5B2EA

N,n'-diacetylchitobiose deacetylase from pyrococcus horikoshii complexed with its inhibitor mpg (acetate-containing condition)
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
267
structure length
267
Chain Sequence
b'FEDIDTFEEAFNKLLREVLEFDLQNPFKDAKKVLCIEPHPDDCVIGMGGTIKKLSDMGVEVIYVCMTDGYMGTTDESLSGHELAAIRRKEEEESARLLGVKKIYWLNYRDTELPYSREVRKDLTKILRKEQPDGVFAPDPWLPYESHPDHRRTGFLAIESVAFSQLPNFSNTDLDIGLNPYNSGSFIALYYTHKPNYIVDITDLMELKLKAIRVHRSQFPDDIWEKWEPFLRTIAMFYGEKIGVRYGEGFRIMPGLFYHITPFTDLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein PH0499
publication title Substrate recognition of N,N'-diacetylchitobiose deacetylase from Pyrococcus horikoshii
pubmed doi rcsb
source organism Pyrococcus horikoshii ot3
molecule tags Hydrolase/hydrolase inhibitor
total genus 99
structure length 267
sequence length 267
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02585 PIG-L GlcNAc-PI de-N-acetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10320 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold LmbE-like 5b2eA00
3WE7A 1Q7TA 3WL4A 3DFFA 3WL3A 1UANA 4EWLA 2X9LA 3DFKA 4XLZA 2XADA 3DFMA 5B2EA 1Q74A 5B2FA 5CGZA 4XM2A 4XM0A 4XM1A 2IXDA 5BMOA 3DFIA
chains in the Genus database with same CATH superfamily
3S40A 2D5CA 2Y9PB 2NXJA 3TG2A 1BE8A 2GZAA 1B16A 4NCAA 3L8GA 4GH5A 4OPMA 3SBDA 3K5WA 1FFEA 1LA2A 2DLNA 2H3HA 1XMPA 3OM0A 4IXWA 4TV8F 1ZMRA 3WIUA 2R1VB 1PEYA 1M6VA 4TTTS 4TWAA 4W9NA 1PLJA 4FFMA 2ZAOA 4U6NA 2WQ7A 1VCOA 3AHCA 2HMUA 2Q9UA 3AX6A 4KJXA 4OF4A 4TYQA 1UJ6A 3LUFA 2F4NA 4N12A 3ECSA 2Q3JA 2YMQA 3NBQA 4YDSA 4AZ0B 3RRJA 2JDID 2OESA 2BYTA 4JJAA 1IN4A 5EQDA 4JVNA 1YFZA 3CE9A 5DF1A 1ZFNA 3JQAA 5AVKA 4EG4A 1ODCA 1GFZA 3SSMA 4GBED 3I9V1 1CJTC 3KFXA 2IS4A 4X7PA 4JJKA 4XQEA 3BBPA 4YP5A 1U0JA 1GT6A 4WLOA 2ZQYA 4FGWA 4OUKX 4Y2TA 5HXAA 3SZOA 4IQGA 5ALEA 1FFCA 1DV2A 3NATA 5AIAA 3RODA 2R68A 5HWSA 5KREA 1SU6A 1CIJA 1DQSA 1Q7CA 1XFAA 2HV9A 2WI8A 3F7NA 1YJ5A 3NHPA 1FDOA 3AJDA 3ZU6A 4BQQA 5ADHA 1U3CA 3D59A 1OI7A 1KO1A 1ECPA 2WHPB 1OX6A 5DCUA 2BEVA 3HS3A 3PGVA 2IF0A 5AD1A 1O3YA 1SK8A 4YRGA 4K2AA 1T0IA 1SC3A 4PIPA 3OX2A 5FNZA 1Z12A 6LDHA 4H7KA 1FDIA 3NHSA 3O93A 4QFCA 3NXSA 1ULUA 3AF0A 3B1YA 1E2FA 3CRW1 1P73A 3WICA 3L6CA 4R6XA 4B3IA 4RH1A 4UFPA 3W1VA 1YRAA 1PWEA 1E9EA 4IILA 5EJEA 1KSFX 2XSZA 3VTZA 4BC0A 5JVDF 1FP6A 1ZOIA 1ENZA 3ZGLA 5KHAA 2YTZA 4G89A 1CG6A 3OT5A 3PE6A 1EJBA 2MTBA 3JAKA 2Z83A 4PHFA 4IKOA 3ZXXA 3WLEA 3X3HA 1XZIA 2REXB 5DGIA 4MJXA 3WJ2A 2YHIA 1QDEA 1KFJB 4PLWA 5C8YB 4GF5A 5TDHA 1OI2A 1QE3A 3OQBA 3B38A 4J0KA 4FDTA 2AUNA 2G25A 4G0OA 5LZ8A 2MSLA 3CUYA 1XDZA 4RJ2A 2EP7A 1EQAA 3QW2A 3N6VA 3G79A 3WE7A 1TZBA 1GG2A 2Y71A 4PGFA 1IAVA 3ZOKA 1RMYA 4QGSA 3HACA 4AVYA 3V7FA 2WFMA 1YZHA 2O7RA 3WWEA 1ZYUA 1V0JA 3IQFA 4WESA 3BL5A 5F1YA 3U19A 1FRQA 2OZKA 1V95A 5IWAB 2CK3A 1DWUA 2AJBA 4EG5A 3WAJA 2HRCA 1XRLA 2VNHA 3M6IA 1ZICA 1BH6A 4EYEA 5DT9A 2O8VA 1LDYA 1C30B 2OOSA 4IICA 4N3AA 3NX4A 3OO0A 3U3MA 2JRCA 2QDXA 2DWQA 1FJGB 1Q0LA 2AOXA 1K3UB 4TSRA 1NVBA 3IODA 1XDDA 3Q3CA 2EDCA 4R9SA 3WRYA 3X1XA 2EJTA 3DOCA 1JKJA 5TMDA 2VYFA 1TT7A 3NLLA 5HG0A 3SE7A 1HR0B 1ZNWA 1YIDA 2EKZA 2WTUA 4TS1A 3PC7A 4BZQA 4WFQA 3Q3IA 3F46A 3PDIA 4N1AA 1ZZGA 3LRPA 4FSXA 4FX5A 1R4NA 1CZUA 1D6MA 3KZ1E 3QX7A 1GPKA 2R8YA 3HL0A 1B6SA 4DSZA 2F17A 2SECE 3MT8A 1M6NA 4YRJA 1KI9A 3IHKA 2QRVB 4Z9FA 3ZX4A 3NOVA 3U9LA 1O8BA 1DLJA 2GXUA 2QM0A 4KTTE 4P8RA 4X1KB 1QKJA 4JYMA 4YYEA 3RSHA 1KJNA 1PG5A 2IEGA 3T7DA 3ZKAA 3EQZA 4BFUA 1VJ1A 2FEAA 5L9AA 1UKZA 4R7TA 1XWFA 4IDPA 2GRUA 2GR9A 3GCXA 1LNZA 5FPHA 3MCUA 1OWOA 4WZBB 4U2DA 1G3IA 5F3RA 4Y6GB 5F4ZA 3FIJA 3I01A 3P0HA 4CFYA 2VTKA 2IYUA 3ADDA 1EX6A 3MCVA 2NIPA 4KMRA 4RVFA 4E3ZA 1RZ3A 1U0NA 4PSAA 3RRZA 3ZE6A 3JVVA 3GDHA 2ORWA 1KTVA 3IJEB 3MMZA 3D2BA 2HBQA 4K03A 1YTUA 1L7MA 4P93A 2E5FA 3NFRA 4NYJR 4LDNA 2JD2A 1JQBA 1KIAA 1EHYA 2IELA 1V8FA 2H7CA 2I3BA 4R9VA 5TB5A 1JT2A 5BYJA 1UK6A 2FDCA 3B1KA 3PLNA 1QIHA 4MS1A 4I2NA 1HFKA 4U2BA 5BVGB 3FUWA 4CKWA 4BX8A 3NIDB 2NQ2C 1US8A 1YBVA 3HG7A 4I4TB 3GP8A 3SBOA 4IIDA 4RPLA 1GAWA 3L02A 3U3JA 5GONA 1Q92A 2ZIZA 2FFRA 1QH8B 5I9BA 4X6UA 3N8DA 4BV9A 1XELA 4JZKA 4MWTA 5EJ4A 3AP3A 2XUIA 4Q9DA 1SVUA 1TX4B 3IBSA 1CDDA 1ZJ4A 3LWZA 5HJ7A 5FEMA 1CY0A 1CNMA 2O05A 2QD4A 2V9PA 3B6EA 2FWIA 3EMBA 4FNMA 4XD7A 4CETA 4MR7B 5E8JA 3IVGA 3IVMA 4CCYB 4AKGA 3HUEA 2VF7A 4D4LA 3E5HA 4QRHA 3E84A 3NOXA 4ZO9A 3OAAD 4FN4A 4G09A 4KXWA 3ZWBA 4CFSA 1OX5A 2AFHB 1A8UA 1N2BA 1TA4A 3FB1A 3MMPA 4G8DA 4KAJA 3E0XA 1D03A 4IJQA 2VSNA 4S35A 3VR3A 3WRYC 3NEAA 5BN4A 3LY9A 8OHMA 2H52A 5EPEA 2AS0A 4CDMA 1GTRA 1EB8A 4UAUA 3EDRA 1HQKA 4FNOA 5EZ6B 4HNRA 2BL4A 3RB8A 1JU9A 3WGUA 4ZJYA 2VH5R 2FWPA 2AEMA 2A5DA 4KXNA 2E18A 2HDNB 2BMVA 5KTKA 1WMSA 4Q4JA 3K6RA 1JSZA 4DPLA 4CR8A 1E1CB 3WWZA 4PWZA 4OMCA 3UV6A 1P1KA 2HRZA 4MDHA 3UUWA 2B5VA 4W5WA 3N07A 3X1WA 5EJ7A 3ZBPA 2C7QA 3AUTA 4ODIA 4NFSA 2HKIA 3UENA 1GSHA 3R3JA 1PEDA 2WSSD 1E7QA 4RPGA 2QTVB 2FZLA 5ALSA 4QJ3A 3NAQA 2NWQA 5CK4A 5L8VA 1W75A 3EISA 4HB4A 5I7SA 3EK2A 3AZOA 4L16A 4DLBA 4X94A 1QORA 1AXEA 2GFHA 4L74A 4IX1A 4LGYA 3ZCPA 3E23A 4AK9A 5JMTA 1GYRA 1B7GO 1M5TA 1V5GA 3N8IA 3R3ZA 