5B2EA

N,n'-diacetylchitobiose deacetylase from pyrococcus horikoshii complexed with its inhibitor mpg (acetate-containing condition)
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
267
structure length
267
Chain Sequence
FEDIDTFEEAFNKLLREVLEFDLQNPFKDAKKVLCIEPHPDDCVIGMGGTIKKLSDMGVEVIYVCMTDGYMGTTDESLSGHELAAIRRKEEEESARLLGVKKIYWLNYRDTELPYSREVRKDLTKILRKEQPDGVFAPDPWLPYESHPDHRRTGFLAIESVAFSQLPNFSNTDLDIGLNPYNSGSFIALYYTHKPNYIVDITDLMELKLKAIRVHRSQFPDDIWEKWEPFLRTIAMFYGEKIGVRYGEGFRIMPGLFYHITPFTDLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein PH0499
publication title Substrate recognition of N,N'-diacetylchitobiose deacetylase from Pyrococcus horikoshii
pubmed doi rcsb
source organism Pyrococcus horikoshii ot3
molecule tags Hydrolase/hydrolase inhibitor
total genus 99
structure length 267
sequence length 267
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02585 PIG-L GlcNAc-PI de-N-acetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10320 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold LmbE-like 5b2eA00
3DFFA 3WL4A 5BMOA 4XM1A 5B2FA 5B2EA 1Q74A 3DFMA 3DFIA 2IXDA 2XADA 4XM0A 1UANA 4XLZA 4XM2A 3WL3A 1Q7TA 5CGZA 4EWLA 3DFKA 2X9LA 3WE7A
chains in the Genus database with same CATH superfamily
1QGUA 2O2GA 5AHWA 2BH9A 1ZSYA 3DP9A 4ISCA 4P6VF 1KIMA 3IGFA 3QTBA 3Q8LA 5H83A 2VXOA 2YV2A 4JP3A 1L5HB 4JLNA 3PPYA 3MCAA 1WBDA 1KK3A 4HDMA 4HLQB 4R9RA 4N3AA 4GI7A 1XYVA 1GLNA 2Z2KA 4V0SA 4WCFA 5IXYA 3WNQA 1ZZEA 3BGVA 3JY6A 4TXMA 3UHJA 4BWGA 4ZCRA 3RAJA 3ZU3A 5LP6A 1DIAA 1GLGA 4H7EA 2ZE5A 3FBWA 2BFAA 4QD3A 1V7QA 2VDPB 3MFYA 2E21A 2ILVA 3STUA 3E35A 1FS6A 1C29B 4I2VA 1H2HA 5I4IA 3FZEA 3UMVA 1ZLXA 2Q2QA 1T0JB 4W4TA 5BV8A 1M8PA 2IQ5A 3WVNA 3ZWYA 2PQ0A 3DDWA 1V9SA 2ON6A 4N5NA 4RHYA 2YJ6A 1EDEA 1DMSA 1V0JA 2XCLA 1CYDA 4DY6A 4N8SA 1AN0A 1P7PA 2H2FA 1VI5A 3JVIA 1UBGA 1NPYA 2RGGA 1M76A 4BBJA 4EPTA 5A4FS 1QH8B 2D1YA 4WXMA 4A03A 3BRCA 2CZQA 1RBZA 3SQOA 2H2AA 4B4WA 4GXQA 3WDLA 1AKEA 3TECE 3KBOA 3KQMA 4RDXA 5KOJA 1XTJA 4F2PA 1WX1A 1FDIA 3RTDA 4Z1OA 2FSHA 3EX7C 5E6RA 2CSXA 1PSWA 1OA1A 1N1DA 4HN9A 1KSHA 1EFHA 1JG7A 1IHPA 5K8TA 3HG7A 1TO6A 1OIVA 3IV9A 4E1BA 3D6HA 4GLFA 3Q11A 3V48A 3UMMA 3I2JA 4E6EA 4H08A 1Z5GA 4PFJA 3TUJC 5BW4A 2SNIE 1P2GA 2P0AA 4MR8A 2ZB7A 4J7CA 4NL4H 4BFWA 2YZGA 4NMWA 4RS3A 2IV7A 2IHJA 3ANMA 3IR5A 4O8CA 4B79A 4D9GA 5DB4A 4YPFA 1OREA 2PYZA 2FUKA 3EFEA 2AG1A 2VYNA 4OSEA 2NSJA 2E5FA 1V5IA 2A0XA 1KYYA 5F51A 4R8SA 4DJ5X 3AJ8A 2F00A 3DDOA 2NNLD 2C7PA 1F2TA 1GNTA 2VHQA 5FL7D 1F0YA 2I6SA 2G5CA 2XMQA 2IHKA 1U0SY 1CR6A 3S8MA 3MS2A 1FNMA 5K8IA 5K3BA 3V8PA 2RBEA 4GH5A 3PI6A 4WZAB 1NR5A 2VUHB 3DT6A 5AHRA 4EWLA 1Z82A 5C51B 4MV9A 1E8MA 1UPBA 2HK8A 4MMZB 3OLCX 4K2HA 1JEAA 3CRW1 1MNAA 4ZO4A 1JFFA 3UMSA 3BVPA 4G3XA 5A9SB 3O75A 3HU1A 4QUGA 4HWGA 4C3UA 1YFJA 5I7OA 1Q6YA 1YB7A 3I76A 1ZDMA 3F4KA 1RPJA 2QQGA 4N7RA 5BORA 3IP6A 1HM5A 2QTWB 1D2RA 2X4LA 4LJ4A 3UW1A 3WTCA 3WWPA 3Q7TA 1MF7A 1DAMA 4BVBA 5KC8A 5B58T 1E7RA 2A5FA 1EFVB 2C54A 2GM9A 3FUCA 3PEYA 1I1QB 1QRTA 5M29A 4A73A 5HIAA 4BFXA 1N9ZA 2JGNA 3ZDFA 3PENA 3EFOB 3JVUA 1HG0A 3D4LA 4TTTS 2RFLA 3VZDA 2FMIA 2IPLA 3N8NA 1ZBQA 4B2LA 3ZE7A 3RYTC 2DFVA 1W4LA 1S0UA 1NV8A 2G1UA 1Q0UA 3ODPA 3FYUA 5CVEA 3D3QA 5LKAA 4C2TA 4C6SA 4TTQA 1JYEA 5KSOA 1SXJD 5EHIA 5KKAA 2I3GA 1NI5A 2CEKA 4IIJA 3CLUD 1DHTA 2R85A 4R9UC 3OFVA 2YKGA 8ATCA 2ONCA 1YZUA 3C14C 3L18A 3P2OA 4G5XA 4L0QA 4L0DA 2XB9A 5EKXA 4DA4A 4OLAA 3YASA 1KBOA 3ST7A 1RXUA 3R20A 1GD1O 1QMGA 4B6SA 3IO3A 2GERA 2QJFA 3GRRA 4BFYA 3VSEA 1RAEA 2RHMA 3V8QA 5TQVA 2JIDA 4Y6SA 5FPPA 2WNIA 3EEYA 1E1CB 1TTPB 4JJEA 5DKFA 3WV4A 3MB5A 1JI0A 1KGSA 3OT4A 1NQOA 4B4OA 1YF3A 3M6UA 1KYVA 3VH3A 4CNBA 1STOA 3NKFA 1Z2EA 2IYNA 2C2ZA 2MU1A 2ZBFA 1UKZA 1XZPA 2CKDA 3IB6A 3IHLA 5JAHA 5AESA 3F7NA 5EXEA 4UHKA 3OMWA 3HUEA 2HBZA 2NTVA 1S7GA 2Q5QA 1FU4A 3NHJA 1FSSA 4O2AB 3GLHE 3VGPA 4GM4A 1AT1A 1G55A 4MIOA 2JL1A 4HWPA 4ONEA 5EXDA 4EEZA 5DK4A 1ZI8A 1OYYA 1H2ZA 4AJ1A 5ESDA 3SYMA 1XFAA 2NUTA 4D82A 5LYJF 2G9RA 5JNLA 3ASYA 1WCIA 3GD5A 1RAHA 4ZCTA 2CJXA 3MCUA 2VDRB 1YZNA 3EPKA 4P2BA 3VHXA 4JT8A 4K9LA 4I4TB 4TTPA 4JA2A 3M4JA 2IQIA 4IWYA 3VR5H 1AGRA 2NZUG 2HSWA 1P0CA 1FYFA 2JD0A 3UA3A 3V2UA 5CB4A 4ME6A 2IF2A 3ONVA 4B7CA 3IMGA 4ENTA 4FMDF 3D8UA 4H60A 1KY5A 3B6MA 3K0SA 3JQFA 4HYQA 4B43A 1K3TA 2QBYA 5ESWA 4US1R 1BZYA 5AK6A 1EXWA 3WIBA 1MGOA 3GHYA 1J6UA 5K0JA 5CLLA 3HWSA 4I4IA 1VL2A 2Q5IA 3F5SA 4P1ZA 2QVXX 1M0SA 1T9BA 1PGNA 1XK6A 2PK3A 3HDYA 1WMEA 4KO3S 1H4SA 4R31A 4EKYA 2ECFA 3NDPA 3SKXA 4ZI5A 3VV3A 3UXEA 2FSUA 2Y0BA 4JJ6A 4E33A 2AYYA 2MSWA 4NYIQ 5TVGA 4D26A 3KQSA 2H18A 3BGIA 3V00A 1TJPB 4RGYA 3KC2A 1GAWA 3HVHA 5H1YA 5KOHA 3OY2A 3MWEB 1W76A 1VG1A 3DG9A 1W2WB 3TE7A 3VC2A 2GZAA 2TSYB 5IMBA 2YYYA 1BWRA 2UAGA 2CHEA 4IQ4A 4Y6LA 3LY5A 3QOWA 3CURA 1N7IA 4L9WA 4TV9F 3QOFA 1JHAA 4Y7CA 3OURA 4NH4A 3SY8A 2JI7A 2VC2B 4TMZA 4ZVMA 4HCJA 1T3LA 4B3FX 2WM8A 1T5DX 4QLAA 3O4RA 5DI9A 2QYTA 4OX9B 4JCOA 4UDOA 1K98A 5LC1A 1IHYA 1NNUA 1PFQA 1X94A 1N2ZA 4AJOA 4FSHA 1QHNA 4DDMA 4L50A 4W1PA 1YA4A 1N7JA 1QTNA 2E9SA 2Q4BA 5DWVA 1K3FA 3A9SA 4UEJA 4ADSG 5IF3A 1R6VA 2IY8A 5K2OA 1HT2E 3MJSA 4P53A 