4KTTE

Structural insights of mat enzymes: mata2b complexed with sam
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
308
structure length
306
Chain Sequence
PNRRVLVTGATGLLGRAVHKEFQQNNWHAVGCGFRRARPKFEQVNLLDSNAVHHIIHDFQPHVIVHCAAERRPDVVENQPDAASQLNVDASGNLAKEAAAVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGEKAVLENNLGAAVLRIPILYGEVEKLEESAVTVMFDKVQFSNKSANMDHWQQRFPTHVKDVATVCRQLAEKRMLDPSIKGTFHWSGNEQMTKYEMACAIADAFNLPSSHLRPITDSPVLQRPRNAQLDCSKLETLGIGQRTPFRIGIKESLWPFLIDKRWRQTVFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function study of the complex that synthesizes S-adenosylmethionine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords S-adenosylmethionine synthase isoform type-2
total genus 101
structure length 306
sequence length 308
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF04321 RmlD_sub_bind RmlD substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4kttE00
4ZHSA 1ZSYA 1B8PA 1XR3A 4WGGA 1P33A 2NACA 2X8LA 3FBGA 1TLTA 2ZTVA 3UCXA 3H2ZA 2Q50A 1R4NB 4XB2A 4Z9XA 1WW8A 2VHXA 3SC4A 4G5HA 5DOVA 2CDCA 4A5OA 1BVRA 4YYZA 1U8XX 4M87A 4IMPA 1GQ2A 1BWSA 4CM9A 3JV7A 1O0SA 1QSGA 2W2LA 1J4AA 1F12A 4ND1A 1DIAA 1TT7A 3NT4A 4PVCA 3ETGA 5ICMA 4GQAA 3KYCA 3PQDA 3W8EA 4OQYA 4IINA 4EJ6A 2C29D 2EXXA 1U5AA 3INRA 2G1UA 4J2OA 5KVQA 3TFOA 5DULA 4S3MA 2Y1CA 3S1LA 4XGNA 3QQPA 3JYOA 4IQ8A 1NQOA 4WE3A 2DUWA 1BXKA 1HEUA 1HDZA 2GPTA 2H1SA 3V2HA 5BSEA 1BDBA 3FF4A 2J5KA 3QWAA 4RZHA 2AEFA 5GMOA 1CQJA 3EAGA 1I01A 2FOIA 2VOEA 2ZB8A 3EUWA 4CMJA 1YRLA 1F06A 3WQQA 2WDZA 2JAHA 5IZCC 3E18A 4OYRA 5TGDA 3AM5A 1B8UA 4XYEA 3ADPA 3WQRA 3FPLA 1HDRA 3H9GA 1LSOA 4DBVO 1DAPA 3HDYA 2WD7B 1IB6A 1Y5RA 4Q3BA 3UW3A 1SOVA 3Q1LA 2QG4A 4NNJA 4K1LA 3UUWA 2DAPA 5GZ6A 4PLWA 5AXAA 1R0KA 4D79A 4YT5A 2BFMA 4JP2A 5G4KA 5JS6A 4WLNA 4CQMD 3DHEA 2AQ8A 1L7EA 3ZW8A 1LSSA 2BLLA 1K89A 4J6FA 4DC0A 3ZNQA 3GLQA 4FJ1A 4J4BA 3QV1A 2BD0A 1EE9A 1XIVA 5KNLA 4BO3A 3UCFA 1B8VA 4J91A 4XR9A 4GKBA 4ZQEA 1R0SA 1PJ2A 5K0ZA 3UGKA 4WLVA 4CM9D 2ZTLA 2VHWA 2W90A 4P22A 2GZ1A 3PI7A 3WFJA 4OOEA 3GA0A 1CJCA 1VL8A 1O6ZA 1NFRA 4YRAA 3ENNA 4OHUA 3ZU5A 1CQIA 2E4AA 2ZB3A 2NUAA 2IZ0A 1ZZEA 3I4FA 3KEQA 3IC5A 2A4KA 3WFIA 5B4TA 3ZHXA 2R6JA 3FR7A 3BMOA 3GEMA 2IYOA 3OJFA 1PS9A 3CINA 3H9JA 3RQSA 2EWMA 3OM9A 2PLAA 4K6FA 5BNFA 3QHAA 2NTNA 2YFHA 3F5QA 4PLYA 3HJAA 2JD0A 4JN6B 2UDPA 3VZRA 3QA9A 1E1NA 2O50A 4GKVA 3RUCA 3VPGA 3L4BC 4MOWA 4DIFA 4AJEA 3WLEA 1HDYA 5KJFA 4BV9A 2HKIA 3H4VA 3JTMA 2B4TO 2DT5A 3ETDA 4PLTA 3PJFA 4E0BA 4L74A 3GY0A 1ZMTA 3GPIA 4GGPA 2DU8A 5JFOA 3R6DA 1CEQA 1NVTA 3PGXA 5C37A 3ZNNA 4E6PA 1R12A 4JCOA 5CAEA 2XOXA 4W9NA 1VKOA 4W6ZA 4BO8A 1NNUA 3OH8A 4GSKA 4MO2A 3S8MA 4IS2A 3BTVA 3VVCA 3JYNA 3E48A 3WYBA 4MVJG 3H5AA 4GGOA 4CMEA 3JQ7B 4D45A 5CEFA 1UUFA 4S1VA 3K92A 3AW9A 4TMFA 1FDUA 3I1JA 3PDUA 2DTEA 2NNLD 5IXYA 4MIOA 2X5KO 4PGFA 1E1LA 4NR0A 4UVEA 4CJXA 2J3KA 4BGVA 4B3IA 1ZCJA 1WMAA 3RUFA 5CEEA 2NU6A 6ADHA 3DHYA 1QYDA 1HE3A 1Z82A 4KMSA 2ET6A 5EQDA 2X22A 3OETA 1RYEA 1SOWA 4Z9YA 4RQTA 2Y05A 1HYEA 1LRKA 3KYDA 4UUPA 1GPDG 4RL6A 1WWKA 4AJOA 2QZZA 2E37A 8LDHA 4FR5A 3ZWYA 1E3SA 2GN4A 1XA0A 5JMWA 4ZN6A 2AXQA 1PJBA 2IZ1A 4RORA 3ZV4A 1G0NA 4IZHA 4E3ZA 1D8AA 4WLOA 3WNVA 3HFGA 3AUTA 4BHTA 4H16A 3U9LA 3RUHA 2PD3A 3DO5A 1V3TA 4QXMA 1Z73A 3M1AA 3UVEA 2ILTA 2WEKA 3S2FA 3JQ9A 1O9BA 4ND4A 1E7MA 3KSUA 3MTJA 1KY5A 4FS3A 2NU8A 1G1AA 4CV1A 1EMDA 2JD1A 1O94A 5B37A 2QYTA 3QY9A 3UN1A 1BW9B 1Y9AA 4FJ2A 1NVMB 1UP4A 2DBQA 4IJKA 1JWAB 1LDBA 4DPMA 3KETA 2FP4A 5BQFA 1NTOA 5L7YA 5ICSA 1YQDA 1OC2A 3JQ9C 1AN9A 3CMCO 2EERA 4K9DA 4CV0A 5KWEA 1NXQA 2P5YA 4XB1A 3BTSA 4Q39A 5BSHA 3O8QA 4RF5A 1K3TA 3V8BA 2DTXA 4KDFA 2AG5A 4QO7A 5IZCA 2ZATA 1LDEA 2GN6A 4TZKA 5U1PA 4CM5A 1B7GO 1HE5A 2F1KA 2FZWA 4URFA 2D59A 2GZ3A 5IDWA 4NFSA 3EZLA 1M76A 4FFRA 5GY7A 3MZ0A 5HBRA 5JC8A 2X5OA 3L6EA 3LVFO 4AJJA 4CM4A 1LC0A 1ULUA 4IDBA 4E31A 1D3AA 1DIRA 2HMUA 3OFSA 3TJRA 2RHRA 4OSPA 2HAEA 3W8FA 4ZGWA 3KB6A 1W4ZA 3IDSA 1PJTA 3GFGA 4Y67A 1TEHA 4JROA 4RZIA 3L77A 2Q2QA 4P4NA 4J7UA 4UUNA 3E5MA 4J4HA 2YHUA 2R2GA 2HDHA 2VNSA 3TZ6A 4XRGA 1AHIA 4R1NA 3OJLA 1E7YA 1LEHA 1CERA 3A1NA 3N58A 3DOOA 4LVUA 3DMTA 4DXHA 3TSCA 3W4IA 2PV7A 4PLHA 1E92A 2GR9A 4MP8A 2D1YA 3NX4A 4BKQA 4YR9A 5BT9A 3UXYA 3FI9A 3KSDO 4UVGA 3VPXA 2HSDA 4NI5A 5EESA 3H5RA 3ZWNA 3OIDA 2G5CA 5FEUA 1NHGA 1DHRA 5A9SB 5AVOA 2Q49A 2C2YA 4NQZA 5CG1A 2JHGA 2X6TA 3LC1O 2OBNA 2V65A 4A27A 4AJHA 3PZRA 3EY4A 1E1MA 1BXGB 4CQLB 3AU8A 4QEDA 1YS4A 1LTHR 1GQQA 4E30A 3R3SA 1A4UA 1JDJA 4PLPA 2PFGA 1HZJA 5DCWA 3L9XA 4CMBA 2DUUA 2VT2A 2WJPA 3GGOA 1WMBA 3GFBA 1RM5A 1P1HA 1PL8A 1T2EA 4DQVA 1ZJYA 1AUPA 3OQBA 3ITKA 5BR7A 3WGOA 1XGKA 2Y1EA 5JYEA 4HXYA 4WUVA 1PZEA 1WZEA 4MINA 2YDXA 4FOSA 1XDWA 4K28A 4PRKA 2NVBA 1LSJA 2YUTA 3PVZA 1NR7A 1ADBA 3OJOA 5EERA 2CMDA 4BKRA 4RLSA 1PJ3A 4HWKA 2PH5A 1V3VA 4EUEA 5CHEA 4RV9A 5DCYA 5F21A 4Z6KA 5G2OA 3UF0A 5JAZA 1XU7A 1YJQA 3V5NA 4O1MA 3VKVA 2PH3A 3T4XA 1E1KA 3GUCA 2Q46A 5H81A 3M2PA 5CEJA 4ALNA 1A27A 3QJ5A 1VJTA 4UVDA 5FF9A 5JSFA 2RH8A 4YT2A 3DQPA 3Q9NA 4P38A 2Q45A 1T24A 2VZ9A 4I9HA 2E49A 4TSKA 1GFSA 2QW8A 1Y8QA 1MGOA 2GERA 1M6WA 4IJUA 5G0TA 