2VUHB 3LYUA 1KEVA 1CIVA 1QZXA 4CM1A 5KVQA 1Q19A 3KM0A 2OA0A 1DL5A 5FL7D 1UEXC 3AY0A 4CM7A 2OVFA 2GJKA 3RPEA 3INRA 4KFSA 4XUEA 5ICMA 2HU2A 4OX9Y 3HLYA 2JJ1D 5LA6A 1VZ2A 2J59A 2FLWA 5KWEA 1TJPB 4FK8A 3SOZA 1H6AA 3ORFA 1CT9A 2Q50A 4AP5A 2VJDA 3M6XA 4G23A 4CEHB 5AJYA 2XCTB 1R5NA 2JI6A 5JWOA 5IFKA 1Y1PA 4Q1VA 2C58A 5LU9A 5HTOA 1N3YA 2CMDA 4CDRA 1JW9B 1C7JA 3AF2A 1WO8A 3AYXB 1RXYA 2HA3A 2PSHA 1FRZA 3PK0A 2KQUA 4H7IA 3LYLA 2QSJA 1VECA 4OXIA 2ODAA 2A86A 3M2PA 4JP5A 3QPCA 3C14C 3G0OA 2QS9A 4KR0A 1TEVA 2HUPA 2X0NA 5IYZA 1JB1A 1WB6A 2OMKA 3MILA 4ZQIA 4AKSA 1OD6A 1RLTA 4GNRA 3HA2A 3DDWA 1OC4A 3LPDA 4DLYA 4E5KA 5LD2C 2OGUA 1Y1QA 3N2NA 3D3WA 5H7XA 1Z4MA 4X84A 4MP6A 2REOA 2VUUA 5BMVF 3R23A 1TYZA 1FYXA 3L7DA 1A27A 2A9VA 2BKVA 4MEAA 2IYVA 3UOAB 4V0SA 1KU6A 4IJMA 3ZDDA 5GWXA 2P6RA 1BWQA 2RK3A 3OIWA 3FN4A 5KJ6A 1X7HA 1TM5E 4NWIA 3T7AA 4GGMX 4MRRA 1IL0A 1K89A 1R64A 1Z7BA 1N5DA 3I2YX 3TD2A 1XRPA 4LXTA 4O1HA 3OJEA 1VA5A 4PBRA 5ALKA 1E1YA 4CKBA 1I4WA 1T0BA 1G64A 4Y9RA 4BV2A 4F9FA 4WBNA 2HJSA 1DMSA 1VMEA 4U7PB 2H8GA 3B36A 1VLVA 4DA6A 7MHTA 4R9UC 1NPYA 4HEA1 4WLNA 4WK2B 3Q6NA 3UK2A 3RSSA 1UZAA 2OCAA 1FCJA 4NONA 4ZHQA 2W98A 3RVRA 4YRQA 1TQDA 1YQEA 1RACA 1P91A 2RGYA 3HWWA 3BIJA 4ZAWA 3O2JA 1P1CA 5T6MA 1YFKA 2AN5A 4LYHA 4QHSA 3TIGA 1C0PA 1OGIA 1HF3A 1G9XA 1CLUA 1H1TA 1NJ6A 1TUGA 2IVFA 2X4IA 2QUHA 3OP1A 4RQBA 3QQPA 5EKUA 4B71A 1BWRA 1JLLA 4CN9A 1G3QA 1L5OA 2YWRA 1FFBA 5ALFA 1ZI6A 5KIAA 2OL4A 2XUKA 1IY1A 2ID7A 3COPA 3HCWA 3D81A 3NYRA 3QXCA 2GPNA 5FR2A 1BCSB 2R5WA 4WNCA 1UJNA 1MIOB 1V8PA 4KGXA 3R20A 4M36A 1FVFA 2HI0A 3GLVA 3HLKA 3MMNA 3NQ41 1JQKA 2P5TB 3QPAA 2X4LA 4NOKA 5C3UA 1H65A 1QHHB 5ALIA 3WTBA 1LK0A 2XWSA 1T5OA 2OVBA 1LX7A 2XHZA 1YTLA 2ZIEA 4LOAA 4BXOA 5CT4A 3CVOA 4E5DA 3PGA1 3QVUA 1YS2X 2FQQA 1ZCJA 4JLDA 4EKNB 2X42A 1CEEA 3FAZA 1K0FA 3NORA 3QTLA 1NW8A 1HNNA 4RGBA 1G7TA 1Q6ZA 3WOVA 1KFEB 1XZPA 4OJKA 5AVQA 1NMYA 1PF7E 4MQEA 2KPOA 1H0RA 4B4WA 3LT5A 2PWBA 3RBAA 2WM2A 4BUZA 1Z6PA 2BKLA 3DVSX 1R0KA 1ZR4A 4TYYA 5TQ2B 1X15A 5CX4A 1AO0A 1AG9A 4JBHA 4G1MB 2H3EA 1U7PA 3FCAA 1M8JA 3AVVA 2APJA 5J2UA 1HG1A 3WYAA 1D09A 2E1PA 3CEMA 1YZVA 4I50F 3RJMA 1EBBA 1MRNA 2WWHA 3NR2A 2ZE7A 3PHGA 3PTZA 4EF6A 1E94E 1GR0A 1WHTB 2OO5C 2V9ZA 1W4AA 3I9JA 4MA4A 3B5IA 2QGZA 2WU4A 1H8HD 3PWKA 1GGMA 4NQZA 2RHGB 1V7ZA 2UV8A 3PUWA 1BXKA 2CLDX 4MMXB 3Q3HA 4E31A 3B78A 2Q21A 4RDCA 5LQJA 1PK9A 4JI0B 1QVRA 3SZMA 3Q1LA 5TPWB 1B0AA 2C9BA 3L7JA 3AEXA 3MOSA 4OHUA 2GVNA 1Q0QA 4U63A 1P5ZB 4IH4A 2OCDA 3FIUA 3LTEA 5G1PA 5K3FA 3V1YA 2BM1A 3DOUA 3O1IC 3GXBA 5E3HA 4N7RA 1L5VA 3K1TA 1VG8A 4HNTA 1XA0A 2ZIVB 4JP1A 3C8UA 1RJ9B 4N3BA 5E38A 3VH1A 4U4AA 3ISJA 4HFRA 1K3FA 1MC5A 1ZMXA 1DX9A 3I2FA 1KKUA 2XB4A 3H1AA 1YI0A 2P4QA 1RPZA 2ZTMA 4GYKA 1ECFA 5IKPA 4PHCA 3EULA 3HCCA 1TLFA 4G0NA 5CB4A 2FPKA 1E0JA 1E64A 2Z58A 2ZXUA 2OXIA 4OA5A 3L3BA 1H6DA 2CMGA 2HF2A 1KYXA 4FFWA 5J59A 1Y8ZA 4TTJA 3TLJA 3RUHA 3PTLA 4UDNA 1IM2A 3IUMA 2A0KA 1GNSA 2X2FA 4Q4DA 4XYBA 4OYRA 2WTXA 1QV6A 3HUFA 4CQJA 3ZQJA 3U4QB 4Z9YA 4FDMA 1OIWA 1WDMA 3W5DA 4OH1A 4G1UC 2BFDB 3HWRA 4ENVA 4Q9HA 2F1KA 4D96A 1U4OA 2CUKA 5D3MB 1MO5A 2BM9A 4N3CA 1XYYA 1C9EA 3IJ5A 2OD9A 1X1QA 5AI9A 4D98A 3HSYA 4D97A 4AY5A 3O74A 1DX4A 1Z0SA 4DSTA 3FLEA 5TQJA 2QZJA 3GBSA 4PXAA 3WLNA 4B3FX 5SZJA 4BVFA 4Z1OA 4Z4CA 1C7FA 1VCIA 1TMYA 4AL4A 1LV7A 3NETA 3W1EA 2GERA 2EFDB 1KYWA 3PHIA 1D07A 3QBEA 5HK8A 3GVPA 2Y8EA 3C85A 3D4IA 4FDLA 4N7MA 1OPXA 1VOTA 2D7JA 2G0TA 3AR8A 4FCCA 2ZYSA 1TAHA 1WZIA 3HRHA 1Y37A 4JBLA 5HKKA 4KC0A 4RDIA 3L6UA 3ZIAA 1DZ3A 2PFKA 4A27A 5JNVA 3H9GA 3O4IA 3CCCA 3KPWA 4EHNA 5JISA 4PFSA 1UAYA 2PD6A 3KVVA 3BDVA 3DEJA 1WZEA 3ZR4B 4DRZA 4CEJA 5JJKA 2VRCA 3QLVC 4G9GA 3Q10A 4LTNA 4PX2A 4F1KA 1NASA 3OHMA 3MGAA 4INAA 4MQFB 4ZP1A 5THXA 3S2ZA 1UKVY 2FR8C 2OBNA 2WHYA 4KXXA 4S24A 2XT9A 1T35A 2OGTA 2J3DA 3ZVLA 2CVOA 4B84A 1MMFB 3OHSX 2FFQA 5DXFA 4B7AA 4C07A 4WGFA 3MAJA 2NUTA 3L43A 4PLTA 5FIUA 3UJPA 4I9HA 4HDNA 1KE2A 1SIUA 1LQ2A 2V74B 2QJFA 4ETIA 1B8UA 2BFBA 4GR4A 3VMFA 3DFZA 1Z8FA 3Q7IA 1FX0B 3CPHA 4Q3BA 4B6GA 1KEEA 4IRXA 4RVHA 2W9XA 3E9NA 2XDAA 1D6SA 5C18A 4IIVA 1QFJA 4UNPA 2PKCA 2EVWX 1MIHA 1L7QA 4IWXA 1ZUNA 2PPLA 5IJ9B 1TM3E 1ZCFA 1TW2A 2CKMA 4KQGA 2QLBA 4RORA 3EVFA 4RTMA 3ZY4A 3L1VA 4CLOB 3H4TA 1NI4A 3AFIA 3HCDA 5FUBA 2BBTA 3WSVA 4RTQA 2XIQA 1V45E 1E79A 3MWDA 2R1TA 3L6BA 1VA4A 3HDJA 4EG3A 1TUEA 2AZTA 1Q0HA 2PL9A 1MOPA 4B6RA 2GYWA 3WDMA 5BOVA 2DKNA 2BONA 4OAOA 3E58A 3OCYA 3KR2A 1GRNA 4MIEA 3CNQS 3H0CA 2CEAA 3QUSA 4ZEOA 4BO2A 1ZNXA 1QZ3A 4G0VA 1O95D 4I9UA 2C07A 1W44A 2W5UA 2B37A 3KT3A 1R15A 1SVIA 4NCIA 1DTEA 2ZUFA 4X71A 1GGKA 4JNCA 4MDEA 4P4NA 4FGZA 2QZPA 1E1RD 1M2EA 1Q44A 1X7GA 1OYVA 2BFEA 4FHDA 5L3ZA 3ZJVA 4ZGGA 4US1R 3LNTA 4D9HA 4WKNA 1QO0A 3OUUA 5K3DA 5C46F 4N5LA 3Q7RA 2IE0A 1DS6A 4A2CA 4CUJA 3GY0A 3ZW7A 3CKYA 1CD5A 1THZA 4HBGA 4FNAA 2ZTVA 4UNRA 3ZWWA 4JI7B 3CRVA 1N3IA 2AI3A 2GJSA 4XR4A 1C3OA 5EE9A 1B0UA 1IHPA 3H6KA 3NEPX 4KQHA 4DR6B 1B1CA 2JS7A 3UMVA 2VHCA 3R3YA 2C29D 1DIBA 4EB6A 1M9NA 3OQOA 4IXTA 1YC2A 4Q93A 1H4VB 2PVPA 3K05A 2D00A 4UMEA 4ETMA 2WFAA 2GNPA 3NGMA 1PGPA 5CEEA 3FCUB 2VDVE 4W5RA 1EG7A 2A4MA 1B8NA 2H7VA 1E8MA 4Z8YA 4IQFA 