3J7TA 1DO0A 4A6EA 2E4AA 4B74A 4LKRA 2V0GA 4CCYA 1J9ZA 3DV0A 2E2WA 3RTCA 3Q2KA 4HNAB 4N3NA 2IS6A 3BF8A 3HZRA 2HRDA 1AJEA 3X43A 3Q5GA 3VHLB 2Z3VA 3LPCA 2Z5LA 3OIYA 4RMGA 3T9EA 3W05A 1Y3FE 1XLTA 3K70C 4O4HA 3VPAA 4EGSA 1JXAA 2Y1OA 2QVYX 1T0HB 3ZDYB 1O9GA 1P5ZB 1ISFA 1XWIA 2GM3A 1W1IA 3OJEA 1ITZA 1ZOOA 3DOEA 3HBMA 5LDHA 1V11A 1G8HA 1P1BA 2E4UA 1RWVA 2R1TB 1LPBB 3NRJA 3QA9A 4NARA 4NCIA 3KG2A 2GFHA 2OCYC 2PSSA 3S2IA 1U31A 1O08A 1TD1A 4QFMA 2IKSA 4ZMRA 7ADHA 2QRLA 4KKXB 4Q3LA 2FP4B 4R2KA 2NO4A 2WM9B 4ZEWA 1HL7A 4B44A 3ORQA 3UY4A 2C03A 3PF8A 2ZUFA 3VR0A 1V5WA 4Z7JA 2TMKA 1K2WA 4PTZA 1O94C 3PNSA 3VPFA 2AKEA 3BXFA 4KN6A 2CLLB 3PA6A 2GXUA 4K6FA 4PZPA 4FZJA 2RK6A 3PRHA 4WCDA 1WB6A 1CQIB 1YR8A 3KOUA 2MOKA 5H59A 1VTKA 1VPTA 3ED1A 2YQ5A 3RUPA 4MIKA 3E8XA 3I9NA 2INGX 4FS3A 3G0OA 3JASB 5DX0A 1K4KA 4KO8A 4ZD6A 2QTVA 1FU8A 2QK4A 3M9WA 4KN8A 4OJTA 3GEHA 5EERA 5AVSA 4LZWA 2HI0A 3UZUA 5AQEA 4H7HA 4B4UA 4ENPA 2AG6A 2W6JD 2R5NA 2BV3A 3H5TA 2E4ZA 1U04A 2GOYA 4UCXA 2JAUA 3DQZA 4LF7B 2D2VA 1VZ3A 4G0YA 4LNUA 4GG1A 1E0JA 2BWJA 2VQ3A 4IDQA 5HF5A 1QH1A 2MYNA 4XTCS 4PR3A 1RHUA 4MWEA 4UNIA 5ALZA 3USES 3UJHA 5J3JA 1QHSA 3EOZA 5DYGA 3C2QA 2RGYA 5IWCA 3VU0A 2ZYRA 1QZZA 1EPUA 1IY2A 4CKCA 3TLMA 1QO0D 4E4TA 5KYVA 1ENYA 1OBOA 4K6GA 3OHPA 2EOAA 1PL6A 4EO4A 2QGFA 1ORTA 1D2MA 4HDCA 2HR1A 2OBXA 1M5UA 3LXUX 2NX2A 4Q3OA 4QO7A 4BNWA 3TOVA 4RORA 1BDJA 4XIJA 1UK7A 5IJXA 5KQPA 1KEZA 2HSGA 3K1JA 5HIMA 4DCTA 1NQ5A 3E8SA 4TYPA 5LZ4A 1WF3A 4DE5A 2J87A 2J5QA 3ZXUB 3CVOA 4PAQA 3K9QO 3B48A 1ZM9A 2UYYA 1SVOA 2VRBA 3AUSA 5MHTA 3DBLA 5BXQC 1XL1A 2ZRFA 3K09A 3QMVA 4P4UA 3KAQA 1LPNA 1U8FO 2OE2A 4YMHA 2Q4RA 2QD5A 3C7KA 4F6CA 3O0TA 4HAWA 1PD0A 2GJ9A 3LP8A 3FAKA 3LFUA 1JXMA 2WEKA 3ONFA 5DLEA 3BD6A 4DDVA 1U2GA 3U31A 5A3SA 4BC1A 5FBRB 5EXXA 4UHFA 2VDJA 3RM3A 1QHIA 2P9QA 2GEKA 1SR8A 1FSFA 2VP2A 2Y1WA 4MR9B 3A58B 1XTVA 1OZAA 4FYMA 4G5RA 4KLNA 1L5ZA 3ETHA 5I7SA 4BXOA 2QM3A 5P21A 2WFMA 3KKEA 4YMSA 3ZH2A 3GRCA 2BISA 2CZCA 3PC8A 2FPOA 4KQHA 3GMSA 1P2VA 1JHYA 2Q6KA 2WIJA 2ZT6A 2VK4A 3EAFA 4RV9A 4MVXA 1V8DA 2Z6VA 4IUDS 4J0FA 3TZLA 1GTMA 3O4FA 4F1WA 3B7GA 2A59A 1OW3B 3T1TA 1BCSA 4JUIA 3U40A 1VPWA 1ZUWA 1GTL1 1Z4JA 3IH5A 4OX9Y 1NJGA 1W8IA 5FH9A 2YYSA 4DBZA 4OL0A 5CFNA 4MVJH 2HF9A 4MQFA 3TR0A 5C1BA 1OV6A 1U90A 4D9FA 1NFRA 2WIAA 2JIQA 1XTPA 3AMVA 1REQA 2X1LA 3NVDA 2I1QA 4U7DA 2UUAB 3L04A 3VMMA 3WXMA 1ADJA 1P4JA 2GUWA 1VJ0A 3CUYA 1R0CA 3CE6A 5EHGA 1EVQA 5JBQA 3AUYA 5HFAA 3UICA 3FYSA 1IXZA 1R6AA 5DNWA 3ZY3A 1XCBA 5DBFA 4M60A 1JKJA 1ODJA 2QD1A 3VI4B 3OLVA 4AT1A 2Q21A 4MCJA 3AR6A 1Y5IA 3G2LA 1M2OB 5FPKA 5IKMA 3ITNA 3MIZA 5KBYA 2C2WA 4KEAA 4FBMA 2PA3A 4BBAA 3COJA 2DHEA 1A8HA 4XWKA 4XWGA 1EFCA 2WIKA 4YLYA 1FVOA 2AXEA 4DR6B 1GGHA 3K2EA 1M0TA 2FR1A 1M54A 3LQ4A 1AU9A 1QK3A 4LPSA 4COOA 5GVSA 5EZYB 1ORHA 3L02A 4BHTA 4EUSA 1A76A 1ANKA 1QP7A 3QEMA 5CCBA 2FPWA 4WXPA 1W93A 1R3UA 3AB3A 1C50A 3LCRA 2IS1A 1HDOA 1EX1A 4O63O 4AZTA 3KQLA 2V7PA 5LA6F 3DVQX 3JQ8B 3QF4A 4RPJA 4XQCA 1S9HA 2YVUA 5HM8A 1U8XX 4GPIB 1H6DA 1L8LA 1GR0A 1UFRA 1FIUA 2GCGA 1TVCA 3NTRA 3OU7A 3DL4A 3V34A 2GAIA 3HUUA 4KK4A 5BWBA 5CDUA 2H4JA 1EUZA 1KY2A 1GJRA 4KDFA 5EUBA 1YV9A 2OA0A 4UTVA 3IVRA 4ZAGA 3B1ZA 1W47A 3NT5A 5ELLA 5TJ9A 3A37A 4B6GA 1E2UA 1ZINA 5BWLA 2JLYA 4KQWA 1V1MA 1ZIPA 3MJVA 4GPEA 1E92A 2H57A 3N2LA 4R0MA 1KJIA 2RGAA 4RL6A 3JRNA 1IRXA 3FPKA 1PWYE 2F9FA 4G85A 1L7RA 3LOPA 4EKIA 1UKYA 4F38A 1T2DA 5AVXA 2E3JA 4BVAA 2XR1A 4RTNA 2EC5A 1CS0B 2EW8A 3IP3A 2FX5A 2YIDA 1K9SA 3ETJA 3N58A 1KP3A 3UQZA 4PO9A 2ZS9A 4N0DA 2P67A 2J0SA 1R4NB 1YS6A 3KFXA 2X0RA 2ADOA 1GL6A 4Y2QA 1K1EA 1K8XB 3U5ZB 3DNPA 4WW0A 5BMVB 2D3WA 1N8NA 3B1FA 1P0IA 3FYCA 1Z33A 2GN0A 4YP1A 3AC0A 2F1IA 2AUMA 4HAOA 1EAMA 4E7OA 3S2YA 2BEWA 1G21B 2QTMA 3B3JA 4LMBA 3MWKA 2Y1EA 2JDIA 4DV5B 2C92A 1B7GO 1ZD4A 4TYNA 3NDJA 4ENVA 5IULC 4LQLA 3S99A 4H4CA 2Y6UA 1G5HA 1NSTA 2FPPB 3DEKA 1YB6A 1ULTA 2OCXA 3VR3D 2WUVA 4IWNA 3L5OA 4BFUA 4CKBB 3DZJA 1CU1A 3AY3A 5EIEA 1IBCA 2CLDX 1B93A 1L5RA 2H1CA 2I3ZA 4MDEA 1XEXB 4TWJA 1MJ5A 1GG5A 2YCBA 1USWA 2B4KA 3CF0A 5GMOA 4C78A 4FOSA 1X7DA 2IK8A 2K5UA 2CLSA 1VBNA 2IGBA 5T6BA 2HK7A 1WDMA 1MB3A 2ZEJA 4HDRA 3VSCA 3I73A 4RMJA 1A9YA 1ADCA 2H0RA 5TGZA 1ID8A 2A9RA 5DZSA 2JLWA 2P2GA 3ETLA 5G4KB 2WU3A 2V6MA 3DE3X 4UBKA 2BTEA 1DI0A 1OVMA 1X70A 4ECAA 2R6HA 5AYVA 521PA 4BLWA 3ILXA 3WWOA 3AFHA 4UVIA 3QWHA 4PTLA 3ZBPA 1ZG3A 2J5RA 5K3FA 1WF6A 1Z5NA 3DMGA 4I5DA 4V39A 3H16A 3ZY5A 3OOWA 1I1OA 1Y48E 3G2OA 3N2IA 1XU4A 4FOLA 4C3OB 2WOOA 2ZTSA 1BKDR 1J99A 3V80A 1Q7RA 3DR3A 3AEYA 1UK8A 5FWXA 3WNCA 4P86A 1RR6A 1KSJA 3AI2A 4WNIA 1BS2A 1FX1A 2WMYA 2HGSA 1PNTA 2JLSA 4Q05A 1FMTA 3AVWA 3KHKA 3VR5A 1CIJA 4G65A 4GYJA 4YECA 4F4DA 2X1HA 3AO0B 3DXZA 4YJDA 2C59A 2IEAA 4NU0A 1L8QA 1GY8A 3L92A 1EP3B 3OZEA 4XIIA 5DM4A 4EHJA 4BY9E 1CRPA 2G6BA 3SIXA 1X1RA 3U3RA 2VWQA 3BRQA 1TM4E 4BO5A 3EC2A 4BV9A 3PQ4A 4Y2HA 2R8EA 3SX4A 4RFSA 3DCYA 4KSYA 5AHOA 4QLBA 1G7SA 2ILTA 2P3LA 3UPDA 4DARA 4IH1A 5C8DA 5LZ2A 4ESHA 3CRRA 4IOMA 6ABPA 1UH5A 1NI4A 4PXAA 4GR5A 3ZE6A 4MHTA 5D5HA 1QB8A 4OBXA 4Q9IA 4D3DA 3IHKA 4EG7A 2CDCA 1Z18A 4H7PA 3TZQA 2R4UA 4F7WA 2FMUA 3KVVA 1THGA 1AMOA 3OWOA 3CX6A 3FOAA 