4KTTE

Structural insights of mat enzymes: mata2b complexed with sam
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
308
structure length
306
Chain Sequence
b'PNRRVLVTGATGLLGRAVHKEFQQNNWHAVGCGFRRARPKFEQVNLLDSNAVHHIIHDFQPHVIVHCAAERRPDVVENQPDAASQLNVDASGNLAKEAAAVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGEKAVLENNLGAAVLRIPILYGEVEKLEESAVTVMFDKVQFSNKSANMDHWQQRFPTHVKDVATVCRQLAEKRMLDPSIKGTFHWSGNEQMTKYEMACAIADAFNLPSSHLRPITDSPVLQRPRNAQLDCSKLETLGIGQRTPFRIGIKESLWPFLIDKRWRQTVFH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-adenosylmethionine synthase isoform type-2
publication title Structure and function study of the complex that synthesizes S-adenosylmethionine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 101
structure length 306
sequence length 308
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF04321 RmlD_sub_bind RmlD substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4kttE00
4OH1A 5JXWA 3GGGA 1EDZA 3ZHYA 4L4RA 4M49A 5ER9A 3H6KA 3ICCA 3PHJA 3UKOA 1H6BA 3MJ4A 3ANNA 5JDIA 5CDUA 1KVRA 3FHLA 3PEFA 4XDYA 2C2YA 1W8DA 1SB9A 2NNLD 3DBHB 1YWGO 1WDKA 1ISIA 3H9UA 1PZEA 4IJVA 3GUCA 4TMFA 3JQBC 1I2BA 4E2WA 4YR9A 1LDEA 4BNKA 4G2NA 1I36A 2VT2A 1EVYA 3MJTA 3WLFA 1I0ZA 4PG7A 2I3AA 4XQCA 3M1AA 2GN8A 2GUGA 3FPCA 3IMFA 3CMCO 2IEDA 4FPXA 1U1IA 1IPFA 2Y1DA 4GKVA 1N1GA 5I7VA 5JMWA 4AVYA 4PLFA 2G17A 4DC0A 1T2CA 2CFCA 1TI7A 2FOIA 1N7HA 1YOVA 3V2UA 3BMOA 3IKTA 3UGKA 3C1AA 4EEXA 4F46A 2G76A 2XF8A 3QA9A 4WKGA 4S1VA 3WS7A 4RZIA 1JTVA 3MCVA 3TNLA 1Q7BA 5TX7A 5BSGA 4XB2A 3E1KA 1E7YA 1YQDA 1T1RA 2BGLA 3FWZA 1B26A 3OBBA 2AQIA 2ZQYA 1PZGA 2FRDA 2DC1A 4AG3A 4CM1A 3R6DA 4IJUA 2QZ9A 4E2ZA 3ROMA 5K6AA 2VWGA 4OSOA 3CUKA 4R5MA 4MINA 1EMDA 3M1LA 4RQUA 4WE3A 5EQDA 3GHHA 3LT2A 2O4CA 1UAGA 4J7CA 5LDHA 3A1NA 4FDAA 4EUEA 2X4GA 1W0CA 1R4NA 1SCUA 3RUIA 1SOWA 2RH8A 3ITDA 3BHIA 4JX8A 4GI2A 3AWDA 1UAYA 4YVFA 2HMUA 4M1QA 1GZ4A 1BXZA 3ONFA 5JAZA 1BXGA 4PCVA 4IM7A 4NMHA 4IZIA 3TRIA 5DDIP 1PWZA 4M86A 4UUOA 1ZSYA 2ET6A 3WSVA 1V3VA 2A4KA 1BRMA 1RM5A 4NH4A 5ENVA 1NVGA 4I1IA 1TT5B 4PLPA 3VKVA 4RPGA 1VKNA 2WM3A 1MUUA 3AUSA 3DFUA 4PG5A 4P8RA 1WWKA 2I76A 1Y1PA 2ZATA 5A9TA 4E0BA 1JLLA 1WDMA 2O23A 4GVXA 3F1KA 4RVGA 4XJTA 3V1YA 2Q3EA 4FFMA 1PZHA 3QW2A 3ZWAA 1YL6A 1W73A 1K5HA 3TPCA 4IDDA 5IG2A 4KWIA 4PLHA 1Y7TA 1PGJA 4OXKA 1I3KA 1GCOA 3ZU2A 4G5HA 2PTGA 1YQGA 3I4CA 2WE8A 3QWFA 4IS2A 3S2EA 1ML3A 1YBMA 2DBVO 4I5GA 3QVTA 3VDRA 1LLCA 4N54A 2DUWA 2X0IA 1D1SA 5ILOA 4HXYA 4E5MA 4FGSA 4CMCA 2EKPA 4YJGB 4IQ0A 1DRUA 3FD8A 3IKVA 1YRLA 5AXBA 3WSWA 2W2KB 3PGJA 4I9HA 4J9UE 1IZ0A 2ZTUA 5BT9A 1E6UA 4TQGA 4HBGA 4XQGA 4MOWA 4XQEA 4MJLA 3E8XA 1E3WA 5JS6A 2J5KA 3IP1A 2FSSA 3D0OA 4FW8A 1T4DA 1ONNA 2CF5A 3HN7A 1VJTA 2AXQA 2EXXA 4A2CA 1GQQA 2EP5A 2IEBA 1PJ4A 3GZNA 1YS4A 4YJHA 1R15A 3C1TA 4BNMA 4W4TA 3DFZA 4DA9A 1BXKA 3O8QA 1DRVA 4MVJG 1KEVA 1MLDA 2EGHA 3R3SA 1X1EA 3D4NA 4UAGA 5CP8A 3ZI0A 1XLTA 5EERA 1B0AA 2G1UA 3JSAA 4UREA 4GMFA 3JYPA 2C2XA 2BMAA 4YYZA 2BGKA 1U2GA 4F6LA 3RBXA 3B1KA 4ND1A 4ZRNA 1LJ8A 1A71A 1Y5MA 3VPGA 3DTYA 2P5YA 4FOOA 5EQFA 1EUZA 4DREA 1R66A 2JD2A 5HTOA 1SZJG 3UVEA 1GY8A 3LT1A 1KVQA 5IXYA 1VI2A 2NVWA 3K92A 4PLTA 5T57A 1XKQA 2DBQA 5G2OA 6LDHA 4ITUA 3L4SO 2OHXA 2YW9A 4AJOA 1FDWA 2O3UA 2PKQP 3INTA 3CKYA 2IRWA 4W6ZA 4ZU3A 3G79A 3FBTA 4CMAA 1T2FA 2VTDA 2F00A 3JV7A 2B5WA 3MOIA 2TMGA 3RUHA 4OO3A 4DWVA 3E18A 4BHTA 4WLFA 2D3TA 5JAQA 4GL4A 4H7PA 1QXSA 2H5LA 3IQDB 3L9XA 4NBTA 2D2IA 4ZICA 4IQGA 1EBFA 4DTIA 4DXHA 1LA2A 4R01A 3QVOA 4DQUA 5A04A 3OICA 1G1AA 1C3VA 5FI5A 3I83A 1ZKMA 3SXPA 4PLWA 3EC7A 3W4KA 4DMMA 5A02A 4G81A 4CMKA 4YT5A 1IOLA 4D3SA 1U3VA 1IHXA 4QFCA 4CQLB 4B3JA 4CM8A 1ID1A 2V6FA 2OP1A 1DHRA 1Y81A 2VYNA 4RVHA 4K26A 2NTVA 3SLKA 4MVJE 1NVTA 5B4VA 3D1LA 4IPTA 1CERA 2VYND 3IJPA 4ZQHA 2DBRA 4RCVA 5EESA 4AJHA 4CM7A 1VPDA 2YZ7A 3GPDG 3C7DB 3OETA 2VT3A 3JQFC 1E7WA 1IE3A 4BMNA 2QYSA 1PL7A 4FD3A 2AA3A 3JD1A 4D45A 1YDEA 4YT4A 1LLUA 1X0XA 3DEYX 1D8AA 4HP8A 3JD2A 1VSUA 3H9GA 4II2A 4R5HA 2ZYDA 2FPPA 4Z9FA 1LDYA 3MTGA 1B3BA 2R00C 2ZQZA 3BYZA 4L0QA 3NT4A 4YPOA 5TGDA 3TZQA 5A9SA 2CDCA 3WR5A 1RM0A 4HNGA 2EGGA 3F1LA 4J7XA 4WNIA 3AOGA 1XHLA 4XIJA 1MGOA 3ZV6A 2R2GA 2C5AA 4BNTA 1A72A 2WYWA 2VN8A 4M89A 4PG8A 2QRJA 1NAIA 3DZFA 4BO0A 1T2DA 3KLPX 4J2OA 4JP2A 1EK6A 4TSKA 5JBIA 4NG5A 4BB6A 4NFHA 1SO8A 3C24A 2G0TA 2PLAA 5JDCA 3AY6A 3CH6A 1YOVB 1LQUA 3BMOB 3D3WA 2Q2QA 2E48A 1N92A 1C1XA 4PG6A 4BNWA 4IZHA 4R9RA 4DGSA 4OYRA 1YB5A 4U0JA 3LVFO 1GFSA 2OBYA 3ZV4A 4LISA 3UXYA 4BIIA 5KVCA 5DCWA 4MVJP 1PR9A 3BAZA 3JYNA 3WGQA 1GU7A 4LSMA 1JA9A 2VWQA 3N7UA 3SLGA 1I3MA 2HMTA 3RJ9A 1CIVA 3E5MA 3LLSA 1Z73A 4DBVO 5J23A 4UULA 4PN3A 2Y1EA 4J1SA 2A94A 3PJGA 4ZQGA 3HG7A 1A7AA 4L74A 2PKQO 3F9IA 1GEEA 2P4HX 3QVSA 4WNCA 2X5JO 1VE9A 2DT5A 4CLOA 1KBZA 3RIHA 3PIDA 5L45A 2PZLA 3B20A 2B35A 2XAAA 3GEMA 3V8BA 4E6PA 1QV7A 4BV9A 2DLDA 4YAIA 3JYQA 4BNLA 4DQXA 4BNJA 3MOGA 3OEYA 4XJSA 5FFFA 1WP4A 4YT2A 1DEHA 2BELA 3FR7A 1BXGB 1BG6A 3JQCA 4OXNA 4PFJA 1IPEA 3L9WA 4E2YA 3S1LA 5JPIA 1ZK4A 2CVQA 4HY3A 3B70A 4JJFA 5DT9A 2VTEA 2A9FA 4HADA 1HT0A 2Q2VA 3PQFA 3QP9A 3HWRA 1TVEA 3H9EO 