N53A 2GJ8A 4JHXA 5JBQA 3DYIA 3GRPA 4TSFD 4TSKA 5ALOA 5BQOA 1DEAA 3ANMA 1ZR2A 1VA4A 1BROA 4HB3A 5I4CA 1HYQA 4FYXA 5CDHA 2JZCA 2I34A 2IEYA 5FBRB 3TLAA 3R2JA 4UZEA 4PHHA 2PTGA 3ZZTA 2AZTA 4H08A 5FWXA 4Z3DA 4F11A 5ENZA 2CLMB 3USZA 3RARA 5CVTA 2Q21A 4HN4B 2GB4A 3JS5A 4IDGA 4LW8A 4XX0A 1ZVMA 4INAA 1PEAA 2ECPA 2HV8A 3OCYA 2ATIA 5CFNA 3AFNA 1KXJA 2WUGA 3DE5X 5ECDA 2C84A 4B3BA 1KY4A 2CXOA 4IV5A 2W70A 2VQDA 3PDWA 4X0EA 1I7PA 2CJWB 3HJAA 1B16A 1OLOA 5EHQA 5AVVA 2YY6A 3IAUA 4BKUA 3RSSA 1KERA 5DTRA 1UFOA 3DAGA 4K9NA 5HF6A 1HT2E 5TLSA 1ZP6A 4GPD1 4ZCIA 1I2AA 4BX2A 3HSKA 1NYRA 1RVV1 1B0UA 4MRSA 1NQOA 4NWIA 1I2MA 1RJ9A 3L93A 3RJ5A 4KH0A 2GBIA 3T5CA 1G21B 2JLRA 4OP1A 4G4SP 4IMIB 4JBWA 1DHTA 1L1QA 2ZKIA 4Z8YA 2VTBA 3W78A 2PKCA 1QWOA 3ORRA 5CUQA 3G5LA 3I0ZA 4GQBA 4X64B 3F47A 3PNKA 2PX4A 4PU0A 5I7WA 3B5EA 1C9KA 2VZ9A 4UATA 1Z2DA 5DF1A 4CM9A 1AKEA 4LYFA 1Z0AA 4YC7A 2HBRA 2X42A 5F5NA 3OE4A 3OTIA 5IPFA 1KP9A 3KR2A 3SR0A 2XCUA 4ZRNA 2AMJA 1NJ8A 3PF8A 1TVKA 1QHFA 4PC7A 3KJHA 2WAXA 3ROXA 1WWKA 1TK9A 2XNCA 1OZFA 2P9BA 3NPAA 2Y3IA 1JI0A 4UBJA 1NTRA 4M98A 1W2HA 2WD7B 3V2HA 4TMKA 4MI9A 1XK7A 3ASYA 4AJ9A 4I1SA 1F60A 2FSVC 5ELMA 2HBYA 3CXRA 2JFXA 3LFHA 4PRZA 4QUIA 5H3CA 2BPOA 1R7RA 4C08A 2JCYA 3QE3A 1YS1X 4OYHA 4XSGA 2X6RA 5IASA 4FYKA 1FMJA 3M5CA 4KWIA 4P38A 5IHXA 4E08A 1WQ4A 2P9JA 3ODPA 2RBKA 5EE1A 2HPHA 3X44A 2ZDQA 3E5RA 5AOBA 3DTVD 3NDBB 1SUCA 4K8OA 5DX1A 3T7CA 1QQTA 4QVGA 2OFXA 2HWKA 3LZDA 2OP0A 1ZNXA 2AXPA 2Q27A 1WA5A 3AP3A 4OHVA 3NBMA 1KFEB 4AT1A 2LRHA 1ONNA 2PT9A 1PAUA 1E3DA 3PKIA 3GG9A 1E6MA 2IEBA 1IOVA 3EWNA 3NT4A 4F5ZA 3E3MA 3IR5A 2BFNA 4EB8A 1I7LA 3IUNA 3V6MA 5DYTA 2C2BA 5DNYB 1W4RA 4M7PA 5COQA 5ERXA 1J97A 3IKJA 1Q1ZA 4EWLA 4QGSA 1LFDB 1IOZA 1NVUQ 2V7UA 3PGLA 1SU8A 3CU5A 1QAQA 3T3EA 3CUUA 1QO0A 2VQFB 1B8PA 3CR7A 3FRJA 4J0JA 3ZVNA 4Q47A 2L2QA 2QF7A 5DLPA 4ZV4A 3F6EX 3QWHA 4Y2PA 1EFVA 4HB2A 1NW6A 3LOPA 1L1FA 3RC9A 3V1KA 2O4UX 4OATA 9LDBA 2I3AA 3F0TA 4LWZA 4F8JA 4M9SA 5E3HA 2DAPA 5CDTA 1K89A 