4KTTE

Structural insights of mat enzymes: mata2b complexed with sam
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
308
structure length
306
Chain Sequence
PNRRVLVTGATGLLGRAVHKEFQQNNWHAVGCGFRRARPKFEQVNLLDSNAVHHIIHDFQPHVIVHCAAERRPDVVENQPDAASQLNVDASGNLAKEAAAVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGEKAVLENNLGAAVLRIPILYGEVEKLEESAVTVMFDKVQFSNKSANMDHWQQRFPTHVKDVATVCRQLAEKRMLDPSIKGTFHWSGNEQMTKYEMACAIADAFNLPSSHLRPITDSPVLQRPRNAQLDCSKLETLGIGQRTPFRIGIKESLWPFLIDKRWRQTVFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords S-adenosylmethionine synthase isoform type-2
publication title Structure and function study of the complex that synthesizes S-adenosylmethionine.
pubmed doi rcsb
source organism Homo sapiens
total genus 101
structure length 306
sequence length 308
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF04321 RmlD_sub_bind RmlD substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4kttE00
3PQEA 4NBWA 1VJTA 4ND1A 1MGOA 5IDQA 1B7GO 1DHRA 1YL5A 2UYYA 1X0XA 4E31A 5GZ1A 2O3UA 4G81A 4BNXA 2W2LA 2LDBA 4P38A 4WPGA 4CM4B 1TT7A 4MDHA 4I9UA 1V9LA 5ICSA 2EERA 3LLVA 4AFNA 4FFMA 3IJRA 3F46A 1YJ8A 3AM4A 4PG7A 1NTOA 3CKYA 4NZ9A 4YJGA 1MC5A 2PD4A 4TRRA 1ZSNA 3NRCA 1YOVA 2H6EA 5KJ1A 2DC1A 3S2FA 5MGBA 4B79A 2AHRA 2DT5A 2C0CA 3RROA 1HXHA 4RQUA 2QW8A 3I4FA 4L8VA 5AXBA 3DMTA 3RWBA 2GF2A 2ZYGA 4J1NA 4YXFA 3NTRA 2D1YA 1ISFA 1ZIDA 3GPIA 4E4YA 3K2EA 1ZSYA 7MDHA 1X7GA 2FRDA 2UVDA 1KC1A 3CH6A 4YJDA 3IC5A 4YR9A 1E7QA 1H0KA 1WXDA 2PNFA 3WSVA 3ZWBA 5JAIA 4OGWA 2FR0A 1NR1A 1MG5A 1LA2A 2YYYA 2ZB7A 3MJTA 1GYRA 4UVHA 4AJPA 2YQ5A 3ZW9A 5JFOA 3K96A 5ENDA 2Q2VA 3EAGA 2G76A 1QR6A 2CY0A 4II2A 3IDSA 3DHNA 1K3TA 1VRWA 1ENPA 1YQXA 3L4BA 3PQDA 3VH3A 1JAYA 2HCTA 3F1KA 4CV0A 4XYLA 2IE0A 2VWGA 1Y8RA 3ANNA 5CFZA 4YEDA 4YQZA 1ZO8A 1IOLA 1U8XX 4WEOA 3FPCA 2O4CA 5G0SA 4DREA 5AYVA 3U4DA 4Z6KA 1T2FA 3VPGA 3WWZA 3TWOA 2NVWA 3PJGA 4R51A 5F1KA 4YT5A 5KJFA 1AXGA 1OFGA 3LT4A 2J5KA 3VPXA 4FGSA 3P2OA 1NYTA 1C14A 3RVDA 4WK6A 3WFIA 4BGEA 1DXYA 2E49A 1CJCA 4XYBA 1YE3A 1UAGA 5A1TA 1HZZA 3N7UA 5ER9A 3ZDFA 1K89A 2HO5A 2JAPA 2OUIA 4IDAA 4S3MA 2Q45A 4HP8A 2GRAA 2I3AA 5KKCA 5JDCC 4IMRA 1HDGO 4QFCA 1C3VA 1I3MA 2ZCUA 3GF4A 5BSEA 2Z1MA 1MX3A 1NAIA 5AXCA 2J8ZA 3DZKA 4J6FA 2W4QA 1PL8A 1V3TA 1ORRA 4IJUA 2C59A 2JKVA 2AEFA 4D45A 4OSPA 2G82A 3AWDA 3PQFA 2P9GA 4GKVA 4XYGA 2X0NA 3W4JA 1JDJA 1E5QA 1UXJA 3HDYA 4R1TA 3JQ7A 4Q3AA 1EVIA 2YHIB 3NX4A 4NBVA 2OHXA 2I67A 2YUTA 5AXAA 2EKPA 4IZHA 4WCFA 4NBTA 4UUOA 3V5NA 5KNLA 1YB5A 4QTZA 1LSSA 1Y9AA 2PZLA 3WS7A 4YAJA 1PGNA 3AU9A 3ZV4A 3H9JA 2P5YA 3DMYA 1PR9A 5T6BA 1DBVO 4IDCA 3WB9A 3I9KA 1DSSG 1LU9A 4NI5A 3G0OA 1X15A 1I01A 1B8UA 1IHXA 2YY7A 3B1KA 1PL7A 4BNUA 1E1LA 4J4TA 2GD1O 3EZLA 1J0XO 1QSGA 3UH1A 3NDRA 2Q50A 3W8EA 4PZDA 5I7FA 3KM0A 1ZK3A 5L7YA 1C1DA 1IHYA 4A2CA 4NBRA 4EEZA 2EIHA 4L4RA 5ER6A 1RWBA 3GFBA 3H3JA 1WZEA 1I33A 1HF3A 2Q4EA 1I5RA 1HSZA 1CETA 4M8SA 2G0TA 3AUUA 4XRRA 2ZYAA 3FNGA 1RYDA 4FFOA 2EWMA 1E3LA 4F45A 5CG1A 4UUPA 6LDHA 4YT2A 1X14A 5TLSA 3GAFA 4PVDA 1PJ3A 3DZGA 3ZNQA 4BNNA 1V3UA 5ENVA 1VJ1A 2ZTMA 1P77A 2B4TO 3LT2A 3Q0EA 3NT5A 1NWCA 4KDFA 2DBRA 5EPOA 4RLHA 2Y05A 4RDIA 3B1FA 3L6DA 3SJUA 1JN0A 1F0YA 4CPDA 4AJNA 1ZJYA 1ZBQA 3KETA 4PLPA 3HZZA 3H9UA 1H6AA 1WW8A 1P0CA 2WE7A 4PLFA 4BUCA 5T57A 4CJXA 4YCAA 1KY5A 3H9GA 3IS3A 4JK3A 1LDBA 2NADA 3H9EO 3JQ8B 4XQCA 4D7AA 1ZVMA 2TMGA 3EVTA 1YONA 3ON5A 4D79A 2FWMX 3PZRA 3HFSA 1JKJA 4B8ZA 3COSA 3GG2A 2ZIZA 3L6EA 1ISHA 2JL1A 3ZV5A 3ZNOA 4MP3A 5CHEA 4WLNA 1DHTA 1QP8A 2A9FA 4UVIA 5JO0A 1K2WA 3NGLA 2WEKA 4IBOA 4MVJI 4U8GA 1LLCA 1Z73A 1YS4A 4C4OA 1HE2A 3F6YA 4L75A 1MV8A 3VZPA 4WLEA 2XXJA 1GYQA 3ZHYA 1C0LA 3H3FA 3VDQA 3GVXA 2GN9A 2OBYA 1LEHA 3QIVA 3G3EA 1R37A 5DBIA 1QXSA 4B4WA 4HFRA 4ALIA 5TT1A 1K6XA 1RYEA 4MP6A 4Q3EA 3WTBA 2Q1UA 3OJFA 4J4HA 4XZ3A 3AI3A 2P68A 3RBZA 3H8VA 3WYBA 4KQXA 3P5SA 2G17A 3C85A 2VHVA 3I4CA 3PXXA 1W6UA 1Y9EA 4CM9A 4DYVA 1GDHA 1HDOA 1PWXA 1PJ4A 2GZ1A 3V2GA 5BSHA 2DBVO 3KRTA 4F6LA 2BGMA 5AVOA 5A9RA 4XDZA 2ZTUA 5EESA 1QG6A 1B26A 4FFRA 1J6UA 2HAEA 1DLIA 1BW9B 1PJLA 1UUFA 3PFWO 2DPHA 5HBRA 1R0LA 4CV3A 1KBZA 4J0EA 3ZWWA 2Y1DA 1FDSA 3KB6A 3BMOA 4XGKA 2DBQA 2OMEA 2QIOA 2XOXA 4LW8A 3AY3A 2I66A 3U4HA 4INAA 1F17A 1HTBA 1ZJZA 2VWPA 3OEYA 4QO7A 1UZLA 3X2FA 4URFA 1IE3A 3VZRA 1EK6A 4CQLA 1GR0A 3GVCA 5GY7A 3UGKA 1HDCA 3EC7A 3I9NA 4RPJA 4A0SA 2PD3A 3VZSA 5KJCA 3WBBA 2VYNA 4ZRNA 3ZWAA 2VTDA 5JYDA 4B3HA 2BFMA 3UFXA 4FR5A 2X8LA 3VPFA 2VZ9A 4JP2A 4E6PA 3IP3A 3PP8A 2BRUA 4ALMA 1NPTO 2VRCA 4W6ZA 3W4KA 1U4OA 3L9WA 4R1SA 1G0NA 4IQ0A 1E7YA 1SOVA 2GZ3A 3CTMA 1GZ3A 2ZQZA 2O50A 4IS3A 3TL3A 4JBHA 5BR7A 4PLCA 1OZAA 4A26A 3ZV6A 3GH3A 4JLWA 3LU1A 1DIGA 1PGQA 3WWYA 2HMSA 4NQZA 4ZN6A 1LX6A 1I0ZA 3K5PA 3Q9UA 4L76A 4L4XA 5CEFA 3GGGA 1UXHA 1DFIA 4XCVA 4RVFA 1CQJA 5CPFA 1EUDA 1YL6A 4UEJA 2QHXA 1EVZA 1B8VA 5EQDA 4A10A 2GGSA 3H9QA 5GMOA 3L9XA 3GZ4A 1M2WA 5JMWA 3ZWXA 4RJTA 2I5PO 5CDSA 4HXYA 4M87A 3OJ0A 4UVDA 2XF8A 3E5MA 2BMAA 4MKRA 1A27A 3PEFA 3SJ7A 3DZIA 1SC6A 4FFNA 4X54A 3HDQA 2FOIA 2A94A 3IKVA 1B15A 1BMDA 1G0OA 3CSDA 3OHSX 3H5RA 4FC7A 2IEDA 1ZMOA 4J9UE 3E9QA 