1JKXA

Unexpected formation of an epoxide-derived multisubstrate adduct inhibitor on the active site of gar transformylase
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
209
structure length
209
Chain Sequence
MNIVVLISGNGSNLQAIIDACKTNKIKGTVRAVFSNKADAFGLERARQAGIATHTLIASAFDSREAYDRELIHEIDMYAPDVVVLAGFMRILSPAFVSHYAGRLLNIHPSLLPKYPGLHTHRQALENGDEEHGTSVHFVTDELDGGPVILQAKVPVFAGDSEDDITARVQTQEHAIYPLVISWFADGRLKMHENAAWLDGQRLPPQGYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE
publication title Unexpected formation of an epoxide-derived multisubstrate adduct inhibitor on the active site of GAR transformylase.
pubmed doi rcsb
source organism Escherichia coli
total genus 68
structure length 209
sequence length 209
chains with identical sequence B, C, D
ec nomenclature ec 2.1.2.2: Phosphoribosylglycinamide formyltransferase.
pdb deposition date 2001-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 1jkxA00
1GRCA 4YFVA 5J63A 2BLNA 1ZLYA 3AV3A 4YFYA 1GARA 3OBIA 1MEOA 1ZLXA 2FMTA 3TQRA 4ZYWA 1ZGHA 1RBYA 4R8VA 4EW3A 3O1LA 1RC0A 2CFIA 1JKXA 5CJJA 1CDEA 1FMTA 1MEJA 4NV1A 4TS4A 4S1NA 1RC1A 4QPCA 4ZYVA 4EW1A 1RBZA 1S3IA 3DA8A 2YWRA 4ZYXA 4ZZ3A 3GARA 4Q12A 1C3EA 4ZZ2A 3W7BA 3R8XA 3KCQA 1RBMA 4DS3A 4PZUA 4ZZ0A 4EW2A 3DCJA 1MENA 3Q0IA 5J9FA 1C2TA 3LOUA 1RBQA 4ZYTA 4TT8A 2GARA 4ZZ1A 2BW0A 3TQQA 1YRWA 3N0VA 1NJSA 3P9XA 3NRBA 4IQFA 4QPDA 3AUFA 4ZYUA 4ZYYA 4ZYZA 1CDDA 4TTSA
chains in the Genus database with same CATH superfamily
1GRCA 4KYIB 5SZKB 5AW3A 1HT2E 2ZK7A 2JKYA 1B0AA 1RABA 1V8FA 5THKA 1KI8A 1OZFA 1RZRA 1U80A 1SG0A 1RMQA 4OBEA 3LJKA 4QLAA 4TSFA 4YJFA 3USZA 1STOA 3W8EA 3BPSA 5CFQA 5HZGA 1E66A 2AV6A 4RTRA 2SCUA 3I6BA 2HA4A 2HNBA 1GGKA 6YASA 2J3HA 5FI5A 1EX9A 2QL5A 5E3JA 2IHVA 4NVRA 2EOAA 3B9RA 3TSCA 2ZPUA 2PMCA 3S8MA 1YR8A 2VPYA 3FVTA 3H1TA 2GN6A 4DJEC 4IZHA 5AQ1A 3EH1A 1G8GA 4PYIA 4KXVA 1F2VA 5H9WA 2Q0QA 3FRIA 5H02A 4J1TA 3WGYA 4AZSA 4PZLA 2R7AA 3V2UA 1IXKA 2J31A 4FU0A 2R5FA 4LOIA 1X0XA 3SYMA 2VQ6A 3ZLVA 2DFNA 3HYNA 5LPNA 1N6IA 2JVJA 4ZOAA 5HKOA 1NXPA 1I3NA 3EGDA 5FOTA 1OGIA 2V7EA 4MGZR 5JC8A 1AKNA 5D51S 2X4DA 3NIFB 1FP1D 4X1IB 4DR5B 2AKAB 1HEYA 2JFGA 1OROA 1OUMA 1S2GA 4NPHA 1KWGA 4FNGA 2CYCA 4GE0A 4HQKA 1GA6A 5AJZA 3ZLUA 4PQYA 1KSGA 2YZKA 3RFVA 4ZRMA 4DLRA 3HRKA 5FLKA 2ZRLA 4D56A 1E77A 1EFVA 1J2UA 1PQWA 2X1MA 3MWDA 3SC2A 3AERA 4U7WA 3AOEC 3PCRB 1DTWB 1TL7C 3AGPA 5CBPA 1G63A 3BK1A 3TX6A 1GZ4A 1UWKA 2BMWA 4HXGA 1DRKA 3DXZA 1SM4A 4Q12A 5J47A 4LISA 3CN9A 3D4IA 2VQFB 1K6MA 3KQMA 4MA0A 3QX8A 2AXPA 1QMGA 4TLLB 1JGTA 5PNTA 1P3JA 3SEZA 2YXBA 1VHTA 5GJWC 1XVAA 1B76A 2F9FA 2Q2QA 3SHWA 1M54A 3TW8A 2IX3A 5CVCA 1R27A 1C7RA 4ER7A 1OZGA 1BJRE 2R8YA 2WE8A 2Y05A 2EJTA 3FMIA 3AB3A 2BMVA 1EDOA 1MX9A 1SUDA 1EWYA 2O2ZA 2R1VA 1WABA 3N76A 3NATA 4LHEA 4J7XA 4R40A 1WWKA 2B82A 3QOWA 1LSOA 4TMWA 1QTRA 2CLLB 1HOXA 1GOTA 3LOQA 5EE1A 4IQGA 3DCNA 1JIXA 2Q0HA 1QRUA 1BRTA 3EGCA 3JASA 5FRDA 3H7IA 3ZKWB 4QXQA 3K2EA 1RIIA 3WWYA 3NXSA 3RFXA 4MMXB 4RY8A 4V2IA 3AKYA 4C30A 3VA7A 3I8OA 4YQYA 3R5JA 1ONSA 5AI9A 3OKCA 3IUYA 4MIKA 4PGGA 1IVYA 3A2KA 1LVUA 1EVZA 1Q0PA 3ELDA 3MIZA 2CJYA 2YYYA 1DKPA 5J2UB 2OV2A 3LT4A 4WT7A 1P2GA 3SQNA 5LP6A 4MUFA 4PNHA 3RVMA 2C5EA 1X1BA 4WBNF 3PYLA 1T2AA 2BBTA 4FE4A 4H9GA 4NMMA 4TL8A 4XDGA 4MVJE 3ZW8A 5F7OA 3FPGA 1SBTA 1X1EA 2RGEA 2BHNA 2G9ZA 2MR5A 2I87A 1X86B 3LVRE 4B6RA 2AWOA 1SBIA 3GRKA 4DNFA 5BW4A 1PYDA 3JSXA 1ZNQO 4N7BA 2E6UX 2A3RA 5AW9A 4DLLA 1U5BB 3ADDA 2Y9PB 2F48A 4ZQFA 2ZRJA 1Y7PA 3P5BA 4B6FA 4P5PA 1I7LA 1F38A 1GG5A 1KK0A 1KJJA 2X23A 4GLLA 3BSWA 4AYXA 1M2JA 3OY2A 2NSYA 1KO8A 3BD8A 4ZI5A 4MEJA 4R2LA 3VO2A 3I5AA 8OHMA 5BNIA 2CUNA 3RWMB 4H7DA 2I4MA 2DEUA 5AVYA 4LRYA 2PZFA 2RH9B 4N5DA 4E31A 3PXXA 2Z2XA 5TQ0A 2W37A 3LP6A 3RF7A 4EJSA 3G2OA 3RKSA 2ZRBA 4RIGA 3WLAA 4JP5A 2D2XA 2OCYC 4Y6PA 4LHVA 4INJA 4XB2A 2LCQA 3RBXA 3NUGA 4XD2A 4DIBA 5AVOA 1FXSA 1JPVA 1Q19A 4ARZB 4BPBA 2IU3A 2XCUA 1R12A 3G2KA 5DNWA 3ZEIA 5B57C 2D7DA 2ZP1A 1UP4A 4RQBA 1BYIA 3HGQA 5FLYA 4H60A 3IXMA 1Q1EA 4YEDA 2CXNA 2CLSA 1C4KA 4RHFA 4UJ3A 10MHA 2IZ1A 3OVMA 4B6PA 3BILA 1DC3A 4I9GA 2ZETA 4G97A 1RPJA 1LH0A 4IIHA 1R6VA 1R2QA 2WOJA 2JA1A 2ZITA 1NM5A 5DMHA 1U0JA 3SZOA 1DOAA 2C9OA 1I6MA 5U1PA 5ULLA 1WXHA 3ZWPA 1U1CA 4LECA 1VBNA 1HFKA 2FE1A 1F6BA 1U7HA 3GEEA 3W8NA 2GSDA 1L1QA 4OIFA 2XF2A 3M70A 4BTEA 5JROA 4HFMA 1H5QA 4RXUA 4ZK2A 2QZ9A 3GLRA 2DFPA 2J9RA 2IOYA 5F3RA 4X6XA 2XUIA 1O5TA 1G8FA 2YMMA 3R23A 4URXR 1O97D 1NF3A 1TQ8A 1SU4A 2GRAA 1T5LA 2BGTA 2N1MA 1J0BA 4WFJA 5DRYA 3ESYA 5IVIA 3PLAE 4B3TB 3IVGA 2QRVA 1HQYE 3LC0A 1JLSA 2IPXA 2AJ8A 3LE8A 1NURA 3OFNA 1IB0A 1H8HD 2LD4A 2NYVA 1MT3A 5IBPA 3OE5A 3PFBA 3GRFA 1FX1A 5BUCA 3ACCA 2IIPA 3PNBA 3Q3VA 3BTVA 4GS5A 4AO7A 1ZCBA 3KXIA 4J1NA 3HCDA 1EEHA 4ES6A 1M1NA 3S2EA 4I81A 4D6YA 2VHUA 1JWBB 1U02A 3CLRC 3ENVA 4JEHA 4UE3S 1VTKA 4B6EA 4HWRA 4K86A 3HN2A 1A1SA 3O03A 3M6VA 3ZYCA 4ENQA 4JV5B 1QO0D 4IVRA 5ESWA 3AH8A 3G9TA 1RWPA 1XDSA 2AR9A 3MIIA 1RYMA 2YX1A 3P0RA 3W9YA 3X1MA 4MQEB 3X1YA 4PYNA 4U6NA 5KSPA 4RK4A 4B31A 4DDKA 3FJ1A 1DVRA 4BC0A 3CA8A 4OSEA 2Z2IA 1AGNA 1IPHA 1OASA 4URFA 5CH5A 3AFOA 3KS9A 1P7ZA 