1GCUA 1KJJA 3HVJA 1BMTA 1II8B 1M2NA 2OSVA 2RB4A 2BONA 4B6PA 4G0WA 5AKJA 2EF0A 3SF8A 2E82A 1C4OA 3RSSA 2C2OA 3IP8A 1ZM2A 3HUDA 1JEDA 2JIZA 3HKEA 5ENZA 2YJ3A 3LVFO 4OHBA 3ZWBA 1GTVA 3FB4A 5BW8A 2YXEA 3CVXA 3JQ9A 1P6QA 3VZBA 3ZLTA 2N46A 3ZQUA 4XVUA 4ZI7A 4BGUA 3PX2A 1FRVA 1Q2XA 3I23A 3PP8A 5DISB 4CFZA 5I7RA 1PZFA 2VKTA 1CVLA 5J2UF 1TLFA 1IIBA 2GYYA 3DVAA 4Q0MA 4REQB 1KRXA 1AK9A 1E0KA 1XP5A 4GQAA 1MORA 2PV0A 1EGQA 4TX1A 4YP9A 1OF1A 1SEPA 1RBQA 3FHCB 3HYNA 3RS7A 4ETNA 2R48A 3IDOA 1H1DA 2OPBA 1XVTA 5JXHA 3SYTA 3L0SA 1AO0A 1NLFA 3I9FA 1A98A 4EF6A 5JPDA 3LWZA 5T67A 4MYSA 2I54A 5LQSA 1ISMA 1UUFA 1VM6A 4TQ9A 4M86A 4YROA 4D4KA 1GZ4A 1EA7A 4WCFB 2W42A 4I46A 3A0UA 1TIPA 2LKDA 1IEQA 5E3JA 4DA7A 2OB2A 2PFGA 2ZSBA 3BORA 1G98A 3EEIA 3JZIA 2ZSIA 4OQDA 1M2VA 3CLTC 4MLZA 1SKBA 2CNWA 4H31A 2AR7A 5JS8A 4WPGA 4RJ2A 4IDGA 2SBTA 3SZGA 3OFND 5IFKA 5KKCA 4KI0A 2UV8A 1QIFA 1SVWA 1IBRA 4K0KB 3JATA 4AG5A 3LT2A 2A1TS 4Q6WA 5COQA 4RTQA 1CEQA 1JHRA 1PD1A 3CUKA 3CZAA 3OZUA 4R9SA 2PNJA 2HDWA 1YZ3A 1Y5MA 4DMUB 4POAA 2QN7A 1WMDA 1UZUA 2VHJA 2WKRA 1K8ZB 5FAKA 4PZ0A 4XH9B 5JS6A 4HBZA 2OHJA 4AKHA 3UCFA 3SN6A 2CXOA 4J94A 2ECQA 1TNDA 4OQEA 3R09A 4WLUA 4PC7A 3SDSA 5BSHA 3DTNA 3EB9A 5ICSA 1R6DA 3ZW7A 5K01A 4CMIB 1ML4A 2YCLA 1CZNA 2HMWA 3PS9A 2YXDA 3VYUB 2X9LA 1JIVA 2GKSA 3K15A 4TS1A 1X80A 2DT8A 2BTOA 1I0IA 3S70A 5HJ5A 2H29A 4KVGA 3DWEX 4GI2A 5DM60 2JGAA 3UHFA 4B7ZA 2C7GA 1TCCA 4BQEA 1OX5A 4NMXB 3WHIA 4HDKB 1WZEA 4QBIA 2XVAA 1XHFA 2AOUA 3KTAA 4BL5A 3RAEC 5BOVA 4HXGA 3ZDRA 1V48A 4DXAA 3N59A 3OBIA 3LI2A 4CLOA 1BH6A 2HZ7A 1CRWG 1DTWB 2WI8A 3DOJA 3EA0A 3ZQ6A 4TTAA 1P6XA 4OKNA 3RS2A 5BR1A 5K45A 4C08A 2O1SA 3HB1A 2IEBA 4DLNA 3IQWA 1KZ7B 1DPFA 2EAUA 3L1HA 1JPUA 4UD6A 3AUUA 5C1DA 1MEOA 2XRFA 3NBZC 3SYRA 4CLDA 4D44A 4JI1B 3AM1A 1PNRA 2YNMC 3SKVA 1M7HA 3F5FA 1XVVA 4NAUA 4RFLA 4GOJA 3A14A 3UHAA 3SJBA 5JTTA 5F7ZA 1IDOA 4IR7A 3QLVC 1TECE 4YV0A 3GLFE 4NBRA 4MB2A 4X5OA 2Q9UA 5HMMA 3I45A 2C4UA 2VP4A 4FR5A 1H1LB 3GNSA 4MUXA 4MI3A 4RV5A 5DN6D 2EP7A 1SA0B 3E22A 4U2CA 1C9MA 4CTJA 2ZB3A 4LHSA 1PZEA 2DFDA 2V7UA 4RDIA 5K2MA 3EPJA 1N6PA 2VTVA 1F9AA 3BM5A 1UM9A 4HRXA 4Q9KA 5EJIA 3FPJA 1JFFB 1N8TA 4PR0A 2GZ1A 2F6RA 2DUUA 2V4MA 3EXFB 3OM1A 4DLXA 3K0FA 3BSWA 2O7SA 4K2AA 3KJIA 3Q85A 3QRWA 4LE0A 1TPYA 4IJMA 3W9UA 2XTMA 3DFMA 2FZLA 2HCTA 2ZIAA 3CF6R 4JR1A 1C9JA 1UXKA 1CUJA 2G40A 3IIEA 4J9VA 4Q3CA 1OGIA 3GUUA 4Z9FA 2HHLA 5E9AA 2VRWA 2Z98A 1K7XB 2GNAA 1JJ7A 1VLQA 4NNOA 2WW8A 4NH0A 1FMLA 3EZNA 1FQKA 1K9VF 4UAVA 4ICIA 4X97A 3D0KA 1I7QB 2XQVA 4WI1A 1EE1A 4Y3UA 3UJBA 1X6VA 3H9QA 1YOBA 3AQ4A 4CDRA 4Z2AA 4G0OA 3FYUB 3FGNA 1CF2O 2QQ5A 3HVUA 2Z2JA 4UM9B 4LF9B 2PX4A 4ND8B 2XMZA 2O2HA 3LHDA 2ZAMA 1BFDA 2WD9A 1WG8A 3H8SA 3HXOA 3VTZA 1DC8A 2VH2A 3KDAA 4AN4A 1IK6A 4XUDA 2O3QA 4AWAA 1M2EA 1I3NA 4R3NA 2RGNA 3CT6A 4LDRA 4KQ9A 2GD0A 4A26A 3OWHA 3VTKA 4TYMA 5BSUA 1VBMA 4C21A 4WNYA 1LJLA 2X0FA 3C3KA 1J2JA 1F1JA 3LT0A 2HA3A 1O6FA 2XNJA 2ZSUA 3M34A 4XGIA 3IEMA 5D1NA 2HHJA 4IGFA 5ALDA 2AXPA 2ODQA 4KAAA 3WLKX 4F3RA 3IQZA 2QTBA 3GLSA 5JNSA 4XIGS 2OHHA 2IUSA 2BEUA 5J5VA 4MVJA 3ASVA 4FWTA 2QV0A 2W98A 3WJ2A 2AX3A 4M8SA 5BOSA 1EUCA 5HKLA 2VF4X 3NVMB 3NHMA 2VBIA 4YJ2B 4V0NA 4BZPA 2UUPA 4HQFA 5LUAA 1JW9B 1LQUA 2ZZMA 1S89A 2EX1A 1DKNA 4OFBA 4KMOA 5D86A 4D45A 3BWVA 1J8FA 1RFGE 2RSLA 5HCUA 3IDSA 3CW2A 2HMSA 3L84A 2X2OA 3LQRA 3MUNA 4DAEA 4CHGA 2JFNA 1R3DA 4MGZR 1OBVA 4OSOA 3GLGB 1XZDA 3WI7A 5KTOA 3L7IA 3VVMA 2BR3A 2QJTA 2GLXA 3KTDA 4EKGA 4YXWD 5A5VA 1PDOA 1TK9A 1WCIB 4DCPA 2NXJA 3NUQA 2NU6B 5D2CA 3COZA 3M81A 5KTNA 3G8AA 1ECFA 4NG5A 3VHXB 1VL0A 5FA5A 1TYEB 1CY2A 4MP6A 3U7GA 1P29A 1V16A 1C1HA 1J2UA 2XUKA 4RD2A 4H7DA 5D87A 2UYQA 5IM4F 2ZBGA 2ZE7A 1O4VA 1CUXA 3D5QA 4U6NA 1NW4A 1CZHA 5D6OA 3FDIA 3ZGOA 4B48A 1TO1E 4AJJA 3VNUA 2YHUA 2VCYA 1T25A 1VLMA 4K7JA 2BFFA 3CJTA 4HWKA 2V7TA 4A3SA 8MHTA 2LKCA 2GJ4A 2WIBA 4JJIA 3IBTA 3C4QA 2BM1A 3TAXA 3FBGA 1SG0A 2G4VA 5FDFA 5IWAB 1MOQA 3R0IA 1Q3KA 1X14A 2GZ2A 4QFCA 3WGUA 3A6HA 4ZVNA 3ZYCA 4B6OA 5DOVA 4D4LA 3R0ZA 4N6NA 3CNHA 3DTVB 5IAEA 4EDHA 4JU8A 5K8UA 4ETMA 4XVRA 2JAWA 3RS4A 1M8KA 1QONA 3DKVA 4JBHA 3WLOA 2RI6A 4OHPA 4Z4HA 2B8EA 3IP1A 3EZ6A 2A0KA 1PK7A 1R9NA 2COKA 2RARA 5ERYA 4AKEA 3NDBB 2WG2A 2J9ZB 1Z6AA 2QMYA 4OK6A 3CRNA 5D5QA 2DUMA 3VKFA 4FGZA 1HBJA 4L16A 4X71A 5U1PA 4A7PA 4E11A 4LEIA 4K40A 1G20A 4XWYA 5B55A 2EX4A 2R6JA 4WZBE 1IXRC 1YOVB 4BX0A 1Y3DE 3OCJA 2GRAA 5TF4A 5KQMA 1GM5A 4YRRA 2YL2A 4JLKA 4NVRA 1NT2A 3FNRA 5ERXA 4EGAA 1V25A 1T8YA 2VJPA 4IV5A 4QU5A 5LBIA 1MIHA 2P30A 3OO1A 2W00A 3ZWDA 4Z49A 2H7VA 1UJ6A 4L27A 2WE8A 1N2CA 5CW2A 1YDWA 3HR7A 3DBIA 4EDFA 3M5PA 3RTBA 1D5CA 3WL7A 4MYUA 4NIMA 2MSKA 4PHTA 1E5DA 4DIDA 3OM9A 3LX8A 1LCIA 1RMTA 1DX4A 1MVOA 4TYWA 4HGOA 3DO8A 4U8HA 4KPUA 4RQBA 4BVHA 4D92A 1Z36A 4EJ6A 4Q9NA 4MMXB 1S02A 3MAJA 3KR2A 4QLOA 4NZPA 4G89A 5AXCA 3I12A 4J6EA 2AKYA 3DUFA 1LTQA 4HX5A 1SKYB 4HY3A 4Q1VA 1V5GA 2I4OA 3TXYA 3VH2A 4G8BA 1W5EA 2ODEA 2L2QA 3IAS6 4Q3NA 2QYOA 3BUSA 5HR5A 4DQKA 5E6SB 4A0RA 5BSGA 3B38A 3IKLA 4L4RA 2Z4TA 2QU8A 1EFPA 4D1YA 2HUPA 3VBEA 1T2NA 1BW9A 4ZTZB 1OOEA 1K97A 1TFUA 4KE9A 4KYUA 2WYHA 4JUAA 1E9BA 3RH0A 2I8LA 5L3QB 3EQ6A 3WYNA 