1F8FA 1P1IA 4IMRA 4ND5A 4CLRB 1LXCA 3B20A 1K2WA 3LT2A 4LN1A 1HSOA 3RBXA 1I24A 4BS9A 1KS9A 4FN4A 2I66A 3FWNA 2GGSA 2FSVA 5G0UA 1PQWA 1R66A 2WMDA 5JDIC 1K5HA 1OOEA 5G0WA 5JAIA 5F1PA 1PGPA 3CPSA 1DLIA 3K73O 2H5LA 1MV8A 3F5SA 3Q2IA 1WAMA 5KTKA 4Y6PA 2VWPA 3VHRA 2VQ3A 3KTDA 3NUGA 4GWGA 3JYLA 5HA5A 4ZICA 3NAQA 5JXWA 3CUKA 1T2CA 3OIGA 1PR9A 3SEFA 3X2FA 1HZZA 4GX1A 4U0JA 1LLQA 5A4DA 1L7DA 4GX0A 1I2ZA 4UUMA 1UDBA 5LDHA 4R1TA 3MJTA 2NQTA 4M89A 4IDGA 2VHVA 3STHA 2I67A 1NYTA 3VKUA 4I8XA 4JBIA 3JD2A 1JKFA 3RC2A 2B69A 5JLAA 5KVCA 2QIOA 1PGOA 1PS0A 1IUKA 2ZK7A 4R01A 1U5CA 3FPCA 3JQBC 4BQRA 4P4GA 2BGMA 2EF1A 4D3FA 4YXFA 4RCVA 2DPGA 5A05A 5DN9A 3I9OA 4DGSA 3ULKA 1LA2A 2DBRA 1P74A 2J8ZA 2AA3A 5ENDA 4JXKA 1A71A 4DA9A 5A3JA 1SB9A 3U0BA 4AVYA 4BO6A 3I9MA 5FFFA 4HY3A 4DQUA 4AJKA 3DBHA 2O3JA 4U0KA 4CM1A 3GVCA 3IKTA 2BFOA 3Q11A 3L0DA 5DBGA 1N9GA 1N92A 3WX0A 2AQIA 3KOUA 5JC1A 3EVTA 4LSWA 3U4DA 1H2BA 4CMAA 3P2YA 2PKQO 3EYWA 4BNNA 4CM8B 3G3EA 5ILOA 4H15A 1PWZA 4P4LA 3L6DA 1KY4A 4MKRA 4B4WA 3D4PA 4YAGA 4L8VA 3FBTA 3D3WB 3QP9A 3VH2A 3PHIA 5L4NA 1LNQA 1N5DA 1IOLA 5A9TA 4C7KA 2CVOA 4P8RA 1N9GB 5JBIA 2BI7A 3OECA 4CODB 3TZQA 1EDZA 1P1FA 1SZJG 5I8WA 5JO9A 4PLZA 3H9UA 3KYDB 4ZVVA 4PN3A 1V3UA 3HHPA 3M6IA 4EJ0A 5L45A 2R00C 3DZHA 3SBOA 2VZ8A 1Z74A 3GZNA 4F6LA 4OOFA 1JQBA 3C8MA 2B83A 1YL6A 3D3WA 2XAAA 4DLLA 4BIIA 3VTFA 1KEUA 3SLKA 4QTZA 4UVHA 3PHJA 1Y6JA 4XQCA 4NJOA 5LCXA 1H0KA 4EJMA 3HSKA 3UKOA 3V1UA 2QRKA 4J43A 3FD8A 1KOLA 2P9CA 5U4QA 4E13A 1DJQA 2TMGA 2XPCA 3WWYA 1VL6A 3SLGA 5HS4A 1YH3A 3HG7A 2PNFA 3NGXA 2H9IA 1UXHA 1PJLA 3Q3CA 1LLDA 4I9NA 2PKRA 3E1KA 2GSDA 1NX6A 4OMUA 2G0TA 3B70A 2VRBA 3QVOA 1P1RA 4YWJA 5C7LO 3WDSA 4D0RA 4D46A 3QWHA 4R51A 1PR3A 2NM0A 2G17A 1U3WA 4GLLA 3SXPA 1GADO 3K31A 2Q2VA 2WTBA 5A06A 3S2GA 4PLFA 1RPNA 5FI5A 3WR5A 4UAGA 1KERA 2PGLA 4OJNA 1CYDA 1J5PA 2PGDA 5I8ZA 2ZYAA 2O2SA 5G4KB 4A0SA 4Q3EA 4ZQHA 1FXSA 1QYWA 3D64A 2Q1WA 1F0YA 4Q3DA 3LC7O 4HBGA 1ZFNA 3WNQA 3DTTA 3HN2A 3PWSA 4R4JA 1I8TA 2H6EA 2VTEA 3E9QA 4D44A 3WYEA 5KIAA 4GVXA 2J3IA 4M49A 4DYVA 1NR1A 1X7GA 3AUAA 1C1XA 5TQVA 3WGZA 4B4UA 3HE3A 1UXIA 3BMCA 1VM6A 3RUDA 3A9WA 2V7PA 1ZK1A 5LC1A 2X0RA 3HNPA 4BNYA 3PWZA 3DZBA 1ADCA 3ENKA 3K2EA 4YA6A 1PL6A 4PG5A 5I9MA 3RVDA 1JKIA 3C7AA 4H3VA 3OHSX 2FPIA 4QT0A 2OP0A 3N7UA 4NMHA 3FNFA 3ETEA 4CLEA 1ML3A 5MDHA 5A9SA 5HTOA 2DC1A 3W6ZA 3FWZA 4CQMB 1W8DA 3IOYA 3GNTA 4AJ4A 2Y1FA 4N18A 4PCVA 3AFNA 4IQ0A 2JJYA 2O2YA 4BOYA 1KYQA 1QP8A 1R15A 1YL5A 4BGIA 1V6AA 1W6UA 3ON5A 3INTA 1AXEA 3DFUA 1TT5B 4Q3CA 1LQTA 5AXBA 1D1SA 1VI2A 3C1AA 3RUEA 1GZ4A 3SX2A 3ZHBA 1PSDA 3U5TA 2C7VA 1V0JA 3OF2A 2D8AA 2HK7A 3PHLA 4XD2A 2C07A 1LDNA 4YACA 2ZB7A 1R6DA 3GT0A 1FDVA 3DR3A 1QRRA 1EVYA 4Y8VA 1E3LA 1X13A 3UAGA 1IZ9A 1A9ZA 3ZHYA 5TIIA 1RM3A 4D42A 3TOXA 4ALIA 5B1YA 2O7SA 2P9GA 5K9ZA 1N7GA 4FC7A 5KKCA 1YBAA 2YV2A 2VHZA 3IUPA 1PJQA 9LDTA 4J49A 3ZZNA 3PFFA 1A5ZA 1EUCA 3QWBA 4J1TA 1BTOA 1X7DA 2DTDA 1GD1O 4NK4A 1UXJA 4MVJM 3GZ4A 1GUZA 4B7XA 3RBVA 4WJZA 3O8QB 1HDGO 1YWGO 5A02A 1EEHA 4WLUA 4CMIB 1GAEO 3PGJA 3UFXA 4AJLA 4YJDA 1OC4A 3IKVA 5CFZA 3FRJA 4JX8A 2JCXA 5T67A 1C3VA 1H9BA 2C0CA 1I2CA 4LRTB 1GEEA 3E9NA 3I6IA 4YAJA 5DF1A 4U6QA 4L73A 3D5TA 4L4SA 2VUUA 3NYWA 4HUJA 5C5IA 3ONDA 5A1TA 1HSZA 3BTUA 2X9GA 4XDZA 2FMUA 4CV3A 1EBUA 3V2UA 4PLVA 3U49A 4J2HA 4RVSA 1Z7BA 4AJPA 4N7RA 3WJ7A 3OA2A 4EBFA 5HWSA 3LT4A 3B1JA 4I9UA 5CG2A 2BI8A 3JD1A 1DAOA 4JIGA 3TNLA 4LISA 1KEWA 1R37A 3VOSA 1DBVO 2NVUA 5CDUA 2NTJA 3ASVA 4BO7A 4IXTA 1QG6A 2VNAA 3RJ9A 1MFZA 3PYMA 4FPXA 3PRJA 3ANNA 2FPGA 2GF2A 2H63A 3VTZA 4CMGA 2FRDA 3K5PA 3MCVA 1SEPA 2IZZA 3VDRA 3WGIA 3PFWO 1HETA 5C3MA 4ZA2A 2O3SA 4WEOA 1AHHA 1B14A 2JFGA 3NTQA 3B1FA 2CY0A 5HRUA 4WLFA 1JU9A 3X2EA 4F6CA 2PGJA 3QVTA 2EW2A 4GH5A 3FNEA 3WIEA 3ZWWA 1EBFA 1OZAA 3JQGB 4J9UE 1M66A 3JQAA 3JYPA 1ORRA 1YBVA 1TVEA 1YO6A 4OAQA 3RC1A 4BMSA 4GI2A 4J7CA 1YKFA 3TZKA 4ZRNA 5JO0A 1IZ0A 3MTGA 2Q99A 1H9AA 2Q2WA 2YYYA 4MVJH 5KJ6A 4JBGA 1UP6A 4FFPA 1CRWG 4QUKA 1B16A 1I3LA 4E2WA 1MX3A 3DBRB 3K2BA 1A4IA 2OGUA 4BNMA 2QX7A 4IDEA 1GUFA 1RJWA 3COSA 2RIRA 4DPKA 2AQKA 1PZHA 1IY8A 4TKMA 3VAZA 5I7EA 1CWUA 3JSAA 2ZJ1A 4CV2A 5JAMA 3K8ZA 3ZCXA 1E3EA 2GLXA 5DBIA 3KV3O 1XQ6A 4J9VA 5T6BA 3DBVO 2BGKA 4ZRMA 5DNAA 1S7CA 4E5PA 1P1KA 3ZH2A 4W99A 4CMHA 3GK3A 4DRYA 1KVRA 4AFNA 4J1SA 1SO8A 4DREA 1DPGA 2GO1A 5IZ4A 1RM0A 3ZHZA 4TRMA 5THKA 3VZSA 4XDYA 3TDKA 2C5AA 4K6CA 1ISIA 1E3WA 5EMHA 4R9SA 4NH4A 4DLBA 4WASA 3EW7A 4WNCA 3PPIA 5JDCC 2YJZA 2YV3A 3LDHA 3CKYA 5L9AA 3MJCA 4HADA 4U5QA 4BQPA 1PX0A 1BXGA 1YVEI 4CQLA 1ENOA 3AJRA 2EP5A 1ZUD1 3NT5A 3GG2A 5FYDA 2C7GA 2Q4EA 3F9IA 5L4LA 3AY6A 4ZQBA 3AY7A 2Y93A 3FNHA 1NVGA 4U8GA 2UYYA 1NFQA 4I5GA 4TWRA 1LX6A 2C20A 1WDKA 4MJLA 3MJ4A 4BB5A 4XQ9A 4ZD6A 3T4EA 3FTNA 4J7XA 3VH4A 3RC9A 1A72A 4GLOA 2Y1GA 4HFNA 2CDBA 4I1IA 3I23A 1HRDA 1QR6A 3VVBA 4E21A 1CIVA 2VYNA 4E32A 3JQGA 3ZN2A 1VJ0A 3IJPA 4B79A 3RFTA 1I0ZA 4YPOA 2VOJA 4FFNA 1B26A 3W1VA 5F5LA 4I5DA 3HQ4O 1KBZA 4JJFA 1I36A 1PTJA 1LC3A 1TI7A 4NBVA 1NQTA 2JCVA 3VDQA 3VPSA 4BNKA 5IDQA 2ZCVA 4CL8A 5COAA 1X1EA 5T8KC 3DWFA 3TQHA 2B35A 4CLDA 4BO9A 3TRIA 1ZBQA 4I08A 2I65A 5TX7A 1T2FA 3HADA 