3K6JA 1ZMTA 3WJAA 4KTTE 5KJEA 3VPHA 3BTVA 4Q39A 1AHIA 5JAMA 3Q3CA 4EJ6A 4FOSA 4IDFA 1K89A 1WPQA 4URFA 1ZFNA 4WEQA 5T64A 3DAPA 4RF3A 1ZO8A 3CMMA 2GLXA 4AJLA 1UXGA 3QWHA 1GYRA 2ZB8A 4HV4A 5KJCA 3KBOA 4Y9DA 1Z7BA 4UVEA 1UXKA 1QYCA 5EINA 1V35A 3FI9A 5THKA 5L3ZA 4R1SA 4P4LA 4K9DA 1G6KA 4PVCA 3RWBA 4LVCA 5B37A 3JQGA 5BQFA 2BI7A 3PIIA 2BFOA 3ENKA 2JAPA 1FDUA 4RLSA 1HE3A 4ONEA 3MWDB 1PGPA 5I9LA 5C7LO 3PVZA 1I32A 2YFQA 5L95A 3IDSA 4E4YA 3K5PA 3WOHA 1YL5A 3BTSA 1UXIA 2NTJA 1EQ2A 2BRUA 1EFKA 2IDZA 2W4QA 2UAGA 2JHFA 1N9GA 2FWMX 1GZ3A 2PGLA 5A05A 2HRBA 2NQ8A 3GVXA 1E3WB 4JROA 4QFDA 3L4BA 3OQBA 4KOAA 1HE2A 4E5PA 5DULA 1ENYA 1GD1O 1UZMA 2O2YA 1PTJA 3OJFA 4YQZA 5AOVA 2O4UX 4D3FA 4IIVA 2H6EA 3GZNB 1LSSA 1HDZA 4YJHB 4GX2A 1VL8A 4XYBA 3TL3A 3U4DA 3O8QB 1NR7A 1HE4A 5LDGA 5U1PA 5KVVA 3DOCA 5B12A 2ZB3A 4A10A 1VRWA 3CPSA 3MJSA 2FPGA 5JDIC 4M55A 2GCGA 1I3NA 3UUWA 3FNHA 1NWCA 4CR8A 1GAEO 1WZEA 3INGA 3ZHBA 2X5OA 3EMKA 1U4OA 1NR1A 3EGOA 5IAAA 3TF5A 1J49A 1HZZA 4GH5A 3PZBA 2FY8A 3AI1A 4R1TA 3HFSA 4IGFA 1PJQA 1WW8A 4RQTA 5T67A 3RKRA 1ISHA 1KEPA 1PJCA 4KZPA 5G0UA 4L8VA 3TSCA 5G0WA 2Y93A 1LEHA 3A9WA 1Z45A 5IZ4A 5TS3A 2GASA 4LRTB 1Y6JA 5CEEA 4E5KA 4KP7A 3QHAA 3KVOA 4R54A 3BA1A 2A35A 4II3A 3I4FA 4WECA 1NXQA 3BTOA 3VVCA 1C1DA 2J3HA 2YYYA 5KJ1A 4AJIA 4CV1A 5IFLA 3WBBA 2Y67A 4DC1A 1HDOA 3AK4A 4Z0TA 1FDTA 1X15A 1HLDA 1ZBQA 2VOEA 2X5KO 5ADHA 4J4HA 4NBVA 4OOEA 1LDGA 3I6QA 4CM8B 1RPNA 3KRTA 4CM3A 2O3SA 1Y8RA 3AY7A 1I2ZA 3HDJA 2GERA 3U9LA 4YAKA 1XIVA 3ZU4A 4N7RA 5EN4A 5G0TA 4WGGA 4K28A 1NWHA 4GAEA 1DFHA 1PQPA 3EZYA 4BNZA 1SOVA 4Q9NA 1BGVA 1M66A 3ETEA 5AYVA 4FB5A 4NPCA 2PH3A 4OIMA 2AEFA 3CINA 4J2HA 5C7IO 3X2EA 4CV0A 4OHUA 1YL7A 5KCZA 3G1TA 3U62A 3Q9NA 9LDTA 3H9JA 4DPKA 3M2TA 3ZWYA 4EEZA 3ON5A 4R51A 2X0NA 5KTKA 1U8FO 2AE2A 3BXXA 4DVJA 4D42A 3GMDA 3U3XA 5ITVA 4FJ0A 3NJ8A 4WEOA 3D64A 4R41A 4JN6B 3ASUA 1PJ2A 2AHRA 1TB4A 2YJZA 4DPLA 1P45A 3I9NA 2OL4A 2GR9A 2X0RA 3SVTA 1P31A 5A9SB 5JAIA 1GADO 4MIOA 4IDGA 4LN1A 1K2WA 3RU9A 4MKXA 2V65A 3VPXA 2Y0CA 1ISJA 2GN4A 1PGQA 1NTOA 2FSVA 1DAPA 1R0LA 4FCCA 3IOYA 1H0KA 2BFPA 2UYYA 3ZNOA 3T7CA 5HS4A 4A7PA 5KKAA 3GG2A 4A27A 2HO5A 4UUMA 4MVJM 4YACA 3V2HA 3D5QA 2PGDA 4F45A 3GC6A 1UXJA 4BOYA 2Z1NA 4RDHA 1SNYA 1KS9A 1X7GA 1GR0A 1U3UA 3U49A 1UJMA 4CMIA 3D3WB 1JWBB 3AUAA 4CODB 4L4SA 4AJ2A 1ZEMA 5IXSA 5DBIA 2Y66A 1C1XB 3SC6A 1GV1A 3WX0A 2HK7A 4IY1A 3RC1A 3GQVA 1PL8A 3H3FA 4IMPA 3WGYA 2VWHA 4KWHA 2EF1A 3DHYA 4ZQEA 3KETA 2NUAA 4IMRA 3UCXA 5L7TA 2CF6A 3BIOA 4JBHA 1MFPA 5BR7A 5KKCA 5L9AA 5BSFA 3WWZA 4E32A 3I1JA 4TVOA 2X9VA 4Z0PA 1P1RA 3MZ0A 1DSSG 1MFZA 3KSDO 4L76A 1H6AA 3KO8A 4L73A 1EVZA 5TSDA 5TIIA 1ZK2A 4BQPA 1SMKA 2EEZA 1T26A 1PIWA 1VSVA 1E7SA 3U09A 3KV3O 3FSRA 4BNYA 4Y6SA 4RVDA 4JCOA 2E49A 2ZTLA 3PI7A 3P7MA 5ILGA 4A26A 4BNVA 4NK4A 1WLYA 2W90A 8LDHA 5TT0A 1GYPA 3WNVA 3ZWVA 2PD6A 4JXKA 4CLOB 4E2XA 1B16A 3ZWWA 4XGKA 4A0SA 2O7QA 4PIVA 4MDHA 2YHIA 4TRJA 2EERA 4BO8A 1FMCA 5CPBA 3MJCA 4XYMA 3GDFA 4B4WA 1V6AA 2W2LA 4O1MA 3ZDFA 2EP7A 2X9GA 3PJDA 2V6BA 2WDZA 2Q4EA 2V6MA 5CAEA 2W2LD 3QVXA 2ZCVA 1D3AA 2IXBA 3NUGA 3U4CA 4UEJA 5IDXA 1ADCA 3GGOA 1NPDA 3SX2A 3CZRA 3WMWA 3DBRA 3UF0A 3L77A 3RUEA 1NNUA 2GZ2A 4NK5A 1I2CA 4Y98A 4ALJA 3VAZA 1P1KA 3BMCA 3GVIA 4Y6PA 3TZHA 5KJFA 3U4IA 1J4AA 5JO9A 3OA0A 3F6YA 3ORFA 2Y1CA 2HJSA 3OHSX 1A7KA 2UUPA 5LC1A 3GAZA 3LLVA 1KVSA 5L4NA 5JYEA 1EDOA 1HSOA 2QRLA 3KXDA 4E3ZA 1QLJA 4BUCA 1LNQA 1O94A 3DZGA 3F4BA 3VKUA 4DLLA 4CUZA 4J3FA 1YKFA 1LDBA 1DJQA 1PS8A 3OQ6A 1YB4A 3JQGB 3VPSA 4B4OA 2PD3A 4Y8VA 3S2IA 3DZIA 3GAFA 1Z75A 1CQIA 3E5RA 3P19A 4BO7A 4E21A 3KOUA 1WMBA 1KY5A 3GNTA 3DHNA 4DIBA 1QP8A 4MVJH 4WLOA 4J16A 3QIVA 4OKIA 4XB1A 2HJRA 4GWGA 1XDWA 2J5QA 1N9GB 4TRRA 1ZXLA 3H2SA 2XOXA 3FBGA 4MO2A 1DC5A 3BMQA 3JQAA 3TZ6A 3M2PA 1DOHA 5IN5A 3GA0A 4EZBA 5IF3A 1AHHA 3A28A 3SJ7A 4D0SA 2X86A 1I24A 4CLHA 4GX1A 4B8ZA 1U4SA 3JQAD 3KB6A 3K2BA 1E3EA 1F0YA 2B4RO 4DL9A 1R4MA 1ADBA 4FFOA 3U0BA 2Q49A 3B1JA 4XKJA 3TFQA 3GVCA 4KTVE 3NT2A 2B69A 2Y1OA 1A4UA 3QVWA 5DCUA 1U2DA 1M75A 3RC9A 3RUDA 1HLPA 5L4LA 4CM4A 3KZVA 1YJ8A 2R6JA 2ZB7A 1AUPA 4Z9YA 5L7YA 1F06A 3OJOA 2BFAA 5B4UA 5CDGA 1NFQA 1A27A 4RGBA 2J8ZA 5CHEA 1MC5A 3OA2A 4WK6A 1LC3A 5EJ2A 4AL4A 2FZWA 3I23A 3WLEA 4H15A 3HJAA 1LQTA 1DBVO 3K8ZA 1NX6A 5IDQA 1MXHA 2WWRA 2PA3A 3NKLA 3NTQA 3E6AA 4XA8A 3RASA 4EGFA 1DFGA 2GRAA 3K96A 4B79A 2RCYA 2NQTA 3EDMA 3H9QA 4TKMA 5T8KA 2P9CA 2GGSA 2UUOA 3GZ4A 4Z9XA 1WNTA 1ADFA 3ZV5A 5JDCC 1E3SA 1HKUA 1NASA 3KLMX 1K3TA 5ICSA 1HDRA 3DTTA 1SC6A 1C1DB 4IINA 2VZ8A 3K9QO 4Q3DA 1HTBA 4U5QA 3HZZA 2F1KA 2HK8A 1ZW1A 2H63A 5AXDA 2DPGA 4BGIA 1IZ9A 1JN0A 2YUTA 4FFNA 2WJPA 4MKZA 1SB8A 3GHYA 4J90A 1ISGA 2J5RA 3OIDA 2B0JA 2AQ8A 3WGIA 4BNUA 1UUFA 3VPFA 1H9BA 2PD4A 4HFRA 1DLJA 3OQ1A 2IZZA 1Z6ZA 4TROA 3DZBA 1Y8RB 4TRMA 1XELA 4XWYA 4BV8A 2LDBA 1JDJA 1MG5A 3GRPA 4LW8A 2WTBA 1KC1A 4AJNA 3IS3A 1ZK1A 2GDZA 3N58A 2YHUA 1JW9B 2HMVA 1M76A 3B6ZA 1EE2A 3Q2KA 4DPMA 2NTNA 1DIGA 2GN9A 5JNLA 4ID9A 2EG9A 5JC8A 4D44A 2HMWA 9LDBA 3HSKA 3I5MA 3PRJA 5A3JA 1M2WA 4CLRB 2J3JA 5HWSA 5TJHA 2QRKA 4IDAA 4IDBA 3BZUA 1DIHA 4WLNA 3EK2A 1NFFA 3NEPX 3HE3A 2NU8A 1LC0A 4MVJF 1U28A 