2I7VA 1GO2A 1P4RA 1A8UA 1U94A 3HABA 4O4LB 2B8TA 4I14A 1Z8DA 4R2MA 2E5LB 3OKCA 4N8DA 4IDHA 4YV7A 1CD5A 4AZ0B 3UF0A 2E5WA 2BKAA 3HNOA 4YJGA 5DI9A 3T12A 1CRQA 3H5OA 5F5XA 3SJBA 4A73A 1FSPA 1SQGA 3PNVA 3KKZA 4HXFB 1NOJA 4UEOA 1ABFA 1CVIA 1UPAA 1Q91A 3OZDA 4XYBA 1P6UA 3SR3A 2P2ZA 3FHOA 3WISA 4JEMA 4IIEA 4X6LA 4N0QA 3T38A 1KQGA 3I2FA 1NFQA 1NLUA 4Z49A 4J0KA 1CY1A 5JMWA 2AEMA 1I6WA 1VMIA 1A88A 1IN6A 2DBQA 2H00A 1WD5A 1UMDA 4DR3B 1Z4PX 3TFWA 1MX1A 4KN6A 1CJMA 2FG6C 2XSZD 3COSA 2RG1A 3AETB 1E3LA 3LYHA 4QOGA 4I5FA 3HWX1 4Q02A 4FHEA 4WLVA 2XOXA 3MLEA 3ORHA 1IHPA 1Q57A 3NV9A 3KL2A 3TLEA 2UZAA 3ABIA 4ZEVA 2R68A 5CLFA 1GQRA 1E2LA 1IATA 4RIEA 4EUHA 4ZJPA 5D1NA 3WGGA 4YRQA 6REQB 4CQLB 3MB8A 1UKYA 1LPBB 4O8ZA 2BP7A 3DP9A 4R9UC 3ZWCA 1H9BA 1N7HA 5CGQB 1WSAA 2A84A 2OHHA 1ZD3A 2O5RA 5FNVB 2HKIA 3SEAA 2EF0A 2FF7A 2VAPA 5AKLA 5K4HA 3DLBA 3UJ7A 3GQBA 4QYIA 2IK8A 4BS9A 2GJ4A 4F21A 4J75A 4S1NA 1VE9A 5BQ5A 2P5TB 1TYAE 4KQXA 3S99A 3OJLA 3ZHZA 4CV2A 3OD1A 4IGEA 3TPZA 1ZCAA 4KVFA 4O4IF 5K3CA 4CNQA 2XUJA 4ZYVA 1T9GS 1F8XA 2IUEA 2IXDA 1DC6A 4FN5A 4DLNA 3GPBA 5JS8A 1AVTA 2WHPB 1PT9A 4B76A 1EFTA 2MMCA 4PQGA 1CIJA 2Z5GA 4AF7A 2AOTA 4C29A 1W88B 2VOEA 3MWYW 4PAGA 4ZOLB 5E9AA 4BLVA 3RHFA 5CFQA 5I7SA 5G53C 3PICA 2J0EA 1Y1TA 2FY8A 3TOCA 3GRKA 1EZ1A 3T9BA 3R0ZA 4ALNA 5A9SA 1ML4A 1EPUA 3IPAA 3D8SA 3S81A 1WL8A 1I6LA 1R5JA 4KZPA 3RKUA 4KKXB 4DQUA 4LZJA 3BRQA 4TQ9A 5CXQA 3A1SA 4LK2A 3OO1A 4WXEA 2I4MA 3ZK8A 2VCEA 5EQDA 3NLLA 1Y6FA 2ZUEA 3OURA 1HGXA 5FYDA 2H1CA 2EYQA 3IHLA 5ELXA 3R5TA 4RVGA 3WYFA 5FOVA 3UW3A 1H93A 1GNTA 4M0DA 1MZPA 2G04A 2GVDC 3K53A 4IS3A 2BBWA 1QK4A 2DHDA 2WIBA 4JQSA 4EB6A 4A5SA 3K70D 4D8YA 1YT5A 3ADCA 2IZOA 4CU2A 3TR0A 3L1UA 4BZQA 3EISA 2DCMA 3ENKA 1HDCA 2Q7OE 1HLDA 1JQKA 4Q24A 4XJTA 5AKEA 5AKYA 4JS0A 3TM4A 4ARAA 4BQRA 3CNNA 3EZ9A 5FOUA 4GKBA 3EEFA 4H77A 4CM4A 1E3SA 3WGZA 1UBCA 3PQ5A 4PPYA 4CL2A 3OP1A 1XEAA 3BIFA 4DLAA 3A1NA 4CQMA 4EAQA 1O58A 3PQDA 5BWMA 2YN0A 2H11A 1MO4A 4GPEA 4ZOCA 4WBSA 4BRSA 