3RYFA 1DC3A 3DL7A 1M2NA 3A7DA 3B3FA 1XLVA 1OYOA 2XRFA 4Z54A 3HO1A 3ZHBA 5A06A 3N58A 3NOOA 1PFGA 3SOPA 2J46A 1XD2A 2ZLBA 4YAOA 3PGKA 2I1QA 4IEFB 5DP2A 2IP1A 4K6FA 2DULA 4HMQA 1CS4C 2HN9A 3B7WA 3DJFA 3ECAA 3F49S 3FUXA 2ZPTX 4QQRA 2MCFA 1FTQA 3AF1A 3IP5A 4DRYA 1UZMA 3R76A 1S0UA 3AYZB 3WYFA 1UWLA 1WF3A 3PC8C 1PKEA 1C8BA 4LDRA 5EHQA 4L95C 1UKAA 1CR0A 4JLUA 7AT1A 4L5AA 4DIBA 2W4MA 4PCUA 1BDHA 4QO8A 4KXYA 5SYAA 3VKVA 5DGHA 3V4OA 2HQRA 3C3AA 1AE1A 1AD2A 2LBPA 3UK7A 5IKXA 3LO5A 4W5QA 3FTEA 2A2ZA 2POCA 5J4VA 3BAZA 1ICEA 1NDHA 2GWHA 3G8AA 1KAOA 1M2HA 3RIMA 1EVQA 2ZS9A 2Z5LA 4HVCA 3LFHA 5JALA 2CYCA 3IMCA 4MUEA 4QJ4A 4WQMA 5AKJA 1MOQA 1E1QD 1SRQA 1MAVA 4EY4A 4YUZA 1SVNA 1NRWA 4NZOA 4OFXA 5CYFA 1OHHD 1P72A 1Y8RA 2WSBA 4WZZA 1Z2AA 3WK4A 3Q7SA 4DOMA 7YASA 4EG8A 1RJEA 2HEGA 2WF6A 1XRQA 3F8TA 5EL0A 3JAWB 2VHWA 1ZQ1A 4MW7A 3V7UA 4FE7A 2ZM5A 1HDCA 4KZPA 4PW0A 1K5GA 1GGNA 3OOEA 5LIRA 5TLSA 1PWHA 5IMBA 1NIJA 3KALA 4S1PA 4EM6A 5AH0A 4JB3A 5JLJA 5EI5A 1W0JD 3HB1A 4CKXA 2XKBA 1EWQA 5LMZA 4F9GA 2O8EA 4UD6A 1ZSVA 3TBKA 2H11A 1A77A 1VL8A 1PJAA 2RG1A 3O0TA 5EXSA 2I7XA 4I1IA 4QIHA 1J9ZA 4OJTA 3RHFA 3WGMA 2H4YA 2HJVA 1LBQA 1ORIA 1AK2A 2ZJBA 1INLA 4UNNA 4AN0A 3THYB 3TECE 2B2CA 3GRCA 4YQEA 1KPHA 1MB2A 2IPLA 1U7WA 3AGPA 3F5MA 5LZ5A 4EVSA 2P2NA 3ZKWB 1NUSA 4H27A 4DQKA 1V3UA 1EFUA 3JYLA 1Y0BA 2C5EA 1IXSB 1Z4PX 4LVOA 3V33A 1NHWA 2ZTSA 3KEFA 4LVNA 2I1VB 4RCZA 5DYWA 5LQMA 4LF5B 4K88A 3F47A 4M6WB 4U02A 2B4TO 2W8BB 4BBPA 3R9XA 1AV6A 1FOEB 2JRLA 3KU1A 4QWWA 2VSOA 4WCFA 2HWKA 2XEDA 1OLOA 1KQGA 3LW8A 3ELYA 2AJTA 1OAOA 1TT5A 3ZE7A 1KK3A 3ETNA 4PYMA 4D9JA 2AMLA 3H2ZA 1WZNA 3MPOA 4E5YA 5EWLB 3DMTA 4ZI3A 5C8YF 3P9CA 5DNVA 4LYYA 2DTDA 1GPLA 2P9FA 4KXMA 4QELA 3TAXA 3RRYA 2E4VA 1KQFA 4EMUA 1VCNA 5BSUA 3H1GA 5K8VA 2BKEA 1F9EA 1KAGA 3QU9A 3RARA 5JJIA 2A84A 2PTGA 1OE0A 2CFTA 4OO3A 4F72A 2VAPA 6GPBA 1D2MA 1EUQA 5AW8A 3HSSA 4POOA 2P2YA 1I4OA 1QYXA 3CMCO 1XZBA 4NABA 1DFGA 3JWEA 1U4SA 4B8YA 5EIBD 1YKGA 1E8NA 3ZWQA 1OBVA 4EKEA 5K5EA 1PJZA 2W43A 1J9EA 1PI3A 4DLAA 3FGPA 2Y0CA 1P4HA 1SB8A 3L4EA 4X9XA 3BRWD 1KJWA 3H05A 4A5OA 1CFJA 4GSKA 1RFLA 4Q7QA 3R5TA 4D4GA 4DLSA 3FOFC 2QLMA 3CVWA 4FZRA 2C1ZA 5IUNC 3UJ7A 3EX7C 3KYIB 1Y1SA 4EHBA 3VGJA 1NQ5A 5FR1A 4EOGA 5AOAA 1LTHR 2EKLA 2LPMA 4L72A 4RMIA 4UMDA 3ZQUA 3VI3B 1NXOA 4E70A 3SCZA 3NRCA 3V4FA 1WOYA 3QVGA 1SVWA 1BJTA 1M0WA 3HCPA 3KYJB 4TZ6A 1ZD9A 5BRJA 3CF2A 5EOVA 2GAOA 4M38A 4EY3A 3HP4A 4PPYA 3O4HA 4EHIA 4E3WA 3ZD6A 4XB6B 1H3EA 2CLMB 2PBRA 3ZCUA 3FJYA 2F1HA 1IRXA 1DBQA 2FPUA 5JCJD 2FETA 2BGIA 1YQTA 5LLTA 3SS7X 2YKGA 3OKPA 1RWNA 2HU8A 3GOQA 1SHJA 4R5MA 4FR0A 3IT2A 3C4JA 3STWA 5MFZA 5KYWA 3TSAA 2ZR9A 2G76A 1HETA 4XZ3A 1FSZA 2CXUA 4OBBA 5CDTA 4IG4A 2OILA 4XIJA 3I1FA 3LHKA 1DKQA 3W6ZA 4EL0A 2RGXA 4GWGA 3BXPA 2J9FA 3RIGA 2RH4A 3T1NA 3PQ6A 5ICGA 2BJHA 4PTZA 1IH8A 4GPTA 3BIFA 4MVYA 5DO9A 4I14A 5GOZA 5FWNA 1S4MA 1UK8A 1J56A 1P5RA 1UP7A 3GVCA 2HLDD 3KEOA 1NVAA 3LPMA 4UHFA 2DFTA 4CIAA 5KVAA 3TX2A 2BOVA 4NV1A 3QVLA 2AXNA 4NNOA 5D3MA 4K8OA 5EFOA 4ZQGA 5HDBB 1OAOC 3U4DA 2J1LA 2OBBA 2PX5A 1QYVA 4FEYA 1DXQA 1QOZA 4P5DA 2IHNA 5CPBA 3A27A 1PQPA 2AQIA 2ZSAA 5K4HA 1C9JA 3ESCA 3BVPA 5F9MA 3CIFA 3FSJX 3K1YA 4N01A 1IWOA 1SNYA 4J4HA 1G5HA 4CJXA 1OLUA 1T9DA 2CVFA 3IR6A 1XAJA 3IJPA 2JFPA 3MUFA 4TTSA 1CB0A 4UAGA 3FDXA 3CH7A 5EXEA 1TF2A 5L7YA 4DY4A 3ZNNA 4X45A 1HE1C 3R8FA 1ZS9A 1EXDA 2NUAA 4RA6B 1Z68A 2CJXA 2A1TR 1R50A 4PGAA 5E6SA 3WLRA 1WCIB 1F5SA 1RXCA 2Q3MA 1CJUC 1X1SA 2AF3C 3I8OA 3KJXA 1RCUA 2AX4A 5JSUA 2H1SA 1U0RA 4MUHA 1ZONA 2FW9A 2GLXA 1E5TA 1YS4A 5FWDA 2VI5A 2P4HX 4GXQA 2H1HA 3QSGA 4O5OA 5K0NA 2C59A 4F86A 5JBIA 2HR1A 2O8FB 2C04A 4FHGA 2L0XA 3ANLA 4PZ0A 3ULKA 1SG9A 5BSVA 1FFYA 2BH9A 2G67A 1CE8A 3C7DB 4KODA 5HJEA 4CXMA 4G97A 1W73A 2BM8A 2MJLA 1TPZA 2PGAA 3NHBA 4Q66C 1DOAA 2F55A 2GO7A 2JI9A 1GDHA 2GT1A 2YZNA 2ZAGA 5IVDA 3GELA 3RIXA 5JD5A 3PEYA 4AP9A 2V7QD 1CQJB 1TJ3A 3FFAA 4P98A 2F9LA 4JEHA 1OXVA 4OAPA 4QDKA 4A0HA 3JD2A 3GLGE 2D8AA 2Z6UA 2PZKA 2FOXA 3W5BA 3QVSA 1Z7YA 1W5TA 3OZRA 4Q02A 1BMFD 4WT7A 2C4TA 3TZLA 4LQDA 2HY7A 4FYIA 4E5NA 4LFBB 1Q91A 3L7NA 1HDEA 1X1BA 3P9IA 3PNYA 4K26A 5JH7A 3KQSA 1J0EA 2Q4OA 1IE3A 2I29A 2DB3A 3PGLA 1K08A 2PUHA 4ZICA 1E6CA 1JQAA 3EVEA 1ECGA 3G2HA 1ND6A 2BCEA 2PH5A 3O2NA 2R6CA 3MMSA 1K7XB 1UC4B 1U8ZA 3CJRA 1Z0UA 1POXA 3FJ1A 3NEJA 2A3NA 4NE9A 4P54A 3VR6A 2K5UA 1BEZA 3IUPA 4C0WA 4PYJA 3TDMA 3NAGA 4HN9A 4QVGA 1AQUA 4JQCA 4FX2A 1GARA 1DUVG 4KPYA 5AI8A 1P1JA 3PD0A 2IBSA 4NU0A 4DA9A 2GXQA 3M3DA 1B74A 4GFDA 4JXZA 3R24A 3U7QA 1T6ZA 2WYUA 2HXGA 4KOAA 3TINA 3T1VA 3OCUA 3HCEA 1EFCA 1R2QA 1TAGA 3EIWA 3JVUA 2DWCA 3ND5A 4FYXA 5HGXA 1Q7EA 4M86A 3EE6A 4GPEA 3NKLA 4Y9TA 3VAAA 2ZSDA 3U6BA 1U7HA 5B3JA 3O8QB 4GOJA 1XLTA 5BQXA 1FVOA 1QV7A 5BWBA 2AYYA 5CNJA 5MF6A 1PYGA 1JG6A 1DQZA 1GPDG 3HA3A 3FGOA 5DBHX 4CT5A 2WB2A 4PINA 5HCIA 4AI6A 5KYNA 4URUR 1F8YA 2JZOA 1Y9EA 4N7BA 4KYIB 3IUYA 1QIFA 4XLZA 3WWPA 2ZM6B 4XR9A 1G4AE 5IHPA 1RRGA 2VXBA 3CNNA 2PJZA 3DBRA 3DM5A 5FDFA 4RVOA 4RXUA 2RI6A 1SH7A 3UJAA 3COJA 1YUNA 4M0LA 3R09A 5IKMA 4NARA 1QBKC 1GPH1 1EAYA 3K53A 2ZRNA 3K71B 3INNA 3KOOA 1GTZA 1Q3TA 3OTGA 4UE6A 3TYXA 4C6RA 4B79A 1A8SA 1U94A 