3ZW8A 3IIEA 4YJFA 3PYMA 3QWBA 2GF2A 3S2GA 1U7HA 3LF2A 5HRUA 3W6ZA 1JWAB 1AE1A 4Q3CA 4E31A 3IP3A 3E9MA 2B36A 1ULSA 2JFGA 3ZH2A 4CUKA 4AJEA 2Q4BA 4C7KA 5A03A 4BVAA 1ZCJA 1BDBA 3VDQA 4LMRA 3T7EA 4W9NC 3EUWA 4YRDA 3NDIA 3ROPA 1EQUA 3NDJA 4G65A 3PQDA 2VCYA 2I9PA 1GPJA 2I66A 2Z95A 2C59A 3DMTA 3UFXA 1SAYA 3KYBA 3KSZO 5ICMA 3Q0EA 2IZ1A 2NU9A 4KMSA 1TT7A 2FN7A 2Q1SA 3RUFA 2BGMA 1ZZEA 4CMIB 4EDFA 5TQVA 1OZAA 3WQSB 3PHLA 4KQWA 2O7SA 2X0JA 1IY8A 3RROA 1W4ZA 4CMEA 1OI7A 5IN4A 1C14A 2QZZA 1E1NA 1BW9A 1PU2A 2OO5A 3Q2IA 1AGNA 4QSMA 3DZKA 2CVZA 3CE6A 3PLNA 4GSLA 5DF1A 2C82A 4B3HA 2NWQA 1O5IA 2FPIA 3NT5A 3PP8A 2ZJ1A 4MP6A 4FFLA 5TC4A 1IUKA 3WB9A 4F3YA 5F5LA 2P2SA 3WIDA 5K9ZA 1JKFA 1NHGA 4CMJA 2VRCA 2VWPA 3I9JA 5C37A 4XR9A 1E1KA 4BNHA 1HDCA 4YQYA 3ZWCA 2VRCD 4IGEA 1OC2A 4J7UA 5JE8A 1KYQA 3ZWXA 5A06A 4I5EA 5A1TA 3L4BC 1PEDA 2PH5A 4UEOA 4CLDA 2I5PO 2RBEA 5JCJA 2WEKA 1WXDA 1P74A 2E37A 3N74A 5L53A 3GFGA 1QV6A 1U5AA 1P3DA 4GX5A 4U8GA 5JCJD 4QTZA 1YGYA 4CUJA 4OKNA 4NU6A 3WYCA 2JCVA 3CTMA 3G49A 1PSDA 1M6HA 1LUAA 3E9NA 4FSHA 2YHIB 4QUKA 3H2ZA 2QYTA 1I30A 3H3JA 1R12A 3K2EA 5I8WA 1X7HA 4HFNA 2PWZA 1NP3A 2OUIA 4GVLA 1N5DA 2DTXA 4XRGA 5AXCA 3FR8A 1BVUA 1LRLA 4DYVA 5GMOA 3NGLA 1KOLA 1F14A 2GSDA 3TWOA 1CWUA 5F1PA 1LRJA 3DZJA 3DBLA 1Y8QA 3KYDA 3C1OA 3DBRB 2B83A 4UVIA 1LSUA 5DOZA 3TZCA 3W1VA 3UCFA 1QR6A 4XGNA 4O59O 3GPIA 1VL6A 1LXCA 2E82A 4FGWA 1IHYA 5COBA 4NIMA 1R4NB 5H83A 3BMCB 3E03A 2TMDA 4NR0A 4AJ4A 3DR3A 2PZKA 1PGOA 3SEFA 4ALMA 3OIFA 1Z74A 4ND3A 4YAGA 1A5ZA 4E33A 1Q1NA 4DIFA 3O4RA 5JFOA 4C4OA 4CPDA 4GPD1 3DXFA 4EBFA 3AI3A 1JVBA 3PXXA 1B8PA 4HKTA 1U7TA 2GD1O 1UXHA 2Q2WA 4WASA 1DC6A 4NBWA 1L1FA 1YO6A 3DB2A 1YBVA 4BKPA 1O95A 1XU9A 1YB1A 4NFYA 4QXMA 4Z3DA 3BHMA 4UUNA 1H6DA 1QMGA 3RSHA 2AEJA 2JD0A 3ZZNA 1E7MA 5JO0A 3GT0A 4FN4A 4W9NA 3NRCA 2NADA 3HFGA 3T4EA 2VUUA 1DXYA 3TDKA 1P0CA 1ZNQO 3BMQB 1UDBA 1XG5A 3JQAB 1UDAA 4M54A 4CQMA 4M87A 5DZSA 2E6UX 4KQXA 4AJJA 3F47A 1DC4A 2RIRA 3JD3A 7ADHA 2P4QA 4Y6RA 1IB6A 2AQKA 2HKIA 1QRRA 4CQMD 2W98A 4EUFA 1T25A 4CLEA 1R4MB 1V9LA 1ZSVA 3OP4A 2Q1TA 3HB5X 3ZU5A 2VHVA 3ZWPA 4KDEA 5CFZA 1H94A 3LK7A 3DMYA 1JKJA 4W7IA 4IUYA 1PQUA 4D7AA 2NVUA 4NHEA 6ADHA 2VHWA 4R1NA 3W6UA 4BNXA 4B8WA 1YE3A 1PJLA 1B15A 1I5RA 2GPTA 4HNHA 4CM4B 3F3SA 2CY0A 4ALIA 1C0IA 3AJRA 3ABIA 3JD0A 4Q3BA 1TA4A 1DIBA 2H9IA 2HDHA 3ZNNA 1GL3A 3LC1O 4BO5A 3DOJA 5ITWA 1IULA 3U5TA 2ILTA 3RBVA 2AMFA 3VZPA 4GGPA 3TZKA 2WYUA 2AEMA 3FRJA 4GLLA 3ZHZA 3Q11A 2DTDA 4ZVVA 1ZMOA 3LT0A 3VZSA 1KC3A 1H6CA 4J43A 4MKRA 4D79A 2P5UA 5A4DA 3WYEA 3DQPA 4BL5A 2CMDA 3FTNA 4CMGA 3AFNA 3H4VA 1FK8A 4QQRA 5IZCA 5GZ6A 1HEUA 3L6EA 1E1MA 3LDHA 3ZNQA 4ZQBA 1Q0LA 1B14A 3KHUA 4FC6A 4BGVA 5B4TA 3STHA 4J4BA 3GFBA 4D3DA 5DP1A 1C0LA 4AJPA 3NGXA 4D43A 1YXMA 4BKRA 3HDYA 3C8MA 4TZKA 1OFGA 1JAXA 1F8GA 2JD1A 2X6TA 5U9CA 2WD7A 1XYGA 4ZJUA 1Y5RA 1LDNA 1B2LA 5C7OO 2HCTA 1BTOA 5F1OA 4JIGA 4ZGWA 1BMDA 1WZIA 4RVFA 4JGBA 3GY0A 4FQ8A 1W6UA 2JCXA 5B1YA 1YBAA 3VTFA 2IZ0A 4CM9A 3KYCA 4J0EA 1ISFA 3RC2A 4CL8A 3AOEA 3FNFA 3BTUA 5DNAA 3A4VA 4CM9D 1PR3A 3AM5A 5FI3A 2JCYA 1B8UA 8ADHA 3GRKA 2C7GA 4Q3EA 4OQYA 1UH5A 3LT4A 2B4TO 1HZJA 5ER6A 4LK3A 4NQZA 4XZ3A 4NJMA 4YBZA 4CR6A 5BSHA 3EAGA 3DAFA 3ZW9A 2CUKA 2Q45A 1E3LA 3GH3A 4ROSA 3E48A 5G4KA 1J0XO 2BKAA 3RUAA 5BSEA 2RH4A 3G0OA 2I3GA 1WAMA 3DWFA 4RPJA 4B4UA 2CD9A 1LTHR 4CV2A 5FYDA 3O9ZA 4JP3A 2FR0A 2Z5LA 1HF3A 2O2SA 5L40A 3H65A 3MJVA 4FIZA 4DRYA 2Y1FA 2X7HA 4EJ0A 1YH3A 4RF5A 3GEGA 1KVUA 5TLSA 3OECA 2VUTA 2EW8A 1FJHA 2YFHA 3DBVO 3KM0A 2PKRA 4YJFB 3VH3A 3VOSA 4PLZA 2EIHA 2QG4A 4P38A 1M6WA 4PG4A 5T6BA 3QY9A 2O3RA 4R3WA 3S2FA 4Q3NA 1LRKA 5A5FA 3C3XA 4A03A 3LQFA 1CEQA 4R3NA 5TJ9A 3EY4A 5TRTA 2O50A 1OC4A 1PJSA 4QECA 4J91A 3UICA 3A06A 3ITKA 1BWSA 3FCOA 5KVSA 3OMLA 1I01A 3W4JA 4BO4A 2AE1A 3O26A 4OAQA 5ENDA 4E12A 1E0DA 1VL0A 1AXEA 3PLRA 1EBUA 5HS6A 4I5FA 2AG5A 5COAA 3WQQA 4J1TA 2CDBA 1PQWA 1BHSA 5K0ZA 3RU7A 4L75A 3WQRA 4F6CA 1K6IA 1MXFA 1D7OA 2EKQA 4ILKA 2PZMA 5G0SA 1DIAA 3R3JA 3ZN2A 1BW9B 4CMBA 3WWYA 2ZK7A 4WCFA 3PPIA 1CDOA 5JCXA 2C29D 3F4LA 3EHEA 4DYDA 4W82A 5ES3A 3PHHA 1PX0A 4RLHA 2CSUA 4D0RA 4Z6KA 2ZKLA 3CXRA 3F5QA 1TLTA 2UDPA 4H3VA 3GNQA 1MV8A 4XRRA 3I9OA 4IQ8A 3KTDA 2A92A 2CDAA 4RV9A 1LI4A 1P44A 2AQHA 3O03A 3LYLA 1EZ4A 3MWEB 4OMUA 4EITA 3PFWO 3EZLA 5FEUA 3RFXA 2RHRA 1LU9A 3UCEA 4RDIA 5EL0A 3MTJA 1NQ5A 3Q6IA 2FP4A 2PK3A 3TQHA 2VZ0A 3VZRA 1B7GO 4O5OA 3GNSA 4I08A 1GUYA 5I9NA 3PQEA 3RJ5A 1GCUA 1P0FA 5COQA 1C0PA 4RPHA 4B7CA 4DMLA 2Y99A 3IUSA 2P9EA 3ANLA 1LLDA 3AU8A 1AXGA 4UEKA 1GUZA 4EUHA 1RKXA 3GG9A 1VLLA 3LF1A 1RM3A 3EYWA 1R6DA 2PV7A 2J3KA 2YV2A 3DC2A 3WTBA 3DBLB 1Y8QB 1CF2O 3KYDB 4Z0HO 4BGEA 3WFJA 2UVDA 4YJDA 4B7XA 4GWKA 3QLJA 4OGWA 2EW2A 4HFMA 1CQJA 3TFOA 1M67A 2DKNA 1ZJYA 3OH8A 4BO1A 3H8VA 4MVJA 1MB4A 3CSDA 4PZDA 4L4XA 2ZTMA 4MVJD 1EE9A 1YJQA 3EVTA 2D8AA 1GEGA 2NU7A 3GR6A 4FBGA 4BQRA 5T8KC 3FTPA 4CM6A 3I3OA 3PGXA 4JNKA 2HUNA 1A9YA 4I9UA 4ZA2A 1MG0A 1JKIA 5T5QA 1E1LA 2X1HA 3JYLA 3I9LA 2YDYA 3OJ0A 3GVPA 4XYGA 4FFRA 5CG2A 3HB4X 4UVHA 3UHAA 3HNPA 3ENNA 3OSUA 4OQZA 1TXGA 1DHTA 3WICA 5KJ6A 3QV1A 3GEDA 1Q0HA 1B3RA 4DBZA 1XR3A 2P9GA 3F5SA 4JJGA 