4KTTE

Structural insights of mat enzymes: mata2b complexed with sam
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
308
structure length
306
Chain Sequence
PNRRVLVTGATGLLGRAVHKEFQQNNWHAVGCGFRRARPKFEQVNLLDSNAVHHIIHDFQPHVIVHCAAERRPDVVENQPDAASQLNVDASGNLAKEAAAVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGEKAVLENNLGAAVLRIPILYGEVEKLEESAVTVMFDKVQFSNKSANMDHWQQRFPTHVKDVATVCRQLAEKRMLDPSIKGTFHWSGNEQMTKYEMACAIADAFNLPSSHLRPITDSPVLQRPRNAQLDCSKLETLGIGQRTPFRIGIKESLWPFLIDKRWRQTVFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-adenosylmethionine synthase isoform type-2
publication title Structure and function study of the complex that synthesizes S-adenosylmethionine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 101
structure length 306
sequence length 308
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF04321 RmlD_sub_bind RmlD substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4kttE00
3GVPA 4EUFA 4M87A 1F8GA 5GZ6A 1ZSVA 2J8ZA 3P19A 4GVLA 2YDXA 3QHAA 2OBYA 1U2DA 5DBGA 4BGEA 3NDRA 2Y93A 2TMDA 3RC1A 3COSA 2HU2A 2ZQYA 4II2A 3K2EA 2EHDA 4B7XA 1K2WA 3KSUA 4CMCA 4J9UE 4YT2A 2AG5A 1PIWA 2OP1A 4U0JA 3SEFA 4AJOA 2CD9A 3HSKA 4E6PA 1J4AA 1PZEA 4RQUA 3RUEA 5DULA 1GL3A 3L9XA 1U7TA 4BKOA 4C7JA 2X0IA 3E5MA 3FN4A 4B4UA 3PJFA 1DPGA 2DBVO 2PLAA 1B7GO 4QFDA 1WDLA 3W8FA 4J0FA 2JD0A 2NV6A 5F5LA 1GUFA 1VL8A 2JL1A 2OHXA 4Z0PA 1N5DA 2A9FA 1TXGA 4FOOA 4BO2A 2X5OA 1U3TA 3FRJA 4E5NA 4XGIA 3OA2A 3ROPA 4PLVA 5B37A 3BTOA 3DBLA 3GLQA 1E1MA 3GN1A 2NQTA 3OFSA 3IS3A 2V6FA 2J5KA 2O7SA 3Q9NA 3KLPX 4NFSA 4D46A 4IDBA 3QWIA 1YKFA 5C5IA 4WASA 5K6AA 1Q0LA 4LISA 3S2IA 3ZWYA 4BO4A 4L9RA 4DYDA 3DZJA 5F1OA 3ANMA 2Y0CA 3ITDA 1UR5A 2A4KA 2YHIB 1HSZA 3GRPA 1KVUA 1XR3A 3G1TA 2QIOA 5ADHA 4CMAA 