1R0SA 4E5KA 1TEHA 3FWZA 1JLLA 3FSRA 1M75A 3IAHA 5I9MA 5I7SA 3F3SA 3OJEA 2WWRA 4JCOA 1T2EA 1YWGO 3AUSA 4IIUA 1CYDA 4NFYA 4BO6A 3UUWA 1RM0A 3I3OA 1ISJA 3CEAA 1P74A 3GDOA 4IXTA 1EQUA 2QG4A 4PLYA 4YJGB 4A27A 1PTJA 5I9NA 3C7CB 1NHGA 5JCJA 1YOVB 1MC4A 2W2LD 3QE3A 5THKA 4WJZA 2G5CA 3GUCA 3OF2A 4JNKA 4DYDA 1HYHA 1AHHA 5G0UA 4CM3A 3RC7A 1NNUA 2BGKA 1TVEA 4CLOA 4GVLA 3AUTA 1UJMA 1ZCJA 3WLFA 4E2XA 3DBLB 3OQ6A 5JNLA 1T24A 1J49A 3HE3A 9LDTA 3NJ8A 1CEQA 1HE5A 5DP1A 3DZHA 4CODB 2PR2A 3G1TA 4OKNA 4O6VA 1GPJA 3W4IA 3UVEA 1P1IA 1ZXBA 1WNTA 2WDZA 3RIHA 4ZQGA 5GZ3A 4QO8A 1XU9A 9LDBA 2JHFA 1VPDA 4AICA 5I8WA 1C0IA 4R5MA 2PZMA 4WGGA 1BHSA 1A4IA 2NSDA 3GHHA 4J16A 3TSCA 1N7GA 1K6JA 4ZQHA 2HQ1A 2WYUA 4FS3A 3WGQA 3RUCA 1XLTA 4DIOA 2Y67A 1I2CA 1Z45A 4ND2A 2AEJA 3SLKA 4FJ1A 3E9MA 1Y8RB 1RKXA 3UN1A 3AJRA 4LCJA 3OECA 4E5YA 1UXIA 1NHWA 2Z5LA 4N5MA 3B1JA 4IM7A 4K9DA 3VVCA 1I2BA 1DRWA 4B4VA 4CMBA 2PGLA 1HKUA 3A28A 4MKXA 2GSDA 1Y5RA 2AMFA 4N5LA 1GQQA 3ITKA 1Z74A 2O23A 3KHUA 4NU6A 4I8XA 2CSUA 3DHEA 4ZQEA 1EUZA 3A4VA 1EUCA 3BHMA 3NKLA 5FF9A 4CMEA 2D5CA 5ADHA 2XPCA 4GBJA 4CLDA 3R3JA 4P4NA 1GPDG 1WPQA 1DB3A 3RBXA 4CV1A 1QRRA 3KEOA 1SBYA 3BMCA 3PJEA 2J6IA 5BQFA 4BO5A 3I6IA 3DBHB 1E6EA 4BO1A 1KVSA 1XEAA 2CF5A 4RCVA 5ES3A 4KZPA 1JKFA 2DQ4A 4YJHA 5JY1A 3Q3CA 5KWEA 1VM6A 5IXSA 3D4PA 3FCOA 4LVCA 5IZCC 1E3WA 2O2YA 4O1MA 2X4GA 3T7CA 2Y1CA 5CG2A 1U4SA 3IQDB 4YAKA 3U49A 1VI2A 2EHDA 1QYXA 1WP4A 2NVBA 1ID1A 3MJSA 3W1VA 1LDEA 3G17A 4IPTA 5BT9A 3WYEA 3V1YA 4PLGA 2B4RO 4BO7A 2CVOA 4GH5A 5FI3A 2RAFA 4R69A 4Z0PA 3ZWVA 4BGUA 5L4NA 2PZKA 4WLFA 5DOZA 3PHHA 4WCFB 1O94A 3JD1A 1OOEA 4BNLA 1QV6A 2Y0DA 3AY7A 5IDWA 4W4TA 3BXXA 2CF6A 4HY3A 2CDBA 4LCEA 2OO5A 3RQSA 4CR8A 3RJ9A 3GA0A 1TI7A 4S1VA 3QWIA 3JYNA 4WOKA 5K9ZA 1KOLA 5KKAA 3WQSB 4A5OA 4BV9A 4BMNA 4JGBA 4FSHA 2HUNA 1ISMA 2VRBA 4R41A 1AHIA 3A1NA 4ALJA 3OETA 2X0RA 4WNIA 4DIFA 1KVQA 5COBA 2YW9A 5TNXA 1C0PA 8ADHA 3K6JA 3O4RA 4LSWA 2O7SA 1BXGA 3AFNA 1V3VA 3DOCA 2SCUA 1CF2O 4B7XA 3JCZA 3QRWA 4E5MA 4FQ8A 4NK4A 5TC4A 4IJKA 2WYVA 3JQFC 5A9TA 1K0UA 3GAZA 3AOEC 3DFUA 4B3JA 1HLPA 2DUUA 2FSSA 5CDUA 4GSLA 3ORFA 5L40A 1CERA 1KC3A 4R01A 2Q1WA 3JD0A 5AQ1A 3JQGA 3ZU3A 4PGFA 3FNFA 4MPDA 4HFMA 3OP4A 1OI7A 3CZMA 4GWGA 3PWZA 2VUSA 1PJSA 4RVUA 2UUPA 2IYOA 4J7CA 3FBGA 2A92A 1ONPA 1PIWA 5HRUA 3DBVO 2FZWA 3GGOA 2EG9A 1SB8A 4LRTB 3KLPX 4J7UA 2R00C 5DDIP 2NTVA 1PQPA 2EW2A 2X7HA 4CR7A 1Z7EA 4D43A 2ZTVA 3BTOA 2I3GA 4FDAA 3O8QA 2B0JA 4UEOA 4NFSA 4ZHSA 3VKVA 3RI3A 3KXDA 1MB4A 2Z95A 1GFSA 3PIIA 4WLUA 5KCZA 2RBEA 1GYPA 1P3DA 1EFLA 1Z7BA 4XJSA 2R6JA 4PLVA 2QRJA 2RCYA 3IOYA 1LDGA 1P1FA 1VL8A 4R1NA 2JD0A 3ROQA 2DFDA 3TZ6A 4O59O 4ZVVA 1GL3A 3MCVA 1YL7A 2CMDA 2Q4BA 5AXDA 4NR0A 3RJ5A 5JAQA 2VUUA 3KTDA 3PGXA 3Q11A 4BNKA 4CR6A 3DFZA 3ENKA 3JTMA 3RBVA 1P1HA 2J5RA 3FR8A 1FDTA 3WX0A 3TPCA 5G4KB 2P4HX 1EDZA 3FTPA 3UCXA 4MVJE 4DBVO 3BTVA 2YQ4A 1DO8A 3GEDA 3M1AA 4CLEA 5A9SA 4DPMA 4UVEA 4EBFA 3RCBA 5CDTA 4ZU3A 4RF5A 3DONA 1V8BA 1NFRA 3QVOA 4J0FA 4P4GA 1ISIA 3I9JA 4JIGA 3ZU5A 3DR3A 4NNJA 3MTJA 3I9LA 3ETDA 2P5UA 2B36A 1I3KA 4HADA 4E21A 3JQBC 3ROMA 4DMLA 4EYEA 3D3WB 1XWFA 4F3YA 5HA5A 1LDNA 2BGLA 4IDFA 5LDGA 1DC5A 3PJDA 2Q2WA 3A06A 5IZ4A 1VC2A 3H2SA 4IJVA 1Z75A 1W73A 2EGGA 3ZH2A 2NQTA 4WCDA 2IZZA 3RC1A 1E6UA 3OH8A 4GMGA 4ZICA 5F1PA 3IL2A 1NWHA 1KVUA 3JQDA 4ITUA 1QYCA 4Q3DA 4CM9D 2E37A 4RVHA 3Q6IA 3RUFA 3C1TA 1WDLA 3U09A 3JSAA 3PLRA 2J3KA 1E1NA 1UDBA 2X6TA 1EVJA 3BMOB 2RHCA 1PZEA 3JD3A 4HBGA 4B7UA 4BVAA 3DQPA 1YBAA 3HB4X 3WLEA 5IAAA 1SNYA 3GNSA 1J4AA 3HJAA 4D3DA 1J5PA 1QORA 4KDEA 3E9NA 4YAEA 1HL3A 2V6MA 2X9GA 3EYWA 3VAZA 3TJRA 1NP3A 2GCGA 5L4SA 1YB4A 1U28A 3LT1A 1K5HA 1Y1PA 2DU8A 1Y8QA 3AOEA 4AL4A 1U1IA 5T64A 2NVUA 3NGXA 4W9NC 1H2BA 4CLHA 1JQBA 4K6CA 4I1IA 1LDMA 5EERA 3GMDA 3ASVA 4JROA 2VWHA 3PYXA 3NUGA 2GYYA 2P91A 5FYDA 1U3VA 2VYND 7ADHA 4FBGA 3WG9A 4D3SA 1KETA 4CUKA 1LJ8A 2IEBA 4RVGA 5KJ6A 2C82A 5JLAA 1GUYA 3WQRA 2VRCD 4FJ2A 4W99A 1E3IA 2OZPA 1KEPA 4XRGA 3LQFA 3PPIA 3V2UA 1LLUA 3D5QA 2HK7A 1ZW1A 1D1TA 3K30A 4E5NA 1VKNA 2EJWA 3E5RA 5I7VA 1HDXA 1UH5A 4ND5A 3TZKA 1E7WA 3DAPA 1HRDA 1R12A 2YV1A 1U5CA 4NH4A 3S8MA 3FWNA 1HE4A 3MWEB 3GG9A 3OJOA 2DBZA 2Y1EA 2D5AA 2BKAA 3IKTA 1P9LA 1UP6A 2HMWA 1R16A 4LMRA 4GSKA 1ONOA 1HLDA 2JHGA 2YV3A 3BTUA 1I32A 5JS6A 1T4BA 1LSJA 3E1KA 2VNAA 2NUAA 4RQTA 4D0SA 1OC2A 2WTBA 3G49A 1QYVA 1YGYA 4U5QA 3NAQA 2DVMA 4G65A 1JVSA 3U5TA 1HSOA 1P1RA 3HG7A 4CM8A 4D41A 2QQ5A 4E2YA 4QEDA 3V8BA 3GHYA 5JCJD 4CLOB 4OH1A 2Q3EA 3NJ4A 3DO5A 1JU9A 2YHUA 4RGBA 4YVFA 1EEHA 3Q9NA 4FC6A 3RUHA 5BNTA 2PV7A 3K8ZA 3R0IA 3T4EA 5F3RA 1ISGA 4KWHA 2X22A 2PZJA 4EZBA 5IFLA 2GN4A 3QW2A 3MJCA 3ZNNA 4YDRA 4XJTA 5A02A 4CQMD 1IB6A 2H9IA 4YT4A 1F14A 4KOAA 1T26A 5KJEA 3OA2A 3D7LA 1AE1A 3GY0A 5AOVA 1GU7A 4HNGA 5C7OO 1YRLA 4WASA 2WYWA 3LYLA 1GEGA 2Y68A 4QQRA 5JAZA 4YJFA 5G4LA 2IODA 3HHPA 1DC4A 3O26A 1BG6A 4Y6PA 4BKPA 4I08A 3ZW8A 1SPXA 3LZ6A 1LRKA 3ZHXA 4OXKA 1LDYA 5C7LO 2FR1A 2H5LA 1DIRA 2Y0CA 2ZCVA 5JYEA 2G1UA 4AJLA 2Y93A 4E30A 1PL6A 1RJWA 5THQA 1V0JA 2IZ0A 3ETEA 3G1UA 3E48A 3TDKA 1KIFA 3JQAD 1HZJA 4LGVA 2YDXA 3SC6A 5JDCA 1EZ4A 1PZGA 3DL2A 4J1TA 3IP1A 4ZRMA 