3MRSA 3KJFA 5F52A 5TGDA 3STWA 4HNUA 4DBVO 1ZR4A 1KYVA 1V8OA 2VK2A 4RD6A 5HMLA 4P54A 3DOIA 5IZ4A 3WIBA 2JJ1A 3NVAA 1ZGJA 2QMEA 1CUYA 2WSBA 1OR8A 4JEIA 3JVEA 1B8NA 1NBOA 4K2HA 4YI5A 2OLJA 4BVAA 4EB6B 5LYJF 1GPUA 3BRWA 4MLCA 2QUHA 2IYUA 1XVTA 3NIDB 3OF2A 4MRPA 5FL7A 2LXNA 3G7SA 3WP1B 3HJUA 2HJHA 1F0KA 4JU8A 1B6SA 2QQGA 3AVOA 4XCQA 3S6JA 5A4FS 4ZI7B 3TCKA 3VYRB 2YNMA 4DV6B 5HE8A 1KP9A 2EBUA 5H82A 1XYGA 2QTTA 1MXFA 3NM6B 4M0UA 5AT1A 4IGIA 3MMNA 5KWJA 1FFXA 2HIAA 4DYVA 4A8JB 4O4HF 1UODA 1TCCA 2B1QA 3DBHA 1EZZA 2R96A 3Q3JB 4FYYA 4MV6A 1E3DA 4C2BA 1N2JA 3DFZA 4KIGA 5BR8B 3BSSA 1JJBA 1ODIA 4OBWA 5KJ6A 1R4NA 4YR7A 3UUGA 4XIIA 2VHVA 3IILA 1QYRA 3D1LA 1X3SA 2VDRB 4CF3A 1KHHA 4LEIA 4TMFA 1KDYA 3WWPA 2DAPA 1XRJA 2Y3IA 3DCIA 3PCTA 4K6OA 4LI0A 3A7DA 3DYVA 4A8PA 2XXBA 2X0IA 2YS7A 3I0MA 5FKJA 2J3QA 2I3GA 2D1QA 3JARB 4PC1A 1KI7A 5E7MA 4NZ9A 4BMSA 4WNAB 1JDNA 4HL6A 1REQB 2OBLA 1BQ4A 1WZ2A 3LPMA 3LT5A 3LLSA 3M89A 3FOFC 4G8DA 1RKQA 2XKJE 4DMRA 4RTNA 2IQ5A 3ODGA 2VPQA 3EPRA 3WL3A 3WRYA 2Q9UA 4YRGA 4Z5XA 1U0NA 2J46A 1CQWA 1X92A 1XQXA 2OGTA 3HHEA 3L4KA 3OLXA 3HVUA 4NLLA 5B53A 3ZWCA 1RQGA 3EQ9A 1L6IA 5LQJA 2XUFA 1O0SA 4L4XA 3JQGA 3QVGB 5HDQA 1W4ZA 3EVNA 1FC0A 1PF7E 4X60A 1R5JA 1DLIA 3IV6A 2Z9CA 3EC1A 2GWHA 3FETA 3JVIA 2OO5C 4L50A 4J16C 4MB6A 4EMSA 621PA 2WT8A 5EHZA 5BN4B 1ZH2A 3SXJA 1QKKA 2D0DA 3AR3A 2IIVA 4HO1X 2IHBA 4TOIA 3SCZA 4XTCS 4BPRA 4GXTA 4KQEA 3HCBA 4PYOA 3KSBC 1UJNA 1MJ5A 4EL0A 4C14A 1V8ZA 1VBKA 1JT2A 3IAS6 4GI7A 3ANSA 3JQ6A 3R1IA 1WXEA 4HOYA 3COSA 3KDAA 5DWVA 1G3UA 3DHEA 1ZM9A 3PLNA 5JE8A 1USUA 3W5IA 3HXQA 5F7XA 1YACA 4H15A 1KETA 3BICA 5J40A 5K2MA 2CXQA 2WFLB 2CMGA 2V7QD 4J3JA 5EZ5A 3WV5A 3FNGA 4QDTA 5GONB 1XPOA 1TJ5A 1VIAA 3MT9A 4CEIA 3PPIA 2QD5A 4YUVA 2B2XA 4JYBA 1B42A 4LJSA 3MELA 1LDMA 1RFGE 5HUQA 4BX8A 3MSCA 1V43A 1W96A 1WHSA 1ML3A 4JIMA 4R2HA 4IXTA 4RA6B 1JEQA 5I7EA 5J3JA 1CZKA 1OBCA 2VLIA 2P2CA 5CTAA 4ZOLA 6AT1A 5KNBA 1R3DA 2XUHA 5L6LB 1G8HA 2I1WA 1TLFA 1R88A 3JYOA 3LO5A 2WKQA 3AYXB 3RSFA 5FWYB 3MBKA 1IUKA 1H9CA 2Q4BA 4CV2A 5E4FA 4W8GA 3C6MA 3F6BX 4Q1EA 3KG2A 4WZAE 3ZTTA 3ZU3A 4S1OA 3B52X 1W5TA 3DZFA 3NQ41 2FEAA 2X5KO 2XRYA 3BOSA 3K1AA 4NMXB 1EA7A 1Y1SA 1R9MA 5C34B 2GTIA 5GAJA 2I4IA 5EHGA 5AUNB 5B36A 1A7JA 1DQRA 1LW6E 4Q4JA 1PX0A 1WZIA 2H06A 3C3YA 5DZSA 5KWIA 2H3EA 3O2SB 4G5FA 1HMYA 5TQVA 4A82A 2YCLA 1T26A 5F5LA 3KYCA 4UHKA 2FEWB 4YRPA 2DPXA 2CXTA 4K81B 2WHRA 5EEGA 1SB9A 3OUZA 1CUZA 3H5IA 4II2A 1IIRA 4QPZA 4DJFC 4L02A 5C4MA 5K6AA 1DQPA 4L3VA 2D5LA 3BCSA 1TQ6A 4BQNA 4EFMA 1JPUA 3I6MA 2C78A 1IBMB 1ANKA 1E8MA 5IUKC 4URVR 4ZQHA 1GITA 4O2AA 2A5LA 4HGPA 2ZB7A 2A7QA 3AR6A 2P6MA 2F1HA 2OD9A 3MBOA 5LNK1 3DOJA 1PLKA 2W4IA 1GRNA 3M3DA 4BNTA 4OM8A 3HG7A 4W1RA 1B73A 3DDHA 5BWNA 1QJ4A 1Z47A 1B43A 3OCZA 3ZVMA 4TMYA 3BGVA 3NP7A 5CD1A 1N6KA 3OIWA 5DGDA 1GQQA 3OT1B 4CR7A 5H1YA 4UEOA 2CLHB 5JO0A 1IZYA 4JLNA 5DT2A 4EEKA 1VSUA 2PPVA 3JQ8A 5D2CA 3AI1A 5EJGA 4ZDKA 3AJ8A 2O8EB 2DRIA 4GPEA 4CE6A 1QHHA 1YBHA 5H80A 3IBGA 2Z58A 3ABQB 1MB0A 1Z0KA 3IUPA 4FC6A 3C3MA 4UXIA 3K8YA 3D1JA 1TQDA 1E2KA 2Q1SA 3A1VA 5KO2A 3HFSA 3GEIA 2PE5A 4AQYB 1Z7BA 3U3MA 3ET4A 1FNDA 2DQ4A 1WKCA 4KVZA 4Y7CA 5FEUA 2DR2A 3AFMA 3WOVA 4EJFA 2PCLA 4CHGA 2G17A 1RAGA 1X38A 4GYJA 3OZWA 4P35A 1AKEA 3B1FA 3BIXA 2AD5A 4QYWA 4J7AA 4BNLA 5EMNA 4DJDC 3DTYA 4R2IA 3IOYA 1QDUA 2L69A 2XX3A 1IJKA 3GFSA 2JGKA 4FCWA 4KXUA 4OHXA 1GKIA 1TM3E 3FM9A 3SC4A 1KKLA 3U37A 3ZEAA 2JLBA 3O1JC 5DNAA 3RSSA 3SXUA 1JW9B 1BCSB 3ICWA 2WJ3A 3UAVA 3VR5H 1SVWA 1NY6A 4ZOEA 1RRGA 4G0XA 3FZNA 2E18A 3BDVA 1T8UA 2BFAA 3DAPA 2P78A 3KJZA 3UQZA 1Z8DA 2IUUA 2YFHA 3EMDA 4L2IB 3BWDD 2JD0A 1YVEI 2XRMA 2I3BA 1XZ8A 2X7XA 1S2OA 5ELLA 1T2DA 4O3MA 5BUQA 1HBJA 2WYHA 3B1XA 4YAKA 2CN1A 4R4JA 3RBVA 4QKQA 1IEQA 1TAQA 1ODJA 3D6MA 4KR0A 1SKUA 3NYQA 2QORA 1FNBA 5EUQB 5HIIA 1JIQA 3JRWA 2VCEA 2WZDA 3UJHA 5IS2A 1W36B 1GTMA 2C1ZA 4M9RA 5TV2A 2WPDD 2WU1A 1YJAA 5KB3A 1SPBS 4ETNA 3KSUA 3CLSC 4G5YA 1AX9A 2H7CA 1MIHA 1N5MA 1NI3A 1ES9A 1T5SA 2GBCA 2HMVA 3IUJA 2W2NA 4CEJA 2PKYX 4NAHA 2R79A 3GJSA 4YTEA 3ST7A 4V0ME 3PQ5A 2A6PA 4CQMA 3E82A 3AHIA 1PWZA 3HMKA 1J5EB 1A5TA 1CE8A 4XFKA 2CXXA 2GM5A 4HYQA 3DLIA 4X61A 1G5PA 4IMRA 2ZIAA 3IAFA 1CDDA 2X15A 4BFVA 2XH8A 5KTSA 5EUCA 1V7QA 2DQKA 1KYQA 3MF4A 5G0SA 2X19A 2IZOA 2VT3A 4KFTA 3GEMA 1H4VB 4JR0A 4QGBA 3NHLA 4YALA 5F3DA 2OAEA 1F06A 2PU5A 1OYOA 3U4QB 3V48A 3SZLA 1VKNA 4D8XA 1NBMA 1XEFA 2C57A 4GW3A 1JYSA 1BEUB 3FWHA 1KJ8A 3B6ZA 4LOAA 1ZM7A 2QXTA 2YV2A 4LJ9A 4UUAA 4YLEA 1OQAA 3AF4A 5CTJA 3IP5A 1XALA 3BE6A 1EBFA 1Q15A 3U80A 4EHBA 3PEWA 1MOZA 2AJBA 4NJEA 3RJ9A 1LPSA 4D43A 4DCNA 1XHFA 2Z2JA 4EF4A 2NSLA 5IHPA 3QPCA 4QXAA 4IY1A 1VL0A 3BUSA 3DLPX 2P5YA 3A6KA 1Z82A 3U16A 1WEHA 2WTMA 2GF0A 1D6SA 2V0GA 2JVIA 3ETJA 1YFJA 3T35A 1VSQA 3VR3D 3FWNA 1Z18A 2ACEA 1GZDA 4NBSA 2A1UA 1XLTA 4JJAA 2XSZD 1PFVA 4EEZA 2JGLA 1QTNA 4NC9A 3MCTA 2QRKA 1DAGA 1UCFA 2ZCUA 2CFRA 3GLQA 4XR9A 5DK4A 2VK1A 3PNVA 1S4MA 2X86A 3KQYA 4H16A 5DTMA 5JECA 3OM0A 1AE1A 5A0FA 1VJCA 2WJAA 2NU6B 2P90A 3CC8A 3T7JA 1NI5A 2BKAA 1JLRA 3KZCA 2P9QA 4RY9A 1LLUA 4B7CA 2QP4A 3H99A 1EX1A 1PKXA 1Z4NA 3FBTA 1X80B 1ELOA 2W6IA 4PFKA 