4KTTE

Structural insights of mat enzymes: mata2b complexed with sam
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
308
structure length
306
Chain Sequence
b'PNRRVLVTGATGLLGRAVHKEFQQNNWHAVGCGFRRARPKFEQVNLLDSNAVHHIIHDFQPHVIVHCAAERRPDVVENQPDAASQLNVDASGNLAKEAAAVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGEKAVLENNLGAAVLRIPILYGEVEKLEESAVTVMFDKVQFSNKSANMDHWQQRFPTHVKDVATVCRQLAEKRMLDPSIKGTFHWSGNEQMTKYEMACAIADAFNLPSSHLRPITDSPVLQRPRNAQLDCSKLETLGIGQRTPFRIGIKESLWPFLIDKRWRQTVFH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-adenosylmethionine synthase isoform type-2
publication title Structure and function study of the complex that synthesizes S-adenosylmethionine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 101
structure length 306
sequence length 308
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF04321 RmlD_sub_bind RmlD substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4kttE00
2FP4A 4CM4A 5I7FA 3KTDA 1A27A 3U9LA 2DFVA 3GRPA 3CZRA 3ETGA 5A02A 2O3JA 2GSDA 1NAIA 4FS3A 5ICSA 1ORRA 2Z1NA 4GX0A 2DVMA 3DBRB 1JWAB 1K2WA 3OEWA 3JQGB 1VI2A 3OQ1A 2HK9A 1Z6ZA 2Q2QA 3VTZA 3PGXA 4R1UA 3L9WA 4YVFA 1SB8A 3T4XA 3WLEA 4UUMA 4FR5A 4CM5A 4E2ZA 4J7CA 4EJ6A 4CR6A 3RBXA 1JKIA 4YAJA 5GZ6A 2J5KA 2ZTLA 3D4NA 1DRWA 4GLOA 1Y8RB 3DZGA 4CJXA 3AWDA 4U7WA 3HADA 1D1TA 2VUSA 2B35A 1PJBA 4OQYA 1CEQA 2EGGA 2YV1A 4OSPA 5A9SB 3WBFA 1EK5A 1XSEA 3ZV6A 3WX0A 1UP6A 2PZJA 3RUFA 2O4CA 1IE3A 1L7EA 1FDWA 2Q2VA 3Q6IA 1NR7A 3TPCA 2X4GA 1ZSVA 2I67A 3Q2IA 2C54A 4R01A 2XPCA 1P33A 1LRKA 3PIDA 4EUFA 3RSHA 3WSWA 3NT2A 3E6AA 4OL9A 5HTOA 1Y7TA 3PQFA 4WUVA 5JE8A 1O6ZA 1HZZA 3STHA 4NU5A 4GWGA 1T4DA 3G17A 4JBGA 4BNUA 3UFXA 3AM3A 4L4XA 4J4BA 2B4TO 1C1DB 3E48A 3K6JA 5EMHA 3UF0A 3U09A 3SX2A 4WASA 3HDQA 5DF1A 2VWGA 3GGOA 2NACA 4IUYA 3DAFA 4JX8A 4MVJA 5CDTA 4O59O 1XKQA 3OJFA 3JQ7B 1LLDA 3KM0A 4YTEA 4B4UA 4CMGA 5FFFA 4MIOA 3GAZA 4P22A 2VHYA 3ZWOA 4BMVA 4BQRA 3V5NA 2YYYA 5KTKA 3FI9A 4AJHA 1YQGA 1ZUD1 3KXDA 4XA8A 4X54A 1XLTA 1DHRA 3Q2KA 5BT9A 4NR0A 4D42A 2B69A 1PS9A 1R4NA 4XZ3A 3PGJA 1ADFA 2OORA 1Q7BA 5TJHA 4EGFA 1DLJA 2Y1CA 3DHYA 3DZFA 4WPGA 2GR9A 1I32A 2DM6A 2FR8A 3KLMX 1P0FA 5DDIP 5H82A 5I9NA 1LSSA 1WLYA 3WSVA 5JSFA 1RM5A 2P4HX 4IZIA 4W7HA 2Y67A 1ZMTA 1VM6A 3ZNNA 3VZRA 2HKIA 2HMTA 1IPEA 4QSMA 1GDHA 3IUPA 2J5RA 3KYDB 1R16A 2FMUA 3CZMA 3ZHYA 1B26A 1MB4A 4NFHA 3JQ8B 1EUZA 4BO8A 1TEHA 3DMTA 3E1KA 4RLSA 1HF3A 5COBA 5IXSA 1K5HA 2X86A 1E3JA 1PZGA 1LA2A 1PGNA 1YQXA 2DUUA 2NWQA 3VPGA 4YPOA 3BZUA 5I9LA 3K2BA 2ZIZA 2BFPA 5FF9A 5L7YA 2VQ3A 1DFHA 1Y5RA 4BB6A 5BSEA 2C5AA 2YFQA 1HSOA 2YV3A 1EFLA 3PIIA 1TT7A 2YJZA 2O3UA 2C7GA 2P91A 4NBVA 2X22A 3PDUA 3GNQA 4I1IA 1PZEA 2OBNA 1D4FA 4MPDA 1SMKA 4IGFA 4R41A 1A7KA 3WWYA 2W2LA 2X9VA 1GV0A 3E18A 4I5GA 3BHIA 3B70A 4AICA 2FPIA 1I2ZA 1YB5A 5MDHA 3I9JA 3HHPA 1B3BA 3JQDA 4N54A 1NWHA 2NQ8A 3P2OA 9LDBA 5A05A 1E3WA 2G76A 3QQPA 3R0IA 3SXPA 2X9GA 5JW6A 1E6EA 4J0FA 4CMAA 4TVBA 1Z7EA 3OFSA 2O2SA 4NHEA 4F6LA 5F1KA 3JQ6A 5CDUA 3X2FA 1E1NA 3GDGA 2BF7A 3GFGA 4MVJP 2PFGA 3H9JA 1ZK3A 4UEOA 2VRCA 4XQGA 1CRWG 4CUZA 5T5QA 1A4IA 3T4EA 4JROA 1EE2A 1LU9A 4LCJA 1KVTA 3JSAA 2JD2A 5CPBA 3VKUA 3AOEC 2V6BA 2D0IA 4CM7A 6ADHA 5TC4A 2QYSA 2GN6A 2PGLA 1GZ3A 3M2TA 1YB1A 2TMGA 3RC7A 3WICA 1UZLA 2X5KO 3PXXA 2D1YA 2JD0A 5IFLA 1X7HA 4XCVA 2X0NA 4N5LA 3V1UA 1T2CA 5IN4A 3PHLA 5KJFA 2HU2A 3L0DA 4JBIA 4B3JA 1KYQA 4U6SA 5CEEA 3PJDA 1ZW1A 5KCZA 4YAIA 1L1FA 3T7EA 1VJ0A 4M86A 3AM5A 3LC2O 2NVWA 4IS2A 1B15A 2JAPA 4YXFA 1PJLA 4FGWA 4IPTA 4MKXA 4B7UA 4KQWA 3JD1A 2EP7A 1K0UA 1KY4A 3DQPA 3V1YA 1R4MA 4E2XA 1E7QA 3RU9A 4PCVA 4ND4A 2GASA 4ZQGA 5C37A 3D3WA 4UREA 3PQEA 4J9UE 1HE3A 1YO6A 1C0PA 3GG9A 4Y9DA 3DZJA 3H9GA 1KVRA 1ZJZA 2W98A 3K96A 5DCYA 2Y05A 4YT2A 1ZSNA 2R00C 3K2EA 4ZN6A 4P38A 4HKTA 4BKQA 1GPJA 1LSJA 3EC7A 1T1SA 1NBOA 4BGUA 1UH5A 4XRRA 4Z0PA 3VZQA 4Z9XA 5JDCA 2X23A 2X5OA 3DR3A 3GVPA 3EGOA 2NSDA 5G4KA 3LC1O 4ND2A 3U5TA 2Q4BA 2Y93A 3TF5A 3M1LA 3MTJA 4JP2A 1PX0A 4UVEA 4E3ZA 1B2LA 2A9FA 1MC4A 1U5CA 3F9IA 3HDHA 2I65A 4L75A 2DAPA 3ZNOA 4RVDA 3H5RA 1DRVA 3QY9A 2VNAA 4BNYA 2DBVO 4FFRA 4AG3A 1U4SA 1JLLA 1M66A 3DC2A 5I8ZA 1U3UA 3PHIA 3FCOA 3LU1A 3LT4A 3NEPX 3QVTA 2Z5LA 4LMPA 1CERA 3KO8A 4H3VA 5GZ3A 3TZKA 5L53A 4L8VA 1UUFA 5EL0A 3ZWWA 3OETA 4B3IA 2Q3EA 2AXQA 2VYNA 3WYCA 3KHUA 4DIBA 3ABIA 3AI1A 3ZN2A 2QX7A 5JCJD 2H6EA 3U4DA 4CLXA 4EJMA 1M2WA 4FJ2A 4OM8A 3DFZA 1Y9EA 2CVZA 1PQPA 4XD2A 4ALLA 5TSDA 3WGQA 3HB5X 5BNFA 2WDZA 4QUKA 5G0SA 4CQLA 3DBHB 5ENDA 4RF3A 4EDFA 4YT8A 5K0ZA 3VPXA 2PKQP 4YJFA 4FC7A 4U0KA 4Z3DA 4YJDA 4EUHA 4ID9A 4K6FA 2AQIA 2E82A 3PYXA 1DJQA 1E5QA 4EITA 4M49A 4OGWA 4IDGA 3E5RA 4D7AA 1D7OA 2BFOA 3WIEA 1U3WA 4ZICA 1QORA 1PS0A 4PRLA 5EN4A 3ROQA 4DA9A 2DUWA 4ZA2A 2C07A 1EVZA 4OXNA 4BNHA 4C7KA 4FPXA 4HNGA 2EWMA 3BMCB 3GNSA 2UV8A 4S1VA 1Y8QB 3BTVA 3OJOA 3NDJA 2IODA 3GZNA 4G81A 3L4SO 1LDNA 5DP1A 1V6AA 1E0DA 1MG5A 1FJHA 2P5UA 1LLCA 3ZDFA 1E7RA 6LDHA 1QKIA 3WGTA 3ZWVA 5T8KC 1H94A 3OICA 4BNTA 2Y0DA 4Q3CA 1R6DA 3HJAA 2B5VA 4GBJA 4GH5A 4WK6A 5JO0A 3LVFO 1VKOA 1ZK0A 1WMAA 3OBBA 2I3AA 3IJRA 4DQUA 3L6DA 4MVJD 4WLNA 2IXAA 1NQOA 2G82A 