2B7BA 1KJQA 1Z6QA 1V1MB 2WK1A 1IQPA 3CG4A 4WA7A 2P5SA 2OMEA 5AD1A 1W6RA 3OF3A 1CUCA 1D1QA 1ZGZA 3JVUA 4EHLA 3HVUA 5FDFA 2NO6A 4CN8A 2PWYA 2QEQA 4ADSG 1DAMA 3EUEA 1ZM9A 4MW2A 2XDWA 4CL8A 2RGRA 1NVVQ 3GDFA 4AG6A 2DQZA 1B8NA 3MWGA 1O95C 4IH9A 2G40A 1Y3CE 5CVDA 4M8KA 4EENA 1XKTA 3WLQA 5H4GA 5LLDA 1A8HA 4QODA 1MX5A 3VRHA 2ZYDA 1YA4A 4UDOA 4S2UA 2ZYRA 1DCTA 3JASA 3IRUA 1UK6A 1YS2X 1MGOA 1WV1A 1G18A 2WJ3A 1DCMA 1WW3A 3OTHA 1KQ3A 4GKAA 4OU5A 1ADGA 4Y2TA 4ZV9A 2VSFA 5EKUA 5J3JA 4M87A 5AJWA 2O59A 1FTYA 2WUEA 3PKZA 5BRAA 1NF2A 2G77B 2OGWA 1XTZA 3ICCA 5KYVA 3OT4A 4BNNA 1O2DA 4KDEA 3WLHA 1N4DA 2QSJA 1CR2A 1KI7A 3MJVA 3L0BA 1XZDA 4CF4A 2DKFA 3CRZA 1GAEO 2XMZA 3I32A 4S1PA 1YFJA 1OXTA 3RUHA 1JB9A 3AY7A 4FHFA 2BEVA 3GGGA 1KQNA 3V8EA 2FSIA 3F8TA 3AR8A 2BF4A 4WERA 3NIFB 4K81B 4EB0A 1L9KA 2R2GA 1C0LA 4UUOA 1IH8A 3STVA 1T5OA 4RTKA 4Q7KA 4JFAA 1HRKA 2FK7A 2JKZA 4ZZ0A 3CX7A 3ZWNA 5BVGA 1AB6A 1O87A 1V1JA 2I2AA 3FKQA 3COPA 4I5EA 3ZQ4A 3WLAA 3AEUA 4RF2A 4JCCA 4CJXA 2Y93A 3BE6A 1GFZA 1T9KA 3N2KA 2EHJA 1V7QA 2DJ5A 4BQNA 2A7QA 2FFBA 1KARA 3I0NA 3Q7QA 4ZJZA 1R8YA 1II9A 3AWDA 1PFGA 4QATA 4MQLA 3FNBA 3W6OA 4B0PA 2PMWB 3NH9A 4WD3A 3EOBI 3A2KA 4S3MA 1S5PA 1NV8A 3DFMA 1CY7A 4LBYA 5CEFA 2XCTB 1MXHA 2CNWD 3I52A 4H1TA 5HCUA 4DCOA 1IN7A 4N5NA 2SHKA 4RWEA 4B9AA 1AQLA 1OXVA 3MN1A 4QU8A 4AP5A 3IQHX 4KQKA 1NFFA 4L0CA 3KOMA 5TQ2A 2R96A 4QHSA 3PCRB 4RPLA 5CFPA 1RHJA 2WJ6A 1CW2B 1TA4A 2X8LA 4WCFB 5DGXA 1KH2A 4M9CA 5EJAA 3ZY3A 4CDNA 1WABA 4OBEA 4FWBA 3K0SA 5ILGA 4H6PA 3BXEA 3JQQA 3SBDA 2UXDB 4N1AA 5TSDA 3ETJA 1MAVA 3NHBA 2ZUDA 1XLTC 2PRZA 2WWIA 2P9CA 3I45A 3FTPA 4EHAA 1ULAA 5JHHB 1RYMA 4GMFA 4QYWA 3DLHA 1YQQA 5ILQA 4U3JA 5JRZA 4H1UA 5LOVA 2ODBA 3FSJX 3EYAA 1R74A 4GPIB 2UVQA 4BNDA 5DIZA 4C22A 2VYQA 3BQNB 3O1JC 3Q98A 3JARA 4LXUA 3T34A 5M29A 4ENWA 3ZWQA 4O08A 1SCBA 5CM2Z 2HLHA 1Z3IX 2AUTA 5EI5A 3MFQA 4D6XA 1N9GA 1U8TA 3CR3C 4CWAA 5EAIA 3KOYA 2DT5A 4C06A 1W52X 4JBLA 1NYQA 3D0OA 1NUTA 1LQ2A 6NULA 1NRIA 4GXTA 5ITWA 2W4IA 