4WN9A 1IG0A 3P4UA 1PUXA 2GUWA 4WV3A 1BHO1 3BD7A 1JJBA 3KQVA 4P32A 2KBFA 3DKKA 1T24A 1F51E 5LP6A 1G8HA 2XYVA 5KUTA 1DGQA 3EH1A 4OQPA 2GEJA 2VT7A 2HXYA 3PICA 4TTPA 4ZKEA 1N36B 2CFSA 2AKEA 3CVYA 4GDMA 3NRJA 3O3MB 5IDWA 5H1YA 3ZLJA 3L0SA 4HZIA 2Z9BA 5EKSA 4G8BA 5CDFA 1BVYF 2HLHA 3ZVKA 4IRUB 1YO6A 4OK5A 3ELDA 3MF4A 5BUSA 3ZE2B 13PKA 3WGJA 2B7BA 2P35A 3D43A 1C0KA 1ITZA 1ML4A 1QCCA 1YVRA 3BMNB 4FYMA 3MOGA 4X0EA 4HATA 4ZVQA 1XN1A 2WNHA 5KI6A 3ZY5A 4BVAA 4URXR 4OXKA 3ZCTA 3VO2A 2CZCA 4HVAA 5DRYA 4ZAZA 1ZXXA 1U9ZA 5ER6A 2IXFA 5G0WA 2DGDA 1QOPB 1XD8A 1E9DA 3LYAA 1RYZA 1J2UA 1M6WA 3GWZA 4OIFA 2AYXA 2GKOA 4Z86A 5I9IA 2AN4A 5BQOA 4LDQA 4CV3A 4HVLA 5KTSA 5LZ4A 3FPEA 1NNLA 1PR6A 2WWWA 3JZDA 2B69A 3N86A 1J8VA 2GJ4A 3GGPA 5LYYA 3CNHA 4HV4A 2AKAB 2QN9A 4EUEA 5IM4A 3B6ZA 5GQSA 3WLPA 2GD1O 2ZDGA 2C9DA 1Z0FA 1OAKA 3I6QA 3OLCX 4BPBA 3M34A 1UFQA 1Z15A 2FW8A 5JDCC 2PBLA 4D8WA 1OOEA 3QOXA 4TKVA 1F12A 1VYUA 3WB9A 2LWIA 2Q1WA 3IE0A 4IDEA 4C1NA 3VHRA 4D3DA 1E2QA 3H5RA 5C1DA 1NXSA 3ZLVA 5JS6A 3T12A 2WIDA 4DR4B 4WXHA 1LNQA 4J9UE 5B3JC 1VKNA 3PF8A 1XLTC 3PRYA 5KDOA 1QYCA 4EKDA 2XBUA 3BJMA 3NS7A 2AQKA 2DPXA 1M34E 3CRZA 1FB5A 2IPNA 2ONZA 3DUFA 3GEHA 3ADCA 1VZ3A 1OH6A 1AS2A 2UXDB 2PMWB 3L8HA 4OD0A 4TMFA 4ARUA 5AW6A 1E3SA 2H0RA 5G4KA 1CYEA 5B3KA 3HCRA 3I52A 4JC4A 3ASUA 4HWTA 3ZDXB 3TGWA 4HAIA 5CXQA 1UDAA 3ROEA 1Z07A 1PT9A 3PDCA 4RJTA 1ODIA 1KP3A 3F7TA 4MWDA 3WL7A 3RKSA 4BLQA 3T7EA 4BCCA 3OT1A 3DXXA 4IRMA 1C4KA 2NW6A 1USKA 3CWZA 1NAHA 5A5FA 3VDRA 3WL8A 4IDOA 2JIOA 3DCJA 2GCOA 4EUFA 2WTEA 2HD4A 3JVEA 5CDHA 4M22A 1NM5A 2A5FA 2XGGA 3GLHE 2XE6A 1PEAA 4J3JA 4YJHB 3PFIA 5JT1A 2IX3A 3OIVA 3IKTA 1F2UA 2CBXA 2JGDA 4YXFA 4GD3Q 1LDBA 1MZPA 1GXSA 3RSOA 2P2DA 5D1NA 3HEAA 1NY6A 4D4IA 3RVJA 3OE7D 4JV5B 3M4ZA 4CVNA 2GA8A 3CPJB 1ZKDA 1P7VA 1PDVA 1LVUA 2FG6C 3KWMA 4H0NA 2XOKA 4AF6A 5G41A 3KDSE 5CBPA 4L9SA 1NBWB 1Y6GA 3TLEA 1CUCA 1XU4A 3HYLA 5JU6A 2X0JA 4NE2A 4KWIA 2GN2A 4REMA 4C4TA 5THQA 3B3AA 5FBQB 1RLUA 4FBGA 3A8TA 5MGBA 1RADA 2UUOA 1P1FA 1K63A 3GDFA 2JAPA 3MWGA 3QKWA 1J99A 1T4BA 3LCRA 4WZAA 2PU5A 4KYUA 1WRBA 1OU4A 4TYPA 1S7CA 2JZCA 4C43A 2C88A 2VDRB 4YRLA 3S5UA 4OSOA 4RM2A 4R9NA 1UPXA 1YRQA 3UEOA 1LLFA 5AVJA 5I8PA 1KI6A 3OY7A 3TQHA 4B0OA 1ZVQA 3RC1A 1EFRD 2VATA 1IG3A 4PQRA 2IRWA 3AEQB 3QELA 3WRWA 2HT6A 4TL6A 3IP1A 4IFTA 1JSRA 1XRJA 1KZ7B 2PZAA 1MGOA 1FPMA 1E66A 3KT0A 1O4VA 5AI0A 5F77A 5AQ1A 1TVMA 4JJFA 2GK4A 3D4LA 1HWYA 4BMZA 3NDIA 2VCEA 3O82A 3V55A 4X85A 3GIDA 4XE5A 5ED4A 3H65A 1R3DA 2GA9A 1JTVA 4PSUA 4QOHA 1GPMA 3H04A 2IQIA 3F6SA 4R8RA 3NBKA 5IAKA 3ZDQA 3KYDB 5B3AA 2HF8A 3ASZA 3T38A 4B5KA 2RARA 4KN6A 3L7MA 4LYDA 2CLIB 3JWGA 4Y18A 1BXGB 5TC4A 4DIDA 4TLBA 3W5SA 5HEKA 2BGNA 3H6GA 1SR8A 4QL3A 4AIRA 2UZ3A 1N2CA 2O3SA 1OXSC 1HZZA 2AK3A 3P20A 3C0KA 5FOWA 4F60A 2V4UA 3AVWA 3JVDA 4BFXA 4JXKA 1A0OA 1XZMA 1P2FA 1DBPA 1N8KA 4NE7A 2NTVA 3JATB 1SCJA 1ESCA 4ACAA 1VIVA 3PCRB 4K2HA 4WEOA 5K8LA 2W2OA 2PVCA 4L8VA 3TL6A 1DBVO 4BQPA 3OZFA 1BN7A 4UQPA 4DCGA 4CUZA 3GA0A 4A8JA 2VS1A 4FSDA 4HQNA 2ZJ8A 1AS0A 2CZQA 4G65A 4NU8X 4O4JA 3RS2A 3WGNA 3ZWNA 3TSZA 5JNLA 2WM9B 4ZV9A 1KNQA 5EN4A 3RQIA 5HE8A 1K6EA 3HA5A 3FPJA 3AF5A 3Q11A 1I7DA 1TYCA 1UKEA 2WNSA 1Q7RA 1V5WA 2YWJA 4AMYA 2IGBA 1Q84A 4BN5A 5JHGB 2E1RA 1R4MA 4WXMA 1X7WA 2R62A 3VR1A 5DM60 1J1UA 4XVQA 1DIRA 9LDBA 3U3OA 2JEZA 5E8RA 1EWTA 3HRIA 4Q39A 4LJ4A 4AJ2A 4E7PA 2IP4A 1JPVA 4KXUA 1I2DA 4JB2A 4N8DA 4GMFA 1X9HA 3E9DA 3DHVA 3FX2A 3STYA 1F1BA 3WHLA 2OSVA 3C3MA 2QD5A 2QJOA 3OFJA 2XB2A 4F97A 2BR4A 4HLCA 4HI0E 4G9EA 1YI1A 3BK1A 4FP9A 5CM9C 1Y3HA 4BQOA 3DE0X 1R8YA 3WB0A 1FP2A 1YNSA 2H2IA 2WV9A 3IKVA 1CJVC 3L9WA 3NJRA 3Q12A 4FJ0A 3QG5A 4OUDB 4YCLA 4UCQA 5JUWA 3DEHA 2GASA 5MGNA 3KPJA 2WW8A 1Y6RA 5EWJA 5EJ5A 4LBYA 4F7DA 4M8KA 1YDHA 4GVXA 3LRTA 1M1YE 2FUG6 2P3SA 3ONDA 3CW9A 2HSJA 3ADOA 3AUYA 3G2JA 3NHJA 3ZDAA 2P1ZA 3WNQA 1G21E 1VL0A 4ZOLA 1N8TA 1VHTA 2ES4A 3HKBA 4P4SA 2EF1A 1KFCB 1T9BA 5JYCA 1FDUA 4HWGA 4II2A 3TSOA 5COBA 2FQ1A 3I23A 2ZKLA 1EZ1A 2NVUB 2GPYA 1Y3DE 3HR4A 4U6SA 2Z08A 2G4VA 4MV4A 2CUZA 4N0EA 3RYHA 4Z1MD 1V47A 2A5LA 2PE5A 2WZCA 3AJAA 2WIBA 2ZANA 2IYTA 1YAJA 2PU7A 4PLVA 4R6WA 4V2IA 1DG9A 1GZ5A 2PXCA 1FX1A 3FYUB 3NAZA 4GRIA 2G0AA 1ETHA 2J30A 1C8VB 2P9GA 2MINA 1KAEA 3OSUA 4YPOA 1BQ3A 2QX4A 4YMWA 4JITA 1P19A 5KDDA 1Q0UA 3EASA 3TLMA 4Z4IA 3MTIA 4EX7A 1NOJA 4WOKA 3CX6A 4ENUA 2PR7A 5BYBA 5CVJA 3LFTA 3T8YA 3H9CA 2LCFA 3WA7A 3BGWA 1RBMA 3FF1A 2HIAA 1I01A 2F9FA 1D8AA 4A8JC 4ZYXA 4JLVA 4ZTZB 2JLUA 4JJ4A 5JEDA 1WCWA 1EFLA 1FDWA 3OUTA 2GN0A 3IESA 2YV3A 1HZJA 4DGQA 1YQGA 2R6JA 1U02A 5FUMA 3ZDZB 3OURA 1MOZA 3AUUA 3IA7A 3HE3A 4V38A 1YE5A 1L7OA 2D3WA 5A2GA 1XP5A 3HYTA 1N2ZA 3UWSA 4PONA 1X86B 4JX8A 4IOMA 3JU3A 3KYCB 3NWBA 4PZYA 4ARZA 3HNPA 5LPNA 4A16A 2YMPA 4AQYB 1XVUA 1XRNA 4RF2A 5NULA 2WHRA 4FXOA 2YWGA 4CKCB 3IFSA 1MQSA 3B85A 2OFPA 1EK1A 2HTFA 1E9FA 2XNHA 2Y1GA 3PXXA 2FW6A 4TX1A 2JI4A 4M9RA 1DCTA 2QN2A 2HNAA 3IO5A 4LZNA 4MEJA 3A32A 5AI6A 2XUDA 3I53A 4L51A 4URHA 1HLDA 2HF7A 4L22A 4YCJA 4CKYA 3I9LA 5HBGA 5HQ3A 4GWLA 1FYWA 1NX9A 2H5IA 1ZN7A 4ZYZA 3DE6X 2HDWA 2IDJA 1PJBA 2WPDD 2HYDA 4OMUA 2HAEA 2VP2A 5L3QB 1EG2A 2VLIA 4HXGA 2XECA 