1D4FA 4F6CA 1ONNA 2E4AA 3PVZA 4XIYA 3D1LA 4YJHB 3BAZA 4YAIA 4Z0TA 3EZYA 1GAEO 4Y6SA 4DVJA 1E3JA 1A7AA 1E3WB 4J43A 3QJ5A 3GNQA 1UP7A 3U62A 4ALNA 1H6DA 2Q1TA 1GUZA 3OIFA 5CPBA 2Y1OA 3RAJA 3VH2A 1P45A 2AQ8A 3P19A 4PG6A 4FFPA 1MUUA 4L4SA 4WKGA 1O5IA 4E12A 4AJIA 1YBVA 2PKQO 5CEJA 1DC3A 2X0IA 3HUDA 5IJZA 1IY8A 3S2EA 2X58A 1O6ZA 1G1AA 4IINA 1E1MA 1VL0A 1W8DA 4FOOA 2DUWA 4KWIA 4XR9A 1C1XA 3E6AA 4Y6RA 1OMOA 5L51A 4CLXA 3P7MA 2XAAA 3ITDA 4DC0A 4DA9A 5FFFA 5GZ6A 4OIMA 4HNHA 2P2SA 2GR9A 1FJHA 1PS8A 3WBFA 2NWQA 3M1LA 3NTQA 1HDRA 3QVSA 1TXGA 4QT0A 5A04A 1VSUA 1GY8A 4DQXA 2DTXA 2DM6A 3FNEA 5B12A 1RM5A 3PI7A 3ROPA 4TRMA 3M2TA 1YDWA 4KUEA 4ND3A 3ULKA 4RPHA 1N1EA 2JFFA 1O0SA 2Y1GA 3V1UA 3VPHA 2W2KA 1SOWA 4ID9A 1BXGB 4Y98A 2WD7A 2AG8A 5A05A 3B20A 3DTYA 1YH3A 5G0VA 1HEUA 2VT2A 1PGOA 1ZZEA 2NU8A 4YRBA 1Y5MA 4JXKA 4DLLA 2D0IA 3GT0A 4CV2A 5IXYA 3IUPA 1TB4A 2DTEA 1PGPA 2AG5A 3JQGB 4PZEA 4TROA 4L0QA 1T1SA 2DLDA 1RM3A 1D3AA 3BIOA 4AJ1A 1MXFA 4YAGA 4WECA 1U7HA 1EFKA 2I6TA 2NQ8A 1DJNA 4E0BA 1H94A 2C7GA 2O3TA 2JFGA 4OAQA 5A3VA 4B4UA 5U9CA 3JQEA 1TA4A 4MINA 3RUIA 4R9SA 2Z1NA 4FB5A 5BNIA 4W82A 4RLSA 3TN7A 1XGKA 4HV4A 4E2ZA 1PJTA 4J49A 1BVUA 3DBRA 4ILKA 5A4DA 4M1QA 4CMGA 4BB5A 4H15A 5L9AA 1X1EA 2IRWA 2OP1A 3HDHA 4XGIA 1WDMA 2B83A 1Y7TA 3PHIA 3E18A 3L6OO 5A03A 2C20A 3H7AA 3SLGA 1GZ6A 4BO9A 2QRKA 3DWFA 4WEQA 1U3UA 3MZ0A 3ONDA 3STHA 1JAXA 1R6DA 4OYRA 1IPEA 3NT2A 4GMFA 5ILOA 3LLSA 1L7EA 4KMSA 3EDMA 1E3SA 3WIDA 5C3MA 1WZIA 5CDYA 3QWFA 2X9VA 3KUXA 1LC0A 2B5WA 4N18A 1H2HA 1NPYA 1Q0HA 4FW8A 3UW3A 3DAGA 3BMNA 3EW7A 3GDFA 1LNQA 1FXSA 5B4TA 1ZKMA 1AXEA 3QWBA 3WGGA 2D3TA 3GGPA 3INGA 4J9VA 2C07A 3UF0A 4PLTA 3GFGA 4GI2A 4M49A 4OMUA 4IDDA 1H9AA 2X5OA 3ZHZA 5C7IO 3GPDG 3AFMA 3ZV3A 3KSDO 1E7SA 1NQ5A 3NT4A 4LRSB 2BF7A 3RC9A 4J90A 2IZ1A 4BNIA 4CQMA 2A35A 3GNTA 4LSMA 4PG5A 1F12A 4IJWA 1B2LA 4Q3NA 5FI5A 3OEWA 2D2IA 2HJSA 5TJHA 2NM0A 2WSBA 3VKUA 2GN6A 4R1UA 3WSWA 1PWZA 3PDUA 3I23A 1K6IA 2O2SA 2GLXA 1PJCA 4DPLA 3WMWA 2UUOA 4DWVA 3R6DA 4L9RA 2FR8A 2PLAA 1PX0A 3MWDB 4ONEA 4Q3BA 5F1OA 5I9LA 4HWKA 4UREA 1O9BA 5L53A 2JCYA 3DC2A 5L4LA 3MJEA 2AQIA 3ICCA 3VTZA 2B69A 2GERA 3CMMA 1N9GA 5IDYA 3X2EA 1MFZA 2ZJ1A 1PS0A 1T1RA 3LC2O 3ABIA 3U4IA 3DZBA 5U1PA 4D46A 2EV9A 2JCXA 4GKBA 2QZZA 4NK5A 4FCCA 4FGWA 4TVBA 2FN7A 4IS2A 3SBOA 4RF3A 1Y8QB 3BMQA 1KVRA 4PCVA 3S2IA 3JQAA 1DIHA 2NVUB 2H63A 2BLLA 3TF5A 1WLYA 3U9LA 3KYBA 3LDHA 3OIDA 4ALKA 4GQAA 3CINA 4W7IA 4ZJUA 2BFPA 3O03A 4D44A 1P31A 3AU8A 3JQ8A 4Z9YA 5F21A 1A9YA 2X5KO 3RFVA 3F4LA 3NV9A 2RHRA 4K28A 5T5QA 4EEXA 3GRPA 1GADO 2VZ0A 5CP8A 1SEPA 3WR5A 3B70A 5JBIA 4IIVA 1CQIA 4XQGA 2PH3A 3WXBA 4MVJF 4ROSA 5C5IA 4ZD6A 4BO8A 3UAGA 4DRYA 3FPLA 5F5NA 3M6IA 3NDJA 1GZ4A 2J5QA 3GUYA 2EP5A 1F06A 1BTOA 2EGHA 2BFAA 1ARZA 1YQDA 3VHRA 1VKOA 4MVJA 3I6QA 5I7EA 4R3WA 4F46A 1UDCA 1I30A 4JX8A 1ZK4A 3C8MA 3JQ7B 3QWAA 3JQCA 4PVCA 3VZQA 2GNAA 1D8AA 1Q0QA 1N5DA 3ICPA 4R16A 3DB2A 3U0BA 4ZA2A 1GUFA 4O5OA 3LVFO 3DMTC 3UCEA 4CMAA 1ML3A 4I5EA 3H4VA 1NBOA 2ZQYA 3QWHA 2AEMA 1Z6ZA 2VYVD 5IN4A 5DP2A 3ZN2A 3KLMX 4I5DA 2OL4A 3EGOA 3VVBA 2XXBA 5H83A 4TZTA 3ZWYA 1DPGA 1M66A 3TZQA 2P4QA 4OXYA 3AY6A 4UEKA 2J3JA 3D3EA 1ADCA 1LI4A 3KEQA 3HSKA 3AW9A 2GN8A 4GX1A 2C2XA 4Q9NA 4FJ0A 3S1LA 2FPIA 3Q1LA 3CE6A 3C7AA 4EJ6A 4PLZA 1LBEA 1ZMTA 6ADHA 1C1DB 4LISA 1I36A 2JCVA 4OSOA 1SZJG 1U8FO 1YVEI 3KYDA 4BNWA 4CM8B 1WMBA 4TRNA 1X13A 4EUEA 1P0FA 1HYEA 1UR5A 2HLPA 2AQKA 3JYLA 1OBFO 3AI2A 3UOGA 1F8GA 3K73O 4IDGA 4CMHA 2VNSA 5EIOA 4YBZA 1ULSA 1YB1A 1YKFA 2O48X 4TKMA 4DXHA 3LF1A 5H81A 1UDAA 1GQ2A 2QRLA 3GZNA 4JJGA 4E5PA 3CUKA 3W6UA 4BNTA 2WJPA 5A5EA 4DC1A 3NEPX 1V35A 4FD3A 1H93A 5ICMA 4UULA 2A4KA 2X23A 3DZJA 1LUAA 4R5HA 1YQGA 1M6HA 2B35A 1KERA 3I5MA 1UP4A 3A14A 4KP7A 4RVSA 1JTVA 4PLHA 2ET6A 2NU9A 4HFNA 3CZRA 1A5ZA 5FWNA 2GASA 3C1AA 1YO6A 4DMMA 4OHUA 1HDYA 1HT0A 3ZWNA 2C54A 3HADA 1DLJA 3H2ZA 3AK4A 1SCUA 3GEGA 4YJFB 3DTTA 1AUPA 3GN1A 3G79A 1ZUD1 2CUKA 3ZWOA 2WMDA 2JFHA 4BNFA 1UZMA 2HMTA 2PFGA 3F4BA 4MVJH 2JJYA 3KOUA 1I10A 1O8CA 1ZXLA 2I65A 1SB9A 1I3LA 2Q2QA 3RUDA 5B4VA 5CAEA 4IQ8A 4P4LA 3PHGA 1VLLA 5HTOA 3VH4A 3OM9A 3EVNA 4LMPA 2BHLA 3LK7A 2B4QA 1CDOA 1N8KA 5KVVA 3D0OA 3TZCA 4ZQFA 2GO1A 4YT8A 5A06A 2CVQA 3FRJA 4CM5A 3HQ4O 4AG3A 2OFPA 4I5FA 4XQ9A 1JKIA 4MVJG 4RDHA 3OBBA 4KUGA 1ADBA 1E1KA 1U2DA 4B7CA 5IZCA 3GRKA 4AJHA 1ENYA 1MA0A 1JW9B 4QFDA 5TX7A 1Z82A 2NTJA 4B8WA 1M76A 4YYZA 1PJBA 1N1GA 3ZI0A 1HETA 2RIRA 4GAEA 4RVDA 4RPKA 4GX2A 3PWSA 1ZFNA 4PG4A 4I9HA 4GLLA 1SEVA 3FNHA 1H6BA 2C5AA 4MJLA 4PLWA 1GQYA 4CM6A 2IYPA 1PEDA 4FPXA 2OOSA 4Z0HO 3HNPA 2ILTA 1XQ1A 3EUWA 4B3IA 5A3JA 1VJ0A 2WE8A 1C1XB 1LRLA 3O38A 2J3HA 4NG5A 2ZATA 3ZNPA 1I24A 1XG5A 3DEYX 1E7MA 4MOWA 1XA0A 3M2PA 3DOJA 1NM5A 1DIAA 5JPIA 1MLDA 3DBLA 4BO2A 3BHJA 3H5AA 4J2OA 4K26A 1RM4A 1DFHA 1LXCA 1E3EA 1NQAO 3L4SO 2HDHA 4WLOA 3F1LA 4U7WA 2Q49A 2PA3A 4GLOA 1QLJA 1XU7A 5JO9A 5TIIA 1PR3A 2AA3A 1PQUA 3KYCA 3MJVA 1XIVA 2W2KB 3KSUA 4BO4A 2DKNA 3AI1A 4CQLB 2WD7B 3F5QA 3R3SA 4ALLA 4PN3A 1UAYA 2EXXA 3U3XA 4BGIA 4Y9DA 2JD1A 1A7KA 1SO8A 1JWBB 1R4MA 1N92A 4J7XA 4RZHA 3JQFA 4BNZA 2DTDA 4BQRA 4E13A 4J1QA 2VOEA 1MXHA 4PFJA 4WLVA 