4CLOA 3MEQA 1ULSA 1X15A 2QW8A 3H65A 5JS6A 1PJSA 1ONPA 4B4OA 1GQ2A 2PD4A 3OF2A 1OOEA 4DBZA 1HLPA 3OSUA 4CQMB 3CE6A 1HE5A 5T67A 3PVZA 4W6ZA 1A72A 1AUPA 5L95A 2OZPA 4WKGA 3PHHA 4IBOA 1O0SA 1WDKA 3X2EA 4AJNA 1MFPA 4BL5A 1JQBA 3CPSA 1I24A 3KSDO 4TZKA 3K5PA 3H3JA 1P31A 1DIBA 5HS6A 3ZWAA 1MG0A 1NAHA 4M1QA 3UAGA 1LDYA 1I3KA 3BMOB 3ZU4A 4E5YA 2FSVA 3GEGA 3FF4A 1GUYA 5EJ2A 1RYDA 3OIDA 1BHSA 4CM8A 3DZKA 3L6EA 5K9ZA 2JD1A 4LN1A 4UVGA 1EVYA 1GCUA 5DP2A 1IZ9A 1DB3A 4W7IA 3PDJA 4UUNA 3WJAA 1CYDA 4EYEA 3RKUA 2EW8A 2JFHA 1ISIA 3E8XA 2WYVA 3I6QA 3EAGA 1LDBA 1PJ2A 3JQ9C 5IDYA 1ZK2A 3I52A 2RCYA 2VN8A 1NTOA 1V8BA 3VPHA 1QRRA 3GMDA 4B4WA 3VKVA 5JYDA 3VDRA 5JY6A 5KJEA 3BXXA 3EVTA 3IUSA 4NMHA 2VYVD 4I5FA 4Z0HO 3BAZA 3AUSA 4LCEA 5A5FA 5F1PA 1YBVA 2IXBA 3GPIA 2EKQA 4B8WA 3Q0EA 1NFFA 3U0BA 3FHLA 1O89A 4Y6SA 1FDTA 4AJPA 3FR8A 5CEFA 3DMTC 3R3SA 1ZJYA 3KOUA 1XCBA 2PNFA 4YAGA 3CTMA 2JHFA 3U62A 1KC1A 2Y0CA 4RF4A 4TZTA 5JY1A 2ZJ1A 3KSZO 4Y6PA 2E49A 3ITDA 1MV8A 4AJEA 2PK3A 4R5MA 4HFJA 3DBLA 2GUGA 3V1TC 2V7PA 1HE4A 1BWSA 1CWUA 1VL8A 4RPKA 1IULA 4PZDA 1Q0HA 1QYWA 3B1JA 3H2ZA 3JQFA 3P19A 4WE3A 2CSUA 4RQUA 4ZD6A 3FBGA 4PLPA 1SPXA 4NJMA 2HLPA 1XU7A 4DLAA 2VUUA 3K30A 1YRLA 3HNPA 4RZIA 1XHLA 1AE1A 1NNUA 4WOJA 3WXBA 5HBRA 3PWSA 3MJSA 4L4RA 4PG5A 1ENPA 1D3AA 1KOLA 1Q2XA 3VVCA 5TNXA 5ICMA 2EKLA 4H7PA 3A9WA 4HBGA 4IJUA 5B1YA 3R1IA 3EK2A 3RKRA 5AQ1A 5CDGA 4BO9A 2OXIA 4MVJH 2XXBA 5A9TA 2O7SA 3UCXA 1VLLA 1E1LA 3BHMA 3PLRA 4HUJA 4XWYA 1U5AA 3GT0A 3WGIA 1Q0LA 1JVBA 1AHIA 3KYBA 3UW3A 4XJTA 4IXWA 1Y9AA 1E1KA 1EVJA 4AJKA 3FNHA 3I4CA 2G5CA 1ENYA 1HDYA 1HL3A 1SEVA 3AI2A 3PHGA 4LRTB 4Y67A 4OXKA 3I5MA 4CL8A 3NYWA 3LT0A 5BSHA 2E37A 4UVDA 4L76A 3NTRA 2G17A 3MOGA 3AFNA 2ZJ0A 3C7AA 3OMLA 4RPLA 3L6OO 3WJ7A 5A06A 1HDRA 3EYWA 3FBTA 4CODB 5TLSA 4J1NA 1GQQA 1LXCA 2DQ4A 2AMFA 3JQEA 5ES3A 1E7MA 2ZB7A 3LZ6A 1UAYA 1YB4A 2VOJA 4R69A 5G0VA 5T57A 2VWQA 4HNHA 4LVCA 4RGBA 3WGGA 3Q11A 5EQFA 4BMNA 5KVCA 1D8AA 3D7LA 3BMQA 2C5EA 3I83A 1K6XA 4BNKA 3PJEA 8LDHA 3JYNA 5IXYA 4KUGA 5HRUA 2QHXA 4ALMA 2VWPA 2O3QA 1A4UA 1ML3A 3AY6A 1WNTA 3H6KA 1B8VA 3PK0A 3GQVA 3SJUA 1BGVA 4IJVA 4XR4A 3A14A 4E2WA 1YOVA 3VPFA 3VZPA 1OC4A 1DJNA 4OO3A 4PRKA 4E5KA 4L9RA 4HFNA 5KKAA 4G65A 1XU9A 1BW9A 2PGDA 3HDJA 3ZI0A 2RH4A 2WE7A 2W2KA 2VHWA 1E5LA 3QA9A 4URFA 2E4AA 4CMKA 5EINA 5A4DA 1DAPA 4IMRA 4TKLA 1ZK1A 3DOCA 2BRUA 4GL4A 2YY7A 4LVUA 3TZQA 2I9PA 4R9RA 4WNCA 2WD8A 1X1EA 1WXDA 1X0VA 4DPMA 4DIOA 4CM1A 3B1KA 3OECA 4TMFA 5KOIA 1NR1A 4J2OA 5COAA 2CVOA 2A92A 1KBZA 4MVJE 1YDWA 5JAZA 4G5HA 3RJ9A 2ZK7A 2NV6A 2J3KA 1ZSYA 3CH6A 3KYCA 1BXKA 5U4QA 4CLRA 1ISFA 4YRDA 4XYBA 4CLHA 3JQBA 3V8BA 3IP3A 3L4BC 3RBVA 4E13A 3I23A 3C1OA 3JYPA 5J23A 3Q3CA 2VYND 3LK7A 3BMNA 2WMDA 3CXRA 3R6DA 1H9AA 3HUDA 1YGYA 5JCXA 4FIZA 3AU8A 1YQDA 4PIVA 1KVUA 1SOWA 4B7XA 1MA0A 3PQDA 2EW2A 3WDSA 3KSUA 3TL3A 2CF5A 5JNLA 4DLBA 5EESA 4J4TA 4WEOA 1N8KA 2YQ4A 4K1LA 3A4VA 4Y6RA 4A10A 3EW7A 4FOOA 3ZWYA 1J5PA 4K9DA 4RPHA 1LSOA 3ZWNA 2VT2A 4LRSB 3O9ZA 4Q3NA 4RLHA 3K9QO 4ND3A 3H5AA 1M6WA 4OSOA 2WD7A 4FB5A 3E5MA 1C1XB 5FI5A 1NHGA 1XWFA 1VPDA 2BELA 2C0CA 3GRKA 4FFOA 1F17A 3DONA 4TVOA 2OP1A 4HX5A 1PL6A 4D3DA 3N58A 1GFSA 4BO3A 2BGLA 3D64A 4DIFA 5T64A 4ZQBA 4MVJF 5IG2A 2HMWA 4BHTA 4GMGA 3Q9UA 1H2BA 4JBHA 4EI2A 2OBYA 4CMBA 1Y5MA 2O23A 3LLSA 3C1AA 1DFGA 5I7EA 2FWMX 3GNTA 4I9UA 2G1UA 1Z74A 3V2HA 3KETA 4BVAA 4BGIA 3TOXA 3OA2A 1R66A 1QMGA 2FZEA 1K6JA 4Q3EA 2J3IA 2GCGA 3NT5A 4E31A 3DHNA 4IDBA 4BKRA 3RUIA 4K6CA 1GYRA 1U1IA 5ENVA 4W4TA 4XB2A 4DL9A 1Q0QA 1VJTA 3M6IA 4NG5A 5KIAA 3DL2A 3TSCA 2NU9A 3CMCO 3F6YA 5L7TA 3A1NA 3ULKA 3HFSA 3WFJA 5IDQA 2I3GA 4BKUA 3C8MA 1OAAA 3NGLA 4YACA 2Z95A 3UCFA 1S7CA 2EJWA 2YW9A 3QWAA 4UVHA 2AEMA 4YT5A 1UR5A 4BNWA 4U8GA 1ARZA 3A06A 2Q1SA 3JYLA 2C20A 1MX3A 4J6FA 2B5WA 3TRIA 2JFGA 2HMSA 1OMOA 2A94A 2NVUA 2D4AA 3N74A 3ST7A 4CLOB 1EQUA 5IZCC 5JLAA 2DBQA 4DMLA 1M76A 3I1JA 4IDFA 4DXHA 4GVXA 2E6UX 4WLVA 1DFIA 1B0AA 3DWFA 4YJHB 4PLTA 1I0ZA 2GDZA 4MINA 5AVOA 3SEFA 1AXEA 4RF2A 3PYLA 3AY3A 4YB8A 4P4GA 1DDOA 1XYGA 1BXZA 2V65A 3FNFA 4YDRA 1C0IA 1XG5A 1PWZA 4BO4A 1B3RA 3H7AA 4PLFA 2PY6A 2ZQYA 2IZZA 2FSSA 3TZCA 4GX5A 1J4AA 3F3SA 3D0OA 1T4BA 1X0XA 4MP6A 1H6BA 1CJCA 1QYVA 4E33A 3VDQA 3M2PA 4KOAA 5L45A 3FD8A 3JD0A 3LSYA 5IN5A 4I8XA 3G3EA 4PG8A 2EF1A 3UCEA 2QZ9A 1AN9A 2UAGA 4GGPA 4FFMA 3OQ6A 1JN0A 4IGEA 1F0YA 5JDIC 5TIIA 1RM0A 3BTOA 3HDYA 4WCFA 4A0SA 1MFZA 2GZ1A 3QWHA 5MGBA 3HN2A 5F21A 1A9ZA 1BXGA 3RUAA 4CMIB 3F5SA 5DBGA 5AOVA 1LRLA 2AQKA 4MP3A 5G0UA 3SC6A 1C3VA 2O3SA 4K26A 2OP0A 1IOLA 2OO5A 3UICA 2H1SA 3F4LA 1Z45A 1EZ4A 1FDVA 1XIVA 4YR9A 3U49A 1EE9A 3E9NA 2WWRA 4XGKA 4W9NC 5CP8A 1PR9A 3DEYX 1W0CA 4GWKA 2EGHA 3QSGA 3GUCA 3ICPA 4JP3A 3EUWA 2RAFA 2VT3A 1YS4A 1ZFNA 1N9GA 4YJGB 4YRAA 1O5IA 4J7UA 1DLIA 3MJTA 1U2GA 3D5TA 3F47A 1HDOA 1P0CA 1GADO 4YEDA 1EQ2A 3JQAA 1PTJA 4CM9A 3WQSB 4KUHA 3RUEA 3WQQA 2NM0A 2P9CA 3CEAA 1PZFA 4M55A 4QO8A 5EPOA 5IAAA 1PWXA 2I5PO 2ZQZA 3IJPA 3MCVA 3SVTA 2RHRA 4MOWA 1MGOA 2J3JA 4OKNA 4LGVA 4KDFA 2HO5A 4BNIA 2QQ5A 5KNLA 1MUUA 1EBUA 1TXGA 2BGKA 3I9MA 3DDNA 5K6AC 2IYOA 4IZHA 3LLVA 3MWDB 3K31A 5TJ9A 4ZQHA 2Y99A 2X0RA 5ADHA 