3OF2A 1NQOA 3FWNA 4DQVA 2Q99A 5I7SA 1R16A 2C20A 5EMHA 5DOVA 4PVDA 1GQ2A 3G17A 3K30A 3GDOA 4QEDA 5KIAA 3P5SA 4LGVA 1WDLA 3H5AA 3HDHA 1FDVA 1DLIA 1H9AA 1P1JA 1HE5A 2VQ3A 4CQMB 4GKBA 2OOSA 1O9BA 1LDMA 4UVDA 3X2FA 1I3LA 3IAHA 4E5YA 1JU9A 4IXTA 1X14A 1H2HA 1PZFA 4ALLA 4N5NA 2CZCA 1NQAO 3UAGA 3Q1LA 4WJZA 3IUPA 2NVUB 3SBOA 5G4LA 1K6XA 1ENOA 3JTMA 4DIOA 1MP0A 1J5PA 1LSJA 3GVHA 1PL6A 1Q7CA 2B37A 2YV3A 1UP6A 1NM5A 1CETA 3DZHA 3L6DA 2G82A 2FR8A 4HUJA 3CEAA 1I10A 2BHLA 4JJIA 1GZ6A 1PJTA 3GOHA 3JCZA 3PJEA 4RPKA 3F46A 1HYHA 1QORA 1N1EA 1WVGA 4R69A 5A5EA 3RI3A 4XR4A 1BVRA 1S6YA 3FN4A 4FC7A 3ICPA 1GV0A 5CEJA 3ST7A 2ZYGA 1C0KA 4WPGA 4IXWA 4P22A 2Y0EA 3DAGA 1DC3A 3NV9A 1ZIDA 3TOZA 2Q46A 1QSGA 1LSOA 5IDYA 3W8EA 3DMTC 4XX0A 4BB5A 4FJ1A 1ISMA 2ZB4A 3T4XA 1U8XX 2FMUA 3OFSA 2DPHA 2WD7B 4J1QA 4BMVA 2HRZA 2GNAA 5F3RA 2WYVA 3ETGA 4CMEC 4BKQA 3K31A 4JQCA 4U0KA 1UDCA 3W4IA 2D4AA 3OJEA 2EJWA 3JQBA 5JSFA 3KYCB 4IDCA 4TVBA 1XQ6A 3V5NA 4B4VA 1KIFA 3I9MA 5CDTA 1PS0A 1KVTA 3RD5A 2EKLA 1T1SA 4WLUA 3R0IA 4N5MA 3DL2A 1F17A 2DUUA 1V8BA 3KUXA 2VZ9A 3RFTA 1K0UA 1U3WA 2C07A 2ZJ0A 2C0CA 2JHGA 3AFMA 3GN2A 3ZWOA 3LSYA 4NJMB 2QW8A 4BKOA 1B8VA 1IYZA 4NI5A 4YWJA 4NBRA 3ULKA 3D4OA 5BNIA 1UP7A 1XCBA 4UUPA 4ND2A 3RUCA 1X0VA 1KY4A 5G4KB 4MIYA 1DIRA 5JY1A 4YAEA 2VHXA 3G3EA 5JC1A 1H2BA 2D5AA 3KEQA 3OIGA 1P33A 3HDQA 2DBZA 2WMDA 2WSBA 3RCBA 3JQ8A 3WMXA 1XSEA 1NVMB 5AQ1A 1PS9A 1ZJZA 5HA5A 2PZJA 3TJRA 4XD2A 3A14A 2DVMA 4AFNA 1E7QA 1RYDA 3QSGA 5BNTA 3JYOA 3HUDA 3PHIA 1N8KA 1F12A 1JVSA 2GYYA 4PRKA 1MX3A 5I7FA 3LC2O 4PLVA 3NTOA 1Q7GA 3H7AA 4TKLA 4JK3A 2Z1MA 1KEWA 1V0JA 1XEAA 1Y9AA 1YONA 2NM0A 2XXBA 5G0VA 4ZD6A 1HDGO 3ZWNA 1RM4A 2EWMA 1HYGA 4JLWA 4IJKA 4O63O 4XGIA 1L7EA 1JQBA 4YA6A 4YTEA 3QRWA 1X7DA 3QE3A 2I67A 1A4IA 1XWFA 4J9VA 4ZQFA 3VTZA 5GY7A 4QO8A 3C85A 2Y1GA 4CM5A 2HAEA 3ZU3A 1EUCA 2IE0A 3V1TC 2OXIA 2DM6A 4WUVA 3KEOA 1VC2A 2VHZA 4AJKA 2HK9A 2EV9A 4BO9A 2Y0DA 3DDNA 5C3MA 2JFHA 2HMSA 2YDXA 4ZRMA 3G1UA 1PJBA 3PFFA 4WCFB 4YRAA 4ZHSA 3GGPA 4XEHA 5TF4A 5JLAA 4R4JA 1DRWA 2Y68A 1E77A 3OM9A 1SEPA 2CVOA 2IXAA 1DDOA 2JJYA 2I6TA 3PYLA 1P9LA 3AUUA 1DFIA 2NACA 4Y67A 4ZN6A 3WGOA 1NAHA 5JY6A 4YEDA 1QYDA 5DP2A 3JQ7A 2NV6A 2VNSA 4IBOA 7MDHA 1EUDA 2VNAA 3MJEA 4R68A 3JQ9C 2PY6A 4EJMA 4C7JA 2RAFA 3LU1A 4NNJA 1F8FA 3GLQA 4NJOA 4WOJA 4J0FA 2Q1WA 5DN9A 3BMNA 1EVJA 2VUSA 3ANMA 1VJ1A 3I52A 2EJVA 5EIOA 3ROQA 4DLBA 2JL1A 1HDXA 3NJ4A 2C5EA 4TRNA 4Z3KA 3I9KA 2P68A 1IL0A 3VH2A 1HRDA 4I8XA 1ULUA 2J6IA 3VC7A 3WGGA 4GSKA 3M6IA 3Q9UA 3C7AA 1U5CA 2RHCA 1O8CA 2O48X 3WGTA 5IJZA 1QYWA 2NSDA 5TNXA 3PYXA 2OBNA 3WG9A 2I99A 3ZWMA 3B1FA 4OXYA 3HN2A 1NFRA 2HLPA 1VKOA 2UV8A 5THQA 4RF2A 1CYDA 1OMOA 5KNLA 3UW3A 1H5QA 1NPYA 1OAAA 1Z82A 4JBGA 4CLXA 4E30A 4YXFA 5IZCC 4J49A 3V2GA 2O3JA 3U4HA 5JMPA 2OGUA 4OL9A 4YT8A 2BFMA 1X1TA 2O3TA 4BNFA 2BLLA 4RPLA 4KUHA 4RF4A 5CDYA 2DFDA 1SEVA 3C7CB 4PGFA 4NU5A 2VRBA 3D7LA 3VVBA 1DAOA 4LRSB 1VJ0A 4BNIA 3LZ6A 2EHDA 5I9MA 1ONOA 1PGNA 2HU2A 3AY3A 1E6EA 5GZ1A 4U7WA 3OJLA 3NYWA 1YQXA 4NDNE 4P4NA 1NHWA 4WLVA 4X54A 2BI8A 4S3MA 3NAQA 3R1IA 3UH1A 2OZPA 3VHRA 3DBHA 2FHSA 2IYPA 5F21A 5IDWA 5I7EA 2VOJA 5JW6A 3S55A 2X23A 2G5CA 3CIFA 3ZGYA 5F1KA 3COSA 4XQ9A 2X9NA 5I8ZA 4BNGA 3AOEC 5FWNA 2X22A 1GQYA 4UVGA 2QIOA 2V7PA 4HX5A 3CZMA 4FS3A 2PFGA 3ETDA 3GUYA 1ZXBA 4H16A 4BNNA 1ZK0A 3NX4A 1I33A 1ZH8A 3JQDA 1E92A 1HYEA 1O0SA 1QKIA 1R37A 1GDHA 1T24A 3DHEA 1YDWA 4RZHA 5H82A 1O89A 1TEHA 2SCUA 3PK0A 4WCDA 3RFVA 1GTMA 4YAJA 3D3EA 2QX7A 3RVDA 1MC4A 1PJ3A 4RORA 5KOIA 3RBZA 2H1SA 4P4GA 3PJFA 3WIEA 4INAA 4DLAA 4HWKA 4GLOA 3L0DA 1ONPA 4GGOA 1EK5A 3VH4A 1D4FA 1HDYA 3IC5A 2PR2A 3PTZA 3AUTA 4OSPA 1H93A 2D59A 4K6FA 4B3IA 5H81A 1E3IA 4FFPA 4GX0A 4PRLA 4OOFA 4MP3A 4KUEA 1E7RA 3JQ9A 1UZLA 3UOGA 5GZ3A 4PLYA 3W8FA 1QYVA 3ADOA 2C7VA 1HSZA 3SC4A 1RYEA 1XQ1A 4E5NA 4TZTA 5A9RA 3VZQA 3RQSA 3WBFA 3ZWBA 5AXAA 1N7GA 4EYEA 1V3TA 3DONA 1Q0QA 4N18A 1HETA 4IJWA 4PLGA 1J6UA 3INRA 1E5QA 3JQFA 2C54A 4WLEA 4L9RA 1P1HA 2IYOA 3PWKA 3AI2A 3TN7A 1YVEI 1QG6A 2JAHA 4DUPA 5KWEA 2WE7A 1DJNA 4U6QA 3RKUA 2JFFA 3GDGA 4NBUA 3VH1A 3L6OO 3E9QA 4QO7A 3WTCA 1X13A 3QJ5A 4RVUA 2GN6A 3ONEA 4J6FA 1L7DA 4ALKA 2R00A 2OMEA 4WCFC 3TOXA 1E3JA 2AW5A 2PGJA 5MGBA 4R9SA 1TT5A 2IODA 2P91A 3KSUA 3AM4A 1NYTA 3W8DA 1OBFO 3K73O 4M8SA 3HADA 4J1NA 4XCVA 4MIEA 5L51A 1RJWA 3TL2A 5DBGA 2NLOA 2JKVA 3ASVA 1FDSA 1ADGA 4BMSA 3L07A 1DO8A 2GZ3A 2GO1A 4CV3A 2HSDA 3V1UA 3WNQA 4RJTA 5CEFA 4Q3AA 1T2EA 4NFSA 3GK3A 1O6ZA 2YY7A 2OP0A 4BS9A 3MEQA 1CRWG 3JD4A 2V6GA 1T4BA 4I5DA 3FF4A 4N5LA 4PLCA 5BNFA 5L4SA 5HBRA 5CG1A 1XU7A 1ZEJA 4MVJI 4QT0A 4CMHA 4GBJA 2ZTVA 3AU9A 3S8MA 4BO3A 3DO5A 3NDRA 4K6CA 3H5NA 3JQ8B 1U3TA 4YDRA 1BDMA 4YJGA 1CJCA 1Y9EA 3AW9A 4YB8A 1XA0A 3ZHXA 4FJ2A 3NTRA 3PDJA 1UR5A 2D1YA 4GQAA 2BH9A 2W2KA 1P1FA 4PZCA 3P2YA 4MP8A 1ZSNA 2PNFA 3EW7A 5DBFA 1E5LA 2LDXA 5L7WA 3ZNPA 2HQ1A 4W99A 1Z7EA 4RVSA 2DFVA 1ENZA 2POQX 3D4PA 2Q50A 1N2SA 2GZ1A 5A3VA 2BD0A 4R1UA 3QWAA 2VYVA 3WJ7A 4BKUA 1ZUD1 2ZCUA 5LCXA 3PWSA 4GMGA 3ZV3A 3WGHA 1SBYA 4ND5A 5HM8A 2VYVD 3PWZA 2OORA 1U9JA 2B5VA 4A73A 4CR7A 1QYXA 1G0NA 2WD8A 3JQEA 3E82A 2E4AA 5FF9A 1P77A 1FF9A 2XPCA 1T2AA 