2FWMX 3VKUA 4WKGA 3V2UA 1H2HA 5I9MA 2B83A 1QMGA 5ICSA 2YZ7A 4ZVVA 1UP4A 4MKRA 4R4JA 1XIVA 4UVEA 4MVJA 3TRIA 4L76A 2DTXA 5I8ZA 3JQAA 5CHEA 3HN7A 5IJZA 4NK4A 3RU9A 3ETGA 4YT5A 3CUKA 1E1LA 3V1YA 4OKNA 3I1JA 2JFFA 3AW9A 4X54A 2DPGA 3H9UA 1LDGA 4JJIA 2HK9A 2Y05A 4YTEA 3WGTA 4DBZA 1HZZA 1U4OA 2DTDA 3DFUA 4GX2A 4ND1A 2ZB7A 4CQLA 4D44A 3VDRA 1PU2A 1WZEA 3WMXA 2HMUA 4URFA 1PQPA 4BIIA 3F46A 4YPOA 2DVMA 4D3DA 1EBUA 4GL4A 3I4CA 2CDAA 1SOWA 4WGGA 2C2YA 2HSDA 1ZK4A 2P5UA 1T4DA 4QECA 5JCJA 1WWKA 3EHEA 1Y8RA 3WNVA 4BNKA 5EJ2A 1XWFA 1OOEA 3MTJA 2F00A 1MGOA 3H5AA 3GPDG 2BGKA 4AJEA 1LA2A 1ENPA 5AOVA 1LUAA 2YV3A 4OXYA 5U9CA 4A73A 1GCOA 4J3FA 3GNSA 2B4RO 2PNFA 2VYVA 3KHUA 1HDXA 1I3NA 2C20A 4OXKA 3CXRA 1I3KA 3L4SO 4AICA 1CF2O 3KOUA 4K26A 3WG9A 3DHYA 2C29D 1C0LA 5G0TA 3D64A 3IJRA 3Q2IA 1DFIA 5L4NA 1DOHA 5LDHA 1X0VA 4N5MA 2C59A 3RUHA 5FI3A 5H83A 2Z5LA 3KVOA 3JQBC 3HB5X 1HDCA 2PKQP 2W2KA 4M1QA 1EQUA 3LK7A 5I7EA 2O3QA 2O48X 1VJ1A 3DONA 3ENNA 3LT4A 2EXXA 1MFPA 3ONEA 3R3SA 1SMKA 4TZTA 4CLOA 4YJGA 1FMCA 4XB1A 4RF4A 1W0CA 5IDWA 2ZB3A 2EV9A 2C7GA 1T2CA 1HDZA 3SLKA 3ZV6A 5CDGA 1CEQA 1NHWA 1T2EA 4CMEC 1S7CA 2NADA 2GGSA 2Q2QA 3OQ6A 3I23A 2VHYA 3F5QA 3KRTA 3ORFA 4OO3A 4BHTA 4CV1A 5A02A 1NWHA 2PA3A 3JSAA 1ISMA 1YB4A 3HQ4O 1WP4A 1DRWA 4IPTA 4BNZA 1E92A 5JXWA 2VYNA 1LX6A 3GEDA 2OZPA 4PLTA 2VUSA 1MG0A 1EVIA 2IXAA 3EY4A 1YONA 1IZ9A 8ADHA 2AHRA 4BO0A 5IXYA 3R1IA 4XZ3A 5TJ9A 2NTNA 2BGLA 3LT0A 3B20A 4GI2A 3K96A 3ZU2A 4CQLB 4A10A 4D7AA 5KVQA 5KJ1A 2RIRA 4O59O 3UXYA 5JAMA 3FI9A 1YXMA 1H6DA 1P74A 3BHMA 4IDFA 5BSFA 4LW8A 1G1AA 1Y81A 4CL3A 1NX6A 2DLDA 4KQWA 5ITVA 3AOGA 3ADOA 2ZYGA 3JQCA 1YDEA 2AA3A 2G0TA 3P5SA 2DBRA 4F3YA 3NJ4A 4PRKA 3FNHA 2J3JA 4HFNA 4Z9XA 2R2GA 1GU7A 3MWDB 3RC9A 4E5PA 2YFQA 2BMAA 3EAGA 4BO8A 1YBMA 