5I5EA 3SBEA 2ZTHA 3NGXA 3UANA 4LE2A 1TPYA 2I7TA 3ZHSA 5JNRA 4LK3A 1RYDA 3QMWA 3TVTA 3UNXA 2HJSA 1YRBA 3OPVA 4QECA 1IAQA 3GD7A 4LY3A 3K0SA 3S28A 1L5FA 4H3KB 5TS3A 1I36A 4ZDIA 1F2UB 3UT6A 5K03A 2ZBQA 3Q8WA 3BHJA 4A0GA 2POQX 1WHTB 4M49A 1U9CA 4DEXA 5BQ3A 4TXNA 2D2VA 5FIUA 2G09A 4MKZA 4TMTA 3W8RA 2FRXA 3EXIB 3ZE6A 1UC4B 3ROZA 4C0XA 4D4KA 5MGNA 4NG4A 2FDXA 1KI6B 4IOKA 3KQHA 3RYCA 5TX7A 3PUVA 3EOBI 1LNZA 1VRVA 4IX1A 3M7IA 5FB3A 3E3MA 3ORSA 3U4MA 5BSVA 3VJRA 5FEMA 5K3EA 4BWVA 1E1QA 3K9HA 4A27A 1XELA 5ENVA 2Y4NA 2D8AA 4C9BA 1GRRA 3YASA 4LSGA 4FGUA 5FL3A 2PH3A 3G8BA 1S5PA 5CBKA 1L4MA 1VP3A 3DXFA 1K6JA 5FQOA 1HDEA 3D6NB 3VSEA 3ZZ1A 4ZI7F 1N57A 1Q1NA 1G98A 3CH4B 3IDSA 5IT4A 1EE1A 4RZIA 3ZWYA 3U9LA 4D9IA 2C2KA 1XDDA 3L1KA 5A7HA 3NAZA 4FLFA 5GOZA 3U5TA 4OGKA 1U2RA 2GEKA 3I5MA 2ZW9A 4TMXA 1FBNA 1TEHA 4QVKA 2D8MA 1VCIA 1LU9A 5B37A 1YRAA 2R6CA 3AHFA 2AN5A 1IY8A 3FJOA 4NICA 2JH8A 1G3IA 1HLPA 3D8TA 3DHWC 5A9TA 3JQCA 4TTSA 1J20A 5HGJA 5B3JC 1Z9BA 1MPTA 5F3WB 2ZSUA 5JRDS 1CS0A 4X1YB 1XLVA 2YZGA 3IHKA 3STUA 1ENOA 1V9CA 3G5LA 1KQOA 4MWDA 2WA1A 4KXFB 3LK7A 4NHEA 4C21A 3K53A 4AJKA 4E70A 1JAXA 2ACVA 1W5EA 3EF0A 1RM4A 1G20A 4JGGA 4QUJA 4UZEA 2C9YA 3WYCA 2RGNA 2JI9A 3MNFA 3TUZC 2B36A 2YV4A 2OV8A 3C6XA 1T1RA 5CFRA 2QVLA 4U5XA 1KEUA 1VJGA 2G67A 2Y1FA 5EINA 2GESA 3VHXA 4I99A 2IGTA 5FPYA 3KPVA 1R0CA 1LPNA 2P0YA 3L7NA 3O1IC 3P2YA 5WRFA 3H1AA 5AXDA 1PR3A 4Z3DA 3NNNA 1N3IA 1PAUA 2QSYA 3EVTA 4M9QA 2NNLD 1CIPA 1QHFA 2X1HA 5F73A 4EG1A 5H81A 3LUCA 4B3CA 1PYGA 3MWYW 4YV0A 5K99A 3LPLA 1EK2A 5BSMA 3UT5A 3A1SA 4PZPA 2O8NA 3OI7A 2WSSA 3WLRA 4KR7A 4NYJR 4QT0A 5ECWA 2ASVA 3OO0A 5AW4A 1Q1BA 3GAZA 4FR0A 5CAEB 2PGDA 4TS4A 1FXUA 3FTPA 3KPJA 4ZA2A 3SBOA 3STYA 4UATA 1JSCA 1Z6QA 2QB5A 2R751 2ZJ3A 3U3OA 2OL4A 3UOAB 2G0TA 1ULSA 2HO5A 3LLVA 4IWXA 3TG2A 4C6HA 4FSXA 1OB2A 5IAJA 3RJZA 1FU8A 1HPLA 3OFND 4L76A 4YVFA 3ZCQA 5B2FA 3KJHA 1X7ZB 2PVCA 3FHLA 1TMGE 4GOMD 4LJRA 3CS3A 2JGJA 3AI2A 3KKZA 4L5JA 2MIIA 2LDXA 3PR2B 3CH5A 3H97A 2PXXA 1O7JA 3GQBB 1GTVA 3LUJA 2ZSKA 3QY0A 4HGYA 1L4UA 3ROGA 3RAEC 3LH5A 5GONF 2HRRA 3WHPA 2Q99A 1CZUA 2QZJA 5AIBA 1E32A 1DJQA 4NBVA 2NO5A 4EPWA 1C0LA 3BGIA 4PFJA 2G8LA 4BNWA 3L4BA 3NCHA 2FWRA 5AJHA 3BXHA 4RTPA 2FSVC 4W5QA 3SLGA 3VBEA 4DMCA 1HDYA 3FN4A 4FEGA 4MUHA 4PLPA 1PFWA 1FMLA 1PZXA 1R50A 2PZMA 4FFDA 4RDHA 5P21A 3T7SA 2VP3A 2CK3A 3QBVA 1RTTA 3BCHA 1VE1A 1EBUA 2CXSA 2FN8A 3M2TA 1HLFA 3O8QA 5L8VA 1PR6A 1OIVA 2JIRA 4H17A 4JLDA 5BN3B 4KXNA 2IS4A 2Q3MA 1Z3CA 4J07A 3MUNA 4JYPA 4H08A 3UYLA 3VKUA 4QUGA 4TWRA 2UXCB 1FJHA 3GUUA 4PRYA 2VSXA 4OMUA 1IC6A 3TTWA 4RQAA 2CY0A 3P4XA 1ZNWA 2WOOA 5K05A 3KBOA 3BMOA 2CLDX 4G81A 1DX6A 1SJ9A 2Q3FA 3QX3A 5CIQA 3WXMA 4C76A 5TIIA 2PA0A 3EHDA 2AOXA 4KXMA 2QU7A 3GMIA 2BTEA 1M8GA 1CBUA 2VYND 4IIJA 4DMUB 4XWTA 1GM5A 2QD4A 2B8WA 1NRXA 1XD9A 4L0CA 3H9EO 1OFIA 2MSWA 2VDLB 2GM3A 1ZYUA 2H1RA 1T1SA 2OILA 2FFRA 1GXSB 3RTCA 5BQ5A 2AFHE 4H7IA 4H0CA 1CWUA 1ZRSA 2RG1A 2FWMX 4MCIA 4B83A 2WR8A 1AHHA 1XNQB 2DLCX 1V3VA 2GTHA 2OVFA 1Z28A 2P9EA 4DM7A 3L1JA 3TW6A 3UK6A 4Z9BA 1OE0A 2YUTA 5H7XA 3EAFA 4L5AA 1T8PA 1VL8A 4JNCA 4KPYA 3N07A 3T3GA 1RCFA 2UDPA 2DPLA 3ONNA 2QR5A 2ZRNA 3A2MA 4DAOA 1SCKA 4CIVA 1XFAA 1LDEA 3G8CA 1MDBA 2DPMA 3AFNA 3QUCA 1K8XB 3PFHA 3P9ZA 2NQ8A 3GYBA 3IA7A 4P3PA 3B82A 4CF5A 3ZDXB 4O5AA 2FPXA 5ITSA 3WGIA 2EFJA 1HH4A 2V8BA 3DOCA 3FROA 3PVSA 4H7PA 3A11A 4BY9E 3RUAA 4ZCSA 1YS1X 3L8MA 1ADJA 2AN1A 5LLDA 4JOCA 4D0NA 4DY4A 1H2YA 2HU7A 2R86A 4ATNA 4LZWA 5DNYB 4FW9A 1JBQA 3F7MA 4W99A 3CSUA 4GRDA 1SQSA 2WDPA 1HFJA 2IXFA 3RC1A 2BFFB 1JHXA 2O2EA 4QBIA 1IH8A 3E81A 1UBKS 1UBUS 2HSEA 3FPSA 3ZPXA 5JYBA 4YCNA 2OK8A 1QF6A 2BZ1A 1EHCA 3QELA 3EN0A 2Z4RA 4WKBA 4PQFA 5J5CA 1EPUA 3EVDA 1QU3A 2R2AA 3RVBA 2QM3A 2XQJA 3PGKA 2IVFA 4PBTA 4FE3A 1ZVQA 2GJAA 2QBYB 2XADA 4ZO8A 4B2LA 1MH1A 1OXUA 4G24A 4IRUB 1GZ7A 3FLMA 1FSFA 1RACA 4G0OA 3V4ZA 1JE1A 1Y3IA 2Q5HA 4LFAB 2RBKA 2OQRA 1TQ2A 1VHLA 2EL9A 4ESVA 5A5EA 4JR2A 3IURA 2DULA 1I5RA 4GP9A 5KVQA 2EKPA 1EGHA 3AETB 3H2ZA 4RJJA 4C06A 1T3LA 4U9IS 3FMVA 4BDTA 1RAIA 4NU6A 2PL1A 4RABA 2NXCA 2OV3A 4OIMA 4DLBA 4HZGA 2OAP1 3RG2A 3UWSA 1RHKA 4EABA 1K5PA 2QHXA 1D7OA 2ORYA 2C7PA 4IQ8A 1TVEA 2MWMA 3GGPA 1T6XA 4P7FA 4ACBA 1I4OA 3F49S 1VHWA 1J9GA 3MK31 3CPEA 4JT9A 5HFAA 4D81A 1O9GA 4HSEA 1MFPA 1RQLA 3DVAB 4BV3A 1I6WA 4CG3A 4LHSA 2CZGA 1GYRA 1P62B 4RGQA 4RVGA 4KX3A 3G9UA 3WAGA 3O4GA 3ER9A 1LV7A 3KWFA 1S2NA 4OHPA 1QRRA 2ZRCA 3FYUA 2Y0EA 4NEGA 5B3KA 3WISA 4RD2A 3A9WA 13PKA 1QONA 4UEJA 4JQCA 4ENPA 3C87A 2RAPA 2LP4Y 3CLVA 4JC4A 1NW7A 1RLUA 1TFRA 2R11A 4LX8A 4WUTA 2ZE8A 1J22A 5MHTA 3LXMA 5LU9A 2RGXA 4LF9B 2UXDB 1DJLA 1OPRA 2C88A 3QBDA 5CT5A 2VHEA 1E5DA 4E5MA 1II8B 3GGCA 3AJRA 4RDXA 3C7DB 1Z4PX 3DL4A 5LDDC 4M7PA 4US2R 2ZAYA 2VPWA 2GD6A 3FNQA 1M2NA 2YZMA 4OJTA 2H59A 4RDIA 3AV3A 4GXNA 2R62A 3ZHQA 4Y2QA 1ONNA 3STVA 1U99A 4EGSA 2NTEA 1XEWX 2FCAA 3MMSA 1CD5A 1DOZA 1HEIA 4JVNA 1FP4A 4GGPA 4EM6A 1TA9A 1QOPB 2FJ0A 2KLBA 1UPTA 3DTTA 1FFEA 1V5EA 2ZBEA 4NJOA 1FK8A 4A9AA 3O4RA 1C7QA 4PZDA 1C9DB 1Z36A 3R44A 2JCGA 4HAWA 2AF3C 4HPJB 4KW7A 3PSAA 5HIMA 3UJBA 1NP6A 2FTKE 3IP8A 4Q1AA 3ABRB 1H0KA 5EA2A 2YV5A 4R1MA 