2AE1A 3NTOA 4XA8A 3JD3A 2X23A 3AOGA 1SMKA 1UP7A 2CF5A 3PYXA 4HFMA 4LK3A 4XWYA 1P9LA 3VPHA 4IJWA 1C0PA 1I3KA 3O4RA 4E4YA 1NP3A 3TPCA 4WOJA 2D3TA 3DONA 1ZW1A 4R1SA 1H94A 3RIHA 1ZK2A 2OUIA 2E6UX 2O48X 4IIVA 4IUYA 3IJRA 1T25A 2QRJA 2ZB4A 3JQAD 4GX2A 2P4HX 3GNQA 1Q0LA 4AICA 3WBBA 3A28A 4L76A 4W7HA 4BL5A 4R16A 3QE3A 3ICCA 5KCZA 2POQX 1Z7EA 3U09A 1ZSNA 4ILKA 4XYMA 2C2XA 5IXSA 1Z45A 2EKPA 3M2TA 2B0JA 1EVJA 3LYLA 4RVFA 4DYDA 4IPTA 5F1KA 5C7OO 3E82A 3AM4A 3AK4A 4JNKA 3AM3A 1XLTA 1YOVB 1BGVA 3OICA 4E2XA 2NADA 2CZCA 3IQDB 4LGVA 3F1LA 4FGWA 2R00A 2HUNA 3GGPA 3NJ8A 1BSVA 2BHLA 4HKTA 4INAA 4BGUA 4YJGB 1Y9EA 3OEWA 1RKXA 4R3NA 1WDMA 1XYGA 4R54A 3RD5A 4NIMA 3WIDA 1FMCA 3I52A 1Q0HA 1K6XA 4WLEA 3L9WA 4ND3A 3H9QA 3H6KA 4NFHA 4TROA 1ADFA 1GEGA 2Q1TA 1PIWA 2EV9A 4NBTA 2ZYDA 2EGHA 1NASA 2GYYA 3G79A 5JCJD 4YTEA 4YVFA 1ARZA 2W98A 2HK8A 3DMTC 1MFPA 1MLDA 1M2WA 4E12A 2YDYA 3PJEA 5L7TA 5ILGA 3DOJA 4YJGA 4JK3A 5I9LA 4MVJP 4NK5A 2NLOA 5G0VA 2J3JA 3I9LA 1BVUA 1QMGA 3RROA 2NQ8A 4XJTA 4D7AA 3W6UA 4Q3NA 4B8WA 5TJ9A 3ST7A 1ZMOA 1ZXLA 2RH4A 1UZLA 4FIZA 2EEZA 4R41A 3F1KA 1ZSVA 2NU7A 4R5MA 3MJEA 3WSVA 3C1TA 4CR7A 2PZKA 3LF1A 3DOCA 4R5HA 1DOHA 4II3A 5I7SA 4XQGA 4NDNE 1O89A 2X7HA 3DBLA 3F46A 2WM3A 3OMLA 1XHLA 3C3XA 1X0XA 1Z75A 3NT2A 5IDXA 4JP3A 3AY3A 3PHGA 1X15A 1XEAA 1HDOA 2A92A 2AQHA 2CSUA 1P0FA 1WNTA 1AXGA 4DVJA 1DJNA 1MB4A 4H7PA 3CZMA 1GYPA 1EFLA 5I7VA 4ALMA 5AYVA 2NSDA 3RI3A 5CP8A 2DPHA 1EK6A 1UDCA 4IDFA 4ITUA 3ZWMA 3DBLB 1JWBB 3WXBA 2HMVA 3HDHA 3BIOA 2Y67A 1JKJA 4FFOA 4IGFA 3BMNA 4RJTA 3LK7A 1KIFA 3DZKA 1C1DA 2P9EA 3GQVA 1E7QA 3TZHA 5CDGA 4KWIA 1UAGA 2B5WA 1HWYA 4A7PA 1UZMA 3D7LA 4DMMA 4FBGA 3H5NA 1HE2A 4RQUA 1FF9A 4Y9DA 1GCUA 5KVVA 2EJVA 4JJIA 2Z5LA 1ZKMA 4OXKA 5AQ1A 4FDAA 1P0CA 1ISGA 4CLOB 3O03A 5CPBA 5ES3A 2IEDA 4GMGA 1DFHA 3WSWA 1ZK3A 4A2CA 2P91A 3JQDA 4RF2A 4CPDA 4EEXA 1I5RA 1D1TA 1BDMA 3F4LA 1DIHA 1KEPA 3ICPA 4IY1A 3DZGA 4B7CA 4CM4B 5EQFA 4BNIA 4XRRA 2OP1A 1MC5A 1Q7GA 1VL0A 2FR0A 4B3JA 3H3FA 4UEJA 1RWBA 1HYHA 3QRWA 3NV9A 3WWZA 3EC7A 4RVDA 4XCVA 4NZ9A 1PJ4A 1PGNA 2FPPA 2GD1O 1HL3A 1JA9A 2FY8A 5ADHA 1SCUA 2P2SA 3BHMA 1B2LA 3WMWA 1FK8A 3SC6A 4YB8A 2GRAA 1YB4A 4EGFA 4XYGA 1G6KA 2O3QA 1GY8A 5THQA 2NWQA 1MUUA 1IYZA 1EZ4A 1LLCA 2PZLA 2ZJ0A 3C7CB 1SEVA 3OJEA 3CZRA 1N1GA 4U6SA 4OQZA 3LZ6A 2BMAA 4YRBA 4RPJA 2EHDA 4MKZA 1XKQA 5ITVA 2O4UX 4B3HA 2Y0DA 1PGJA 3JQCA 5TJHA 1IULA 1WXDA 2D2IA 3FHLA 5G4LA 3ZU2A 4BO4A 4FQ8A 2JHFA 2CD9A 3E9MA 3BMCB 3CH6A 4DMLA 1J49A 3JQFC 1E3JA 4IS3A 1JAYA 2VN8A 3ORFA 2W2KB 4M1QA 1GZ6A 3A14A 3GAFA 2BH9A 2TMDA 1HDXA 1LRJA 5J23A 4DLAA 1VSUA 1C14A 1YJ8A 4CQMA 1SB8A 4FW8A 4TRJA 4BO2A 4MVJF 3FSRA 1OBFO 3RKUA 4Z3DA 5IF3A 1QV6A 1VRWA 2VWHA 2BELA 4C7JA 3ZW9A 1H5QA 5TSDA 1RYDA 2X4GA 4KDEA 3HDJA 3BTOA 4FC6A 2Z95A 1A7KA 1DXYA 3WG9A 1ZO8A 2ZQYA 4C4OA 3LT0A 4J16A 5A04A 4E2YA 1EK5A 4LRSB 4CUJA 1JLLA 1M75A 1Y81A 1ENPA 3GG9A 5L40A 4IGEA 2WE7A 2FSSA 2Z1NA 1PGQA 2J3HA 3WTCA 3WGYA 5IN4A 3GN2A 3NGLA 5CDTA 4BVAA 3MWEB 1NQAO 2PZMA 4BMVA 3AWDA 1QYXA 1ZIDA 5JPIA 4Y6RA 2FR1A 1LDMA 1MXFA 2D4AA 1VKNA 2EJWA 3RBZA 1U4OA 2HMSA 4TKLA 4PG8A 3ABIA 1NFFA 1TXGA 4RVUA 4XQEA 2A94A 2C54A 1ISJA 4ND2A 1R16A 2QQ5A 1N8KA 4BO0A 1QLHA 3O26A 4WECA 5TT1A 1X0VA 4TRRA 2CUKA 4D3DA 3ZV6A 1K6JA 2I5PO 4CMIA 5DCUA 1J0XO 3NDIA 3KM0A 3L07A 4XGKA 1DRVA 3AFMA 3EHEA 3QW2A 4GL4A 3ITDA 4R3WA 3C24A 1H93A 1E7SA 1Z6ZA 1LU9A 1EUZA 2AE2A 3MWDB 2LDXA 4DTIA 3OQ6A 1LDYA 2IYPA 3DAGA 4CLRA 1GU7A 1Y8RA 3MOIA 2HMWA 4YT4A 5GZ3A 4II2A 3VPFA 2VHYA 1OAAA 4RVGA 3GPDG 4Z9FA 3TFQA 3F3SA 2E48A 1WZIA 2ZIZA 3F6YA 3A06A 3SJ7A 3TN7A 4EW6A 1GV1A 1ZVMA 1A7AA 4M86A 1E6EA 1U7TA 2Q4BA 1DO8A 1E0DA 3JD4A 1O8CA 1U28A 2Y0EA 3M1LA 3H7AA 4G2NA 1GPJA 2CVQA 2DBVO 5IDYA 1ZK0A 2EW8A 4JLWA 2C59A 3C85A 1ZEMA 5ITWA 3I3OA 2PA3A 1BG6A 1QKIA 1T26A 7ADHA 1Y8QB 4F3YA 3LF2A 1HYGA 1K6IA 4GX5A 4OSOA 3K9QO 3IS3A 4X54A 3KEOA 2YZ7A 1E7RA 1P31A 5BSFA 2V6MA 4W4TA 1JAXA 1U7HA 5IFLA 3T7CA 1W73A 2IE0A 1M67A 4JGBA 5K6AA 3PTZA 4OXYA 4LMPA 3DB2A 1DRUA 2B36A 4QFCA 5LDGA 4PZDA 1G0OA 4XGIA 1GDHA 3HUDA 4YAKA 2VUTA 3RU9A 3DDNA 1DIGA 1P1JA 1P45A 1R4MB 2BF7A 2DKNA 4JJGA 4DPLA 4RDIA 4J90A 2I3AA 2JD2A 3FN4A 5IG2A 3Q2KA 2VYND 1KVSA 5JDCA 2JAPA 1U4SA 3ZI0A 1GYRA 1DDOA 5DT9A 3I9NA 4O6VA 3BHIA 3GDGA 4PIVA 3ROKA 2ZTUA 2I99A 1HE4A 1Y8RB 2PR2A 4EDFA 1I32A 2JL1A 4D3SA 6LDHA 1X7HA 2C5EA 2O3TA 3NKLA 3GN1A 4RF4A 1XELA 2UUOA 4B8ZA 2RAFA 1IHXA 1XCBA 2WD8A 3INGA 4ZU3A 5IJZA 5EIOA 2OXIA 2J6IA 1ULSA 2RCYA 4RPKA 4N5MA 4PG4A 5TF4A 3IAHA 3OSUA 1CETA 4CM6A 3RKRA 3EK2A 3MJSA 1ADGA 2YQ5A 3MOGA 2FWMX 2G82A 5ER9A 2Y0CA 3L4BA 3OQ1A 1V8BA 3D1LA 4BKUA 3KO8A 3FCOA 1GR0A 4HFRA 2O23A 4ESOA 4LMRA 3NRCA 2VUSA 3D4OA 3GHHA 3ZV3A 4OIMA 1GUYA 4O59O 3H3JA 3JQ7A 5IAAA 4RVHA 5JE8A 2O4CA 4BNUA 3S2IA 3RWBA 1WDLA 4Y6SA 1BRMA 1PZGA 1LLUA 1JN0A 1EE2A 2YW9A 1JW9B 3A4VA 4D41A 3LSYA 4MP6A 1VPDA 1ZEJA 5JCJA 3UH1A 3DZJA 1JVBA 4FFMA 5MGBA 1TA4A 3FR8A 1Q1NA 3TOZA 2RBEA 4WKGA 1MG0A 1ZXBA 3TF5A 4BMNA 3OA0A 1U3UA 3GMDA 1ZNQO 3KVOA 4L0QA 4CLXA 1VLLA 3W4JA 1IPFA 4AJNA 5BSGA 2OZPA 2PWZA 1N2SA 3P7MA 4XX0A 3ZWVA 2GZ2A 3R0IA 2OL4A 2WYUA 3WJAA 3D4NA 1U2DA 3IP1A 4BO1A 3CIFA 