5B2EA

N,n'-diacetylchitobiose deacetylase from pyrococcus horikoshii complexed with its inhibitor mpg (acetate-containing condition)
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
267
structure length
267
Chain Sequence
FEDIDTFEEAFNKLLREVLEFDLQNPFKDAKKVLCIEPHPDDCVIGMGGTIKKLSDMGVEVIYVCMTDGYMGTTDESLSGHELAAIRRKEEEESARLLGVKKIYWLNYRDTELPYSREVRKDLTKILRKEQPDGVFAPDPWLPYESHPDHRRTGFLAIESVAFSQLPNFSNTDLDIGLNPYNSGSFIALYYTHKPNYIVDITDLMELKLKAIRVHRSQFPDDIWEKWEPFLRTIAMFYGEKIGVRYGEGFRIMPGLFYHITPFTDLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein PH0499
publication title Substrate recognition of N,N'-diacetylchitobiose deacetylase from Pyrococcus horikoshii
pubmed doi rcsb
source organism Pyrococcus horikoshii ot3
molecule tags Hydrolase/hydrolase inhibitor
total genus 99
structure length 267
sequence length 267
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02585 PIG-L GlcNAc-PI de-N-acetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10320 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold LmbE-like 5b2eA00
3DFFA 5BMOA 4EWLA 3DFKA 1Q74A 4XM0A 2IXDA 1UANA 3WL4A 5B2FA 3DFMA 5CGZA 1Q7TA 3WE7A 2XADA 4XM1A 4XM2A 4XLZA 5B2EA 2X9LA 3WL3A 3DFIA
chains in the Genus database with same CATH superfamily
1AY0A 5HOQA 3R9KA 4XVUA 2CVPA 3V34A 3F0TA 5IM5A 4H7IA 1NY5A 3D0RA 1XZGA 4EEZA 2ZATA 3K30A 3SE0A 4C6RA 2NV2B 3TXAA 1GUBA 2FSGA 5I7FA 5JFTA 4H7JA 4MW4A 2YWCA 4X61A 1TC2A 1JR4A 1U2SA 3IJPA 4OKSA 5U1PA 2GCOA 2DHQA 3WS7A 1V2HE 1SUDA 3F6BX 1ZQ9A 3H11A 4JUAA 4RF3A 1N3IA 1QQ5A 2FKAA 3QBVA 1ZG3A 3F1LA 4BNFA 4I7EA 1X13A 4WLVA 4RXUA 5EHZA 4CMJA 5FLYA 5B6PA 2JVKA 3E82A 4GKBA 1ECFA 4R5MA 4L2IA 4TKVA 1RI5A 4F2GA 1EFVA 5L7WA 1H1LB 3KKPA 5JI3E 2VP3A 2JZNA 4IIJB 2JGLA 1SXJC 4U7HA 3ZNQA 4E4TA 1UOEA 3N2GB 3DAGA 3UW1A 3MJVA 3BH0A 3K09C 4BNWA 3PKJA 4B6FA 1IOZA 2JAQA 3MLBA 4LYJA 2MYNA 4B09A 5HWSA 4V0LA 1CR0A 4KQIA 4XQEA 5LB4A 1WL8A 1X7ZA 3GL9A 1ZVVA 2H17A 3ELDA 2ZVPX 1M0TA 2M1ZA 4OCZA 5ALFA 4ZEWA 4BNXA 1KRHA 3ZJ5A 2XNSA 1PLKA 2AX4A 2NO1A 3E8MA 3H97A 5DX1A 5LUBA 3RYFB 3GCXA 4YC7A 4AJIA 1Q0SA 2BSQA 1PJRA 4RL4A 1IBSA 3VUEA 4XGRA 5ELXA 1QH1B 4HZUA 5BWBA 1RWKA 5IKPA 2O52A 2AXNA 1XZQA 4I14A 2H2WA 2D1TA 4M7PA 5AJVB 1PR0A 2YN0A 4DPMA 2XZLA 1VSUA 1VL0A 1E2KA 1MC5A 2P9BA 1WU8A 1DWPA 4S1WA 5CBKA 1V8OA 1RMTA 3R9XA 1YL5A 1AC5A 2CLSA 1X7WA 1PZFA 2ZIAA 4JLSA 4WE3A 2R86A 1IZ0A 2CNWA 3SC2A 4EZEA 1KDYA 1Q0TA 4U2FA 2QBYB 3O2NA 3KOUA 2CNOA 3WJ7A 3QW2A 5CRIA 1QAQA 4MICA 1OILA 2ZRCA 2ZTUA 3BTSA 4JQSA 3I2JA 1OT3A 4OM7A 5C18A 1BZYA 5EJ4A 2WA2A 3WICA 1DWOA 3OICA 2QR2A 1GPAA 1T2AA 3E7FA 4KUHA 5GWXA 3SBEA 4RFSB 1DNPA 3FW1A 2ZQ5A 4S1VA 2O8BB 2GM5A 3LF1A 4GDFA 4AY2A 4KNVA 4IBOA 2QTWB 3E7DA 1RHRA 3L8EA 3ZQ4A 5JQWA 1GN8A 1Y1QA 3TOCA 6REQB 1M6HA 1DIRA 4TWZA 1QTNA 4B3JA 2UXCB 4NECA 4XR4A 4MVJA 1ONNA 2MSEB 2OILA 4BPBA 1BXKA 4B45A 4DMFA 4XB6B 3ZOKA 1TTTA 1G5FA 1Y9DA 5MN5A 1PEKE 1LPSA 3HU1A 4QATA 2CXNA 4CLRA 3GRUA 2YXBA 4KLRA 2Z2ZA 2F3RA 5DX8A 1BDMA 1UBSB 2R6FA 4A6EA 3BULA 1R37A 2J3KA 2EHDA 3SYMA 3AKEA 4HFJA 2VWPA 1SGWA 4IGKA 1I7SB 3F7NA 1Y3CE 5AUPB 1X3LA 2BFBA 2H2GA 4N18A 5HUQA 3LUBA 1E8MA 3CG0A 4RDCA 3UMFA 2RMKA 2HT1A 1CTQA 3SF8B 1N7GA 1ZICA 3ZWCA 1UMBB 3DOHA 3ZU3A 4RYLA 1RIIA 4AJNA 4Q1VA 4DNPA 1CNMA 1VBFA 1MGOA 5L3RA 1C14A 2OV2A 3T6KA 1ID8A 3FF4A 2EJUA 2AHOA 1Q0UA 2EFGA 4UPDA 1XZBA 1GPBA 4EB8A 3QU7A 5TVGA 1KQPA 3HCNA 4RKQA 3SZUA 1T6BY 5CFMA 1DRVA 2Y0PA 1DAPA 3O8BA 2ZDHA 5DMHA 3EUAA 3PX2A 2C7VA 3S99A 2AQKA 5EUCA 1QOPB 4BIIA 3QVKA 3CW9A 4EFNA 4MW2A 3O94A 3C6MA 3TNLA 5MFPA 1QOQB 1U0SY 3L8YA 3IT0A 2IXDA 3GARA 4DJFC 1CJTC 2QROA 2AX3A 3OF3A 4M0EA 4V2IA 3JALB 4HLUA 3RIHA 2AXPA 2VI5A 3GZNA 1YUNA 1P4JA 4BLOA 1JEOA 1R9MA 4RK4A 1SU8A 1ZN8A 2AYYA 4IQGA 2WHRA 1YO6A 2P9EA 1XU4A 4WQMA 1Z2AA 1IK4A 1KARA 1RKUA 4Q02A 3REOA 4UNSA 1S3GA 1DO8A 2QRNA 4FLEA 4TYQA 2P4UA 3ED1A 2IYEA 4Z4FA 3NXSA 4OIFA 3R5TA 4FR0A 4PNZA 3O3CA 1I9CA 4A8JA 4K3UA 3AEYA 4Y3UA 1VYVA 2E82A 4HRVA 1LZLA 2ZRAA 3BRQA 3G1TA 4KRYA 1OX5A 2C1ZA 1IL0A 3KQNA 1DINA 3QPDA 1ZIXA 4PTLA 1GXSA 1JW9B 2LNDA 2Q5IA 3ESCA 4GBJA 3UAZA 2IHNA 2CLEB 2FFAA 1PR9A 1U5CA 2I4LA 2RKWA 3FFXA 5JH7F 1E9SA 2DY0A 5AUQA 1J49A 2WM8A 2ZB4A 3B3AA 2PUVA 3CZ9A 2G9RA 5JASA 3TCKA 3IKMB 1T2CA 1W73A 4O1HA 5THXA 5DN6D 1GHTA 5JZOA 1D7OA 2OZPA 1E9EA 4CIVA 4J0GA 4WN9A 3ZS8A 3RTDA 4XSHA 3U7QB 2DPYA 2A9VA 2C4WA 5DU2A 1KI6B 1ZCFA 3H7AA 3B9BA 3HFSA 4JKYA 1IJFA 1IN7A 3I8SA 3LQQA 3S7TA 1K66A 3TQQA 4RMHA 2UZ1A 3FKSD 1C0IA 3A6KA 1SULA 2WIKA 3OWHA 2ZZMA 2DKNA 4LQCA 4AXXA 1V5WA 1O95A 2D1RA 2YWXA 1WAMA 5ICCA 3NP7A 1Q1GA 4UBLA 5LP6C 4PWYA 2AFHE 2JCVA 2F43A 3GMDA 4MAFA 2H4JA 4NSNA 5FBLB 1U7OA 2NWQA 3ANXA 1UDCA 3OOSA 3BHJA 4V39A 1XC7A 5IDQA 4UHDA 5ITZB 1I4DD 1Q91A 2O59A 5BWNA 1SBTA 4J0IA 3OT1A 1PQYA 2QLLA 4N65A 2H2AA 1NF8A 3HJFA 3RS0A 4BQQA 2O8DB 1VHLA 1LX6A 3GNSA 5C5DA 2Q3FA 2RK3A 3A9SA 4E15A 3NHWA 4M8SA 1JNXX 3L7JA 4N3AA 3QI2A 4ROTA 4WLEA 1T2NA 1F6BA 1IZ7A 1M2NA 1SU6A 3LA6A 4UOQA 3BOSA 5K8JB 1BDIA 2J7PD 3O8LA 2XXAA 1KK1A 3NIFB 1R4AA 3MFQA 3WNZA 1PFKA 3DTVD 3H42B 2O6HA 3MWEB 3IPCA 4RS3A 3CR8A 4AKGA 2HIGA 2Q41A 3A1DA 4XKJA 4KTVE 4REMA 1R0XA 5DI3A 1D7AA 