4J4TA 5EPOA 3GF4A 2QHXA 1BSVA 1LX6A 1SPXA 3WYBA 3SJUA 3WFIA 4RL6A 4EW6A 1E6WA 2D5CA 1HXHA 4D46A 3WDSA 4YCAA 4ESOA 4O6VA 2DQ4A 4YRBA 3QQPA 1ARZA 5U4QA 1EFLA 3FNGA 1P1IA 4U6SA 4XYEA 3H5RA 3P2OA 4JBIA 4TWRA 1QLHA 5CPFA 1EEHA 2YQ4A 4CJXA 2FR1A 4E13A 3FNEA 4B7UA 1ZVMA 3ADPA 3I6IA 1RWBA 2OFPA 2Q1UA 1FXSA 2X8LA 5AVOA 4XYLA 2X58A 1GPDG 3IJRA 4NZ9A 1GYQA 2AG8A 3QWIA 2DAPA 1R0KA 1V3UA 2YV1A 4LSWA 3JQ7B 2D0IA 3IL2A 5K6AC 3JQ6A 3ONDA 2I65A 4LCJA 1OOEA 1HWYA 5C5IA 4CL3A 4BO6A 1GUFA 1WMAA 1NQTA 4KUGA 1KETA 4QX6A 1A9ZA 4OJNA 2DU8A 3ZCXA 1DPGA 3PHGA 4RO0A 5JYDA 1VM6A 3PZRA 3UN1A 4R16A 2QQ5A 3AM3A 1UP4A 2FZEA 3BHJA 3HQ4O 3BMNB 2NU6A 5DCYA 1MA0A 4A5OA 4D41A 1XGKA 4FR5A 5TT1A 1LLQA 1G0OA 4KDFA 3RAJA 4IDEA 4IIUA 4BO2A 3EVNA 4HFJA 1I8TA 1PWXA 5MDHA 3LC7O 3WGZA 3WXBA 3GMSA 1EVIA 1KEUA 1AN9A 4CLRA 2NVBA 1JAYA 2BF7A 2ZIZA 1UZNA 3D5TA 4K1LA 4ALNA 2O3QA 4PZEA 2YQ5A 3FPLA 1K6JA 4EI2A 3HHPA 4CQLA 4LMPA 4I9NA 2B4QA 3O38A 1ENPA 5KVQA 4ND4A 1S7CA 1NPTO 3DOOA 2ZYAA 4AJ1A 3OEWA 4XDZA 3GN1A 4LVUA 4BGUA 5CDSA 4OM8A 3ROKA 3PDUA 2J3IA 1R0SA 2VHYA 1NBOA 2CNBA 2W8ZA 4W7HA 4LCEA 2Y05A 4O0LA 4AICA 1ORRA 1LBEA 1HL3A 1Q2XA 5F5NA 3RC7A 1DB3A 1ZK3A 4XIYA 2XXJA 4IS3A 4WOKA 1KERA 2DTEA 1D1TA 4MPDA
chains in the Genus database with same CATH superfamily
1DRKA 3VDNB 1UIRA 3L3BA 3IOMA 3R3UA 3RRYA 3K9NA 3UK0A 2D2XA 4BFZA 5CM8B 3IAAA 2F1RA 3H6KA 4LSGA 3UKOA 1D4OA 1HC7A 2CK3D 4FR2A 1XTJA 2VJQA 1QIIA 5CYFA 2G36A 1WCXA 2FUCA 2GLTA 4OHZA 3KLNA 3PEFA 5KZMB 4XDYA 2C2YA 3DEIA 4EB8A 5BV8A 4XLZA 2PWYA 1S2NA 2G9RA 5C34B 2HIHA 5LD2B 3SHTA 4HDKA 5HCUA 1PZEA 2RBGA 1IG3A 2ORVA 4E2WA 1FFEA 5KMGA 1QH1A 1NN5A 3EA0A 1LDEA 4G2NA 3WL4A 1YCDA 1QH9A 1EVYA 1OT3A 3FMPB 1OLUA 1I0ZA 4RE5A 1OZ0A 1BQ3A 2I3AA 2ZRDA 4XH9B 2E9SA 3VYTB 3UIEA 1PV4A 3TLZA 3HBNA 2VHUA 1YI0A 4MI6A 4LKRA 4Q6BA 4A0HA 1ESCA 3NPMA 3CZAA 4KPYA 4FINA 4ZAGA 4DT1A 1Y5LA 4DCTA 3VRHA 1BFUA 1DKRA 1H3EA 4HMQA 2XQVA 2G17A 2ENUA 4DV6B 2ZJ2A 3RGWS 1ZHHA 2FOIA 1XNHA 1N7HA 1ZQ9A 2R79A 3H11B 3H2GA 4MGKR 3BMOA 1NRWA 3V2UA 1QONA 4DA0A 2DHCA 1E1CA 4JSTA 3UGKA 3IKTA 5K8CA 3JAKA 5LWHA 1M2JA 3O9MA 4URHA 3I3SR 3PFIA 1HQYE 3MCVA 4UBNA 3TK1A 1Q7BA 4AMVA 2R751 2HLNA 3C1UA 3ZDEA 5B55A 2F59A 5DNUA 2GPYA 3KALA 3M82A 1VXRA 3HO8A 5KYGA 5SY4A 1PT6A 3OBBA 1G7TA 2Z58A 3EVEA 4TMYA 3W06A 3FDJA 1DX9A 4R1OA 4OHFA 4ENRA 3HBFA 4G4SO 3O75A 4CTJA 2GHTA 4LGYA 2QZ9A 1REQB 3OIYA 4E2ZA 2WYHA 4P7JA 5K6AA 4EMBA 2H4XA 2VWGA 3TJMA 1OREA 4UE6A 4NL4H 3WB2A 3EOAI 4LJLA 4DNXA 3TZEA 2C2HA 1XP5A 4CTOA 4RQUA 2D4HA 2NW6A 3L1IA 2R4TA 3C6ZA 1HFKA 3QMWA 4I4NA 3WP1B 3CVWA 1VTKA 1R0BA 1XEXB 2DUMA 3MTAA 1G8HA 4J7CA 1YB2A 3A1NA 4V2IA 3BE4A 2X0DA 1JFSA 1X77A 4PR0A 3R3VA 3WYGA 4DRXB 3P27A 4QQKA 1JDUA 2F3TA 3EGVA 4Y2RA 3E4DA 3H84A 1SOWA 2RH8A 1N5RA 4IXNA 5EKXA 4EMTA 4XVRA 1AKQA 4EB0A 1H69A 2DX7A 2OSVA 4HDMA 4RY8A 1Q44A 4QYXA 3AWDA 2EQAA 5LUBA 4IDNA 4BTLA 3R5HA 5I9SA 4TYQA 3GGDA 4OK5A 4MMZB 5ITZA 2IBMA 2JJ2A 2N42A 3ONFA 5BR4A 1N32B 1RJEA 2OGZA 1IJEA 2PV0A 3MTDA 2GSWA 3ZJ4A 3D6JA 4FILA 2AL7A 3OURA 2VNHA 1YI1A 1IEWA 1QLWA 2VSOA 2W6ZA 3FAKA 5DDIP 1IZZA 1PWZA 2CVFA 2PRSA 3BBPA 4N7BA 5KSWB 1ZUNA 4UPVA 3WSVA 3W2TA 4E08A 2JLVA 2INGX 1RM5A 4BX0A 3EJWA 1TT5B 3VKVA 3KEMA 2Q5LA 4IVRA 5EIEA 1P5ZB 1M1XB 2H4YA 2HFJA 3M9WA 3R20A 1KA9H 2C58A 1IY0A 3P52A 4AUMA 3ZDCA 1WWKA 4JA2A 5A9TA 4E0BA 4E5DA 1JLLA 1WDMA 4RADA 4KKXB 2IEZA 2IWHA 1HOTA 1PZHA 2Q3DA 1L1RA 5FA5A 4AROA 3KOWA 2REQB 5FL7A 1E2FA 2Q8PA 5AIAA 4KWIA 5AM2A 3V6LA 1DEXA 4WQMA 1Y7TA 2GDJA 1E3MA 4Q7EA 2H4WA 5JMOA 1GCOA 2F17A 3E58A 4US0R 3A6EA 5DTRA 2PTGA 1F0PA 1G5QA 1XZHA 2NO6A 2PSHA 4IS2A 5H7XA 1OVGA 4LRQA 4Q9HA 5AJHA 1MTOA 2QJFA 2Y9PB 4NEHB 4YUYA 3ZDRA 1QIHA 1SBNE 5IH3A 3HNOA 4ZK6A 2X0IA 2FEXA 1D1SA 2RH9B 1M2OB 4E5MA 4JEMA 5JIBA 1G17A 3FH0A 4B76A 4CMCA 3KT6A 3QG5A 4YJGB 4ZJYA 4Q4HB 5AXBA 5CJJA 2DCMA 2W2KB 1NBHA 3CV3A 3I92A 5BT9A 5H4GA 5CA0A 4K87A 2SNIE 5K0LA 1IJKA 5BQ3A 2ZGVA 4EI9A 4MOWA 1JIKA 1J2YA 2GKOA 1Y8CA 4EYOA 3ZLUA 5HK8A 1U6KA 5JS6A 2OG1A 5HRAA 2WAMA 1UKCA 2ODNA 3CKLA 4L3OA 2HT1A 2FSSA 1D09A 2BZ1A 3OLVA 4H1UA 2OUKA 1VJTA 1QAOA 5BUCA 2R1VA 5IT0A 4GM0A 2IEBA 4Q3LA 3RG2A 3GZNA 4KK4A 4ENPA 1YS4A 2OPBA 3O1IC 5E3JA 5HKKA 1IJBA 2AW3A 2QX6A 3P9RA 2O8FA 3DFZA 3P1JA 4Y3UA 4PX3A 2HIAA 4H1TA 1CUUA 1KEVA 2FPOA 2WWGA 1YVPA 3ZQ4A 1AXRA 5KTYA 1X1EA 1U65A 1AO3A 3D4NA 4PRZA 4B40A 4EVQA 4NCBA 2C0PA 4LOHA 3B6EA 1B0AA 3DDCA 1ESNA 3MELA 4FEEA 4P93A 5EERA 2V7GA 2QW1A 3I2JA 4R6WA 2GHIA 4KO8A 2BCEA 1X92A 4ZVOA 2G08A 2BGKA 4YYZA 1IXYA 3WAKA 3NVMB 3ZHCA 3T5AA 3P0EA 3ET5A 3ITNA 5H02A 4YQFA 4EJ2A 3V97A 3DTYA 2FG6C 4ZCRA 1BE0A 1HH4A 1JHVA 1WDWB 2B2CA 1EP2B 1CULC 2JD2A 2Z4RA 3G0IA 3KTOA 4MS3B 2OYRA 2JIPA 2CJWA 2YNMC 5C35A 3TCNA 4M9ZA 1V39A 2M2IA 4OQEA 4HH4A 2NVWA 3K92A 4PLTA 3EPLA 1MB9A 1FLNA 1XKQA 1RHKA 2DBQA 2OCAA 1C41A 1D8TA 2BBSA 3I6BA 2R6R1 3I6YA 3ICOA 3OCVA 5K09A 3EEOA 3RAFC 2OHXA 2YW9A 2QNIA 3IAUA 4HGZA 1FNSA 2GAIA 2J3EA 4WXPA 1EA7A 4ZU3A 5BW6B 2F00A 2CYCA 4TT3A 4PGAA 3V4FA 1BS2A 5FPQA 2R7MA 4BEWA 1HMYA 5H80A 1FTNA 3ZDDA 2NIPA 3EZ7A 3L79A 1QXSA 2H7YA 3W79A 2XQIA 1SQFA 2I33A 1GPKA 1TUGA 2GLUA 2D2IA 5IXJA 3IUEA 4K9LA 5EWLA 