4W9NA 2PKQO 1NNUA 1XELA 1AUPA 4CLXA 2I9PA 1GYPA 2Q4BA 3TF5A 3WGGA 4TRJA 2GSDA 3CMCO 1D8AA 4ZHSA 5JY6A 3E1KA 4QSMA 3I52A 4YACA 3AOEA 3D5QA 2GDZA 3IP3A 1N7GA 1C1XB 3L07A 4KUHA 4Q3DA 5TF4A 3PLNA 3ROKA 1QV7A 3PDJA 4ESOA 4YYZA 1VJ0A 5HTOA 4KWIA 3D3WA 2AEJA 4BNIA 3FR8A 1D3AA 4FFNA 2B69A 4BGVA 4JCOA 4E2XA 2W2KB 3CINA 4DQXA 2D3TA 4XRRA 1BVUA 1SNYA 1UXIA 1B3RA 2XOXA 3W8DA 4RVDA 1NR7A 4EI2A 3FNEA 4C4OA 3GFBA 4CLOB 3EK2A 2G76A 3IP1A 4FS3A 2BKAA 3T4EA 4DMLA 1YOVB 2X0NA 3I9LA 4HBGA 5I7SA 2C07A 4YAIA 4WECA 1DLIA 1UZNA 3WTBA 2OGUA 1OAAA 3IC5A 1ZIDA 4JBHA 2Z95A 4D79A 1PL6A 1P0FA 3IUSA 4BNYA 1LDEA 1WVGA 4HP8A 1CIVA 2Q45A 2I66A 4IJUA 5C3MA 1EMDA 1HDOA 2JAHA 1CJCA 4P4NA 4RF3A 1I32A 3DZBA 3VZSA 4ZJUA 1XEAA 4E12A 2IDZA 4I08A 1P0CA 2AQ8A 3H3JA 3L6DA 3PGJA 1R6DA 3WR5A 1RKXA 1GEEA 1Z75A 3F1LA 3QWBA 1OFGA 1BSVA 5IG2A 4NQZA 3GNQA 3IOYA 1DJQA 1V0JA 2NU8A 4DMMA 1LBEA 4FJ0A 1IHXA 5CG1A 2DTEA 4MO2A 4GPD1 2B4QA 4GSKA 1GQQA 1V35A 1YVEI 3F1KA 3WWZA 3K5PA 2ZJ1A 3R0IA 1J5PA 5HRUA 4GH5A 2UUOA 3A4VA 5JAIA 3T4XA 3KUXA 4GWGA 4QTZA 2C2XA 1VRWA 3LQFA 1B15A 1R37A 3KB6A 2OORA 2QX7A 3U3XA 3AFMA 1AHIA 2JCVA 2Q4EA 1NFQA 5DP1A 3ZZNA 4P4GA 1NQAO 3VH2A 4MP3A 2UDPA 5KJ6A 4YQZA 1LDYA 1DSSG 4YT4A 3MOIA 3NJ8A 1UXJA 5DBIA 2PZLA 2NTJA 1XQ1A 4OHUA 4CMGA 1DAPA 2Q50A 1IUKA 3IUPA 4PLZA 1KVTA 3D3WB 2I6TA 4J7XA 5DT9A 4DC0A 2PGLA 5TJHA 1ENOA 5KJCA 1Y5RA 4FW8A 3WSVA 1H94A 2NU9A 3DWFA 3AUUA 4MVJI 3ENKA 3PPIA 2Y0EA 1JDJA 1T1RA 1EUZA 5JDIC 2B0JA 2Q49A 1QXSA 1DLJA 1EDZA 5CPFA 4A2CA 1PR3A 2GF2A 3DQPA 1HE5A 1M2WA 2ET6A 4GX0A 5A3VA 1O95A 2Y0DA 2PY6A 5B1YA 2PK3A 5TSDA 3HHPA 4FDAA 2IRWA 3BIOA 5DOZA 4OH1A 1IB6A 1H9AA 2EP7A 4DLBA 4Y98A 4YA6A 4BNGA 1HWYA 2GRAA 1LRLA 1ZUD1 4BNHA 4JX8A 5DCUA 1I24A 4E5KA 3JQDA 4TRRA 1HTBA 4CODB 2DFDA 5T6BA 5KVVA 