5AW8A 3EXEA 1CUUA 1E3EA 2AFHB 3O03A 1O77A 2EJVA 3AIIA 4XX0B 3ZHVA 2A5LA 3A4YA 5FB3A 5MDHA 1PLKA 1E5TA 1XEWY 2HAEA 3GJRA 4KLAA 4JWTA 4BNTA 1D2EA 3QSYA 5HZMA 1GUAA 1ZD5A 2H1VA 1BGXT 5EG5A 4X8MA 3RVLA 1E2PA 5B37A 5TPWA 3V7NA 2I4TA 4BCBA 4NV1A 3T9AA 3HY4A 4RZQA 4G9EA 1L4UA 3K3PA 3UFXA 3VSBA 5I01A 1LF0A 2P4QA 3TTXA 3IO5A 1GVNB 1KKMA 1AZWA 1T9KA 2DQSA 2QR5A 2CYBA 1VE7A 4URUR 4BNNA 5ES4B 1L7OA 2DQYA 1TKRA 3GF4A 4GMFA 4M1TA 5FTNA 3V9PA 3WL3A 4F56A 3DPSA 4P38A 5KDDA 4NCBA 1KVRA 1H3NA 1PT5A 1R74A 4LY3A 3R24A 4OHUA 3BKXA 3P4UA 4TTSA 3WL4A 4D8XA 1JVNA 5AVUA 5JU6A 1L5OA 4LSGA 5J2TA 1FXWA 1X1EA 3NH9A 4JX9A 4ZEMA 1L7QA 3U4QB 2DSNA 4B8WA 3LWDA 4UFPA 5E9WA 5IEBA 1QH1B 2QN6A 4NU6A 4X90A 4ZT6A 4C7OA 8ADHA 3DDCA 1PLLA 3KD3A 4M98A 4N5IX 5KEIA 3LLSA 2IIBA 1KDZA 4AAYA 2WFAA 1P5HA 1Z45A 3E7WA 4K88A 4CMHA 3LT4A 4RZIA 1BMQA 2ZWMA 4EABA 3O73A 1OWMA 2DY1A 4P34A 5C37A 5EQDA 1K7EB 4N3GA 1Q7TA 1XU9A 3ECSA 5B6IA 5BT8A 5FOQA 4ZQFA 2Z3ZA 3AOGA 3CR3C 1GP2A 4YUXA 4NFYA 3MTJA 3KQVA 1HYEA 4QGBA 5K3AA 3SC6A 2I67A 4Q93A 5C7YA 1Y6FA 4FEGA 4ZWNA 1AGPA 2AA3A 4ZCPA 4DTCA 1GFSA 3W0LB 4OAOA 2IHUA 4FXPA 4NNJA 1QK5A 1N4AA 5C5DA 1VLJA 4L95C 4I19A 3C6KA 3PFGA 3BD7A 3HXLA 5FL7A 4IIJF 3RTGA 1PIWA 2VSOA 2PUAA 1RU3A 1LPPA 4BVJA 3EXHA 4DLTA 5TPZD 4RPGA 2AR0A 1SBNE 2RJ3A 3PC6A 4G86A 4XRGA 5AICA 4KRFA 4FHCA 4Z0HO 2WTXA 2G8LA 4PC3A 4M8IA 2B25A 2QTAA 3I0ZA 1TQ8A 3VA7A 5EGNA 5BQ3A 4RGVA 2IYPA 3DNMA 2HNBA 1FYDA 3U7FB 2BP7A 1AF7A 3U1VA 3TW6A 1RRCA 4N76A 2P2NA 3TD6A 3G9UA 4BFVA 3LNCA 3Q5EA 3Q12A 3OZSA 3WTBA 3HZOA 4O4IA 4MS1A 6REQA 3PRYA 4PTYA 5A6SA 3GUZA 1C30B 4L73A 1UKEA 1VMDA 3PBKA 5F1YA 1AGYA 4FMPA 5EE5B 2YVLA 3E53A 1YO6A 2QZ4A 5K03A 1ZN7A 1JIUA 2F1RA 3PQEA 1XMSA 4HWSA 4C14A 3MT8A 2PD4A 2IZ5A 1PR5A 2AQIA 2BFCA 2H3EA 2CLHB 3N6RA 2ABWA 5JYCA 1E2IA 1Q92A 4GYWA 1E2JA 5G3ZA 3WK4A 5JI2E 1JHDA 2FR8A 2UXCB 3CZ4A 3R3SA 2NUBA 5LP6F 1LK5A 4OKIA 3EWNA 4DMCA 4DN6A 3HGMA 3PI7A 5K09A 4WLNA 1AM4D 2VT7A 2RGXA 1E2MA 1HA3A 2IPNA 2RGCA 3C3EA 1KI2A 1DSSG 2RHGB 2J59A 3CCCA 2R87A 2F9MA 1SXJA 1Z26A 5CB4F 2OBLA 1U7WA 3PEWA 3GJXC 2PV7A 3RSQA 3PC2A 5DXFA 5TQ0B 3JW8A 4PHHA 4UZEA 2IVZA 4DDTA 1ZCAA 1E1QD 1U9CA 3HKBA 4X44A 1DXQA 1EB8A 2PX2A 1DPGA 4EG0A 1ZGHA 2VJMB 4QG7A 1HE3A 2BMVA 4BLSA 1G19A 1BN7A 1E6KA 1MC5A 1J8YF 5F3WB 1PFVA 1SC3A 3F3KA 1W6RA 1KPHA 4AURA 4GW3A 1KPIA 1UMDB 2CYAA 4L8WB 1AIPA 4YJGA 3TPCA 1WAMA 2WT9A 3NS7A 2RHLA 3TD9A 3FSRA 4CMKA 3IE2A 4RCVA 3UAWA 4ZK2A 1TQ6A 5HE9A 1AKVA 1GPLA 1XGKA 3QEMB 1H2EA 1MZVA 4FDVA 3ROQA 2AW5A 2GBCA 4WBNA 5IVDA 1XTTA 1TYDE 1J00A 1TJ4A 3NPAA 3C3CA 1FMCA 2G72A 4V0OA 4DL9A 3QF4B 2Y77A 1V43A 2DVMA 4TT3D 2QTHA 1DRJA 4O33A 1LZLA 1NVVQ 4EARA 3MMNA 2IVFA 4DQXA 1H6AA 2PWAA 2OBNA 3MFQA 4LCBA 2X7JA 3R4VA 2DUJA 4HYYA 3EGDA 1IG3A 3IAS1 3T3EA 4IHAA 1P0QA 5DEIA 2PGAA 3L0YA 5JAMA 4MJ3A 1PO7A 1OKKD 4LK3A 4EVRA 5ALRA 4RK1A 3ZV7A 1QVRA 3KALA 5JQGA 2HADA 2Y4OA 3WK7A 2XF2A 1D2CA 1XEFA 1FS5A 4UEQA 1VJ1A 5BUSA 4JCCA 1T29A 2AZMA 2B34A 4DAOA 1A8IA 1JVSA 2WWWA 4KVAA 5AVWA 1VSQA 5I8WA 3ML1A 3RBZA 1I3LA 1PVVA 3R2JA 3MOSA 4M9RA 5CXSA 2AN1A 3FBTA 3W7VA 2YR0A 3C3DA 3GEIA 3BRWD 4N6OA 3TVYA 3KKLA 4Q3BA 3OIGA 1TEXA 1ZX1A 5EWMA 3I9MA 3TR5A 1ESNA 3NRBA 5JWOA 3ROMA 1GPYA 2ZYWX 3AEXA 3EHEA 1ENZA 4AJ4A 2R60A 1OHHD 2B4YA 3JD4A 4M0MA 2GF0A 4ZCMA 1DRUA 3QTLA 3V33A 4BKQA 3U7IA 4BQRA 3RD5A 5B3LA 1KWKA 2ZUEA 1PZXA 3TW8A 3U7QA 1A5TA 1Z2DA 2C2BA 2JK0A 2CZGA 3N0RA 2WZCA 4O4HF 4OYYA 4E70A 4TKZA 3IVAA 4G5FA 3X1WA 3BMCB 2A86A 1U7ZA 2WINI 4IDOA 1TC1A 1X7YA 3L6DA 4ZOBA 4BO6A 4DM7A 4BZWA 4UCQA 5B7NA 5AM5A 4ZXFA 5THKA 3VNAA 3EVNA 4Q4DA 1UFVA 4MUYA 4JP1A 1JILA 1Q5PA 1NY5A 3DFZA 4YCCA 2HMVA 1E3DA 1ESMA 2BM8A 2W2OA 2G8NA 3UAYA 2CXXA 3WLEA 4NONA 1E2NA 4PYRA 5B58C 2DQZA 3N8IA 5HG0A 5KWEA 3H0CA 1Z08A 5L9AA 3F6PA 3OICA 2XYQA 4FDAA 4C0HA 4YAEA 2BELA 1O4WA 1T0UA 4ZP1A 3ESBA 1L7AA 2WZBA 2G5TA 2XB4A 5I7WA 1G5QA 5IU6A 1HDYA 2H65A 1FUIA 3ENWA 4CM6A 5UKDA 1N0IA 1YFKA 1WE2A 3DLIA 3WYGA 3FOZA 1B76A 2Z4SA 2VXBA 3G3EA 3VR2A 3ZU4A 4PIPA 4ZDIA 5LIPA 1MW8X 2VXYA 3ULKA 4URYR 2IODA 3A1EA 3HV2A 1PK8A 5E3HA 4DNXA 2VSXA 1DAIA 4KXXA 2OAQ1 3GQBB 3L49A 4F5YA 3L8CA 3B1YA 5AOCA 1YDMA 1DCKA 1I10A 5CDHA 1X8JA 4KK3A 1N6KA 1UJMA 4MWDA 3VOSA 4XWWA 1NKSA 2WWVD 1JAHA 4KV7A 2GUGA 3N2KA 4YUYA 4FTWA 1IQ0A 2WG0A 3IC5A 3L8ZA 2VA9A 4PO1A 5KSYA 3VU9B 2RGBA 3O74A 3ZWOA 1USGA 1EWVA 2Q1XA 4Y1GA 4ABYA 4BLUA 2B4TO 4MS4A 3FVWA 2FEPA 1WXEA 2X4IA 2JLAA 3PEVA 3QWAA 1SHZA 3DONA 2BBTA 3N0TA 4YUAA 1AO3A 1B0ZA 2I7DA 3KL4A 3P9QA 1Q0HA 1TA0A 5C8YA 1Y8RB 1YAHA 1FDUA 1ORIA 2B6NA 2JD2A 2RC5A 4CN9A 4D5EA 3EXG1 3OO0A 4JQCA 2XB8A 4CODB 3BGSA 3PFKA 3PTZA 4MI6A 4WBXC 3S7TA 4H4EA 7YASA 4FQ7A 1DWOA 3VX4A 1G5RA 2JFXA 2GCOA 2NUPA 3AM3A 3LXXA 3QLEA 4FHDA 4BJ1A 4E0BA 2SCUA 5HKBA 1GPBA 2YWHA 3JWHA 4C6TA 1RYFA 4NMMA 1P19A 3VOAA 4CJXA 4HGZA 1XRQA 2QM0A 3MJ4A 5KQGA 4FVTA 1JDBC 2GXSA 4TMYA 3F7OA 4E5YA 1YDHA 5HIJA 3WGGA 2LCFA 3QELA 5E1OA 3TNDA 4ZI7B 4YMLA 1VYTA 4QX6A 2PZBA 4DBVO 3D4BA 1GPUA 5KPDA 2ZWVA 3DVAB 4X3PA 1CETA 4GO1A 2B0JA 5CM2Z 4X63A 4G81A 4MP8A 4ZICA 5E1BA 2C84A 1JWBB 2W6JA 1GZVA 1J0AA 3RIMA 1NJSA 3RHFA 2XAUA 4BJHB 5JANA 5MN6A 5G0TA 2IIQA 4MV0A 3R3YA 5ARBA 