3CLHA 4JODA 4YRKA 5CB0A 3DHWC 1RBQA 3ZVLA 2OAP1 1FP7A 1V1MB 4CTMA 3V8RA 1JA0A 2QI9F 1C3VA 1S2GA 3GJZA 3ZC3A 4LHWA 5BMOA 1MH1A 2PSFA 4KO4S 3I83A 5HF5A 1RI2A 3VX4A 1WZNA 4QRIA 1XXHE 2PX3A 2HQBA 3EC7A 4DUGA 3QXXA 1VHTA 3W4KA 5KB3A 3I8XA 2J46A 3LGSA 2AFIE 1U3VA 4KBYA 1NG1A 4UW9A 3CW2A 3JY6A 4B6EA 2J0EA 1ID1A 3ROTA 3RRJA 5KQSA 4JVSB 1PYOA 5FLXA 3QUSA 4NMXB 4RVHA 5HGJA 2V03A 4K26A 1KXJA 1ZC4A 4WMLA 5B4VA 3DLIA 4IPTA 4OXXA 1DUSA 2XNJA 4AJHA 4IIEA 1CHNA 5E4FA 4DBLE 4QGSA 1W47A 2YZ7A 3BD9A 3LJKA 2HHCA 3NOXA 4JT8A 1AUXA 4HNQA 3HB1A 3LT5A 5DHAA 5T4EA 4WDRA 1OYVA 2ZRAA 1PL7A 1T5LA 4BMNA 4EKEA 4YIKA 4AZ0B 3NDBB 3SJZA 2P2ZA 3D3NA 1YDEA 3NRJA 4YT4A 1X0XA 4QOHA 1D8AA 4HP8A 2AOUB 4FE4A 4JI5B 1VSUA 2GHQA 4A82A 1FL9A 1TADA 2FPPA 5KOYA 2BGNA 1IONA 5CFNA 1BA2A 2I9KA 1E4YA 1C8BA 1AD2A 1NVVR 3CBQA 4F4IA 3AG6A 3GJ0A 1PKEA 2R00C 4DV7B 2XCLA 3NT4A 5CH5A 2HYIC 4CF3A 3PB3A 3TZQA 2CDCA 3WR5A 2FE4A 1QHEA 1ULAA 3FMVA 4DMHA 1PUXA 3DAHA 5G40A 1EWQA 3F1LA 3HRKA 5JTTA 3AOGA 3F3YA 2OB2A 4UJ3A 3RTGA 4BNTA 1MGOA 2PKEA 3ZV6A 4BQFA 5HXAA 5EZYB 2P6RA 4F2PA 2Y1KA 3MQ2A 1PCXA 1E9EA 3LP6A 4IFTA 5IKPA 1NAIA 1PI3A 3BIJA 1GNTA 3KJXA 3L1VA 3LPAA 2TMYA 121PA 4J2OA 1J8MF 2PMBA 1FYXA 2VDLB 4X20A 3U4GA 3RABA 1SIWA 1EK6A 1RLTA 4TSKA 2R8RA 3GXOA 3HCFA 3NHZA 4XUCA 2W0MA 4FKMA 1DJPA 2JKZA 3BDAA 3KPVA 3LLMA 1C3LA 1YJ5A 2CB0A 3MWFA 3GFVA 1KGSA 5AW5A 1E4OA 3HA7A 4QC2A 5JDCA 1YOVB 5AW9A 3LQ4A 3JVUA 4EEKA 1P8AA 1J97A 3KC2A 1IBRA 2P3OA 1ZNZA 2AOWA 4KJXA 1E2NA 1N92A 1UBMS 1WG8A 4XCQA 1GOTA 3NXKA 4D9EA 5A4MS 3O91A 2QEQA 5B7PA 4OQFA 2IU6A 3VKHA 5CFOA 4NBSA 2PTHA 3LVFO 3MOSA 1Z7GA 2QLNA 4KE8A 1NP7A 4UDXX 2OBYA 3QNWA 4FCVA 2BFEB 2X3FA 4LISA 5BRNA 3U0VA 3WLMA 9ATCA 4F2GA 5I48A 4U2EA 3HFJA 5DCWA 5KVCA 2O2EA 5JYCA 2ZM5A 3C8ZA 5DKFA 3G68A 3ERCA 2DFNA 2P0YA 4LSMA 1JA9A 1ZA1A 4I3HA 721PA 1EYZA 2I1QA 5J1SB 1SVSA 1B6TA 4G1UC 4MA5A 3LQ1A 1HT3A 4UU1A 5ALPA 3OUTA 1IK4A 2BSXA 2HDOA 5JH7B 1E1DA 1GTVA 4OJKA 4ZO4A 3OFVA 3VMMA 3QEMA 3DH0A 3RRNA 1Z0IA 5FWDA 2D54A 1U3DA 3PXEA 4RXTA 4B6GA 4YDSA 1H2YA 3UJCA 1LTKA 4LS3A 4K9SA 4MICA 1KBZA 2IPLA 4ES6A 1GTSA 3PIDA 5L45A 4GP7A 1CQPA 1VLQA 3I1FA 3B20A 1VJCA 2B35A 3GEMA 2II6A 3R9KA 3V8BA 3NP7A 5JBQA 2PMWB 4Y6LA 1NVFA 2JANA 4YAIA 4EA9A 1JEYB 2JBAA 3QBJA 5CTAA 1J8QA 4GF5A 1ICEA 1POXA 1TLLA 4MZDA 4P3PA 3OZTA 1WP4A 2ZJAA 3GGSA 1XPOA 2GBGA 4YMSA 1BXGB 3JQCA 5EJAA 1Y37A 1Z33A 1IPEA 3LXRA 3L9WA 4DQKA 1VIAA 3B3FA 1TCCA 1DQPA 3IIJA 4DLWA 5DT9A 5CVEA 3UBMA 2VTEA 5IC4A 4DFDA 2A1UA 2JGAA 4ZVKA 3SQWA 4B3BA 4AKTA 3DUFA 4TX1A 1TVEA 3DXZA 2PJZA 3HU1A 3DLPX 1X2BA 1ZMTA 4D41A 2CYAA 4C7BA 4XWWA 2UXDB 2XRYA 4PYJA 5LZ7A 1NATA 2RGEA 4KCGA 1BNCA 2Q6IA 2XVAA 3G8CA 4LDQA 2ZRHA 3Q3CA 3TSOA 1LW6E 4FMCB 5JXGA 1QDEA 3L8CA 4RH3A 4NF2A 4URFA 5FYQA 4C1NA 4WEQA 5T64A 4D96A 3CVXA 1O6CA 3CMMA 4QYMA 3GFTA 2HMAA 4BUJA 3QWHA 3SZOA 2OC9A 3RS9A 4BCCA 1JFFA 1T2NA 2WM2A 1H22A 1A9RA 4JLDA 4UTRA 1ZVKA 2ONJA 1BCSB 4XWAA 3MERA 3RREA 2V4ZA 3L7MA 2EFJA 5EINA 1ILEA 2Z43A 3T1OA 4HRAA 2Y1XA 4MTCA 4OJQA 5BSUA 4CZ2A 1WDTA 5B37A 4AUEA 4RKEA 1O58A 4FGZA 4IFBA 1JFVA 3JQGA 5BQFA 1G4HA 2BI7A 3PIIA 2HCJB 2HRDA 2BFOA 1TK9A 5FDFA 1JLSA 3H5VA 1F20A 3KR0A 4KIGA 4PR3A 4QLAA 2D2VA 1HE3A 2BMWA 2I71A 1NUPA 3LP5A 3AINA 4TMXA 5CLHA 4YFYA 2ZIEA 3W3AD 1T8PA 4FGUA 3ELDA 3LFTA 3WIUA 4DM3A 5C7LO 1CIJA 1I32A 3PVZA 1VL5A 2OCLA 5J2TB 3WOHA 1YL5A 3BTSA 2NTJA 1EQ2A 3RIMA 3WL3A 3TR0A 5KYKA 1QIJA 1RQRA 4Y2VA 3WLRA 2UAGA 4NONA 4DLNA 1GZ3A 4PSUA 1DP4A 5A05A 2HRBA 1QS0A 1E3WB 1U2RA 3ES9A 2NNWB 4OHKA 3SHOA 4B1FA 4RGVA 1ZJ6A 2Z3ZA 4GUAA 3KVYA 1RBMA 1BQEA 1RPJA 1GD1O 3W7AA 2ZYUX 4MRRA 1UMDB 1R0WA 2AEEA 2VVTA 2V7WA 3OU7A 1L6RA 4YQZA 6NULA 3AVUA 5BWMA 2P9BA 4D3FA 3KEGA 2ID7A 2VQDA 4DAEA 2Z2IA 4DZRA 2HREA 3ZJUA 1E2IA 1L8AA 3DOHA 2P3SA 1SULA 1WB5A 2ZRCA 3QXSA 3TL3A 4CCYA 1G55A 2F6RA 3KKEA 3KCQA 4B75A 1HE4A 1SWVA 2R8PA 4JL6A 1UL1X 3EPHA 3BCRA 1K8XB 2GD2A 3EVBA 1KYYA 1V7PC 4KRYA 2PVSA 3TXAA 5B5SA 5BVGA 2C97A 1EVQA 3W9SA 2JGEA 3L0YA 1A1SA 3TE7A 2GFIA 4A10A 2FAXA 3UAVA 4BZXA 1XDSA 1A9TA 2FMKA 2FPGA 1LBTA 1TMYA 4QAJA 2GCGA 4LRUA 2ACEA 2BFDB 3K0HA 4OB6A 1SWWA 3VA7A 3FNHA 1NWCA 4C9BA 1GAEO 4GLJA 4NY1A 1WXGA 4PFKA 1ETHA 3HCWA 3ZD9A 3ZHBA 3EMKA 3UJNA 4FDTA 1U4OA 1Y1QA 3LX4A 1II8A 4N12A 3PZBA 5BR1A 4R1TA 3RKRA 2QV7A 1A8HA 5FPYA 4K6HA 1UWLA 1DE0A 2CZQA 4KZPA 2BEWB 5EIBD 1OH8A 2VXOA 5G0UA 4C4YA 4IQFA 4BAUA 1G7RA 4EJSA 4X7RA 2HV8A 3WNBA 1ZINA 2BTQA 3BFPA 1U7WA 4Y30A 1YNSA 1X3SA 1E1QA 5JQWA 1BN7A 2V98A 5E7QA 2QXYA 2JH8A 3L7AA 4RA6B 1Y4UA 3EXEA 3PNOA 4TLLB 3ESDA 3MGGA 4UBOA 3QITA 2VNKA 1Y6JA 3HJRA 4QOEA 3KQQA 4E5KA 5K8TA 3QHAA 2WKSA 2A35A 2B3TA 2WB4A 4II3A 3SR0A 4ZV7A 3KHTA 1NXQA 3OHPA 3DT9A 3CQ9A 1C1DA 3KJNA 3MSCA 2EARA 1FSFA 1USVA 3OKPA 5C5CA 3SVZA 1QO9A 3O21A 1HUQA 1CR2A 1XL1A 1V71A 4RDCA 1JPJA 3KB1A 4AJIA 5KJ1A 5LYJA 5FR2A 4CV1A 1P9NA 3MA0A 3PC3A 5IFLA 3O73A 4C4XA 1ATZA 3ROGA 3EXHB 4TKVA 3PXUA 3T7KA 2IH5A 5LQDA 1FDTA 1OH7A 1CUCA 4P5EA 4YCJA 2PKWA 2RHHA 4FHZA 5ERGB 2FRDC 1Y89A 1M7GA 5KWVA 3QW4B 5JZ9A 5BXYA 3NHLA 2P69A 2GJ4A 3ED1A 4B17A 1LDGA 3GPBA 1K4KA 1TTPB 2X6QA 2XLBA 2D0DA 1E6LA 4G8CA 1HE1C 1UC4B 2WK1A 4JP5A 4O08A 