4W9NC 4HX5A 4GAEA 2NVWA 3SVTA 4J0EA 3AI1A 4AG3A 3Q0EA 3KXDA 3I5MA 4HFJA 2WYVA 1U1IA 2CF6A 1WLYA 1QXSA 1T2DA 2VRCA 2VZ0A 3GR6A 4EEZA 3C1OA 4E5KA 3GF4A 1HKUA 3GMSA 3WQSB 2W8ZA 3GAZA 3GVXA 1Y7TA 1SAYA 3FTPA 3GVPA 1H2HA 5F5NA 5T57A 1M6HA 2D0IA 1UH5A 5TLSA 1NM5A 2NV6A 3GNSA 4MDHA 4CUZA 2BFPA 1MC4A 1H6CA 3RUAA 1FDTA 4ZQFA 3I9JA 1XG5A 1PWXA 5AXDA 4AL4A 1ONPA 2ZTMA 1GL3A 1U3VA 1UZNA 2UV8A 3KLPX 4FOOA 5KJ1A 2GN8A 2WD7A 3ZNPA 4WEQA 4BKPA 2G76A 4ZQGA 4HP8A 4LVCA 4TVOA 1NWCA 1YDEA 5KJCA 5FWNA 4O5OA 1E6WA 1GYQA 4DC1A 4OO3A 5A5FA 4A10A 3OP4A 1C1XB 4L75A 1OFGA 2XXJA 2DBZA 5TNXA 5B12A 5U9CA 1X1TA 3KHUA 3GVIA 2X9VA 3GRKA 2D5CA 2V6GA 4AJ2A 2I3GA 2O3RA 4EUHA 4E5YA 3DFZA 4BNWA 4BKOA 1VJ1A 1QLJA 3QSGA 2YFQA 3WLFA 1OMOA 4Q3AA 4YJHB 4W82A 4UUOA 1VC2A 3GEDA 1R0LA 3GOHA 5EJ2A 2YY7A 3JQ6A 2EKLA 1T1SA 3NDRA 1ENZA 3HDQA 4E2ZA 1CF2O 1PQPA 3H9EO 4IXWA 4ALLA 5ENVA 2W2KA 3IUSA 2PK3A 2A9FA 3CMMA 3U62A 3KUXA 3DEYX 3ZU4A 5A9RA 1V9LA 2Y1DA 1YXMA 3DMYA 1P44A 3GH3A 1D4FA 1GZ3A 5AOVA 2AG8A 3K6JA 4DWVA 3LQFA 1YE3A 5CDYA 2X0NA 4Z0HO 5EN4A 4KZPA 4NU6A 5B4VA 2PD6A 3QVWA 2DQ4A 4N5LA 4NU5A 3UCEA 3QVXA 4A03A 3GUYA 3WICA 3ZWCA 5L4SA 4E5NA 5F1OA 1I2BA 3PHHA 2YHIA 2XF8A 1WPQA 5JW6A 3AUSA 3ROPA 2AHRA 3I83A 3I4CA 1BMDA 3NDJA 4G81A 4MIYA 1ONOA 2PZJA 2IODA 4YQYA 1RM4A 5DBFA 1PQUA 5L7WA 1JVSA 4R69A 4ZJUA 1NAHA 3CSDA 4J3FA 1I33A 2OO5A 1LI4A 1KEVA 5DP2A 4ALKA 4PVDA 2HJSA 4W7IA 2JCYA 1AE1A 3WBFA 1YL7A 1SPXA 2VYVA 3BMQA 3IMFA 5COBA 4J1NA 3DZIA 5ER6A 1UAYA 1ZH8A 5JCXA 3WB9A 5B4UA 1X14A 2OORA 4U7WA 2EG9A 2Y66A 3JQEA 2CVZA 3ZNOA 1J6UA 1F14A 1QORA 5DZSA 3QWIA 1YGYA 5T64A 5HS6A 1I30A 2EP7A 1PZFA 3KSZO 2PD4A 4J0FA 4Z3KA 3DTYA 5A03A 2XXBA 3ZU3A 3ZWPA 4ROSA 4RPHA 1A9YA 3PP8A 5TC4A 1T1RA 3S2EA 2FR8A 3W8DA 5JY6A 1KVUA 3WGQA 2HU2A 3P5SA 1GV0A 2GUGA 2X0IA 4NPCA 1LQUA 3PYLA 4XZ3A 2Q1SA 3U4IA 2HCTA 1ISHA 1IPEA 1DC6A 3IL2A 3NEPX 4KP7A 1QYCA 2HQ1A 3R3JA 4RPGA 1PS8A 2EKQA 3D5QA 3H8VA 2PY6A 3JYQA 1VE9A 3Q9UA 4HNHA 3ANMA 5EL0A 1UJMA 4J4TA 1LRLA 1UXKA 3DAFA 4DUPA 3W4KA 4CMKA 1T2AA 4OKNA 2X5JO 2Z1MA 2B4QA 2D5AA 4PG7A 5FI3A 3GDFA 4CM8A 4MP3A 7MDHA 2OHXA 2GDZA 4ALJA 4OL9A 4IBOA 5DDIP 2X58A 3EMKA 3NJ4A 3PWKA 3QWFA 4FJ0A 3WGGA 1YQGA 4UULA 4G65A 3DAPA 3S55A 5JY1A 3JQFA 3V1TC 1DRWA 1ENYA 4BNFA 4F45A 2HRZA 4WNIA 5H82A 4JBHA 4PZCA 5BNIA 3JQ8A 1H6AA 2A35A 3JQAB 3QVSA 4FFLA 2BKAA 4Y98A 1LJ8A 4QQRA 4QO8A 4TVBA 3BYZA 3ZWBA 4HNGA 4E33A 3ONFA 2P4QA 1XSEA 4KTTE 4XIYA 4N5NA 4AJIA 4NBWA 4CR6A 4EITA 3C7DB 2HRBA 3NTRA 3RASA 1R4NA 4BNHA 4XYLA 3LLVA 3VZPA 1XU9A 4JQCA 5BNTA 1DFGA 4CMEC 5JYDA 2QHXA 2NTVA 1QYVA 3P2OA 1T4DA 1NWHA 4PG6A 1DC5A 2DFVA 1F8GA 3DBRA 1IL0A 1PJSA 4XIJA 5C7IO 2RHCA 2ZKLA 3HWRA 1YB1A 2F00A 1E77A 1ONNA 2I76A 1PU2A 2UVDA 3B1KA 2B5VA 4XJSA 5JDIA 4BNVA 2BRUA 3DXFA 3MJVA 4RGBA 4WCFA 5KJEA 4FGSA 4YJFB 1E6UA 2QYSA 3N74A 4RLHA 1FDSA 1PJCA 5TT0A 1EQ2A 2IDZA 3PLRA 1S6YA 3HFSA 3MEQA 2GASA 4EYEA 4GBJA 2OMEA 1LBEA 2WWRA 5L51A 3GZNB 5JNLA 1O95A 1NHWA 5TS3A 2X9NA 4EI2A 3P19A 4FB5A 1XQ1A 3RFXA 3EZYA 3RSHA 1P3DA 3AI3A 4TQGA 4IZIA 3LLSA 4I5EA 4J1QA 1BXZA 3G17A 2X1HA 2ZCUA 3IP3A 3EVNA 1HLDA 4WPGA 3IIEA 2J5QA 1ISMA 3VH3A 4YAEA 1I10A 2IXBA 4NBUA 8ADHA 3H65A 3JQBA 4IQGA 3F47A 4B7UA 1WP4A 3TWOA 2B4RO 3VC7A 1F17A 1HLPA 1DFIA 4KWHA 3KYCB 3EGOA 3V1YA 3RFVA 4D0SA 3BMNB 1EQUA 1ZK4A 4HV4A 4R68A 1LSUA 3HN7A 4ONEA 4CLHA 3ZDFA 5KKAA 4CL3A 3D3EA 3SJUA 1BHSA 1YDWA 1E5LA 1R4MA 4UEKA 4PLGA 1I3MA 4QX6A 1BW9A 4GSLA 4YQZA 1C0KA 2DFDA 4QSMA 3AU9A 3ZV5A 4BNGA 5CDSA 2NU9A 3PEFA 2EIHA 2W2LD 2GCGA 3PIDA 3WGHA 4XEHA 4RO0A 3BZUA 3GVHA 4NFYA 4CMCA 2AEMA 4RF3A 4BNTA 5K6AC 4LCJA 3E8XA 4NBRA 5JMPA 5L95A 1ISFA 2ZYGA 3OIFA 3PQFA 2X86A 3K30A 2PTGA 4FCCA 4IDAA 4OGWA 3GDOA 1ID1A 1B15A 4YRDA 3BA1A 4UVIA 3G49A 4CM3A 3BMOB 4QECA 4FD3A 3TL2A 3OBBA 5F3RA 1U2GA 4BGEA 3U4CA 2WE8A 1DSSG 2E82A 1U9JA 4O0LA 3ZGYA 1U3TA 4YBZA 2VWGA 2B37A 3ZWAA 3DC2A 1DC4A 3KRTA 4BB6A 4BV8A 4LW8A 3ADOA 3PK0A 4GWKA 2VWQA 3BHJA 4BNXA 3VH1A 1KVQA 4DQXA 2FN7A 1HTBA 2BFAA 2FHSA 2FZEA 2V6FA 5CPFA 3OEYA 1GCOA 3RCBA 1U8FO 5TRTA 4M54A 4EUFA 2SCUA 3E5RA 1MXHA 4DIOA 2HO5A 1YBMA 2Q1UA 2BGLA 3ASUA 3KBOA 1KC3A 3O38A 4UREA 3OJ0A 2CFCA 3G0OA 3AUUA 3T7EA 1Q0QA 2O3UA 1C1DB 2O7QA 1NPTO 3ZWXA 4MIEA 4M55A 4MVJD 4OH1A 5COQA 4KTVE 2Y1OA 4IM7A 2VRCD 4Q9NA 3AOEC 4TZTA 4YAIA 3LT1A 1L1FA 3ROMA 4Z0TA 4KQXA 1CDOA 4UEOA 3WMXA 3H2SA 3ZWOA 1P77A 5AXCA 3KLMX 1Q7CA 1OI7A 2HK9A 4OKIA 2P5UA 3GHYA 1H6BA 2JKVA 3DHNA 3Q6IA 3PXXA 1NQ5A 1EFKA 1N1EA 1W0CA 4DIBA 5KVSA 4OXNA 4XYBA 2QZ9A 1Q7BA 1UDAA 4WOKA 3TZCA 4QFDA 1MG5A 1TT5A 5A3VA 1DLJA 3AOEA 4LCEA 5EINA 3GC6A 4I5FA 4BO5A 2YQ4A 1EDOA 1QV7A 2CNBA 2HMTA 5DOZA 2ZQZA 3QLJA 4OM8A 5IN5A 1DB3A 1WVGA 3I6QA 1EUDA 4NHEA 1KVTA 4B4OA 4YCAA 4CM7A 3CE6A 2I6TA 3CXRA 4RDHA 4BUCA 4WCFC 3KYBA 3RC7A 5G0SA 1NBOA 4F46A 4KQWA 1E3IA 4ID9A 5EPOA 4XKJA 1PL7A 4BNLA 2OFPA 1JTVA 3BAZA 3DBHB 2Y99A 2VYVD 1C0IA 3GEGA 4KUGA 1HXHA 1K0UA 1FDWA 4RPLA 3RUIA 4R1UA 1B0AA 1HT0A 3GRPA 5A5EA 1NPYA 3JCZA 1PEDA 2GN9A 4GVLA 4D43A 4IDDA 1IHYA 1YQXA 2QRLA 4YDRA 4YT8A 2AEJA 2P68A 4A26A 4BNZA 3V2GA 5L53A 4NJMB 4MVJI 3WS7A 2IRWA 2JFHA 5GZ1A 1DHTA 2EGGA 1YB5A 4YJHA 4PFJA 4KUEA 