4MQUA 1GSAA 4IZHA 4CNQA 5FD8A 1VRVA 4OQXA 4W8GA 2PX0A 4DLSA 4JBIA 2IOHA 4O59O 1QQ7A 1KI7A 4KXQA 3OZVA 5A5FA 3QBVA 2CJWA 1E3QA 4X94A 1GOTA 3DE6X 2IX9A 4QPCA 1HKUA 2AB0A 2PJDA 1Y6QA 2ZRCA 5FPYA 3O2JA 3I04M 3KJNA 4FM9A 3VPBA 4AS3A 3AERA 4QQNA 1SUBA 3KYDA 2ZIXA 3EDOA 3L43A 4HSGA 2V6BA 3S4YA 4DDWA 3F4BA 5EP2A 5KJ1A 1JA1A 1JXOA 1Q17A 1P1FA 2R8OA 1VCIA 3FW1A 4NJEB 2W43A 3NTVA 3OLXA 1PTJA 2GLTA 5DT2A 4NCJA 1WSDA 2QW8A 4H3VA 5FJIA 1LDBA 3EAQA 5ELMA 5F2OA 4D8WA 4DLBA 4IQGA 5IYZB 1DELA 1PJSA 1QCYA 1WULS 1Y9EA 2XDWA 4W1QA 5TR9A 1WY7A 4QNRA 4WOJA 4IHJB 5DNVA 4PLVA 3U3DA 3WE7A 4BTEA 1PKEA 1ZKMA 3OG9A 5KNDD 4U2GA 2R25B 1W35A 2CL5A 3VVCA 2Q5EA 2LCQA 1W7AA 3JSXA 1E2KA 3LLUA 3DKKA 4P92A 4WKCA 4YQEA 3UC5A 3OMLA 1IY8A 4DYDA 5IDWA 1M1NB 1WM1A 2J1LA 2WVGA 2OFFA 3AVPA 3UGJA 5F78A 5FPHA 5KYXB 3JWJA 3TTYA 1JT2A 1B2LA 1F0NA 2XNHA 3M4YA 4HQ6A 4U7TB 2QL7A 3SBEA 2XMSA 1P0PA 5IF9A 2H6EA 2PAAA 3CGWA 3EYWA 3QKRB 4BFCA 2YX1A 1T9CA 4QZVA 2QR3A 5HIKA 3TF5A 3N76A 1UPXA 5AJTA 4DMFA 5CFLA 1A50B 2DF8A 4Y9SA 1ZU5A 1JS1X 2MSDB 4ZVUA 1NC1A 4KWEA 3RANA 1ZD8A 2MSLA 5KJ6A 2WDPA 2I2FA 1G3MA 2BGKA 2I66A 4ZCSA 3S5UA 1JG1A 4IEIA 1RAAA 2CXNA 2YBDA 5EJMA 3AKZA 4QPDA 3PJGA 3H1EA 4XWTA 1B73A 4JI4B 4DF3A 4A2CA 1FE8A 2ET6A 2GA8A 3CNOA 4ENUA 4JU9A 4LECA 3DE7X 4EYEA 2P4UA 3AINA 4PZZA 2ODPA 1P75A 2QZJA 1WD5A 1TT7A 4HGYA 4MDYA 1DC4A 2IHYA 1XZMA 3B5JA 1NP7A 3DT8A 4RMHA 4TSFD 1TVKB 5H3HA 3C6MA 2EFJA 3K4HA 5DWDA 3SPXA 4CKXA 2UZ4A 3JTEA 3LC2O 1TCVA 4DG8A 4JYCA 1LRKA 1GITA 1L3IA 1HDEA 3U60B 1T8UA 1NN3A 3GGCA 1W34A 4DSZA 4HDOB 3C3AA 5C34B 3UMJA 4D3SA 2XZLA 1V6CA 1GXSA 2P9ZA 1XA0A 4OHMA 4ZKEA 2VP0A 4PAOA 1HURA 3GRYA 4R8RA 4ND2A 3Q7QA 3PUYA 1KAGA 2XQIA 3LIIA 3PNPA 4W6ZA 1KDYA 2D6FA 3R5XA 1ST3A 1G8SA 4BC0A 3AFGA 2DEUA 4FPXA 1WU8A 4MUNA 3OX2A 3A1VA 1ZOSA 2I4RA 2KQUA 1QF9A 1XQ9A 3NLLA 3OQBA 5LQAA 1BXGA 4I4NA 2ZJOA 2Z9BA 4CM7A 1W5TA 3V32A 3G2MA 2XSZD 3JVEA 1KEWA 4A23A 1IHDA 1XDSA 1ZAKA 4B5LA 5BQFA 1KKLA 1T2AA 2CLKB 2VO1A 3D1JA 2Q4DA 4HLUA 4OAPA 3WIVA 2AI2A 1E7QA 2J6HA 1SAYA 3SK0A 3R3UA 2R1ZA 1Y9ZA 4OIMA 4D8VA 2HEGA 3RF6A 3WA6A 3EVTA 5JSZA 821PA 5MF6A 5LXTB 1JSRA 1XZNA 2P5TB 3O1IC 5SZJA 3H86A 1R8YA 1YRAA 4WXRA 1ZWKA 1JE0A 3WGTA 3SIWA 4CL3A 5K8CA 2G9NA 1CR1A 3QHPA 2JFUA 4ID9A 3LPMA 4GQBA 3QXSA 4I81A 4LHXA 4EBFA 5B12A 2O19A 2GTIA 1KPGA 1N6OA 3AK4A 3C3MA 3IRUA 1P7VA 3OAAD 4GOOD 3LUPA 4TSRA 2WD8A 4J43A 4W9NC 4EKEA 4FFWA 1Z47A 3IDQA 1MRSA 2X15A 4PSCA 1MAUA 5IFLA 1SUWA 1RZRD 2G4LA 3E6AA 4AMZA 2DY0A 4BBPA 1VLZA 3R7FA 2FSVC 1H5UA 3JCZA 3OSZA 3R9WA 4R54A 2HWWA 1VQ1A 1AKYA 3OHSX 4RDCA 1SPXA 4YHBA 5AVYA 2BEUB 3AL3A 3SF0A 5CURA 3R7WB 2IW1A 3UMCA 4Q7QA 2DFTA 4PIMA 3G8DA 2PT7A 4R1TA 1W0JD 1Z4KA 1OTXA 2OQ2A 1DFGA 3BQNB 3DTYA 4HYEA 4YASA 4EA7A 2DHQA 2KJQA 4L51A 4BS9A 1CJVC 1WDWB 2I6QA 3TLCA 1QPGA 1NDHA 5HPYB 3OJWA 2BDUA 1X7GA 2A0YA 2FN8A 1J0DA 5TQ2B 3TQOA 2ZM6B 2HYIC 2NZ8A 2I78A 2NVWA 3C15C 3KAKA 1IPHA 3HL4A 1ODFA 4MV4A 4XKJA 2AN5A 3TJRA 4ER6A 4ZOEA 1C14A 3OETA 1PR3A 1BU5A 3Q5DA 5FJJA 5KJCA 2O8DA 2R11A 4ARSA 5EPOA 4Z9YA 3DFKA 4JOQA 4DEVA 4AY5A 3LCMA 1L4HA 2QRMA 2YFHA 1JQDA 2YJNA 3GT4A 4UQPA 5ALSA 2HHHB 3DMRA 3MQFA 4P54A 3WDSA 1NRWA 3T95A 1R66A 2H4YA 2HMYB 3AR2A 1QO9A 3AGPA 4FOOA 4JOCA 3DEYX 4NYMR 2AT1A 4WOKA 1YTUA 1L7VC 3A1WA 5AI8A 3COPA 4ZA2A 5EIBD 2PR2A 2XT6A 1YBVA 2OFOA 3DVSX 2H7XA 2HX1A 1H94A 2Q2VA 3DSRA 4V0LA 2P65A 3DT9A 3IDAA 5LFAA 5I8ZA 2O7VA 3NV9A 3LC1O 4L02A 4PINA 1EGMB 2ZJ8A 3SDBA 1B8PA 1W0KD 1IEVA 1MHPA 1ZGBA 3GFGA 3AHHA 3GBVA 3FMIA 3CS3A 3E7FA 1NJ2A 5FOTA 4Q4AB 2IUYA 4YAOA 2AZXA 1DFHA 1BKYA 1PQUA 1QDLB 1DDOA 3T3GA 1NG9A 221PA 4YY3B 4OQ4A 3CIOA 1MVNA 3QJ5A 4DMRA 1KS2A 3FF1A 3QBJA 1X39A 1YDEA 3QXCA 3A28A 4E2XA 4UPEA 5A3RA 5JC1A 3OPYA 4MGIR 4CDNA 1E89A 2DLCX 1FFYA 1DAPA 2X4DA 3KD2A 1MW9X 4YRDA 5H3CA 3N2EA 5FEMA 1ADYA 1WHSB 5FEUA 4UNNA 1AN9A 2DQ4A 1JG2A 2BSAA 3GA7A 4H1TA 4IJ6A 1RQ7A 1R4MA 4X8LA 5G53C 3VUEA 4ARAA 1WDKA 1FFHA 3LY9A 5JWHA 4R3UC 4E88A 5K0NA 4YJ3F 4P32A 4M8LA 4Q4CA 2HWKA 1OY1A 2ONYA 1V3QE 3C3YA 2V9CA 1A8PA 3CQ9A 3FVQA 3PD1A 3V7WA 2BMEA 5G40A 2JHGA 3C8UA 1YONA 2JBHA 3BE8A 2CMDA 5K5EA 3M4XA 2CD7A 3H4MA 1ZP6A 2XJ4A 2Y1CA 4IIUA 2QIOA 1X3SA 3QLUA 4R41A 3ZJYA 2V7EA 1WUHS 3TX2A 1E1LA 4AY2A 3GFFA 1GN8A 2JFGA 3GP8A 4OEHA 2RB5A 3HP7A 3KEOA 4ARUA 4EPVA 1RWNA 3DAPA 3KJQA 3N7TA 4C30A 4BZXA 5AJZA 1Z5WA 4YA6A 1RHKA 2CK3D 2JAQA 1SK8A 3LW8A 4QYTA 4AUMA 2MMCA 3CKMA 1U9IC 4M0CA 1BD4A 3QH4A 4TLLB 2BI8A 5T5QA 3TLEA 4EI9A 4LFBB 1DX6A 1DU4A 1AQJA 1DLIA 2ZTUA 5EJFA 4RJLA 3NOXA 1TUEA 3I92A 4FKZA 1CS4C 1FUYB 2RAPA 1NMEA 3LPNA 1KEUA 2NSDA 1OAOC 4G67A 4ESVA 3JYPA 4BB5A 4NV3A 5JBIA 3W3AD 1BW9B 1J70A 3WKCA 4CKEB 1S3SA 5H80A 4ZV4A 5HF8A 5BWMA 5B7QA 2BGGA 2BBSA 1RIFA 4XAQA 4QFBA 1HG1A 4F85A 3JARB 2B8NA 2D5LA 3OFSA 1G38A 2QM8A 4U7GA 3ROFA 1E4VA 1O3YA 3DFIA 3ED5A 3Q4GA 4HEHA 2WJHA 4NBUA 1ZJ5A 5AK0A 3WIUA 1Z9BA 4AJNA 2OOKA 4X6XA 4K3UA 4FD2A 2IYRA 2PMBA 1AKUA 1DINA 2GRUA 2C31A 3R5HA 3W2IA 1ZJ6A 4AO6A 1G42A 1PHRA 2BLLA 3LKDA 3Q72A 4ES6A 3RVQA 2PH3A 3WLIA 3ZVKA 2VXCA 4C4RA 3K7EA 4LYAA 5A7FA 2X9QA 3OFNA 4HF7A 3QU7A 4K8OA 1W8DA 4FLEA 3D7NA 5TE9A 2N1MA 4LFCB 4KAXA 3BULA 5FKJA 1ESCA 3UXYA 4PSAA 