3QIVA 1UZMA 3AM3A 4NU5A 2ZB8A 2PD6A 4U6SA 5EERA 4NIMA 3WGIA 1LC0A 4OM8A 4L0QA 4CMJA 3NT2A 3NGLA 2P9CA 3K8ZA 2GPTA 4IINA 4CM8B 3AFNA 2GZ3A 4UAGA 4KMSA 1JVBA 1WZIA 3JCZA 4CMIB 3UCXA 5AYVA 3PHJA 1GV1A 5TQVA 3BMNA 4QO7A 4I9HA 3JYOA 4YRBA 4PZEA 1ML3A 4J7CA 4HWKA 1O0SA 4XQCA 1HYGA 3KYDB 3AM5A 1KEVA 5ICMA 4I8XA 1O89A 5DN9A 1Z7BA 1TLTA 3OEYA 2PFGA 4D42A 4XA8A 1R0KA 2E49A 3CKYA 4ND5A 2BFAA 3GZNA 3LT2A 1VPDA 5LC1A 5IZ4A 1P1HA 4TZKA 3TZKA 1PGNA 3U09A 5IAAA 1LDBA 4GSLA 3DBHA 3OIGA 2Y99A 3DMYA 3LSYA 4IDCA 3K6JA 1MC4A 3CH6A 1DIBA 1IULA 1PGQA 2JAPA 2P91A 3WFIA 1SOVA 3KETA 3BMOB 3RBVA 1TEHA 2EGHA 3G1UA 4IGFA 4EUEA 2PZJA 2VRBA 2XPCA 2YJZA 3DAPA 3X2FA 4Q3NA 2WYWA 1Y6JA 1ZXBA 1P45A 4QO8A 2GN8A 1Q1NA 1K6JA 1HYHA 4WPGA 1OMOA 1J49A 2WJPA 4Y9DA 1MUUA 2QG4A 1DRUA 4IMPA 3F47A 2FSVA 5TS3A 1NVTA 2G5CA 3ONFA 2WDZA 2Y1GA 4B8ZA 1TA4A 1YL7A 3ETDA 3GVXA 1E5QA 3O38A 4TWRA 5TRTA 3RUFA 2Q1UA 2IE0A 2CDBA 1PZGA 4J6FA 1LSUA 1M66A 1CQJA 2H1SA 3CE6A 4XRGA 3GOHA 5CPBA 2DUUA 3MOGA 3OSUA 4XYLA 3E8XA 4L4SA 4UREA 4E2WA 5TNXA 2X86A 4RPHA 4GKBA 4CQMD 1JTVA 1V3VA 4JGBA 3D7LA 5COAA 4ZQGA 2O3RA 2X9GA 1YBVA 4I9UA 3WQSB 4P22A 2E6UX 5KOIA 3HZZA 4BO7A 1BXKA 3LC2O 4PLPA 3KEOA 5FFFA 1W73A 2OBNA 4I5GA 4CV0A 1N2SA 3PZBA 1PQWA 1EBFA 3QWAA 4WLFA 1BGVA 3ZWPA 3JQGA 4CLRA 3PIDA 3U49A 3OJFA 4KQXA 3BTUA 4OL9A 5HM8A 4G81A 4AJJA 4D0SA 3H5NA 3KEQA 4Y6PA 1EE2A 3PQFA 1OI7A 1X1EA 4I5DA 4UUPA 4R3NA 4GWKA 2RH4A 2VT2A 3VKVA 5L4LA 4JNKA 3WYEA 4B3IA 4DWVA 2X4GA 4PLGA 5T67A 1RYEA 1FDVA 4DLAA 2CY0A 1UZLA 4XD2A 3W4JA 2PR2A 4H15A 1UP6A 4J1SA 3ZWCA 1CDOA 4KTVE 5JO9A 1BW9B 3HDJA 1PEDA 1DXYA 1PJCA 2D59A 2ZTMA 1UP7A 4FR5A 2B35A 1LJ8A 1C14A 4OKIA 3WJAA 2IZ1A 4UUOA 2DBQA 4NBTA 3BMQA 1E5LA 5I7FA 5BSGA 2UVDA 3GG9A 1PS0A 4N54A 2R00C 3NDIA 4L73A 3C7AA 3VH4A 