1SHKA 1XJ5A 3JZDA 1C2YA 4GSKA 4NNPA 1HSOA 4WK4B 3RROA 4EHFA 5HDBB 2CMKA 1H2YA 3PR3A 1NN1A 4FFPA 2XUPA 3RC7A 2R3SA 3GJ8A 3VGPA 1II8A 3HMKA 3PGKA 4P2GA 4D4KA 1R1DA 4UBKA 2PL1A 1SC3A 3OIUA 1XT6A 1SVMA 3V8RA 4REOA 5FOSA 3P0IA 5JLAA 3IQDB 2CYCA 3T7DA 4Y6SA 1TCUA 3TI9A 2G1AA 2OFOA 1CB0A 1VBFA 4QDZA 2JJ1A 1PR2A 1YQUA 3A6HA 3EXEA 3TL6A 4EJ6A 2BFFB 5LR6A 5FR1A 1U8XX 2GGSA 2VHZA 5LIPA 2L82A 3O4FA 4PQFA 2GF2A 4EG3A 2NV0A 4GP9A 1TCCA 5LNK1 4FXPA 4ND3A 3BAFA 3O8NA 1R4MB 2NYUA 2OM2A 4TMFA 4U7GA 2A1TS 3VU1A 2J8ZA 5TEWA 3LC0A 1MP0A 1K4MA 1X0VA 1PUXA 2WWXA 4AJ1A 1GGJA 3Q1LA 5FBWB 4KYVA 1RT9A 1JA1A 3CIOA 3BILA 5CPFA 3ZGOA 5JSUA 2HSJA 4I9UA 2C4TA 4S1TA 5IBPA 1O1YA 3RC2A 1L7MA 1SUFA 3D31A 1ESNA 2YW9A 3DBHA 5J2UA 5JCJD 4I8DA 4EL5A 4P4NA 1RQPA 1NX9A 2CV0A 2VF5X 4UAVA 5FAKA 4YRLA 3WJ1A 3ZQ6A 5CXUA 5HOQA 9MHTA 3SMQA 2YIDA 1HH4A 3KK0A 3O8QA 3ORQA 4N12A 3CCFA 4EMUA 4B3RB 4NFLA 4I1RA 5ALYA 2Y1LA 1LW7A 4N0MA 3UQYS 3WO1A 1U8ZA 3T3MB 3ROZA 3EVTA 3QTLA 2H4WA 1T6NA 4BLTA 1W87A 2I3BA 2V9PA 2JAQA 1U7UA 1UPBA 5E2AA 1LFAA 3H04A 1B76A 3UANA 2RI6A 4C76A 1NBOA 2CC2A 1LS6A 2RC6A 2JGLA 4TKUA 3RABA 5K6RA 2EKPA 1I0IA 3LLVA 2C1EA 2W6JA 1POXA 3T5BA 1ZW6A 2DSNA 2V7QA 1IUOA 1UIMA 2BBTA 5JZMA 3UPTA 4QXOA 1XA4A 2X8AA 1E3QA 3RLFA 2O7NA 3R3VA 1YMVA 4Y6OA 5B6PA 1X1CA 3IAFA 4YP1A 1AQIA 5IJ9B 4L50A 1IBKB 3DO5A 1PT6A 3LPCA 1E1QA 2QT1A 2RHWA 3AUXA 5LYJA 3CE6A 1ZNWA 3CPEA 4D99A 3AFHA 1EUCA 2F1HA 1NSYA 2HMSA 2WIKA 5CVCA 3UHAA 4ICIA 3LOQA 2PVSA 2XVAA 2MSNA 3R6LA 3KAJA 4PWZA 4CG0A 3WWPA 4UD6A 2B92A 1PR5A 1IQUA 3UT5A 3OJOA 2NP6A 1XQ9A 1E9SA 1X7YB 3H5IA 4YRJA 4D4GA 5C53B 4BGVA 2YBDA 3I62A 1HE4A 4DABA 2WJJA 1QKKA 3A6FA 5T4EA 4KO1S 4G6ZA 5JHGB 1M6NA 2XD4A 3P2IA 2GN8A 3NIGB 1YZFA 2IYQA 1W76A 1WM1A 1ZA1A 2C9MA 2VPTA 4GLBA 1CUDA 3RFTA 3AL2A 3GARA 4PLZA 4BX0A 2GSDA 3JD2A 3Q12A 1Q0UA 2DBRA 2Z43A 4I36A 4KRYA 4MS3A 4KEAA 2AI1A 2IV2X 3TYXA 4A7PA 4ETNA 2PD3A 1HE5A 1US8A 2QI9F 4BZPA 5GGYA 7YASA 3Q5DA 1E7WA 1KR5A 4AO7A 5IG2A 4IM7A 1MIOB 