1AB5A 4LOLA 4DUGD 2G9UA 1G3RA 2FA9A 3ECCA 1PR6A 2W7TA 4TTQA 4YCDA 1Z36A 3HGMA 1ULBA 3OIYA 3R3UA 3IA2A 2IZ5A 4B3BA 5FI5A 2WT4A 4NXMB 1YDHA 2XVXA 1LPNA 1YBAA 2O54A 3JQBA 1E2UA 1NHWA 1RTTA 4IXMA 5L3QA 2ETVA 3HCRA 1ULSA 3LKBA 1LA2A 2ZUVA 1OLXB 3WIEA 4YHBA 1QQAA 3DTTA 2WPDA 5IRCD 2PD4A 4DC9A 3MPUA 2VNIA 1U81A 3TRDA 2ZRQA 3BMOB 1W5FA 3KOWA 1QGYA 1YB5A 4MZDA 1H3EA 4OI2A 3KR1A 5EXTA 3W1WA 4AO8A 5LOVF 3KVNA 2QORA 3D7LA 3EISA 1BFKA 2NUTB 4ERNA 2I6GA 3O4VA 1YI0A 3B38A 1KGDA 4HSEA 1BKDR 1G6OA 4K81B 1CZHA 4LPSA 5A71A 1YK1A 2X2FA 3ZJVA 5AVRA 2I6SA 3GELA 5CU7A 3OURA 4O2BA 4XFJA 4YRJA 3LXMA 1NPTO 1QVAA 2AS0A 2Z08A 3EW7A 4JC0A 4UTPA 4FFRA 2O8EA 1AQIA 2NQTA 1G4UR 1E3IA 2H1CA 2VK2A 4WOCA 3WISA 2A7QA 2XGMA 2JIPA 4RVSA 4QU5A 3UAWA 1YDMA 1ML3A 3IMKA 3DE3X 4IFEA 5C1PA 5CLGA 1BG6A 1AXGA 3N9IA 2R6R1 1KVTA 3EB9A 2I1WA 2C5GA 3P8ZA 4DA0A 3DT9A 2ZE7A 2HDHA 2VJLA 2JGEA 3K2BA 1Z2PX 4PSUA 5BVGB 1DHRA 3E5HA 1YB6A 4G09A 4R2LA 1RAEA 3PTAA 3RUCA 2LBPA 4R8VA 3MJCA 1Z22A 2IXFA 2CHFA 2G1KA 1WPGA 2IF0A 1IK6A 5LN1A 2YXEA 2R2AA 4MW1A 5I7RA 3ZHSA 2FJPA 1KA9H 2GBIA 1W2WB 3RYCB 1OFVA 2ZYDA 3WL7A 3VR4A 5F52A 1RRFA 1UJ6A 2SKEA 1DU4A 4RA9B 3I3SR 3WL3A 1U8TA 2HA0A 3QVTA 5J2TA 2BBTA 5IZ4A 3U61B 3RI3A 2NT4A 4XJXA 3I3OA 1KEKA 3MWKA 4WA8A 5LDHA 2AEJA 3E81A 1EX6A 3AZPA 1GL7A 1OCEA 3EVNA 5I9TA 1TK2A 2Q50A 3ESZA 4X44A 5TE9A 3ZHTA 5BNTA 2CCJA 4DCNA 3O74A 3GLFA 3I2YX 5F64A 2PKYX 1A4RA 3GWGA 1YUMA 2C7OA 2AB0A 4I6GA 3CW8X 3IQXA 4QU0A 4UNNA 2P9QA 1O6FA 3EIWA 1KH3A 4CM5A 4E1BA 2E4XA 5I5EA 1XJQA 1E2PA 3A0RB 5JLJA 1L5RA 4RIIA 1R1DA 5BR8B 2IOHA 2TMKA 5DT9A 4CIDA 4PAWA 3Q0EA 4MV0A 2OY0A 4PVDA 1GGMA 2PKEA 2YVQA 2AKAB 2CVZA 3HB0A 3TZ6A 2R8XA 3HCFA 3H5AA 1VCIA 3I9V6 3M83A 3PNSA 3B52X 3MS7A 4E08A 1M67A 1EVEA 1NWCA 2VQDA 3B3FA 1JU9A 1OXXK 1UMCA 5JHGB 5JSZA 4IX9A 2XLCA 1ZWLA 3QY9A 3RUHA 1QCZA 3KSBC 2NTVA 1ADGA 1SUSA 1WRBA 4NG5A 2CZCA 1Z0SA 3OX2A 5L53A 1GCOA 2Z2IA 2FW9A 1ZZEA 4QYMA 2EFYA 3WNCA 5K3CA 1G5IA 1GAJA 1PJ8A 3UT6A 2VDRB 2HV8A 4Q3AA 4AS1A 3AFNA 4K9MA 4C7OA 2VR1A 4Y1RB 1R0RE 4KV7A 3RVBA 3GFTA 2KQUA 3A4LA 2QZJA 3N0WA 2JFVA 3AOEC 3DE5X 3V32A 4BO2A 4ZZ1A 3VNAA 3GJ7A 2A0YA 3VAYA 1HDOA 3D8TA 4OGLA 3C6BA 2OHHA 4RTRA 1DOZA 4AS3A 3WB9A 3NIWA 4D3SA 4EZBA 2B1QA 5T4BA 1X80A 3V3TA 1R74A 2DTEA 4MUBA 3NDIA 5EP2A 2JLXA 4CM1A 3NIBA 1NBMA 2WHEA 3JQAA 1XTPA 2R8RA 1SVKA 1X1AA 3OCJA 3GRPA 1N2CA 1QC5B 2QRGA 1NN1A 4N7BA 4NBVA 4RY2A 4XWYA 3WL4A 1G2OA 1VFPA 3B70A 2VZ9A 4EM6A 3AZOA 4AULA 4BYGA 3DDWA 1HSZA 1QZUA 1AUOA 3BL6A 4HNHA 1SUCA 2NU6A 2WJZB 1TLFA 2JARA 4BGUA 1R6TA 2JI6A 2P9YA 4CTOA 5CLFA 1SC4A 1B93A 4YREA 2F9LA 2DQKA 3LBIA 1JLKA 2NXCA 2FY8A 3LXXA 3QA9A 3U16A 3N7TA 13PKA 4IV8A 3OHMA 3WLNA 4C78A 3AVWA 2LKDA 3BD6A 3S1LA 2QQGA 3B51X 1S01A 2ANCA 1EEXB 5E1OA 3DJYA 3PICA 1KFBB 3FTFA 5HF8A 4CCYB 5DCWA 1XDSA 4XR9A 3FPGA 1T3GA 1HQKA 3U9TA 5BV8A 3O93A 3LKVA 1XPUA 2P9JA 3N2YA 1NP3A 4M0UA 1IXKA 3CPEA 4RNDB 2J41A 5IN5A 2OL4A 4PC3A 2PRKA 4F9GA 1TU0A 3IP9A 1QVRA 3LO5A 1FP4B 1UZUA 2QZZA 2W83A 2ZKLA 3DE6X 1ADBA 3E48A 4Q05A 2YDYA 4XSGA 3STUA 4YJDA 2OAQ1 3TD6A 4G5RA 2OZLB 1BKYA 2VDUE 1QZ3A 2H7YA 4D0NA 5GM1A 5F3WB 4L8LA 3WRYC 5J4VA 4JUBA 3C7TA 4MP6A 4Q9LA 4N3NA 1TX4B 1XZJA 3AFOA 5DYWA 5E95A 4MPRA 5EIOA 3EMDA 1M7BA 2XIQA 4ME6A 3MCAA 1WUHS 2POQX 3MN1A 4H6VA 1W0KA 2P2ZA 2YN2A 4J6FA 1CY0A 1D2HA 1HDEA 2OCIA 3BGSA 4RC9A 2QM8A 3UWSA 1AU9A 1DG9A 2FVYA 5TMEA 2O2EA 3F9CA 3LVRE 4H77A 2GD0A 3ZWAA 3LL7A 4I50B 4LSZA 4JUCA 1MAAA 4FYMA 4AZ0B 2Y9PB 2C07A 3MFYA 4YJ2A 3TL6A 5L4SA 3EDMA 1XNRB 2VUHB 4JN6B 2R6CA 3NPAA 5JJLA 4BLWA 5BNIA 3MWYW 4RMIA 1RRCA 3PFGA 2WM2A 3BMQB 2X1HA 4O1MA 4X24A 3UK2A 5A4FS 1GSOA 8MHTA 3BSSA 3IKLA 3L4EA 4R7GA 4C4RA 4HNTA 1XFDA 2VCYA 1FFXA 1AKQA 2PT6A 2IU4A 4E11A 1BCSA 4RIEA 3BB3A 4JI7B 2OB2A 1CEEA 1W52X 3VYTB 1VMKA 1NX9A 4MJXA 4CEJB 3C4QA 2HJRA 5KYUA 1DKRA 2WDPA 1QX4A 2P6MA 1IMJA 1EYZA 1XLTC 3I6BA 3FWHA 2QD5A 1KDTA 2BFEB 3BCUA 3DMRA 4O2AB 5EJAA 2BEKA 1AUQA 1ZUD1 1AKNA 3NBYC 2TMGA 1E5DA 3E58A 3HG7A 3L49A 3QFHA 4GKVA 2RB5A 3NKFA 4GECA 3WG9A 3PTZA 4CWAA 3P9SA 3SKYA 2OCLA 2O1XA 4C7XA 4UHBA 2E4AA 3L6BA 3RC9A 3CRW1 1K75A 3M33A 4MH0R 3HDVA 4MGZR 3W0LB 4LE2A 4W9NC 3IXQA 5J23A 3HQ4O 1L8QA 1NW3A 1VQ1A 5G4LA 3OQNA 3G2HA 1XVTA 2WLTA 4LF4B 4ZHQB 1IBRA 2CN1A 3RAJA 3TVTA 1ACJA 1UBTS 5DOZA 2AI3A 3L0CA 3GXBA 5D1HA 2HCTA 3CISA 5G3ZA 5JTUA 4EGAA 4Z51A 4MQFB 5FWXB 3ZWOA 1A2OA 1FP1D 1M7GA 5CT6A 4ES6A 4B7UA 4NNJA 1M1YA 4UREA 1PT9A 3K53A 2VLBA 1GAWA 2JGDA 3D3WB 3ZZMA 4Q7EA 1BD4A 2DY1A 3HC7A 4YRFA 2EG9A 3AVOA 3D7SA 3E3LA 3VTZA 2XVYA 5TMPA 1KERA 4W1QA 2B5VA 1SU4A 3BG5A 3IAXA 4RELA 1NNEA 4E33A 2ZJFA 3ENQA 1LC3A 5AJHA 4V1CI 3VU9B 2I8AA 3RRXA 4KDFA 4BLTA 1KETA 1YZHA 4EFKA 3L05A 3ONEA 1N9GA 4K7JA 2H2IA 1K1EA 1BFDA 1OLUA 4BL5A 4EF5A 4WBNA 1LUAA 2B98A 4FZRA 4NULA 4UDNA 3ZDDA 4MKIA 3TDMA 1V48A 2R8ZA 1K6EA 1OLSA 2UAGA 3QFCA 4CIWA 2IS1A 3DFMA 1OHHA 2FX5A 3ZI0A 4H60A 4LCBA 2VQEB 1HYQA 1II0A 2NU7A 2PSSA 3MMZA 5G3YA 3TCNA 1EWYA 1O96A 4RDHA 4WKGA 3PHHA 1K5PA 1UBCA 4DDTA 3USES 1O94D 3D1VA 1RD4A 4QJBA 3HJGA 2P69A 3KTAA 2GB4A 2D5CA 2X9NA 3EWSA 4D8YA 6LDHA 2JHGA 1UDAA 1Y1LA 1CBUA 3FCSB 1RVDA 3JPYA 2P2NA 1MQSA 4YJHB 3RVOA 2D5IA 