4G07A 2R25B 1DKPA 1UWKA 4WDQA 3AP1A 2V6IA 1IXZA 2D2IA 2Q4DA 3U40A 5KOHA 2IXGA 3FMOB 3O2SB 3ZD7A 3UJHA 1YJAA 3GPDG 4LN1A 1PT8A 1R0RE 2OQIA 5H83A 5SYMA 1Q1NA 1G8MA 4RFSA 4KLNA 3RK0A 3EIHA 2LR0A 1X42A 1TLLA 3D3KA 2D2EA 4R1NA 3ZJ4A 2ECPA 1J2EA 3ER6A 2CJPA 4LI3X 4MQLA 5DBGA 3X2EA 1FTWA 3LDAA 3LC0A 2KHZA 4K9KA 2BZ0A 1W34A 1XTRA 1ZOPA 3AILA 5K8CA 1XQVA 4K9DA 1KOLA 2QQGA 2GM3A 4IHJB 3QLUA 5FADA 2H4XA 3EQ7A 4HQLA 3R0ZA 2H5LA 4KYTA 5J4YA 1RIFA 2Y1EA 4CODB 5FI3A 3PHJA 3V4RA 1TYBE 5ALPA 5T64A 1G18A 2QUAA 3ORHA 1F7VA 1EFAA 3C6MA 4EG6A 3MRSA 4Z0PA 3TM4A 1VP3A 1Y1TA 1NYQA 4DZTA 4Q00A 3LKZA 2BP7A 4N5DA 2YWHA 3H7AA 5FUVA 1ZC4A 4DSUA 2FRDA 3DW3X 3H1FA 1CCWA 1MH1A 1VBMA 3N5KA 3AI3A 5CCEA 5KOIA 4K3UA 1YL5A 2RMKA 2ZJ4A 3BULA 3H8JA 2R8XA 3QLEA 3QWFA 2GCEA 3I76A 3JPYA 1ODTC 1RTTA 1KI1A 1SQFA 2WP0A 1XTBA 3JQ6A 4HLQB 2EP8A 3V7YA 3H7IA 2QV7A 1ACJA 1CJKC 1KMQA 2GHIA 2V97A 4DR3B 2C2YA 3E82A 3WHKA 4MVJE 1I7QB 3Q7PA 4YO7A 3DS8A 3G02A 3PDHA 1E8DA 1RQ7A 4C0BA 3S1SA 1DC7A 4JWTA 2X1LA 1F3OA 2FW7A 4HQRA 4HUQA 4PWYA 4FHCA 3OFND 5H59A 1WS6A 1WXHA 3P1JA 1YR6A 4ZEXA 3ZIUA 1D7AA 4TKUA 3AU8A 5AP9A 4XX0A 1ZKMA 3LBIA 2KI5A 2HOQA 3PQ4A 4ZZ2A 1YBAA 2G9RA 3LPLA 3S2IA 2JW5A 4JUCA 1LDEA 2BMJA 1CQIA 3SC2B 4MUKA 5ALNA 1MG5A 4ZCTA 3ZYCA 1Y9JA 2VJMA 4L7QA 1CZKA 3EVTA 2DU8A 1YT5A 4TM7A 4TXNA 1T2VA 5DVZA 5J1TB 3UJ6A 3ELWA 3VYUB 1E60A 1VL5A 2H8KA 4RX1A 5BV2P 1Q1BA 2YCBA 3C7CB 4YP9A 5LYJA 2V03A 4IDAA 2PSJA 5KNBH 4ISBA 2P9CA 4NV0A 3P94A 4GZMA 2I1WA 2R47A 4XA8A 2WIJA 4QDUA 1QGZA 2AQHA 2FHPA 1CUVA 1GLNA 1XJ0A 5AXDA 2NMVA 4J1TA 4S2UA 1ZIOA 1O2DA 1VIAA 3PUHA 2GSDA 3MBKA 1JFTA 1MLDA 4UTPA 2G9UA 5AKYA 5HYVA 1UMBA 1QG6A 3DYVA 2I2BA 5K99A 4AUKA 3STTA 2CUTA 3F8WA 1FNDA 1HNWB 1JJFA 1JEEA 2IUEA 1P5JA 1ZGHA 4PC3A 1JSXA 2YN4A 1BO6A 4YJGA 4EI7A 5CLIA 4M1MA 3DMDA 4MI6A 1CY7A 4HEJA 3UCFA 1M54A 2RONA 1M6VB 1E18A 2IYAA 5M04A 5KYYA 2P91A 1L4HA 4HDKA 2OHOA 1OZAA 5GTDA 3KLMX 5GV7A 3KQYA 4A5SA 2ODQA 2O2EA 4H7EA 4X24A 4B73A 4C76A 4G8CA 4H7DA 3O1LA 1I14A 2GBLA 4PZLA 4QAJA 1E5LA 1GSIA 4RADA 5A7HA 2Z30A 2EX4A 2C5GA 4OK3A 2GBGA 1WIWA 1CBUA 1LRKA 4QLOA 4DMFA 3JQAB 5LQKA 1Q1ZA 1IRIA 3GNTA 4KK3A 4IV0A 3A1UA 4RJJA 2H1CA 1YJ8A 3T4EA 3CPEA 4FCVA 2HNBA 4BZWA 2PGJA 3I9MA 4DSAA 2Q3FA 3M1LA 3QUCA 2IH4A 2G72A 3LOPA 1LDNA 2IEBA 3T1HB 3LTNC 1G2PA 4JJ6A 2PMEA 2Z09A 3TQQA 1ZDMA 2GNAA 2Q8QA 3E5NA 1KAQA 2F90A 4URWR 3ZDEA 3NO4A 5H3LA 3HXQA 2C2OA 1X2BA 3DZIA 1E4VA 2OP0A 4OSEA 2P9JA 4UUPA 3WJAA 4CM3A 2YYYA 4EW2A 2F8SA 3RV3A 4U5QA 4B82A 1W0CA 3PE3A 2HQBA 2AJCA 3HYNA 2YJ6A 5EMMA 1KMHB 2Q5IA 3MC1A 1O6FA 3QJYA 4MXDA 4P7JA 2WWXA 2X8JB 3L5KA 8GPBA 1GM5A 4WFIA 5A3SA 2B8TA 2PT5A 4BDSA 1AF7A 5G53C 3H5AA 2E6UX 1Y5RA 4HMPA 3LUCA 1WU8A 3A3YA 5CDGA 4Q9JA 2I5PO 3KQUA 2Q2OA 4GI5A 2SKDA 1J1ZA 4N0DA 2WSSA 3GLFA 2QMZA 3JAKB 1FVXA 1RQRA 3NDRA 1PVOA 1K7EB 4ND5A 1FNNA 1QB8A 3ETLA 2EX1A 3FZYA 2EBFX 3H13A 4FZVA 4U5XA 5KTMA 5E4JA 2YHIB 4E6EA 1TU0A 1GCAA 1ML3A 3GCDA 3H1EA 3QE0A 4J1TC 4BP3A 3FWHA 2FP4A 3P2EA 4WFKA 5TIIA 1GU7A 3MD9A 4JFRA 1XHFA 3DTYA 2PMCA 4HB3A 3WLJA 2PCLA 4ZI7A 5FWYA 4RHUA 1U1CA 5FL7A 3ITKA 3V2UA 1U2EA 4LECA 4CG2A 1Y48E 3VPGA 5JANA 1U8TA 3A36A 4ZVNA 2ZVQX 2XQJA 3L04A 2JJ1A 1V25A 2QE7A 3P9RA 3NPMA 4QFMA 4XGQA 1P81A 5B7GA 5T67A 1PV2A 2EOAA 1WA5A 1NJ2A 2W71A 2C2KA 2VP9A 5CB0A 3NWOA 3D31A 3ND7A 5GVSA 3B2QA 1T5SA 3GMIA 5EINA 3I1YA 1PZFA 5E0OA 4WBXC 6PFKA 3AM3A 2G5PA 1BE0A 2GBLC 2ODTX 1NV8A 1OZHA 2B1GA 4JK3A 4GM1A 2CLEB 3S8MA 2IF2A 4C88A 1TECE 5T4HA 1JSCA 1JKJB 3QWIA 2PXHA 4PBSA 2EJBA 5A3VA 4GKVA 1QR6A 3OOJA 4JB8A 3NU1A 1PT6A 3BWXA 4RZ2A 3FVWA 5JXJA 5JADA 5LDDC 2QTWB 4MV7A 4U7FA 2F8TA 2HPZA 1KFBB 4RETA 4DR2B 3LT4A 3FRJA 5GM1A 2GYUA 1R4NB 3HVKA 5JCXA 2W42A 1DC5A 4W8HA 1V5FA 5DIFA 3TJZA 3UCEA 3GHYA 2J5KA 1E0KA 1GR1A 4TSKA 3W5JA 1S7GA 2PZBA 1YVDA 3CLUD 3FLMA 2FMTA 2EJCA 2F00A 2NO0A 4LISA 3QEJA 1KDVA 3WRXC 2Q3EA 3CY6A 2QGNA 3R8CA 5JCPA 3PQ8A 3IHLA 4OHPA 2D2XA 1I6MA 3HN6A 4B3SB 1D4OA 5TMPA 3KKEA 4R8MA 3JWJA 4DC0A 2ZITA 1PP4A 5GM2A 2PSSA 3T7TA 3ZWDA 1ZU5A 4NV3A 1K97A 4FYPA 2V5UA 1KQ3A 4KCGA 4FM9A 4MDYA 1IM8A 2FPIA 3KLPX 4V02A 2O8BB 1GV0A 3DT8A 5EIHA 3HBMA 2X9GA 4UM8B 5ALXA 4B1FA 2C03A 3GJ6A 2ZYDA 5EJMA 3HV2A 1RHMA 1YS6A 2FN9A 4C4AA 1DKLA 2G3YA 3S8YA 3GJTA 1P29A 3OZUA 2DX7A 1WEHA 2GB4A 4HSGA 3UGKA 2AVDA 1AQNA 4D0NA 3MCZA 3TKAA 4MUGA 5C8XA 4MS1B 4WY5A 1J7JA 1HQDA 2DQZA 3AIKA 4AXBA 5AJHA 3L5OA 3SVLA 4LRUA 4CKWB 2B4RO 5FJIA 5LSAA 3AR5A 1US8B 4QTYA 3E81A 4ISCA 3KK0A 2OHVA 2HXSA 2UZAA 1KGSA 3BZWA 3Q0EA 3GNQA 5JZVA 2BE9A 1W6UA 5DNDA 3LIPA 1RHRA 3NHFA 1JILA 1S96A 4WL0A 5GONB 1NPTO 3GEIA 2JKZA 4W5HA 3WGIA 1QCYA 5D3ZA 3ENKA 1RC8A 3A04A 4RL6A 1MW9X 1I7PA 3U5ZB 2VOEA 1WG8A 4KKXB 2AMVA 1FLAA 3QWBA 4IGKA 5CG1A 1C7IA 3F2IA 2G0NA 2A5JA 1N6OA 2PRYA 4DDMA 4JLJA 2AZ4A 1M6HA 3T1TA 3JQBA 5GADl 4GP6A 3V7WA 1E2JA 1MEOA 1NBOA 2FUKA 3GFRA 5F64A 3UA3A 4ND2A 2E0IA 1CZNA 1DBIA 3PXGA 3WLAA 2IS6A 4BBAA 1AO3A 5LD2B 5E2IA 5BN4B 3LXRA 2IDMA 1NMZA 2OZVA 5CUQA 2LE0A 2YJ4A 4UVIA 3I9OA 2MWMA 2IHBA 2G40A 2Z5GA 4EIWA 1N2OA 2FG5A 3QU2A 4ILEA 2HFKA 3WXBA 2QRLA 3IR7A 4WKPA 5EUMA 1W88A 3SMVA 1RYEA 2QPOA 2VT6A 3E3LA 4TLDA 3VOAA 2RAUA 4INPA 3E61A 2BJWA 