4L78A 5AJTA 2WB4A 3X1YA 4BO0A 2QUBA 3GRCA 4TXHA 6PFKA 3IT1A 1A2KC 5EIBD 1T0HB 1JMVA 2OBXA 1LX7A 2QX9A 1FDOA 1XKLA 1CWUA 2ZBGA 3M9XA 4MUYA 4P1ZA 1OC2A 5AVUA 3C3CA 4U7JA 2ISQA 3FI0A 2F55A 3WLPA 2ES4A 5K45A 2E87A 3H4MA 2QXUA 5ENVA 5A9TA 4AY3A 2BTQA 2EFCB 4DG9A 1V0JA 5D84A 2PFKA 2WJHA 1T3HA 4Q1CA 4EIWA 5MGNA 3VU0A 3D6TB 4AJ2A 3U44B 1TK3A 4UQOA 4FZRA 2YVUA 2AR0A 4ZOBA 3AUFA 3E3OA 3E5NA 4L6CA 4XFJA 5BN4B 3LXRA 4CMCA 2C29D 3FMGA 2FX2A 3CVOA 3LVRE 4IRMA 4QGBA 3CY6A 4X20B 3EJWA 2IOHA 4Y9RA 5EXEA 2Z1DA 4W6ZA 3RBAA 1KI1A 1RKBA 3HR4A 4OHFA 4HNQA 4WT7A 4TMYA 4PZCA 2VK1A 2ZUWA 3OCVA 2NWQA 2HV9A 2TMYA 2WSYB 1FUEA 4HBGA 4EMBA 1DUVG 2AEEA 2OXFA 3LXXA 4P98A 3O5AA 2AK3A 4TN5A 4MIOA 3HU5A 4QVKA 3RSHA 4W1SA 3B3GA 2JASA 1U8FO 4R1PA 3WQHA 1Q0HA 4G67A 4UVGA 5EJFA 1KMNA 4KOAA 1OFTA 3ICVA 4DRXB 1ZJ6A 1ZI8A 3C3KA 4EZIA 1Q17A 1SEPA 5C4IA 1KI6A 4GZ5A 1DKMA 3MUNA 1SQ5A 4GXRA 4KR9A 3I6IA 2IE0A 5DULA 5AR1A 5C34B 4G5OA 4ACBA 3T15A 1M1UA 3S2EA 4W9MC 1SIUA 3X2SA 5B3AA 4BP9A 2BONA 3AM4A 1L5GB 2P4SA 1XDUA 2ATCA 3EHEA 2EXXA 3VR6H 4QEZA 4Y1EA 3G2IA 2EKQA 3TW8A 3HXOA 4LMPA 2XOKA 1ACJA 2FX3A 2EX0A 4YNBA 3ZGYA 1NX6A 2JGMA 1Z6TA 3B9BA 1G4UR 3EVZA 4L15A 4DLKA 1E1NA 4MQ5A 5T4BA 1D2HA 2JIQA 2ZJ4A 3FRHA 3L9WA 3N8GA 4OLFA 5AVOA 5L3QB 4H4EA 1D4FA 1RYNA 1SO8A 5D51S 1KAGA 1VPLA 4NL4H 2PD4A 4CCWA 2FMHA 4QD3A 4Q9NA 8LDHA 3C48A 4HB4A 3V2GA 4O63O 3A28A 3IV6A 2P8JA 2Z6UA 1F9EA 1FF9A 3QJYA 4UFOA 4FBGA 2FP4B 2Q99A 2XYPA 4JU8A 5J5AA 3RC1A 4EYKA 3COYA 2ZYTX 4BX3A 1TQHA 1TF5A 1YJQA 4LC1A 4RACA 1Z73A 1K7EB 5KQMA 3KUXA 1MJNA 4HNGA 3EPJA 3WLJA 1TIPA 4YCLA 2PMEA 1LBTA 2R5NA 3OG9A 3MS4A 3DE1X 1BOOA 5EGSA 1B6RA 2O2DA 2RHMA 1SXIA 4X8HA 4FCTA 3LI2A 4E13A 3KYJB 1W75A 2YV4A 5LZ8A 1UWCA 5BYAA 3NT2A 3T9EA 3DS8A 4BYGA 3FPKA 1ZFNA 3DC2A 4KI0A 4XJSA 1NONA 1ZEMA 2CCGA 2BR4A 3DKKA 2PK3A 4CI0B 2XITA 3RADC 3PUJA 3AIMA 1ZWLA 2V98A 3FKJA 4LQ4A 4URWR 2ZKLA 1KPGA 4HL6A 4PM4A 4ECEA 1REQB 3AH8A 1YZLA 3E22B 4Y2YA 1NVDA 1W96A 2IYTA 3DDHA 3D8HA 5J5VA 1BNCA 