3GQVA 1M3SA 3PIIA 5A2QA 2FMFA 4B4VA 3HCEA 4NBKA 5T4BA 3LBFA 4QYXA 1OYVA 5J4VA 1Q2UA 2RMKA 1NNI1 3AO0B 4NOMA 4ZCQA 1JVSA 4MVJD 3LYUA 4HPXB 2AC7A 1Z63A 4I8IA 1DUSA 1XRQA 2BEUA 3DV0A 1WB9A 1QFYA 2JCYA 2MCFA 3R7WB 4B3JA 4F1JA 2XPCA 4LJKA 1XLUA 1U3DA 1GPNA 4KMSA 4GMHA 4GQIA 3TFWA 1RIFA 4HDKA 5I4IA 1E7WA 1FTWA 3AFHA 4QQFA 5L45A 4KR2A 4IJ5A 2A1TS 1HETA 3LC1O 2FKNA 3WC4A 4A0QA 1W49A 2PX3A 2XJ4A 4EHLA 1G18A 1A5SB 5JEEA 4ONEA 1TM1E 2CF5A 5HBGA 3A3OA 5EN4A 3KJNA 2V03A 4PSCA 1UWLA 2WJ4A 2PJDA 2WUWE 1HXHA 2FZWA 3DMGA 3RE1A 1IHPA 3HPQA 3KCQA 3KHSA 5FOUA 3CY6A 4HRXA 3AEZA 4ICIA 3R3VA 2QMYA 2G3YA 5KTOA 4DQLA 2M1ZA 3FHJA 4HPWA 4OA5A 4MYCA 4DQUA 4Z2AA 1D2AA 4PYQA 2G63A 4DLNA 4YUYA 2D6FA 5JAPA 3BGSA 1MOSA 2J3DA 2NU7A 3HHPA 3MTQA 2IODA 5DTRA 5FUYA 4QULA 2HU5A 1Y8RB 2OCAA 5ICMA 1WD5A 3NVMB 2P69A 2RHDA 4MQFA 4PYLA 2NUTA 3X1XA 4MWTA 4NABA 3WGVA 2IHUA 1U6KA 1ZD5A 1GDHA 3CX6A 1FRQA 3BMNA 3HKBB 3KZVA 4JWKA 4B4UA 4CR6A 4YMTA 1BG6A 1RM0A 2QJFA 1QVZA 3F4BA 4EX6A 5EUBA 2BEJA 2B3DA 1FY2A 4GVPA 4AC9A 1A9XA 1Z6YA 4FLMA 2H7YA 4RKEA 3T1QA 5BP7A 4NOLA 2JAWA 1GFSA 1MR3F 2YHSA 4L8YA 1QX4A 4NEHB 3VQTA 3A6LA 2VJOA 1GUBA 3MMXA 1WUKS 4A3SA 1IZ0A 1XRLA 2JF0A 1GL3A 1HRKA 3GZTB 4FX2A 5CVJA 1FJ2A 1QH8B 1QSGA 4YUZA 3I2HA 4YDHB 4UUNA 2Z95A 4HWOA 3GMDA 3RTEA 3WJ2A 1KRXA 1QIJA 3B89A 3ND9A 4X00A 2GEFA 3HYTA 4URHA 3WHKA 4BWYA 2DP4E 2IP1A 4NCNA 4MJ3A 3WRXA 5AM3A 6REQB 1QWSA 1N7IA 1T5IA 2O3UA 1WA5A 1JILA 3OIGA 4AZTA 2Q7XA 4U2CA 1VLZA 5ADUS 2NO1A 1WY7A 3L8CA 1IUNA 2FMTA 5SYAA 3D0RA 1OJ7A 1P9OA 1YZLA 4HY3A 1QTQA 4KZKA 3W5SA 1CK4A 4DMHA 4NZMA 3HWRA 3T7AA 2ZI3A 3T3EA 1NBHA 2CHEA 4G63A 2CDCA 1DKNA 2GT1A 2NUAB 1NMXA 4AKEA 4LRTB 6GPBA 5DCLA 2IV3A 2B21A 1EWKA 4GEKA 1XJ0A 4E12A 4L8GA 2Y99A 1MDFA 2I3AA 1YNSA 4ZYLA 4F86A 4UAVA 4LMRA 1XUOA 3CEHA 4G6ZA 3JR3A 4J0KA 4ML3A 3WMGA 1Y5LA 1E1RA 3G2MA 3HK2A 1XJQA 5T3YA 3OY7A 1O4VA 1KVTA 3S5UA 3A4IA 5IZCC 1IY2A 1DFGA 3EA4A 3L82B 4OQYA 4JP2A 4XQCA 2J59A 1U3FA 1V4VA 1X7WB 2HIMA 2P4UA 4KH0A 2Q29A 1A0OA 2P7HA 5ENDA 3WSVA 1Y98A 3N6VA 2QTCA 4WNAA 4F96A 5KINB 1JFSA 3OE7D 2RC5A 3QF4B 2FWPA 3M4NA 5TVKA 3VJLA 4M6WB 3R5KA 2FEXA 2QX9A 4WZBE 121PA 2M2IA 9ABPA 3TSYA 4ZYXA 3Q72A 3TRFA 1ZQ9A 2JFNA 2ZJ0A 1CHNA 3Q11A 5E3HA 2PA3A 3O9ZA 5TPWA 1PX2A 2O3SA 1B15A 2QMHA 3E03A 3SU8A 3UG7A 2IHTA 4WHMA 2IYPA 3NRCA 4XAQA 3TZKA 3L5KA 5DI3A 1PUIA 1ACLA 1Q14A 3ZZUA 1FZTA 2RSLA 2A0KA 1MJGA 1JDVA 5AP9A 5CDGA 1TCVA 5F5XA 1SCDA 4DZRA 3PUJA 2BVNA 1ZISA 1FSSA 2X2OA 1IMOA 3R0ZA 5DH9A 3FR7A 4UULA 3BC1A 3RC3A 4DR6B 1ZK1A 3GJ4A 3KD3A 5FTNA 4I8XA 4D44A 1OH7A 1U8CB 4P4SB 1TYDE 2D2FA 4CODB 2AFIB 2Y9MB 3PUKA 5J4YA 4MCJA 2YVUA 1JWLA 4NKRA 2HK8A 2YJZA 3ZQKA 2ZYVX 4GO1A 3GXOA 3SSMA 3CR7A 1CX9B 3PC3A 4G4SO 1O94D 2ZDQA 5T67A 4F6RB 4ZJYA 2ZCJA 1CNMA 4S1PA 2O4UX 1K1EA 4HN9A 2VNIA 3H1FA 1UDXA 1I14A 3CPJB 4JY7A 3T4PA 2YJNA 1Z16A 1HZJA 1Z12A 2C54A 3O8OA 1AN0A 4Z4EA 4W9MC 4RTJA 1QHIA 1KR2A 1UC9A 1UFVA 3MZ0A 5IDYA 5BRNA 1AJEA 2X9QA 1Z39A 3B51X 3EZNA 4WMLA 3W90A 1NVVR 1XAGA 3HSYA 1W581 4WASA 1O9HA 2NMVA 2DJIA 1F7VA 1L7RA 5CXSA 3ROQA 4DLZA 2RB5A 3SC3A 3HJBA 5CEJA 4XQEA 5FUQA 1QE5A 3UWPA 3SQDA 4II7A 5BV2P 2HV8A 3HACA 4DA6A 3IMEA 2ZSEA 3OOYA 4JOBA 4WACA 1XO1A 2WKSA 1J90A 3AEKB 4J7UA 1ZI6A 3ZVRA 4OATA 5EFOA 1I0LA 1ZLYA 3X0DA 3SK0A 3VSBA 1ESZA 3ADKA 3FCCA 4OREX 4C07A 2O8BB 4EDFA 2KPOA 2E4UA 1K3FA 3PA8A 2VHYA 3PXCX 5DYIA 3BT7A 5AKHA 5FI3A 1OKKD 3ELWA 4RLQA 2SKDA 1M2VA 4O2BB 5TC4A 3TDKA 4OMCA 4YMVA 1J0CA 1GQRA 4LJ8A 3WKAA 1YA8A 3IDFA 2X3YA 1Z4IA 4MW9A 1WPRA 2WZCA 1GL9B 4G1VA 3ORHA 3UAOA 4BQIA 1WBBA 1OFUA 4PLWA 4M9UA 4BASA 2AE2A 2MTBA 3MA0A 1PEAA 3TLXA 1CJSA 3AZOA 3CISA 4CZ2A 4F4UA 4IV8A 1SIWA 4IYJA 1J97A 1QPBA 5TNXA 2GILA 1I13A 3FHCB 2ETXA 2QQ5A 3SHOA 1Y6RA 4DIKA 5GIPE 3ZDRA 1P4AA 5FORA 3WWZA 2Z57A 3CF0A 3D3QA 3EVGA 5EG5A 4WCFB 1XXLA 3LC2O 2YXLA 4LJYA 1BC5A 1X3LA 4K6MA 2DY1A 4A6EA 4O0MA 2VRNA 3K0EA 1L8LA 1RLMA 1A4IA 4WXHA 1QIHA 5TLSA 1KF0A 2Q0SA 3K1ZA 3FSJX 1ORIA 2JARA 3MGCA 1GTG1 2PYIA 4PO1A 4EO9A 5AW8A 4D7AA 5KC8A 1TMKA 5LFAA 2OGZA 2AJTA 1RHJA 1X1DA 4MWSA 2ZT6A 2YIVX 4KG7A 1JP7A 3A1NA 3G5UA 1NX9A 1VLMA 1WXDA 5C7IO 4F5YA 2BT4A 4QRIA 1RP1A 2CJFA 2G6TA 1ENZA 3BHIA 3RV4A 3D4BA 5BMOA 4YIHA 4LF5B 1VP9A 3TLCA 2PS0A 3ICQB 1DDOA 2BUAA 3LDGA 3OIFA 4ILKA 4CMIA 1SUAA 3ESBA 3R3YA 5A4AA 5MFPA 2YW2A 4DB2A 1XFDA 4HKTA 2CCGA 3HKDA 4ZO9A 4ZPJA 1PD1A 3IIIA 4FBLA 1ZNZA 3O84A 4EJ0A 5FNZA 2V6JA 3L8GA 3PBKA 5EIWA 4TV9A 2UVPB 5ITZA 3PTZA 1TADA 3FNBA 4OGGA 1TUIA 1NULA 3K70D 1T0BA 4G37A 2H1OA 3EPHA 4IRXA 2Q6OA 2VDWA 1GT91 3BRQA 4J4HA 4CM4A 4LXYA 5F2EA 2XEDA 3T52A 3PB3A 5GJBA 3QU7A 2PLFA 1OLXB 2Q8PA 2WWTA 3E2PA 1QQBA 1RWMA 1ORDA 1U7XA 1U8XX 2ORVA 4R71A 3RIHA 3GBSA 1NJ1A 4YXFA 1EXWA 3GJ7A 4BLRA 5BURA 1KDVA 1KEPA 4XWOA 3UMCA 5JJLA 3N8NA 2E48A 2ZSFA 4QD3A 4MJXA 3U1TA 2EIXA 4HTAA 3I9FA 3EPPA 2IUEA 1UPXA 1NMSA 1YRLA 4JLWA 2DXIA 2IRWA 4LQDA 3KQVA 4BE4A 4WXRA 1E2EA 1HSOA 3DDZX 3KU4A 5G02A 1DBWA 4C0WA 4YMIA 4DRXB 4IMIB 1Q7GA 1SD5A 1G38A 3FPHA 5DNUA 1LRJA 2D4HA 4H7KA 1XRMA 3IE1A 4TYMA 1HORA 4WA7A 4UHCA 3UC5A 2EX4A 2LRHA 4MQ6A 1JLKA 1G21B 8ATCA 3DVLA 5IHXA 3P2MA 3IO5A 4PGAA 3KB6A 3JQFA 4GFDA 