1LWNA 1OA1A 1OREA 3IEXA 4LDAA 3URKA 4BATA 3UG6A 3H0KA 3OPYA 2A58A 1TFRA 2JVJA 3MT7A 5D2CA 5F7OA 1EVZA 2FSPA 4IG9A 1BFUA 1T0UA 2JIZA 4W1RA 4JCOA 3P2MA 1N7JA 5I7HA 5BYKA 3DBLA 4HB2A 4AB1A 1NVTA 2AXEA 2VDWA 4EHKA 3LDUA 2C4HA 1ILWA 4LZOA 1FFHA 3FA2A 3OBIA 3BFJA 4XB2A 2CSXA 1T9ZA 3OQ6A 2QX6A 3IUBA 1O6CA 1N7HA 1IBRA 1TO1E 2PD4A 4L02A 9GPBA 3P4YA 4M9XA 2X8AA 2XDWA 1O94D 3KPUA 5B1SA 3V8QA 1DKRA 1RXSA 2IK8A 2ZB3A 2B3DA 2C5BA 1IWPB 1DBWA 3HK2A 3MJHA 1USWA 4HXYA 3W7VA 1AB6A 4M1TA 4ZI2A 5JXHA 2BSQA 3VKHA 3OMLA 5ESXA 4PO1A 3O8RA 4RPJA 4GSYA 3ZV4A 2IDKA 4JYBA 4YDQA 2VN8A 3QLTA 3NIBA 5LA6B 1AHHA 4H4DA 3THWA 3U7RA 3U0VA 2P8SA 3E22A 3T54A 1F0YA 4E1VA 1Y63A 4MMYB 3VYRB 4C29A 1LTKA 4QG3A 3TVDA 4BVJA 3GAAA 3KEGA 4KDFA 4OMDA 4RE6A 3N3BC 4UULA 4HAVA 4IJKA 2B61A 3G88A 5IT9A 4IR7A 2A14A 3DVAA 4UVDA 1MVOA 4ARVA 4D0GA 2EXXA 5JNSA 1EFPA 3LT0A 4K9PA 2GPJA 2R2AA 5KZMB 5H8WA 2AK2A 1Z16A 1FNMA 3L6EA 3QPWA 2R7NA 4YWJA 3V32A 4BMOB 4ZJUA 4C05A 5A3RA 1OKKA 3W5UA 2HCFA 3SF8B 1M6EX 1XJWA 2R87A 2ZPAA 4DBLC 4ZTBA 3UXMA 1ZHHA 3NDPA 3K2BA 5JDIC 4NK5A 4FDAA 2I87A 4N82A 2PLRA 2O57A 1QRUA 4OYYA 4Q1AA 4FXPA 2C97A 3A1NA 3SG0A 2F7SA 1G7CA 2JCBA 4RVUA 4GGPA 2R2GA 2RJNA 3EEFA 2W37A 4QBFA 4Q05A 1G1AA 4YV1A 3QPBA 5IAEA 3K9BA 1CHNA 1H3FA 2C4WA 2IYOA 3ZK9A 4O2BF 5IVHA 3IV7A 3HNRA 4XPIA 4N5NA 4GLOA 2YOHA 1N1GA 1F06A 4J29A 1V5EA 3LCCA 1VC2A 1QG2A 4MGYR 2J07A 1PSWA 4O5AA 1L4MA 1WVMA 5C31A 4Z49A 3KXDA 1AGRA 1OBOA 2CD7A 4IGEA 1K0UA 1DAKA 5FLYA 2WDZA 5IANA 1PZHA 4BEWA 1BMDA 1E3EA 3P9KA 5JCZA 4BQIA 1E99A 1TW3A 2C4NA 2P1RA 1P7CA 1YOVA 3DFMA 3HPRA 4ZAFA 4WBNB 4P53A 1EE9A 4L0CA 5IRCD 2FK7A 4JSTA 2WG1A 4AFNA 2TMYA 4ZHQB 2VSQA 5G3ZA 2XCRB 4A82A 2NV0A 4CIBA 2JD0A 1EVJA 1LQUA 1VDZA 1YRYE 2CHQA 4FHEA 1DLIA 5FLEX 1OV4A 4GMXA 3KR9A 4FI3F 3TB6A 1Y8CA 1SUPA 3EMKA 1G7SA 1V8DA 3NNDA 3NP7A 2JHPA 1PDOA 4N4AA 4C14A 2YOGA 3HVHA 4QAQA 3S1AA 1X8KA 2GESA 1S1MA 3DMPA 3I0ZA 1JLLB 2BDTA 4DQLA 2P69A 2WBLC 4MUNA 3L0YA 5IZCA 3CUWA 4Z9AA 3G23A 3LUHA 2QB5A 4AZ3A 3H8VA 4H6XA 1RC0A 2EW8A 3VDNB 4PG8A 3KQHA 1PR9A 3F9IA 2Y6VA 4B4UA 4IDHA 1FNCA 4BPRA 4LV6A 4XVUA 2V8OA 1EWRA 3IYLW 4QUGA 3D3QA 3H3JA 4LJKA 1N6HA 4PYLA 3W2FA 3EC7A 3CUTA 3IDOA 4QU8A 5C5EA 1AKVA 1U63A 1XK6A 4PRLA 2RCNA 5GOTA 5ADWA 1XL0A 1ICIA 3GEEA 4PAGA 4C3OB 1Y42X 3TTXA 1B15A 2GN6A 2QX8A 4KRXA 4MVJD 2WZBA 4DN6A 3I73A 1XDGA 1T8TA 5H0IA 2V7WA 1N6NA 3PSAA 4LXUA 1WJGA 4MQEB 1L4KA 1E2HA 4P4GA 4NK4A 1L5ZA 1R8XA 4GEKA 4KV9A 2BEUA 3CC8A 4TS3A 1J2JA 2BFFA 3X1MA 4CTKA 2WMYA 4Y6OA 1XNGA 3UH0A 4YO8A 1YHYA 3IAXA 5J5AA 3U9TA 4LHSA 3UGTA 5C9ZA 3PVZA 1UCFA 4PYQA 1P80A 1RZVA 2PMBA 2YQZA 3FNGA 1O95A 2VDJA 4V1CI 4MW9A 2DUJA 1SUEA 2JIPA 3LCUA 2J5RA 2PL1A 4P2GA 3V5NA 5B58C 3WZLA 1JSLA 1RQGA 3L7YA 4Z7QB 1HEIA 5TEWA 3D6MA 6Q21A 3EYAA 2X19A 4TWZA 4WECA 2YYZA 3B6JA 2EX0A 3IP8A 1ZN2A 2IS2A 1WB5A 1U3WA 2VJPA 1NXTA 1L3IA 2OGSA 1D0SA 3B9PA 3WDLA 2W2TA 1N0UA 5BWNA 2XY4A 1UKYA 1L4NA 3JARB 5DWDA 2NPOA 3W9SA 4ASUD 4DR7B 5JJ5A 1JWLA 3UGJA 3EOBI 4PZUA 2IT1A 3C87A 1HE2A 3LDGA 3QX8A 1AKUA 3KJNA 1EWYA 5EEHA 5EVJA 3I5MA 3TZCA 5KYXB 2OG2A 3O03A 5K3FB 4H4EA 3VHQA 4H15A 4MB6A 3LBYA 4JSRA 1HYQA 4KLCA 2NYVA 4HF7A 1AUQA 4RK5A 3KQNA 2OD7A 4G81A 5DMHA 1A2QA 2Q9CA 3LPCA 1UJ5A 3M4JA 5KEIA 1O5TA 5IH3A 1Y7TA 3C5WP 2G08A 1HY3A 5BORA 1ZK2A 5CP8A 4U9HS 4L28A 4L4XA 2D5IA 4WXPA 1NWHA 1V7PC 2R8BA 1WHSA 4HQKA 1T25A 1PGNA 1G6KA 2J32A 3KSZO 4TUYA 2QSUA 2VZ0A 1B41A 1A76A 3VRHA 4BLSA 5FB3A 5DISB 2JFBA 2JANA 1QH1B 3D8NA 4OP3A 1QX4A 4J76A 4V0ME 1ISJA 5IZCC 4EJ2A 4R1MA 5IC6A 1CUWA 1UDRA 3MWYW 4IAOA 5FD8A 2L2QA 2F64A 5HNKA 1JDVA 1WOMA 3NG1A 3FCOA 5LM3A 3JYQA 1XZEA 1T5BA 3KYBA 5BNFA 4NDZA 3UWPA 3T3IA 3ZWMA 2CDCA 4U00A 3B1XA 5HOEA 2WFZA 4P4LA 5AW7A 3ZUPA 2G4LA 4P7FA 2FPPA 1I0LA 4RTSA 1NUAA 4ZT7A 1H69A 1FFWA 2IUYA 3HPQA 1HT3A 3CMMA 3N76A 4BVGA 2VT3A 1EFKA 1XHEA 2YXDA 2OV8A 3MUEA 3ONEA 4KWHA 4G5XA 3SICE 1R74A 3QIVA 5J3JA 3A14A 4ZVRA 4IUBS 4YH1A 1U9JA 1UAGA 1YJQA 1HMYA 3LQRA 3NOQA 3SFVA 5A4DA 2EJWA 4R8LA 4F12A 3A70A 1O95C 1JZSA 1E1QA 1SVOA 3BL6A 3EGDA 4KDCA 3ORSA 4O6VA 1GKYA 4ENTA 4NIMA 1MBZA 4J4TA 2V7TA 4Y98A 2FEPA 3GRAA 2HNKA 3HP7A 5FBLB 4CEJB 5AKIA 1H66A 5PNTA 4YMGA 2RGDA 5C7LO 3BZBA 2OSBA 3GW8A 5KQGA 1ODSA 1E58A 5EC8A 1P4AA 2G88A 3DZKA 4RY0A 1EIWA 4IHQA 2FEWB 5LUBA 4XIIA 4DAOA 5KWJA 2DBRA 5K3CA 1CQXA 3D3EA 5CAEA 1M1NB 4I1UA 5B37A 2HW8A 1IM5A 1MRZA 1Y5NA 3H9BA 2FE4A 5H16A 1R5BA 3TZBA 1EUYA 1RE1A 4HDNB 5IK2D 3QY0A 2B2NA 3ESAA 4PGGA 3OE4A 4OQXA 3MHTA 1D1TA 3SEZA 2BFBB 1SCNE 2HJ9A 5HVNA 1U28A 2JGNA 1M83A 2UAGA 2Y76A 4O4LA 1SU8A 2ZRGA 2YJTD 1I13A 2XWPA 5LB4A 3NC4A 4NBRA 3BHNA 3WMFA 2X5JO 4LUCA 5KJFA 1VLQA 1FXWA 2BRUA 4I6JA 3UUGA 1ZUNB 3JCZA 2R8PA 1MB0A 3L77A 5LJIA 1XR3A 4Q9IA 3B89A 4UXJA 4AJOA 4JUBA 4B44A 1Y3CE 5DW0A 5ESRA 1QH9A 4FU0A 1PAUA 2YFQA 4KRGA 3RS3A 1K8QA 1IY0A 4ZIRA 1QWSA 1FRNA 1NI4B 4AP6A 1LLCA 1N7GA 1Z08A 1NE2A 2X6QA 2ECKA 1X1TA 1ECCA 4RM3A 5A7FA 1XO1A 1N3BA 2R1TB 1E2UA 4LSGA 4B09A 1ORTA 4IHJF 1EGQA 2RCYA 3B12A 3I39X 3AB3A 4GOLD 1KS9A 3G0GA 4NLLA 5FOXA 3T3EA 2ST1A 1F8FA 4QICA 5JAPA 3NTXA 4MB0A 1JHAA 1O89A 4K6HA 2ZUWA 2FSHA 5ADUS 1DFIA 4Q7LA 3PFNA 3HDQA 2XTAA 4R40A 4JR2A 3LJKA 