3EMDA 2OSBA 3ORFA 3D2LA 4NLLA 1M3SA 1YDMA 4DJFC 2C2OA 1FNMA 1EX6A 2R1VB 3JPWA 4GR9A 1RR6A 5LA6F 1G5PA 2GN2A 2ZE7A 4F96A 3E9DA 4K6FA 3BOSA 2UUOA 5G4KA 4Q6BA 1PQUA 3M81A 4ALIA 1QIGA 1Q14A 1VG9B 4PANA 2CSUA 2B78A 2X5XA 3SDZA 4AUNA 4YJFA 2PH3A 2E89A 2QDKA 3H5VA 4CMGA 2ZW9A 3CTMA 3QEBZ 2FW1A 2O3SA 1FVXA 5MFZA 1KC1A 2OBMA 5H02A 6AT1A 3IH5A 1BW9A 3QKSB 4PNHA 2G06A 1E5XA 2D5AA 2B7LA 2OZVA 3V6LA 3EIOA 5K9ZA 2TMKA 4RE5A 2B21A 4CKCB 4DV5B 4KWTA 2CUKA 2FWMX 2YWBA 4UPDA 1Z34A 3QOYA 2FSPA 2C42A 2IU4A 5MFPA 5TPWA 4F4HA 4ZGGA 4PG7A 4BO4A 4YA6A 1ZJYA 1IB0A 1Y8QB 2GDJA 1V5EA 1AN9A 3GJXC 3L8MA 3NKLA 3HGTA 4RQAA 3PXUA 3R5XA 2JA1A 4UDYX 1S96A 1F0YA 1E1RD 1TM1E 1UBRS 1W85A 2CD7A 2B61A 2WIDA 1IUKA 3B13B 4GU5A 2P2GA 2AHRA 1WP4A 3PRKE 2FV8A 4INZA 4AKIA 2ZWMA 4GQIA 4EW2A 1A5ZA 4B3TB 4KN9S 4EF5A 2CZCA 4PTYA 3FUUA 4FFWA 3H5LA 4Q4CA 2HH9A 3WAGA 4R2LA 2G63A 2FG5A 4BN0A 1XL0A 4QOSA 4ZYYA 1LPMA 3GT4A 3PE6A 4QVIA 3AYZB 4Y30A 4YAKA 2AKEA 4G1CA 4IV8A 1Z5GA 3FYUA 4ZCQA 1JNXX 4WEOA 4ZK2A 2ICAA 4TGLA 1AC5A 1MENA 1XN4A 3E3LA 1TDJA 1UFQA 4OKSA 3B1VA 4EFKA 1CNEA 3IUQA 3FSGD 3IAHA 4GEGA 3WGYA 1UFKA 3HUDA 2OCKA 4KXYA 2PYZA 2Q6TA 3BGIA 4DQXA 5IUNC 1TAUA 1DEOA 4CF7A 1JLMA 5I01A 1FL9A 3HSSA 4ZVMA 3T6KA 2N1MA 3NALA 5F21A 1XQ6A 4PNEA 2ZJ8A 1WHTB 1J07A 2P11A 3AR5A 4RO0A 5FCDA 4DB4A 1T3GA 2HJHA 3R8XA 1LWOA 3B82A 3HB5X 4TTPA 3BH0A 4CV0A 2W0MA 4UHHA 3TJMA 4WTOA 4NYJQ 2X86A 1V3TA 3EIQA 3AWIA 1NG1A 4D74A 3G6KA 1XDDA 3OTGA 4QBHA 4XPIA 3S8MA 3ZJ5A 1TM7E 3TIVA 2HK9A 3SVTA 3L04A 3PC8A 1PK7A 3E1GA 2OAGA 1UFRA 4FZ5A 1Z3CA 1Z0SA 4PX5A 3U13A 1AKQA 4GLLA 5J2TB 3W8DA 3GEIA 2V7TA 4E5YA 3PJRA 4P4UA 4F46A 4RCYA 3PUYA 2LVBA 3HI4A 1SXJD 1VSBA 2BTEA 2WWWA 3R5JA 4L2IB 2GM3A 3GLGA 1E9AA 1B7GO 1N7JA 2E4YA 1TD1A 1C1HA 2NU7A 3KB8A 2FWNA 5GOTA 3K0FA 2JFVA 1WIWA 2I7DA 3ZDBA 3KJZA 4N4AA 3EGXA 1E6KA 2AFIA 1OIXA 2CDCA 3BFVA 4DQDA 5FUMA 2VHWA 4KV9A 4JEHA 4TS3A 2CDNA 5A4KA 1QHYA 2H1WA 5ALTA 1KMQA 5HZMA 2RGDA 3TMYA 3VX4A 1QG0A 1QP8A 3N0VA 4NBTA 2ZT8A 