4BNVA 4R1SA 4IM7A 4DQVA 4E12A 3ITKA 4YRBA 5A3JA 2GGSA 2DTDA 2DBZA 4JK3A 4QFCA 2A35A 5ILGA 3NDIA 4CUKA 3IOYA 1GD1O 2HK7A 2YHIB 1H6DA 3NT4A 1HSZA 1G0OA 1Q7CA 2FR1A 3HQ4O 4JQCA 4JCOA 3I9OA 3DOOA 2EV9A 2JKVA 1GUFA 2BD0A 5A1TA 1HDCA 3WLFA 1U9JA 1BVRA 5IJZA 3D1LA 3BYZA 5JAIA 3GC6A 2Y1EA 4NPCA 2O2YA 1DBVO 5BNIA 1J6UA 1ZKMA 1WWKA 5U1PA 4R51A 3ZW9A 1PJQA 5FYDA 1PS8A 2GYYA 3VPSA 1QP8A 1RM3A 4JIGA 1VRWA 2HK8A 1EK6A 4HP8A 7ADHA 3FR7A 1XEAA 4FJ0A 4YAKA 3I9KA 4L73A 3GH3A 3VAZA 2VTEA 3DBRA 4TRRA 1JTVA 4CV2A 3JQGA 1IB6A 1NVTA 3ZHZA 2P9EA 5LDGA 4L0QA 3D3EA 3WBBA 4M87A 1A9YA 3OHSX 1ADCA 2Y1OA 2NU7A 2O50A 3OQBA 2R6JA 1UXKA 5HWSA 3LC7O 4RVFA 4Z9YA 2FY8A 3W1VA 4E0BA 5U9CA 1M6HA 1OI7A 3E9MA 3ZGYA 4IQ0A 2JL1A 3MWEB 4ZQFA 4YQZA 1Y8RA 4DYDA 3DTYA 1UXJA 1PL8A 1PQWA 1QLJA 4KUEA 5IDXA 3GAFA 3LT1A 2DT5A 4KTTE 2R2GA 2PWZA 4L4SA 1FXSA 4FFLA 4AJ2A 4DC1A 1V3UA 5A9SA 3WYEA 3OIGA 2DLDA 3ADPA 4R3WA 1DOHA 3GA0A 4E30A 1JWBB 7MDHA 3RWBA 3KEQA 4HY3A 2JAHA 3NJ4A 1MXFA 3LF2A 1I10A 1R12A 2HCTA 1KETA 1ADGA 3S2GA 4BOYA 1VC2A 3FPLA 1F8GA 2I76A 3HSKA 2BFMA 3QVSA 4NNJA 2NQTA 2QZZA 1V0JA 1DIAA 3UVEA 1GYQA 3NAQA 2GNAA 1F8FA 2GN8A 2XF8A 3O8QB 2H63A 2Q45A 1VKNA 2Y1DA 4BNXA 1JW9B 3BHJA 3OA0A 3ZU5A 2Y66A 3JCZA 1HETA 5CDSA 4AL4A 1TT5B 3H4VA 3OIFA 3EDMA 1C1DA 4IS3A 4CM4B 3WOHA 5DNAA 2CY0A 3JQBC 1DIHA 2UUPA 3BA1A 4UEJA 1KVSA 3RFXA 1VSUA 3F1LA 1F14A 2Q1TA 3DHEA 3INGA 4NU6A 2C82A 5I7SA 3AI3A 1F12A 3NRCA 1H93A 3ZU3A 3CSDA 1SO8A 1I36A 4E21A 5KVQA 2B4QA 3VTFA 4LISA 1G1AA 4RQTA 3JQ7A 4WEQA 1LI4A 5L51A 1NYTA 2EKPA 1ENZA 1ISGA 3TJRA 3VOSA 3ZHBA 3GDFA 4QQRA 3RU7A 4HWKA 3FSRA 3JYOA 4ITUA 1P74A 3N7UA 3HZZA 1RYEA 5G0WA 4J1TA 1N7GA 1RKXA 2Z1MA 4RZHA 3RCBA 4CM3A 4PLWA 5KVSA 3I9LA 1WDMA 3S55A 3AUAA 3PEFA 2ILTA 2YFHA 3NKLA 4ND5A 2PLAA 3IKTA 2AA3A 2AQ8A 1E92A 5KWEA 1U8XX 1XR3A 1YJQA 4KZPA 5I8WA 1SCUA 1DC4A 3C7CB 5IZ4A 5JXWA 1IHXA 2ZYGA 3QV1A 4D46A 4GAEA 5H83A 5CFZA 4NK4A 1TLTA 4ILKA 2X5JO 2X58A 1MP0A 4FC6A 4CMJA 1V3VA 5ER9A 4PLZA 2EHDA 3UHAA 1KIFA 4Z3KA 2TMDA 3GVIA 1CQIA 3KYDA 1W4ZA 2PA3A 3ZHXA 2WD7B 2JCXA 3TFOA 3RUDA 4CMEA 3JQ8A 4IQ8A 2Y68A 4GPD1 5BR7A 3ANMA 2H9IA 4AJ1A 2B83A 3EMKA 3ETEA 2ZCVA 2VUTA 4D0RA 3CINA 2A4KA 4DWVA 1SEPA 1MC5A 4R1NA 4NFYA 1T2DA 5KJ6A 4ZQEA 1ZH8A 4XGIA 1OBFO 1SOVA 1DIGA 2B36A 2J3HA 4HFMA 2PH5A 5GMOA 1CIVA 1NQTA 4TROA 4BIIA 3WQRA 3RFTA 3UN1A 4B4VA 3QVWA 1QYDA 4J1QA 3UGKA 4GI2A 4O1MA 1QV6A 3B6ZA 4IY1A 1FMCA 3HWRA 3DBVO 4IDDA 4PVDA 2O3TA 4LMRA 1NVMB 2CMDA 3D5QA 4FQ8A 2J5QA 3JYQA 2O7QA 2PZKA 2P5YA 1DO8A 1UP7A 3C1TA 1KVQA 4D45A 1E3LA 3EZYA 1N1GA 2FR0A 2OOSA 4I5EA 1JU9A 1O95A 3ONFA 2ZATA 4R68A 4GMFA 2NTVA 1HYGA 4O5OA 5I9MA 1R4NB 1NPTO 1TI7A 4ROSA 1Y6JA 2NVBA 3W8EA 4XQEA 3GEMA 4FOSA 4ZVVA 4YQYA 4CV0A 4EJ0A 3RI3A 3O26A 3RBZA 4BO1A 3I4FA 2BGMA 3W6UA 5LDHA 1P3DA 3E82A 2AE2A 4YT4A 1ENOA 1EDOA 1D1SA 1NASA 2Y1FA 5JYEA 1Y1PA 1P1FA 1ZXLA 3G1TA 5JMWA 1EUDA 1RPNA 1X7DA 4QEDA 4GSKA 3NV9A 1IUKA 4N5MA 1JKJA 2W2LD 5HA5A 1HEUA 2PZMA 1E1MA 4BNJA 5TF4A 1NPDA 4P4NA 3UXYA 3FNEA 3ROMA 5C5IA 4J4HA 4FFPA 5TRTA 3COSA 2YZ7A 4AJ4A 3S1LA 1G0NA 4RV9A 3AOGA 1YXMA 1YL6A 2ZB4A 4OYRA 4EZBA 1KY5A 1Q1NA 1YKFA 2X7HA 4KQXA 1YWGO 3MZ0A 4DPLA 4R16A 1BRMA 1K3TA 3AOEA 4KDEA 4UVIA 4QXMA 1EUCA 1E77A 3OH8A 4TRNA 5DCUA 2BI7A 4G2NA 2HUNA 2VRCD 4TSKA 1ZBQA 3GVCA 5B4TA 2HAEA 4W99A 4JN6B 4IJWA 4D3FA 4RCVA 1DRUA 4I08A 3PJFA 3RC1A 2CDBA 1KEPA 3QWIA 2OMEA 2Q1UA 5BNTA 4S3MA 2VTDA 4MIEA 1U7HA 4IXTA 2Q46A 5FI3A 3ZH2A 4OKIA 1QYXA 4B8ZA 4ESOA 4OHUA 1VSVA 3SBOA 5B4VA 1M75A 4JNKA 4BMSA 4BO7A 4L74A 1OFGA 3JQAD 3RROA 3RUHA 4A03A 1NXQA 2O4UX 4MP8A 2GD1O 1CDOA 5CHEA 2HJSA 4Q9NA 4FSHA 5L4LA 4BO6A 3PLNA 4E5NA 1E3WB 1E7WA 3ORFA 4EUEA 4FCCA 2P2SA 1GQYA 3FNGA 3GDOA 4FBGA 5G0TA 3IL2A 3LF1A 2VNSA 2I6TA 1LX6A 2PTGA 4PG4A 1KC3A 4ZU3A 5JAMA 2H5LA 4N5NA 1P45A 4PG7A 2PR2A 1KEVA 3K8ZA 1N1EA 1PIWA 2AEFA 2HRBA 1DPGA 3PHJA 4YBZA 5DZSA 2VHXA 4B3HA 2AE1A 3ENNA 1SBYA 2AEJA 4KWIA 2YQ5A 3U3XA 2AQHA 4PN3A 2HSDA 4A5OA 3RVDA 1U3TA 2WE8A 5COQA 2CDAA 3QW2A 5A9RA 4RORA 5KKCA 4Z9FA 4RVUA 5EIOA 4ZRNA 5DN9A 1BDMA 1ZXBA 2PV7A 3JQAB 2X0IA 3WNVA 4FDAA 3H2SA 2NUAA 3L07A 2NLOA 1LQTA 2ZYAA 2RIRA 2VCYA 5DBIA 1B16A 3WFIA 3GGPA 3NTOA 4RVGA 1DEHA 2VZ9A 1C0LA 1GL3A 4P4LA 4NI5A 1N5DA 4M8SA 1I8TA 2GPTA 2VRBA 1Q7GA 2IYPA 1ZEMA 3O4RA 1I33A 4XIJA 1T26A 1W73A 5THQA 3TNLA 2W4QA 4ALIA 4MVJG 4BO0A 3RJ5A 3AFMA 1OZAA 3KEOA 3PTZA 3QIVA 4M54A 2C7VA 3GMSA 5GY7A 3SC4A 3ZWBA 3ZU2A 3DAPA 3F46A 4R1TA 3NTQA 4D0SA 5GZ1A 3DZHA 1PGJA 4O0LA 4CLDA 1GCOA 1R4MB 2HDHA 4JLWA 3RQSA 3TQHA 1YL7A 3VH3A 5L7WA 3GPDG 4BS9A 1P9LA 3D3WB 4ALKA 2X8LA 2Q2WA 4CUJA 3QJ5A 5JDCC 3DXFA 3L77A 3RAJA 3OP4A 3DBHA 4GX1A 5TX7A 2GZ3A 4QECA 1C14A 3RIHA 4UAGA 3S8MA 1Z7BA 2CFCA 2XXJA 4XJSA 3RASA 4AJIA 3DZIA 3FTNA 2O48X 5HS4A 4KMSA 3TOZA 1ONNA 4UULA 4A73A 3AUTA 4EW6A 3UOGA 4PLVA 1I3NA 4AFNA 4B79A 4FD3A 5G4KB 1ADBA 1B14A 1UXGA 1HYEA 4MO2A 2XOXA 4BB5A 1W8DA 4YYZA 3UH1A 1XA0A 1P1RA 3BMCA 5JO9A 4OOFA 5JCJA 4CM6A 1Y8QA 2FN7A 2LDXA 2YDYA 1H9BA 4I9HA 1VE9A 4FGSA 3FTPA 2G0TA 2UVDA 4XYLA 1ID1A 3KRTA 4GSLA 1WPQA 5EQDA 3LDHA 3WMXA 2GN4A 4W82A 4CL3A 4XYMA 1N92A 3OM9A 2QRKA 5DCWA 2EEZA 2WEKA 1UP4A 