3N2ZB 5DP2A 4GHWA 2QM7A 1NKVA 1YU9A 3LX6A 5ARDA 1DAKA 4C2AA 4DLUA 1P7YA 3P9ZA 5FO0A 1MT0A 4FILA 3OQIA 3WYCA 2V6IA 3ZTYA 4OF4A 5ITWA 4S04A 3UAXA 3AOEC 3PGJA 2BTQB 1LV8A 1N2JA 2NG1A 3D0QA 2JIMA 3I53A 3GFRA 2HWYA 5A1JA 3IKTA 3W5VA 1VG0B 3BZUA 5LMCA 1VE1A 2VNHA 4ND5A 1CVIA 3CISA 3VSAA 3FTPA 5C18A 4RJIA 1FB5A 1CZKA 1NRXA 3Q6MA 1CR4A 3PUVA 2C94A 1MBZA 4K9OA 2DFKB 2DBYA 4BNXA 3A1NA 3CLVA 4YJHB 5CIWA 5ECDA 5IX8A 3WA7A 1R6TA 1RQGA 4OU4A 4TMTA 5A4MS 1HDIA 4FT2A 2AK3A 2VIIA 3HP1A 3KWMA 4HGRA 3H1FA 4I1RA 2X2EA 4D9CA 4HR7A 1UJBA 4M9CA 4AO7A 4Z4EA 3A4VA 4PSDA 4XPIB 1CJKC 2PY6A 2R96A 3LX5A 3U7JA 5HHTA 2Y66A 1POWA 3ETNA 2ECOA 4AF8A 1K7FB 1KZ4A 1ONBA 5CT6A 3MCVA 5ALGA 2KBEA 3M4ZA 4J2OA 1LH0A 4UW9A 4JQSA 5TXGA 3EZXA 4B45A 4F3KA 1OIXA 5FWDA 3BMXA 3EXAA 4LZOA 1SRQA 3DTTA 3HV0A 2J9FA 4F5EA 2YWFA 4QTTB 3ZEAA 1ATIA 3V4SA 5JAUA 1XNHA 4H35A 2OUKA 3QW4B 1LFAA 1BCRB 3I9V6 4JGGA 3SG0A 3N6XA 1PEKE 3LWBA 3OEHA 3I01A 4PCUA 4TYQA 4UHBA 2OD2A 5DN6A 3DPUA 1N34B 2GD6A 2RKOA 2WTNA 1UOQA 4L4XA 1P1CA 1XCPA 2OV8A 2AEMA 2CUNA 2J3HA 3H4TA 4HZUA 4N49A 3SBDA 1YSCA 2NZ2A 2ZBDA 3CX3A 4QGFA 4FNAA 1YU6A 2XD4A 3S6JA 4NP6A 6GPBA 4QULA 4LMPA 2G0TA 2ZSEA 3PNBA 4MVJF 2JJMA 1Z63A 5FUYA 1LNSA 1I7LA 3T9BA 3U4HA 1MZPA 1BIFA 1TAUA 1L4KA 1L5VA 1Y1LA 2GPJA 4OB6A 4L8YA 4H9GA 3PX7A 1O96B 4U2BA 1YI0A 5ECYA 3EEBA 4P5EA 1LKZA 4R2IA 1YDGA 4CXMA 4RADA 3I4LA 5DWQA 2ZYHA 1M6WA 3A31A 2AZ4A 3BEOA 5AKLA 1SCNE 4AECA 1E3IA 2IY9A 4GPAA 5BYAA 1U02A 2GBGA 3K9GA 3WBBA 4S2EA 3F8TA 3FHOA 5A7HA 3FPGA 6PFKA 2AVDA 4Z0TA 1IH8A 4X95A 2IA5A 3H2KA 3GX1A 3HN2A 4XCVA 5DOZA 1CF9A 3P7MA 3EVGA 4ZTBA 4F2WA 2JHAA 4KH1A 3EG9A 1KRWA 4DQDA 1PR6A 1FTGA 2EGHA 3P0FA 1Y98A 3BBPA 3LDUA 1OYVA 4L8VA 3D3NA 2OCDA 5ILQA 4RA6B 1I32A 1PX0A 3BIFA 2QY6A 1PT7A 2GAJA 3C1OA 4GOXA 5E9JA 3RHTA 2XQJA 4CR7A 4DJTA 1NVDA 3BWYA 4E5VA 4CG1A 2CSUA 4CUZA 5I9LA 4P2GA 2PU7A 1Y3AA 1O87A 2FYTA 3EY4A 2J0UA 2IYOA 4UM5A 1PS8A 4FC6A 1RRPA 4ZVOA 4RIIA 4YRIA 3M3DA 5H0IA 3ZXYA 4Z6KA 3LQYA 1M8GA 2EZUA 3G23A 2JLZA 1A71A 3VO2A 4ZYXA 4PY2A 5EYPB 1JFRA 1JFSA 4EEKA 4O0MA 3IQGX 1NVFA 2JVIA 2Q27A 1G3RA 2CNOA 1CUFA 2QW1A 3KRTA 1NG1A 3FLMA 3JALB 1FP6A 1Y82A 4RC9A 4Q9HA 4R5HA 4A8TA 1S2MA 3IBGA 2OY0A 1X38A 2RK3A 3WAGA 4L4SA 1LLUA 5F7JA 1I7NA 3RDPA 3E1KA 4X9XA 1NBME 1JDJA 2HF8A 2J5KA 5CNJA 4EL0A 2IIVA 1VE6A 1ZI9A 2O0HA 2Q5OA 3HCNA 3S2SA 3CZMA 1XCMA 3UMFA 3W7BA 4X8HA 3EIXA 3PIDA 1NNI1 3C8MA 5JS2A 1DXYA 1VBFA 3CSSA 4G5HA 3HDTA 1KO5A 5JQGB 5K4GA 1P7WA 1KYQA 2I7TA 2O7QA 1G59A 1M6VA 3L8EA 5JI3E 2YWBA 3B1WA 4QM6A 3WRVA 1HRKA 3L6BA 4OB7A 1CUYA 2MCFA 1CZOA 3AEQA 4CEIA 1E2EA 4GNRA 1TGYA 2YH2A 4EAQA 2Z9DA 2CHVA 4U0KA 3KOMA 1ZSVA 2OGZA 2P8JA 3CC8A 5D3MB 2XGSA 1AXEA 3VDXA 4Q12A 1M0EA 3M2PA 1GTZA 1E0SA 3NUZA 5BPFA 2WC1A 2GCIA 3K6KA 3LUFA 1P17A 3WS7A 4BDSA 3WSTA 1WQ3A 1S2IA 3UWMA 3I5AA 4KX5A 3HB4X 3ND8A 1OBHA 2Q4TA 4DDUA 4M4SA 4NR0A 4OM8A 4BMPB 3SI7A 3U7QB 3SS8A 2Q0SA 2ZRHA 3OTOB 1J8QA 3GVXA 1JIQA 4D98A 1F4PA 2QN3A 3ZV6A 1WUYA 1EQAA 4PLFA 1VDMA 3DPIA 2P62A 4M1MA 4XB2A 3MBOA 3H5RA 3CRZA 4WVLA 2GBLC 2BW0A 5BNTA 1P5RA 1E1MA 2VDMB 3UB3A 1CVRA 3ABZA 4DT1A 1YQXA 4HP8A 1JQLB 5FFFA 4GD3Q 5ILOA 2R7KA 4U6SA 3CH4B 4G8DA 3E84A 1BC5A 4JLUA 4MDHA 1Z4NA 2C7VA 3IP7A 1KI6B 4LZJA 3T15A 3DGEC 5H81A 4BE7B 3EUFA 4EKNB 1JDVA 4I8IA 4J91A 4BNJA 1YZFA 4KIWA 4QRIA 2Q1YA 1C7FA 4Z99A 5JR3A 3HK2A 1E2BA 1M0WA 3OPQA 3W5HA 4EHHA 2O8BB 3PKIA 3NKLA 3RYFB 2ZFUA 1IQUA 1S7CA 1E1YA 4XVQA 4BPRA 3FSGA 1ZM4A 2ZU6A 4YAIA 2PZJA 1H2FA 4QYIA 4JY7A 3GLVA 3K94A 3L4BA 1YBMA 3G1WA 4M0DA 2OQVA 5F52A 4Q9AA 2I2DA 2GN2A 5J4KA 1LW7A 2ZI6A 1KZ1A 2F62A 4FU0A 2Z43A 2A9OA 3R3WA 5HMLA 3NFRA 4BMOB 1ODIA 5BNZA 5J2TF 4M7RA 1SELA 1FXWF 1LS1A 4IDFA 4LF5B 5DHSA 4KZPA 1QRDA 4N3BA 4FYVA 3OOEA 1EHIA 1K5DA 4K1XA 3I9V1 3D3WB 1O97D 1QE0A 3C6BA 5JFOA 3AIMA 4QYMA 2GPSA 4KGXA 3S0JA 2X8WA 1DBSA 1OV4A 2GPAA 2Y1LA 1ETUA 1MB9A 2KLBA 5T64A 1SK9A 2AIRA 4YAGA 3IMFA 5IVKA 1SN7A 1GRQA 1TYAE 2QJOA 1KWGA 2RHTA 4BEVA 2H5JA 1X7ZB 2PMKA 3W5UA 3KP1A 3N05A 4DYHA 2H5LA 3REQA 1R50A 1FFBA 1RKVA 3FHJA 4QOJA 4N1AA 1UMBA 4KCGA 2VS1A 2ONKA 2Z57A 4GXNA 5L3RA 1E94E 1RJDA 1U2PA 2WPNA 4K87A 4Z3DA 2O05A 3MGGA 4C22A 5BMOA 2CCKA 2P4SA 3AM5A 1ZMOA 1WOMA 2WTEA 4FFPA 2FR0A 4OXNA 2WT4A 2WSIA 3JU3A 2KW5A 3WISA 2SCUB 3VYWA 4KHPB 4GGOA 2R86A 5LB4A 2Q8PA 4BQSA 3IQXA 2DLDA 4KQJA 3QU2A 1VMAA 4KC0A 3PL1A 1OXTA 5C31A 5COAA 3UWOA 3ZDXB 3RBVA 4LBWA 4AQDA 4WCFC 3E2PA 2W93A 2XWSA 4LV6A 4DUGD 1U4SA 1U9JA 3L1KA 1KYTA 3R7LA 3U4AA 4B3DA 4Z86A 5KWSA 4HDSA 2GPNA 4WXEA 3NU1A 4TM8A 1Z4PX 2GPBA 3NW9A 4EW1A 1ZK4A 2EHDA 2X6TA 3FXAA 4RTSA 3ZHBA 4BVGA 1C2TA 2REOA 2POCA 3TNLA 4YRKA 4MZXA 5PNTA 4O4IF 5H02A 2CXUA 3ONEA 3ESAA 2C04A 3NTXA 3CY6A 5ALIA 3UV7A 1C81A 1LC3A 1ND6A 2OGTA 5L7YA 1X7WA 2Q99A 1KO7A 2M2IA 2Q1TA 4EB8A 1QDEA 3D2AA 4IM7A 1QHHB 2IITA 1BMFD 3O0DA 2ORIA 1OR8A 5JZBA 1HE4A 4Y18A 4JVOA 3U9SA 2DR0A 1NUUA 3COYA 2H63A 2GPYA 2ZSKA 1DBRA 1HH4A 2G0AA 1O58A 1DZ3A 1MP0A 1VIVA 3K92A 3KYDB 4M9UA 4N41A 1E77A 4IVNA 2H4WA 4Y6GB 1KQFA 3HJTA 5JVDB 3LK7A 5B7PA 3H9CA 4X7BA 5AVZA 1EIWA 1Z6GA 2PBLA 3AP2A 3FPHA 5EQFA 4LYDA 3IJEB 1BG6A 4X1IB 4RTOA 1XJWA 1U2RA 4JXXA 3MSCA 1G0NA 1SCDA 3O3MB 