4OHRA 4PYNA 4NZYA 4PCAA 5T4HA 3JVIA 1OYWA 1Q11A 4IDCA 4JGIA 4LVOA 3D6NB 1JFFB 2P1DA 3VR6A 4RY0A 3OZBA 5ADUS 4XM1A 4WK0B 5ITZB 1TYZA 1VP3A 4Y2JA 3HZHA 4Z4IA 1G8FA 1B41A 1POWA 4W5RA 1DDIA 1ONPA 5DWDA 4O2LA 4BUJA 1C7RA 2YFHA 2D2EA 2EP8A 3KV3O 3FR7A 3M82A 2J1LA 3HJFA 1O9HA 2I2FA 5F1OA 1M10A 4DPLA 4K9KA 3JVDA 4F71A 1V39A 4DV1B 3FPFA 4MRRA 3O93A 3BZBA 3VA7A 1BHQ1 4U39A 5JXHA 3RCBA 1YONA 5K0EA 1OIWA 3RRYA 1TMKA 2W2PA 4TS9A 2ID7A 4PO9A 4E5MA 5JZSA 3LFUA 4AJNA 5DBGA 1IXRC 4QUJA 1VSVA 1XNGA 4CKZA 3GFRA 4HPXB 1JIJA 2BEUA 3O92A 3S2GA 4EG5A 3M1YA 5JNUA 3A2NA 4NONA 1QK3A 2QAJA 4BWFB 3FIJA 4ARZB 1ZOIA 4CIDA 4LBZA 1L7RA 1OLUA 1GCGA 1PTKA 2HK8A 3O31A 3T7SA 4XOUA 2YOGA 1WCIA 3IP9A 4IG9A 1E4EB 1NTOA 3IPRA 4HLUA 2GN9A 5JNSA 1JDBC 1KE1A 5DBEX 3H83A 2OOKA 3G1TA 1QRAA 3O8OA 1NWHA 2IL1A 3E3AA 2RK4A 4P36A 3MCAA 1MF7A 3QU7A 4J0QA 4K9PA 4DNFA 1GRCA 9ABPA 5JH7A 2VHXA 1OT3A 5EQJB 2RH8A 2ZXFA 4J2HA 3R7BA 2BFEB 1FXWF 4NY1A 3T41A 4BGDA 3TUZC 1MG0A 1HQKA 3SJUA 2FQXA 4W5WA 5CVJA 1ZUNB 3OFVA 1CUUA 3MF4A 3LMKA 3T06B 4YI5A 1K5PA 4QYTA 5HS4A 3R9XB 3SOZA 4QBFA 3ZWXA 2B4YA 4YK7A 1VTKA 1CS4C 3PU6A 4C1NA 4JI8B 4ZWNA 3R5HA 2NVUB 3FD8A 4EG8A 5J1SB 1DX4A 1RWNA 3W2IA 4FHGA 5IDVA 3NWPA 4HRYA 2FWJA 4C0KA 4FOLA 5A3QA 3DMTA 1XEWY 1NJ6A 1OVGA 3IDZA 3QPDA 3QNUA 2HI0A 2J9GA 3F78A 2YC2C 3OPYI 4Q3LA 2IGBA 4OJYA 4QTUB 4RWZA 3Q8LA 3WWYA 1OZ0A 1U31A 3K0EA 1H6CA 3WNBA 1VRVA 2AG5A 4EVQA 5IN4A 1GPDG 2JZOA 3K4QA 1F12A 5BORA 4TLBA 1DGQA 4J2TA 4E0BA 2L19A 1UMKA 4V0RA 2N9UA 2YHBA 2JVIA 3BWYA 4EKEA 4CM6A 4YJDA 1JEEA 1TC1A 3IVXA 3GCDA 5FTMA 5JYCA 1IWPB 3GHYA 3PXAA 2QTNA 1QJ4A 1NLMA 1LNZA 3DEKA 2E5FA 4E7OA 2UXBB 1DLIA 4Q1FA 1HYBA 1I94B 1U9IA 4I4IA 2P77A 2UUPA 3AF2A 3S55A 3ZGZA 3K4HA 2ETVA 4IXMA 5F77A 2FEPA 1PT5A 1SVLA 1QYIA 4JENA 4U00A 2VP2A 1IXYA 1Z15A 3OFKA 2IDJA 1JG3A 1NM5C 3TAUA 3S5UA 2W71A 3PJFA 1P1JA 3G0CA 2ZIFA 1GG9A 2WHRA 3EIUA 1GTL1 4DUGD 2X2PA 4E5KA 1O97D 1X1QA 4P3PA 3FUTA 3BXPA 4P7GA 4TQUS 3SEFA 3IUEA 2UUBB 2O6HA 2X3YA 3EEBA 