3PWZA 4XIYA 4I5DA 4LSWA 3TZ6A 1XQ1A 5B4UA 2D3TA 4KP7A 2AG5A 1J49A 4GLLA 1ZNQO 4FFNA 1QV7A 3ZWXA 4MVJM 4J43A 4MKRA 3GVXA 1TA4A 1E6WA 1U4OA 1DC6A 4GX2A 5T8KA 3TDKA 1PU2A 2PZLA 4NQZA 5H81A 1IPFA 4J0EA 4YA6A 3MJVA 3U4CA 3CMMA 4AJOA 1B8UA 3QVOA 1N7HA 1IHYA 4WNIA 2C2YA 3ROKA 1T25A 4WLOA 3AUUA 2J6IA 2GZ2A 1FK8A 1I3MA 4CQMA 4CQLB 4WLFA 1MXHA 3T7CA 4CV1A 5CG2A 2NU6A 4J49A 4U6QA 1E7YA 2Y1GA 1H2HA 4YJFB 2F1KA 3TN7A 3H3FA 5A03A 4WLUA 4D43A 1LDGA 4DLLA 1UDCA 3ONEA 2HRZA 4BNGA 5TGDA 3AK4A 3VHRA 4ONEA 3GK3A 9LDTA 3NGXA 3DOJA 3A28A 3BMOA 5F3RA 5L4NA 3WTCA 3D4PA 1P1IA 1RM4A 3INTA 1IY8A 1ZIDA 3JD2A 1H6CA 2UDPA 1QLHA 1R0KA 1PQUA 3LT2A 1I5RA 3ICCA 3GR6A 4J9VA 3F5QA 3G79A 2ZTVA 4BNLA 2BLLA 1GYPA 3U4HA 1YH3A 4BUCA 3GZNB 3PPIA 3DO5A 2Q1WA 4OMUA 5CG1A 3KLPX 5F5LA 1LC3A 1A71A 3CUKA 1WVGA 3ASVA 1HT0A 1NFQA 1LLQA 3IMFA 1H6AA 5DBFA 4F46A 3ZNPA 4PGFA 3PRJA 2DU8A 4XQ9A 1RWBA 2EG9A 2YUTA 4QTZA 1PJ3A 3ONDA 3ZNQA 3BTUA 5JPIA 3H9EO 2X1HA 2NU8A 2NTNA 3JQ9A 2CD9A 5B12A 3KV3O 4CMEC 2WYUA 4KTVE 1KERA 4NBRA 1LBEA 3QP9A 3W8FA 3TWOA 1PSDA 1P1HA 2GLXA 5AXDA 2CZCA 4R3NA 1T24A 3H9UA 5AXAA 2OFPA 1GEGA 4O6VA 4MJLA 1I2BA 4MIYA 1IZ0A 2VZ0A 2Q99A 1SB9A 4J90A 3SLGA 3Q9NA 3C24A 1HKUA 1PJCA 2XAAA 4JJFA 3GUYA 2NADA 3BTSA 4XYGA 1WZIA 1GEEA 1KS9A 4DMMA 1GZ4A 1DSSG 4D79A 2VYVA 2VWHA 3C7DB 1BG6A 3DMYA 2SCUA 4MVJI 1QYCA 3GZ4A 4CM8B 1H5QA 4NDNE 5DT9A 4WCDA 5G4LA 3S2EA 4CR8A 4PLHA 3W4IA 3ZZNA 4BNFA 1HXHA 4H16A 1A5ZA 2JCYA 4YCAA 3O03A 1ISJA 1IYZA 4RO0A 1VL0A 1PZHA 1WAMA 2FOIA 2JJYA 3NX4A 1NP3A 1YE3A 1O8CA 1ULUA 4R4JA 3ZCXA 4BNZA 3W4KA 2VHZA 3HFGA 2WYWA 3G1UA 4OIMA 4OAQA 1XELA 3PJGA 5DOZA 5G2OA 2D2IA 4RVHA 1X7GA 2WM3A 4OOEA 1GR0A 4EEXA 1T1RA 4IQGA 3H5NA 3PFWO 3QLJA 5THKA 3PFFA 3BIOA 4IIUA 4II2A 5T6BA 1K89A 4LK3A 1PGQA 3GLQA 3GGGA 1GTMA 4WOKA 4UEKA 4J7XA 4TWRA 5AXBA 3MJ4A 3I6IA 2B0JA 4YWJA 2QRLA 1CQJA 3WGYA 3FWNA 3NDRA 5A5EA 3W6ZA 3WR5A 1LQUA 3JQFC 4Q3BA 1UZMA 3DBLB 3QRWA 2ZB8A 2HQ1A 3JTMA 1O9BA 1HDZA 4FN4A 4C7JA 3OJ0A 4CPDA 3INRA 4BNNA 3RUCA 1PGPA 4NH4A 2WJPA 2P4QA 4BGVA 4K28A 3ZV3A 4QT0A 1GY8A 2RH8A 3AY7A 4PG6A 4J91A 2EIHA 2POQX 4NJMB 4WGGA 1HTBA 2NNLD 1EFKA 2Y0EA 4HADA 4JJGA 3JD4A 3JV7A 4F6CA 1BTOA 2X6TA 1RJWA 1PR3A 1DXYA 3KBOA 8ADHA 3AJRA 4WJZA 3FPCA 2ZTUA 4JXKA 3GF4A 3H9QA 5B37A 3OEYA 3ZW8A 4BO2A 1UJMA 4IJKA 4CLEA 4ALNA 4LSMA 3DTTA 3WGOA 1P1JA 4N7RA 1Z73A 1JAYA 1DHTA 2CNBA 2PKQO 2AW5A 1IL0A 4QFDA 3EZLA 1DIRA 4MKZA 3ZWMA 1U2DA 4A27A 1YBAA 3PZBA 5L9AA 2Q4EA 4Y8VA 1SNYA 5L40A 2QYTA 4A2CA 1JAXA 4AJLA 2C29D 4E2YA 5CAEA 3IQDB 4RPGA 4WECA 5BSGA 1LRJA 1HZJA 2DKNA 1KEWA 1XDWA 2IZ1A 2JFFA 4E6PA 1JKFA 4C4OA 4GKVA 1WW8A 2BFAA 4IDAA 3ROPA 5CPFA 4DYVA 1LC0A 3RFVA 5TT0A 3BMQB 2V6GA 3HE3A 3L4BA 3DFUA 3V2GA 3VH1A 3GHYA 4E5MA 2JHGA 1NFRA 3LYLA 4Y98A 2C59A 4PVCA 1CF2O 4Q39A 4N18A 4GVLA 4U0JA 3KB6A 2DFDA 3M1AA 3GEDA 3QVXA 1YBMA 2P9GA 1ZO8A 2WSBA 1V35A 3K92A 3NJ8A 5DULA 1YOVB 1FDSA 4D3SA 1LEHA 4OXYA 3DAGA 1BW9B 2VZ8A 4XDYA 1C1XA 3WGHA 1LUAA 2W2KB 4U5QA 2W8ZA 3ZV4A 4RJTA 1J0XO 1NM5A 3MJEA 3W8DA 2YV2A 4NIMA 2DPHA 3TZHA 1N2SA 3WWZA 4F3YA 1I30A 4A7PA 5FEUA 4DC0A 5JAQA 3P2YA 4RL6A 1I01A 3SLKA 2I66A 2DTXA 3ETDA 3EVNA 2ZYDA 3PP8A 1X1TA 1PEDA 2I99A 1LJ8A 3GOHA 3P5SA 2PKRA 4EBFA 1U3VA 2ET6A 3ADOA 4GKBA 1P1KA 1OC2A 3HB4X 1EDZA 3WMWA 3KYCB 3I9NA 2D59A 2IEBA 2E48A 4OH1A 3RD5A 4CLRB 2PGJA 3K73O 4DBVO 3I3OA 2D5CA 4GGOA 2VHVA 4AJJA 3IP1A 3CIFA 1ZVMA 4B7CA 2GF2A 3BMNB 3G0OA 4ZGWA 1VJ1A 3VC7A 5KVVA 2CVQA 4XR9A 4M89A 4J16A 4XQCA 2RHCA 3MJCA 1T2AA 5F5NA 3QWFA 3GVHA 3WG9A 1M67A 4BNMA 1PL7A 4EEZA 4J1SA 4CQMD 1H0KA 1GV1A 2OHXA 3HG7A 4D44A 4IDCA 2RBEA 1ISMA 3G49A 1B7GO 3L9XA 1P77A 1WMBA 3VH4A 4CR7A 1JVSA 1BDBA 4Q3DA 1C0KA 2B37A 3GG2A 4XGNA 4PZCA 5HM8A 2D5AA 4R5HA 2NTJA 2IRWA 1EMDA 5LC1A 3AU9A 4FW8A 4ALJA 1UXHA 1NVGA 1R15A 2FRDA 4WLEA 3IS3A 5ILOA 2FZWA 2EXXA 2IZ0A 1LTHR 3JQCA 4R9SA 4O63O 4DRYA 3KVOA 1SAYA 4XDZA 2DBRA 5BSFA 5KJCA 3AM4A 1QSGA 5TS3A 2GN9A 4RDHA 5C7OO 3D4OA 3VVBA 1ZEJA 4BGEA 4E5PA 1EEHA 1XQ6A 1NQAO 3FRJA 1ZCJA 2BI8A 3GN2A 4XRGA 2QRJA 1R0LA 2IEDA 4TKMA 4YJHA 2AG8A 1UAGA 4D41A 1HDGO 1E6UA 3CKYA 2DTEA 1E3IA 2V6MA 4NFSA 3WGZA 3QWBA 4CMCA 5JFOA 3C3XA 1DC3A 4J2HA 1LLUA 1G6KA 5IZCA 3VZSA 4Z0TA 4PLCA 3B20A 3R3JA 4I9NA 2Q49A 3WIDA 4DQXA 4F45A 1U28A 4IDEA 4ZRMA 1B8PA 5A04A 1CETA 4BV8A 4DGSA 1BSVA 1FDUA 1X14A 3GHHA 4DREA 4XX0A 4Z6KA 1DC5A 1TVEA 2GO1A 3H8VA 1T2FA 2UYYA 4JJIA 4LW8A 2BH9A 5AYVA 1HDXA 3U4IA 5JMPA 1R0SA 5KJ1A 1YL5A 4XEHA 1NQ5A 5ITVA 2BHLA 3GFBA 1FF9A 4NJOA 1S6YA 1QXSA 3WNQA 4CMIA 3S2IA 2UUOA 4UUPA 4BQPA 2ZB3A 1ISHA 2QG4A 4TQGA 4ZHSA 1Z75A 2PH3A 2HJRA 4RPJA 1JA9A 5JDIA 4HXYA 4IIVA 1AHHA 3HN7A 4BO5A 4HV4A 5EERA 5L3ZA 3LQFA 2V6FA 1EBFA 2D8AA 2IE0A 1GZ6A 3F4BA 1I3LA 1WZEA 2OUIA 3ASUA 1P44A 4TRJA 1Y81A 1YONA 1TB4A 2X0JA 2LDBA 4NBTA 3WS7A 4OJNA 4DPKA 1BVUA 4YJGA 2NVUB 3DZBA 3RC2A 3PWKA 4NZ9A 3E03A 1X13A 4XYEA 4CV3A 1SZJG 3IDSA 1ZK4A 1VL6A 1WDLA 1UXIA 4W9NA 4ND1A 2YHUA 4KWHA 3TL2A 1L7DA 2DC1A 1XGKA 5CEJA 4DTIA 2O3RA 3OJLA 4E32A 5JC1A 1NPYA 3WTBA 3IC5A 2F00A 4PZEA 5I7VA 2AHRA 3UUWA 5JBIA 1AXGA 5IDWA 2WTBA 4YAEA 3FN4A 2GRAA 3OJEA 3C85A 1MLDA 1BMDA 1V9LA 1NHWA 2ZTMA 3MTGA 