4P4SA 4CM3A 5FTWA 4UOZA 1AC5A 4ZI3A 3U9LA 1SZPA 4PYOA 1FRNA 1WOYA 3PVCA 3IH5A 1P4HA 4QU8A 1D1QA 2BHSA 3KQOA 4OLHA 5CXSA 5EN4A 4WGGA 5B36A 4CKZA 3ZLJA 3OPYA 2OAQ1 4FONA 2XCUA 3QK7A 2UYGA 1PQPA 4MV7A 4WI1A 3TVDA 1P0IA 3NIGB 5FJIA 4NCXA 4BNZA 1BGVA 4L5CA 4JSRA 1P4JA 2ZYHA 4JLKA 3DBOB 4OIMA 4J2HA 1NA5A 4FYKA 1FXUA 4H08A 4KQJA 4P1ZA 1A7UA 4CV0A 2PYZA 5ICGA 1DQYA 4OHUA 4AG5A 5KCZA 1SUDA 1Y7PA 1FMTA 3M2TA 4MR8B 4GWLA 3ZWYA 4LBWA 3UWDA 4DPKA 2O2DA 3M1IA 2X0NA 4R81A 5KTKA 1AK2A 4M0PA 2FP3A 3JYHA 1E3DA 4FZVA 5FOVA 3U3XA 1D4AA 3OCCA 2Z2XA 3N8KA 2OHIA 2H1WA 1EINA 3OZAA 1MIHA 2O5EA 3Q5EA 4JN6B 3DF9A 2HXSA 2AHRA 1XCMA 2PH7A 1M2VB 2V7VA 4FZRA 5SZJA 4DPLA 1X74A 1GAQA 2OL4A 5I5GA 1E6MA 3NHFA 1GADO 1Q84A 4IDGA 4LN1A 3PGA1 2A9OA 4ZKEA 3PXBA 4MKXA 2V65A 3IURA 4B34A 4MITA 1ISJA 3EQZA 1UBNA 3LWZA 1SOUA 3QU4A 1PGQA 1NTOA 1T9GR 1SBCA 2FSVA 2ZRQA 4MRMA 2GUWA 2R5WA 1Z6AA 1FNCA 2JDID 2WUWE 3QKSA 4IR7A 5HS4A 2F2TA 4H6WA 3MUFA 3FUUA 3GG2A 3UT5B 3K1YA 1FUIA 1NMQA 4O4JA 5BN3A 2IQIA 4HQRA 3T3OA 1PNVA 2ZIGA 3B3GA 5EP2A 1KP3A 3T7AA 3IV9A 2PGDA 1QRTA 4FTWA 3K4PA 4ZP1A 5L6LB 3AEKA 2Z1NA 2NP7A 1T36A 1G21A 5FP0A 3LL7A 1KS9A 4S0XA 2HZ7A 2BUBA 4MW1A 4OLBA 4CMIA 3G0HA 1S8NA 1Q3TA 3D3WB 4G0VA 4FGLA 1J2JA 1ND5A 1F2TA 1IJFA 4L4SA 5DLQC 2VQFB 2C9ZA 5JFGA 5JQGB 4LYEA 2XWBF 2YZKA 4B74A 2HK7A 1G6Q1 3GQVA 4IMPA 2PMCA 1GZHB 2VWHA 1H85A 4LY3A 4B48A 4EG4A 2CF6A 1NYQA 5BSFA 1J70A 5CLJA 2VSXA 4TVOA 4UATA 2DR3A 3DEKA 5IYZA 3EF0A 4Z0PA 2DFTA 3MZ0A 4ARAA 1OZFA 2OO7A 1RHUA 1O1YA 3KO8A 4L76A 5TSDA 5IBPA 3ZXUB 2ATEA 2MINB 2MCFA 2EEZA 2VJBA 1SKYE 4LG1A 2ZE7A 2PZFA 1D7AA 4OQ4A 3T5DA 3KV3O 5D6NA 1JEJA 1OBOA 5JVDA 1MKYA 4ZU1X 4Y6SA 4JCOA 2E49A 4B3DA 3P7MA 5JPCA 4BNVA 1UBFA 1L7BA 4NK4A 1DV1A 2W70A 1MOZA 2PD6A 3ENVA 4JXKA 2Z56A 3EEQA 4KAJA 1FQKA 2IYXA 4K03A 3I9V1 1GHTA 3TYXA 5GVSA 4MDHA 4WXHA 1KTIA 1TEZA 1AM4D 4BO8A 5AICA 4WAUA 3EY9A 3OBIA 5J9FA 3R24A 1FMCA 4AXXA 1CV2A 2V9ZA 2QGNA 3QUQA 3SE7A 4LF8B 1XLTC 1DCTA 3RYHB 2XRZA 2HLDD 4YRZA 3PQ4A 4JJ4A 4TS3A 4XFJA 5AJTA 4G5RA 3T9FA 1V5FA 2Q4EA 1P6QA 1O97D 2V6MA 3N8IA 2W2LD 1U2GC 3ELWA 4X6LA 3GJ7A 2AG0A 4QYIB 1YZTA 4UEJA 3HJBA 4HZIA 4LECA 4CWAA 3O82A 1N5OX 2YVUA 5BMVA 3SX2A 2WPNA 4W5RA 1SBTA 2O0MA 2JFWA 4XLTA 5D7NA 3WMWA 4QXOA 3ZIAD 4DMRA 1XRMA 3DBRA 1PNRA 1W6RA 4JELA 1TOAA 3L77A 4OXQA 5K8JB 1AUOA 2QUKA 2R6FA 2JK0A 4OHBA 4ZC1A 2ZIWB 4N3NA 2P6PA 1RYFA 4IGIA 4NZYA 2HGZA 2VP5A 4X1IB 3U1VA 2G04A 3BMCA 1N0WA 2OBXA 2QD5A 1I6LA 1ZUWA 2BF4A 3CRNA 4MEBA 3T99A 3FSJX 4YGYA 4CETA 1Z25A 2IP2A 2DB3A 3P9XA 1H2ZA 1XN4A 2Y1CA 2QJOA 4QDTA 3OHSX 4HDSB 1UEXC 3N2ZB 1U0TA 1H8HA 2IXEA 2UUPA 3GAZA 1KVSA 4F4HA 4HNAB 5JYEA 2REXB 3TOVA 2QRLA 4YRPA 4B44A 1W34A 2E1RA 1MH9A 1MO2A 4WZAA 1LNQA 4MYHA 3DZGA 5EZ6B 1XEFA 3UNXA 1YKFA 3MGKA 1DJQA 3A6ZA 2ZUTA 4OA5A 1YB4A 2GYVA 3UUGA 3N2GB 4ZDJA 1UDXA 1LBIA 3EFEA 5TXGA 3A7DA 3CH7A 3GAFA 2M6SA 2W7TA 5CVVA 5ICFA 3E5RA 3S68A 3ENWA 3P19A 1WZUA 2CXXA 2AOTA 3UM9A 3P9CA 3KOUA 2J08A 2E89A 2VPWA 3GNTA 1YVRA 2FEKA 3QEAZ 2NVOA 4EZIA 1NI5A 2YL2A 4WLOA 1I5OA 4XB1A 1G3MA 2R6ZA 2WJIA 2XHZA 3ZPXA 2WFAA 3FYTA 5DX1A 3N39C 3JQAA 2H17A 3OPQA 3PEWA 2JA2A 2VJMB 2XQFA 3MBKA 1T6XA 3MQFA 3QTLA 4FLMA 3V4OA 4MUHA 2ZZNA 5KYWB 4CCSA 2Q0XA 2X86A 4KACA 4TL8A 4B8ZA 3L05A 3DGFC 3KB6A 4TUYF 4CLHA 5MN5A 2XCSB 1GA6A 2XYPA 3NTLA 1FRVA 1Z4JA 1E3EA 1F0YA 2PA0A 1ZAKA 1RXSA 2QYOA 4KGZA 5A3QA 1QB7A 5LMNB 2BR5A 4XKJA 5CB6A 3GVCA 4KTVE 3B89A 3KKZA 1RPTA 5IMSA 1Y6GA 1VPLA 2H9AA 2LCFA 4Q01A 3UWKA 4I14A 3A05A 3QVWA 2ZQ5A 4Y6OA 3RC9A 3RUDA 2J7PA 4K0RA 4TV9B 2D5LA 3MTEA 3OG9A 3KZVA 4QEKA 4RKWA 4OHXA 2R6AA 4GBMA 4HWTA 1JHAA 1YZVA 3CZ9A 1QCDA 2CC2A 2IEAA 4YC7A 5L7YA 1NT4A 5B6JA 2BFAA 2GM9A 4RABA 4U6NA 4BC0A 1LK5A 1A27A 1TQDA 2AC2A 1EFDN 3P9ZA 4POAA 5CHEA 1MC5A 3K6KA 1FS6A 3T5PA 1C7JA 3PITA 1IK6A 1RVDA 1RI1A 3I23A 4BX9A 2IHVA 2W6ID 4H15A 2A78A 3K70B 1DBVO 2FKNA 1Y1LA 4NCKA 2IYFA 1G4AE 2QZPA 3OT5A 3ID6C 5KNBA 1WUHS 2ZAIA 2EDCA 2IYZA 3CLRC 2D7JA 4E1BA 1T1JA 3I6ZA 3RTCA 3WZLA 1MXHA 2GTHA 2PA3A 2WWRA 1R6BX 2GAFA 3RV3A 1EFRA 1DFGA 1WMDA 2VF8A 1P61B 5GGXA 1KAGA 2ZIXA 3EDMA 4DJEC 2G8LA 5AMXA 2P9CA 1T1GA 2GGSA 3KAJA 1NQUA 2IIVA 4IVQA 4QULA 4XIFA 1FQOA 4HPJB 3IILA 3CM0A 4FMPA 5FPSA 2QL9A 2YVKA 3VNAA 3ZV5A 2BCJQ 4JLVA 1HKUA 1T3LA 4LDNA 1K3TA 2GXQA 3GRUA 3IPXA 4FYWA 2XAUA 5KC9A 3CLUD 1R27A 3DTTA 5L3RA 1SC6A 2OHVA 1YTUA 2NO7A 2VZ8A 2XMRA 3AR3A 4WXMA 4CIDA 3TLXA 3RSGA 1IXKA 2PLWA 4P5PA 3HZZA 3FAZA 1MNAA 2HK8A 3AFGA 4U5QA 5BQXA 1HI9A 3ETCA 2E21A 3LHSA 5D3KA 4EG3A 1H8ED 2YUTA 4FFNA 5CW2A 1IIBA 2PMDA 4C6TA 3DR5A 4MKZA 2FB9A 4C6SA 1SB8A 3PA8A 4E22A 2B34A 2JFYA 3DE3X 3PV0A 4EAAA 5A5GA 3UWPA 5ALSA 3DS8A 2HWXA 1UUFA 4ZVQA 5FQOA 4BDSA 4XVUA 5LXTB 1H9BA 2PD4A 3IELA 5F78A 3B13B 5E2BA 3T7RA 1V8DA 2O2IA 5JATA 4NNPA 4TROA 2CHGA 5GADl 1T10A 4KPEC 4KI7A 4TRMA 2ZUBA 1JLRA 4BXOA 1ZNXA 4PYNA 2QR3A 3C97A 1JDJA 1MG5A 1R0XA 4LW8A 5AW4A 3TUZC 3ODPA 4W5OA 3TVTA 4AJNA 5LZ2A 3A70A 3T3IA 3GLGB 2GDZA 2QN1A 2YHUA 3N58A 5C4IA 4X7BA 3B6ZA 2ILVA 3ABSB 2MYNA 4OGLA 1M9NA 4ARCA 1PG2A 2NTNA 1DIGA 2VL7A 3G2IA 4ID9A 2F1JA 4D44A 2OTCA 3SXUB 9LDBA 3HSKA 5JXJA 2VK4A 3I5MA 4PHGA 4W63A 3VAYA 