1QLWA 4JLKA 4MLZA 3TE7A 1Z2PX 1CWUA 3DC2A 4C6TA 1G8AA 1L5YA 1VGRA 1KQPA 3NONA 1HYGA 2CVHA 2HO5A 1OR8A 3TAUA 1JR4A 3WLMA 3BA1A 3OMWA 4F1WA 1XZCA 3ZYZA 1I24A 3LRXA 1H0HA 4EYKA 1Q77A 2HA6A 2BFEB 2NAPA 4C20A 1U2QA 3U7EB 1C1XA 3BRWA 4FMPA 1VGQA 4OQLA 1Z5VA 3FPAA 5AK0A 2VQ6A 3IXQA 1QIJA 5KTYA 4NBLA 2HHAA 3CIOA 2VJYA 4LJYA 2ZI5A 4HO1X 1MD9A 1NQUA 4HBZA 3S2EA 3LNCA 4FC6A 4N7JA 2JFYA 3NHKA 3M5WA 4L3OA 1IPHA 3ACDA 2RHTA 3CT4A 4IMRA 1UANA 4CF5A 2WWGA 4RKFA 1T3TA 3B9BA 3L7LA 4MZXA 3ZG6A 1XJCA 4ITVA 2I4IA 2CCJA 4LX0A 4EB6B 4L2IB 4F9EA 5CB6A 3R7WA 5AOBA 4DDUA 2CDBA 4RTKA 3FOEC 4KH0A 3R7FA 3ETCA 4NDNE 4AJKA 3T3OA 1S2LA 5CM8B 3D7MA 3GEGA 3GR6A 1ZINA 1W5AA 3HFRA 5JCJA 2BTEA 3IMFA 5DM0A 4RMJA 4P82A 3RUCA 3HI6A 3VVLA 2GK7A 3RYFB 2BMFA 3AQIA 1W85A 4BFLA 1MJGA 3I1IA 5A04A 5B4UA 4LFAB 1N2XA 2AOTB 1MA0A 5FAKA 2NP6A 3QBTA 2DFVA 1MF7A 5FOQA 4E30A 3JD1A 1BD3A 2R6HA 4EUSA 3CEPB 1K2VN 1FSFA 1XAIA 1Z62A 2PDAA 4KDRA 5A6SA 3F3SA 1XMOB 1FMFA 1EQ2A 2IPMA 2PS9A 4EGAA 4HVTA 3KG2A 4UEOA 5JWRA 3C8ZA 1HT2E 3R2JA 4I9NA 1OTXA 4Q7KA 4FFDA 4XOIA 5AUPB 4DMLA 1QGDA 2V58A 3AG6A 3HDGA 3PJFA 1QP8A 3JQFA 5D7NA 5I4KA 2LDXA 1KVRA 2W48A 2NO5A 2SHKA 1Z3IX 1GCIA 1TK2A 5BSMA 2LIVA 3HB4X 3KFVA 2XOXA 3WYNA 2CXPA 5IPFA 1Z0KA 3EJ6A 5FF9A 1FP7A 4LKRA 5K0TA 3F6YA 1IN8A 2FVXA 3KE8A 1XMSA 4GYYA 1XVVA 3JQGA 4PQGA 3L4KA 5ALWA 1VIMA 2QNRA 3SLKA 1P9LA 3E4CA 3T0GA 2QLNA 1JEDA 1SC1A 3DMYA 4FYJA 3U26A 1JMVA 3V46A 4K3VA 3VNRA 4A6PA 1UPTA 1Z7EA 3CKLA 2I76A 3C97A 4QLAA 1NRIA 4ZT5A 2KMLA 4O02B 3QFHA 3MGBA 1LTQA 1SXHA 2MYNA 1XMXA 4BO8A 1Y8RB 3E9YA 1OJ7A 3EVDA 4O0MA 1ORRA 1WXDA 2IW1A 4IDBA 4ZALA 4ZTUB 4LKOA 2I2AA 3ZLUA 3KV3O 1K7FB 2J4FA 2OG1A 2JLAA 1NJGA 3I9FA 2FSFA 1UXOA 3MTAA 2ZFUA 2XZPA 4PZEA 3T5GA 4BWGA 3LCMA 4D8YA 4DWVA 2VWGA 4ZOCA 2O8EB 4BEBA 3DLBA 3MTBA 1U1EA 2XZLA 1EJ2A 4YJ2A 1EM8A 3AR6A 1GZ6A 3UT5A 3QA3E 2RGBA 4MQUA 4Z4FA 1ZK4A 3B1ZA 1VSQA 4IINA 4YAEA 1UT8A 4GZ6A 5AVVA 2V7QA 2C83A 2ZWVA 4GZ5A 1W9HA 4W6ZA 4AKEA 3TRDA 5H4GA 2JBAA 2ZULA 3JALA 4W1SA 3A10A 4AXXA 2VK1A 3AETA 2FPLA 3HCOA 1MP0A 1U0GA 4TROA 5D85A 3A0UA 4CZ2A 5A2QA 4HSEA 4XCXA 5FWXA 2OZLB 2ECOA 3M9WA 3WYEA 1NYRA 3IEVA 1YQUA 3R9XB 2JJYA 2RHMA 3FKQA 5EWMA 4IIBA 1NBAA 1HRDA 3O92A 3ZHXA 2DPMA 5I3CA 3TLCA 4QXOA 2BAGA 1TT5B 1XZJA 5FT9A 3TB4A 3FPGA 1N57A 1RP1A 2AFIE 1V7QA 4F3KA 4JU8A 1TA9A 2XSZD 1GY8A 4RLHA 2JLRA 5IC4A 5EHGA 3Q41A 1A7KA 4Q3DA 1F8GA 3PNOA 2ANCA 2YWBA 1KSHA 3RU3A 2PRKA 3T1OA 4P22A 1P1RA 3KTAB 4JGBA 2A1TS 3SJZA 1QTQA 4EJSC 3A6JA 4UTRA 1J90A 2YYAA 2AEEA 3CF6R 4QULA 1NVEA 4TQUS 4Q1DA 3TEJA 4KVGA 5GIOE 2ZRQA 3CSSA 3RSQA 3KB8A 3OBBA 1XN4A 1F0KA 1YZTA 2JCXA 2NT3A 2OK7A 3KLOA 3V00A 3PENA 4EI2A 1GNLA 2NO7A 4BJ5A 4JHLA 2D1SA 3BORA 5LZ2A 3GD7A 1ZN9A 1ENOA 3GIWA 5EHNA 2DQSA 4MH0R 5DOVA 5E9WA 3PLAE 1FMJA 3ZDRA 3EXIA 1PWZA 3MQFA 1GPAA 3KZOA 3HFJA 1CVLA 1VKZA 3PR1A 4B85A 2CK3D 4ER5A 2AZMA 2EWVA 2YRXA 4PLPA 4F11A 1U1GA 4JJ8A 2IYRA 4RIFA 2F1OA 2NZUG 5M29A 3CZ5A 3MYRA 2M1ZA 4M37A 5KPJA 2YHUA 2DBVO 4HLNA 2VP5A 3T99A 3CVVA 2FUG1 4JJZA 1KVSA 4O4IA 3W9BA 5J4HA 4R5HA 3CRMA 3VDQA 2WMOB 5E4TA 3UJNA 4PX5A 2Z0MA 2P7HA 5GJBA 4TLLB 5CLLA 1IMOA 3DZHA 2YJZA 1HLPA 3CW2A 4YIKA 5FYQA 1MTZA 1WW2A 1O97D 2X1MA 2CMHA 3HU3A 4MWBA 4X5OA 2P7IA 5F1KA 1X9IA 4M0MA 5TF0A 4IGAA 1YRLA 3BMCA 3SZGA 4C2BA 1DNPA 4NENA 1DJLA 2P5UA 1OROA 3T9FA 3AI1A 2FUEA 3VBCA 4BY9E 1T6BY 3EIOA 5AM4A 1ESEA 1RPTA 1UPCA 4JNKA 5EYPA 2J9FB 4C7BA 4BZPA 4Y3UA 3RHSA 1QU2A 4I8IA 1KP9A 2G06A 2VP6A 3LBHA 2PKQP 2RHRA 1ZUWA 4OHWA 1J8DA 1I0IA 4ZVOA 3DDZX 3VKFA 3M4YA 3OM8A 3L9XA 4CMHA 2A0UA 3CT6A 4HNQA 4X3PA 3GGGA 5BSKA 1IMJA 2R65A 5KWIA 2Y1WA 2EZ9A 5AJUA 2FRXA 2PKQO 3U37A 3A6FA 3PA8A 3AQ4A 3P0EA 1QZUA 1ZIYA 5IS2A 2LV8A 3D8TA 1G3UA 2V8BA 3PC6A 1ZGGA 4ECAA 1P2SA 1R88A 1CRWG 4UATA 2N9UA 3NTOA 4J07A 1LSJA 2C4MA 3C6BA 2ZB8A 5IDQA 1IHUA 2JFXA 3VTKA 5B7PA 4EELA 5DYIA 4H1WA 4M9ZA 1E6LA 3W5HA 1J33A 1OLUB 2CNWD 3K09A 3GN2A 3B6KA 5L45A 1YONA 5GONF 3CZ9A 5K0ZA 1NVWQ 3A6PC 1PE0A 1U1FA 2A4KA 3ER8A 5CPFA 3EXG2 4WFJA 2UXCB 2VAMA 3VR5H 1YQWA 1TFUA 2ZB2A 1V7CA 1UAAA 2BEKA 2AT1A 2RHWA 3CFYA 3O9VA 1Z88A 4ZU3A 3QVOA 3ZNOA 2I6QA 2VA8A 4BO9A 4B8WA 3TZQA 4EY6A 2LVBA 3BUSA 3QPVA 2ZUVA 4I66A 1TJ4A 2PAFA 4C3VA 2I2CA 3E70C 4XSHA 2X3FA 2EWMA 4XCVA 4G4SO 4PZZA 3EXG1 4Y2YA 3FOAA 3PJRA 1C0LA 2EBWA 4PXSA 3IIIA 1Y3IA 2R3SA 3Q72A 4UVEA 3RS8A 2H5EA 2A9OA 2BBOA 2Y1KA 4PEVA 3VHXA 1TDJA 2QMEA 3VPAA 1CE8B 1NC3A 3LCJA 2GM4A 4TRJA 5DXAA 4DY6A 2JBWA 1JXQA 2R48A 1K4MA 2ZUSA 3EFBA 3GNSA 1IQPA 3IUQA 3OA2A 3GJ4A 4KN9S 5KTNA 3W8NA 1J39A 4LQCA 1C9MA 5K8TA 2CXHA 2HQOA 2AWNA 3SWWA 3U7FB 3JW8A 3NBYC 3ORQA 3ZPXA 2Y1CA 1OILA 4E2YA 4P58A 3TTTA 5FUWA 4HTFA 2EQBA 1V3TA 1OF1A 2EYQA 2Q6IA 3NTQA 2VAWA 3QE4A 3VC3A 1KOFA 1QVAA 3JRXA 4JL5A 2JLVA 3M3PA 4C7VA 1K3TA 1QAQA 1KEUA 2CFIA 3USCS 3HQ4O 3OTWA 5LQNA 1NP6A 2ZWIA 2I22A 4HEQA 2WWVD 5JH7B 4JD5A 4RY9A 2DXIA 1QRTA 1U0SY 2JEOA 3GV0A 3REFA 3CF4A 5CA0A 1Z35A 4ZGBA 4QQ8A 2AEJA 1EX1A 2ORED 3OE7A 5AESA 5CD1A 3X43A 1M0EA 2P6OA 1ZJJA 3L49A 4LNHA 1CUZA 1OAAA 2ATCA 3HN2A 4LHEA 4IP0A 1H4QA 1XX6A 1N9KA 1RMTA 2GZ3A 4MVCA 1GQOA 2O2SA 1Q7GA 5ITZA 4YRDA 1T5TA 3BQ9A 3N74A 3QKRB 2PQMA 4NEQA 1U0HC 4GSLA 