2AE1A 1F8FA 5EN4A 1IL0A 4D0RA 3WMXA 1VE9A 3S2GA 5L7WA 1N7HA 4O63O 1D1SA 5EMHA 1R4NA 4OQYA 4WE3A 2WM3A 1Y6JA 1QMGA 1ZK2A 2B37A 3U4CA 4K6FA 3ROKA 4CLRA 1FF9A 1Y81A 1EMDA 2P9CA 2DAPA 4AJJA 4TRJA 2CZCA 2J3IA 5F5LA 2GUGA 3I9OA 4NJMA 3F9IA 4R68A 1XSEA 3B6ZA 1I2ZA 4BKQA 2PKRA 1LRJA 3LSYA 4IDBA 1U7TA 4YRDA 1BGVA 1ADGA 2R00A 3W8FA 4R4JA 2UV8A 5KVQA 5TRTA 1B8PA 4AJEA 2AQHA 4NPCA 3DBRB 5H82A 1E5LA 4PRLA 4IUYA 3Q2KA 1BDMA 3ZGYA 1B14A 1PU2A 2IXAA 4IZIA 1MP0A 3TQHA 3TZHA 3KV3O 3DBHA 3PTZA 1B3BA 4KTVE 4C7KA 2V6FA 5DZSA 2VYVA 3L77A 4QX6A 3F5SA 2WD8A 2O3SA 1FDUA 3PHJA 3PLNA 1HDZA 4GL4A 4R54A 4PZCA 3FN4A 3INRA 4FFLA 4JBGA 4AVYA 1EE2A 3VPSA 4EW6A 4JJIA 2CD9A 2D8AA 4U0JA 3ZZNA 5T8KC 3OIGA 2VWQA 1T2CA 3QVXA 2FHSA 2FZEA 4L73A 2B5VA 4NBUA 1LSOA 4Y67A 2IXBA 4YPOA 4NU5A 1P1JA 1XELA 1SMKA 1AGNA 4NJOA 3SVTA 2O3RA 1E92A 4OO3A 1PQWA 5A5FA 4Q3CA 1LSUA 3BMNB 1T4DA 2O4UX 4I5GA 4MVJM 2VZ8A 4YACA 4YTEA 3WGHA 3AM3A 3P2YA 3S55A 2P9EA 2VHWA 3GVIA 3JV7A 4OJNA 4R9RA 1DDOA 2C5EA 3QV1A 3JD2A 3VC7A 3QP9A 5B4UA 3AUAA 2NNLD 3I83A 4BV8A 4PRKA 3GVHA 1SAYA 3K9QO 3I52A 5HS6A 1BVRA 4E32A 3GQVA 1QV7A 3JQBA 2V65A 1D7OA 4U0KA 3TFQA 3W8DA 1T25A 1GD1O 4BGVA 1TT5A 5LC1A 1MFPA 3Q2IA 4TZKA 1Q0LA 1T2AA 3SXPA 2V6GA 1P33A 4CQMB 2FMUA 3KO8A 1BSVA 4GX5A 1NR7A 5IF3A 5EL0A 4BNJA 4QXMA 2BD0A 1NAHA 2ZB3A 4EJ0A 1XR3A 2VHYA 2ZJ0A 3BZUA 2YJZA 2UDPA 4UUMA 4N54A 4XEHA 1UXKA 3GVPA 3JYOA 1PZHA 1G6KA 4OOFA 1NFQA 1U3WA 3OMLA 5DF1A 4A73A 1A9ZA 2YFQA 1NVMB 1YXMA 5LDHA 4JBIA 4J2HA 2GZ2A 4OOEA 2ZTLA 1FMCA 2EP7A 3D4NA 3ZU2A 4BHTA 5B1YA 3UICA 1O89A 1GEEA 1E7RA 4DLBA 4MO2A 2Q99A 5TF4A 2HJRA 1ZSVA 2JAHA 5BSFA 3TFOA 1X1TA 2E48A 4DQUA 1B3RA 1N9GB 1EK5A 3KBOA 4E33A 2PY6A 1Q2XA 1E0DA 1DAPA 1FDWA 2JD2A 3GMSA 2PKQP 4M86A 4IGFA 4TVOA 1DAOA 2Q1SA 4HKTA 4A7PA 1X7DA 4MIEA 5DCWA 2W90A 4ZQBA 2I76A 2VQ3A 2PGDA 1XCBA 3BMQB 3H65A 3JQAB 3JQ6A 4TMFA 4XB1A 4Z3KA 3L07A 1BRMA 1GCOA 4W9NA 4ESOA 1LQUA 1NQOA 3IMFA 4BMSA 3PGJA 5TT0A 3WDSA 4OM8A 1DEHA 2OP0A 3RU7A 4CMIA 3BMCB 3BA1A 2NLOA 4UAGA 3K31A 2FSVA 1H6CA 1LQTA 5CEEA 3MTGA 1QLHA 5K6AC 4II3A 3TNLA 3WQQA 5K0ZA 4IXWA 3LF2A 1LTHR 2VTEA 3OFSA 3MOIA 1U3TA 3ADOA 5JCXA 1OC4A 3FTNA 4NHEA 1W4ZA 1NQTA 5G4KA 1LC3A 4EJMA 2X86A 4CM4A 1KS9A 3RKRA 4EITA 3IUSA 2VHZA 3MJ4A 4G2NA 2EEZA 2VOJA 4YB8A 3L0DA 4UVGA 4BNVA 3VDRA 4QECA 3RD5A 3ZCXA 3WICA 1XYGA 3LC1O 3C24A 4N5NA 3GN2A 3PWKA 3OQ1A 4NDNE 1DFGA 5G0WA 3WYCA 2Y66A 3KSZO 3EK2A 4MVJD 4Q39A 4AJ4A 2CFCA 2BFOA 4ND4A 1LLQA 3ST7A 2V7PA 1Q7CA 3D3WA 5T8KA 4FIZA 4C7JA 4CL8A 2I99A 3AOGA 1XHLA 2ZB8A 1KEWA 4HX5A 1CIVA 1YJQA 1S7CA 4JJFA 2YZ7A 4TWRA 5DN9A 3ZU4A 4IDEA 3TOZA 2RH8A 3GEMA 4LVUA 4H7PA 3PFFA 3EY4A 3MOGA 3PHLA 2YDYA 1BXZA 3NDIA 2YFHA 3AM5A 4NIMA 4OQZA 4YQYA 3T7EA 3GDGA 3ENNA 3QY9A 3GLQA 4OXNA 3ANLA 4LK3A 4CUJA 4YRAA 3GR6A 3WGOA 5CDGA 1U9JA 2OORA 1L1FA 4Y8VA 3KYDB 2H1SA 2HSDA 2EW8A 3LT0A 3PIDA 5TQVA 3WNQA 1VL6A 3QHAA 2AXQA 3ANMA 1MG0A 2ZKLA 1V6AA 2ZB4A 2BI7A 3ZWCA 3JD4A 4A03A 3RC2A 2POQX 3PJFA 3H6KA 4BKOA 3JYQA 4YA6A 5L3ZA 1ENZA 2DFVA 3UCFA 4P22A 3ZWMA 3GZNB 1A71A 2Q46A 5G2OA 5ILGA 3PDJA 5L95A 1N2SA 3WNVA 5JDIC 1Q1NA 1EE9A 5L45A 3GC6A 2HMVA 4BOYA 5HM8A 1IPFA 2C2YA 4CMEC 5BSGA 1KVTA 1LLDA 4CMJA 4K1LA 1QYDA 1R0KA 2EJVA 2IDZA 3O8QB 2C29D 2EF1A 3JYPA 3N58A 3HDJA 3RFTA 4Z9FA 2HRBA 1NFFA 2HK9A 3WFJA 1GV1A 4RO0A 3SC4A 1HWYA 2ZK7A 1B0AA 3DAFA 4JN6B 3UXYA 3OICA 4DIBA 4XA8A 1Q7BA 3HWRA 2QZ9A 1NVTA 2C7VA 4O0LA 2NU7A 1ZK0A 5IG2A 4CM1A 5L7TA 3NTOA 1ULUA 3FHLA 4FOSA 2V6BA 5JMPA 2EKQA 2X0JA 3LC7O 5DCYA 3W6ZA 1UZNA 1NXQA 2PK3A 3JQ9C 4J91A 1KY4A 3VH1A 1R15A 5JSFA 5TJ9A 4WUVA 3WJAA 1KEVA 1KYQA 2OBNA 4P8RA 4WNCA 5A9SB 4M54A 5JW6A 3FD8A 2CNBA 4J1SA 4MP8A 2NACA 4RPGA 2R2GA 1DRVA 2YHIA 3E82A 2PD6A 4QSMA 3RUEA 4DUPA 2Y1FA 5K6AA 2HRZA 4AJOA 3OA0A 4KUHA 1T2DA 3NYWA 5DULA 5JE8A 3SEFA 3TOXA 2CVZA 1NX6A 4XR4A 3H5NA 4XDYA 3A9WA 1GCUA 2CDCA 2W98A 4XX0A 1H9BA 1PGJA 5JC8A 4M55A 3ONFA 3PYMA 5EJ2A 4RF2A 5JXWA 3QLJA 3BHIA 4ZGWA 1WMAA 5JC1A 5LCXA 1ENOA 1I3NA 4B4OA 5B37A 2E6UX 4NMHA 4DTIA 2F1KA 1A72A 3QSGA 3ZHBA 1DC6A 3C7DB 4RORA 4XQEA 1IYZA 4UUNA 2NU6A 5EQFA 4J4BA 1ZNQO 3FR7A 4EI2A 3WOHA 1S6YA 4IGEA 3WJ7A 2FPGA 4EUFA 3V1TC 3FBTA 2BI8A 1EDOA 8LDHA 2X1HA 5DBFA 4PG8A 4OL9A 2TMDA 4BL5A 2NV6A 2LDXA 1EBUA 3D4OA 3I1JA 4FN4A 3FI9A 4AJ2A 3GK3A 5KVSA 3BTSA 3O9ZA 4DL9A 2CDAA 5DCUA 1GV0A 2BELA 4XKJA 4IQGA 2UAGA 1QKIA 5KVCA 4R3NA 3RKUA 2PWZA 4M89A 3HB5X 4HUJA 2VT3A 4XYMA 1AN9A 4E2WA 4E3ZA 3HN2A 2Y99A 4JP3A 1NASA 1BXKA 1BDBA 1I8TA 4BQPA 3KYCB 4H3VA 1DJQA 1JWAB 1ZK1A 4JQCA 2O7QA 3WGZA 4XIJA 1EBFA 3SX2A 4EUHA 3I9MA 1NPDA 1R4MB 3HN7A 5JY6A 3WGYA 2X9NA 5TGDA 5TS3A 4XGNA 1EVYA 1R66A 1FK8A 5COAA 3OJLA 1PZFA 5J23A 3PRJA 2O3JA 1R4NB 3KZVA 4W7HA 1TLTA 1HE3A 1OAAA 1X7HA 2D59A 2RH4A 3DHYA 4CLRB 3QVTA 1CRWG 2FY8A 3RUAA 2O3QA 3K2BA 3K92A 3QA9A 3EMKA 4BKRA 3HFGA 4NJMB 5FEUA 1UXGA 1WDKA 2VCYA 5JDIA 1XDWA 1ZEMA 3ETGA 3WIEA 2FPPA 3WGTA 3TRIA 1XKQA 1E77A 5DBGA 5KOIA 1Q7GA 3CPSA 4PIVA 3C3XA 5KTKA 1YBMA 1U5AA 4MIYA 4RL6A 3T4XA 3WTCA 5IDXA 1M6WA 4XB2A 4H16A 3FF4A 2HU2A 4J3FA 1WVGA 1E6WA 2DPGA 1M67A 3C1OA 4BMVA 1BWSA 1C0KA 1ADFA 4I9NA 3ONEA 3IIEA 3IJPA 2VHXA 3EHEA 3E8XA 