4HB0A 1MGPA 2HM7A 2HJVA 2O2XA 4IVRA 5CYOA 4OREX 3ZK7A 4ZYLA 1PBTA 5ALMA 3P2IA 3LUAA 3OQHA 1J5XA 3B5EA 4XQ9A 3A7EA 3J81A 2QJWA 1NTOA 1LD3A 1WS6A 3AVQA 4M38A 1JDPA 2J3MA 3Q3EA 4QA9A 1U3DA 1G18A 3HJHA 2YMMA 2PWBA 5KJEA 4QVIA 1T5OA 1UQRA 2VL7A 1AUOA 3RUIA 2I62A 2FWPA 1ODKA 2FQ1A 5JCJD 2ATEA 2VHTA 4AP5A 3MS7A 3PIRA 5CPBA 4Z2YA 4BNLA 2X0JA 4GPZA 1HYQA 4MRAA 4IRUB 3LHIA 4WMLA 5B36A 5DULA 5JH7A 3PHLA 1XDBA 4YCJA 2WQ7A 5DM1A 4A0SA 4OI0A 3K6RA 4INPA 3UGTA 2H1OA 4CEHA 4WBNF 4LK2A 2C5LA 1R00A 4BQFA 2VYVD 3PUWA 4DIOA 1MENA 4F6RA 1D6SA 2QGZA 5EGSA 3HCDA 3T7DA 1OFGA 3ZHCA 2DPGA 3WR5A 1DB3A 3JQAD 2AXQA 1R88A 2Y27A 4BVLA 2PGNA 3JD2A 3VNBA 5AW7A 2O4CA 4FUTA 3UK1A 2VDWB 3DEZA 2HQRA 3JX9A 4QECA 4U7HA 3B6ZA 1HV8A 2AWNA 5ED0A 4WA7A 4YPVA 5HQ3A 3ZWPA 3BF7A 3QHQA 2NV2B 2GA9A 2IEYA 2Q6OA 2EZTA 3EVEA 3OFKA 3UH1A 4DDKA 4GECA 1VPEA 3WV5A 5JJIA 1Y9AA 3BDVA 4OXRA 4K0RA 2WY2D 1E9DA 3CVUA 2K7ZA 2VTDA 4ZFNA 2G04A 1EESA 1VPLA 1WMAA 3M4NA 4EITA 3FAZA 1WXIA 4RHUA 5DGTA 1PS9A 1XZEA 3GPCA 1RM0A 1CQJB 5E6UB 3WLNA 2OO5A 1XWFA 3D6VA 2FWMX 3BA1A 4MRRA 1BRMA 5KYTA 1T5HX 5FYQA 5JDIA 3G8YA 4MPPA 4TVBA 3PJEA 2HYDA 3C1TA 2CF5A 3K32A 5HZKA 3FYUC 1GZUA 4GDMA 2FU5C 4MRMB 2D59A 1MEEA 5HRCA 4JROA 4ESOA 1PG2A 1BXGB 1SO8A 2EWWA 2F3UA 4PZAA 3VOTA 3VKGA 1R12A 2C1XA 3RWBA 4PNHA 3T41A 3AEKB 1GU7A 3VAYA 3O90A 2ZJ7A 3OZ7A 4JODA 2V7GA 1ACJA 2J7PD 3LVQE 2Y68A 4IRMA 5DTEA 1HYBA 1D9XA 3A1FA 1EK5A 4OLFA 4KWCA 5M7EA 4HNSA 3JQ7A 2LNDA 5JZVA 1LZKA 3ZH9B 1Q19A 1BDBA 3BQ9A 4R3WA 1NOJA 3D6JA 4N0MA 1OAKA 1ULAA 2YN0A 3K53A 2CMGA 1XNJA 2BT4A 3BZBA 3BOSA 5HXAA 3IUMA 1HXHA 1N6NA 2OV3A 3WO0A 1D4FA 4RTMA 1M3SA 1WXHA 2C3OA 3O8OA 1OKKA 4GP6A 4GR4A 3AKCA 3WKAA 2F17A 5DXJA 3WLFA 1QV6A 1UMCB 2QPAA 4D9BA 3TGLA 5IARA 1H2RS 2JFBA 3PYXA 3RNOA 1E79D 1L4GA 1OWPA 2Q28A 2Q8NA 3OE1A 2WIDA 5B1HA 3RSCA 4GZ3A 4EJ0A 2HPZA 3HLYA 3HGTA 3P2KA 3LLVA 4ENQA 1S4QA 2PZEA 3BSFA 1XRJA 4Q15A 1XUOA 2P4EA 4GOKA 5E4JA 5AUQA 5FR2A 2D5CA 5ARCA 3PXBA 4LA4A 5I5EA 1PJQA 1U6IA 5E2BA 3F6RA 3CA8A 2FX2A 3WHKA 2Z5GA 2B0CA 4CU5A 5AKEA 2V6FA 3CMMA 5E8RA 1GQRA 3VC3A 4FMCF 2ZBRA 2VQDA 5FPSA 3B6KA 2R6CA 1OHHA 4K5QA 3M1AA 2PX3A 3FDFA 2HB6A 4U6QA 4JJ4A 5F2NA 1C8KA 3UUWA 1IIRA 1DHRA 5IAGA 1E98A 1AUPA 2IZ0A 2VPYA 1JU3A 1XZGA 3JQFC 2W71A 1SBYA 1WW2A 3GELA 4QRDA 2H1SA 4RV4A 4HFJA 3UAVA 1GSIA 1QVZA 3ZDAA 1Z7EA 1J97A 3EF0A 2I6TA 4YRZA 4WLFA 3G9QA 4NCXA 3RRZA 5DHQA 3LZDA 4NPCA 5C8YF 1RAIA 4L72A 4MW9A 4HGNA 3GAAA 2BM0A 3L8GA 4MLPA 4NULA 1U3VA 2O8FB 1CE8B 2HRCA 3AYZB 3EBLA 1PW7A 1Y3HA 1JEEA 3TIGA 3OUZA 5KU1A 2FE1A 2D8MA 2RG1A 3B6EA 1SKUA 3UB4A 5CVCA 4JI5B 5BSTA 2IEDA 4HGQA 1N2BA 1E3MA 2ZAGA 1EJ6A 4LNHA 1BDIA 5ALKA 1T5SA 4ZMSA 3OZXA 4FE7A 3I6YA 4RETA 1L5GB 4C89A 3T3NA 2Q2OA 1ILWA 3ASZA 3DV9A 1OU0A 1J1UA 3CX7A 4HTFB 4RW0A 1DADA 1G8FA 3GLHA 3MLAA 1H66A 3PXDA 1X74A 1WOYA 5D51S 5CG1A 4R1NA 2P6MA 2A5DA 4Z4FA 3RE1A 3W2HA 5K51A 3IPRA 3KPWA 4H7FA 1JHQA 1G6HA 3QV2A 1JIKA 3A1TA 3I37X 4XJVA 1Y3IA 4U5XA 4L9SA 4JLBA 3DAFA 1MMFB 4Y9DA 2IU0A 3OPYB 2EBHX 4S0ZA 5SZIA 3K6SB 4WZAE 4B17A 2B69A 1QIEA 1Q0RA 1LA2A 4QELA 2O23A 4L9AA 1E3SA 1G3QA 5D7NA 3PKJA 4DNPA 2X5NA 4Z4GA 2VHXA 2PUCA 4L28A 4NBNA 4LGYA 3MTGA 4JUFA 3K9HA 2Q29A 5D01A 4GP9A 4YVFA 4ROSA 5CVJA 5DW0A 3H9EO 3MUFA 2Q4OA 3IPXA 4E30A 5U9CA 2IXFA 4AQ7A 1XLTC 3K1ZA 1CNMA 2PMWB 2G3YA 3PUHA 4Q48A 4X60A 1EU1A 1PYGA 5JCXA 3LUJA 4TRRA 4Y9TA 1JUDA 3BMOB 4MS3B 3TSYA 4X92A 3TRIA 2ZRKA 3BDIA 3DMTA 5T4FA 3WZLA 1CUBA 1OLUB 1WV0A 5I7AA 4C0KA 2C2YA 3SS9X 1NNEA 2W5UA 3VU1A 4ZODA 1E59A 4EQ6A 2PT5A 2JJ8A 5IKPA 4RKRA 1I5RA 2HXGA 2P2LA 1V8FA 4KQ1A 3HE3A 3ZXIA 2C2HA 4BMDA 3D4NA 3U3KA 3V1YA 2BIFA 1KF0A 5IVHA 4G01B 2AEJA 4AUEA 3QFHA 4CKWA 3WLTA 4ALLA 3RVOA 2ETVA 4UD2A 4JSTA 1Z0KA 1ZLYA 3PNMA 1D0SA 2QTTA 5EE0A 1Y63A 1YS2X 4BKMA 3GN2A 4N5HX 3OTHA 2OBMA 1OXUA 5CCDA 3UOAB 2O4UX 3FCEA 3AFIA 3AWIA 3IVXA 4L6AA 4HLDA 4KDCA 3DCJA 1YXMA 4OFZA 4DG9A 1ZMTA 1V1JA 2J3EA 4G1EB 1RJGA 4C7KA 1B42A 5AR1A 4RKFA 3GLQA 3TMYA 3MCTA 2IYAA 4Z8XA 5BUCA 3C85A 3GVHA 4EG6A 1O5TA 3B2QA 5CD9A 2VPQA 3DNFA 3A04A 1NPTO 3L0ZA 4CF6A 2X5OA 2QUBA 2MYPA 3D3EA 3NHBA 2SKEA 4KGVA 4ZU6X 4MR7A 1SVSA 4XGRA 1TW2A 3OUUA 3WHLA 1HQCA 4POOA 2BZ1A 4J1TA 4JVLA 1UBHS 5AK5A 2NVUA 3S8EA 3DDHA 3FN4A 4P3PA 1QGYA 1ZUNA 5BUQA 3SBXA 2FPGB 4AYWA 4HXFB 4PEVA 4WDRA 1YGYA 4V0RA 3Q3JB 1RXSA 4X20A 5G0VA 4EPWA 4M1SA 2WU8A 4FZ5A 2BKXA 4ZOLA 1EQUA 2VF5X 3VUFA 2G06A 5KNDA 1Y7LA 2QT0A 4RQUA 2F1OA 3MJFA 3R6WA 3AV0B 1OLSB 1RABA 4XYLA 1N7HA 2FY8A 4ARZB 1XXHB 4TS9A 3OZTA 2HOQA 1UT8A 3F8SA 2B4AA 3E0QA 2PKCA 3IOYA 4GOMD 1KI8A 3G79A 2FOXA 1A7JA 2HRZA 4AIRA 3C3JA 1P4AA 2PVCA 3HFGA 5JAIA 4L6IA 5BQOA 5B64A 2J45A 3LVRE 1U0JA 2NYVA 1J23A 4C4ZA 3K09C 2X42A 4FEYA 5COBA 1JTFA 4D9EA 3IX7A 3PFIA 5A0VA 4XM0A 1Y1RA 4RSGA 4MEJA 2B21A 3VKWA 1GGEA 4PPQA 5AI5A 5ANRB 2AMYA 2PM8A 4PGMA 4TQGA 2WMNB 3JR7A 3QX8A 3OQMA 4X41A 1YFLA 1NZFA 1JA0A 1DO8A 1HSZA 1I51A 4IUYA 1KXZA 1U0EA 2XOXA 3DWGA 2VWHA 4LF6B 3P2JA 1HMPA 4FHEA 1OX6A 4ZVSA 5EKSA 2FUEA 4EHKA 3AVUA 3MCWA 4B3GA 2AZTA 4LRUA 4FYKA 3E82A 3GNQA 3L7YA 4U2KA 5D3ZA 3GVPA 1HRDA 3T0FA 2GN8A 3PC8C 1ZO8A 2DQKA 4P9NA 3RYIB 1NXTA 2XRYA 1BGWA 3GARA 4IXDA 3TRFA 1JQ3A 3R0QA 