4A26A 5C3MA 5FWNA 5L4SA 4WCFC 5CDYA 1E7SA 4H15A 4INAA 3PYMA 4R54A 5DOVA 4NK5A 4AVYA 1HLDA 3UKOA 1LSUA 2YDXA 3DB2A 4OQZA 3ZWPA 5ER6A 2CF6A 5K6AA 5A3VA 2YHIA 4BV9A 4CM9D 2ZKLA 1YDEA 3P7MA 4NBWA 3PI7A 2FPPA 4WCFB 1O94A 2EJVA 3IAHA 3IIEA 4QX6A 4IMPA 5F1OA 1UDAA 3ANNA 4PLGA 4XKJA 3WB9A 1BXGB 4FJ1A 1EVIA 4MDHA 1W6UA 4QO7A 1UZNA 4UUOA 2W90A 1ONOA 1A7AA 2FHSA 2B4RO 3GY0A 1R37A 3EHEA 3EY4A 5AXCA 2BKAA 2OGUA 4Q3AA 1JDJA 2BMAA 3F1KA 4JGBA 1SC6A 2ZCUA 4ZJUA 1E3EA 1UDBA 3Q1LA 1NX6A 2CDCA 1HE2A 3IKVA 1YJ8A 1V3TA 3B1FA 3ZWCA 3ZV5A 1N9GB 4DUPA 2R00A 4II3A 3FWZA 1F06A 1K6IA 1AGNA 1DAOA 1T2EA 2GERA 1GPDG 5TQVA 3PZRA 1ZZEA 3JD3A 3S2FA 5ITWA 1U7TA 3VH2A 1GUZA 2EERA 4HFRA 5BQFA 1HYHA 3SJ7A 4BKOA 3TFQA 1QG6A 4GQAA 1QR6A 1PJTA 2DPGA 4PFJA 4TRMA 1I2CA 4P8RA 3KZVA 3AW9A 2FPGA 1ZMOA 3QHAA 4CMHA 1WP4A 1YVEI 4DVJA 5JC8A 3GN1A 2PD6A 3V2UA 4PLYA 1LNQA 3E9QA 3KUXA 1GAEO 4RF5A 1Z82A 3RC9A 4BKPA 1KEUA 1LDEA 1HWYA 1NWCA 2X9NA 4E4YA 2Q50A 4J3FA 1U8FO 1PGOA 2QIOA 3ENKA 4XB1A 2JCVA 3O38A 4RDIA 2HMUA 2IDZA 3NUGA 5LCXA 2VOEA 3QE3A 2EP5A 4RVSA 1E3SA 1GU7A 5TT1A 2J8ZA 4IINA 5C7LO 2CUKA 5C7IO 5IF3A 2HMVA 1PJ4A 1LDMA 2PD3A 3O8QA 3W4JA 3MOIA 2OL4A 4NBUA 3ANLA 1TT5A 3WYBA 3ON5A 2C2XA 2P68A 1HRDA
chains in the Genus database with same CATH superfamily
5GM1A 3JWJA 4XAQA 1XVLA 3F0TA 4N0EA 4KR3A 5ANRB 4RIFA 2HI0A 5GGXA 3CZRA 3ETGA 4C14A 1KGDA 2GSDA 1GL6A 5LMUB 4FS3A 1VPEA 1RACA 3CVXA 1OZ0A 2BHNA 3LUFA 3KQSA 1QHNA 5FOQA 1MOQA 2LCFA 1K2WA 4OFWA 1XDDA 2PH7A 3JQGB 5B2ZA 1DI0A 1JMYA 1IH8A 1CY6A 3M82A 2HK9A 1Z6ZA 3OZWA 5LLSA 2MR5A 4R1UA 4V24A 2W4IA 4YVFA 3PDWA 1S8AA 2FW7A 1JQ3A 4J7CA 1PVDA 4EJ6A 2KI5A 4CR6A 4EM6A 4EJ2A 1VE5A 3OZEA 4YCJA 1BU5A 1G41A 2J7PD 4EB6A 3WO1A 2J5KA 3O4VA 4D6XA 4EW2A 1DRWA 4CJXA 3DZGA 5ALHA 3F6PA 2ABWA 3IDFA 5E9JA 4F5DA 1M1ZA 2GAJA 1LI7A 1TW3A 3HADA 1D1TA 3EQ6A 4PSAA 2VUSA 4UM9D 1BE8A 2B35A 3NAGA 3LRXA 4OQYA 3ZXIA 3WNDA 2YV1A 4GLFA 3WBFA 1NJ5A 4L8YA 2CXPA 1TMYA 4JC5A 5E4FA 4YQFA 3O8DA 2CN1A 2QGNA 4MR7A 4XTCS 3CZCA 1MHTA 3BIFA 2AOUB 1WCXA 3SDSA 2GAIA 3EVAA 2VJCA 2O4CA 1IE3A 1L7EA 1NM5C 2P9BA 1FDWA 2Q0HA 4PTZA 4EHLA 3MPOA 2BEJA 3IH5A 2C8KA 1REQB 2X4GA 4IX9A 2I67A 2C54A 4EG1A 1DG3A 3T5AA 5I9SA 3UTCA 1D9ZA 4S0XA 2ZWAA 5GWXA 2WKPA 1JQLB 2HADA 3L02A 1LRKA 4RTLA 5DW3A 2XQFA 1GGHA 4UOQA 4LC9A 4EFNA 3ZIAD 2YKGA 1QCZA 1L4UA 1ES9A 3AV3A 3PQFA 5JE8A 4YREA 5A0TA 1YDMA 1E2EA 4NU5A 1UWLA 2QD5A 4B7ZA 5JECA 1L8LA 4BNUA 3AHIA 3R0ZA 3PC6A 3FKSD 4QU8A 5IC6A 3WLNA 5L6MB 4CL0A 2C83A 4B3SB 2VQSA 1E94E 5HZGA 1HORA 3R3YA 5FPYA 5SZKB 4QDJA 2JH8A 3K1ZA 2C1XA 3QYJA 4WASA 4DA6A 1TPZA 3B5EA 3HDQA 1UBMS 4L0CA 4BQIA 1NXXA 4IUYA 4YR7A 2AOXA 3DAFA 3P52A 4MVJA 5CDTA 1V96A 1IBCA 5B7QA 5D6OA 2YINC 4FI3C 2GFHA 4O59O 5FBLB 2OGWA 2ZYVX 4GNKA 3DVSX 2AZTA 3MTBA 5BY2A 3SVLA 5ULLA 3KM0A 2YXLA 4MQ4A 1YKSA 1M6YA 1ZRNA 1MAWA 1PQ4A 4TWIA 3IBCA 2WJYA 4A36A 4P4SA 2UYCA 3D6MA 3ETNA 1PFKA 1YQGA 3MVEA 2TSYB 2BFBA 3KVRA 4IZOA 3RS2A 3RVSA 3RVKA 4EJFA 3KEMA 5BT9A 1Z22A 4NR0A 1Y5IA 3NTLA 5C5CA 1DOZA 2P2CA 4L02A 3COVA 1TK9A 1F2UB 2OORA 5TJHA 3W5IA 1I80A 4E1AA 4EGFA 2J9FB 1D09A 3IO5A 2Y1CA 3DZFA 3P27A 4QHYA 4ARZA 5FTLA 1I32A 5M34A 5KO2A 2FWRA 3JALA 4AF8A 4V2UA 3RTDA 1G8SA 3NPAA 2OCBA 3SE0A 4R2LA 3CUSA 1DAHA 4KHZA 1J0CA 1M2NA 4PPQA 3WSVA 1SG6A 2LBPA 1W6RA 2P4HX 3V7FA 4G07A 5LQCA 2WYHA 1XZJA 4MKFA 5F64A 4MUBA 2HKIA 2ZPAA 5KINB 4LE2A 3E7PA 1RZRA 1GDHA 4FNOA 3BN3A 4M7WA 4PE5B 4FCVA 4R6XA 2MR6A 3VR0A 2C8VA 2F3QA 5C4MA 1GN9A 4ARCA 4GYWA 3G1WA 1EUZA 1XKLA 2EGUA 3BJIC 3S28A 2X86A 1E3JA 1CQXA 4U63A 3ESXA 4JQOA 1TCAA 4E07A 2FSUA 4UDYX 1R10A 2IYEA 4PIMA 2J3QA 3IPRA 3C87A 1C7RA 2CLSA 1OBVA 1QQTA 2EZTA 2G3YA 4I81A 4IFBA 4JOQA 4KQCA 2R62A 4TL6A 2C4UA 2CNDA 4WOPA 5I9LA 3Q5GA 5E6UB 3PGMA 3RRBA 4C0KA 5C8ZA 5FF9A 4NCXA 5L7YA 5TPWB 2VQ3A 3PXGA 4BB6A 3SYRA 4GW3A 5DHRA 3H87A 2OWEA 2G70A 3AESA 2GEFA 1O95C 1TT7A 1BMFD 4M9UA 1FYEA 1XNJA 2E4VA 2P91A 1KS2A 2XB8A 3TW0A 3V4PB 4CG2A 1CJVC 4D4MA 1ECPA 2CB9A 3LCRA 4I1IA 1G8FA 4OEHA 1SMKA 4R41A 1A7KA 2JBAB 3L0YA 2W2LA 2I6QA 1XU4A 2X9VA 1PK9A 1GV0A 2WSLA 2QPOA 3ADKA 5FNVF 3VAAA 1YS7A 3ZKWB 3B70A 4AICA 2FPIA 3W5HA 2XXAA 4QELA 1YB5A 2GRJA 2V3CC 4C7OB 3N8GA 1UBFA 1B3BA 4TKUB 1PKEA 3HUFA 1KHTA 1ZD5A 1ZNXA 9LDBA 2WM9B 3S2SA 5A05A 4DXAA 2HBZA 5J4HA 2ZYTX 3QQPA 1QUFA 3QU4A 4ZDJA 1OXBB 2X9GA 5JW6A 1UWVA 4CMAA 3QEKA 4TVBA 4IEIA 4P7KA 5FB3A 1OI2A 5IH3A 1WCV1 3N2NA 2VDLB 1V3QE 3HFJA 4KQ1A 1E1NA 1TCBA 1USUA 1UMCB 3DW3X 1H2XA 1P6XA 3T3EA 1A9XA 1S01A 2CFTA 4ZHQB 4UEOA 2X8AA 1A97A 2II6A 5EIAA 5AUQA 1W581 5CRIA 2MYNA 1CRWG 3DVAB 4NPAA 1XK6A 4MGYR 3EBPA 1OR8A 1VCHA 1JKJB 5JG7A 4QM6A 2CYCA 3SE7A 2D0PB 1KVTA 2JD2A 2WFLA 5CPBA 4QGAA 5EJ6A 1OLUA 3VKUA 4MHOA 2D0IA 3HWWA 4L1KA 3NHJA 1P7YA 2PDAA 2FPWA 2RSLA 4ABYA 3BWXA 3UWMA 2ECOA 3IXQA 3QYPA 1WUTA 3PUYA 4GKAA 3O0DA 1WL8A 1KMCA 2D1YA 4YP1A 3IMCA 2GX6A 1R0YA 1XJWA 2MT9A 4JHLA 3LM8A 3V1UA 1D8TA 1T2CA 4X1IA 5ESWA 4I6EA 5TE9A 2DHQA 2Q7OE 5IN4A 4ARIA 3NV7A 4V0NA 2VH1A 3DD5A 5CD1A 1GWNA 3A6GA 3CF0A 4GPZA 2C42A 1OPRA 1P62B 3FMPB 5BN4B 1L1FA 3Q8KA 5F51A 2XSZA 2SHKA 3ICOA 4LOJA 2H52A 3AEXA 1K6EA 1HDEA 4YXFA 5TEWA 3ZZMA 3OTHA 