1EUZA 1O5IA 2ZR8A 2QLLA 3I32A 3MUNA 1Q15A 3O3OB 1B8PA 1EVIA 1U5AA 4ZREA 4B32A 3U7QB 4EA6A 2F1JA 2ONYA 1OJLA 5IHXA 5FBHA 2JATA 5SY9A 1ETUA 5HRUA 1VE7A 1XKTA 3FD8A 2DQYA 5ALDA 4AD8A 2ECQA 3MNFA 4R84A 5LA6F 4GL4A 4O2LA 3TM5A 4AECA 2QTFA 3EWAA 1WY5A 3TL3A 4GE3A 3WGVA 4TZ0A 1AGXA 5J58A 4OBXA 1MCZA 3G2KA 1Z5PA 1DAFA 1EFRA 1SY7A 4MCAA 2OBYA 2WJZB 3K8QA 4MX8A 2UUAB 3WSTA 3RHZA 2ZYWX 3HA7A 1L8LA 3ESQA 4G37A 2H59A 3I9V6 1UBEA 3FVTA 4HB0A 1JDBC 4NJOA 2AI1A 4UEQA 3DBRB 4MKIA 5B2ZA 3WNZA 4AZSA 5KYGA 1KY2A 5L4LA 3N5CA 1U0BB 3O31A 1Z7WA 3I2KA 1QV9A 4MUJA 3W2GA 3L84A 1F8XA 3IIMA 3QYAA 3EFHA 3WZ2A 5DNWA 3ICEA 3W7BA 2Q3HA 1AH2A 2JAQA 1OB2A 4ND4A 5ALRA 5J47A 2O54A 2O50A 3ZHUA 2ZWMA 3HVRA 3QITA 2ZYUX 3EF3A 1NVDA 4N0MA 2QVYX 5IYZF 2O23A 3KDAA 4OKNA 3TW6A 3IV9A 3BEOA 2RKWA 5LP6B 1TE2A 3DE1X 5ADVA 3H1BA 4MI3A 5B64A 3R0QA 1R0ZA 1DKUA 4FGSA 1MAUA 1A2OA 1HOXA 4HPJB 2IYFA 3EA4A 3R6LA 3TE6A 1AJEA 2N3ZA 1RW4A 3A2NA 3T7CA 3I2JA 5HIJA 1XB2A 2FJ0A 4M3NA 1II0A 1T13A 3V6LA 4B3XA 4EUKA 1I5OA 1YA4A 5LR6A 3O8CA 3PJGA 1DEAA 2O0JA 2PANA 3E7XA 2QQ5A 3N8KA 3T15A 4X6LA 4PYKA 4YCMA 4LMPA 1TF5A 2DHQA 2HHCA 4OCZA 2QL5A 2Z3ZA 3DDUA 1JFSA 2OTCA 5CHYA 5I5EA 2VNIA 2HIGA 2ZYIA 3V97A 5CLFA 1E62A 3R3SA 1CF4A 3ZX5A 1QQ6A 4OFZA 2WB4A 4WBNF 3DR3A 4W6QA 5AFSA 1V5IA 1EUDA 1T5HX 1YCFA 1ZNYA 3O1HB 4IHKA 3IEUA 1NVVQ 3WGOA 2BFMA 1XTUA 3Q8LA 1B3BA 4OGWA 3TNFA 4QC2A 5KSOA 5KO2A 4ZHQF 2YIDA 5P21A 1GQYA 4Y9DA 3VZQA 4YY3B 3WTCA 4UHDA 2FFJA 4FONA 1RMQA 2X9VA 1IC6A 2PAAA 2VPTA 2W2LD 5L3RA 2NPIA 3TW0A 3WGLA 5B58T 4HLDA 4BKPA 4GR5A 4R01A 4N39A 4B7XA 2J48A 3KT6A 2Y4OA 4KLAA 5DNAA 2GN1A 5JI3E 2CV1A 3QX3A 5EMNA 1UBKS 1UPBA 4D2IA 3JYOA 521PA 4UUBA 2UU9B 1E6KA 3EUEA 5AR1A 3V4SA 1F17A 3TGLA 1YFJA 1B2LA 4DJ5X 5K3EA 1VBFA 1RRCA 1KQNA 3U4MA 1RHQA 1WSDA 2ISSD 2RJOA 5U4XA 5BUCA 4NBUA 5BSWA 4JASB 5AKGA 3ZWCA 2PZMA 4NCNA 3R7BA 3DUFB 4YJ3A 1JHYA 2QTRA 1IVSA 3AL0C 1G291 1PFWA 4FLFA 2H4FA 4JLNA 5DHAA 1D2AA 1X80A 3MFQA 1P5HA 4YECA 2IHYA 3WLIA 2AG5A 4EBFA 5BR1A 5G4KB 1GQ2A 2DUWA 4L5YA 2Z8ZA 2CXXA 1T26A 1GG9A 2HRBA 2CL7X 3ICOA 4FIZA 4HC4A 4RTNA 2JFQA 1IN7A 1JAIA 1JE0A 1VB3A 1Y82A 3Q8XB 4PVCA 5IEBA 4MJLA 3K0CA 4YN3A 3G7SA 4Z1MA 4DQDA 2A0YA 4EPVA 3ZY3A 2HHLA 3RVPA 2D5BA 4A73A 3OT1B 2NQTA 4DCOA 1GRQA 4LY3A 2DOKA 1TK9A 3L40A 1V11A 2WU1A 2W2XA 1RU3A 1ABBA 4B81A 1OXUA 4K6KA 4M60A 5J2UF 1GWNA 5CIWA 2GCOB 2YRWA 3R1IA 5FPQA 4ER0A 1RWXA 1Z0ZA 4N8EA 1DBRA 2ZTLA 1F2UB 2JGDB 2P2CA 1M5RA 2HK7A 2WAXA 2KLHA 4MVJM 1DPGA 3QWAA 2V0CA 3PA6A 2QU7A 1QRSA 1JDTA 2C2WA 3A4NA 3JQCA 4Y9SA 2FSGA 4JIMA 4DBVO 1P0CA 4E5UA 3DFKA 1QO9A 3CSDA 3VISA 5CBPB 1Z73A 3IEKA 5AK5A 3GRFA 2RH9B 4M1ZA 4QXQA 2ZI7A 1EEHA 3T95A 1Y4SA 3WLSA 5JECA 1MJNA 1HSOA 4R4JA 3L8MA 5L53A 1D0VA 4QUAA 3H5TA 1RWPA 1A1VA 2JNWA 2E5WA 5CFRA 2PBZA 4HAWA 4YASA 1I6LA 4WZAB 2QUKA 3RS7A 3B8EA 2J3HA 1RBYA 1JA1A 1OIXA 4WZ6A 5KYXA 4UPVA 2FDRA 1NTOA 1XTJA 4OVKA 2X8BA 4JIGA 1P17A 1CUFA 2NUBA 3LQ2A 5BQ3A 4V1CA 1OGJA 3DHEA 4Q3LA 1PHPA 3F6PA 2E6KA 1PR4A 1U6KA 1KI6B 1WULS 2IZ7A 1GT91 2JBHA 2LD4A 3IPAA 2WLTA 4L27A 3O1JC 4K9LA 3FMFA 2Q4TA 3QELB 4JYCA 2ZRFA 1RBQA 3K4QA 1AT1A 4RULA 4ZDIA 1T9HA 2R66A 4O4HA 2ZI4A 2WR8A 5ALTA 5CB4F 3CH4B 3CISA 3CLRD 4IZ6A 1GUZA 1SURA 1TXGA 3LZCA 2RGWA 4KEAA 3JASA 3GA5A 5DYNA 1MAWA 4NHOA 2GWRA 3RS0A 4ZZIA 5AVZA 3E9ZA 1W0KA 5HPYB 1JA9A 1VI5A 2PUTA 4PPGA 3ZS9A 3K9WA 4RU1A 3OEWA 2ZAMA 3GEMA 1N2CB 1TMOA 2D0IA 3BTOA 4GPBA 4CN8A 2XVYA 3O4JA 4YHHB 5IAJA 3FZEA 3KUDA 5HUJA 3TJRA 4TKLA 4H1TA 2IU6A 5J2TB 1NKTA 2JCYA 3DJYA 4G0UA 1G8JA 1F6BA 3FBTA 5BXYA 1TM1E 2CJYA 3N8HA 3P52A 3GZJA 4MRSA 5DB4A 2JAOA 1J25A 1SPBS 3MN1A 3RUPA 2ILVA 2XMDA 5EMKA 1SBCA 2IXAA 4OQEA 3T52A 3NDJA 3AB8A 1ESNA 2NSHA 4CT4B 1L9KA 4YUWA 4B4KA 4P31A 3PUYA 4A8JB 3PNBA 1COWA 4RD1A 2XUGA 4X8MA 1H5QA 3SHOA 5KX5A 3O4VA 2BFPA 4O4JB 3TMAA 3AIIA 3AWIA 2Q07A 3SSOA 3K0AB 3DLAA 1KJ9A 1AU9A 1GYQA 3U4CA 4IDGA 4ZVSA 3E1SA 1QE0A 3R5HA 5LZ7A 4WY2A 5CXUA 1GU1A 3GLGA 4WKOA 5CDSA 1R4MB 1SC4A 3EAQA 1X7WB 3OZSA 1SCUA 4M88A 5IF9A 4L78A 3AH8A 2R5NA 3S5JA 2MU1A 3LXUX 1DIGA 1VSVA 2ZDHA 4U3JA 1WUIS 2OD2A 3ONVA 3EQ6A 2FLVA 4TLEA 2DJIA 3H2GA 1OTYA 4JUAA 5JASA 1XZHA 4NCBA 3RC8A 1D4FA 4BTVA 2C57A 4KO2S 1KDYA 5BN3A 1WCYA 3DZJA 2G9QA 4KE6A 3IH5A 2IYQA 1PNTA 2Q5JA 3DV9A 3PGXA 3RKRA 3ZIAD 1GL3A 4TVSA 3HCFA 2IYYA 2ZSIA 3TLGB 5CG2A 2JAUA 1B8VA 2FQXA 5E1MA 1BAPA 4OXNA 1U2DA 2EDAA 3OA0A 4MZDA 3RYCB 4US0R 2FEOA 2QSZA 3TNDA 2BEWB 2R79A 1VKOA 1JIIA 2JCSA 3E35A 3LSYA 5K3SA 1JDPA 2QZSA 4OQNA 4ZMBA 1QUFA 4X7MA 5TGDA 1UZUA 2CL5A 4W9RA 5CDFE 5KOYA 1ZXLA 2EWWA 3FBGA 4KGVA 1A50B 1EFVA 1HOTA 4JENA 4GKJB 5I7EA 3Q0TA 1IQUA 1BXRA 3HM2A 3WQQA 1O6GA 5G3YA 4ZOLB 5ILGA 1UBJS 3A4YA 5H80A 4AJLA 1FNBA 2C78A 2ERXA 2JJQA 3HKBB 4QEZA 3S2UA 3ZGNA 4CGZA 4ZMSA 1P1HA 1YSCA 5K09A 1A8PA 1ZM2A 4UNQA 2HM7A 4HMOA 3IELA 2PX4A 5K0CA 2C3PA 2VK8A 3M83A 3U81A 3CCBA 3DOOA 3ZZNA 4FMDF 4J9VA 3S7ZA 5KJ1A 2OWEA 4B34A 1KHTA 1RNLA 4I19A 5ALYA 1NP3A 1AKQA 3HZHA 3NHUA 2B36A 3EEIA 1WPXA 4CQLA 2B4QA 1CP2A 2J45A 4IKPA 4ZA2A 3BAFA 2MINB 1VG0B 1JPUA 3E2IA 1KYZA 3G3EA 2DP4E 2ZBQA 4BE4A 5AVXA 4OQMA 1ZVKA 3WY9A 2WV7A 2C3OA 4I6GA 4TRNA 3GUCA 5AHXA 2PLFA 3RFFA 3SYLA