1UXGA 2VWQA 4K28A 4N5LA 4BMVA 5A5EA 4RLSA 4CM5A 4DLLA 5JLAA 3E5RA 2Q3EA 5A1TA 3HDYA 5L53A 5L7TA 4CR7A 3GVCA 3MJSA 2DM6A 3UUWA 4PN3A 3V2GA 4M8SA 1ULUA 5FF9A 4XDYA 1VSUA 4JROA 4AJNA 3FD8A 4Q3CA 4F6CA 1NTOA 3ZHXA 4B4WA 2CF5A 1VLLA 4MVJP 2GERA 5GY7A 1PWZA 3H8VA 4PLHA 4WLVA 2BI7A 3KXDA 1HDGO 1OC2A 3KLMX 4KP7A 4YQYA 4R9RA 2EERA 1LRJA 3GR6A 4R5MA 3WIDA 4IS2A 5L4SA 3NKLA 4RJTA 4S1VA 3EMKA 2Q99A 4E2YA 3PHLA 2ZYDA 3ANLA 3KM0A 1I01A 3OBBA 1QLHA 4RO0A 3UOGA 1YB1A 2RHRA 3P2OA 3JQGB 4CLRB 2Y1OA 4GLLA 2BELA 3DBRA 1DB3A 3L0DA 5K0ZA 3WS7A 3K2BA 2J5QA 1Y9AA 3CZMA 4WJZA 4ROSA 1LRKA 2UAGA 4CL8A 3P7MA 4WE3A 1HYEA 2WEKA 4W4TA 1QG6A 3PQDA 4WLEA 3ZDFA 4UEOA 2ILTA 1RJWA 3Q1LA 4INAA 3UH1A 3AUTA 4PZDA 4ND4A 5LCXA 3VVCA 3IL2A 3HG7A 3W8EA 1MG5A 3JYNA 4N7RA 4BUCA 3U4CA 3EW7A 2B5VA 1UAGA 4YXFA 3ON5A 3E18A 4M49A 1FXSA 4CMBA 5B4UA 1ADCA 1SO8A 4R9SA 3DMTA 4BB6A 2DQ4A 1PX0A 4JJGA 2YHUA 1NQTA 4GLOA 2GZ1A 1DDOA 1RM3A 2WD8A 3A06A 3GF4A 4YJHA 4Y67A 5B4VA 3IAHA 4PG6A 3AU9A 4XIJA 3H4VA 4Z3KA 3RJ9A 2VHZA 5EL0A 2AW5A 4J49A 2J5RA 4YCAA 1S6YA 2EP5A 4BO6A 3WJ7A 3GVHA 4YR9A 1KIFA 3OJ0A 5JNLA 3JYQA 3LF1A 5I7VA 3X2EA 3N74A 5JO0A 3W6ZA 3DOJA 1QORA 4LK3A 3ZNOA 1U28A 1OZAA 2NVUA 2YV2A 4OQYA 4CV3A 4MVJM 3WGOA 3I9MA 2OFPA 4FC7A 4NH4A 3I9KA 4OJNA 4BNWA 1GR0A 2H6EA 2O3UA 3P2YA 1A5ZA 4KDEA 3PFFA 3DTTA 1X13A 2RAFA 1ID1A 2EW8A 4NBWA 4O5OA 1PR9A 2BGMA 5A06A 5T64A 4EEZA 1K3TA 1QLJA 4KUGA 1SCUA 3T7EA 1IZ0A 3QSGA 5A9SA 1C1DA 3C8MA 4WOJA 3BMCA 3TDKA 4YT8A 3RKRA 4BOYA 1G0NA 1ULSA 2FZWA 4J90A 1KOLA 1QV6A 2C54A 3WXBA 4YWJA 1ORRA 1IYZA 1KYQA 3KO8A 4FCCA 4Q39A 5I9LA 1DAOA 3C1AA 3GVIA 4CM9D 3FNFA 3QWFA 1O9BA 5DNAA 1QKIA 1FDSA 3UAGA 4F46A 4IIVA 1A7KA 1PL8A 1PJSA 3PWKA 5BQFA 4UUMA 4O63O 5TT1A 3S2GA 3A14A 2VOJA 4II3A 4ZRMA 4NJMA 1IOLA 5J23A 