4F3CA 3UMRA 1HYBA 1XEAA 2W83A 1S89A 4OHKA 3KR0A 2B4YA 4L74A 2OK7A 5FBVB 2BONA 3PHCA 1LUAA 5CCEA 2J4CA 2QRJA 4Q5IA 3C7CB 3Q1LA 4FDLA 5HJ7A 2H8KA 3AC0A 3R6GA 3LNTA 2F3PA 4QA9A 5TDHA 4B2PA 5EJ5A 1M0EA 5I7AA 3R8FA 2YFQA 1F5SA 1R37A 4JXJA 4NFSA 1XD2B 4RD4A 3CF4G 3NWOA 2EG9A 4ALMA 5AVZA 4EA6A 3VO9A 4NG5A 2IV7A 1IZ9A 2PLAA 4HBGA 3WWCA 3GP8A 5CA0B 3LK6A 2CFIA 3HRHA 4EF5A 1C3OB 2E5WA 4B6SA 1AMUA 3CB2A 2EZ9A 2V7XA 4I0WB 3O1HB 4WZ6A 1V37A 1V71A 3HPRA 1AC5A 4KN8A 2PZBA 4E1VA 1MQ9A 4HNVA 4PQRA 1ESMA 2P68A 3NIGB 4C2AA 5HK9A 16PKA 4JBHA 1Q44A 3ZXYA 5I7VA 1ECPA 4F8YA 6NULA 3V1UA 5D00A 5LC1A 1QRTA 1GPJA 4KDRA 2DBRA 2FPLA 2JC3A 5B1HA 5KCZA 4AP6A 4RC9A 1UP6A 2YFKA 2XCOA 3KEOA 3OJFA 1L5OA 1SCBA 3HQ4O 3HU5A 2REBA 1M2HA 1RVV1 2D5BA 2NGRA 3CRW1 4ECEA 2WYVA 4NK4A 3ZU4A 1JAIA 1P3Y1 3MM4A 3UB2A 2ZYRA 2Q21A 3P45A 4DY6A 4DNXA 4C4XA 4MRRA 4K5QA 4L9WA 1RKUA 2HWYA 1ZFNA 1SD2A 1LLQA 3JSAA 2VH5R 5HK8A 1ODCA 4OL9A 3T3IA 2WSIA 3E5RA 4PYMA 5ALQA 3AUSA 3R7FA 5D5HA 3FTEA 2ZE5A 1WB4A 5KQGA 1KMHA 1P5ZB 4LXIA 4N65A 1RJWA 3T7CA 4A1FA 2EJBA 3ACDA 4MAMA 5EJ6A 2EBHX 3BFXA 3JQPA 4IDOA 1HE3A 2B4KA 4U6QA 4IHJB 4NULA 2FAXA 1J4AA 3GFBA 1SC6A 3CE6A 2IUSA 1Q7CA 3IL2A 2ADMA 3L41A 2UUBB 2CD9A 3RUIA 4GZMA 4C88A 2PVSA 4NZPA 1MNQA 3QU5A 5GVRA 2OYCA 4PZYA 4MLDA 2GASA 4FYXA 1SO8A 3UXEA 2Q2NA 2VHZA 4KPEC 3EE6A 4DM4A 3LQQA 4MVJP 4TQGA 5E1MA 3RREA 4ASUA 2V7GA 4DLKA 4KRGA 3L84A 1YR1A 3D5TA 5HIJA 2IEYA 2LBPA 4ANFA 3IRUA 4RZSA 1KZ4A 4TRMA 1OZHA 5C31A 5LA6A 3Q5DA 2C5SA 1JIIA 5EWJA 2Q5CA 4BCBA 3C3KA 4F7WA 1IHXA 2Q50A 1M6VA 2C8JA 3IIMA 4RU1A 4HP8A 5K0CA 1BHJA 1SEPA 3FGZA 4YJFB 2X58A 2IYXA 2P0AA 5KQRA 5B1DA 4GIBA 1H6DA 3AF0A 4KQ9A 1T6ZA 2SCUB 4LPKA 4KIUA 1MA0A 5I8WA 1C3XA 1JEAA 5SZHB 1ZUHA 1DFIA 1YQTA 3MYRA 4HDRA 2HXSA 1JZQA 2W11A 4LXXA 3AVWA 2BOVA 4FDMA 3ZS9A 1X1CA 4DCPA 1W8IA 2LCIA 3GN2A 3JYQA 4V0LA 2XCRB 1D03A 2REXB 5K8UA 4WIAA 4HDOB 3U81A 4QAQA 5C5IA 4XX0B 3VZBA 3UMBA 1D0VA 2DBZA 1Y7IA 3P71T 3UW1A 2H17A 1JKMA 5B3JA 5LXTF 4PU0A 3EGDB 4S04A 3C15C 4U4AA 3KQPA 1E7QA 3G0DA 4WLEA 4MZXA 1GGJA 1C7JA 1ZJ5A 3GLHE 1QZZA 1GL7A 3D43A 4Z53A 2AHRA 5CJJA 2HQRA 3VR4H 3BAZA 2QXUA 3RQIA 1OX5A 3JVUA 4D3SA 3MWGA 1FMTA 3WGHA 3FNFA 1XJ5A 2WINI 3HBNA 3QW2A 1U2QA 4PZAA 2Y93A 4QAJA 5C37A 4L0MA 2GSWA 2ZIXA 5L4LA 2REOA 3DEAA 3QV1A 3U6BA 4BP1A 1EFVB 1LTQA 3HYLA 1KH1A 3MWDB 4P36A 3AERB 2X0DA 3SC2B 1BRMA 2BFDA 2E37A 4FQ7A 4IOLA 3T3MB 3TLZA 2XUZA 5CBPB 3WY9A 4JX9A 1JJ7A 4TL7A 2IXBA 3EIQA 5DN6A 5EJ7A 1U1EA 4HLNA 3C43A 1MJGM 1N2ZA 2VYQA 2O0KA 1TIPA 3K2IA 5TXGA 3DNPA 4B3MB 2E4VA 1D5WA 4WOPA 4ZALA 4D9MA 3T0IA 2L17A 4HWTA 3TW8B 1P0FA 1ZRHA 4YAOA 3RVDA 3TLBA 3HVRA 2QZ4A 1MW8X 3ZUGA 1Z4MA 1I3LA 1GO2A 2D13A 3CIFA 4KE7A 2ZBPA 2DHEA 3IKVA 2R1VB 1E3WA 2HEIA 3KALA 2VH2A 4N6GA 4WK2B 5IH3A 2A5JA 5IG2A 3TXAA 3LUKA 1JDTA 1KIFA 2LE0A 3GLKA 4KI7A 1R6TA 1I2ZA 3GN1A 4EVSA 1VHDA 3JASB 3TW4A 2FX2A 4Q02A 3B6MA 4DMGA 5IM4F 2WYIA 3JR7A 4PO3X 2FEOA 4TTAA 1X7DA 4RK1A 3CLRD 3L7OA 3GT7A 3M5PA 5JJIA 3CNBA 2PUCA 2K5UA 4XIFA 5J4KA 2J3EA 2VPIA 2VYVD 2C82A 5HG0A 2EBWA 4UVIA 3TIIA 1FVFA 2EYUA 2YRWA 5K0TA 1K4MA 5LP6B 1X8JA 2GFHA 1CV2A 3SF8A 5AVVA 3BD6A 2E2WA 4M83A 4ZTZB 2A0UA 3PT5A 4CQLB 1W30A 3I4LA 5IJXA 4F4JA 2GPWA 2UZ1B 3STHA 2GHIA 4EMUA 3VU3A 2HNAA 2VKTA 3CWZA 3UKDA 3QXSA 3UJ3X 3I12A 1HTBA 3HMQA 4MHSA 2B1GA 5E1DA 5FLXA 1E2LA 1H1DA 5HJ5A 1QG0A 3ZV3A 5E7JA 1KXJA 1SZCA 5L3VA 2GZHA 1PL6A 4KHZA 1PEYA 4A0FA 4LQ4A 4Z4GA 5FYQA 1DWQA 1U9IC 4UCFA 4TUYA 3AUTA 3WMRA 3E5HA 1C7FA 1MG5A 4X93A 1IU9A 5EPOA 3S1AA 3SAJA 1WU7A 2AD1A 2JIBA 3EPKA 3B2EA 2I0FA 5D1HA 4PYKA 4B0OA 4EJSB 3UBTA 3PQ3A 4MJLA 4KSCA 1UFOA 2EXXA 1JFTA 4C0BA 2QRGA 3R77A 5CB4F 4G0YA 5CLJA 2WWYA 2IH4A 3D3JA 3EG5A 3H7AA 4GYKA 4IDAA 5CFOA 1EHIA 4MUIA 2PBRA 4WKNA 3CX4A 3O7WA 4LJ6A 4DANA 4EPRA 2KMLA 1M0WA 2IYTA 3RS9A 4V1CI 5BSWA 1MTZA 2RHBA 4QYIA 1M8KA 1TJYA 5E8JA 1M8PA 4Q4LA 3LUHA 4BJ1A 4ERNA 1Y3CE 3B8EA 2O2IA 3E9EA 1KEEA 3B3AA 2AG1A 4L15A 4FGWA 5ALPA 1T8YA 1Y4SA 2IDZA 1UXGA 1TYEB 2IPMA 1HEUA 1Y5IA 2JJMA 3O4FA 4EUEA 5KNCA 4GM1A 1W1IA 3RT1A 1E6EA 2V96A 4M21A 5FR1A 3H0CA 1W4AA 2XMCA 3D0QA 3H65A 4M0FA 1FA9A 1FNNA 4EG6A 4I36A 4QT4A 4BX2A 1P2SA 2E4XA 1R6UA 1XAIA 4PX2A 4U7FA 2DUUA 5LD2B 3X2EA 3DFUA 2P6RA 4YK7A 4M8KA 2DFDA 4OH1A 3KQTA 2PGAA 4V3CA 4U63A 3BGWA 5TJ9A 5ADWA 5K0EA 1F4PA 1NUQA 1ZGBA 2Z2ZA 1LX7A 3EXFA 5SY4A 3DWIA 1PL7A 2PEYA 4Y18A 4GX2A 3ASUA 1MO5A 2ZVPX 1OLOA 3ABSB 3IV9A 3PQFA 4BLQA 4UNSA 5JQGA 3SPXA 2QRVB 4RGBA 4U2KA 2AMJA 3UMVA 3KD2A 3C8ZA 3ZDYB 4WVFA 3V1KA 1W35A 1YIOA 4PIVA 3UGTA 1TXGA 5K9ZA 4NCIA 5HQJA 3OO1A 1NT2A 1L7OA 4U7PB 3ZGLA 1ONOA 1I7SB 4FBGA 3IPCA 1VL6A 4QJ5A 3VKHA 1M1NB 1WLSA 1W1UA 2J3MA 2FV8A 2QD1A 4OU4A 4YASA 4L16A 3D7LA 3EEQA 5EMKA 2C8VA 3OLZA 1X7YA 2XBUA 3JALA 4EG4A 5EERA 2CDBA 1WPQA 2HHLA 3D6AA 3PPYA 3TXXA 4S05A 2A92A 4H6XA 4LV5B 2COUA 1P1IA 1EFPA 1H42A 2HBYA 3F67A 3LOUA 4PTYA 4W8OA 4HVLA 1K89A 4JQZA 1YQGA 2AZTA 3MCUA 3RHTA 1FDVA 2DG2A 4WJLA 1GAQA 2L82A 4EMTA 2BV3A 2A2ZA 4G36A 5LNK6 3CSDA 4H0NA 3PL5A 2B61A 4E3WA 5AVSA 3I5YA 3ONDA 2C98A 1C50A 2TRSB 1KDZA 1YS4A 2OCLA 1WCIA 3LL7A 5HF6A 4Q7MB 1CXZA 3CYFA 3TIXB 4OHFA 4AG6A 3HVIA 1W6UA 1P74A 