4A73A 1NPDA 4YEDA 1FJHA 3JD0A 1T4BA 4IJVA 1YOVA 3EDMA 2W4QA 2J5RA 3PQEA 4K26A 1SBYA 3PJGA 1SNYA 2X0JA 3RU7A 1EVIA 1DEHA 4L4RA 3DL2A 4R9RA 4NG5A 1O5IA 5I9NA 5DP1A 1GQYA 3BXXA 4WK6A 1H6DA 2LDBA 4NJMA 2VT3A 3R1IA 1AGNA 1TB4A 4MVJE 4DBZA 3ANLA 2UUPA 3F4BA 1B3BA 2V6BA 1I3NA 1YONA 3L4SO 3WYCA 2WYWA 1Y5MA 2YV1A 2IXAA 3D0OA 3CEAA 3G1TA 4CLOA 3O9ZA 2I9PA 5I7FA 4FSHA 1MA0A 1ZJZA 3B6ZA 4MPDA 1D7OA 5JAQA 2WSBA 3DZFA 3FNGA 3HB5X 2HLPA 3CTMA 3LU1A 2NVUB 4AJ1A 5KOIA 1Y1PA 1E7WA 2PKQP 4B4VA 2HJRA 1E3WB 1MP0A 3HB4X 3HZZA 2DVMA 3ROQA 1B3RA 5T5QA 4GMFA 2YHIB 2AMFA 4IDCA 1V35A 4EZBA 3UOGA 4L4XA 1NAIA 3U3XA 1EVZA 1E5QA 2CDAA 2Q3EA 4MVJA 1SC6A 3RJ5A 3JQ8B 3E6AA 4L9RA 5T8KA 4N54A 4IIUA 2JFFA 2IEBA 3RAJA 3VZQA 5L3ZA 1HDCA 4CR8A 3E03A 4PLCA 3U4HA 1GTMA 1UXGA 3K96A 3PLNA 4Z0PA 3G1UA 2VCYA 9LDBA 1KC1A 2DM6A 1VSVA 2UAGA 3BMQB 3LC2O 3ONEA 3QIVA 3UHAA 5HM8A 1DIBA 1LDGA 1Q2XA 3KZVA 4PRLA 4KUHA 1KETA 3PDJA 4LSMA 4XR4A 4WCDA 4DL9A 3GGGA 3WOHA 4BNJA 3TL3A 1HF3A 2VTDA 3PZBA 4YJFA 3WTBA 3AI2A 2Y68A 4TRNA 2AW5A 3L6OO 2OOSA 1DC3A 5H83A 4WCFB 4CUKA 2GNAA 2DLDA 4GPD1 1XWFA 1UR5A 4PZEA 2OBYA 4MKXA 3UICA 3PIIA 1C0LA 1IE3A 1N7HA 4M8SA 3WGTA 4E5MA 3PJDA 4O63O 2C82A 1LUAA 4KOAA 3I9KA
chains in the Genus database with same CATH superfamily
1XZGA 1ZSYA 4MB6A 5JATA 1LZKA 5E7MA 2KW5A 2NACA 3K09A 2ZTVA 3HA7A 4XSHA 1Q7TA 5AKGA 3NRJA 1YHNA 4LYFA 4JQSA 1JV2B 1L7PA 2I8CA 4XB2A 1ZUWA 1JSZA 4ESEA 1UKBA 1WW8A 4FYJA 3RS0A 2AF4C 2VHXA 1CR0A 1UBRS 2CDCA 1Q0TA 4ZOLB 2Y2UA 5JJKA 4G0ZA 5SZIA 4LJ6A 1GQ2A 2QX4A 3SPXA 4CM9A 4I1PA 3PX2A 5DHQA 3G5UA 5CBPB 2FWRA 1C3EA 2W2LA 3NPMA 1PVDA 3DF9A 2N9UA 1RHMA 1YZYA 1X8LA 3K4PA 2D7CA 5DPMA 3RVJA 3UK0A 1SHUX 4IINA 2C29D 3QX3A 1QK4A 2EXXA 4NZYA 4KR2A 5HBGA 4P7GA 4EHDA 3NBYC 2BC9A 3PFBA 3TFOA 1I4WA 4S3MA 2Y1CA 1S3IA 1I7NA 4XGNA 3CTPA 3QQPA 4IQ8A 3KVNA 4L22A 2DUWA 3DO8A 1BXKA 1G5TA 1V7PC 2GPTA 2H1SA 2OBMA 3C74A 3FDXA 3QUCA 5E7JA 3CVUA 3DDSA 1RWWA 4MYUA 4RZHA 3D8TA 3IHTA 1JLMA 4L5AA 4XPZA 5GMOA 1ODCA 1VHDA 3A1SA 4Z4GA 1OFIA 2ZAGA 4MUEA 2R8XA 2Y1LA 2VOEA 3EUWA 3H8WA 3OWOA 1NP6A 2C03A 5HJ7A 3AP1A 1TK9A 2BT4A 3HU1A 5BRJA 3ITEA 5TMEA 3ZCSA 5ECYA 3RVLA 5FV4A 1YZNA 5T7BA 3DUFA 2IHYA 1Y1KE 2O7RA 4WK0B 1VMDA 4XYEA 5TGDA 1QCDA 3FPLA 3TLCA 3UHJA 4BTLA 4C0HA 3OIYA 4HZUB 5IJ9B 2N46A 2JIMA 5F9HA 1Q7RA 2P4SA 1BEZA 2JFVA 4C04A 4R31A 1WDTA 1JJBA 4Q3BA 5DN6D 3EIOA 1SOVA 3MGCA 3GUHA 3R3WA 1QHHB 1T8SA 4JGIA 3E2MA 4UZEA 5HJEA 1RAGA 4KK4A 1KK3A 2K7ZA 2PL9A 4KJXA 3R8FA 3UB4A 4OJMX 3NATA 3UFXB 1CRQA 3ND9A 1OCEA 3G0CA 1Y48E 2AQ8A 1L7EA 4U2CA 1ZUIA 3BH6A 1P4RA 2QUAA 2YRXA 5CX1A 2BLLA 2JFNA 1FTQA 1K89A 3M83A 4J6FA 4DC0A 4M7WA 4EW2A 3L0PA 1WXIA 3B48A 3GA5A 2JLXA 4MQLA 2HC9A 2DECA 3ZWDA 4BO3A 1WCIA 5B1SA 3EG9A 5BOSA 3T7AA 2OQIA 1PJ2A 4F60A 1KWKA 2PVSA 1GSOA 4KVAA 4QVGA 4BEVA 1D2EA 5K0ZA 4NCBA 3GW8A 1AS2A 5EJEA 1TAHA 3MB8A 1J2RA 2B8JA 4JJ6A 5LMZA 1XZ8A 2VHWA 4TMWA 3OTIA 3HABA 1KU6A 2AWNA 4P22A 4U63A 3W77A 4B6EA 3G2JA 3Q72A 3HYNA 4HUQB 1OT5A 3R3YA 4TX1A 2NU8B 3L1KA 2CLMB 2YYSA 2C2GA 1CJCA 1PR0A 1E9SA 1O1YA 3EZXA 4U3JB 3EH2A 1T6ZA 2ZVJA 1R0XA 3LL4A 4KLCA 4QA9A 4X5OA 4OHUA 4EJFA 1CQIA 2E4AA 4K05A 3KEQA 1PSZA 1ZZEA 3I4FA 3EJWA 4ND7A 5TPZD 3U13A 2V9PA 2OXRA 3FR7A 1NJ1A 1QGAA 4JYZA 1I9GA 1JEDA 2JGLA 2QRVB 5CIQA 4UXIA 5ETJA 3OM9A 2PLAA 3R5SA 3LPAA 4MKFA 4DZTA 2P77A 3Q3GE 4V0NA 2UXCB 3CVOA 1G5IA 3RREA 1N0IA 4PLYA 3AUJB 1LPAB 2DWPA 3FPHA 4JN6B 3KHSA 5D5QA 3SF8B 4MUBA 2UDPA 2RGNC 1KZ6A 2J9FA 1E1NA 3VZRA 1IHDA 1ISPA 3RUCA 3W2EA 2GAFA 3KXIA 3DW1X 2ASEA 4G0WA 5E6UA 1OAOA 4M0UA 5KJFA 4BV9A 3EBLA 1PO7A 1QZXA 1X1BA 5AK3A 4BV3A 4LKOA 2EJBA 4DLWA 2DT5A 4MYRA 3K5HA 4G5QA 3ECSA 1ZRMA 4DYHA 4G85A 3ZS8A 1ZMTA 1QVWA 4I1OA 4CE6A 3X1JA 2V4ZA 5JFOA 3HU5A 3IIMA 1DTSA 2WJWA 1K4YA 2XB6A 3ZNNA 1TAQA 4OX9Y 4Y0NA 1P9NA 4E6PA 4M9CA 5A4IS 4W9NA 1VKOA 1MC8A 4GPZA 4Q9AA 5FNZA 1X1QA 5EHNA 3I62A 1RJ9A 2ZAYA 2JGDB 2RGXA 4G3XA 4WN9B 4ZAGA 2JI9A 2PSDA 4O5AA 3VVCA 3E48A 2EKBA 3AJ8A 3H5AA 2XB9A 4K6KA 4M0EA 5AHXA 2XVMA 2VHQA 3A6JA 4NJEA 4OHWA 1C8VB 4CMEA 1DCFA 5CH8A 4I14A 1UUFA 3TLZA 4CQJA 4D9JA 2RGUA 3ASYA 1VBMA 2F62A 4PPGA 3JASA 1C9EA 4MV6A 2PXHA 2B7BA 2GJ4A 2HNBA 1GTZA 2NX2A 2PRJA 3W79A 4EY5A 5CD9A 1M2GA 4CJXA 4BGVA 1FNMA 1UADA 1ZCJA 4YRKA 1WMAA 3EEQA 1OLXB 4O4JB 5CEEA 6ADHA 4XWGA 2ZYHA 4KIUA 1RP1A 1QYDA 2Z0MA 3EMBA 1RE0A 1M1NB 1T1EA 1DKLA 2JAWA 1ST3A 1T6BY 2X22A 3JATA 5EQDA 3LBIA 1RYEA 1WQ4A 3HPQA 4A8JA 4AULA 4UEWA 3OWHA 1G8JA 3LXRA 3S5JA 4Y7DA 4LYGA 3SHQA 5LM3A 2R1TA 4NRDA 5D87A 4FUQA 5GM1A 1J09A 2IGBA 3CR8A 2QZZA 3FNRA 4Q48A 4Y30A 3ZR4B 8LDHA 2VUHB 2GN4A 4INJA 5BUCA 4MRMB 3PC8C 1UMDB 1XZNA 4QYIB 2FPRA 4V02A 2QD2A 4RORA 4WIAA 4CTNA 1MQ8B 4N7MA 4GECA 2W6QA 1HG1A 4BHTA 1S7GA 3CT4A 3U9LA 4Q03A 2EBUA 2PD3A 5IPFA 4R8MA 2C57A 1V3TA 3QEMA 1D6JA 3VR5A 4Q4JB 1TZ2A 1W9HA 1WCXA 3M1AA 2WEKA 2XB4A 1N6LA 3S2FA 2GWRA 1O9BA 1RMQA 3Q41A 4ND4A 4TLCA 5F98A 1CYEA 1ZU4A 1VJCA 2W5UA 4LX0A 1QQTA 1MOPA 2B8TA 3WYGA 1CG6A 1TJPB 2CUTA 3VO9A 2G8NA 5JWRA 2ZSJA 4HX9A 4WZAE 2DJIA 5CXXA 2I2AA 4DPMA 2XMPA 2JJQA 3ZDZB 3WKAA 3ILSA 3MRXA 1VBKA 1M2NA 4RA6A 5ICSA 1AA6A 2YV5A 2ZUTA 3GMIA 1XMJA 2PEZA 5IWAB 