1EQ2A 4L74A 4DPKA 5DT9A 4DQVA 1IUKA 4LN1A 4RPLA 4YWJA 4CL3A 1VSVA 5JAMA 2Y0EA 4Z9XA 4WOJA 1ZH8A 3DOOA 4BO3A 2E82A 4MVJP 1P44A 1KEUA 3OQBA 3JQ9A 3CIFA 3D5TA 3ADPA 5T67A 2OGUA 1YDEA 3CMCO 4AJKA 1O95A 4BNGA 4GX0A 4N7RA 4OKIA 3VOSA 3BYZA 1ZEJA 1PJQA 2NTNA 4DGSA 4XWYA 1NVGA 4RZIA 5BNFA 4NFHA 1WAMA 5HWSA 1U2GA 3RU9A 1IZ9A 2EKLA 5MDHA 4TQGA 1DOHA 1BW9A 3QQPA 4KQWA 1P1KA 3L4BC 1XQ6A 1IULA 4GGOA 3ZWPA 2F00A 3PK0A 4KTTE 4GPD1 4BNYA 1H5QA 4QUKA 4TSKA 1IZ0A 1TT5B 4BB6A 3QVWA 3WGIA 3E03A 1FDVA 2HK8A 2PH5A 4GWKA 4RF4A 4TKLA 3GOHA 4CM7A 3PZBA 3R1IA 4D3FA 1PSDA 1X0VA 2PGJA 4U6QA 1JVBA 3MEQA 3ASUA 4IMPA 5ITWA 5ITVA 3PYLA 4RV9A 5G0TA 3F47A 1B16A 2D4AA 2ZYDA 1DRUA 2HMUA 5TSDA 4EGFA 4Z3DA 1W0CA 3N74A 4IY1A 2AW5A 2W8ZA 4BNMA 3KVOA 3OSUA 2VUTA 4G5HA 3DXFA 1PS9A 5DOVA 5U4QA 3V2HA 4MIOA 2GPTA 4DLAA 2AE2A 4BO0A 3UHAA 2PTGA 3UKOA 4BKUA 1DIBA 4BNHA 4GGPA 5HS4A 5IN5A 2QX7A 4BS9A 3CXRA 4D42A 4CUZA 5EINA 2QYSA 5C37A 1RPNA 2GDZA 4U6SA 4CMKA 2YV2A 5KIAA 1L7DA 3RASA 4DBZA 2VN8A 1JA9A 3D64A 1QYWA 4MKZA 3TL2A 3RSHA 2QYTA 3DDNA 5DNAA 1A4UA 4CMIB 4BIIA 2FP4A 1PJ2A 2HKIA 2X5JO 3VTFA 4EDFA 2OXIA 1HYGA 2I9PA 4XD2A 4WCFC 3RFXA 5I8ZA 4CMCA 4XYEA 3INTA 4GVXA 5COQA 2BH9A 1GTMA 1CWUA 3DZFA 4HFJA 1WWKA
chains in the Genus database with same CATH superfamily
3TAXA 3QX3A 1FLDA 821PA 1RBZA 3M0EA 2XI4A 1KAGA 5IKOA 2ORWA 1GG9A 3IVRA 2HU5A 4LFCB 4E31A 1X0XA 4QM7A 4MNTA 2ATEA 4LZNA 1M0EA 3LVRE 3BQNB 1J42A 4MDHA 1U5BB 2Q7OE 1NXSA 1T0PA 3CEPB 4CM4B 3HV2A 4EHIA 1RWOA 5EJGA 1YJ8A 1TD1A 2PA0A 3CKYA 4NZ9A 4YLEA 5DMHA 3REQB 1MC5A 1TM3E 4RQAA 2JK1A 2R8PA 1Z4KA 2PZFA 1IHUA 4O2AF 1S3IA 4EGJA 1ES9A 3S2FA 4B79A 4QWMA 4UZFA 1ZW6A 4RQUA 1Q0TA 1WBBA 3DE6X 2MR6A 3K4QA 4P7GA 4QTTB 2BJVA 2GF2A 2ZRGA 4J1NA 2IV7A 4YXFA 3GLUA 2D1YA 1ISFA 1ZIDA 3ZZ1A 1GTG1 4E4YA 3DNMA 1X7GA 3MMPA 4N4AA 1EFTA 4XWAA 2BM8A 1KC1A 2D7JA 2CEKA 5IM4A 3BXPA 3IC5A 5BMVB 3ZWBA 3BS4A 4G01B 5JAIA 2I33A 2J9RA 3ADBA 4OGWA 3FWYA 1NBMA 1UBLS 1LA2A 3D9QX 4G56A 1GNTA 4UVHA 4QGFA 3UXMA 1CEYA 2XTNA 2ZWMA 3KOXA 2J6BA 3OKFA 2YQ5A 4RHFA 4YJ2F 2WKWA 4DMRA 1LGYA 2Z2IA 5JXIA 2DHDA 3MUOA 2Q2VA 4CQNA 2H0QA 4DLSA 2CY0A 2ZPUA 4II2A 3WZ2A 1HV8A 2B6HA 5A7GA 2O8EB 3A9RA 3QFRA 3IDSA 3A2MA 3MMNA 3NW9A 5FUQA 5LA6A 2RGEA 4ETNA 2RGXA 2ZAMA 4E70A 1VRWA 5C1BA 1YQXA 3PQDA 3VH3A 1AK2A 2JFZA 4B76A 1JAYA 1QK4A 2FFBA 2XB9A 3RYIA 2D74A 5A2QA 1YS2X 1FQJA 1W88B 2ILVA 4XYLA 2VWGA 4DA4A 1Y8RA 2IYFA 2R8ZA 2XQJA 4JUCA 4NHOA 4Y30A 1IOLA 2JG3A 3EPLA 5G0SA 3TNYA 1M6VA 2PX0A 3RW9A 4Z6KA 4KYVA 1T9KA 4P58A 5B6JA 2XQKA 4RZ2A 2NVWA 3TWOA 4MQFA 2GVDC 1VI6A 4YCSA 4FFSA 3OWHA 1CBUA 3TYXA 3VSBA 2ZYWX 4RDCA 4O3FA 4XVQA 2HV8A 3VR1A 4Y1RA 1J21A 4ZO8A 3W8RA 3D0RA 2HDOA 5KYNA 4FSDA 1BX3A 1NYTA 4O4IA 2F3PA 4HQLA 4BGEA 1DXYA 4C7BA 3VPCA 3KDAA 3QKIA 4U7PB 4AK9A 2HFKA 1UAGA 1RZRD 1HZZA 1KKUA 2NUPB 1G8FA 2OENG 4FE4A 3ZDFA 4YR7A 2JAPA 5DI3A 4S3MA 1AKVA 1XJ0A 3PQ7A 1A69A 2I3AA 5CTAA 1RBMA 1HDGO 2CXSA 4P86A 1UBOS 1C3VA 1YAHA 4J1TC 4PYOA 1WD5A 3A36A 3G2JA 1T35A 1MX3A 4YPVA 1DKPA 2J8ZA 5FLYA 3ZY5A 3DJFA 3IUBA 2FA9A 4ZJYA 1MAUA 2FXVA 5K0CA 4LSZA 3FBWA 4QYIA 4V1CB 4GF5A 1OLSB 3QKWA 1VG1A 4QTYA 1W44A 1EZZA 1WHSB 1UQUA 5H9WA 1JR3D 3U2QA 4D45A 1FEZA 2G82A 3AWDA 4I19A 1L6RA 2O59A 4AY6A 5EZQA 3ZY3A 3W4JA 1JDJA 3D3NA 1WEHA 4TXHA 4GOXA 2VJMB 4EABA 1BWPA 3STWA 2HIHA 1Q84A 3LRXA 4AZSA 1K63A 4CETA 3C74A 4HYTA 2XX3A 1NR5A 3U4GA 5HJ2A 2J6HA 2QM8A 4MYHA 3NX4A 2P65A 2WMNB 3LL7A 1WABA 2FE4A 3CBQA 3KD2A 3NBAA 4WW0A 4AMZA 3U60B 4E0BA 1RWQA 3IAUA 4NBTA 3RF7A 1L5RA 4F91B 4QTZA 1LSSA 3ZWKA 1Y9AA 4IR7A 3SSNA 2C0PA 4XX0B 4AZ0A 1ZL2A 1G42A 4ACAA 4DLXA 2BVNA 3DMYA 3K6RA 3JZIA 2G04A 1DBVO 3PX3A 1DSSG 4HPWA 3BXEA 5BY2A 3TLYA 3FNRA 4NI5A 1W35A 4X65B 1Q11A 3QEMB 4WXPA 5JV5A 3ORHA 4HVLA 1IVNA 1MQ8B 1IHXA 1ZG3A 3EMVA 3QPUA 5KHAA 3B1KA 4BNUA 2QDXA 4PYKA 1YULA 4XM2A 2QPLA 2PRKA 1OX4B 3UH1A 4CGZA 1JYFA 1IZYA 5JVDA 1IQUA 4DUGD 1GZSA 4QQFA 2Q9CA 4II7A 4JEUA 3K4HA 4XGRA 5E6SB 4A9AA 4HNAA 1P75A 1XTTA 1KP3A 5FTLA 1MO5A 1I33A 2OZVA 3A4TA 2GPNA 3IPYA 4W5HA 5AW6A 1N5MA 1I5RA 3QPWA 4GPIB 4D5GA 5FTJA 3W0LB 1HSZA 2ZT6A 3FB1A 4Q7EA 3GFRA 3ZLUA 3WK8A 3VDNB 5AUOB 1FXUA 2ZYAA 3LKZA 4GP6A 3FRHA 4FFOA 5FPPA 4F45A 1J0CA 4UUPA 6LDHA 2MSKA 2NNWB 3CURA 1X14A 4ABTA 4OQFA 3GAFA 4QXAA 3V8EA 3DZGA 4BNNA 1V3UA 4BX9A 4F86A 7YASA 2Q8NA 1P77A 1U81A 1ZUNA 2PDAA 3JWHA 4PZEA 5D6NA 3SVLA 1NWCA 1WULS 1H3NA 2DBRA 1CJUC 1D1PA 5EPOA 4RLHA 1TZ2A 4OHCA 1AKNA 2WP8J 3D6FA 4QEZA 1KZ1A 1F0YA 3LYUA 1YVDA 1VKRA 4CPDA 1A2KC 4FEEA 1ZJYA 1ZBQA 1FFEA 2ODAA 1ZIPA 2VAMA 3DWGA 4PLPA 1K9SA 5C9ZA 5IKMA 5KX5F 1SIUA 5G1PA 2OE2A 2R6FA 1JGTA 1MO3A 4LHZA 2WE7A 3CM0A 5E9AA 4DILA 4PLFA 1OLUB 4BUCA 4HGZA 3JZDA 2P7HA 4FQ5A 5LYJF 1JEDA 5DJ5A 1QUFA 4PPGA 4NXNB 2FMFA 4RJLA 4ZVNA 1Z33A 4MRPA 2B8TA 3LOPA 5DNEA 3ON5A 3AP2A 3VO1A 1YONA 5AVSA 3QF7A 2D0PB 2FWMX 3PZRA 3HFSA 1JKJA 1R4AA 1UC9A 3C7TA 4YFYA 5AJUA 3BX1A 1Q22A 5K09A 3L6EA 1ESMA 3S6JA 3KQNA 3LO8A 3DFKA 5EY5B 1DHTA 4OB6A 1GR1A 4LJAA 3QFHA 2O5EA 3NGLA 4JJKA 4PQEA 4U8GA 4J0IA 1LLCA 4UKDA 5DSZA 1RADA 1YS4A 4YV2A 1GAXA 4R83A 2HN9A 2C04A 3DHWC 4WLEA 3UV7A 5JNVA 1DXHA 1SBZA 1GYQA 1WW2A 2ROQA 2XXJA 