3AM3A 2PEZA 4FLFA 2GZMA 1WDLA 4PFSA 4Q9DA 5AVKA 3ZXSA 5LQJA 4K46A 5JO0A 1NNI1 3M5WA 4L8VA 3D81A 4Y2HA 3HBMA 1W49A 3Q3HA 4EGFA 3S8YA 5JOQA 4ZYYA 1J42A 1EP1B 4QHSA 5LKAA 2AEMA 2YDXA 3GJ6A 3DEHA 3NHRA 3Q1LA 1TOAA 1Z29A 5B6JA 3E0XA 3BERA 4FINA 5CYOA 3K71B 1XOIA 2J7KA 1U8YA 2PXHA 3LPDA 3A1NA 3B1VA 3AY6A 4LOIA 4X6XA 1PV1A 2I3BA 2IITA 3OJLA 1HE2A 2QRPA 2OQVA 4IUCS 3L6DA 5LIRA 3GUZA 3ETHA 4BO6A 1A1SA 2JPDA 1U3FA 3FOBA 4N39A 2CF6A 1JAHA 4C3UA 1C0EA 5G0SA 4P7BA 4ZVTA 4JELA 3GD5A 5L7TA 4X8OA 1GTSA 4CLOA 1WEHA 2VZ0A 4TMFA 3HBAA 4Y9SA 4D3XA 3GDOA 5K6AC 1PIWA 3LDFA 1KQ3A 5A1TA 3RGGA 1SKUA 4UXHA 4LQ4A 4RY0A 4B7ZA 4RCVA 4F3CA 5IM4A 1KR5A 3K5IA 3V1MA 2XUQA 5ALSA 1PZGA 5SY4A 1ZN9A 2IY8A 2V7UA 3NFYA 4ARSA 3D6JA 5J5VA 4EZIA 1Z08A 2A1UA 1QG6A 2V6JA 2CXSA 2W2NA 3P0HA 4FCCA 4IMIB 3QU2A 2NN3C 4LMRA 1JHMA 2R84A 5DISB 3VNUA 3STWA 4I55F 3WQRA 1Z8HA 1O1YA 3PFIA 1UDXA 1HKUA 2AR9A 4DLLA 3EZ9A 3EVAA 3RWBA 1TK9A 1HK7A 1YKSA 2BBOA 2BMFA 3KRTA 4M9CA 4B8WA 3OJCA 4P4UA 4YUXA 2C9ZA 4JYPA 3VDMA 4HDMB 1NN0A 5C3MA 2WU1A 2GYUA 4JJIA 5J5CA 1RJDA 5JCOA 3ZIUA 4DYDA 3THWA 1B7GO 3MBIA 3LSTA 3UTCA 1KFJB 4LRSB 2ZUTA 4QOIA 3T34A 4B3XA 1BCRA 1WCYA 3FYUB 1SB9A 2CYCA 2EFHB 2WTBA 5DNDA 4AU1A 1LDYA 5U9CA 5D3KA 1NLYA 4G0NA 4YRBA 1Z4PX 2ZBVA 1S9DA 1MMFB 1QNLA 3H17A 4JLUA 2ZEJA 2XI4A 4IW3B 4OQPA 2ODAA 5BR4A 1AMUA 4RJIA 3SF0A 4B34A 3KHTA 1I30A 1I6KA 2H5JA 4AMYA 1W2HA 3ADCA 4KGZA 5H82A 2CLFB 5ABPA 2DFTA 5I51A 3H1FA 4B47A 4B3RB 1WB4A 1L7EA 5MF6A 4HN9A 3QLEA 3JAMA 1LTQA 3JAKB 5CDHA 1IM2A 4AKEA 1JRLA 4U2CA 2ZIXB 4ZAYA 4LZWA 4I1UA 3K0HA 1PAUA 3W1EA 4P4TA 5HP4A 1YK0A 2C1XA 2VA8A 5JCZA 4AG5A 1A9YA 1JDSA 3IXMA 1YRYE 4ZO4A 5HKBA 1OU4A 1Q83A 3W2FA 4EG0A 3GG9A 4B76A 5HW0A 1G0NA 2QD3A 3PF8A 4M9SA 3NANA 1Y8RA 5JVDB 2B8TA 3KVOA 4ERXA 3P9QA 1FE8A 4OP3A 3BILA 1SXGA 3D0OA 1Z26A 1F3OA 3GLTA 4IFTA 3IV6A 4NPHA 4OAOA 5C8YF 5CDSA 4GL4A 3WFZA 1XYYA 1HZZC 4Z49A 3N58A 3O31A 5GMOA 3SJZA 2B0CA 3MUFA 2P27A 3AF0A 3IOEA 2CF5A 3IQEA 4RF2A 5FJIA 1N0HA 5KCZA 1HTWA 4MWGA 1NMQA 4R3WA 1MJ5A 4MKZA 3P9YA 1W29A 3A26A 4LAFA 5DBFA 3UKDA 5KQMA 1N1MA 1P1HA 1OD6A 1SMKA 2CEKA 2NZUG 3LSYA 1WCV1 4C08A 3F96A 1V6AA 3HDJA 3FYDA 4Q12A 3U60B 1MRZA 3UWKA 1SB8A 2H1RA 2I99A 4KPGA 5H9VA 2YBDA 3DB1A 3TW6A 4TPKA 4NH0A 4R1NA 1VKHA 2B9VA 2QMYA 3EZXA 4Q4HA 4B80A 2PKQP 5HK9A 1OFHA 4P2BA 2QTLA 3BFPA 3PC8A 1W36C 2GN4A 1O9HA 1U9YA 1EG7A 1J8VA 1X8LA 1Q1QA 5KX5F 4HX2A 4TTVA 4BKQA 1LV8A 4FU0A 3FSRA 5HHTA 4QGHA 1TUGA 1XNHA 5C46F 5K4HA 3OG9A 3HJUA 3NCTA 4LOKA 3C45A 4MAAA 3RQIA 3UMJA 5KYNA 1STOA 1NAHA 4PO1A 2PK3A 2TMYA 2G40A 3L46A 4RH0A 4J9VA 1FTQA 4MIEA 4G4GA 3AGQA 3OLVA 4NYIQ 3ONVA 2OTCA 4XPZA 4YV7A 2EQAA 4RGQA 1P7ZA 3FCOA 4ZALA 1KQNA 2JRLA 4QD3A 2VXOA 3NM4A 4G23A 4WA7A 2HWWA 3BWMA 3U1BA 4U7DA 4G5XA 3GCWA 2YFKA 1SURA 1CLEA 5E1BA 3L7DA 5AQEA 5AI5A 2G1AA 4JT4A 1IHXA 2VHZA 3QSGA 3A04A 4LYGA 1DCTA 4OM8A 3OSZA 4JBIA 1TC1A 4BMVA 3BHIA 3EMVA 1NDHA 4IQ4A 1KMQA 2ODBA 4DCJA 3KJEA 3PC4A 4EGQA 1R27A 1PR4A 4BQNA 5BV0A 4KWTA 4FD3A 1U1EA 1TAGA 1U9JA 5CT4A 3W34A 1CUVA 3AH8A 1E79A 1YFLA 1OSNA 1VMIA 4DGSA 5F1YA 4INAA 4CCSA 2Q0QA 2ZJOA 4TZTA 1Z47A 4AN0A 1CFJA 4D4HA 2CJWB 1BVRA 4YR7A 1RAAA 1QHIA 1OH6A 4XTCS 1AK9A 1GILA 1RE0A 4DA6A 1XTRA 5JDIC 1U63A 3IV7A 1A8IA 1CZRA 3KALA 3HR4A 4FKZA 3OE7A 2JKZA 1QVVA 3BMCB 3G85A 3K9BA 1UIMA 2FFJA 1RLTA 4QAJA 5CXQA 4N54A 4UMEA 4HGNA 1ZGAA 3FZNA 3ROPA 5ADUS 3THOA 5BYBA 1KAOA 3BYZA 1FS4A 1FY2A 4D8TA 5BN3A 3GA5A 1AK1A 2FWMX 3C2QA 1RAFA 2HCJB 1B73A 4KQEA 1TGYA 4L8YA 4LY9A 4F71A 5F2KA 3DQZA 4UVEA 4V0MA 3W6ZA 4R1UA 1TD9A 1K7FB 3KZMA 3PYMA 4V0QA 3UFXB 3OLYA 4RQTA 4EKIA 3N5CA 3P4UA 1G1MA 3BRWD 1DRKA 2Z30A 3EGCA 3O4HA 4CDRA 1KORA 3A7DA 4D74A 1HNZB 1Y4DE 3L92A 4GNKA 5M2QA 3T61A 2P78A 2C61A 5BSKA 9MHTA 1COWA 2X23A 3A6ZA 5CLIA 4CKCA 5AHOA 4IIYA 4GYYA 2I6QA 4QG3A 4ZYZA 1E7SA 3Q12A 5T57A 5FI1B 3PQ8A 2MCFA 4DC0A 4IHAA 2CB9A 3CE6A 4UQOA 5CDYA 2R68A 1A4IA 1JHXA 4G5OA 3E9RA 1Y3DE 2IQIA 2R1TB 2UUCB 1Y81A 1U0OC 2G70A 2TMDA 4QBHA 4BKOA 4E6EA 3HVUA 2YVLA 2NU8A 1NKVA 5IVIA 2IZ6A 3ZJTA 1N6KA 4YCLA 3SHWA 3P9IA 1TEHA 4CKBB 1EGAA 4N01A 4WLNA 2NZ2A 5BSEA 3MMPA 4UHKA 4FYJA 3QH4A 4MVJH 1G3QA 4D6YA 4PRYA 3K9QO 2A35A 2GK6A 2R97A 3NRBA 1THTA 3VSEA 1J2UA 2JIOA 2X9LA 1M2KA 2EC5A 3S2YA 1WHSA 5CA1F 3I2HA 3A9RA 3W1VA 5BRJA 4JT9A 4OQMA 4OSPA 4PN3A 1ZNWA 3E22B 3CFYA 4DS3A 2WC1A 3ZVNA 1N2EA 1OOEA 1MD9A 5FTWA 1LCIA 3U4HA 3FFBA 3CXUA 5E4YA 2XCOA 3PUJA 3PCXA 1V5GA 4Y2QA 1P2GA 1R6VA 1N2SA 3T7TA 5H3LA 2JW5A 3PNPA 1ZEMA 1I51A 2QM3A 4A27A 1EBFA 4YMGA 1T9HA 2LVBA 3ND7A 4URYR 3V6MA 1RYYA 1FYXA 2WYOA 3D2CA 3QYFA 1TW3A 3JAWB 3KEOA 3WFJA 4O3MA 1TYCA 3GUVA 1WUTA 2CNNA 4JWKA 2IWRA 4B7AA 4OFXA 1M5RA 3OHPA 3U7IA 1MEOA 4KVZA 4IUDS 1Q84A 1C3EA 3TD2A 4IKOA 2WR8A 1DE0A 1F9AA 2WV7A 4HAYA 5HVNA 2YJZA 1U2EA 1W47A 2WJPA 3FLMA 5E38A 2ASEA 4Y6LA 3PQFA 3OEEA 1A5TA 1UJMA 2KWIA 1YT5A 3KWLA 2I7DA 3AKZA 3AEQA 3JQ7A 3LY8A 1I24A 1UOOA 1Z45A 3AQ4A 1W96A 2AC4A 4EI8A 2XT6A 3DV9A 4ED9A 5BN5B 5CAEA 2FOXA 4KDCA 2HAEA 4HEA1 2FR8C 2ZAYA 1QH8B 4LVOA 3SR0A 4CT4B 1TCAA 2RKBA 3LC2O 5IDVA 3WGJA 3X1JA 1F17A 1CX9B 3OM0A 5LD2B 3HKDA 4XTRA 1U65A 3EDQA 5BYAA 5JWRA 2YVAA 3A25A 3I39X 4JXXA 