5JRDS 2VRWA 3E7DA 4RMIA 4DG5A 4CIXA 1SVOA 1XALA 1ZA2A 3I5UA 5BSHA 3I3SR 1K7XB 2DTXA 5JXHA 2ZSUA 1XWIA 2G88A 2XLBA 3WL6A 1I7LA 5IDWA 2DZDA 4NFSA 1M76A 1M5UA 1J2JA 1T9GS 2GBCA 4I4NA 4BATA 4UOZA 1M74A 2FSFA 2X5OA 1BIFA 5B3JC 1Z5NA 3U37A 2KX7A 3K6SA 3T3MB 3VA7A 4BVLA 2BWJA 3TJRA 2ZYSA 3KS9A 1JHRA 3SQWA 2RHRA 2FW0A 1LNZA 5IHXA 3W8FA 1A5BB 1TU3A 1U0TA 1TL7C 1Z62A 1PD1A 2I2WA 3W7VA 2QTRA 2C1ZA 2QT1A 2YJTD 3GFGA 4JROA 1SR8A 3IDFA 5J2UA 4QYXA 5FP0A 4JZKA 2CZGA 1KXZA 2J32A 2FF7A 3N2EA 1FYEA 3CIOA 3ETHA 1JALA 5HUJA 4HSGA 1RXWA 2OHOA 3HLYA 3HO6A 3INYA 2VNSA 2IFTA 4IX9A 1L7MA 1R9NA 3U6BA 2BH2A 5EWJA 2A0FA 1CERA 4LI3X 4IDQA 3FA2A 3DOOA 3FPJA 2OG1A 3IVXA 4MP8A 5CFQA 1RI4A 5FUBA 2YXBA 2MYTA 4YR9A 3WYNA 4DV6B 4G01B 4LBZA 1FFGA 1YCHA 3KSDO 4UVGA 1W1IA 4K40A 2HSDA 1WUKS 2QV7A 4BXOB 4W8HA 1VP3A 5CXSA 1SC9A 3O3CA 3PQCA 3RC3A 3L4JA 1IY0A 4P35A 5JI3E 2Q49A 2I0FA 3MUFA 2B25A 1CVRA 1MN6A 2C92A 2FPXA 3HBFA 3HMKA 4LOIA 5EFOA 1HE1C 4DNFA 4HNUA 2JHGA 3P0IA 2X6TA 1H2XA 2A9OA 2V65A 3JQRA 4AJHA 1E1MA 1OBHA 3PRHA 4JH0A 4F5DA 3O0TA 1A8QA 2EKDA 4TV9F 4ECEA 1YS4A 4B85A 5JIBA 3E3AA 1JIQA 1Q1GA 2A0WA 1GQQA 4MTLA 3LO5A 2XE4A 1C1HA 1JDJA 2ZIUB 2PFGA 4PAWA 2MOKA 3VYWA 5G3ZA 3L9XA 3GGOA 3PC7A 4I50B 4RSHA 4UE6A 3SJCA 1T2EA 4RD3A 3RR2A 3EQZA 4MRPA 3C3YA 5KWVA 1M5RA 5SYMA 3EIWA 2H4JA 1OPXA 5F73A 1XGKA 3IAXA 1GL6A 2OPBA 1F6WA 2ZUWA 4HXYA 2E18A 4WUVA 1PZEA 1BZYA 1WZEA 3V4SA 4BWFB 1MNAA 5AKYA 5K0EA 4FOSA 3FLAA 4GZLA 3MMPA 2WJHA 1AMNA 3CUWA 3O8OA 2H06A 3GOQA 2CMDA 3IEUA 1OGJA 1XMPA 3MLEA 1K92A 3QX8A 4OFWA 5P21A 3VHLB 2V7QD 4E1VA 5CXUA 1E3DA 2PH5A 4QOIA 3KZXA 5CA0F 1ETHA 3Q6NA 4UPEA 3G59A 4RV9A 3C5VA 3DM5A 4CGYA 5AVTA 5B7QA 2ZJAA 3IMEA 3TE6A 4ETMA 3AKCA 4CNQA 3VKVA 4LFAB 1OYOA 3ETNA 1CUEA 2WBLC 3OX3A 3ZJUA 3GUCA 1GG9A 3SXUA 3NBZC 5LPNA 1ORDA 5F7JA 3TPFA 4ALNA 1SXJE 2XH8A 2YBEA 3L1IA 4YGXB 1CF9A 2RH8A 5CHYA 2IBMA 4B40A 4UUAA 4YT2A 4HDSA 4GS5A 3RGGA 2FAXA 4I9HA 4TSKA 3INNA 3F6BX 4A8HA 2IS4A 1JL3A 1MGOA 4HDRB 4AO6A 1EZ1A 4P36A 2JBWA 3RSLA 4AROA 5ALPA 3ZY6A 2CHQA 4WERA 2P2LA 2PYDA 1DJPA 3QFHA 4R2IA 3ZTYA 2IL1A 4ND5A 1U0HC 3IE0A 4LX8A 1N8TA 3B20A 1DBIA 1QOQB 4HATA 3VR4H 3QITA 3RBXA 5L6LB 1F3OA 3EW9A 1I24A 3LY9A 4J7AA 4P32A 3EEYA 1GSAA 3IQWA 4HN4B 3WRYC 4FN4A 1AKEA 4KNYA 3U44B 2WKSA 4EQZA 1COWA 3FWNA 2BEVA 2GGSA 2HPZA 4N5DA 2FSVA 1G4HA 4KIGA 4DLUA 5F5XA 5CLFA 3LE8A 1P2DA 5EE9A 5JLJA 2H2DA 1VSQA 3KQPA 1HM5A 5ALGA 4C3OB 4JLBA 4WY5A 4ZXFA 1VA5A 1RYYA 1OOEA 2O06A 2COUA 2R8ZA 5F1PA 3F2VA 1PGPA 2GMWA 3R0XA 4LV5B 4RWEA 2GEVA 1G2IA 1TCBA 2KE5A 1MX5A 1WXGA 4JLPA 4CEIA 2JLVA 1MV8A 7MHTA 3F5SA 3Q2IA 1KJIA 4EH1A 2A0YA 2WSMA 3B89A 5FULA 4I8IA 3VHRA 4WZBB 1M0EA 3NUGA 5IVHA 4FYMA 1XD8A 5SZKB 4UHJA 2ADOA 1C8BA 1R00A 3NAQA 3N9IA 4CKBA 2IPNA 1B1CA 3SEFA 3X2FA 5K7SA 3L8HA 2VF8A 3O9VA 4GRDA 4L0DA 3SI7A 5A4DA 4GX0A 3V1LA 1I2ZA 2H3HA 4UUMA 4CETA 1II8A 3U31A 1G6HA 2ZRBA 2NQTA 4IDGA 2R6FA 1NF9A 2AMVA 4I8XA 3RC2A 2Q1XA 1TCUA 2B8NA 1PS0A 1A5TA 4W5WA 1N3YA 1N6KA 2IPOA 1O97C 3WDKA 3E4CA 3JQBC 1KYIA 2FSVC 2B1IA 3ASZA 4RMNA 2BGMA 2EF1A 2A4MA 4GPIB 4IMIB 1Y6QA 4D3FA 2EVWX 2WU8A 3VDNB 3NONA 5A05A 5AHWA 5DN9A 3GLIE 1V2HE 1VIAA 1H5NA 1MRZA 1U1GA 4GR4A 4IRUB 4PAMA 4X97A 1NJ6A 2YVUA 3O1JC 4NE7A 4QVKA 2IPLA 5ESXA 4FQ5A 1XEXB 1MDBA 2VDQB 1EBBA 1A9TA 4FDUA 1M1UA 3F4KA 4IOJA 2RK4A 3WLIA 3ER9A 1YK1A 2D62A 2J5XA 3DLIA 3DBHA 4Q1AA 1FB5A 2ONJA 5JH7F 1ZI6A 2IEYA 2X2OA 3ESZA 3U1TA 1Q95A 4FHFA 3GVCA 3O1HB 2FVXA 4B6JA 1PW7A 4ZYTA 3AHGA 3DLHA 4Q4HA 1GQFA 1VHJA 5JC1A 4RD6A 4JUBA 4YXWD 1H2BA 3O6VA 1VBNA 3DFFA 4ZRDA 2P0AA 3RU3A 1NRJB 4CM8B 3VR2D 3KZKA 2A5YB 4A91A 2BFDA 4Y2RA 1KY4A 4MKRA 5HGJA 4B4WA 1PV4A 3D4PA 2A78A 3L7MA 4Q1FA 4L8VA 4MV1A 5IBQA 4DJDC 2BGWA 2KWIA 3AXSA 1JH9A 1J1ZA 2VJQA 3VH2A 1YFKA 3PHIA 3CS3A 3QLTA 5A9TA 1TCAA 5B58C 5AW1A 3BD8A 5GOTA 2XIJA 3PSHA 3PQ8A 5E9AA 3H2IA 4PR0A 4JVNA 2H52A 4N47A 2QRPA 5HIKA 2QR3A 4CIYA 3L6CA 3AYXB 3GFQA 2FW1A 2J7PD 3ZLBA 4PN3A 821PA 2DHEA 1CEEA 3AEKB 5L45A 3R20A 4R6WA 4R8RA 1V9SA 2G08A 1B0PA 3K5WA 4JJEA 2GPWA 2MSNA 1JQBA 2WAYA 3C8MA 4OOFA 1YL6A 2JGNA 4PQRA 2IYVA 4MWTA 1IIRA 1KEUA 1KPIA 2FJUA 3SIWA 2GD0A 2OLJA 4FKBA 2AFIE 3F5FA 3L0OA 4XQCA 1A98A 4C9BA 5LYJF 4RYDA 5C8ZA 2FUG1 4KKXB 1IM2A 3ENVA 3VUEA 4F8YA 2QRKA 4J43A 1IN8A 2WWYA 2GEKA 3O8BA 4KYIB 1YVUA 3CNEA 3E1GA 1PRYA 4CIBA 4E4TA 3HKBA 1DJQA 4LNUA 3GZJA 3WWYA 1QANA 3FTCA 5A0VA 4XUCA 1J70A 3LQ4A 4OLBA 3V4LA 4Z1OA 2HDOA 4OAPA 2PNFA 3NGXA 4C4PA 3KQNA 2G6TA 2H9IA 1FFHA 3QKUA 1FQOA 2GAJA 3D7KA 2BHNA 3E1KA 1C81A 1RRPA 3B9QA 5DE3A 5FA6A 4B0PA 3F96A 1NX6A 3Q15C 1AQ6A 1Z18A 4ETNA 1SQ5A 4RTJA 4KQJA 3B70A 4OJTA 1GA1A 3WLRA 1G7SA 3E9CA 1N2EA 4D46A 4TM7A 3RYHA 2CYCA 3D7NA 3NHBA 4PGAA 1AD2A 5I47A 4A5SA 2BFFB 3ZD7A 4C0QC 1I94B 2L82A 5J4KA 1NZFA 3A0RB 4GLLA 1G2OA 1Y63A 3G2PA 2Q2VA 3LCJA 4X91A 2M6KA 3A3YA 4DMRA 2GEUA 2IU0A 1V95A 5FI5A 1TYBE 2WR8A 3GAMA 3CNBA 4UHBA 4L0CA 2FXVA 5EWMB 4PEVA 4E08A 2ZYAA 1Z6PA 4ZVRA 1NVWQ 4JUDX 1SUWA 4O4LB 4Q3EA 4F38A 5C8YB 1WV0A 1KYVA 1QYWA 5CDHA 2WNHA 4TS3A 4F86A 4HBGA 2P41A 1ZFNA 1M6VA 1XDUA 2GK6A 2GPYA 1XB2A 2QUBA 4TLAA 3SJZA 1NE7A 1QVAA 1TK2A 3RS4A 4B3GA 1RTKA 1YIOA 2O1EA 