4RNCA 2C2ZA 2DUNA 3KJQA 1NZFA 3CRVA 3I2YX 5CT9A 1G55A 1NQUA 1J42A 3F74A 3IVRA 4N7MA 4M8NE 3WLKX 5JMOA 3LCUA 4GKBA 2YUIA 1Z88A 2YWCA 2ORWA 3C74A 4IFEA 4MPJA 3T1NA 3FDXA 3QPDA 5F1YA 3E1SA 3L0CA 2IE8A 1GNRA 2AUTA 1HURA 2HWWA 3DBHB 1XZMA 5LZ9A 4B0PA 2E89A 3OC0A 1SCIA 3RS5A 4HLQB 2PWZA 1R4NB 3A8TA 3IAXA 1E99A 4UUBA 3H2YA 5C0OE 4NY1A 3MERA 3O90A 4OXQA 5CA0F 1HE2A 2IHKA 1QNLA 2IKSA 2WFAA 3WK7A 2F8LA 5C9ZA 4D9EA 1JH9A 4LMPA 2O8CA 2F7SA 1XQ1A 3E9CA 5DHTA 2CMKA 2GZ3A 2PJZA 1JPJA 4PC3A 3MEQA 4RYDA 3NDRA 3UT0A 4TRJA 1N9GA 1V48A 4TM7A 7REQA 5IKMA 4KAFA 1VM6A 2WJWA 3HUUA 4RXTA 2UYYA 1D07A 1K86A 3GZNA 3TKAA 1YT5A 4R0VA 3ZD9A 3GT3A 4XWKA 4UOEA 4KQ6A 2YJTD 1X14A 1D2RA 3PDJA 3REQA 1JMKC 5DYWA 3H4VA 3JQGB 3KQQA 3L7LA 3EXAA 2J9ZB 1SU8A 1ZI9A 1R6DA 1RVDA 2EQ5A 1P4HA 1FPQA 1AKWA 1MX5A 2WB4A 3HCCA 5DW3A 3H9UA 2H5LA 4QX6A 3RVPA 5A0VA 2WLSA 4N0EA 5K8TA 2G36A 2B4AA 3ROTA 1KC3A 4D96A 3ZLTA 2AOUA 2YMPA 4CL8A 1NLUA 5JZOA 4CMCA 3K8QA 3BXEA 3VPGA 3IT1A 4RZUA 2M6LA 3LS2A 4EG7A 2I2FA 2RHTA 3DL7A 4IKPA 4FJ0A 3ZDBA 1WUIS 4ZAFA 1E20A 5L51A 1MUUA 4FT4A 4BIIA 2OCXA 4CM9D 1E2GA 2VP2A 4CF4A 4MIEA 3KFVA 2IOFK 1DX4A 2B9EA 1DRUA 4QHSA 4BWFB 3CW9A 4S1TA 1BS9A 2DUWA 1R0ZA 2IPLA 1GFIA 2RJNA 2ZU6A 3I23A 4I2VA 4IHJF 1QFMA 3RJMA 4PS0A 4CLDA 2O2XA 1IK6A 3FPJA 4YDRA 4CEIB 1ZSYA 5FOVA 5J2TB 3KZOA 3F8SA 5FI0B 3OOHA 4EBBA 4JSYA 3S81A 3AMVA 1K98A 1SIUA 1WHSB 4O4IA 3GUVA 2JRCA 3OP4A 4WERA 3BWCA 4EUSA 3WSTA 2CBZA 4RZ2A 2ATIA 4FN5A 4TN1A 1SK8A 3WKCA 4ZOLB 5K0FA 4XSHA 3TX2A 3F78A 3GYGA 2R65A 3PGXA 3LPCA 1JL3A 4OTZA 5DYYA 2CJWA 2RGWA 3M4ZA 1J9ZA 3MWFA 4QPNA 1XAHA 1E4VA 4HDCA 2WFZA 3GDHA 4IKOA 2GARA 4F4HA 4A6DA 5BW8A 7AT1A 2IL1A 5KYNA 1VL1A 2WJJA 3GP3A 2P77A 3D0KA 1Y3AA 1LI4A 3GLHA 3K1AB 3FOAA 4IDPA 1TO1E 2P4HX 1NTRA 1RP7A 2VWHA 4Q4JB 5FPPA 3ZY3A 2JLXA 2OHXA 5K0SA 2Y1EA 3OOJA 3QU9A 4B48A 3CLSD 4G2TA 1QYDA 4P3NA 3ZI7A 3OLQA 1BDHA 4G3XA 2D1YA 4BNKA 1GPKA 2AYXA 4EUFA 4JL5A 3R5HA 3B7WA 3CJQA 1BX1A 1DRVA 1LCIA 1WS6A 3K6RA 3ZGOA 3N1UA 1NSYA 4C4TA 1H93A 4IJMA 1GKYA 1H5UA 4PC7A 3AFIA 1JSZA 4M3NA 4MI3A 4PRKA 4KFRA 2PL9A 5AK4A 3SY8A 4WK4B 4CV1A 3ZVKA 3I9V1 1Q7RA 3H5RA 4JFAA 4O2AB 4HAOA 3EIEA 3TAHA 1H9AA 4X24A 3A9SA 2RIPA 3CKKA 1WOMA 4HEJA 1GVHA 2ZT5A 3M6IA 4I6JA 5ECDA 3EVAA 2PMDA 5B7QA 4HGOA 3P9IA 3ICEA 4JXZA 1ZAYA 4K3VA 3EPLA 4L6AA 1D2GA 4OY3A 1DRJA 3SFVA 1SCJA 2G71A 2C0PA 3IOCA 4S1WA 4RL4A 5GVSA 1YMUA 1HGXA 3L0IB 3G7NA 4LXQA 4J9UE 4Y6RA 1YB4A 4WBSA 5AESA 2FPIA 2AT1A 2Q49A 5KOHA 1YZVA 3C5EA 3OWOA 1CY6A 5EVJA 1KMMA 3JQ8B 3RNOA 4GT1A 4HNTA 3GAAA 2EFEB 2APJA 3GWGA 4KYTA 3C98A 1QCYA 1QHHB 2CLEB 1MJFA 4OK6A 1PHPA 1ZGCA 1PVDA 1E6KA 2PUBA 3DAHA 4HADA 1MBZA 2GERA 4C0HA 2JIDA 5E1OA 5F1OA 3FTFA 2ZJAA 1CERA 2QQ0A 2V7BA 4RMIA 2G9NA 1UBSB 3ED1A 1JA9A 1RJFA 4Y1RA 4FIZA 4ZC1A 3PC2A 1NXWA 1E89A 3BORA 2GZSA 1U1GA 1SEVA 1QK5A 2F3TA 3B38A 3EH2A 1P61B 3I04A 4PC6A 3ZY6A 7YASA 3NOXA 1ZCZA 5JDCC 1UJ4A 1NLMA 3THYA 1B93A 4YMHA 2PMWB 1MB3A 4IIBA 1FJXA 1TMOA 2B6HA 3FNIA 3G2QA 4RK6A 2OFFA 1PNRA 4MQ4A 3SXUB 1DBSA 3PE4A 4FK8A 5F33A 1CUUA 3TEJA 3IQWA 1KS9A 2P5TB 4JJKA 1KJNA 2NV0A 5JY6A 1T9BA 3TO5A 4H31A 1WM1A 2GBPA 1E1YA 4RJ2A 1XWIA 3ZIUA 4DUGD 1BTOA 4E5SA 4Z1OA 4ZEVA 4YYZA 1E0KA 1G7SA 4C01A 3CUYA 4N5NA 4E2FA 1J0EA 3MQ2A 3E58A 4MVCA 2ZJ8A 1PG2A 4X9XA 1QM5A 4JLOA 2QLBA 4CKCA 2QL6A 1SRQA 3OAAA 2BYTA 2A9FA 2I4OA 2Q5OA 3RVNA 3F7OA 4JP8A 4D80A 3I62A 1EQUA 2VIIA 4IFBA 4C1NA 2TSYB 1GNPA 3I76A 3MOIA 3NC1C 1P45A 3CUKA 4L7QA 1XT6A 3ZHRA 2C2BA 1OHHA 4TLAA 5HVNA 4DKJA 2FDRA 4WLVA 2VJPA 4CEJB 1QKJA 1GGHA 2Q8NA 2ZSJA 3FKSA 3N3BC 3N86A 3PHHA 4FFPA 4S24A 5FA8A 1BVYF 1RWQA 2ZS9A 3QLUC 1F6WA 1ZZGA 4HXEB 3UO8B 4IIUA 1M67A 3TSWA 5CDUA 3A36A 4CQMB 3TQTA 1YFLA 3MHTA 1X7XA 1R00A 3MMPA 3UJ6A 3UK0A 4EOGA 3RYFA 3Q7IA 3R20A 2R5WA 3WRWA 2JLUA 2C42A 3VKFA 1U3TA 3QFRA 1E2MA 2J6BA 4GX5A 2W6JA 4NARA 4YPFA 1OWNA 3IUQA 1B14A 3EYWA 4UHEA 2WQ6A 2JHPA 4MKGA 5LYJA 2EFGA 4FQ5A 4ZMRA 3W2FA 3PHIA 3IULA 4MDFA 4WFIA 3HL4A 3R7DA 1ZD8A 2ZUEA 1OV6A 5AVKA 2ZJ6A 2ODEA 3KR9A 5LWHA 4K7JA 2E5FA 1NPDA 4YHBA 3E2IA 1XKXA 3D3EA 2FG6C 3TUJC 1M5RA 2HHAA 4B17A 2Q9AA 2WK1A 2Q9CA 5DYGA 2GPNA 2WJGA 4NJEB 3TI7A 3H83A 1IBSA 1BS2A 2QD3A 4INOA 1YNOA 2WJ6A 3MS4A 3DNFA 4CM6A 3HBJA 5BNFA 1NAHA 3BL8A 1HM5A 4R3WA 5TF4A 4A03A 1JJIA 4DLVA 4DCTA 1DX9A 5F9FA 3MWLA 5ALZA 1NYRA 3GLSA 4EB3A 2CVQA 4X85A 2A1UB 2FRDC 3E22A 1O5IA 1DQSA 2HEGA 3EZ9A 3JQQA 4FZRA 4QOGA 3DZ8A 3E0QA 5FBRB 1WP4A 4L1KA 5FO0A 2G04A 3O31A 1A9SA 3O93A 2GF9A 4K9SA 4US1R 1J1IA 3L8HA 3RVJA 3CFYA 4BFXA 4MV4A 4QUAA 5JS8A 4Y2JA 4B9EA 1FQJA 2CHFA 4M1KA 4RE5A 1SNYA 2OZLA 2PGXA 4NV1A 3HNRA 4HLDA 3UMSA 2I67A 3CRNA 3DNMA 4FCCA 4YP5A 5IW8A 4C87A 2J1LA 4PNEA 5E9WA 4GRAA 2FMHA 3HVJA 3ZY4A 4ZHSA 3FWZA 1YMVA 1VOTA 3DZJA 4M4SA 3DF9A 4D45A 2ODTX 1NVDA 3FLAA 4I14A 4X65B 4KYUA 2FN9A 1MMFB 1XZCA 1VC2A 2C3UA 2VUIB 1YZKA 3HVHA 4YYEA 2I76A 4GBED 5BV7A 4NYIQ 1K2WA 3F8TA 2CZQA 3A6PC 3DAOA 1C3LA 3VVLA 1YL7A 3A6DA 4ZVQA 821PA 4TZKA 3NTLA 2I4TA 3FBWA 5F21A 4E4RA 2A5DA 2FP4A 5JHGB 1IBCA 1PE0A 1JHMA 2JCVA 2QSUA 3TIGA 3C7KA 4I7EA 5EXXA 3SYKA 4D99A 5DNCA 3KM0A 4KXLA 3RYCB 4FEYA 5GMOA 2NP6A 3I32A 4LDAA 1W5AA 