1T1IA 3E9YA 3L7AA 4Q9IA 4B3GA 3MTAA 1TPYA 1XTSA 4K8RB 2WJWA 2XJ9A 2XRZA 1AO0A 2IH2A 3RS7A 1NN5A 5LOVA 2Z5VA 5JD6A 1D9ZA 1WXIA 2RK6A 4KE8A 4MUXA 5DM2A 4H4DA 4ARAA 1L7OA 1DG1G 4CHGA 1B8OA 3HU3A 1R37A 3CZAA 3ZJYA 4B4WA 1NW6A 4MYCA 5TT1A 2D1SA 3NAGA 4MUEA 1BWQA 1C1YA 1USKA 5ESWA 4MP6A 4Q3EA 2P27A 4KYIB 4URYR 1QNLA 1I13A 2Q1UA 1ORVA 5IXJA 1NXPA 4JLVA 4D8TA 4XZ3A 3AI3A 4RADA 4PTYA 4KHZA 3WYBA 1GPWB 2VSYA 2RHGB 1X7YA 1WVIA 4BZWA 1XZIA 4EA9A 2XB6A 3L0SA 1VI5A 3AR4A 4AMGA 4CM9A 4YRPA 2WSMA 3OJXA 2J9YB 4MQEA 2K87A 2ZWPA 1HDOA 1PWXA 2XUAA 2WWGA 4PCAA 3UHJA 4Q0MA 5BSVA 4ZYLA 3FWKA 2B8WA 1KJYA 2R6HA 3N1UA 2DBVO 2C3MA 3KRTA 3ND9A 2PMFA 4TKUA 4KPFC 4L0DA 1YIDA 5AVOA 4XDZA 5A9RA 3HJRA 2FR8C 5B1EA 1ZH6A 3DB1A 3PKJA 2HAEA 1BW9B 2G83A 3A70A 3E8SA 4N7MA 2F9FA 3O8OB 2OHFA 2VPPA 5HBRA 2AI1A 2F3UA 4DG9A 4J0EA 4MV4A 3FTEA 1HNZB 4LZLA 1ECLA 1KARA 4LV5B 4Q1AA 4U7JA 4MB6A 3DFIA 3NJRA 4YYEA 3W5VA 5CA1F 5M5BA 5HOQA 3L8YA 1NUSA 3BMOA 2XOXA 3DXXA 2V7BA 4XGKA 2I2XB 3UJBA 1E6LA 1RXVA 2FN4A 5JZVA 3VGPA 5JZ9A 3OZAA 4X20B 4JOQA 1ZZGA 5HP4A 4INAA 3I8SA 3L4JA 3KKPA 1WPGA 3K15A 4C4ZA 2OG1A 4REMA 3ZBUA 3FYHA 3OTWA 1Q6ZA 1EK6A 3T5DA 3VZRA 1XWIA 2W37A 2WLSA 4MA4A 3QUTA 1W1UA 2OT3B 1HDCA 4RKRA 1S2DA 2JC3A 2O8VA 1XZJA 5DIZA 2ACEA 1A5SB 3K0CA 4WACA 5A62A 2VYNA 2M98A 3W6OA 3ZWAA 2D1FA 2ZJ2A 1YK0A 3KXPA 5JYDA 1HNWB 3IUQA 4B3HA 2UYOA 1SXQA 4JVSB 2BFMA 2HNKA 3UFXA 3VPFA 4TWZA 3WYDA 2O8DA 1ZOLA 3IP3A 2KMLA 3D43A 3LNTA 4BVFA 5B7QA 1A98A 3PP8A 2JGDA 3ZDYB 2DHEA 2VRCA 4G5OA 3NYRA 1JR3A 4EHFA 2QN3A 4C29A 1TYBE 3NDBB 1J1UA 3O8BA 1SOVA 2O50A 5CYOA 1YZLA 1FLAA 1Q20A 2QN2A 4KX3A 3TL3A 4P82A 5BR7A 1NW4A 4PLCA 1NNLA 3QTLA 3HVRA 3FGPA 5JNUA 3BICA 2PJZA 1PGQA 3LP8A 1FMTA 2HMSA 4NQZA 1LX6A 3K5PA 3WWYA 4DDUA 5F9FA 3FY4A 1OKKD 1L7RA 3AJDA 5E4JA 4XCVA 1NMEA 3R3WA 2NAPA 1ZI6A 1SBQA 3ENQA 1T1GA 3DLTA 3KLBA 1YL6A 4UEJA 1B8VA 2IKSA 2D06A 3IMEA 3AEYA 5GMOA 5CD9A 2YXPX 4D4JA 1B6SA 4WFIA 2NTEA 3TLZA 1JDPA 5ICFA 2K2WA 4FE3A 1M2WA 1DTEA 1ZY2A 4NVRA 1F4PA 2L0XA 2QZ4A 1EK1A 3UTDA 1JXMA 2ZCJA 1RYMA 3OJ0A 1D4AA 5LLTA 2AKAB 2BSQA 2XF8A 2O2HA 2BR4A 2X0KA 1V1RA 4K6HA 1N5RA 4P3KA 4FFNA 3RYFA 4X54A 3GJ6A 4Q9HA 5KPDA 1MTZA 2FOIA 3D3JA 2ZR7A 3HU2A 3IT0A 4DIEA 1BMDA 1G0OA 4RFVA 4GOND 4XYMA 4TXJA 2H2HA 2X15A 5BR8B 1E18A 1M75A 2KWIA 3IAHA 3WQBA 5SYMA 1A96A 1HFWA 4BDTA 4P5DA 3MT8A 4HN9A 4I50B 4C3ZA 3NOQA 4IIUA 2OV2A 4BO6A 5ALYA 2HRRA 2CWDA 4JIMA 4BXOB 1KPHA 3CJTA 1N1MA 1GZVA 1EQUA 1VG8A 6REQB 3O2SB 4A27A 3OG9A 5DTMA 2QVXX 4F4IA 2A57A 3FGZA 1Y8AA 3MXOA 4QLAA 1MC4A 1J2UA 2W2LD 5THKA 2IUEA 1YI8A 4ZJZA 1K8YB 1N7IA 1N8TA 1P91A 3I42A 4OK3A 4A8JC 1PNRA 3RS8A 3PBKA 5HKAA 4JP8A 1UKCA 4W5OA 2BF4A 2BUCA 3RC7A 2D00A 2ZSBA 1TVEA 4IZ6A 1QZZA 3G7NA 3ZCSA 5K45A 2W6OA 4CLOA 5LWHA 1ADYA 1XDBA 1UJMA 3VR4D 3AV0B 1ZCJA 2VSXA 4E2XA 5JNLA 3OQ6A 1T24A 2CDRA 1J49A 3DM5A 4H2DA 4K3UA 5BYJA 2PM8A 5LDDC 3L7MA 2NO6A 3B6IA 1SC9A 4JSRA 4L0CA 3SIPA 4CODB 1TFRA 2IXEA 2PN1A 3G1TA 2P3SA 4O6VA 3LMKA 5FPYA 1GPJA 3J81k 3CPEA 3KWLA 3KUKA 1P1IA 1ZXBA 4FLMA 4MRRA 4NDZA 4ZZ3A 3FCUB 1XZCA 3PUZA 1WXXA 2BISA 4TTJA 2JHFA 3B48A 2AMJA 5BYAA 4HQOA 5I8WA 1MB3A 3BWDD 4B3SB 2R87A 3SQXA 2IP1A 4PANA 3RYHB 1A4IA 3U4QA 4HB4A 3GHHA 4J16A 3TSCA 1N7GA 1HORA 2W2OA 4W1QA 4Y2UA 2PMEA 1RYZA 5ALIA 3OCJA 2YUIA 2C98A 3L7DA 1KZ9A 3FM9A 3G5UA 3I09A 3L5KA 3O91A 4JH0A 3RUCA 4DIOA 2DKFA 2R65A 4CTOA 1U94A 5JRZA 5BV1A 1G8JA 3KJEA 4D0NA 1HOTA 3U4AA 1Q83A 3P45A 3AJRA 4A8HA 1Z4NA 5TV2A 1CHDA 3B1JA 4O4LF 4CMBA 4DJ5X 2PE5A 4TMTA 1A8QA 1DKQA 3A28A 4DQLA 2GSDA 3H11A 2TECE 1JB1A 3PV0A 3IBSA 1N2HA 1W0KD 3ODGA 3PF9A 3PC4A 3NQ41 4YCJA 4QL3A 4QQKA 5DGDA 2HXSA 2AF4C 2HCBA 3ILHA 1XJCA 1EUCA 3BHMA 4H18A 2LW7A 4QOHA 2PZEA 2R4UA 1ZGBA 4GBJA 1XCGB 3KQVA 1YJXA 3R3JA 4KO2S 3D7RA 4CLDA 5L3QA 1DB3A 3Q3HA 5EZ5A 5KO2A 1U8CB 1QRRA 1L8OA 1F0PA 4EVRA 3KELA 1GJRA 1VJDA 3KIPA 4FWIB 1DXQA 1VYUA 4OL0A 3BWXA 3O8DA 3AEUA 4P4SB 1G16A 1DKUA 5KC9A 2W6QA 3O1JC 421PA 2QSJA 2QM3A 3HS3A 3KR2A 1CG6A 4RCVA 1HGXA 3X2SA 3ZOZA 4Z53A 5AW0A 2Q5IA 4U5XA 1S89A 3FCOA 4Q4HA 1MZPA 4AIIA 4YI5A 2JGLA 4EYQA 4Z54A 4UBOA 3D7MA 4PNHA 2Y1WA 1Y98A 1PUIA 4M21A 5EMKA 3IQDB 2JBHA 4AS2A 1NF9A 4COKA 4EF6A 4A23A 1G6HA 1RE0A 3GROA 2YS7A 2G4VA 4BMDA 4GGMX 1ID1A 2OHIA 3BJIC 2IEAA 3WLQA 4TKVB 3TX6A 1ZGGA 2X8BA 4AUEA 2RE8A 1PJAA 3RSSA 2AFVA 1G19A 3NVDA 4DLKA 1W52X 4PLGA 2B4RO 4LNUB 4GH5A 1B43A 3AR9A 1CIPA 4HJRA 1P1CA 4Z0PA 1WL8A 1ZC4A 5DOZA 2F3SA 1UEJA 2W6JD 1QOZA 3PHHA 4F3TA 1CUIA 2HIMA 3LCCA 1S1MA 1FLNA 1T3LA 4ODIA 4G0OA 4X62B 1YC2A 4YCBA 3WK7A 2WTUA 4PFQA 1N8NA 2A0WA 5J2TB 2OM2A 2VZEA 2DEUA 1PKEA 2I1VB 3OZVA 4B87A 3BXXA 2CF6A 3UV3A 2CDBA 3RQSA 1VSTA 1KYVA 2WWVD 2VPQA 3RJ9A 4CR8A 2JIOA 3GA0A 4CQJA 4EKNB 1ORTA 4LXIA 4YLGA 3B2NA 3B8HA 1KOLA 4CT4B 3EUFA 3JXEA 5G53C 4BMNA 2XIJA 3USCS 3BWBA 1DRJA 4YASA 5D6OA 3DVRX 3VO9A 1AHIA 4DXAA 3THXA 2X0RA 4ZV7A 3IQWA 1VMEA 1FFWA 2I7TA 2JJ8A 1REQB 1S2LA 1TRHA 2XTZA 3B7WA 1SUEA 3O4RA 2O7SA 3K0BA 5AMXA 4C6TB 1HRKA 2YFKA 4W5TA 5JOQA 3QRWA 4FQ8A 1L5GB 5EZYB 1WOMA 3BIJA 3JQFC 1KU0A 5A9TA 1ZGHA 1K0UA 1XL1A 3GH1A 3IVXA 3AOEC 3VSAA 3DFUA 4HWTA 1O4WA 3PC8C 2DUUA 2FSSA 1BX1A 2JLWA 