2GKOA 4AF7A 2XQGA 1TQ2A 5BVHA 4FGWA 1MJGA 3KEGA 2Y6VA 3HP1A 4C03A 4CGYA 2EP7A 4P36A 2YNMC 5CFNA 3E3LA 1XA4A 1HOTA 2RHJA 2SKCA 3PNVA 2YCLA 2ZJ4A 5TMEA 4Z4CA 4GBGA 4MV7A 1N2JA 4PCVA 3QSYA 1DTEA 4A6PA 3BG5A 4JVLA 3L7NA 4JLAA 2I7XA 2AGVA 3PE6A 4ESVA 3KHKA 3ORQA 4A15A 1MO6A 1NLFA 5AKYA 2OFXA 2J6CA 1ODFA 3ZUGA 1ONSA 2WZBA 4RTRA 3TOCA 1F2VA 1ZJZA 5CLLA 4YT2A 5KC8A 1W94A 3FTFA 4V03A 3KOXA 4BKQA 2HNKA 1LSJA 3EC7A 3R6WA 5KYTA 4Q7KA 1E2MA 4BGUA 2PYIA 2PUEA 5J40A 3PEUA 4XRRA 2OESA 4Z0PA 2OD7A 1EFAA 1Z4QA 4Z9XA 3M81A 3OLVA 5F33A 1KDTA 3T38A 4AMZA 3U6KA 3DR3A 2EU8A 2IYUA 2NXWA 1YIOA 2FB9A 5AUNB 5GVSA 3QNUA 1BHJA 3LC1O 3W9UA 4YRTA 2WT8A 2WY2D 4E09A 5BUCA 4XB6B 1P61B 3U5TA 2HT6A 4TTAA 2A4MA 3U5ZB 2ZE8A 2RKOA 3AETA 3TF5A 2GCPA 4EDHA 1PX0A 5B57C 4IIHA 2CXNA 4O4HB 4E3ZA 2B8TA 1SUSA 3SR3A 3CF2A 5HGJA 2I29A 1FIUA 2NUAB 3KXKA 1U1FA 2WABA 4RVDA 3QY9A 1DRVA 1ZMRA 4YDSA 2EX0A 5BV0A 4HGQA 1M66A 2EFYA 2ZQ5A 3ZK9A 5B6PA 5LM3A 3EGEA 1U3UA 3PHIA 1J2UA 5AKLA 1UJBA 4XUEA 1YZVA 2F9MA 5AO9A 2ODQA 2G8NA 2GSWA 5TXGA 3QVTA 3H42B 3VHQA 3Q40A 4MS3A 4DIMA 5AUPB 1Q0SA 1WTCA 4DB4A 2GMWA 5EL0A 3QXJA 2J48A 4Q4AA 3VNUA 2Q3EA 2R5FA 1D1QA 3OX1A 4H0FA 3WYCA 1VDZA 3EZ7A 3ZCTA 4HVLA 3ICWA 1QDUA 4O2BF 2AW3A 4OX9B 3ABIA 3GRZA 1HOXA 3GCDA 3ZN2A 1IMOA 4ZARA 1E6LA 4MVYA 3GGCA 2AK2A 3WAKA 1I7QB 2XUJA 3B85A 1NNSA 2XHEA 1M2WA 2PS1A 4EG5A 4FJ2A 3T5CA 1Y9EA 1ZNWA 3EF1A 2H4JA 5J2UA 1IN1A 4ALLA 2RHGB 5G0SA 4CQLA 1WF6A 3DBHB 5AJYA 4RF3A 4H7JA 4AECA 2R7NA 4YT8A 3EA0A 1YZNA 5EKDA 3VPXA 1L6IA 1PV4A 1Z36A 1IXZA 2XKJE 1G4UR 4YJFA 2FPXA 1M1NA 1RE0A 1W2HA 4LC1A 1CPYA 1Y6QA 3Q87B 1WP9A 4QYSA 4ID9A 4KQEA 3M3DA 4K6FA 4JI8B 1GQFA 2AQIA 1W5EA 2PRJA 4FI3F 4DS3A 1RKQA 5BOVA 1UXOA 1XTSA 3IMEA 2ZBQA 3E5RA 4D7AA 1NURA 2V8BA 3ILVA 2V7EA 1NMSA 3SXJA 1QORA 4PRLA 4EPRA 2XLCA 3WWPA 2C07A 3F8SA 4BNHA 3DFKA 4Q7EA 3GBPA 4FPXA 3TZLA 1KOFA 3WHKA 1XAIA 4RSMA 4FGLA 1Y1RA 3EGDB 1Y8QB 1TTQB 1OH7A 1ST3A 1RXCA 1FC0A 3LUPA 3SR0A 1W0KD 1ZCAA 1LDNA 2HQOA 3L7MA 3W0LB 2YRXA 1V6AA 4D26A 5TQ0A 1FJHA 3T41A 1S2MA 3D8TA 4GKJB 4IV8A 3PDIB 4L8GA 1QHXA 1SXQA 4IFEA 4G5XA 5JTTA 1H94A 3H4IA 2Y0DA 4Q3CA 4JJ7A 2QPLA 4GH5A 1MJ5A 4L27A 1KY2A 3RAEC 3GBSA 3P5BA 1VKOA 1Y82A 2ZRCA 4GRAA 4X5OA 3EOBI 3OBBA 1F3LA 2BV3A 3LSTA 1TTTA 2PMDA 3IJRA 4DQUA 2OM2A 1EVLA 4JR0A 4KFRA 2XGMA 2C4MA 5MN4A 3ISVA 1X15A 2QW8A 2DHEA 3E84A 3TLCA 3KB1A 2F1IA 2R7LA 3DTVA 3O3NB 3O6VA 3R5HA 4ZGGA 3UAYA 4XOUA 5HKKA 2IPAB 2PD4A 2V03A 4G0XA 1I1HA 3OF2A 4X94A 1N36B 1OOEA 3DF9A 3NRBA 4BX3A 1IBLB 2D2EA 1MR3F 3N0TA 3OSUA 5BMVB 4KRFA 3IT3A 4CQMB 3CE6A 2HN9A 3ER8A 2XEXA 1HE5A 2WYIA 3CKMA 3DLCA 5T67A 2CEKA 5J63A 1AUPA 3GFTA 1VBNA 2HYIC 1R74A 1H1TA 3KUUA 3O92A 4RXTA 3IA7A 2FPSA 2HHLA 2PX2A 3PHHA 3PR2B 5J9FA 3X2EA 4BL5A 4LZAA 3AKZA 3CHYA 4FHZA 1I24A 3QPWA 1AHPA 4YRKA 4S04A 4TTQA 5DGXA 4JUIA 3ZHCA 1SURA 5HS6A 3ZWAA 3MGAA 1MG0A 2PL9A 3NKVA 3P26A 1X86B 1L9KA 1BX0A 4XFKA 4E5YA 3UJNA 3U3RA 2YN0A 4UNQA 1JH8A 2H29A 1JG3A 1E2PA 4OK5A 5AKEA 5B58T 7ABPA 2ANBA 1AUOA 1BCRA 1T8PA 2F3RA 1O03A 2G8LA 3WB1A 4RD1A 3DZKA 3L6EA 3H11B 4F2GA 2ODWA 2LUOA 4XWTA 5EJ4A 3LE8A 3AR7A 5JWRA 2G4CA 3KR2A 1GCUA 3UJ6A 3RJMA 1XNRB 1DB3A 2C7RA 1CFZA 1C9YA 3PDJA 4IVPA 3L4JA 1OH8A 1H2EA 1Q92A 2IOHA 2JK1A 3DJFA 4Z1MD 1XA3A 5F23A 3HBLA 4C2TA 1QP7A 2C2GA 2FR8C 4IJ6A 2XKBA 4KQFA 4G1UC 3AF0A 1XE3A 3EZNA 3I52A 5BWNA 3UK7A 3KV1A 3PU6A 1OF1A 1ULBA 4MVWA 4YRPA 4IYJA 4DA8A 1QRRA 1RLUA 3HCCA 3INNA 4O4IF 3FPGA 1EEXB 3UH0A 3VKVA 4YCSA 2OV8A 2H08A 1KYVA 5KJEA 4RA6A 3EVTA 4GPIB 3RG2A 1ZUHA 2Z3ZA 2O5VA 3EWSA 1HM5A 3NQ41 4I5FA 4WUTA 4EG6A 5IVHA 4EF6A 5A5FA 9MHTA 1Y34E 2C0PA 3GPIA 3EVFA 1UAAA 4B8WA 5K3EA 3VU9A 3H05A 3LYUA 4Y6SA 1GUAA 1DCFA 3RQIA 3DMTC 4I1RA 4DFDA 2QL5A 3V1NA 2YWCA 2H1RA 5LXTB 1Z16A 3RRMA 2PSSA 3V9AA 4YWHA 5HNKA 2DETA 1U0GA 5BQOA 4TV9A 4LPKA 5BR8B 1R64A 5AUOB 1MV8A 3PNSA 2PK3A 4R5MA 4PX9A 1WHTA 4OM7A 3NOQA 5TGTA 1I3CA 3HH8A 3DULA 3D3NA 4M1YA 2G0NA 3FPKA 5HFAA 3DLHA 4DV7B 3C6XA 1XDGA 3TKLA 1BWSA 3UAOA 2XZPA 4UBIA 3RRJA 3MK31 3OU6A 4RPKA 2HCRA 3SIXA 2X15A 1Q0HA 3TG2A 3B1JA 2D6FA 4HDRA 1PI3A 3IE1A 3T7TA 1EWKA 1XCPA 2L42A 1N5JA 3JQFA 2WJZB 2QVBA 3KB8A 4WE3A 1SC9A 5AVWA 5KX5B 4YY3B 4RQUA 4ZD6A 3KOMA 3TTXA 4MHTA 1SPXA 4HDSA 1E58A 2HLPA 2PWYA 2QM7A 3FX2A 4IDHA 2H1LA 1OFHA 2ID8A 4U2EA 4DLAA 3K30A 3HNPA 4B7AA 5JNRA 1OIWA 1F2DA 3VISA 1CLUA 5KSPA 3TB4A 5DI3B 3RGWS 4GP9A 4ACAA 1MORA 3RM3A 1VTKA 2BHTA 2X9QA 1PJRA 3VVCA 4DGQA 4DLNA 5TNXA 5AM3A 5D8DA 1BX1A 4JU8A 3WIVA 3HKCA 1RYHA 4MUMA 4DLWA 4OHOA 2OXIA 2HC9A 4OUDA 1IWOA 1DEXA 2O20A 2V1XA 4B3GA 1UPBA 3N6VA 3FNRA 1X1RA 4D1YA 4X71A 3DL7A 3W79A 4PFSA 4TUYB 2BTEA 1RWXA 1Z17A 1Z2NX 3NI2A 4HUJA 5A7FA 1FU4A 3FETA 1LQ2A 3KB2A 2ZR7A 1AHIA 1BAPA 3KYBA 1FP1D 1RAGA 1WXQA 3I4CA 2C2OA 1RWWA 4PCUA 3HY4A 3K94A 2D0OB 1MAUA 1ENYA 1HDYA 3KP1A 3SS7X 1T36A 5CLFA 4RD2A 2FFAA 3E23A 2XUQA 3A6HA 5BSHA 1W5TA 2ZJ6A 1MVLA 3NYWA 3O94A 3PX3A 3DHWC 2IIBA 5PNTA 4MV9A 2WPNA 3SIPA 5GONB 3AL0C 2HA4A 2MMCA 2PSHA 4OI0A 3WJ7A 5K0CA 4C88A 3EYWA 4B33A 5TLSA 4D9BA 3CUWA 3TL3A 1ZGGA 1GQQA 3WRYA 3KSAC 1E7MA 3LZ6A 4UM7A 1YB4A 4UXIA 5G0VA 5T57A 4LVCA 4NOLA 4UDOA 3D7LA 4MJXA 1A4XA 