2OO5A 4G2NA 1PJ3A 3U9LA 1GADO 2I3GA 5KVCA 5JS6A 3GFGA 3C85A 1JA9A 1XU9A 1AGNA 2O3TA 4PZCA 4FFMA 3G79A 4E21A 2X22A 2FR0A 5JBIA 1C0KA 1P31A 1R4NA 4ZQFA 4CM3A 4CUKA 3GMDA 4OYRA 4E13A 4MVJG 2D4AA 5G0VA 3OJOA 4R01A 1K89A 4RPLA 4PGFA 1VJTA 3BHJA 3ZV4A 1JKIA 4YJHB 1DHTA 3FF4A 1NFRA 2IYOA 5KKAA 1NP3A 2IEDA 4O6VA 2P9EA 1KC1A 3RCBA 4DPKA 3RJ5A 3R6DA 4IGEA 4CPDA 2AQHA 1U8XX 2AQKA 2DU8A 3U62A 4E5YA 2VN8A 1H6CA 4M54A 1BHSA 2HQ1A 4MKZA 4OQZA 3GRKA 2AE1A 2JD1A 2CVQA 2J6IA 1AXGA 3FCOA 3ZWAA 3WNQA 3QWHA 3H2ZA 4BQRA 5A5FA 2WMDA 3GEMA 4YAKA 1JKJA 4WLUA 1NXQA 1B26A 4UVDA 1ONPA 3LZ6A 4HFMA 4E3ZA 3DBLB 3GEGA 5G0UA 1MLDA 1K6XA 4K1LA 1CQIA 5G4KA 5BSEA 1G0OA 3INGA 4XIYA 2X0JA 4DC1A 4U5QA 4NMHA 3BMCB 2O4UX 2Y1CA 4L8VA 4AG3A 4NFYA 1PJLA 2C82A 2CZCA 1R4MA 1P9LA 2VZ8A 1E3WA 3BAZA 4GQAA 1NVMB 3ROMA 5L3ZA 4J2OA 1PJ4A 5KJFA 2Y68A 2I3AA 1Z45A 3I9OA 4HNGA 4DL9A 3B1KA 1LTHR 1B14A 1PQUA 1H5QA 4UVHA 2X7HA 2PWZA 3SBOA 1T25A 1HF3A 1KEUA 2I67A 4R41A 3VDQA 1D1SA 1KVRA 4GBJA 1NASA 4R5HA 4RDIA 1PJBA 3DZKA 2FPIA 4R54A 4FFOA 2A35A 4K6FA 4GAEA 4NJMB 4XR9A 3MJVA 4BVAA 1LLUA 3JQAB 1QYDA 3WB9A 5ILGA 4J7UA 3MJCA 4OSOA 4XR4A 1GFSA 5AQ1A 2PD4A 2W98A 5EESA 4PLFA 3VPXA 5DCYA 3WSWA 2HKIA 4IJKA 4J9VA 3GZ4A 3EZYA 3KYCA 4RF2A 4J0EA 1Y8QA 5EQFA 3TJRA 3EUWA 4EJ6A 4GKVA 3B1FA 4U8GA 2AEFA 4U0KA 2EGGA 2GNAA 3RFTA 4BKPA 3TWOA 2VWHA 3MEQA 3GDOA 2CNBA 1T24A 3M6IA 3UW3A 1ONOA 2E48A 1B0AA 5K6AC 3H5RA 3C3XA 4TKLA 3ASUA 1U3WA 3OEWA 1KY4A 4NDNE 1Y8RB 4BNVA 1GV0A 5JC8A 1EFKA 2P4QA 1ISFA 5HA5A 1A72A 3FTPA 4O0LA 3A1NA 1RM5A 2F1KA 1HL3A 1ZFNA 1YJ8A 3RUCA 5CEFA 1U3UA 1EVJA 4IXWA 3TNLA 3V1TC 1UXHA 3GHYA 3PRJA 2PGDA 3OA0A 1LLDA 3AI1A 1UUFA 3Q0EA 4L75A 3RQSA 4CUJA 3WQRA 4Y8VA 1U3VA 3DC2A 3FSRA 4PVCA 4CLDA 3K9QO 2VRCD 1LNQA 1L1FA 5G4KB 4HFJA 