1TO6A 3HBNA 3IFSA 4X3OA 4FW9A 1EK6A 4J16A 1UBNA 2J3QA 2VSFA 1AB6A 2X3YA 4C6HA 4CR8A 3EX7C 1A9ZA 2L42A 4C0XA 2Q2OA 1W4CA 3I9JA 2QZ9A 3T99A 3I42A 4UOZA 1O4VA 3GUHA 1USGA 4MUJA 4UHHA 1DIAA 5ILQA 4B3IA 3N74A 3MRTA 5EINA 4DSZA 5K09A 4KYVA 1PJTA 4CRWB 1RJEA 2CVFA 5JXGA 1MNAA 1PS8A 1XTBA 1X8KA 1Z4KA 2F8LA 1N7JA 3AFHA 2IUTA 3QPUA 2H1IA 3KFLA 5D00A 5K8IA 1Y0BA 1EJ2A 4KQ2A 4WCFA 4X20B 4RM2A 3QKSA 2PV0A 2WSLA 4WAUA 1VE9A 2WF9A 4QULA 2DUUA 2Q5QA 5LMCA 1V4NA 1Z6QA 3NYIA 3VZBA 5JISA 1UM9A 1FQJA 2GDJA 4FS8A 3COJA 2E37A 2VYFA 3BZBA 3MT8A 3B89A 3H9JA 4OBBA 3EE6A 3PWTA 2FV8A 8ADHA 1AKEA 4N5DA 2JGJA 3CVYA 2NYAA 1M2HA 1LWNA 2J9YB 3ED5A 3DE4X 2HDNB 3R24A 3FRJA 4F3YA 5A4MS 1JZSA 2JEYA 2HA3A 2DT5A 5CT9A 3RASA 2PZLA 4M0PA 2BC9A 3FVTA 3LKZA 5C7LO 4KU4A 5CFZA 5KYWB 1OXTA 5AESA 1QG0A 2TRSB 3BN3A 4N6GA 4B6OA 2QRLA 1VYUA 2HPZA 3IUNA 1VKOA 2WUEA 1PJBA 1M2GA 2O0LA 2V55B 2X42A 2XQGA 4DCUA 2ID9A 4KQGA 1DKLA 3NOQA 1M2VA 5A9SB 1XKQA 3DXFA 1FU7A 2CLCX 2F64A 1O9GA 2ZQYA 4EGSA 3V4VB 2FMIA 1SCUB 3ZQJA 1QGOA 1E0DA 2WF7A 2B61A 4IEIA 3TLGB 5C1DA 2H29A 3GDGA 4KX3A 1KL7A 1PJCA 1GNVA 2ORIA 5K0LA 3ICEA 1H3FA 4B5KA 4UU8A 1GYPA 1JBEA 2ZZNA 1DIBA 3FGPA 2H92A 3LX4A 3EXFB 3NDJA 3IO5A 4KK3A 2EW2A 1FTGA 3CM0A 2W71A 3NWBA 4G1FA 1O97C 3CRQA 4KVGA 4U7JA 1OBCA 1Q2UA 4IH1A 3DLPX 3R41A 3SYTA 1FDIA 1VP9A 2NM0A 3BJMA 1NT2A 1WTAA 3DTVB 2XMSA 3SLRA 5HX7A 1D2CA 2IYLD 4B46A 2E9SA 4HC4A 1F2UB 4IIUA 4M21A 1T4GA 2CLIB 2X1VA 3QLVA 4U0JA 1WQ1R 2CVQA 1Y9JA 4NMWA 1Z4JA 2QTHA 3RR2A 5K45A 2YV1A 5LSAA 3SP1A 1P1KA 3AGPA 3T54A 5JE8A 3GJ0A 4LXGA 5JG7A 1FMTA 2IYTA 5DNWA 2COEA 3OJ0A 3U31A 3H5RA 1ORTA 3OTWA 4BO8A 1NRXA 3LWZA 3EPHA 2JK0A 1ZIOA 1HG0A 1PV2A 1NIPA 1PL7A 2EDCA 2J6IA 1DIHA 2BLNA 2PL1A 2VRBA 3LBYA 3N2EA 4OHRA 5IYZA 1DOHA 3JVIA 4AWAA 5JYEA 2VOJA 1ZUNA 2YRWA 1G2QA 1XRNA 2DG2A 2QE6A 1GZ7A 3EXHC 5DHUA 3RAGA 4GH5A 3U39A 2BBWA 3ZGLA 1IEWA 1PL0A 3R1IA 4A5SA 4JB0A 4F97A 5HJEA 3IOCA 1W48A 2SECE 3SIPA 4YAEA 3WBFA 4B71A 4OXYA 1L8LA 4EHLA 1R0SA 2D1FA 3B2EA 4G4IA 5E3JA 2FQ1A 4CXMA 1BEZA 1NE2A 2A59A 1DTWA 5LZ2A 2SICE 4OV6B 2B2CA 1E3JA 4X63A 1P2SA 3V7YA 1CIVA 1XZPA 3QGMA 4D92A 4K6KA 3T1HB 4W6QA 1D2GA 4MULA 3EYWA 4PLCA 4J0QA 1WHTB 4GX2A 3L79A 2XEDA 2B4YA 2ISSD 3FTDA 2UDPA 2JBWA 3COSA 3IOMA 3I01A 1RRVA 4FSHA 4M7RA 1MAWA 3TTTA 2P4QA 2Q5LA 2ZIFA 1T36B 4ZXFA 1MN6A 3CUWA 2W8BB 1IU9A 1NUPA 3HJNA 4KMOA 3UUFA 3ZV3A 3KPVA 4FFMA 2BL4A 2VHYA 3QTLA 1XEAA 4N5LA 4ZOLF 3T35A 4W1SA 4ILEA 2NG1A 4AZ3A 4LJ7A 2PX5A 3JQPA 1LQ2A 4J76A 4QDXA 2JCBA 2FMHA 2RCYA 2L0XA 4Z3OA 3M1IA 4MW7A 1V0JA 2W4QA 1UBJS 3VR4H 9ATCA 3E27A 5LPNA 4BX8A 4RLHA 4KIFA 4ZCQA 3W8DA 2X8WA 3LBFA 3RVDA 4B8ZA 1E62A 1DJLA 2WUFA 1AKUA 2DLNA 2ZTHA 5DGHA 5LP6F 2QL9A 3KQPA 2I2AA 4YJ3B 5F3RA 3SX2A 3LZDA 4LDZA 2VAPA 1UPAA 4YECA 2NSYA 1T9BA 1JHDA 4JA0A 3SEAA 2GPJA 4ZDKA 5EJ7A 2P2GA 3O90A 3IAFA 1KU0A 1L7DA 5AKXA 5TF0A 2LV8A 1ISGA 3AR2A 1JEYA 2NU9B 2QM0A 1QF7A 2W6IA 1CEXA 1E1KA 5BXYA 1NI4A 2OLJA 3R20A 3OCCA 4EB6A 3VDRA 3OZ7A 4BU1A 1QOZA 5BW5A 1O77A 4ZO6A 1BHO1 3DDSA 4BMSA 1LBSA 1NU8A 1T6XA 2F1RA 1QQ7A 2G9ZA 2OBXA 3DZGA 3MWGA 3P0IA 4GW3A 4TRRA 2ZJYA 2C8KA 4YRCA 4FDTA 1NQXA 1R16A 2YW2A 3D6FA 5BN4B 1V9CA 5K3DA 5L3ZA 1UPFA 2OGSA 1SK9A 4KZPA 4MRSA 4BMYA 3I1IA 1S2LA 3B5EA 3AHFA 1XWIA 4J8PA 4ZKEA 4DLBA 2NVOA 4II7A 2HQRA 2A57A 2ECQA 3FOWA 3QKIA 4BE7B 3PPVA 3BGOS 1LW7A 2QP9X 1GCGA 2ATXA 4P6VF 3ZK8A 1W5AA 3D2LA 2V96A 3AETA 4EJSB 3S28A 3TZQA 3WK6A 3ZEAA 2XY4A 3BD9A 2K2QB 4EO9A 2WHPB 3FOZA 4G0WA 3HSSA 1HF3A 1P31A 2YXDA 4F4IA 3VC1A 5T41A 3R9WA 3IELA 4XD7D 4F1KA 4G37A 4RMGA 1JQBA 1ZO8A 4BTEA 3HB4X 5F9FA 4C06A 1W94A 1W76A 5IC4A 1ZMXA 4TKUB 4EDHA 2NQ2C 2BEVB 1GNQA 4KXQA 3TZEA 2CXTA 1OFUX 3MRXA 2DHCA 3KB6A 4KQ6A 5JSYA 3RSOA 3FVQA 4H17A 1EH5A 4R83A 4ZGGA 1W88A 2HYIC 2PWYA 3WK7A 4MPTA 3KZCA 3H4TA 4I9UA 3FAZA 2JH8A 3DWFA 3TEFA 3IEKA 2OK7A 1S0UA 2EBHX 2XMPA 3LWBA 4HFRA 1CY8A 4B4UA 2AN5A 2DHEA 4NY1A 4H3HB 3AHEA 1SPXA 4DLVA 1KMCA 1U99A 3DFZA 4FKBA 4FQ5A 1EAYA 1MJGA 2FEOA 4ETIA 3EEBA 3KYDA 2RK6A 1XDZA 1UADA 2HHLA 3HP1A 1QPBA 2GD1O 3DT6A 3PHJA 5K8LA 4E94A 2J45A 2VF2A 4GC9A 5IVHA 4FX2A 2G6BA 3SSAA 3N39C 1KO7A 3FJYA 4K2AA 1BOFA 3LKDA 1F2VA 2BGWA 1VHWA 2V7VA 7REQB 1PNQA 2HWUA 3NONA 1ODTC 1EXVA 4V0KA 1DQPA 5M7EA 4PBTA 2DCMA 1YAJA 1EVKA 2J0UB 3GH1A 4H4DA 2OKCA 4KR0A 4UVGA 5AM0A 1IEVA 3V1TC 3TTYA 4AF6A 4U6SA 4HEHA 1E9VA 1P4RA 4D0SA 4GPEA 2RSLA 4U9IS 4YAFA 1XEFA 4GI5A 5JAPA 5LWQA 4HDNA 5LWHA 1P72A 1DEXA 2TSYB 2Z8ZA 3NATA 5EKDA 4J4TA 2O5VA 3WLSA 4OHMA 4UHCA 1JHPA 1OZ0A 1JFFB 1EP3B 1U0FA 2DU8A 2FPGA 5KOJA 3DAPA 3U3OA 2FPOA 4D4LA 1ULHA 3DAYA 1YRQA 2B4AA 4MYSA 5A04A 4Q15A 3VZQA 1JPJA 3RJTA 4CMHA 4W5NA 4UVHA 3OPYB 3HCWA 3WL8A 1T2VA 2IA5A 4CU2A 3WDMA 4FUTA 3GCZA 3C8DA 3A2KA 2XRMA 3TSZA 3BA1A 3DNFA 1E6EA 1UKVY 3OE5A 4REQA 2Z8YA 4LZAA 1LV7A 4FFSA 5KCMA 1AE1A 1KJYA 2VNAA 3H9UA 2V4MA 2AQIA 3OUZA 3QEMA 4DWVA 2VTBB 3HLYA 4R7TA 1QP4A 5TLSA 1U3TA 1KAGA 3IQIX 1UBOS 5CNJA 3WZLA 2MSDB 3ASUA 4KGVA 2ZI7A 1TMOA 3ES9A 4A8TA 1PG0A 3AXSA 3TNYA 4DCTA 3DBIA 3V1UA 3MCUA 3MS4A 2VUSA 3DOCA 3KLNA 5AHXA 5JMPA 5FPHA 2PT9A 5HILA 3M1LA 3ZHQA 1RU3A 1AMOA 2JFXA 2K2WA 521PA 4XVQA 1X70A 1QFYA 2AFHB 4GM0A 