1OWNA 1V11B 1CULC 5HK9A 2FFRA 2WHPA 4X66B 1N6IA 4HFMA 1R5NA 3VJMA 5IASA 1N25A 1W36C 2C4UA 1E64A 3CZMA 1F5NA 5KPJA 3N8HA 3T94A 2WVAA 3JZFA 4QICA 1KO4A 2H7YA 3QU5A 3I04A 4I0WB 4J7CA 2H1FA 3ILXA 4X1IB 3TR5A 3QM1A 5EIWA 4KR6A 3JVVA 1ONPA 1PIWA 1OKKA 2CV2A 2PVCA 4OU5A 4DR6B 4HDKA 1CNMA 1UFRA 3C8DA 5H68A 3LPDA 1ZOPA 3FJYA 1VHLA 1JSZA 3LRPA 3P9ZA 1PQPA 3VC1A 1RXUA 2X7HA 1Z7EA 2VDRB 4UDNA 4QBKA 1JG1A 4PZ9A 3PFHA 1SUBA 2CJFA 2HA4A 2IPNA 2W6PA 3KU1A 2B0JA 2CHEA 3QHQA 4JYBA 2XNDD 1ANKA 4QJIA 4UEOA 5DXJA 2EOAA 3E2MA 1BA3A 4M0FA 3A04A 5EXDA 3KXDA 5JZBA 1R18A 1GFSA 3GIDA 3H8WA 4WLUA 1GYPA 3UYKA 1EFLA 1XD2A 2QXYA 2RBKA 4L16A 4PNZA 4XJSA 3DVSX 4JLJA 1I1HA 1LDGA 4R1NA 1EINA 3IIJA 4GT1A 1JQEA 1PUXA 2YASA 2GD2A 2K5UA 2HF7A 5FBZA 5CFLA 4KQGA 4NR0A 1UPXA 5JAQA 4BNKA 4CR6A 1FFCA 4BFYA 3D6HA 3ENKA 4FI3F 3DOHA 5D3MB 1P1HA 2J5RA 3P9SA 4MYTA 3Q40A 4TQUS 1FOEB 1VBMA 3G5AA 1UJ5A 3FPBA 2P4HX 4I4TA 5GM2A 2GHRA 4UHCA 3LKBA 4Q15A 3BTVA 1VPLA 3EPPA 2BFWA 2YQ4A 1H3EA 3KSMA 2YJGA 3BSYA 1CUXA 3G0CA 3C16C 5C3MA 4V0RA 1F4LA 3EIEA 3MD0A 5B6IA 1O6BA 2C3UA 5CDTA 1NE7A 4RNDB 1NKVA 4DM3A 5CITA 4RF5A 1P5RA 1A9QA 2IUYA 3DONA 1NFRA 4JT4A 2GH1A 3VR4A 3A2LA 3FKQA 2GZSA 4MR8A 4UASA 5DHQA 4JIGA 4RGQA 3ZU5A 2PUHA 4Z5XA 4NNJA 1RC8A 5LQNA 3MTJA 4M6WB 1KE1A 2FWPA 3ETDA 1CP3A 1E6KA 1MJGM 2C83A 2P5UA 4NWIA 4BV3A 3E7PA 5KREA 3CVVA 4JI4B 1VMDA 4UATA 3IE2A 3EX7C 3ZVMA 3LDFA 4MV7A 3ILVA 1I4WA 1L5VA 1YOBA 2C5SA 3AG5A 4G9EA 1DC5A 1CZLA 1GGVA 3UOAB 3A06A 5IZ4A 2HQSA 1BOFA 3BM5A 4N82A 4E7PA 2R1TA 2EGGA 2OD7A 2NQTA 3FYCA 3IQEA 3A0RB 5HIJA 5B1DA 4WCDA 3L93A 4TV9A 2JNWA 4ZICA 5K3SA 3EASA 1Q95A 4K9MA 1GQFA 4H08A 1IBMB 1TCVA 2XDYA 3MINB 5IBQA 3AXSA 4ZCQA 4JZYA 3O83A 5DTJA 4ITUA 3AM1A 2A9PA 1J09A 4KAAA 2VJNA 4G8JA 2HLDD 3PQ8A 3Q6IA 2WBLC 4OPMA 4KSCA 3B6EA 1TIPA 3IESA 1SUDA 3OMXA 4WK0B 3RUFA 3QNMA 4YREA 5I4KA 3ADDA 2ADOA 3HBJA 3JSAA 3FLAA 3PL1A 1MHPA 5LQSA 1E1NA 1M1XB 2X6TA 1EVJA 1QGED 4IGKA 5CM8B 3SSAA 4AWBA 1K8XB 1PFUA 4M1MA 5U4XA 3WLEA 2FEOA 4EB0A 2WQ7A 3A3YA 2F3TA 3SYLA 3VOTA 1EXDA 1W0KA 1QORA 4MW6A 4NS1A 1XL0A 1DBIA 1HL3A 1MIOA 1A7UA 4NX2A 3PXGA 2JI4A 4BNDB 4D82A 4HNTA 1TRKA 1NY5A 1JZTA 3ZEAA 2QVBA 2AZXA 2EJUA 2QPTA 4R1OA 1YB4A 4F5YA 3WJ1A 2OXFA 2VDVE 3HSYA 2CDNA 3EEOA 1Y1PA 4KIFA 3BB4A 3HO8A 3VR5H 3NH9A 2NVUA 2UUCB 3VGJA 4IGIA 4C03A 4RSGA 1R6VA 2A14A 4HN2A 4ESVA 4RFLA 3LBYA 1NKSA 4Y2TA 4K6CA 2WC1A 3GMDA 3IAEA 2VJLA 4AT1A 4AKTA 4EFKA 3PYXA 2GM3A 3G9XA 1E59A 3KUCA 4PO1A 2P91A 2FSVC 2QX6A 4LJLA 4MXDA 4LBZA 1PR6A 2AFHA 1AKRA 1U3VA 4V03A 5CYFA 3VR6H 4MRNA 1T36A 4Q3LA 3VPAA 4D3SA 1KETA 5LLDA 2QW0X 4DM7A 1PJZA 2W6ZA 1T8SA 3HY6A 2A9VA 2PUGA 1JU4A 5IRCD 4H6VA 3BAFA 2ZEJA 3EGDB 4FUTA 3N07A 1SCIA 4HGQA 1BS1A 5FCDA 3C3AA 3LX5A 5LZ5A 4NLLA 1TADA 1VP3A 3HVKA 1G8HA 4FJ2A 3P96A 1G3QA 4PS1A 3KJIA 1BD4A 1YR8A 4W9MC 1EWQA 4IFIA 1VG9B 3IBTA 4OGKA 3UAOA 2WSLA 3IUMA 5KMGA 3IE1A 1CQJB 3D8SA 3DNPA 1EUDB 1NONA 2WNIA 3LUJA 3D5QA 4M98A 1W93A 4OYLA 2XRMA 2QGZA 3DVLA 1SKYE 1CS4C 3ZS9A 3UUEA 1DU4A 2CBGA 1NDHA 2JLUA 1SH7A 2W6CX 1ZVJA 2YOFA 2BFEB 4TSFD 2Y1LA 3SKYA 4E5NA 4DV3B 2EJWA 2B21A 3E5RA 1SKMA 1RC1A 3G0IA 2EDCA 4KREA 4L07A 1V16A 1XTQA 1E7WA 1VBKA 3DAPA 1R12A 3DDUA 3WZLA 2P2NA 4NH4A 5IULC 1PEKE 3FWNA 1L4EA 3QELA 5KNCA 3GG9A 3EQ9A 2LNDA 2WU3A 5AP9A 3P52A 2R7KA 1Q1AA 3IKTA 3UG7A 1JLLB 2HMWA 1K66A 4GSKA 4INJA 4A6EA 2J46A 3TAHA 4AY5A 2XH8A 2ZWAA 4EPXA 4M1YA 5FOVA 2ODPA 1Z6AA 2F1OA 1QFJA 4HPXB 2YV3A 4UXJA 4HS4A 4B6RA 6Q21A 2Q5FA 4NKRA 1WX1A 4O02B 1YT5A 4L51A 2ORVA 1W4CA 5BUZA 3HN6A 3WGJA 1DWPA 1M2VA 1RLUA 1S0UA 2D3WA 5DXFA 4BRUA 3D6VA 1C81A 1YGYA 2PX4A 1Z3CA 3QMVA 5F5XA 2OSBA 2PRJA 2P30A 3H18A 1YZYA 2F17A 3IVMA 2XDQA 3HU1A 1QTQA 1HSOA 1P1RA 3HG7A 3BE5A 3HDTA 1W1IA 5TB5A 5I7WA 2WW8A 3M9XA 3F5MA 4KYTA 3A2KA 2QXTA 2MR5A 3VNQA 4OH1A 2O2IA 1ITZA 2CNNA 3DE0X 2Q3EA 3BCHA 4RKFA 3U48A 4C3UA 4FSXA 4EUKA 1RLTA 4NPAA 1Z6TA 3IA2A 4RABA 4A8TA 2ZI9A 3QXSA 5T4FA 1H4VB 2ZRHA 2QU7A 3LWNA 3Q9NA 5E7IA 5HILA 3GRCA 4N0PA 1Y9JA 3TUIC 4I9FA 3FSGA 1U9IC 5FEMA 5F3RA 4FZRA 3S5JA 4Q82A 3K16A 3NWEA 3FCSB 4IF6A 4TS9A 3L0ZA 3NLLA 4MR9B 4P3YA 3EXHA 3GEPA 5CYGA 2RARA 1MX9A 3RUPA 4L3OA 4YDRA 3QOXA 1OI4A 1VE7A 1VL5A 2K4MA 2XNDA 3I72A 5A02A 2JVJA 2WTEA 2YYSA 1XDGA 1K8QA 3HWX1 4M53A 4MWOA 4LZWA 1R9JA 2R11A 4P36A 4YRCA 5FORA 2P1DA 2IE8A 1TNDA 4ZHQB 2GM4A 1OWMA 1CR1A 1FJ2A 4OHXA 3D7LA 4Q93A 1TYZA 2R5FA 3GY0A 4F93B 5TPWB 4IKOA 1MRSA 2EX4A 1YRLA 4RGVA 2CJWB 1TO2E 2GQ0A 3LYLA 2L82A 1PI3A 3B12A 1LNSA 4YJFA 4ATNA 1CT9A 2BFBB 3FOEC 4HATA 3WL4A 4H7KA 3O26A 3HXMA 3ZW8A 2R84A 1XVVA 3LVBA 2YWBA 1I3OA 3AJEA 1LRKA 3V1NA 3O75A 4OXKA 2C9DA 2A1IA 2OBFA 4PCUA 4ERNA 2FR1A 5LMCA 1ST2A 2XZOA 4IV0A 2H5LA 3P2EA 4NU8X 3RABA 5JYEA 3KKMA 4AJLA 5JSZA 5BWLA 1RJWA 1TEZA 4EJSA 1M1ZA 2R7LA 1V0JA 4UBLA 4JDUA 3HJUA 4GMKA 3T3IA 3HXQA 3CVWA 4B6JA 1C4KA 8OHMA 2XY4A 3E48A 1WMDA 2V9ZA 3EPJA 2X7JA 4FNMA 1SXJD 2R6GA 4WZAB 4OHOA 3L7IA 3JALB 2GS9A 3IP1A 3C87A 1KXJA 2QZJA 1ONNA 2XCUA 3BZWA 3JVUA 4RA9A 4XJXA 4YJHB 3N2YA 2ZR0A 4YAIA 3M6LA 4Z0TA 3F49S 1T1JA 1LNZA 1ZH4A 2P6MA 3L4EA 1WTCA 2AOWA 3LOUA 3R3VA 3EZYA 4Y6SA 4ZWNA 1E3JA 1USVA 1Z15A 4LXYA 1WXQA 