3T8YA 2EBFX 5F1PA 5LOVA 3ZS8A 1TUBA 2G25A 3G5UA 4YQFA 3WK5A 4O4LB 4EY4A 3KQKA 1AUQA 1AKRA 2H85A 3DJFA 5EUQB 1SVKA 3E05A 2GVNA 4DLLA 3OCCA 1EFUA 4PC1A 1B8NA 1QTIA 4YQZA 1MRNA 1YMQA 3I9KA 1UJCA 2ZVDA 4UEWA 5DFAA 2R6FA 5FCDA 5CP8A 2CCJA 1I6MA 1EUDB 4X7MA 2ODWA 1M1YB 3ZZ1A 3SX2A 3ADKA 4NBKA 3NHAA 4EA6A 3IQDB 1SOUA 5JJ5A 1DQSA 2ZAIA 1IL0A 3A8TA 1R8JA 1U3GA 4IDEA 1ZRHA 3LTEA 3TM5A 5CIYA 2XSZA 4DA6A 2F3PA 3QWFA 4M46A 1H23A 5AM4A 3IUBA 4NEQA 2Y9MB 4I5EA 1PLJA 4RTJA 4ZZ1A 5L4SA 3W5BA 1U99A 4TVSA 2ZS7A 4R2XA 3PIIA 1UBCA 2X9GA 3QIVA 2HWUA 1C7IA 1S96A 4K3VA 4BNDA 3N75A 3O1HB 3SC2A 3FOCA 2KB0A 1XDZA 1X1DA 1KH3A 3HSYA 1A9QA 5E95A 1RDFA 2H92A 1T2VA 2I3DA 5DNUA 2J0QA 2XGMA 2C82A 2VYQA 3N39C 4BYMA 4NENB 3ADDA 4EP1A 4AZ0B 4FT4A 3L07A 3Q7IA 4E2FA 3OAAA 3MINA 3V4VB 4HRAA 2Q8QA 4N7JA 1EM6A 3Q8WA 4BVKA 1BNCA 4IP0A 2C8JA 1W1WA 1TRHA 3AY6A 2JJQA 5LLSA 1WZUA 3HP4A 3OC0A 4GZ6A 3ZGLA 5A5DA 2C7QA 1VYUA 5FOXA 4CV2A 1RTTA 1KYWA 3FKQA 3PNVA 4CV1A 5C4MA 2DC1A 4ZEXA 4B6RA 5AD1A 1JZTA 1YNOA 5WRFA 4NOJA 3QZUA 4PQYA 2I4IA 1FVHA 4QTZA 1B8OA 3KBBA 2FN7A 1DC7A 2XVXA 4KMSA 3FTFA 3BMNA 1X2BA 1XVLA 4BMSA 4P35A 3U16A 1JQEA 3U7RA 2CVQA 4ZVPA 2RJOA 3VKHA 3QMMA 3JV7A 4B3SB 4DG5A 1I1HA 4QOIA 2IHNA 1IYZA 3E58A 2Z2IA 2J6CA 3LPAA 4QOHA 5G0SA 2ZUBA 4CZ2A 4B33A 4O4JB 2PLRA 5IZCA 2F2TA 4A8JA 2B99A 1F06A 4I1IA 1VE3A 4Y2SA 5AW4A 2GCEA 1F1BA 2XOKD 2ZCUA 4AY4A 5EZ5A 2ZBUA 2CXQA 2GF2A 4K1LA 3WSVA 1A5AB 1KVSA 2V0NA 4WXHA 4CEIB 3M6WA 1G0OA 4TV8A 1TYBE 1V1RA 5LZ7A 2ZRAA 3PCTA 5HRAA 4H77A 5DW3A 4W7HA 3QBEA 1FJGB 2CVOA 2XF8A 3HL0A 2HC9A 3KWJA 1SY7A 4HGPA 4X3OA 1A72A 1QHFA 2L18A 4GYKA 3W3ZB 3W8EA 4BX8A 3CBQA 3GRPA 1DRVA 3ZIAD 2ENUA 4JQZA 1R6BX 4U9IS 1GTG1 4HQOA 1AKTA 1AC5A 1ZMRA 4Q66C 1T43A 4XIFA 3B36A 1KNXA 1VHTA 1W0KA 2IUTA 1VPDA 3DEAA 3G13A 3W6NA 5A03A 1SD1A 4YAFA 3SHFA 1W85A 1RIIA 5AM1A 2G6TA 3M5CA 1CUEA 1YUNA 1H3EA 4HFMA 4TKUA 3HYLA 2BUCA 2BFOA 1JR3E 2PEYA 2AH5A 3QY0A 4MUGA 2I0FA 3ZCUA 4RPKA 1VSUA 3D6FA 4AMVA 5L53A 2EARA 3NTLA 5DYTA 1HNNA 3M6LA 1NW9B 2EQBA 2FEKA 4G37A 1VRWA 3FDZA 4PPFA 4U00A 3OU2A 4MWSA 1ESDA 1U4NA 2IPAB 3GJ8A 4DCSA 1B15A 4Q03A 4L1KA 2IDJA 4PCLA 1C9KA 3F3MA 2H08A 4X1YA 5HQJA 3ROPA 4BFTA 2JIPA 3C8HA 1CUVA 2ECPA 2GS9A 1KA9H 1H4VB 3FRJA 3GWZA 1QLHA 2F59A 4X65B 1L0BA 3NHPA 1D6JA 3B13B 4KO1S 3ZD8A 2WILA 3DF7A 4Z1MA 5F7XA 3A11A 2HL6A 2QTLA 1J0EA 3A4LA 5EHZA 5ITSA 2PX8A 3R1IA 4GGMX 2FUG1 2PR7A 3G49A 3NYIA 4IL5A 4MJLA 4WK6A 2ZIUB 4WKBA 5JT1A 2AD5A 1E3TA 2PLWA 4LJ9A 2VAVA 3A6GA 1RYYA 1TF7A 2VPZA 5E0KB 3SIPA 3TLYA 1XQ6A 5H9WA 5J40A 4B3CA 3FTEA 2PXXA 3SYLA 3GG2A 4HZGA 1JZSA 4RNCA 1DMRA 3LZ6A 3CE9A 1BXZA 4WQMA 1YZYA 3VJRA 4QUJA 4ZO6A 4MW1A 4QBHA 1GKYA 4D9NA 4ZVRA 4F06A 4IIEA 1XQVA 4CL0A 3U4GA 2JI6A 5THXA 1CQZA 3TKLA 4DM4A 2Q3FA 1ZNYA 1EFTA 3M3PA 2BEJA 3DO6A 4HDQB 2CK3A 5J9FA 5YASA 3WFIA 1N9GA 1S8NA 9LDBA 1QNFA 2GXQA 4QVGA 2PKYX 5K3CA 1OROA 3CFYA 2CXHA 3MTDA 4JH0A 4QO8A 8ABPA 2B5OA 2I1VB 4V1CI 2JBAB 4FW9A 1YZKA 1X0XA 3LF2A 5EJ2A 2ZDHA 1IB0A 3SLRA 4CIXA 5JXWA 1JWAB 3EH1A 4HAXA 4AICA 4LRWA 3CKKA 2ZJ1A 1DQYA 2HA7A 2RCYA 3JQ9C 3IAUA 1PJAA 4YIHA 4XDYA 3B53X 2R62A 4DV7B 1A1VA 1OT3A 4Q37A 4OVKA 2PEZA 4R98A 2WNHA 2PRKA 1KP2A 1UDCA 4JB3A 4EB6A 4RY9A 1Z17A 4IINA 1VFPA 1KZ9A 5AIAA 3RKSA 5JZMA 1FRFS 1QR6A 1NP6A 3AHIA 5HF9A 2IDMA 2Z04A 2CNBA 3KS9A 3QTTA 5CR9A 3F6YA 1O9HA 5BSRA 5CHYA 4PG6A 1NF2A 1KDTA 3AZOA 4IW3B 2ZUUA 3CJQA 4PRZA 4AQYB 4KO2S 4DC1A 2NZWA 1EDBA 1PT8A 5IKEA 2RH9B 2C8LA 2FLVA 2R47A 5E4YA 3TGWA 3OCUA 1GNQA 1E5XA 3G0BA 3GUHA 2WWHA 4K26A 5DI3A 2Q3JA 2B35A 4D3XA 4F4FA 2UXBB 4YP6A 4IH9A 2R8PA 2C2GA 2H31A 1CULC 4ZVTA 1TM3E 3HKCB 5HM6A 1C3LA 1G9TA 2VZ9A 5JRJA 1PJLA 3TB6A 4GC5A 1BJRE 3TQTA 3ITKA 3VYTB 3TZCA 4Q5IA 3U3ZA 1HC7A 2WUEA 3IJ5A 3BHNA 2O07A 5K8JB 1GYPA 1GO2A 2O3TA 4OP2A 2WA2A 4A4DA 4EY8A 3SE7A 1C7RA 2RAUA 4EG8A 3CR8A 1LBTA 1J5PA 2FEAA 1X19A 3CUEF 3E18A 1SHLA 4IJWA 2HT6A 4PS0A 2IV3A 3VU8A 1OFUA 3LV8A 1FU7A 2MYTA 4OLBA 5E9QA 3DUWA 1XNGA 2CVPA 3OT1B 4DJJA 3KZCA 2SKCA 5CUQA 1DXHA 3IAEA 5ALTA 4H7IA 2ZZNA 5J5AA 2W2KB 1FUUA 3O2SB 4ZHSA 1OLXA 2OWEA 2LE0A 2BMDA 1YACA 1SKMA 3CXUA 3AWDA 4QGSA 2AG5A 1TZKA 3N7AA 1LLDA 4M1KA 5JZ9A 4RGBA 3U3MA 4EVSA 4PC6A 1MC8A 1ZITA 1EA5A 1UODA 2VJLA 4BP3A 5LB2A 1JJBA 3S5JA 1XZQA 5H3LA 2JGIA 2ES4A 1EWTA 2FN4A 2R84A 3KSDO 4GMXA 3RIEA 3RWOA 4BZZA 1QP4A 2W2PA 3CJRA 3OZFA 4N8DA 4NYJQ 2XECA 1T8RA 2I2CA 1SVIA 3SC4A 1AY0A 3VPXA 3I05A 4OGGA 4TUYA 1Z22A 4OQFA 3E9DA 2IYSA 2QDKA 1ISSA 2FG5A 1IN4A 3PDIB 4HI0E 1XMXA 3HA5A 2AL7A 4IF4A 3TINA 2IX3A 2GRJA 2H48A 2O59A 3IVGA 3H11B 1MJHA 3PDWA 2WJGA 3AHDA 4LISA 4K86A 2OTCA 4LMRA 3IP9A 2R7NA 2QXTA 3Q7EA 3REGA 3A9UA 1N25A 2FP3A 3PHGA 4F71A 1DX9A 4PW0A 3IIJA 4C03A 4ZYZA 3MM4A 5CM8B 5JH7B 1EJBA 4QTYA 1IHOA 421PA 4EJSA 1TX4B 3L9XA 2GO7A 2DPXA 3RFCA 3D6UA 3USZA 4EEXA 1EGVB 1OE0A 4PHGA 4ZTUB 1UJ4A 3H19A 3TVDA 1S8FA 2ST1A 3WK6A 3T5PA 2QOEA 3E4DA 4JDUA 5IP5A 1IXSB 1M2HA 4TM7A 1E1KA 2OYRA 1ZK2A 3HKDA 3L4EA 4PZLA 4RPIA 4EI7A 2V55B 1JJVA 2BHNA 2V3WA 2YBEA 3HPRA 2GPWA 4WNAB 1IBKB 3ZWWA 2P78A 3BXEA 2CMKA 4OTZA 4A0FA 4E5KA 4FIDA 4CQLB 4XEUA 3GFSA 3L8MA 2RC6A 4DEYA 2MIIA 1AKWA 2F9LA 1Y4UA 4HATA 1GFZA 2QLMA