4NEQA 1WM1A 4C3ZA 4MI3A 4KZKA 1PX2A 3UPTA 5E1DA 3GVCA 3IHTA 1RI3A 3VR5H 1VYHA 1EGMB 2OHOA 3FWZA 4BFWA 4RTOA 2HRDA 1CW2B 1EDZA 1FRQA 1UKCA 1ZRNA 2BFDB 3EH1A 5HIMA 1J22A 2GJ9A 3JVEA 2MWMA 3EODA 2XDAA 4XQGA 3VDXA 2GK3A 4MVYA 1LBTA 1W44A 1PQUA 1GAXA 1H8HA 1QM5A 3DBLA 3OFJA 1P5RA 3ESBA 2QW8A 5JNLA 5C53B 1SHUX 2QLTA 5H3HA 1QQ6A 2BFAA 2HJHA 2GM9A 4IG9A 4OJKA 3AU8A 4YRRA 2HC9A 1JEQB 1Z56C 4QOEA 1A98A 4YIKA 4PQRA 3RHZA 2VPTA 2X77A 1EP9A 4JU8A 4XQ9A 4UTNA 2OCPA 2OG2A 4JVLA 1A9XB 5BV7A 2C2XA 3IULA 4F38A 4RD0A 3ZJUA 3W6OA 2GCNA 3SFTA 4M0MA 1KTIA 2IHYA 3AM5A 1PK7A 2OXFA 3W6NA 3FNIA 5CM9C 3HWX1 1QONA 1K7CA 3E3OA 4V2UA 3KKQA 1CUJA 3GMTA 4JOBA 3SXUB 2GLUA 5CG1A 1XYVA 1YR8A 1PQPA 4K0RA 4MJ3A 4MVXA 5BYKA 1ZK1A 3GWZA 1U2QA 4OGFA 4EATA 2J67A 1WY5A 4C0BA 2WP8J 4IYJA 4HDRB 2OXCA 3REGA 3AHIA 1OX4B 3OQMA 2NAFA 3NYQA 3BORA 5DNCA 3HLTA 1V4VA 4A10A 5HYVA 1PGPA 2ECFA 2JS7A 1UFQA 2IHUA 1VCNA 2X7HA 3BDAA 3TFWA 2BFFB 1T5DX 2Q5FA 4IOJA 3EXEA 4C22A 2YMQA 3KSAC 2KLBA 4D4IA 1TUBB 1EUZA 3WMWA 3ZHOA 2VT7A 4A2PA 1S7GA 2KBEA 2QMHA 1HNWB 4M98A 4IZHA 1KI8A 4L5YA 4HDKB 4WNYA 1QKJA 1CERA 3U7RA 4CJXA 3K9FC 2P79A 3DHWC 3MINA 1X77A 4P5DA 3SMQA 2A88A 3A6FA 5J4YA 4JI4B 3WJ1A 4DY4A 1HWYA 3MJSA 3T5PA 2YOFA 1H8EA 3OT4A 4ALJA 2XX3A 5G1PA 1SCNE 2OCBA 2NO0A 1ZIYA 3MNFA 1KBQA 4IJ5A 1IRIA 1ONPA 4KX5A 5JWOA 3I9V1 1UQRA 1T6ZA 1V47A 2LP4Y 3RSSA 4DSTA 1JG6A 3QOWA 2I3DA 2XWQA 1IY0A 3SU8A 4YEDA 3E7XA 4G24A 4XEHA 4TL8A 3KJXA 1GG9A 2EEZA 4NATA 5IJXA 1BU8A 4R2WA 2Z6AA 1ZKMA 4R1LA 1FSPA 2FP3A 4C0WA 1CUSA 3DGEC 3MYYA 1KJ9A 4WLOA 5TGTA 4IF6A 5LQMA 3AUYA 4CTJA 3UT5B 1XLUA 3DONA 1V43A 1XXLA 3FVVA 2NSLA 5TRTA 3S2FA 4DR6B 1OF1A 1Q92A 2JGIA 4IJQA 1NHGA 4UC0A 4BTLA 3R7AA 1NURA 2R87A 3AVTA 2GCPA 5JJKA 2NTEA 2YWGA 3ANSA 2SBTA 3ISVA 3I6ZA 4N8EA 4UUQA 2W11A 5JJ5A 2VJKA 1XPJA 3C70A 1GSHA 1P0FA 4R1MA 2A9FA 2ZPAA 4ND3A 3ABRB 1I7NA 1XWFA 1WPQA 3DOJA 1NBAA 1VPTA 4OXNA 4XXHA 2DWUA 5FJJA 3IBGA 2RHTA 2HB6A 1MB4A 1XK6A 1CB7A 2WRZA 3ME5A 4QX6A 4FOTA 3EMBA 1N1GA 4C0AC 4CKWB 4DIUA 1BMDA 2WK1A 4D25A 2QD4A 2XLBA 3QXSA 4IMJB 2AEFA 3T9CA 5FO0A 1LSUA 3CLSC 5HA5A 4QODA 3DUFA 1E6MA 3Q3VA 3IUJA 1CDEA 2O57A 1D04A 2OD2A 1R64A 1NC3A 5LQAA 2QZPA 1ADFA 1AF7A 1I10A 4RE5A 1EXWA 3OZAA 1ID1A 2PNFA 3ZX5A 4C4ZA 3ZD9A 4ETMA 5BORA 2PQ2A 1WQ4A 4RDIA 1QGDA 4IL5A 1SY7A 2WFLB 5LKRA 1T8UA 3L8ZA 2FDCA 4D42A 4M6WA 1KIFA 4UU0A 1GPKA 1B8NA 1RQRA 5KDOA 5GOZA 5CB0A 4WUVA 2AVDA 2M32A 4YDQA 3O8OB 4HH4A 4CLHA 1EFCA 1UFRA 3CMCO 4PCUA 4UM8B 5CVEA 5FI3A 1XL0A 2QSUA 1GDTA 4LF6B 1GPMA 5K0FA 4KLZA 4OBWA 3BJZA 5J59A 5BRAA 1CUWA 4IKPA 4EHKA 3K20A 3PRJA 1T0IA 4W7IA 4CHTA 3SY8A 4L16A 4RTPA 1KC3A 1N1EA 1RLMA 3E9YA 2NP7A 5FUXA 5C8YA 1PNOA 4CE6A 2JL1A 1N0UA 1XHFA 2RAVA 4V3BA 5LVAA 2DWQA 3L41A 1JIQA 1VHJA 1Z0FA 2GN2A 2X76A 4L08A 1YDGA 2F2TA 4XASA 4B4OA 3UGQA 1NOJA 2WSYB 5DHPA 1E89A 1MHPA 5ESWA 1ZD9A 5KU1A 3WMFA 5ALZA 2QEQA 3ZHXA 3I61A 3AP3A 1XZHA 4C7KA 2V0GA 4PR0A 1E7RA 2QTTA 1PYOA 3DMTA 4L5AA 3AIKA 2O7RA 3C41J 3A1EA 3FF1A 5LLDA 4CNBA 4NZNA 3W6UA 4RAOA 3BGDA 2X40A 3CTMA 1YZ3A 2BISA 3RD5A 3SQLA 5DBOA 3VYUB 4CF6A 2IZ1A 3IYLW 3C15C 3GV0A 3K5HA 1H5QA 3NJ4A 4Q1DA 1CE8A 3DUWA 2UU9B 4FFBA 4O4JF 2F8SA 3BXFA 4AMZA 4UM9B 1EFLA 3N76A 1FZTA 4JFAA 3AEUB 1NXTA 2GCIA 1IM5A 4R0VA 1FZQA 1ZIPA 4LV6A 5JEEA 1KC1A 1X87A 1FNCA 2C9CA 3MMXA 3Q8WA 1YBMA 2IOQA 4RK6A 4S0ZA 4TX1A 3STXA 4R81A 5HF9A 3RGWS 1H4SA 2H48A 1G8FA 2JI4A 3EG9A 3NU1A 4YCNA 2ZYUX 3HCDA 5L3SB 5JZ9A 1F0NA 1M2WA 1YJQA 3ZKWB 3JVVA 1U3CA 4YXFA 3TSYA 2AJDA 1TYZA 4BZPA 4Z53A 2C5FA 2BMEA 2GDZA 4I1VA 1Z2NX 5A4JA 4J1SA 2Q9UA 3EH2A 1YRBA 1EK5A 3UJBA 2MINB 5J2UF 1GZ6A 2FEKA 2B5OA 3ETLA 4XUDA 4J1TA 1UMKA 3N0RA 4KFUA 4PF1A 1YTLA 3TSOA 4ER3A 1C3OB 2C5BA 4RK1A 4EHIA 4BV9A 4NBWA 2ZSIA 1TJ3A 1XVAA 2Y1DA 4RSMA 3H1AA 3WE7A 1JFRA 2AYXA 5LFAA 2ZWOA 4QVKA 1SU7A 5LMUB 1OKKA 4OAQA 3E4CA 3BQMB 4KBFA 4D3FA 1NR5A 4P3OA 3M6MD 4BB0A 1C0LA 1EDEA 3HMKA 3HM9A 3HWRA 4G5HA 4PG7A 4EA7A 2H6EA 1CB0A 3ZHUA 1C9DB 4MVJP 4NBRA 2R25B 2VJBA 3BTVA 3NYRA 4HGYA 4NTZA 5A05A 2Q7OE 1NL3A 3WAKA 3MTQA 2LIPA 2WKRA 1DVRA 4H6PA 3QVLA 4P92A 5KYXA 2J0SA 2XNCA 5ALGA 4OXXA 3V55A 2ZT5A 4JD5A 4URHA 3A27A 4ZCIA 3K0EA 4PFKA 1JHZA 2BHRA 1VIYA 3W3AD 1C30A 2HA5A 3PENA 4ND6A 3TRJA 3GLKA 2XB6A 2HA2A 1RJWA 1MCZA 2QM7A 4UUAA 3ZBQA 1XR3A 2GM3A 2FQYA 3CB2A 2QW0X 2OESA 3ZZNA 2Z2XA 4Q3NA 1Q2XA 2IYWA 4CT5A 1EFPB 3WL5A 4I66A 3OTHA 1I3CA 2QAGB 4MO9A 2RHGB 2RH5A 3TLKA 2P35A 5D3MA 2WICA 2GK7A 5K3AA 4F1WA 2J9RA 2WABA 4QBGB 1DOAA 1N2CE 2NO9A 1JYFA 1RYNA 1M6VA 1P29A 1ETHA 4H1TA 4FFWA 3R8CA 4AW9A 3EDYA 1L5YA 3P52A 3GP5A 1BSVA 2WZCA 4HRAA 3N8HA 1EZZA 1E6LA 4QQFA 4WKBA 4JJ7A 2ZCJA 4LJRA 4OHWA 1Q19A 2JJYA 1GDHA 1M8JA 1PLLA 2RKOA 1WSAA 1L5HA 2IPNA 4MUGA 2HGZA 1DFIA 3OFKA 1Y6GA 4R54A 1IN4A 3ZQKA 4CQMB 1TQ8A 4Z6KA 2C77A 4Z1MD 3P9KA 2FHPA 4CMKA 5KQRA 3FOEC 4Q34A 4MKFA 2XJ9A 2Y05A 2NP6A 3M2TA 3U5ZB 1DKUA 1JKXA 4FIZA 2AR7A 3W2EA 3O26A 1PGNA 2IX9A 5DWDA 4D79A 5JS1A 3RK4A 2ERYA 5D6NA 3LQ1A 5FFFA 3UQYS 4DDHA 3OESA 2V1XA 3HJTA 3NUGA 3GEBA 3CRVA 5HZKA 4K2HA 2V4ZA 2WWIA 4U00A 1UPTA 5BQOA 4IOKA 4FHDA 5DXFA 3E84A 4UU1A 4L76A 1XE3A 5BWCA 5EL0A 3LUPA 1YNSA 4MS4A 2COKA 4QOSA 1P81A 