1W47A 3O5AA 2I2AA 1LSSA 4JEMA 3U3RA 2G1PA 3OD1A 3TPFA 2NVBA 4UVHA 3GCDA 5EGSA 3KC2A 4RA9A 2RE8A 3PQDA 3GNSA 4L75A 2XWPA 4REQA 3W6PA 2O8FA 1DEXA 3JQAA 4XVQA 3ZDDA 3CMMA 3AJDA 1JDZA 3MJVA 2KS6A 1Y4DE 3OMWA 3PC4A 1KI9A 1YV9A 4TXHA 2R8ZA 2GGSA 2BJHA 5M7EA 4Z9XA 1KAMA 4LRSB 2WWXA 4NSNA 1DIAA 3L79A 3QW4B 4UQOA 3WYBA 1XZDA 3KK0A 3BEOA 5NLLA 4YRJA 3Q3HA 4HDAA 4RBNA 4KXYA 1D2MA 3IQFA 4X92A 4PG7A 4OHMA 2K6GA 3KPWA 3SDZA 4UM5A 1CS0B 3ITEA 3NYIA 2IOHA 1KSHA 1Y34E 4B35A 1NLYA 3FW1A 3MUFA 1QF7A 5J1TB 5JZBA 4EK9A 1V7PC 1JFRA 2F9LA 5EWMA 4MUMA 4OXNA 2XCLA 4YFVA 4ZVTA 4HT3B 1G20B 3JZDA 1RJ9A 1FNMA 1GR0A 1UBLS 3N7AA 4G01B 3BHMA 2OLEA 3BG5A 3ORFA 3PXAA 3DUWA 5K4HA 4Y98A 3VHXB 1JFLA 1TQ4A 2BMEA 1K8RA 4Y2HA 3GFTA 3M4JA 4EYKA 4DG5A 4B34A 4FUTA 2J9YB 1E3EA 1FLDA 2J8ZA 2W2LA 4TMVA 1PR1A 4WBXC 1SD1A 4MWZA 3R8CA 5F76A 1FUYB 2GO1A 3D2CA 4IGAA 3CONA 3W2EA 4Q3AA 5ER9A 1JHPA 3NEYA 3RTDA 4E11A 1I0IA 4AJPA 3SHTA 1JIKA 4XGIA 1XQVA 4BB5A 1AS0A 1UZNA 4MUBA 5EE3A 1TA4A 2P6NA 4XM0A 4AZWA 2XZOA 3OUUA 2C95A 1N5DA 3WVNA 1L5LA 4AK9A 4F3KA 3PI6A 1SRRA 3DTNA 1RI2A 4W4TA 4J1SA 3OEHA 2F9MA 3U44B 3VR5D 3W3AH 3SS7X 3RK4A 3ROEA 2BH2A 4LZNA 1VMAA 1W8DA 3PGLA 4KLCA 5A3JA 2YY7A 4LHZA 1LF5A 3IOBA 1L5HA 3PX2A 1VE7A 2EAUA 1P1JA 1A9OA 3SKXA 1XXHA 2ACWA 2LIPA 3WFIA 3AI7A 3NXKA 2VL7A 4JCCA 1D4FA 1NATA 3Q7SA 3DMTC 3ZY2A 4E15A 7MDHA 3MS2A 2FSFA 4I5IA 4ISCA 1PQ4A 3CVXA 2YC4C 3EQZA 3OTOB 4KQKA 5DPMA 1YH3A 3VTFA 3CNNA 4ZOLF 2D1FA 3HR4A 2ZS8A 2QLFA 3H2KA 1OYYA 2JBAA 4ZEXA 4IIEA 2VTBA 4OFWA 1NVTA 1XTIA 1WV1A 2EW2A 1IN7A 3KAJA 3KV1A 5CXXA 2WTAA 1O95A 4YONB 1GGEA 3O8QB 2AMVA 3O7MA 2OXCA 1XKQA 2P1ZA 2PU7A 4JXKA 4DQKA 4YXWD 3DEJA 1VL5A 3JVVA 1JQKA 1OLSA 3AQ4A 3HYSA 1P6XA 3KWJA 4GUDA 4H3SA 3SIWA 5JQWA 2I91A 2HGSA 2RKBA 5IU6A 4ITRC 3DFIA 1EHYA 4E07A 2ZIWB 3KOYA 3D8RA 3N9IA 4L3OA 4M0KA 1LJ8A 2O07A 3BMOB 1W5SA 1NGSA 1L2TA 1Q3HA 1EFAA 2QI9F 1ZC4A 3C6YA 3HKCA 1I2BA 2NO0A 1EFRD 5KSYA 3WB0A 3W9UA 4LE1A 1NR5A 4ER5A 3UN1A 3SZMA 4B3FX 4DIMA 4NNPA 4P53A 2A9KA 4O2AF 3MINA 3RUCA 4V38A 2FB9A 1N2CA 1P7YA 4DPLA 4ZD6A 3VHRA 3OQBA 2ETVA 1BN7A 4CNQA 1S1MA 3NOOA 2NUBA 4UHJA 4BMDA 5G53C 1FFYA 4DA7A 5BO5A 1ISSA 1V1MA 3EZXA 5BPHA 2FWJA 1WKBA 4UMFA 2PMBA 2YOHA 2WTEA 3D4LA 2R6AA 421PA 1RWWA 5LIRA 1DDIA 1E9DA 2VHJA 5BYBA 5CM2Z 4ADSG 1U2DC 4Q15A 3NHAA 2Y0DA 4EHAA 2YYZA 1JQLB 1NHGA 4B7UA 3JD1A 2J33A 1WCXA 3BE5A 4BBJA 1CF2O 1V41E 3IBYA 1YCDA 5KSOA 4WZZA 1RI4A 2XBLA 4PWZA 4W7HA 5G4KA 4DYHA 3CG0A 4FHCA 4P83A 1Z56C 1IQUA 2DSNA 4NQRA 3H2SA 1CETA 3F2VA 4TVSA 3OE1A 4J3FA 4GMGA 1OBOA 4E32A 3OU2A 5LDGA 1E7YA 4I5EA 2RAVA 3H2GA 2PMEA 1U0SY 5DF1A 2IEGA 2WB2A 1CY8A 3BSYA 4FCVA 2HC9A 1Q12A 3T38A 4HDQB 3NX4A 2HSDA 2GXQA 2W22A 1UC8A 1SVSA 4GPD1 2QR2A 1Q3TA 2QTBA 3I04M 3C6KA 1EK1A 5KPJA 1KY3A 3TVYA 3QELB 3FAKA 3GLGA 3LF2A 4LZJA 2CB0A 4MR9B 3GVPA 4E5VA 4YHHB 2WQ7A 3D3WA 2JFXA 4D82A 4IW3B 1E79A 1NYQA 3AVPA 2B4TO 2WYOA 4QODA 3DONA 1V5WA 2D54A 4L5CA 1CRLA 1B26A 1O87A 3KJIA 3I9NA 4JR1A 2V58A 5JMPA 5D6NA 5DHUA 4DDUA 4OG2A 1GNVA 1T34A 2NZVG 4DM3A 1X9GA 2OAQ1 1Z8NA 4J6FA 1JEEA 1L8AA 1XQ9A 3LW7A 4IOMA 2Z5LA 4YWJA 4DIFA 3R5FA 1Y5RA 5J58A 2ZE6A 4L8FA 1PJ4A 3QGMA 4O8ZA 4HQ6A 1YL5A 4QEZA 5DCWA 5FQNA 3WDMA 1A8HA 1Q95A 1XZQA 4DW8A 3IP7A 4LDPA 1WMFA 4H1TA 1C8LA 3OESA 1RYBA 2ZAGA 5GTDA 3I42A 5DXAA 2HREA 4GGMX 5EIXA 4WRRA 3W4KA 1V16A 2PMKA 4QM7A 5AJTA 1KQNA 3IAEA 4R0MA 1YAJA 4QU5A 3B5EA 2FSPA 4TYWA 4O6VA 3PK0A 5I9BA 4XM1A 2GD0A 3ZZMA 2JFZA 4KWCA 1TZMA 1NW6A 4ARBA 2WHPA 4A73A 1ZIPA 2W6NA 4JN6B 1DIRA 3UB3A 4DXHA 2X2EA 2Y77A 4OXXA 5L53A 3QHPA 1VL2A 2FR0A 5G0VA 3ZCRA 4B3DA 2YVLA 3IPAA 4XZ3A 3CJRA 3K0KA 4NZZA 3NWEA 5IJWA 2DJ5A 1A2BA 3FYUB 3VR6A 4IIYA 3REFA 3U7FB 2XAAA 4B33A 2V8OA 1IBKB 2BTOA 5HKKD 2QX4A 2B4QA 4WPGA 4YJ2A 4ENVA 3W5CA 1JR3E 2J7PA 2WT9A 2F1IA 2XKKA 1U4OA 1XZLA 5E9JA 3LKVA 3B9PA 1QHXA 2IYVA 2QZSA 2JFYA 1ZRMA 1Z7WA 4QGSA 3MUOA 1CFZA 3MW8A 1ZX1A 2ZUSA 1UT8A 5IVDA 3LI2A 2WMYA 5FAXA 5TGTA 3UHPA 1IZ8A 5FV7A 3W77A 3WGOA 2YHUA 5B7GA 5ERGB 4AUMA 2OCDA 5CFPA 2A35A 3A9UA 1FTSA 2JFWA 3CVJA 2FP3A 3KAQA 4M1MA 4M55A 5L3RA 4C7KA 3L6RA 1EX7A 1SXJA 2WJZB 3LTNC 4TZ6A 3SR4A 1ZUNA 2JLRA 3HN6A 1TTPB 4A2CA 1CS4C 4G09A 1FP4B 4UZSA 3W1VA 4PM4A 4PLZA 1P1FA 2XOKD 3PWSA 1VPTA 3FOZA 1KRWA 4MSUA 2D5IA 4LOJA 2CDNA 3FWYA 4OHZA 1ZD9A 2Q3EA 2JKZA 3CZQA 5JD4A 5LZ2A 5I9SA 3HA3A 2C5GA 1E2IA 4RXMA 4COOA 4NFHA 1UANA 1N92A 3TGLA 1JFVA 1J49A 1WBJB 1KDOA 4G8BA 4WFQA 2P9ZA 4DNPA 4F38A 3GJQA 4FFOA 1XJWA 4Y2YA 1C0IA 4BO5A 4D3XA 5EESA 2UUOA 2IHJA 1TCUA 2ODBA 4Q4DA 4UBOA 3WBBA 4HNRA 3NT4A 1RKVA 2ATCA 3OTWA 4C4RA 2BEUB 4ZI3A 3DV0B 4J91A 3WMXA 1FXWA 1MGPA 2PR2A 3PXEA 4MEBA 4DWWA 2C7RA 1MAVA 3RVOA 1E59A 1M7HA 5LUAA 2J5RA 4CFZA 1GQFA 5JCXA 3EUFA 2OHHA 1XL0A 4IDDA 1QX3A 3W0LB 2EIHA 3CKLA 3K0AB 4HDKB 3RRJA 5CFZA 4RETA 3Q85A 3G0CA 4IIDA 3U4AA 1ARZA 1RWKA 4P84A 1DJOA 1THTA 5JCOA 1X9HA 3LIPA 3MFQA 3RTAA 4F45A 5A3SA 2QMQA 4KFSA 3HLTA 3W5HA 1V9LA 4B6QA 1LPMA 3DPUA 2I33A 3GDOA 2HM7A 4XOIA 1DDGA 2XYQA 4QARA 3SZGA 3OA2A 1CUHA 2BKUA 1KC1A 2HWKA 4U3JA 1KDPA 1JTEA 3KOWA 4MWGA 5FWXA 3CX3A 3TFQA 5A06A 5JBIA 2J7KA 5AKZA 1I1NA 3QUAA 3O74A 5MFZA 3ANMA 2HGZA 