2JKZA 1TM4E 1QZ3A 3EAQA 2Z2IA 1EPUA 3QVMA 4PQEA 4XTCS 2XXAB 5CCBA 2MJLA 2JGEA 2B2NA 3AP3A 2WV7A 2Q9BA 5KIAA 2OO7A 1HTWA 1KYYA 1DP4A 1WUJS 2J3IA 4II7A 1X1SA 1H05A 3A1CA 4QWWA 4GZ5A 4B4UA 2QENA 2XYVA 2ATIA 1V4VA 3O4VA 2QMZA 1VM6A 3CCBA 5IUJC 4QGHA 5C53B 2V7PA 5FWXA 1ZK1A 3T9AA 1MEEA 3DZBA 3MVEA 3GCZA 3PWZA 4JLAA 1G21A 4M6WB 2QTBA 4EG0A 4ZYZA 1A9XA 5GQSA 1WEHA 4C14A 5JNUA 4D96A 2A59A 3C7AA 1ZYUA 2VBFA 4DKJA 1FMJA 4ZIRB 3DUWA 1AKYA 1L5MA 4BYGA 1E2KA 2XRMA 2DC1A 1RT9A 3IDOA 3W6ZA 4NULA 4QUHA 2CUNA 1XO1A 1YR9A 3BCRA 4YCCA 2QAGA 1WF6A 4KW7A 3W2HA 5FUVA 5BW5A 5MHTA 1PFYA 2C2ZA 2H08A 4BXOA 3L6RA 4BN5A 2AK2A 2VDOB 1QJCA 2RHLA 2Y1FA 1GPLA 2NV0A 3AFNA 3AEXA 3IP6A 4IQ0A 4L9AA 4RHTA 5KQSA 2XDWA 1KYQA 5I7UA 1R15A 1DWPA 1V6AA 4TYMA 1W6UA 4OREX 6Q21A 1AXEA 4M1YA 4GO1A 4BU0A 1Z2EA 1LQTA 4MUKA 3UK2A 5AXBA 1D1SA 1UZUA 4TTRA 4OGKA 1GZ4A 4PGMA 1QWOA 2ZVDA 3RUEA 4HS9A 2B3DA 4C20A 4DNOA 3IV7A 1V0JA 1C7RA 2HGZA 5JCOC 1WVMA 4CXMA 3C3JA 3G5MA 5H02A 4X85A 4ZREA 5ECDA 5M5BA 1OXBB 3GT0A 1QRRA 2IYQA 2Q7XA 4KH0A 1E3LA 1L4MA 4V38A 3AVTA 2XQVA 3D3KA 1IZ9A 4U7HA 1EX1A 3UAGA 4KGVA 4Z1MD 4D42A 4JYCA 4HEJA 1DG3A 5AJXA 4BC0A 2GZAA 5B1YA 1ZR4A 5H3HA 1JEQB 1FNDA 4PC3A 1XVTA 2YJ3A 2YV2A 4G8JA 4OF4A 1O0CA 1JZTA 1FNNA 3KVYA 1Z7WA 1EUCA 2Y3IA 3QWBA 5EKXA 2DTDA 6PFKA 3HKEB 3C6XA 4PS1A 3HLKA 4U2KA 1DAMA 1RADA 2CCKA 4N49A 4B7XA 4TZ6A 2HWYA 3O8QB 2HO4A 5IAJA 1F8XA 1MOZA 1HDGO 1SCKA 2BF4A 1YWGO 2QTAA 4CMIB 1I5OA 5KX5A 3UFXA 2D2EA 4AJLA 4MB2A 1G5RA 3IKVA 5KEIA 3SJBA 3L06A 1Y82A 3FRJA 3O92A 4JX8A 3DKIA 3VR0A 4CDGA 2GARA 1JQLB 4QE3A 4ZIRA 5KC8A 2V0NA 4B74A 5LXTA 3RRBA 2CWDA 1GNSA 3E9NA 4MR8A 4HH0A 2DCUA 4OQXA 2O8NA 1PCXA 5A3RA 4HF7A 2FETA 5CT9A 5C4GB 1NVVQ 2AN4A 5J2UB 4L4SA 4NHOA 3ROZA 5KOJA 3HGQA 3QEKA 5AI0A 4HUJA 1XEWX 5A1TA 3KEGA 2QE7A 2ZRGA 4PM4A 4F56A 1W0KD 2GA9A 2C3YA 3E0XA 3QBTA 5JHGB 2J9XB 1M34E 4COKA 2FMUA 4KOEC 1BH2A 2TS1A 3OZIA 4WKPA 5BSWA 2QKYA 5EP2A 4EKYA 1YOBA 3RJMA 3ZG6A 1FDRA 1K8ZB 4PHTA 4EBFA 3IP9A 4Y2YA 3CFYA 4AX8A 4CF7A 2H4ZA 1L5OA 1K7YA 3D0RA 5AI5A 1VTKA 1KI4A 1ZHOA 4Z7NB 4KN6A 5CG2A 4JI3B 3EXEB 4ZKDA 1JNYA 3SYRA 1IHPA 3A3PA 2X5NA 3LRXA 2FGJA 5FL3A 2R4QA 4JP1A 2NZXA 3FWYA 1HPLA 2BPOA 2NTJA 4M53A 1Y6RA 4RZ3A 2YV4A 3O1LA 4EA7A 5HZKA 2HSGA 3HJUA 1MFZA 2H8KA 5KTRA 4OQNA 2H63A 2QTWB 3VTZA 4CMGA 4MI3A 2FRDA 1JT9A 3DB1A 3RFUA 1FFXA 3I12A 4DNQA 1F5SA 5C3MA 3AFGA 2WF5A 3GQBB 5B1EA 4WEOA 3NTQA 1R4ZA 4Q7LA 3B1FA 4BASA 1PE0A 4D9KA 5LMUB 1QTIA 4WOPA 2II6A 5HRUA 2AJLI 3X2EA 4C4XA 4Q4DA 1NI4B 2OCDA 2PGJA 2CV1A 3HZOA 1AB6A 4MGYR 4MLDA 1T5BA 3WIEA 1P2BA 2RAUA 1QIMA 2WA1A 4HGQA 2EDAA 3TOVA 1F9AA 3NAZA 3F49S 4J9UE 5DO9A 1HV8A 1W5EA 2A1UA 2DR3A 1BE1A 3WIVA 2QTNA 4INPA 1OFHA 1TM5E 1TVEA 4OAQA 4YHHB 3NZEA 1NU8A 4GI2A 4GR9A 1RQGA 4V0SA 3NHRA 1L5HA 3KB8A 2YZMA 4YRFA 1L8LA 4DRXB 1GTRA 4M4SA 2Q99A 1DO0A 3DYVA 4CG2A 1H9AA 2J1LA 1OJ7A 3OZFA 2JHCA 1OWNA 3RAFC 4OIFA 2J3MA 1U4NA 2ZR8A 2R11A 4RHCA 4NU8X 2QSYA 3D8SA 2ID7A 1HBJA 2BEUA 2C3PA 3VYTB 1B16A 2J0QA 4HNRA 2TECE 4IDHA 2NT4A 1A4IA 2OGUA 3ZD9A 1DKQA 1GNLA 1KKMA 5E9JA 1Q16A 2QX7A 4FZJA 5LP6F 1U31A 5BN5B 1E4VA 1I5EA 3JPWA 1IY8A 2FSGA 2P35A 2WG2A 5CW2A 2P4EA 3KNZA 4HAWA 4OGGA 5KQRA 3K8ZA 5LLSA 5G1NA 1F8YA 2GZHA 5DBIA 3N1UA 4J9VA 4V24A 1N0VC 2CGEA 2AJCA 1UPTA 1UJCA 2H54A 2QVLA 2X9LA 3IEXA 2G63A 4NYIQ 4ZI7A 1DUSA 1S7CA 2CMHA 3U17A 5JARA 3PPXA 1ECJA 4H27A 4E5PA 1P6UA 1TUGA 3ZH2A 1JR3A 4DRYA 5AJYA 3KK0A 4HD8A 4MUAA 1M7GA 1OBCA 3QBEA 5ICGA 1FQKA 1P7CA 4C0BA 1EUYA 2R5NA 3L1JA 5IZ4A 4RY0A 2J0EA 3JZIA 4TRMA 3IURA 3L7CA 3M5DA 4EY6A 4C05A 3MFYA 3HVRA 1D1PA 3WQBA 2C5AA 4CKEB 2XKKA 1E9CA 4K6CA 2EEPA 1E3WA 5EMHA 3VNUA 3ICEA 4ZOLF 4EPVA 1P2SA 4WASA 4IYRA 4URYR 2YJZA 2YV3A 3LDHA 1UKAA 4DA4A 1EB9A 4ASUA 2G72A 1PX0A 5F23A 1BXGA 4REMA 1FRNA 2OESA 1Y6ZA 1VMIA 4MWDA 4DCSA 1GG8A 4CEIB 3GG2A 4FI3F 1YS9A 5CB4B 5L4LA 4FHZA 4WKBA 4H1HA 1WO8A 2Y93A 4AYTA 2Z3ZA 4QGFA 1D5CA 5DW3A 2UYYA 5MDHA 1NSFA 1NFQA 4CNBA 1DI0A 4I5GA 4N8SA 3LHKA 2FMXA 1KYWA 2O2EA 4U4AA 1SOUA 1V41E 4UU0A 1DV1A 2BEJA 5A7GA 2WLTA 4XQ9A 3OU2A 3FTNA 4MUIA 4J7XA 4QAQA 3ER8A 3OLWA 4RKFA 4UOEA 4GLOA 2FWIA 3FUXA 4DLVA 1GFZA 4IWYA 4QG7A 4Y2PA 4RD0A 2YJGA 1HQCA 1QR6A 4QYWA 1CIPA 1CIVA 2E6KA 1GR1A 2B1JA 4H17A 1P6QA 1JQ3A 2JIZA 1UXOA 3N2YA 4JBLA 1W4RA 3RFTA 2JCGA 3PUJA 1Z4MA 5CM8B 5K51A 1QYIA 1B26A 1WQ1R 4KXLA 4BEBA 2XKJE 4YPOA 5KQLA 3SEQA 4MW1A 3AO0B 4HG2A 3PXGA 1TMYA 3VNRA 4I5DA 4JXJA 4HLNA 1W5TA 1L3IA 2XW6A 3IUJA 2D13A 3IIKA 3M6FA 1IWPB 4JVLA 2UZ1A 4M9ZA 4X6UA 4BMYA 3RHFA 4BNKA 3AV3A 3BZWA 1XROA 3FI0A 5T8KC 1LJUA 4AU1A 3MIZA 4I08A 4AK9A 1Q3TA 1NA5A 4KYVA 3OQHA 1P73A 1LK5A 4BRUA 1QKJA 3A7EA 3G9XA 5BMVA 3DE2X 1JJIA 3KZMA 5IVIA 3S5UA 2G7ZA 1E2EA 4F1KA 2XVAA 1DJLA 1X3LA 3AOGA 5DLQC 4TLMB 1K8YB 2HD4A 1UK8A 4TV9B 1X19A 3PYXA 4LK3A 4XWYA 2Q9AA 1P9LA 3D8HA 3WLAA 4US1R 4B3MB 4IJWA 4TYPA 1NTRA 2EQBA 4YALA 1X2EA 1CNMA 4E4YA 1NP3A 3TPCA 3RAEC 4WOJA 3U4QB 2D3TA 3EQ8A 4IDPA 4R1SA 4AF8A 2OQRA 4CYMA 1ZK2A 5F77A 1SUIA 2PUHA 4NV1A 5EGNA 1KAQA 2FDXA 4D0NA 2OUIA 4H0FA 2RHGB 3JQAD 4GX2A 4I2NA 4L15A 2Y8EA 1Q0LA 1DT5A 4YX9A 4PXAA 5I48A 2AYYA 3AW8A 1UL1X 1KI8A 3LUPA 3ICCA 