3RNOA 2F8TA 2B92A 3UA3A 4GPAA 1AMNA 1K8XB 2HGSA 1CVLA 2EWVA 4EY6A 2A8YA 3G0BA 3CRNA 4KNYA 4MA0A 2XKKA 4QYTA 1TT5B 1RHKA 4WXPA 3TGLA 1OYWA 1OPRA 5AM2A 2X41A 4R1QA 1OA0A 3EASA 1K0FA 2JC3A 3NDPA 2PZ8A 3BQNB 3DEFA 4DCCA 5CH8A 1QB7A 3KETA 3CRRA 3P7MA 4L6CA 1K7EB 2OV8A 1ZK4A 1BEEA 2P3SA 1HEIA 1OWMA 5D3ZA 3TI7A 3H3JA 4JJ4A 1RPZA 2GEBA 4HXGA 1OYOA 4TT8A 2ZRPA 2WWRA 1BJTA 2FPIB 3GLVA 3PT9A 4HNQA 3MF4A 3F8SA 2O0KA 1DTSA 2QP3A 3P2KA 1SXJA 2WTEA 2PGJA 3ORSA 4GLLA 2ZETA 2WSSA 3K2IA 3VBCA 4B7XA 2FF7A 1P9WA 1V7PC 5JS7A 4QUJA 4BZXA 2AG1A 1JI3A 5FNVF 3I23A 3NJ8A 3P9ZA 1W4LA 1KO4A 2QP4A 5K51A 4MUHA 1RMYA 3ZV6A 3KFXA 5COAA 2C9DA 1KZGB 2CXHA 5ENDA 5L4LA 4WKOA 1O95D 3IKVA 4QSMA 3QOFA 5COBA 5HDQA 1CEQA 2FN9A 1GQQA 1EZ1A 4LXHA 2W5UA 5A5EA 3FPBA 3JWPA 5FLXA 2N3ZA 1XTJA 2F3UA 4KTTE 3T3HA 3UV7A 3WMEA 1MXHA 5HDBB 4JBLA 4UKDA 3RFFA 3ZHVA 1KOFA 1DJOA 1WNFA 2QPAA 3ZW8A 1US8B 2ZR0A 1XMIA 3RUEA 2QMEA 4YAJA 3HEMA 4P3KA 3T7SA 3G2NA 1Z0UA 4E3WA 3K70D 4J7UA 4D26A 2VP9A 1LVUA 2BEUA 3IQDB 4JR2A 5ER6A 3DHYA 2O3QA 3MGAA 1PVOA 1BWRA 1V7ZA 4JB8A 2BELA 1YGPA 2QN6A 4UHFA 3S70A 4EY8A 3N8DA 4EA9A 5GVRA 3SQWA 5DP1A 1RZVA 1GPYA 3VI3B 1D0SA 1E6WA 4F2WA 4IP0A 2WMDA 3QHPA 1ZUWA 3M6XA 4QTXA 5K0BA 4M1WA 1ZCJA 1KPIA 3RC3A 4QRDA 4UARA 2EARA 2G3YA 1JHRA 2HLHA 3V2HA 4IKEA 1E4YA 2X7XA 3ZDRA 1O0BA 4KFSA 3MWDA 1O08A 1PK8A 2A14A 1B26A 2C42A 3KL2A 3KPJA 4FDMA 4CMEC 1C50A 5BQPA 4R8MA 5DRTA 1P60A 4HL6A 4LI3X 5FWDA 3T5MA 5GY7A 5EJEA 2RGNC 1XLVA 1UWCA 2IZOA 1BJRE 1GZVA 1P9LA 3UAYA 4LYYA 4RVDA 3SMVA 4DG8A 2A3RA 4I4TB 5F77A 4UBNA 4PCAA 2VYQA 3HZHA 4YV0A 1QFXA 1DO2A 1U7TA 3A7EA 4H0NA 3DZBA 4MYUA 4QQKA 4BN5A 1N32B 1Y4UA 5AI0A 5KAMA 3MGBA 1KE2A 3CEAA 3PC6A 5FAKA 4UD2A 1QIIA 2QTNA 4RVCA 4IG4A 4Y9DA 3TOSA 3NRCA 1NI3A 3WOHA 3UMMA 4TWIA 4S05A 4ARZA 2Q1YA 4D8WA 2P1ZA 4GLFA 3GT4A 2P5UA 3T7EA 4ESOA 1CDOA 4ZJPA 1W93A 3OQPA 3FSGA 1T6NA 4MHSA 4ZD6A 1LFDB 2VJNA 4AN1A 4E2FA 1MKYA 1RMQA 2ZPUA 3Q2IA 4PYQA 1E2GA 3ZIAA 1IPHA 5JAZA 1QS0B 3PNLA 2FN4A 2IPXA 1C0KA 2P1DA 3RS5A 1L7PA 5AXBA 5J3JA 4I81A 1LBIA 4JOQA 1OXVA 2FUG6 5ALVA 3TLYA 1YSCA 4M60A 2Z2KA 4EDFA 2ORED 1ZUHA 2DQZA 1R88A 2EJCA 1VMAA 4ADSG 1CUGA 1KJ8A 5JQGB 4UTZA 5FBQB 3E3NA 5CD1A 3U3XA 4XDGA 1T4CA 1QIEA 4IFBA 4XJSA 2XBMA 4JXZA 2JIZD 2Q3BA 4R3UC 1M8PA 1AXEA 2VG8A 1G6KA 5ALLA 1VI2A 5DW3A 5IG2A 1OC2A 3RBXA 3REQA 3AVUA 4NZMA 1MX5A 1Q7RA 2QJOA 3TB6A 3GRCA 1C9JA 4BNYA 5JZMA 3TPCA 4QWWA 4ZEVA 4CMIA 1KEVA 2VYCA 1JLSA 3DPUA 4HGQA 1ZQ1A 1YRAA 1JQAA 2BZSA 5CR9A 5CXSA 3L0DA 2XAUA 5BQFA 9LDBA 2I6UA 2I7VA 1Z28A 4C7JA 4YUAA 4YTEA 4BBJA 3QOXA 3QVJA 3OQOA 2CXXA 4QUGA 4R51A 4GKAA 2R5NA 4LXIA 2GARA 1IJBA 1ZM2A 1RHUA 2KSQA 3MMNA 3R5FA 1O6CA 4RJJA 3ZGVA 4AJPA 2RHLA 1G8GA 1MH9A 2P9HA 5B2EA 3FSJX 3MOSA 4LRYA 4OL9A 4NAUA 2Z04A 3OOEA 3R7WA 4ENWA 1V11A 1B42A 3MMSA 3EC2A 4O63O 4EKNB 3UICA 3W8FA 5CX1B 3CBQA 1QXSA 3BSWA 4E32A 1P3JA 2KJQA 2VBFA 1Z6YA 2IXBA 2O6LA 4MS3A 1Y48E 1O7JA 3WP0A 3ZHBA 3ZLTA 4D9MA 5A5VA 5KKCA 2O8FB 3ROTA 3G8CA 4H3VA 3D5QA 4PC6A 2QSYA 1A9PA 2BI4A 3VHQA 5ELLA 4ESHA 4LTMA 5K3OA 3RTCA 4Z0TA 3MUOA 4ZOLA 1XMJA 4I2VA 2H4WA 2V45A 5IJ9B 1SEPA 1YF3A 4NE9A 1MVLA 2VDPB 4EYQA 4F56A 3JQ8A 1J56A 4XGNA 4GPBA 1E5XA 2EF1A 2NTNA 3CWCA 2AUMA 2XXJA 1M8FA 1GPUA 4II2A 1CDZA 2B7LA 5DX0A 4AUNA 4E6PA 3R5KA 4MB2A 5IJ0B 5JARA 1UQTA 5CMLA 3E61A 3JVDA 1QKIA 5IC6A 1YVUA 3SWWA 1EX7A 1F8XA 1P9RA 2BCJQ 3PR2B 4LDNA 4QDJA 1E58A 2BV3A 2OLKA 4NOKA 4ZT3A 4CG2A 3ZIDA 3CKYA 3PUKA 2CSXA 3PD7A 1N2HA 1RWWA 1OVGA 3OX1A 1IIRA 4P3NA 3A1FA 2I87A 1NNLA 4CM8B 3FWNA 4MARA 4RVNA 1L7AA 1SBZA 4Y2UA 4QJ3A 2AWNA 5E2BA 3I92A 3IQGX 1JN0A 1AOXA 1GKLA 5T67A 3QQ5A 3KJNA 4HAVA 4EMSA 1UPCA 4GRDA 4JLVA 2OOKA 4IWNA 4JB2A 5JJCA 3K3PA 4YUZA 4ND8B 2WWVD 3SN6A 1GA1A 1QIFA 4QWMA 2GFQA 2I3ZA 3WSVA 3IERA 4BV2A 2C04A 3MGCA 1IBLB 3GJ5A 3GYGA 4OHOA 3BFVA 1Z74A 2PQ6A 1F3LA 4ZK2A 2YL2A 4DL9A 2CDRA 4N9QA 3RWMB 1DXOA 4F3TA 1AGNA 1CS0A 3TN7A 5CIYA 2YKGA 4JROA 3TTSA 4LXTA 1CZNA 4EITA 2DZDA 3E5NA 3MQFA 4EPYA 5AJZA 3RYIB 4X5OA 1LRKA 1IUNA 2YWDA 4MYCA 4GR4A 4NXNB 1ZD3A 2ZYRA 1XVLA 4M8NE 1WE2A 3FGZA 2UUOA 1UK6A 1LLDA 1W85A 4Q4DA 4M1EA 4TVSA 3P0JA 3HVRA 1PSWA 3FBTA 1K8QA 3W3ZB 1P19A 4KXVA 1PKEA 1VJRA 2FKNA 3TOZA 1EVIA 3ZJYA 3EQZA 3U1TA 1NVBA 2OENG 3IJ5A 5FUYA 4EH1A 2REQA 2M98A 1UKEA 1ND5A 3QUTA 4PGAA 5EZYF 4R6XA 2RB4A 3RS4A 4P0QB 1AJEA 1ZLYA 4TN5A 1FOEB 4R2MA 4E5YA 3LT2A 1T5OA 1RXSA 2QV0A 3A6DA 2ZE5A 3EPRA 4UJ5A 1HMPA 5TDHA 1C1XB 2OAP1 3HRHA 2J5XA 3JV7A 4S1OA 3ZUPA 2BEWA 2ISQA 1EFAA 4F5ZA 3H1BA 3NXKA 3TOXA 3U5TA 1Y8CA 2C4KA 1B43A 1Z39A 1TVMA 2VYND 5DWVA 4OP2A 4DMLA 1W0KD 2ZCUA 1P61B 2QTVB 7AT1A 2H51A 3DPSA 3GFRA 2Z2JA 4M89A 4BNJA 1NRJB 3MD0A 3NHUA 1K06A 4Q9JA 1NG1A 2VATA 3BE8A 4U7FA 1XRRA 3Q5EA 3EGDA 1E20A 3LT4A 1VLLA 4PX5A 4JIMA 4BV3A 4EPWA 2ADOA 2GN6A 2QXTA 3OF5A 4HLUC 1T15A 2KPOA 2RI1A 5FAXA 3UUGA 3WK4A 1SVOA 4BV8A 2ZJBA 4ZK6A 2ZI6A 3H0CA 4E5VA 3TRKA 1XU7A 3D64A 2RBEA 1F6DA 1JT2A 3P0FA 1UBKS 4CM4B 4R2JA 1BMTA 4DWJA 3SQDA 4EKYA 4ESVA 2H5LA 3FVRA 3KQTA 5TQ0B 4QREA 3QWIA 3ZNPA 4PLGA 4LXUA 1G8SA 2A0WA 3EFEA 5IUJC 2ATIA 2JVIA 3RIXA 3RQSA 1L0BA 5T4HA 4EX7A 1Z2DA 4A8JC 1ZGJA 1AUPA 1IB0A 1R6AA 3PQCA 3VPDA 4A92A 