2LDBA 1ZIXA 3DEFA 2W2PA 1L4LA 5JCPA 4N39A 2PUTA 3UV6A 2C2YA 3CUTA 5CHYA 3A4MA 5CVVA 1MT0A 1TA0A 2VDJA 4GXRA 3GGDA 4KL8S 5ALJA 4MNTA 2O3QA 4OKIA 3FKSD 3U2QA 3WRVA 2XRFA 3A3YA 2NU7B 1SIOA 3QHQA 2VTDA 3H8VA 1CEYA 3ZHZA 3Q2IA 5ED4A 2LNDA 2I03A 4MQFB 2F43A 5CNKA 1D04A 1P7CA 2NUTB 3PU6A 2RHGB 3UMJA 2BHRA 3T15A 2IHNA 2P3LA 2WWIA 5EXEA 1N1GA 2D00A 2G28A 3PR1A 3BMNB 4MGEA 1B8UA 3ZHUA 3W2HA 8ADHA 3THXB 1KJ9A 1KORA 1T6BY 3DWGA 3SIXA 1TW2A 1KE2A 1A9XB 2FZGA 1T43A 1Y7TA 3URMA 1PV4A 1ZVMA 2WA2A 3GO4A 3PSHA 4N03A 4DNOA 1ESDA 1H3NA 2JIPA 2FZLA 5JC1A 1YRHA 5HCIA 3KUXA 1SCUA 1LK7A 4BCDA 2CNLA 1DAHA 2B2CA 2BCJQ 3A10A 3JQBA 4IRMA 2ZATA 3ESRA 3C6BA 2E85A 3CVUA 1B7GO 2ID4A 5ARDA 4YV1A 2EF0A 4OHYA 2O2SA 3AF6A 3KE9A 3HEBA 3EEFA 1Z5GA 1VRWA 5HGXA 4IDGA 3NAGA 5INTA 2XE4A 4Z9YA 5KSZA 1JU4A 4G5SA 1T2FA 4PCVA 5DWDA 1ADFA 3KVVA 1P4SA 3WYGA 4A5SA 2YH2A 2PXAA 1KPIA 3LY8A 5F4BA 4O33A 4YCBA 1Y8QB 3FTQA 4PONA 5JJBA 1TJNA 3B3JA 8GPBA 1KZHA 2YXEA 2FW0A 1B6RA 4U8GA 2DFTA 3HA2A 1H2FA 2UUPA 2YR0A 3GDFA 3SFTA 4JLMA 3JZMA 2VHWA 3U4HA 5E7QA 2H16A 4RM2A 1KO4A 1NY5A 1ZW6A 3ILHA 1U0OC 3FDZA 3DFFA 3TZHA 1H85A 5KWSA 2KQUA 4OX9B 2NP7A 1NWHA 3AP2A 2V45A 4JMLA 5EJAA 3HWX1 2AC4A 3DT8A 4AN4A 4IX9A 3QEOA 2ZOSA 5LJIA 3OICA 1W6RA 2FEPA 2L18A 3RTGA 5AM2A 2IK8A 1MTOA 3K92A 3MWEB 3O91A 3TOVA 3R3HA 3HLYA 2V3CC 1BWRA 2WIGA 4IVPA 1MJHA 5DSXA 1I2CA 4CV3A 3NBXX 4EB0A 1CUIA 4FYVA 2FOIA 1UM9A 3R3ZA 5L7TA 4DV0B 2NVOA 1KSJA 2XGJA 4Q4AA 5JYDA 1ZJ4A 3F47A 1ORRA 5FPTA 4EFLA 1FS5A 1PJRA 1VPVA 1JSXA 1WMAA 3ISVA 4Q00A 3CU5A 2V1UA 3UAWA 1GSIA 3HV2A 4B9AA 4GI3A 3ICOA 5CPBA 3TGPA 4ZV9A 1XEXA 2H0RA 1ODLA 4J0QA 1OWMA 2GBLC 5TPWB 2WDZA 2XCSB 2C94A 1V2HE 3KLPX 1A8PA 4YJGA 1UWVA 1XV5A 2XVMA 4Z49A 2V3VA 1A9YA 5DI3B 1TU0A 2O6HA 4DDVA 1OFUX 5D3QA 3KXPA 4IG9A 1NVFA 4HDMA 2HJ9A 1HDIA 5F7ZA 3E35A 4OHVA 3A1WA 3LD9A 1LQ2A 4FILA 4PZ0A 1ZJZA 1RLOA 4QXMA 3O0DA 3ETDA 5GM1A 2PZKA 2SNIE 1U9ZA 5LN1A 2R1TB 1VKOA 1XROA 3BMQA 3IT0A 5JXJA 4IXDA 2E0IA 4IIJF 3BF7A 4EI8A 1SQ0A 1MENA 4TLBA 4CFYA 1XOIA 2BE7A 3OT5A 3M6UA 3IQIX 2WT4A 2GA8A 3IV7A 3LWBA 2OWEA 2W2KA 1ETHA 5DI9A 1M1YA 3A4NA 2QG6A 2UZ3A 3DPIA 1YZGA 3ETGA 4YECA 5JD5A 2ZJ1A 5JASA 5A4KA 2G7MC 5BUZA 3RUFA 2I54A 4AY6A 1YUMA 1ZKDA 3OIDA 1HL3A 4IXMA 1LW7A 3BH6A 3OUTA 2ZBRA 2CKDA 4DJAA 4LTDA 1PT8A 4B45A 1XCPA 2I6GA 3E7XA 4FN4A 1XNGA 1WL8A 1M6YA 5EKXA 1ADCA 3UWMA 4WUVA 3P9SA 3H4TA 1L5GB 4UDXX 2W2XA 3IDAA 2BZSA 2PLNA 4BNGA 3KIPA 1ZONA 4KE8A 4G1FA 3IQHX 1KQ3A 1U0FA 2A94A 3BB4A 3M6WA 4V1CA 3EIFA 3HL0A 1PFYA 4ZQCB 3Q6IA 3EMKA 1PJQA 2PKCA 3HABA 5EJ9A 2GXSA 3R75A 2ZYDA 3G6KA 1JDUA 2AG5A 3PJRA 4RE6A 2XXAA 1T3TA 3SNKA 3FAZA 4YRAA 1M2VB 2HAEA 4AU1A 3ADCA 4C22A 2RB4A 4MMYB 4CDGA 1UP7A 4M60A 2G4LA 1F8XA 4UMEA 2P3QA 5J4HA 3MJ4A 3UXHA 5H3LA 4U00A 2JLYA 1RPZA 2ZRPA 4N0QA 2WM2A 4I4NA 1COWD 4WOCA 4F9TA 4ZGWA 1U7DA 4MICA 5F9MA 2A0YA 4P3XA 4LAFA 3C3JA 1E7RA 1CUBA 5AK5A 2PZAA 2DCUA 1GZ3A 3I2FA 2X5JO 3KTAA 1K4YA 1V45E 4RS4A 4LVOA 3T12A 3ZWNA 4FYPA 4F4IA 1N77A 4LXTA 1KFCB 1V8PA 4TS9A 4ESEA 2Z3VA 2D06A 2VSFA 5AW1A 4ZVPA 4PQEA 4B74A 1JEDA 4GX1A 2HJVA 4INPA 1GZVA 4RANA 4RMHA 3B7GA 3WB1A 1CNFA 2XITA 5ALSA 4RIHA 2ORED 4RSHA 5KKCA 3TF5A 1NBEA 1H6BA 5D01A 3FTNA 4ZI2A 2PRZA 5DV9A 3F5DA 1FOEB 1FB5A 2JHFA 2PUHA 3N2GA 3RTBA 4RCYA 2MINA 3DTVA 4BV2A 2PX0A 1PJ3A 2ZU0C 3SJ7A 3P27A 3I5UA 1P75A 3CH6A 2CNOA 3G5AA 3FNHA 1SUEA 4GBGA 4LMBA 1EWVA 2JAOA 4MR7A 1DXQA 2VI5A 4PAMA 5TEWA 4ABYA 4Y2VA 4BFLA 5B4TA 2WHXA 3FFWA 4FNAA 3BWVA 3NWJA 4ND7A 3THWA 1CUJA 2QAJA 4XLTA 1HG0A 3OC6A 1PZFA 2PY6A 1I24A 1SUSA 2PX4A 4MLPA 3PLRA 4BO8A 3ZIAD 2KHZA 3L07A 2XVZA 3HKDB 2NG1A 4E6EA 1NC1A 4TZTA 2DR0A 4KCGA 3BA6A 2RHRA 1PR9A 1CUFA 1LLDA 2RK3A 4HH3C 5DGXA 5ERXA 2H63A 4CDMA 5BOSA 1IL0A 4TV9B 5ITZB 5H9VA 2ONJA 2G5TA 4H4DA 1L4EA 2P2ZA 3OZVA 3WNBA 1UT5A 4MV9A 1ZXLA 3MAGA 4KPGA 3N2KA 3C5HA 4URUR 1W85A 3IT3A 3GLIE 2VCYA 2TMYA 2VDWB 1PJLA 2FVYA 2VXCA 4EF6A 3X1DA 1P2VA 2FRVA 3S5JA 2ZI4A 3REOA 4AX8A 2RC6A 2JRLA 1RDFA 1BXRA 2HL6A 2YWHA 1NPTO 4AECA 3COZA 3N58A 4TWZA 4C5CA 1L1FA 3X1ZA 1PTJA 3KXKA 1CJUC 2BMFA 5JWHA 2A0XA 4R9VA 4MI9A 3S2IA 1JDPA 1TIKA 1N2SA 1UEXC 1FRNA 1VG8A 2REQB 4TT3D 3VHLB 3T5PA 2XGGA 1DL5A 2C9DA 3T3HA 1ORHA 4JI6B 4ESHA 3SDSA 2MYTA 4Y7DA 5ALXA 1E3JA 1E8NA 3BGOS 3L3BA 1KQGA 3NDBB 4M37A 5KWVA 1BGXT 4Y6GB 2CVFA 1L7NA 3DBLA 2QN2A 4I4LA 3LQKA 1MAWA 1BE6A 1W4RA 1EH5A 2AKEA 3F5QA 3WL6A 5IPFA 2TYSB 2FPKA 4LQCA 4RWZA 1RAFA 1RXCA 4ARVA 1PGJA 4FS3A 4BZXA 1ULBA 1YJQA 4GR9A 4NL4H 1N1MA 3ORYA 2C5HA 5I8ZA 4P80A 3ZIDA 3EXG1 2I6XA 1GTJ1 5AJYA 5JXIA 3Q40A 2NT4A 4MYSA 3FXAA 2IPOA 2DPYA 2QIPA 3CB4A 3PPXA 3G3EA 1UC5B 2ADOA 2JFFA 4BNJA 2XDWA 3H9GA 4GKJB 1PFQA 4V0KA 1G8MA 4WK6A 4TN5A 1VLHA 2XMRA 3G8DA 1NU6A 1ABFA 4JB3A 2OZPA 1T3HA 2OQIA 3G1UA 4IDBA 3K8ZA 4KAJA 4PSAA 1XTUA 3J80A 5K6TA 4DRYA 2YN0A 1HYGA 3CZRA 1EAMA 1JDJA 4OQ4A 4UUMA 4ZAYA 4C6RA 1A95A 3L06A 2ZSDA 1XG5A 3IB6A 5CG2A 4NPCA 1NYTA 3KHKA 1G1AA 4P1ZA 4Q3BA 1K4KA 4U5QA 1GY8A 4PBRA 3T1OA 4D9NA 4FOSA 4ZOBA 1N3YA 3EUWA 5LZ5A 4CI0B 5TMEA 3GV0A 5KJCA 5LMUB 4EY5A 1T2CA 2F2TA 3CVOA 1TVMA 3O8RA 1Z0FA 3I6IA 1M34E 4RIFA 1SCQA 5FBLB 2QYSA 2GD1O 5EKTA 3WBKA 4LJ4A