4HEA6 3OLYA 3FPHA 5AJXA 1K6XA 1H65A 3IP7A 3LX5A 4KJZA 1TO6A 5HRUA 1DUIA 4M6WA 2VWPA 1V9SA 4ALMA 1CD5A 3FBWA 3RIXA 3CONA 4F9FA 4WZAA 1XPJA 5BUQA 1J2YA 1Z2DA 1Z4MA 2REXB 3OFJA 1BEUB 3GQVA 3SXUB 1Z4JA 3BDVA 2Z1DA 4P5EA 4TLEA 3A14A 1U2EA 1CJSA 4E2WA 5K3CA 7REQB 1F4VA 3VPFA 3VZPA 5CBPB 1OC4A 1DJNA 3E8MA 3D54D 4ZI7A 4RPCA 3TMKA 3BL8A 4CKCA 1SCKA 2PUVA 3RBAA 3NTXA 2RGUA 2W0MA 2WE7A 2W2KA 2YICA 3FPBA 3SPXA 2VHWA 3I8XA 1NKVA 3JVIA 3QA9A 4MB6A 4URFA 1HKHA 3KZNA 2X1VA 4Q66C 2E4AA 3LPMA 1U2DC 3OF3A 4Y9RA 3ZPXA 5F2NA 5K0NA 3SZRA 1CVLA 4KVAA 3ZTYA 3I2JA 1ZK1A 3DOCA 1L2TA 2BRUA 2YY7A 4LGCA 1GGMA 4URZR 5CJPA 3TKAA 5J3JA 1ILWA 3VNVA 4TXNA 3UJ7A 4PHCA 5IKMA 1WXDA 1DUVG 5FWXA 4C5CA 3KUKA 1JIKA 1K66A 4CM1A 4MQ5A 1IEWA 1WMEA 1Z29A 3DE2X 5KOIA 1NR1A 3OEHD 3ENQA 1J8FA 1GZ7A 4J2OA 4UU7A 1NATA 5COAA 2NVOA 2IEAA 3IDQA 3JU3A 2YXEA 4DCJA 3FGPA 2AD1A 3GLUA 3O4JA 3QU2A 1XZLA 4G5HA 2C9ZA 4RENA 4TS4A 4DCGA 4B4DA 2J3KA 4C4AA 3ABRB 1HG1A 3KYCA 3QXCA 4Q4HB 1GFWA 2PUCA 1ISFA 5CAEB 3MS4A 1YMUA 3PXDA 4HF7A 1MF7A 1HGXA 2GXQA 3L4BC 4XPZA 1J33A 2CFIA 4XYBA 5IAGA 2QQGA 4XVCA 1X42A 3C1OA 4YRQA 3JYPA 5IK2D 4RFLA 3MT9A 3LK7A 1RJ9A 3R6DA 4OKSA 5TMPA 3HUDA 2G88A 1YS6A 1CP2A 4JI1B 3FWPA 1KVUA 4ZIRA 4MQMA 1ACLA 1PD1A 4C0SA 5KTNA 1H2YA 3FCYA 3KD3A 1TCCA 3CXUA 3MB8A 5C7YA 3WDSA 2IBTA 2G08A 1TQHA 2J4FA 4E15A 4IIJB 4RTJA 2P9FA 2FPMA 4DKJA 1EFTA 3RODA 3G9UA 4Q03A 5K05A 5TQ2A 1N8KA 3VHXB 4L28A 4RY2A 4ZMRA 1PWYE 4Y6RA 4IICA 5EKXA 1Y42X 3R6TA 1I6LA 4GMDA 4RK6A 1W85B 5LUBA 1DCMA 3O9ZA 2BM8A 2HTFA 3RV3A 1T4CB 1VLZA 4B31A 4BQNA 2XMZA 4JOBA 5TMBA 3PI6A 1P2UA 1A04A 5GVRA 5A5VA 1TM5E 4FB5A 3E5MA 1C29B 1C1XB 1KAOA 2Q1YA 4FTWA 1U3CA 1VPDA 2V7XA 3GRKA 3HCAA 4J29A 1NG1A 1VL2A 3DONA 2I34A 1XTVA 2OP1A 2X1LA 2IHKA 3FB1A 4P3XA 1PL6A 4RTMA 3N58A 4N49A 5BV7A 3USES 3NW9A 4RHXA 5J4KA 4P53A 4DLXA 1DO0A 4JUFA 5B3JC 5K8TA 1K8RA 4OA5A 1H1LA 1Z08A 1QHSA 2H0QA 5B6JA 1UK6A 4LNUB 4BHTA 3Q9UA 1H2BA 1UC4B 1Y5MA 1M2VB 2HSZA 3LLSA 4F11A 3KAJA 3SZUA 1ZH4A 5K09A 1DFGA 1RLIA 3G2QA 3V2HA 4C4RA 1BCSA 4BGIA 3OA2A 4FYJA 5AHXA 4UHEA 3VFDA 3OZBA 2ZT6A 5DX1A 3JAKB 1YTLA 1CF9A 5D5HA 4NONA 1DARA 3LQ1A 2W2NA 2XCRB 4E31A 2ACVA 3QU9A 1ZGZA 3ROEA 5BV8A 9ATCA 5JRZA 2OYSA 3WA7A 3RUIA 2A9QA 3SS9X 1PFVA 1U1IA 3AL2A 5ENVA 2NV2B 3PGKA 4XB2A 1VJTA 2HZBA 1F3OA 1YAHA 1E2KA 4RSGA 4U1RA 3U7QA 3ZLVA 1ND6A 4F72A 1ORTA 3A3PA 2V6IA 2V55B 3LLMA 2VAPA 4ETMA 3VR6A 3WFJA 2NSYA 2P3OA 2I3GA 3KR9A 4BKUA 1OI4A 2FU5C 3CKKA 4GVPA 1K6MA 4YACA 2D13A 3DMNA 3L8CA 2P2LA 4BVGA 3THXA 5CTAA 1D7AA 5CVDA 1N3BA 3UB4A 2JLQA 4A3SA 4HAXA 2CLEB 2PBLA 3VU1A 4ZYLA 1JIUA 3FSJX 3B3JA 2AFHA 3CUTA 4YT5A 4KDRA 1UR5A 4CKBA 1LK5A 1ARZA 4UBLA 2JS7A 2R79A 3A06A 3JYLA 3P97A 4A6XA 3KC2A 4LJAA 5AKJA 5E1OA 5I8PA 3N74A 3PRHA 4IGKA 2CBXA 2B4AA 1KHHA 4J07A 4QBHA 5LA6B 2IC5A 4HRYA 4WH0A 3HNRA 3R9WA 4OI4A 4YBRA 3SIRA 4DMLA 1M76A 4IDFA 1W0JD 4DXHA 4GVXA 4KX5A 3S8MA 2VFAA 5ALIA 1UDWA 1DFIA 2Q3JA 1DKNA 3DWFA 4YJHB 2A1UA 3O90A 3THRA 3FVRA 2Z4RA 4H4DA 5FL7D 2AT1A 2WP8J 3FKJA 4MWGA 1GTSA 4RF2A 2WF9A 4YB8A 3PFNA 4P4GA 3SGLA 4XCQA 1XYGA 1BMQA 4HWTA 1B6RA 1XTZA 2HHHB 4YDRA 4EA9A 5KNBA 1P2FA 2ZIGA 3FJOA 4HX2A 1C0IA 1TM2A 2IF0A 1XG5A 2QVYX 2VSYA 1B3RA 1FNDA 1T8SA 2GF9A 2OUKA 2ZQYA 3H7AA 4PLFA 3GLGB 4MCJA 1IDOA 2YXPX 1YD7A 1MRNA 2HYDA 3F3SA 2FJ0A 4M0MA 3S99A 4MP6A 3PEYA 4BTVA 5JJLA 1QYVA 4I4TB 4FHDA 3NDPA 3FD8A 4KK4A 3JD0A 1FE8A 4PG8A 3UCEA 2DX7A 2R1ZA 1AN9A 4JIMA 5HBGA 1N0WA 3GI1A 5CURA 4MUAA 1ITZA 4J94A 1J2JA 1JN0A 4IGEA 1M33A 2CLCX 1RM0A 5B53A 3DHVA 3S8EA 1WABA 4WCFA 1YE8A 4A0SA 2QJWA 2GZ1A 3PPWA 1QVVA 2J41A 3HA3A 5MGBA 3HRKA 1V5EA 3W2IA 1FUUA 3FOZA 2CNKA 1G9TA 4CMIB 1G3MA 2GJSA 4YJ2B 5IT0A 2WHYA 3DFFA 3UATA 3VMMA 1Z3CA 1NW7A 2O3SA 3MUEA 2AMVA 1NXTA 1NUHA 4M1WA 2ZUVA 1XIVA 5D5QA 1E3DA 1Y8CA 3E9NA 3P0FA 3VV2A 2V3VA 4W9NC 4GPTA 1OKKA 3DEYX 4HQ0A 4QYWA 2N9UA 1W0CA 3U7HB 3CG4A 3ESQA 3AVWA 4B3XA 3PPVA 4RAOA 3LFUA 1GR1A 1N6RA 2FMKA 3AI7A 3GUCA 4HH1A 3UENA 4JP3A 2XTZA 1IVNA 2H1WA 2QEQA 5IC5A 2PN1A 1YS4A 3K1AB 1GAXA 1UJ2A 4GOND 1ZFNA 1N9GA 2WFMA 3RYFB 4U39A 4WOBA 4J7UA 5IYZA 1DLIA 1F4LA 4MYDA 2VYQA 2GQ0A 3F47A 1HMPA 2DUJA 2UZIR 1O94D 5C9ZA 2W6JA 1GADO 4YEDA 1SCAA 3RR2A 3HR7A 3TQTA 3H5OA 5F2OA 5KNCD 2N0SA 1RZ3A 4M55A 5IAAA 2QVGA 3ASZA 3TAHA 1N8TA 2XB6A 3BEDA 3C6QA 4MOWA 5DGCA 2RBKA 1N3LA 1I51A 4O4JB 1FFDA 1DQSA 1ZICA 2R3SA 4HB3A 1YQQA 2LZ0A 1NF3A 3GUUA 4BNIA 2YTZA 4G01B 3DDNA 1P5JA 1G66A 2IYOA 3MWDB 1HTWA 1SVWA 3H2IA 4TYWA 1S2DA 5IXJA 3RS4A 1VHDA 1NUTA 2JGDA 4NICA 5ADHA 4DZTA 2P0AA 2AR9A 1OHHA 4BNVA 4B17A 1NLUA 1ZLXA 2GFQA 5LFAA 4PGAA 4KNVA 4DQVA 1FQKA 1R4AA 4MK4A 1UM9A 3ITKA 4YRBA 5DGHA 5E1DA 1KJ8A 3F7MA 4JK3A 5ILGA 4KN8A 2A35A 1GD1O 1TU0A 2Y1WA 3A3OA 3BIXA 2JLSA 1WB6A 4JQCA 4JCOA 1Y9JA 4WADA 3V4ZA 1THTA 1RSZA 2WAMA 5KTSA 1X77A 1JHZA 2QL7A 1XQYA 3AFIA 1GUFA 4ZT6A 2FZVA 3OJXA 1HDCA 3WLFA 3TPFA 3X1JA 4OHZA 1ZIXA 1XMXA 5IJZA 5L3SA 2VHCA 1EXMA 1XCOA 3GC6A 2ONZA 3GJTA 2Y1EA 4YAOA 4NPCA 4C0AC 3DKVA 3N28A 1J6UA 1VL5A 1MB2A 1ZKMA 3HJRA 5GGYA 3H2JA 4R51A 1J99A 1PJQA 5FYDA 3BIJA 1UKBA 4DRXB 3VPSA 1EB8A 3NBUA 4I4LA 2PHZA 3ZZ0A 2HK8A 1EK6A 3FKQA 7ADHA 1VLVA 1XEAA 