1FDOA 1PJ3A 2EV9A 2V6IA 1C9EA 1EVJA 1RT9A 1URPA 5BMOA 2QTCA 5ALOA 3GPIA 2KW5A 3VZSA 4UAJA 1M6NA 3DBRB 4BNLA 3GJ3A 2I4TA 4W8GA 2WD7A 4G85A 4GLBA 4U1RA 3URKA 1V5IA 1VHTA 2VJMB 4HPXB 4MGKR 1BX0A 3Q5GA 2HLPA 1GPWB 2YJ6A 3UK1A 3NWEA 2VAXA 3Q88A 4LJLA 1GFWA 2V8BA 4HB0A 1OV4A 2GAIA 1QP0A 1P1JA 1VRCA 5JSQA 4HQFA 2IU6A 3EVBA 3D6AA 2CJPA 3KVYA 1N6OA 4GE0A 1YVRA 4A7PA 2PRJA 4V0ME 2YIMA 3ZVKA 2QJFA 3OEYA 2DQYA 3ASVA 1DRUA 1QZZA 2ON6A 3DGFC 3O8QB 4QLOA 5DULA 4DLAA 1YL7A 5KYYA 2VQ6A 4BEJA 4OBXA 1ARZA 4IH9A 5K05A 1PVVA 3RSLA 4XI9A 4B4KA 4C2TA 2P65A 4LFCB 2R44A 4LRXA 5LXTB 2VPIA 3NT4A 4NS1A 3WOVA 4HXYA 4EFMA 3HXQA 1CR6A 2GEFA 2L19A 4AY3A 2ACVA 5HKKA 1BTOA 1KK3A 1Z13A 4PQGA 3WK9A 3W9BA 3BMXA 3P0EA 1B1CA 1DAHA 4D1YA 1Z5ZA 2YMLA 4RTSA 1JIIA 4YRAA 4CKEB 1AN9A 4QOJA 2HMSA 1EUDB 4M9XA 1S8OA 4CTNA 2CHUA 2Y0DA 3S2SA 5JCPA 3AOEA 4RJTA 3IPLA 4MRMA 3WWPA 2C4TA 1W87A 2D2VA 2GN1A 2CDNA 4QU8A 2QV7A 5TY0A 221PA 2P3LA 2VHEA 2HO4A 2X22A 1YRLA 3NVKI 4RABA 1NBHA 4MVCA 3HPRA 2P77A 1FVFA 2WHYA 4ZGWA 5CA0B 4L3WA 2R4QA 4YI3A 2PGDA 1OW3B 1VE1A 3RBAA 3WLAA 4GPD1 1DG1G 1XHEA 4IJUA 4JI2B 5DT2A 5BNZA 1V8DA 2M1XA 4OX9B 2P3OA 1YB7A 2W2OA 3GMSA 2XNDA 5KAPA 1SCDA 2O7SA 4Z2YA 2C31A 5BMVB 3WYNA 4RUKA 3W5UA 2ZJ5A 3JQFA 4HGPA 3JZDA 3DKIA 1RPTA 1RJGA 2OFOA 1P2TA 1S3SA 1H22A 1VSVA 3PVSA 2FI1A 4LYHA 4E14A 1OBHA 4RH1A 1J7JA 4X41A 3ZBUA 1E8DA 3KKOA 5LJLA 1FFDA 4EEXA 5C80A 3NORA 16PKA 4N5IX 1CQJB 3VSCA 4BB9A 4GL2A 3DDOA 3ZI7A 3U44B 1HX7A 1DXYA 4ZGBA 1U0TA 2Z2YA 2XYGA 2QY6A 3WLQA 3RRBA 1BDBA 2XSZA 4IR7A 1NX6A 1S4MA 4XWAA 2ZJ2A 2ZRHA 1HQCA 1P2VA 4RVOA 4YLGA 5FBVB 4JZKA 3QSYA 2P75A 3V9AA 3NAZA 2YHSA 4TKLA 3PC7A 3WB1A 2MIIA 2ZI9A 4EI7A 2YZKA 2ZRKA 1V25A 3MJFA 4PZPA 4ZYLA 3UWMA 5IZCA 5LQDA 4AVYA 3H1PA 5JSHA 3HXLA 3RJ9A 4ZICA 5C1OA 3KXIA 3L7OA 4OJYA 2AN1A 4H35A 4LBYA 3RLIA 4C1NA 2CV0A 1P2UA 4M9QA 3K92A 1YS2X 2V6FA 3A9WA 1YZYA 1ZD2P 3KWMA 4JNCA 1N2IA 4MMZB 1MW8X 2GBCA 2D8MA 3OIFA 2JJ1D 4QXPA 2ZSUA 1T34A 1GGEA 4JP3A 4G0QA 5IAGA 3E4DA 3OOJA 3HKCB 2R8PA 2RONA 3PDHA 3LDUA 1S4QA 2VPYA 1QV7A 4CCAA 3F4LA 3VZDA 4CM9D 1NVFA 1ZOIA 3C3JA 3JD0A 1AHIA 2DULA 2R1VA 5DW0A 4ZIRA 4BDTA 3MHTA 1YOBA 4W99A 2PMDA 2NO6A 2PJUA 1OIWA 1I32A 2XD4A 1BN7A 2N0SA 1DKNA 1HYGA 1RHMA 2B1GA 4RZXA 3KLPX 5HM6A 1QQBA 2AI1A 4YPOA 4D4GA 1GZ5A 3CVJA 5F12A 4F91B 1SXPA 1YA4A 2XYQA 3H05A 2ONYA 2FLVA 3IUEA 3OU7A 2D1SA 5FP0A 3RWOA 3DDZX 1SOAA 1XUOA 2RJOA 3GUUA 3A11A 1QF6A 4OXRA 2GZHA 3EC7A 3JQEA 2Q46A 3D1JA 3C3CA 4LZNA 3PJRA 4BXOB 4MZXA 4DDKA 1F2TA 2P90A 1DDGA 3BF7A 4HPWA 3UVEA 5H80A 2W0MA 4DA4A 3D7KA 1XPOA 3DLAA 3QLJA 4F4DA 2ZT8A 5L4NA 4KIGA 4D9IA 3NALA 4D96A 4FFPA 2HXYA 3G82C 3MD9A 3EVEA 4FK8A 4EJ6A 3AJAA 1P7YA 3UCFA 2HRRA 5JANA 5JRJA 3RSHA 3EMKA 4WMLA 1XZNA 3BIFA 1U2TA 3CLHA 3WBKA 1CP3A 1LDBA 3LUCA 1XKXA 3NR2A 1DP4A 4NP6A 4BO5A 3CGWA 3JQDA 3UN1A 4DBZA 1NOKA 4YT8A 4P32A 4ENSA 3IR6A 3JWGA 3Q6NA 4A16A 4UBKA 5I9IA 4BNDB 3CB4A 1NVAA 3F8WA 3GNLA 3ACDA 3DKKA 4AJ9A 2FRDA 1EFTA 4TTTS 1Q7TA 3ET4A 3HSKA 3KXPA 1P80A 2HCFA 4L7VA 4A2WA 5TJHA 2EFCB 1PQWA 1X7YB 2MHCA 1YJAA 3OCWA 4ZREA 5B4UA 3G1WA 4XCQA 4DLTA 4ARCA 5H5JA 2EBFX 2ZIVB 2JLRA 5GZ6A 1AKWA 5L45A 2II6A 1YA8A 2R7KA 1L5SA 2WOJA 3OFNA 4G1MB 3BB4A 4JLDA 3TVDA 1TU4A 2J59A 1LQTA 4J2TA 4B40A 5F7XA 3LCMA 3K4HA 5CCDA 4GF5A 2IV3A 1N2ZA 2I8CA 3CNOA 3RSQA 5I8PA 3K7EA 3LBAA 1BX1A 4RNCA 5C8VA 4IHJF 4IJVA 5KNBA 4OH7A 4ZVKA 4JAVC 3P2JA 5A03A 1MC8A 2PTHA 4JVMA 3ONDA 1YV9A 5EN4A 3CLRD 4GPIB 3RUPA 3SEFA 3ZE6A 2VNSA 4DIFA 2PBRA 4RTMA 4XUCA 2P6PA 2QN1A 3TRIA 3UJ7A 1BO6A 1Y6ZA 4ZAVA 3VKWA 5DYTA 5B3JA 2A30A 3WK5A 5JQGF 1JA9A 4FMDF 4O4IB 5JS6A 1B8OA 5LA6F 4JYAB 3ORYA 4E46A 2MDTA 1NVVQ 2A78A 1IVSA 1PYDA 3T5BA 4J4BA 3TLCA 1DUVG 1K3UB 2G71A 3O4FA 1E1YA 3PVZA 5M34A 5G2OA 1AQYA 1OBOA 3LZ6A 3PE4A 4RSRA 4S3MA 4MUMA 3U4GA 3QMVA 1AQNA 4I9HA 2H63A 1MRNA 3WP1B 4OREX 1I4WA 3VJMA 3O91A 1R3UA 1WIWA 1P2DA 4L2IB 4TKVB 4E22A 3DZFA 4OQZA 1EK2A 2HA4A 1CRZA 3W4KA 1FS6A 4B79A 3EPKA 2Z09A 2A5YB 5AJTA 2IYAA 2REBA 1UKYA 1NVDA 2RHJA 3LT5A 4N3CA 3M9LA 1KEEA 3JD3A 1TA9A 4A03A 4TLLB 1PN3A 4DAEA 4DR2B 1IHOA 2XMQA 3BXPA 4FVTA 4JSTA 1F8GA 2E5FA 3IBFA 1W5BA 2APJA 1P62B 3CE9A 4HLNA 5EMMA 3UY4A 4DYHA 5HOEA 1XAHA 4Q39A 1RXCA 4UULA 1G20A 1E99A 1N57A 3RYHB 5J2UA 3A31A 2AHRA 1USVA 1R8QA 2PX4A 3KR2A 4XARA 4DSUA 3G0IA 4YFVA 2AMYA 3F6CA 1XA0A 5A3JA 1ZI6A 3PUZA 2A84A 1J39A 1JFLA 2C2WA 4PGGA 4BP9A 4GVXA 4ML3A 4BVHA 2YZ2A 4BAZA 4BKMA 4EYEA 4L9AA 4RDXA 1DRJA 3OH8A 5FR2A 1MO4A 2K4MA 4HZUB 5HS4A 1DXQA 4WT7A 4LXYA 4CTKA 3M6UA 4X6YA 5AW6A 4ND1A 1AKTA 3ENNA 4FHZA 3V1YA 3DWGA 3C14C 3SKXA 2W2PA 1A2QA 2GJAA 1O2DA 1K5GA 2B1RA 5KC8A 2CB0A 4ARVA 2C94A 2J9FA 5C2JB 1X7WB 3M7IA 3WIVA 4BC0A 3KV1A 2VDOB 2P4EA 3MAAC 3NC4A 2WILA 4KODA 3TQIA 3W8RA 4ABYA 1IFXA 2I4IA 5IUNC 2IGTA 3KWFA 2C3YA 3C48A 4GMXA 2F17A 1L5NA 3PJGA 1HA3A 2PU5A 3TUIC 1T43A 2JLCA 3S2EA 1ISIA 4ITRC 4M76B 4ZANA 5GONB 1EKXA 5K03A 3CCFA 3MB5A 3OEHD 1L6IA 3CZCA 5T64A 2SHKA 1RRKA 4IOMA 4IDDA 3EAFA 4CR7A 2B7BA 5LYJF 1I2BA 1P8AA 2DPMA 1ZH6A 3I4LA 4ODIA 3TFQA 4EL5A 1ZM4A 3M4YA 4B2YA 1I7LA 1P3Y1 5TC4A 2P5TB 3CPJB 2CGEA 4B8YA 5CCEA 3U3KA 1PU2A 3CO5A 2O1EA 1Z9BA 3I1JA 2YWFA 2QU8A 2VZ8A 