1M2WA 4CLRB 4GPZA 3TW8B 4BE7B 4F5EA 5A3JA 1BWQA 4ZC8A 1UK8A 3AR4A 5F2OA 4FDMA 1Z6YA 3RIGA 4WLNA 5BYBA 1W5FA 5KNBH 4KFCA 1WLSA 4OMFG 3QWBA 2YUIA 3LUFA 4M0MA 4ZARA 3X1JA 3FOZA 1DNPA 3LF2A 3U4QB 3PE4A 1VOTA 4KR3A 5F98A 2G1KA 4PQFA 4P7BA 4PAQA 4JLPA 5KSYA 2FMIA 1MO5A 4XVQA 1XK6A 1XJQA 2YWFA 3ZH2A 1P5FA 4CUKA 2CEKA 4AJEA 2Q4BA 3IHWA 4C7KA 2MYUA 1UC9A 4YLGA 1DBWA 5FHQA 1ZCJA 1BDBA 4FB4A 2YMLA 3VDQA 1LF5A 4LMRA 2GZSA 1XZJA 3EUWA 2EFDB 4J6EA 3LDGA 4X7MA 3ROPA 3I5YA 3HJUA 3M8KA 1IH8A 4GOMD 2ZU6A 3PQDA 2VCYA 3D54D 3UAOA 3N7AA 1EK0A 2I66A 3O92A 3UFXA 3CH5A 1N3LA 1DTWB 1ODJA 1Z35A 3KYBA 3M6UA 3Q0EA 2NU9A 4FNAA 4KMSA 4PX9A 3SYKA 3LVQE 4RS3A 2Q1SA 2BFBA 2F8LA 4TLDA 2BGMA 1ZZEA 3L7BA 4P4TA 5LBIA 5IABA 1JHDA 4CF5A 1L4UA 2J9FA 1RC0A 4C20A 1WO8A 1N2JA 2ATXA 1W4ZA 1OI7A 5IN4A 1C14A 3DDUA 2QZZA 3UAYA 4JI3B 1BW9A 4EA7A 3K0AB 3PIRA 1AGNA 4LXHA 3DVAB 3PLNA 4R98A 5DW3A 3E70C 3PP8A 2FTKE 3AL2A 3AHDA 4RHCA 4LYHA 3OQNA 3OX3A 2QTNA 2FPRA 2OHJA 3KUKA 2C7BA 4RNDB 5EMNA 3QFTA 5CT4A 5EWJA 1Z6XA 1AHNA 2C4NA 3DZCA 3VR4D 1AMUA 2BRUC 3PFKA 2PYDA 3KLOA 1W30A 1RC8A 2DR0A 4JWKA 3C43A 3E2IA 1XPJA 4WRRA 2JGDB 4GVPA 3SZLA 2XNDD 4HRYA 3LOPA 4RXMA 4XSHA 2PL1A 3ZWCA 5JE8A 4DCSA 4G0ZA 4I5EA 3TG2A 4H0NA 1PEDA 4QUGA 4UEOA 2C5HA 2WTAA 2NPIA 3GUUA 3VNSA 2P7IA 4OI1A 4FXPA 5BUSA 4DLKA 4EX6A 1J24A 3MMNA 1BQ4A 5DYGA 4B6OA 1QV6A 5BWLA 1P3DA 4GX5A 1DJMA 4CUJA 4D9CA 1L3IA 1J1UA 1CX9B 2JCVA 4PQYA 4BP9A 2YS7A 2H7CA 2IHJA 3HGMA 3E9NA 4FSHA 5LQRA 2YHIB 4FDLA 1OV4A 3MXOA 1D2NA 2IZ5A 3VR1A 3ZKAA 2PE5A 3IKMB 1XAIA 2IYYA 4N0PA 1NIPA 3M3DA 3F8SA 4GVLA 1N5DA 3KKNA 1JNXX 1OU4A 3FPKA 3FR8A 5TY0A 2FI1A 4ZANA 4RMIA 3VQTA 4RTSA 1SOAA 5IAOA 2G4CA 1MOPA 5CNKA 1C9NA 3T61A 3NFYA 1CWUA 2D2FA 3ZQ6A 2A9VA 5JISA 4RHFA 3DZJA 4LYGA 3DBLA 1QP0A 3KYDA 3R0QA 3GUZA 3WAGA 2YRXA 4FGKA 4UVIA 3WK9A 1LSUA 4JKOA 1YMUA 4JBLA 3OFND 4OYHA 1GNPA 3I72A 3W1VA 2WYIA 2CV2A 5EIBC 1YFZA 4Z53A 1XZIA 2ZS8A 3O6VA 3VZBA 1N2CB 2C4TA 2F43B 2VAMA 4NIMA 4JQZA 1JFLA 2J6CA 1UJ4A 1H2WA 2BWJA 2TMDA 4JLUA 4G36A 4MGIR 2PZKA 1BCRA 3MSXA 2C7QA 3J7TA 2WHQA 4MS1A 5F35A 1BWPA 4MWBA 1Z74A 5CGQB 2W9XA 4YAGA 1A5ZA 3TGPA 3NJRA 3VO8A 3O4RA 3MB8A 2O8BA 2ERCA 3B60A 2EL9A 5ALTA 5H1YA 5JFOA 4DLZA 3QKIA 3ZW7A 3QSYA 1ISSA 3L43A 3DXFA 3FVRA 3GFPA 4GPD1 4XI9A 4EGSA 5LNK6 1VI5A 1JVBA 2COEA 1LPBB 3PXXA 1ADYA 4HKTA 1U7TA 2GD1O 1NNEA 4NBWA 2IL1A 2OLEA 3FDIA 5FIUA 4YCCA 2JLWA 1O95A 4ZOCA 4C7VA 5ALMA 4NFYA 3RVKA 3PT9A 3SAJA 4Z3DA 2K2QB 3EBPA 5C1OA 5DNYB 4P0PB 2AEJA 4LJSA 4LZAA 4S1PA 3LWBA 4NU8X 2JBHA 2JGJA 2W6MA 3DW1X 2HSGA 4TMKA 5DISB 1OFUX 2CMFA 2XKAA 3MYYA 4XIIA 3SKVA 1DBSA 4O4IB 2H54A 3TW6A 2NAPA 1H66A 1EA5A 2PAAA 3WZ2A 1NJ6A 2YS6A 2CVHA 4FN5A 1T0BA 5J43A 1PK8A 2ZPTX 4B47A 2Y9MB 1Y9DA 2B4KA 2OE2A 3VJRA 1ZVQA 1GZ5A 1ZNQO 4PS0A 3TQOA 2CB9A 2XGSA 3KPWA 3AR8A 3WKCA 2QQEA 1AKTA 1VKRA 1DC4A 3HP1A 3DWEX 3JD3A 5ALEA 4R1PA 3V4SA 2X1MA 3I32A 3DM5A 3K9CA 4N3GA 1QRRA 2W98A 1NN3A 4FHGA 4W5TA 3IP6A 3RARA 3OP4A 4V02A 3C3KA 5KQGA 2YWDA 3GEHA 4KDEA 3FPEA 1BOOA 5CFZA 2VO1A 3T1NA 1LCIA 1U11A 1VB5A 4IUYA 3RW9A 4BX8A 3L01A 2NVUA 3AUYA 4NHEA 4R1NA 4KE6A 3NAMA 1T0IA 1D6MA 4CM4B 4HNHA 3F3SA 1O6BA 1C0IA 4HLUA 1O5TA 4EVIA 2GF9A 2ZIVB 3ZX4A 5FLKA 1ODKA 3EQ8A 2CLDX 5EMLA 3CKMA 3D81A 4GI5A 3OMWA 2KQUA 3I9FA 5TGZA 4W5JA 4D4MA 3RBVA 4LE1A 4GGPA 2EC5A 2C84A 1JYFA 1RABA 2OCDA 3TZKA 2JZCA 2AEMA 3ILVA 3MCTA 3NU1A 1KC3A 2OZLB 4ADSG 5A4DA 2VATA 1EDDA 1Y8ZA 1T4MA 2XMPA 3DMFA 3HC7A 5F9MA 3Q3JB 3BH7A 3KWFA 1T9KA 2FUKA 1D04A 3SYTA 1HEUA 1TKAA 1YIDA 3EQ2A 1KE1A 3ZNQA 3A4NA 5ELXA 2J41A 2R87A 3KHUA 3GB9A 4E4TA 1J22A 1FFAA 4D3DA 4P3YA 5DP1A 4AJPA 1G59A 2WIDA 1XNRB 3HDYA 4I1SA 1HORA 1MIOA 2ZSIA 3EZGA 4MCAA 3EWNA 2VBGA 1JAXA 5IMBA 5KOHB 2ZRPA 3M9LA 1KJJA 1XA3A 3TI9A 2WD7A 3OY7A 2PBLA 5L3SB 4H6VA 2EFGA 2BFNA 3UPDA 1BTOA 4JLAA 5ERYA 5HCNA 3O0TA 1BMDA 3N2IA 4PSDA 4RVFA 3LRXA 4O2AB 4LOAA 3BCUA 1NVWQ 4DJAA 3LY9A 4EB3A 4MW0A 2Q9UA 2ZUFA 2JCXA 2R1ZA 4Q00A 3BGIA 1YBAA 3C48A 4FX2A 3R7AA 3AETB 2O54A 1N6RA 4DQXA 1RR6A 3S5UA 1KQGA 1ISFA 4KREA 3Q15C 5DLPA 4M6WB 1DOAA 2IUFA 1Q0PA 3AOEA 1IZ8A 2JHCA 3FNFA 4E7OA 1DTSA 3BB3A 1R8XA 2PQMA 3RS8A 4K1XA 5CH3A 3ZBQA 3AM5A 2JCYA 3OT4A 4UCFA 1W85B 4Q3EA 5GV7A 1PEKE 2GOYA 3TCXB 4BRZA 1XAGA 3QMVA 2B4TO 4EYKA 1JG6A 1MRNA 3OWOA 2BMDA 1UQRA 1EGHA 2B78A 4LE2A 3WZMA 3CVYA 4IHJB 2X1LA 4KFUA 1J56A 3ZW9A 3ZCSA 2R65A 1MABA 4IDPA 2ZRGA 3X1YA 4A6XA 2Q45A 1Z5GA 3TSYA 1GGMA 2FZCA 3GH3A 4PNHA 4N0EA 4ROSA 1Q0TA 2IHNA 4MYCA 2R9VA 1JHRA 3RUAA 1SCBA 1R6VA 2QRVA 2HEGA 2I3GA 1SUBA 1WAMA 3DWFA 1A5TA 1J33A 2J48A 5FYDA 2XUKA 5LA6B 5KDDA 1EQAA 2O2SA 2NUPB 1PW5A 3MJVA 3N8GA 4FIZA 1Y42X 3TO5A 1O97C 2X7HA 4EJ0A 1YH3A 4RF5A 5KWSA 1OD6A 2L0XA 5D3MA 1GZ7A 3JRNA 4TKUB 2VUTA 3BGWA 4OD0A 5AW3A 3KM0A 2PKRA 3FYUA 3VOSA 2WNHA 4PNPA 1D2AA 3FWKA 4MO9A 1T4GA 5T6BA 5FBWB 4CU5A 1YT5A 1AKMA 2RDMA 2QL6A 3TIVA 3L7IA 1NULA 2KHZA 4DLUA 4Q3NA 5E7MA 4DCGA 2PUDA 2CSXA 2X15A 3C3XA 2RHBA 4RVOA 4KQFA 4R3NA 2P5TB 5TJ9A 5J5AA 3G5TA 4LXTA 1A9XB 1CIPA 1UBHS 1OC4A 5TRTA 4Q1FA 1ZD1A 3F6CA 3T7SA 4J91A 4QGGA 3UICA 3ITKA 5DWQA 1P9WA 2HA0A 3OJXA 4V03A 4Q6WA 3RLIA 5KVSA 2VPIA 1HOXA 1UK9A 4C0BA