4M9QA 3S81A 2IHUA 4EKIA 1P1BA 3QFTA 3NHRA 2Q1TA 4CKZA 1GUZA 2JEZA 3QEJA 2GBGA 1SVUA 2NUBA 2AQ8A 2H59A 3P19A 4XX1A 3R7FA 5I9TA 4JJ8A 1WETA 2W8BA 1MD9A 4UCWA 3AG6A 1JDZA 2C7PA 1LS1A 2YBDA 1QO7A 2PKQO 3H2BA 1E1YA 4R2IA 4B33A 3S2EA 2X58A 1O6ZA 3BIXA 1E1MA 3RE1A 2HLDA 5GONB 1SC3A 2DUWA 4KWIA 2ZWOA 4FGLA 4DG5A 1C1XA 4Z4EA 3E6AA 3OZUA 5FP0A 5BMVF 4CLXA 2XAAA 1K5GA 4RY0A 4A36A 3V55A 4DA9A 2VF2A 5FFFA 3QLUA 2IHNA 3KALA 2P2SA 1WY7A 2M6SA 1XEWY 2NPOA 5JD4A 1TJ3A 1GN8A 4DR3B 5A04A 3W77A 1YR1A 2ZSIA 2DTXA 4Q18A 2QTCA 1F60A 3RSCA 1P81A 1KQNA 5FBQB 2A30A 1GQOA 1V8ZA 2DE0X 3EQ7A 1YRQA 4TRMA 4KUEA 4BLOA 3UT6A 2YTZA 1S9DA 2NZYA 1Z6QA 2IITA 3NBQA 1SOWA 1BXGB 5J1SB 2VJDA 2G67A 2FPSA 2JGRA 3B20A 3E9ZA 3SCZA 1YH3A 2ZDGA 1TC2A 4AX8A 2PYDA 4JYPA 3CZ5A 2PEYA 2XECA 1NBAA 3GJQA 5AK4A 2OQVA 2VT2A 4RWZA 3S0JA 1OH6A 1H8HA 2EYQA 4OHYA 1HTTA 4YRBA 5CA0F 5JARA 1IONA 4PO8A 2D0IA 2NGRA 2YJ5A 3GT0A 4CV2A 4M99A 1TB4A 3UJPA 5JPDA 3COJA 3CSSA 3CG0A 5AM1A 1CUGA 1RJ9A 2IXTA 3JQGB 2AG5A 1XC7A 3P0IA 3QKRB 2XYRA 3OWXA 4JFRA 2DLDA 4TROA 5EMNA 4PR0A 3TE7A 3URMA 3NHWA 3WLNA 1JZQA 4DCMA 2EGUA 2E7ZA 1ZR2A 2KI5A 3WISA 4WX2B 3CUTA 2ECPA 1LPSA 4M88A 4TTTS 2BBOA 4V0QA 1C9NA 3T3HA 2IHVA 2C5LA 1DJNA 2PMBA 3RBAA 4U3JA 2ZJ3A 5G1OA 3NTUA 1QANA 3PNYA 4BFWA 4DOMA 3F5DA 4OAQA 4B4UA 4ZJPA 4Y7DA 4BZZA 3NBYC 5EYPB 3FZNA 3NNSA 2CCJA 3RUIA 4YS6A 4F9EA 3PFGA 4HG2A 4FB5A 3K1ZA 4W82A 3KZMA 4RLSA 1XGKA 2A1TR 1PK9A 2WSIA 1MBZA 5EZSA 3TN7A 1PJTA 4YXWD 3GPBA 1QVRA 5A4DA 4TSFA 4M1QA 4CMGA 1FFXB 3LK6A 2VA8A 1X1EA 2IRWA 2JDID 1WDMA 2QTVB 3LJKA 4TZ6A 4FOLA 5IVHA 3I61A 1D0IA 1J23A 2MIIA 2PGNA 2QAGC 3EVZA 4F04A 4CKEB 4FNAA 2D7DA 1U80A 4ZOLF 4B85A 2P9TA 4JU9A 1D2AA 3TNDA 2I7DA 2CUTA 2QRKA 5FJJA 1VE3A 4P81A 3MZ0A 3EF3A 1JAXA 4OYRA 2W4MA 3H4MA 2CLFB 2FB9A 1E4YA 2OHOA 2BEKA 1G8KA 2FAXA 3CZ4A 3K0EA 4UCFA 5B3JA 1D2EA 4MEAA 1Q6YA 1L7EA 1NATA 4KMSA 1S8AA 4TV8F 2QL7A 3RG2A 3WIDA 5HUJA 9MHTA 4MUMA 3OQNA 3C3YA 2COKA 3OCVA 5IF9A 3R5JA 4YRTA 4CG3A 1CUVA 2WYHA 3QWFA 5CDYA 2BKVA 3NWOA 4W63A 1OXSC 2HY7A 5A2GA 2D8MA 1O95C 3FPAA 1WLSA 4YDQA 1G20A 4HRVA 1H2XA 3UWPA 4YK7A 1Q0HA 2V7UA 3RSZA 2PCJA 3ZGZA 4PXYA 1RCTE 1L5HA 5B4TA 1IXYA 5DNUA 1AXEA 1T5BA 1L1EA 2MU1A 3WGGA 1L1QA 2IOFK 4OHMA 1XRRA 3BCUA 3KTAB 4J9VA 3T0GA 4QG3A 4H60A 4X94A 1EM8A 4OMUA 2QTTA 4IDDA 1SBNE 1ZJ6A 5KYWA 1EJ2A 3FYUA 3ZV3A 1CQXA 1RPZA 8AT1A 3DDZX 4PGMA 4YO8A 2PQ0A 2E5FA 2Z0MA 3CZCA 3C8ZA 3QITA 4YMGA 3T1HB 2IZ1A 1JEYA 1G2OA 4BNIA 3OKPA 4NCHA 3WKAA 5CIWA 3CGGA 1HDEA 1Q21A 4OB7A 2VZLA 5TMEA 2GKGA 3DE1X 5F64A 4IJWA 3WA6A 1B2LA 4Q3NA 3UAWA 5BYKA 2D2IA 3CF2A 3VKUA 3VZDA 2GN6A 3EODA 3F6SA 3G5MA 3M5CA 3OTQA 2J4CA 1X1QA 4HZUB 2VO1A 4DMKA 2PO5A 4TS1A 5HE9A 1Q0ZA 1IJFA 2FPMA 3WLAA 5DYWA 3SDSA 2YNMD 2P9ZA 3IEXA 4BFLA 4YP7A 4HCJA 4L4UA 4CKCB 1ZMRA 2D0DA 3CKLA 3SEAA 2ZUCA 3HRKA 3MWDB 4ZI7B 2O8CA 3QG5A 4RTLA 4QYXA 2YJ3A 3FFBA 4UREA 5LU9A 1ABEA 5L53A 1MOSA 2JCYA 2JGKA 3LBFA 1EBBA 1KNQA 3AF2A 2VJYA 4BB0A 3ICCA 4OK6A 2B69A 1ZN9A 3GFQA 2HF8A 3P4UA 3A7EA 5ERGB 1N9GA 4BTEA 5A4MS 1FW8A 2ZJ1A 4MULA 1YZVA 1JQ5A 4OSEA 1VCNA 4DMFA 5JBQA 3NB0A 1LZKA 4Z4FA 1VLMA 3CNEA 5U1PA 4L78A 2EV9A 2WNSA 1LK7A 5KDDA 3EH1A 1JHXA 2RGNC 3C7KA 3K1AB 4HAIA 2ORYA 2QUJA 5FULA 5JS8A 4RF3A 1V7ZA 3SHFA 1XOIA 1Y8QB 2EJTA 1KVRA 4CIAA 2EQAA 4M1OA 2QM7A 1SXJA 3ORSA 4X3CA 3S2IA 4HDMB 4JYAB 2H63A 2BLLA 3TF5A 4WV3A 1A9OA 3ZJ4A 2JF0A 4LF4B 1YCHA 3ONWA 1NVBA 1UBRS 4LZPA 3HP4A 2JJ1D 1BCRB 1R0BA 2MYPA 3AF1A 1A9YA 2JI7A 3F4LA 2BL4A 5AVVA 4MLPA 2PANA 4DCGA 4QDZA 4MQ5A 4RJIA 5BQXA 1NJ6A 2A67A 2OCLA 1SU6A 3FUWA 1SVOA 1SEPA 3B70A 5JBIA 3U7QA 1CQIA 1PZNA 4MAFA 3KQTA 4QYMA 4IZOA 1P2BA 1GA1A 2GD6A 5C5IA 4FFBB 3FWPA 4N5DA 4BASA 7GPBA 4EYSA 2GNPA 3UXEA 5HUQA 1GTRA 4TTSA 1N2OA 3BRWD 3DLCA 3LTEA 3OQOA 3SJAA 1YASA 1ACLA 2JKZA 2HSGA 3ABOB 3O2QB 1Y6ZA 3OAAA 1ARZA 1ORWA 1YQDA 1ZA1A 3MK31 2O1XA 2XNJA 3IKLA 4MVJA 1Y1RA 2ISQA 2QX4A 2VYCA 4XPZA 3RRNA 1QRDA 3A4IA 1HLFA 1X7XB 3QPCA 4R8RA 5D5HA 5KCMA 1Q0QA 5LP1A 2JBAB 3FKSA 5EHQA 4CE6A 1N5DA 1XO1A 3TXAA 4UHKA 2Q0HA 3U0BA 4PYRA 2VF7A 1U3GA 3NOVA 3X1MA 3L8GA 2CV1A 1GUFA 2ZVPX 3O0TA 4O5OA 2HZBA 3OD5A 3Q7EA 2XOEA 4QBIA 2F1IA 2AEMA 2YXEA 3DOFA 1KBQA 3QLTA 4V39A 2CSXA 5LDHA 4K6OA 1GTVA 4N5IX 3T3OA 2OL4A 2QN1A 3EGOA 4LJYA 4TLDA 1E2PA 2VQ6A 3TZQA 2P4QA 4OXYA 4UEKA 4COOA 5IFKA 4PZPA 5K8IA 1O5OA 2A9KA 1MABB 4B6EA 5IJ9B 4GPTA 4HDRB 1Y5LA 3K9LA 3Q5DA 2C2XA 3EEBA 4GX1A 1RPAA 5K8CA 4U9UA 2BIFA 4NAHA 4AY4A 1RI4A 4DLNA 4F3NA 4LPKA 5CLLA 3II6X 2IWHA 1A2BA 2QA5A 1TQDA 4C4TA 4GE0A 6ADHA 1TU4A 4GOMD 4Q4LA 3C15C 1KI1A 4LISA 3EDRA 3FNBA 4BAUA 4J3NA 3W2GA 1SZJG 1YVEI 2XIQA 3S4YA 4BNWA 5JADA 4PGHA 4TRNA 3T34A 4LF6B 4OLBA 1UR5A 4C4PA 1IY9A 2FZ4A 2B9EA 3JYLA 1XP5A 1FSSA 2ODNA 2V7XA 2FPKA 3LFUA 2CVPA 5J2UA 3VR0A 4IQFA 2WV9A 2HJHA 4HUQA 4FCTA 1PUJA 1ZCFA 2IOHA 1JFTA 3WV4A 3QTTA 2E4ZA 3HCAA 1SWWA 1ULAA 2G1AA 1ULSA 5HKLA 4MV0A 2CLHB 4WN9B 2P75A 5ANRB 3ZOKA 2IOYA 3KV1A 1UDAA 4JJGA 3OF3A 2IYSA 2O0HA 4UDOA 1FDOA 3CUKA 4KH0A 1ZCBA 2FN9A 4Z4GA 3W6UA 2JVIA 4XWTA 5A5EA 1MVNA 5AI8A 3NEPX 4DC1A 1V35A 1H93A 1PD0A 1Z08A 2JDIA 3BDIA 2X23A 4BC1A 1EAYA 3DZJA 1T3SA 3OPQA 1NI5A 4ML3A