3NUZA 2HSEA 4KPUB 5WRFA 1WP4A 4D98A 1AKYA 1ORVA 1NSTA 4N0PA 1T6YA 4R84A 3AW9A 4ZRMA 4S24A 1I4OA 3SVTA 5EJIA 3HO1A 5EPUA 2ZSJA 3GJXC 4WXMA 3AERB 4CLRB 4HWRA 2FW0A 1KJWA 3JYOA 2PNJA 1Z15A 1DKQA 1HMYA 3TJMA 4HZIA 3DD1A 4IVQA 3IPYA 2Q9BA 5AOBA 5BUZA 4C0HA 2W2TA 3DLCA 1YE3A 3R3ZA 3FCUB 1SBHA 3ZCXA 3IAAA 4RL6A 3RAPR 1LX7A 2DBQA 5TB5A 4BS9A 2BTQA 3AEKA 3LRPA 1M2EA 4PC7A 4XW2A 1SQ5A 2IPLA 2MSKA 2MYUA 2BGNA 2O2SA 3WJ2A 4X91A 2V0CA 4DV5B 5LQRA 2Q6OA 3A1TA 4L3OA 1Q77A 2R7LA 1KZYC 3CPSA 3IUPA 2X5NA 4R1SA 1MO3A 3MZ0A 1AZLA 1NPYA 2G06A 3CO0S 5BURA 5HCNA 4OJQA 2VDJA 2E5WA 3HB5X 5TPWA 3HGTA 2Q1UA 3OEED 3B6JA 1Y5MA 1C2YA 5TGDA 4AJJA 2YX1A 2JGNA 3D4PA 1JDJA 1K6MA 2XE8A 1EM8B 3WO1A 3ITDA 4I8IA 1HRKA 4IXTA 4M1TA 3TGWA 3HXTA 1DKPA 2BHTA 2NVBA 1QHHA 3GDWA 2JD2A 4W1PA 1HQDA 4ZIRB 2AF4C 4KDRA 4WERA 3UYLA 2O06A 3KD3A 3OUUA 1IBCA 3LQYA 3Q8KA 3K1AA 2C88A 2NT3A 1AT1A 3N70A 4DT1A 2VK1A 1CD5A 3HHEA 3CBGA 1UK9A 4IZOA 4S1PA 2JJQA 4RZHA 2I2FA 4MPDA 2XR1A 4DOMA 3ID6C 2CXQA 3PRYA 2WUDA 4MV6A 1B76A 4ZT2A 1V16B 4RO0A 3UM9A 3ROXA 1NVGA 1SVNA 3AV0B 3EJWA 1J2RA 2ZRDA 4MQBA 4QEDA 1RQXA 1VL1A 2ZANA 4IAOA 4KUGA 4KQMA 4F7WA 3SZMA 4NOJA 5KSZA 1TZKA 3ZHZA 3AW8A 1KKUA 4XIGS 1L5FA 4KRGA 3KFVA 2HX1A 4RLFA 4JDUA 2P67A 5LLSA 3TLMA 1Z0JA 2F4NA 3FTQA 4P38A 1QLJA 1TMKA 3LYLA 1ZBQA 3CEPB 4DANA 1IBMB 4N41A 4AZTA 4R01A 2C0QA 3MTBA 3TDNA 3G2KA 3QKUA 4DMRA 4GWGA 3MPOA 4PZCA 3RRJA 2CJXA 1THGA 2NXEA 4IGAA 4CGYA 1CG6A 1E9DA 1ESCA 3BD8A 3I9KA 4U63A 4AP9A 5CFLA 5KWIA 4Y2SA 3OIGA 4TYWA 4WN9B 1S8FA 2XKBA 3OLWA 3EFHA 3EIQA 4FOOA 1B74A 1LGYA 3A8TA 3AP1A 2PS0A 3DM9B 3PCRB 4JJ8A 3UH0A 2PKWA 3AXTA 4EHAA 2FEMA 3ZC3A 5A2GA 5B36A 4D4KA 1W5SA 2UZ1B 3DMDA 3FH0A 3WRWA 5JDIA 5HBRA 1M72A 3C16C 3NV7A 1C1DA 5BSVA 3EQ2A 1N25A 1Z07A 5TT0A 4QPCA 3HYCA 2Q5HA 3RB8A 3C3PA 1EM6A 1M5UA 1WLSA 2F43B 1M34A 2FSIA 1B2RA 2I2WA 2QUAA 3B8EA 4V0OA 2M6KA 1MORA 4NV0A 4OAPA 4FMCF 1GWNA 5BUCA 5K9ZA 2BDTA 4TV9A 2DKOA 2XTZA 1YJCA 2AJCA 5JCOC 2G6TA 2AYZA 4PEVA 3ZW9A 4GOXA 1K92A 5J1SB 3BWXA 1S2MA 4P98A 2IZ0A 2ZWIA 1YU6A 2VBCA 3K70B 1NXVA 1SEVA 3V8QA 5EJ6A 1C7EA 1VSTA 2UZ3A 3CX4A 4PY2A 2Y4OA 3NHFA 4LYFA 2AL7A 2Z9BA 2C59A 3KM0A 1KOGA 4JJEA 2G7MC 1ZL2A 4PPYA 4BB5A 2PUWA 4F2PA 1CUDA 4H1UA 2UYQA 2Y4NA 4ZI3A 2WIJA 1DFHA 2J08A 4RD1A 1AA6A 5EQTA 2GQ0A 3A58B 2C58A 1GM5A 2QD2A 3V4SA 3K9HA 1FFAA 1NR1A 1TD1A 3MTIA 3VJKA 1G38A 8LDHA 2XXAB 1GU1A 4TL6A 3GPCA 4TMYA 2YR0A 1G41A 3PX3A 4FYIA 2UYOA 5D84A 5AVTA 1R0BA 4N7JA 4X60A 1B6SA 3KWJA 1QRRA 2Z0MA 3DHVA 1JS1X 5J1TB 5L3QB 4CMBA 1XTSA 3AUAA 3B1JA 1VG8A 3GLHB 4Q21A 3WQBA 3D5TA 4AUEA 3D3QA 3SQNA 1JIJA 2I80A 1EG2A 4BNIA 1E5QA 2BE9A 2A9RA 3IRVA 4BQEA 3CEMA 4JLNA 2OYCA 2XW6A 5T7BA 3EF1A 1KQFA 3HDGA 1QAOA 1RI4A 1YKGA 1PDWA 2VF8A 1SKMA 1E94E 4ZI5A 4GOMD 2BBSA 1XZEA 3OM8A 4FEYA 4CL3A 4TLMB 4CF3A 3VGJA 1NXXA 4WWHA 2VTEA 4GOOD 1IIBA 4LGYA 3LWDA 3NM5A 2BIFA 2GEUA 4BTVA 1SRQA 3RTEA 2XCLA 3T3GA 1GOTA 1GVHA 3IQFA 4ZO7A 5E3IA 2XITA 4CG0A 1A0OA 1K9SA 4DHWA 2IIBA 2HK8A 3I05A 1TQ2A 4YA6A 3PC8C 4LW8A 3SBDA 3K4PA 3PV0A 2FGJA 2UVDA 4X7RA 5HGJA 2EJBA 3OZIA 4KCGA 3WNQA 5HRUA 2ZR9A 1OLOA 4P35A 3V3KA 4I3FA 5IFKA 2WU4A 1JHQA 4K9PA 3PWKA 5K6RA 4MJLA 4AWBA 1EVZA 3EZGA 3HNOA 1ATIA 2GKOA 2XZPA 5JCJA 2AR0A 1XMPA 5I7UA 2PLWA 3WYEA 5E6UB 3PQEA 3QUQA 4PONA 4HWPA 1MF7A 3R40A 4P9NA 4Z9FA 3BWYA 4KE9A 2NADA 2Q4DA 2F1KA 4JJAA 2REOA 5HFNA 1JV2B 3BXXA 4I8DA 5D5QA 5AO9A 2IJGX 3AUUA 5MFZA 1E6UA 4W8OA 3R0XA 1H1LA 1IHUA 2B34A 4HQ0A 1OC4A 1AQ6A 4IIJA 1W5EA 3MJRA 1GCUA 3PXDA 1I5OA 3N2GA 3ZE0B 1U7DA 2WFZA 4UTOA 3WIBA 3CGGA 3WMGA 5JDCA 1XDBA 4HK4A 1PV4A 1O8BA 3RBZA 3ADBA 4JUFA 3ETJA 1K8ZB 1RWQA 2Q62A 2W6ID 1XF1A 1JFVA 1ZMOA 2P9TA 4FW8A 1OI3A 2FW6A 2ZUSA 3QWAA 4CF4A 1JDPA 2WJ4A 4FZ3A 4U2BA 2IZ7A 2DETA 2NUPA 4KQ1A 4AWXA 2KMLA 3NHPA 3RYFA 4WASA 1DX9A 2BP7B 1EHIA 2EGGA 2HMVA 3S1AA 1OA1A 4LOHA 4OMCA 1ESEA 1NUSA 2VHXA 1C80A 4LEIA 4S2EA 1XVVA 1Y1TA 1QH1A 5F73A 5JSZB 1GZHB 1UMCB 3I2IA 1J1UA 2NZWA 2JI9A 2AK3A 2ZRBA 3ACCA 2Y6UA 4UTRA 4P80A 3LYUA 6ADHA 4HO1X 1WSDA 3E18A 2AKEA 3SJBA 1MJFA 3PBKA 3GR6A 1G8HA 1S2IA 2C8VA 1F8YA 2YCLA 3I1YA 4FT4A 5B7GA 3SE7A 1BMFA 4JY7A 2D2XA 2BSAA 3CWZA 1DL5A 4BUJA 1PUXA 1FNBA 2WHXA 2YIJA 5I3CA 2JKVA 2VJCA 3VOBA 3NW9A 3EIOA 2ZR7A 1XN4A 2QBYA 1DCMA 1XQ6A 5DVZA 2QU7A 1CRPA 4Z9XA 2I33A 1HI9A 4D56A 3OQVA 2N46A 1K9VF 2QGFA 1SG0A 3AUKA 2EBWA 4EI2A 1X80B 3RFXA 3RT7A 1Y9EA 1P7CA 1SELA 4RSGA 4JLKA 4BZWA 5KU7A 3TIVA 4CTMA 2VJPA 1JL3A 4H31A 2Y0BA 3JQAB 1R9JA 2YXNA 1N2CB 1PUJA 4ZAFA 3UYKA 3EW9A 2ZSDA 2XOEA 2ZYGA 3FZQA 3H87A 4ZCPA 4Y67A 1Y3BE 2BUAA 3ZE7A 1J9EA 1I1QB 2A4KA 4PPQA 5AH0A 4EUNA 3IBYA 2FGKA 2HDOA 4PICA 3ICWA 4MA5A 4M1MA 1YB4A 2ZTMA 1KYVA 1QORA 1Y9ZA 1L7NA 2JATA 1BVUA 2Q4EA 1KFCB 2OG1A 3FMIA 3HE3A 3HYNA 1W0JA 1YNOA 1VRVA 4MGIR 3WTCA 3A32A 5EJ9A 2B2NA 5FOQA 1ZHOA 1U8UA 2YQZA 2VPZA 2ZJ1A 4MEBA 4DDMA 3D8UA 4JGGA 3VH1A 1CPYA 3LT0A 4HD8A 5HJ7A 4L4SA 3SLKA 1JVSA 4TWJA 1PD0A 3U80A 4YPVA 4F6LA 2Y77A 1FFHA 4U5XA 3FZGA 4PGHA 1N2BA 4BJ1A 1IBKB 2R5FA 1I3KA 1OI2A 3NHKA 4KL8S 1I94B 2P9CA 3L1IA 3SF8A 2ZYTX 4G0XA 4J0HA 3PQ3A 3ZWXA 1RABA 1UMBA 2QI9C 1KZ1A 3W77A 4HT3B 2PGXA 2EIXA 5T8KC 3K1TA 4A6XA 2EF0A 2ILTA