2RCYA 1T2AA 4DXHA 4ZA2A 4A26A 2VWGA 5JPIA 1I8TA 2EJVA 1MFZA 2IZ0A 3RC7A 4P4LA 2W2LD 2QHXA 1IE3A 4YJGB 4XEHA 3C7CB 2G1UA 2YV1A 4ZQEA 1AHHA 2PTGA 1I36A 3TL3A 1NPYA 1QYWA 1ZJZA 3H7AA 4Q3AA 1BDBA 2GO1A 2I99A 1JWBB 3QRWA 4MJLA 4R51A 3NT5A 2DC1A 3LC7O 2V65A 4Z0HO 4QEDA 4NU6A 3WX0A 3SJ7A 1A7AA 4GMFA 1E3SA 2YW9A 4CR8A 1EE9A 3LF2A 4RPKA 3HDQA 4NR0A 3AY7A 1HT0A 3FWZA 3E03A 2O50A 5HS4A 1OBFO 3HDHA 3GNTA 3KYCB 2CFCA 1E7MA 3DFZA 4AL4A 3KYBA 4CMKA 4LSWA 2CSUA 3QVXA 1O94A 2NVBA 1NQOA 3ZI0A 4FSHA 3I9NA 1SEPA 5FWNA 1VE9A 4DGSA 3H9JA 5G0WA 3LLVA 3JQFA 2VQ3A 1JW9B 4HXYA 5AXCA 5I9NA 1VSVA 5A05A 3QVSA 5F21A 4FGSA 3IJPA 4YAEA 1A4IA 1UXKA 5EMHA 3VPGA 4EBFA 5COBA 5JDCC 4CQMA 1T1SA 3D4PA 4L74A 4ZQBA 3I5MA 2HMVA 3O4RA 1C3VA 4XQGA 5GZ1A 3WTCA 1MXFA 3WYCA 1R12A 3TFQA 4BL5A 4MIEA 3MZ0A 5EIOA 3WICA 5JY1A 1Z6ZA 5FEUA 4RZIA 4IUYA 5U1PA 1GPJA 2ZB4A 1GQ2A 4NPCA 3CZRA 3ZWMA 2Y1FA 4TRMA 1KY5A 3L77A 4W7HA 1C0PA 4QUKA 4WLNA 2VUTA 2PV7A 3JQ9A 3MJ4A 4I9NA 5L9AA 2NQ8A 3WFJA 4PRLA 1X0XA 3G17A 2OMEA 4TROA 3TQHA 5BT9A 1R0SA 3ZU3A 1LDMA 4OMUA 1PJ2A 3JQ8A 1XLTA 2NSDA 2JHGA 4WLOA 1GEGA 1DIHA 3L4BA 2CVOA 1YL5A 3OJEA 1LQUA 3PFWO 5CDUA 1O8CA 4IS3A 5B4TA 1HLPA 3TOZA 2ZCVA 5IDXA 4CJXA 1DFHA 3ONDA 5KJEA 2BH9A 1PGOA 1MP0A 5H81A 4DTIA 2FPPA 4ILKA 1I2BA 1XCBA 2DUWA 2O4CA 2UV8A 3SC4A 2AMFA 4BNTA 4W9NC 1BVRA 4PFJA 4W99A 3EZLA 2W4QA 1F17A 5GMOA 5CEEA 3GQVA 3HB4X 5T8KA 3PQEA 5AXAA 3DTYA 3D1LA 3AOEC 4EJ0A 4ALIA 4U7WA 1YWGO 3S2FA 5G2OA 3AY3A 8LDHA 3NEPX 5TX7A 3H65A 5IZCA 4RPJA 3EVTA 2FHSA 4XYMA 3DAGA 3NV9A 1CRWG 3OETA 3H2SA 2DFVA 5DCWA 4NI5A 4BNXA 2PD3A 2VTEA 1TT5A 3LLSA 4RORA 2GUGA 3IKVA 3LYLA 4HUJA 4NBRA 1F06A 1NM5A 4TKMA 4UVIA 3ST7A 4WCFA 5T5QA 1B16A 1RWBA 1E3LA 3C1TA 2R00A 2D8AA 2RHCA 2YQ4A 1B3BA 3E82A 4F45A 1L7DA 2Y1DA 4BKUA 