4G9BA 1VGRA 4RABA 5K0FA 4FJ0A 4E7PA 5HCNA 1JAHA 5LYJB 1KQGA 3E2IA 4HNRA 5FNZA 3CJTA 1JTVA 1FTSA 3JQGA 5F4BA 1QGED 4JSTA 3OCXA 5LDGA 2OCAA 2L17A 1A9YA 4BP3A 3BD8A 2DQKA 2OAQ1 5JAOA 1SWWA 2QZSA 1J8YF 2R6JA 3OQBA 3ZDAA 1X70A 1YR2A 1W47A 1Y1LA 2GYVA 3AGPA 4YRCA 1ZVKA 4RVFA 4Z9YA 5B64A 1NOKA 1DAKA 2FY8A 1DQNA 5T4BA 1KI8A 5EP4A 1MZPA 3FYHA 2FPGB 3QOFA 2HIMA 1GXSB 2JL1A 4JT8A 3LOUA 1EZ1A 1HG0A 3MWEB 1RVDA 3N2LA 5I48A 3ROFA 4PS1A 3IESA 4MPPA 1PL8A 3STWA 5IDXA 3GAFA 3LT1A 3R6GA 2QMZA 1S2NA 2GZDA 1O7JA 2O2DA 1Y3IA 2ZETA 3I1YA 5CA0F 4JI2B 2H8GA 1RKVA 3Q9SA 2G04A 2YWEA 4DC1A 1V3UA 2CUTA 4HEA1 3WYEA 2RONA 2DLDA 3SMQA 4BMYA 5JEEA 2CNWD 2I8AA 5LN1A 1Y37A 2FPRA 1I9CA 1E5TA 5HIKA 2AOUA 3BJRA 4C4ZA 5DM70 4D2IA 5AK0A 3WLQA 5BRAA 1AQJA 3W34A 1GL9B 2JAHA 2JFWA 3LECA 1KMQA 1I10A 3R9IA 4UU0A 1REQA 2JIPA 2O8VA 3A6DA 4MWZA 4FMBB 1CUEA 2EVWX 4KVZA 4BVKA 1QVRA 3QVSA 2BFMA 3LCVB 4NNJA 3CURA 2XUKA 5LQUA 2FFBA 3NAQA 2GNAA 1F8FA 4FMDF 2XF8A 2Q45A 3A1VA 3JCZA 4X1OA 1HETA 1P4AA 2BZ0A 1B23P 1O6FA 1TT5B 1Y3BE 3H4VA 4YALA 5HIAA 1P2VA 2YRWA 1MB9A 2IP2A 2CL6X 1A9SA 3IURA 3L5KA 3GLGE 2J5XA 1O5OA 3L0IB 2VPZA 4IS3A 1KYWA 1HC7A 2CY0A 2IOFA 3K0FB 3PNMA 5DNAA 1KVSA 1YOBA 3UKJA 1VSUA 2Y92A 3F1LA 5AW3A 3INGA 4LHVA 4ZVLA 4CEJA 1ZUWA 3AI3A 2FLWA 3NRCA 1H93A 3CSDA 2XUDA 1SO8A 4E21A 5LQAA 1OWMA 1RADA 5JJCA 1YR3A 4LISA 4ZPJA 3T5MA 1G1AA 4RQTA 1ZR2A 2HF8A 1E3QA 2BGJA 2WILA 1XQXA 2X4DA 4M37A 1D5CA 1M2HA 1NYTA 4R6WA 2A7QA 3SQLA 3I04A 4QRIA 3VDXA 3LX6A 1ENZA 3DP7A 3ZHBA 2V7QA 4HTFB 3DQQA 4QJ4A 1AD2A 1FYXA 1P74A 1GLGA 3L04A 5KYKA 4DCUA 5G0WA 4BBPA 4ENQA 5EJ7A 1KMIY 1A1VA 2QRQA 1VHQA 3LBAA 3O75A 4OK6A 3ZIAA 5JYBA 1L3IA 3EE6A 2HLHA 2JFBA 2JLBA 1VE7A 3ZR4B 5KVSA 1LV7A 4KR7A 1SD1A 2IU0A 1FW6A 1CUWA 3AUAA 1X3LA 4DR7B 4B5LA 3BCUA 2NTYC 1F2UA 3ONNA 2PLAA 3I0NA 1S9HA 3H5WA 4ND5A 2J9FA 3IKTA 2AA3A 3VGPA 5KWEA 3CYFA 1KP3A 4ZDIA 1Q95A 1KJ9A 5I8WA 1E6KA 1JRLA 4N40A 2TMYA 1FNSA 2PGNA 1DC4A 5HCIA 4ENPA 4UBKA 2R7AA 1RXWA 4FZJA 2CNOA 3HLYA 5H83A 1XNHA 4IQFA 4OP2A 1QM5A 1TLTA 1TZJA 2X5JO 2X58A 4ILKA 4NV1A 2YVQA 2D1SA 4XDHA 2XMSA 3SFTA 3CLTC 1W4ZA 2PA3A 3LL4A 2WD7B 4P3PA 3ZZ1A 2DJ5A 3CNHA 4CMEA 3H0KA 5KS2A 2GBFA 2Y68A 3IMGA 1Q2UA 5BR7A 1ECCA 2EJCA 3IPCA 3MQFA 5BW6B 1U2RA 1M8JA 2B83A 5A7GA 2ZCVA 1V25A 4C4XA 4Y2TA 3WBJA 1DKLA 3T1TA 5BR1A 1SEPA 5DNUA 4DAEA 1E4OA 1T2DA 4NFYA 2Y6UA 1SD5A 1VYVA 2WIBA 1N33B 1FP2A 3FFAA 4ZQEA 5E6UA 2PEZA 5TPWA 1SOVA 3MLAA 1XD2B 3L0SA 2J3HA 5GMOA 4W5JA 1SZPA 1NQTA 1LWOA 3S68A 2XI4A 1FY2A 2GILA 3RFTA 4G63A 4B4VA 4J1QA 2CDRA 4U2BA 3PGLA 4GI2A 3RSFA 1A2KC 1C0EA 1FMCA 3LX8A 4YV7A 2ATXA 1KFBB 4CEHB 3A26A 2JGFA 2ZWVA 3GDHA 5JRJA 1NVMB 4FXOA 1C3EA 2CMDA 2JBAA 1B8OA 4DNQA 4XWOA 3O8RA 5MHTA 2VF4X 2XYQA 4QNMA 3ZKWA 1UP7A 1X39A 3C1TA 2JJ1D 2WTEA 4C6SA 2EW1A 1N1GA 1L5VA 1JU9A 1W36C 2GXUA 2ZATA 1TQDA 4C7OA 5HK9A 4IXMA 4KAFA 4DLSA 2RH5A 1WUKS 2DPYA 1C2TA 1CY7A 1KQOA 1RRGA 1TI7A 2JLAA 4FZRA 4PV7A 1TUIA 1SQSA 3GEMA 2PKXA 4UQPA 2QE7A 4EJ0A 3OLZA 1Z0KA 1X87A 3QU7A 3DXZA 5FI0B 3I4FA 3WBKA 1NN5A 2TECE 4IDOA 1W9MA 1XBTA 2OD9A 2YOGA 4G26A 5DNCA 3VNRA 4Z2YA 1FXWA 1EK1A 3RYCB 5HQ3B 1UMCA 1XZAA 3QUTA 2OHGA 1Y1PA 5JYEA 3NGMA 5KYUB 3PSHA 1Z2CA 4N39A 4ZHQA 1BMFA 5JMWA 2DWOA 1G7RA 1KORA 1X7DA 3DVAA 1I7LA 1RP1A 4IWNA 3ZXYA 4E4TA 1JKJA 1HEUA 1EG7A 1E1MA 1IN6A 3EAFA 1NPDA 4P4NA 2IWRA 1GNQA 3TBFA 5C1DA 2PLFA 3FNEA 3ROMA 3VI4B 4M0DA 1TIBA 1S2GA 1U7PA 3UNXA 3MFYA 4Y2YA 3AIKA 1QWSA 5JI3E 3ZJ4A 3N8NA 4URXR 4RV9A 3AOGA 2PT6A 3GFSA 4LG1A 1MGPA 1GZDA 2R6HA 1VPWA 4HWOA 4OJQA 6Q21A 2X7HA 1T35A 2CVPA 1YWGO 2B7BA 2JAXA 3LUGA 2HXGA 3MZ0A 4KQXA 3RTBA 1II8B 3DLIA 5GAJA 1BRMA 3WL8A 5LQRA 2XZOA 4KDEA 4UVIA 3Q3VA 4JAVC 1IQRA 1KYTA 1LVHA 3DZCA 3QNWA 5I51A 4RHFA 1E77A 2DP4E 4ZVNA 4BLUA 5BN4A 1SFRA 4TRNA 2H4XA 1T1JA 1YB2A 5DCUA 3W2FA 4G2NA 4PYOA 4C3ZA 4TSKA 5B6IA 3LPCA 5ERGB 3U3ZA 4BEWA 4IJWA 1C9DB 4RCVA 3W5UA 1TMOA 4IDQA 2KE5A 5D7BA 3GJ4A 3RLFA 4ENSA 1RYBA 3L3BA 5FOVA 4FINA 2QQ0A 2Q1UA 4ZYWA 2AMJA 2O1XA 2R5NA 2HPZA 3VGJA 1SVKA 2IOYA 2IU4A 5FI3A 1C3OB 3F78A 3Q7PA 4XM2A 3IV9A 1RVV1 1UBKS 3CRMA 3FAKA 4KK3A 1Q12A 2Y2VA 3IDOA 4BMSA 3F73A 2CK3D 4K9QA 4UMEA 3JQAD 4CVNA 1M2OB 3AJAA 4LQCA 3RROA 3RUHA 4QPJC 1NXQA 4A03A 4RK5A 2DQSA 3C4JA 5CHEA 4QATA 2HJSA 4Q9NA 1DKOA 2ZAMA 4FSHA 4E5NA 3PLNA 4YMHA 4EVRA 1E7WA 5DWDA 1FLNA 4IJMA 4DCNA 4QE3A 1Z26A 3FNGA 5FTWA 3WQHA 4B6PA 5JD4A 2FQ1A 1HMYA 4BFSA 1I0IA 4HEQA 4ZU3A 5KQMA 4OHMA 1WZUA 3GFFA 1GHTA 4PG7A 5JAMA 5K6TA 4MRRA 3S44A 3K8ZA 2O6LA 2AEFA 3ZDZB 1FYFA 1AGRA 1YDGA 3MRVA 5K2MA 4YBZA 5IUKC 3FVWA 5H4HA 1U8UA 2JFQA 4QPZA 3REFA 3TRJA 4C4PA 3S5JA 1GL7A 3P2EA 1DC7A 2JK0A 2WINI 3PQ6A 4NULA 5EJAA 3WK5A 4J6EA 5K45A 2HSDA 4NMMA 4A5OA 3RVDA 1IFXA 2P41A 2QG6A 3TM4A 5KYYB 3QW2A 4QUHA 3AO0B 2Q41A 2QIPA 2Q9BA 2ZBDA 4MR9B 3UV7A 4BEVA 4DDHA 2GK3A 1R5NA 3AR4A 1ZCFA 4RA9B 1LNZA 1VIVA 1VCIA 3KKLA 3LTEA 5ALXA 1QHYA 3CA8A 4ZRNA 2C9BA 2PV7A 3UJAA 1EFCA 3OQIB 1FNCA 4O5AA 3RU2A 3JQAB 4O4HA 2GK7A 1W75A 1L5RA 3D02A 4E5SA 2GFIA 5C8XA 4JB2A 3PCTA 5FV7A 3JWPA 2A9JA 2XNJA 2NUAA 3H2SA 4S2UA 5FR2A 4BQQA 4YRMA 3L07A 3OY2A 1QJCA 2P3SA 2VCYA 5EE3A 3K71B 4XARA 5CCEA 1OX5A 3IXLA