5KCZA 3U09A 1TJYA 1ZSNA 1W76A 4EHAA 3Q0IA 5IT5A 4XYMA 4WKOA 2FJPA 2OYSA 1Z45A 5DXAA 2BFFA 1EVJA 5LVAA 4YNBA 3T94A 1USVA 3LDGA 4G0PA 4RVFA 4YUAA 4REQB 5DM60 5JEEA 2C99A 3QYPA 4RYLA 3ZHRA 2RGWA 4IHJB 4TYYA 2BUAA 4FFSA 2GM4A 4FYHA 4PZYA 1QYRA 1E9EA 3N2KA 1BGVA 4LCBA 2R25B 3H4IA 1ZHFA 4RKYA 4Z7QB 1BS1A 1CQXA 3CLSC 4V0ME 1OXXK 3DJFA 1W581 2AOVA 1TK3A 3F1LA 2FOXA 1CR2A 1XRNA 1KMCA 2R00A 3AETB 3GGPA 3NJ8A 4H4DA 5AKZA 3TIVA 4F4HA 1GKYA 4G4SO 4LBVA 4PCUA 4RD1A 3KUUA 2WKRA 1SZDA 2QAIA 3OUZA 3DAYA 3I52A 1Q0HA 4QBGB 3L9WA 2HLDA 2QOEA 5FUMA 5FWYA 4U2EA 1GGFA 2EV9A 2FFJA 3FOFC 3N2ZB 1S02A 4B3SB 2HRRA 4QLAA 3USES 3WK4A 1NXXA 4RY2A 5JCJD 2WJAA 3DNMA 5AOBA 2R9VA 3DMTC 3PE4A 1QVVA 4PHFA 2JIOA 5ITSA 3C3CA 1NQUA 4Y2TA 1U8YA 2F9FA 4AP9A 2V59A 5L7TA 4F9TA 2NYUA 5ILGA 3DOJA 3E9RA 1C0EA 2EQAA 5LWHA 1DCMA 3JASB 3RUPA 4Y2XA 1UM8A 4WZ6A 2NQ2C 3OY2A 3AM1A 3ZQ4A 1TX4B 5HQTA 2CHFA 4J0DA 3ST7A 1ZMOA 1U0LA 2Q8NA 3SY8A 2ZAMA 5INTA 4EX7A 2G0NA 3VX3A 9ATCA 2J6HA 1ZSVA 3BK7A 1GZSA 4R5MA 3A70A 1W5AA 4C0WA 1ZRSA 4CR7A 3LF1A 4Y0VA 3TGLA 4ED9A 5CCEA 4II3A 5K45A 5I7SA 4XQGA 2JH3A 4MRMA 4PAGA 1WB9A 2X7HA 3DBLA 3I6ZA 3OQJA 4YJ3B 3FCAA 1XHLA 2E7ZA 3N05A 2ZIVB 5EEGA 1HK7A 4GYWA 3OZEA 3L0CA 4RENA 2O5EA 5KYXB 5AM1A 4I4TF 1ECBA 4PO8A 2OYRA 1P0QA 3T3PB 5M2QA 3HEBA 4O4JF 1LBHA 1HDOA 2FVYA 3TEFA 4F72A 3OQOA 4ZO6A 1P0FA 1AXGA 2QM8A 1DJNA 1MB4A 1RBMA 1YRYE 3GUVA 3OCXA 1Q74A 2AEEA 2AD5A 4C6HA 5KYKA 3THWA 1OD6A 2LVBA 2DX7A 1GQOA 4DDKA 2NSDA 1EFPB 3KR2A 5CP8A 3RI3A 5HIAA 5G53C 2D54A 3KSBC 1FUIA 3MOSA 3TCKA 3R7WA 1MVLA 4IGKA 1PR2A 3ORHA 4RHEA 3L0IB 2XRZA 2X3FA 2XE6A 2QTZA 4JEIA 4N5HX 3SR3A 2PEYA 5K0CA 3HDHA 4IF4A 1EP3B 5AK6A 3BIOA 4DCPA 1ZAYA 1OLUB 2Y67A 3KOYA 4IGFA 4C4YA 4Z49A 1J5XA 1Z12A 3A4NA 3DZKA 4CEJB 5DTIA 4MCIA 3QQ5A 1FPMA 3ZBPA 3K70D 1OWOA 4AG6A 2ZYWX 4ZDJA 5I9IA 2Q2NA 2B5WA 1HWYA 5EUMA 4ARAA 1AQUA 3HCEA 1URPA 3COYA 3D7LA 1CBUA 2HLNA 4RMGA 5EIAA 2DT8A 2FWJA 2FRXA 2PTHA 4XXHA 1T34A 3GLGE 3G0BA 5DGDA 1FF9A 5FPQA 3NBXX 1T4CB 1UBFA 2Z5LA 3ENWA 3SHWA 4OXKA 5AQ1A 4DLZA 1ISGA 5TV2A 5HZGA 1W87A 4HGZA 4GMGA 1DFHA 2DUMA 2CNWA 2AG1A 2H65A 1IWBB 1ZK3A 2QDXA 1RWMA 2JK0A 1RAEA 3FPEA 2BKXA 3WL5A 4RJ2A 3JQDA 2FP3A 3H11B 3OSZA 3EASA 3LW8A 2ZI4A 5E4YA 3TIGA 1ETUA 4PO9A 4C1BA 1ZD9A 2BGRA 1J0BA 4AQDA 5EGSA 4CM4B 4BNIA 1DBRA 5C4MA 4FVTA 4J6EA 4QEKA 2OP1A 2WIDA 1Q7GA 1VL0A 2FR0A 2Z6VA 2IYRA 3CUSA 4JT9A 4AF7A 1XKLA 1HYHA 2LNDA 4KC0A 1XXLA 2IPMA 3WB0A 1JWLA 3TJZA 1TUBA 2I7TA 3TS1A 1USGA 2LIVA 5LQCA 3WK7A 1CQJB 3LWBA 4L8YA 2QIPA 4LRUA 3V4OA 4DUGD 2POCA 2VBCA 4S05A 2HPHA 4TXNA 1OU4A 3HSYA 3UMVA 5ADHA 3QV2A 4KHZA 5FI3A 2AHOA 1FK8A 2QJFA 4FMBB 3WMWA 3U56A 3G9UA 4P82A 2HIGA 2O3QA 4OI2A 1RYMA 1P4AA 1NZJA 1Y0BA 5TQ2B 1MUUA 1EZ4A 1LLCA 2FXIA 2PZLA 2ZJ0A 2JBAB 4OK5A 3C7CB 4F3NA 1SKYB 3PENA 2D0OB 1N4AA 4OQZA 3CX3A 3T4UA 2BMAA 2FEMA 4YRBA 1Z33A 5AW9A 1K9SA 5ITVA 2IHBA 2O4UX 1PGJA 2K87A 3DLAA 1EP2B 3LP8A 4EX6A 2QZSA 3B6MA 4BE4A 2RD2A 4TTTS 1NUUA 3BMCB 4AKEA 3AX6A 4LF6B 1KRXA 2B21A 2R7NA 1J49A 2P1ZA 1JFLA 3ZVRA 1L6IA 4HQ0A 4ITVA 2XQFA 1SC4A 1JAYA 1GRVA 2VN8A 3VR3A 1PAUA 2RJOA 1F6BA 2ZSEA 2MINA 3ORFA 3NPAA 5B64A 1GZ6A 2PFKA 2PSHA 1PZMA 3HMQA 1M1ZA 3EVZA 3H8SA 4UW9A 5FFMA 4C7BA 1M5TA 3UC5A 5I4BA 3VO2A 4X45A 3ZS9A 5DM4A 3FZEA 1A88A 4X1IB 4O3FA 3D59A 3U39A 2ZM5A 1C14A 4KQCA 3AIIA 4IG4A 3ICOA 1VHQA 1W1WA 1DVRA 1NQWA 2IOQA 2PKWA 4BO2A 2CNLA 4GICA 1QV6A 2GM3A 4L8GA 4HUTA 4D25A 4C7JA 3ZW9A 1H5QA 2WFLA 2QSUA 3UT5A 1D4ZA 1G42A 2X4GA 5I45A 2PX3A 2WRZA 4HLCA 3AGPA 5D00A 4AUKA 1O8BA 4L51A 3P26A 1DUVG 1R0CA 1Z17A 3BB1A 1LF5A 2JFBA 5DNEA 2NUTB 1ZWKA 4PYQA 2F67A 4JNCA 3ZEAA 5L3QB 2CXPA 4XFDA 3LKBA 1E3TA 3W5AA 1O57A 1QHHA 4E2YA 1DQRA 3PUWA 4M83A 4CUJA 3AR3A 1AOXA 1J8MF 3QOWA 4NCNA 3EC1A 4PZ9A 4EHIA 4P5PA 5BP7A 1MJNA 3EIFA 3L8CA 2XTNA 3NGMA 2J3HA 4FX5A 4DV1B 2O8EB 5LQSA 1E9BA 5CDTA 5AVSA 3IOCA 4LJ4A 3MWEB 1TGYA 2CNOA 1PYOA 2ZWIA 1FC0A 5BUZA 5CVEA 4Q1BA 5I3CA 5JPIA 3Q8WA 1LDMA 3VVMA 3OZVA 4KE8A 5LLDA 3H2HA 4E3WA 1U4OA 2HMSA 4DMHA 4BFLA 4TKLA 2AD1A 3HKEA 1EXVA 4XM1A 1NFFA 4X6XA 4CF3A 3LVQE 1APBA 2JATA 4ND2A 2QQ5A 5ALRA 1BROA 3WWEA 1XZKA 2ZFUA 3DMPA 4RLFA 3R74A 5DCUA 1BX0A 2QMEA 1J0XO 1X87A 1NN3A 1MIHA 2H85A 4EB0A 5JBNA 3SNHA 2I6FA 1DRVA 2VLIA 3VNBA 3QW2A 3EHEA 5KVAA 4J0HA 5LP6A 3A1TA 3CRVA 4MR7B 1P75A 3C24A 2QM0A 1E7SA 1Z6ZA 1EUZA 1LV7A 3C6YA 2RGEA 5M3BA 3OQ6A 1LDYA 3RF7A 1WM1A 4EHLA 4KPUA 3S29A 3IXMA 5KTNA 5KTTA 1JR3D 4BGDA 2XTZA 3IB3A 3VPFA 2REQA 4Z9FA 2AOUA 2O6HA 3TFQA 3HCAA 1UC5B 1B0UA 2BM9A 4S2EA 4WY2A 3UWSA 3VR6D 2JDIA 3A06A 2IS1A 1RWXA 4N1AA 2WP0A 3R7SA 4EW6A 5J47A 1ZVMA 1LWNA 2CLOB 4G1UC 4M86A 3LGXA 3RRXA 1DO8A 4TTPA 1I0LA 1KNQA 4HZGA 2VDNB 2Y0EA 1QE0A 3WO0A 2R6ZA 3H7AA 3CCFA 4F9FA 2CLFB 4GXTA 4EYKA 1FSPA 4G2NA 4QDKA 1GPJA 4S12A 3PWTA 2DBVO 3BB4A 5IDYA 5HR5A 2PGXA 2EW8A 2ZULA 3FIJA 4JLWA 3VOBA 4DCNA 2C59A 3C85A 3AG6A 1C9MA 3KIPA 2PA3A 2EJUA 5JFGA 4Z9BA 3I28A 7ADHA 3IYLW 4NMXB 4JBNA 1EWRA 4F3YA 1Z6GA 1MVOA 4HEA6 1HYGA 4AUEA 2H8GA 3IS3A 1XZFA 4E1AA 5B4TA 5JQGA 3NYRA 4KLRA 1INLA 2EJCA 3HS3A 1PHRA 2V6MA 4W4TA 5IFLA 1EK0A 2TRSB 1H0HA 1W73A 4EA6A 5LKAA 2IKSA 4OXYA 4CIAA 1KKUA