2WC1A 1W581 2AKYA 3B52X 2ST1A 5CHYA 1GZVA 3BORA 3I0MA 4FCCA 3RIMA 4P33A 5J63A 5I9BA 2W9XA 1M0SA 2GN1A 4CEHB 3JYOA 5L6MB 4IZIA 4ERNA 3DMPA 4I4LA 5B3JC 2J07A 5LXTA 2OORA 4EY3A 4ODIA 3AF4A 1LPAB 4DIDA 1W1IA 1U81A 3ZI4A 3B9PA 3CVJA 2G9QA 1ECFA 2ZUSA 1Y4ZA 3VNBA 2HYIC 2IZ5A 1KY5A 2ZR0A 2YUIA 2VDQB 2WHXA 3L0YA 5BN5B 1OZAA 1SBHA 2M6KA 1A98A 1P5RA 2HCFA 1JEJA 2ZBDA 3INNA 4WFIA 1FUIA 4N8SA 3OOWA 1NJ2A 4PWYA 2FQQA 2FEMA 1Z8HA 3FNFA 4ZREA 3WK6A 2CFCA 3ZZUA 2BFDB 2JLBA 5AT1A 4CMJA 4IO1A 4Z4QA 3ZIUA 1CJTC 1ZI6A 2CMHA 3EARA 3O1IC 2NTEA 3PD7A 3PNPA 2ZAIA 4ALJA 4AUMA 2CHQA 4R8MA 2C4WA 2QU8A 3QKIA 2YV2A 5CCEA 4TV8A 4INPA 1FNBA 5C8DA 1UF9A 5HCIA 3W5UA 2H8KA 1IZ0A 2JI9A 1JS1X 2H5IA 3GZNA 1J00A 1YI1A 2O5VA 5HHTA 2IIVA 3U1VA 3BEDA 3W3AD 1IQRA 1MLDA 4PYQA 1T5LA 2DULA 5E4YA 5DFAA 1FX1A 1KI4A 1QK5A 1ZG3A 2X9QA 3I04M 3QZUA 4W7HA 2NZ2A 1Q0ZA 4JJKA 2O3JA 4DIMA 1VKJA 2GCNA 1BCSA 1P17A 2YYAA 2WVJA 5KS2A 4OQEA 4DEYA 3FUXA 1IY0A 1T1JA 3RTGA 1JTEA 4ND1A 1EE9A 2I6TA 4WVLA 4HWKA 2O9JA 4WNIA 3P2JA 1F2UA 1GD1O 3WP0A 3LBFA 4XWWA 2G08A 3NJ8A 4M0LA 4WOKA 2YV5A 5KTMA 1M0EA 1OCEA 2YYYA 3OFSA 3WWCA 1XZFA 2V8OA 4UXIA 4YFYA 4LE0A 4PG8A 1F48A 4X84A 2XYQA 4G4SO 3L4BA 5HILA 1W0KD 1QH1A 4CMEC 1JJFA 3WA7A 1C9MA 3HBAA 4IL5A 2BF7A 1FEZA 3AQIA 1J5XA 3LYLA 3QQPA 5L4LA 4K9LA 1KVTA 3HZRA 1D2MA 2BVNA 4N8EA 3V55A 1ZCJA 2VJDA 1IBRA 2JB9A 3WL6A 2C2KA 3I1IA 4ENTA 2YDXA 1OWNA 1DBPA 2WBLC 3E8XA 4B3HA 4L8LA 4DMRA 4ETMA 3FLAA 3JQ8A 3AVXA 4GX5A 5K0GA 3G0HA 5HJ2A 4TS1A 3MC1A 4KX5A 5AK6A 2Q3JA 1E2NA 3BSYA 4GPTA 4O4IA 2CB0A 3STXA 1NVMB 1AKUA 1GWNA 1WVMA 4M7OA 1N0WA 1TLLA 2O2CA 2QA5A 4PYOA 4FKZA 4BFYA 4FZVA 4MZXA 1BN6A 1LPNA 2WILA 2K2WA 4X6XA 2VPIA 4EITA 3CEAA 3MGBA 4WHMA 5C1IA 3UUFA 3O21A 4PYMA 3HKBA 4FKBA 4YQYA 3A6ZA 1L5HA 3T4XA 1KI9A 1ZOSA 1JPUA 1UMBA 4LRTB 4NBSA 3PGVA 2UDPA 2ZIGA 3H5TA 3GBVA 5AHWA 2K4MA 3ZI0A 4HNAA 5CFOA 1Z0IA 3RVPA 3HYNA 1C3XA 4L5CA 5JVDA 3LUFA 4M9RA 3GHHA 1AQUA 1JQ5A 1M1NA 1QGED 3IVGA 4KE7A 1DXYA 1ZQ1A 2H65A 2R8OA