1ZK2A 1E6WA 3FPLA 4QT0A 2EKPA 4JQCA 1Y7TA 2NTVA 3ZH2A 3UVEA 4KWHA 4R1NA 4R16A 4CMHA 5BNIA 5C7OO 3W1VA 5JMPA 3RWBA 5B12A 1KBZA 3TZ6A 2FR1A 3VPFA 3PZRA 4H3VA 5C7IO 1BXGA 4ALJA 1KERA 2V7PA 3I3OA 2E37A 3H9EO 1EDOA 1Q0HA 1P1JA 3ZV3A 3GGGA 3PLRA 2GLXA 5HWSA 4Z9FA 1SBYA 4J1QA 1YQDA 3WGZA 1PZFA 3CIFA 4RVSA 3HJAA 2Z1MA 4RVFA 1NAIA 3BXXA 1ZK0A 2RH8A 1ZEMA 2D0IA 2QRLA 2YDYA 1X7GA 4KDFA 1DO8A 3GDGA 3SXPA 4R68A 1AXEA 1GYQA 5ER9A 4FB5A 1ENZA 1CWUA 4OIMA 3GUCA 3DHEA 4RF5A 2Q46A 2JKVA 5AXDA 2ZQZA 2RBEA 4ALNA 1ZCJA 3FTNA 3CMMA 1B2LA 5L7YA 3RC2A 3H3FA 3OIFA 4OOEA 3QJ5A 3U4IA 4ZRNA 1SZJG 4IQ8A 4FPXA 4H16A 2A94A 2IEBA 5L7WA 4M89A 4BGIA 2OOSA 1WDMA 4M55A 1RM0A 1PSDA 2VWPA 2HLPA 2VOEA 4D43A 5EN4A 5AVOA 3BMNB 4OXNA 4DA9A 3UKOA 3GAZA 1PJTA 3NTOA 3WOHA 5L95A 1HDYA 3UCEA 3FWNA 3OQBA 4FFPA 5JW6A 4NBUA 3JD4A 3PGXA 1PZHA 2BI8A 3ZN2A 3BZUA 4AJLA 2WYUA 1A27A 4ALLA 3IIEA 3RU7A 5BR7A 2FR8A 3GZNB 3LT1A 2VNAA 3RFVA 1P44A 4IJVA 5JE8A 4CM6A 3JD2A 3JTMA 5EQDA 2OXIA 3DBHB 1E7RA 2O23A 4NFHA 3GGPA 2JFGA 3S1LA 4WUVA 4WEOA 3S2EA 3UHAA 3UN1A 1A71A 4XGNA 1GYRA 1I0ZA 4JK3A 3GG2A 2V6MA 2CF6A 2GYYA 1KEWA 3NRCA 4YRDA 4Z0TA 4ZGWA 4CM9A 4DQUA 2CUKA 1LI4A 3W6UA 5CDYA 4GVXA 2WD7A 2HRBA 1ZMOA 3QA9A 2NU6A 2QZZA 4IM7A 1BXGB 4Y6SA 3QQPA 4E5MA 3CSDA 1ENYA 3RSHA 4IDAA 3RUDA 2I65A 4LSMA 4B4VA 3WGQA 1I3LA 2HMSA 3ZWOA 3K73O 3WBFA 4EW6A 2IODA 1QYXA 2P2SA 2WE7A 3MTGA 3ABIA 3ZHZA 1ISHA 2H9IA 5F3RA 1CERA 3SVTA 1QSGA 3ZWVA 4DPLA 1WMAA 2P68A 4W6ZA 4J4BA 4E31A 1A9ZA 2DPHA 4BKRA 1DJNA 1XKQA 1UJMA 1X14A 3F4LA 3EGOA 3QP9A 4IQGA 2G82A 2GN6A 3TFOA 1EZ4A 3GY0A 4DVJA 4XYGA 4B8WA 2Q1WA 3OF2A 1P77A 3PTZA 3I6QA 1E77A 1YDWA 4K6CA 1ADBA 1ZSNA 1MXHA 3DL2A 1ZMTA 7ADHA 3GC6A 3RAJA 1DEHA 2ZKLA 1X7HA 2XAAA 1W6UA 4IDGA 3WLFA 1J6UA 2FRDA 2PGJA 2ZCUA 4CM7A 3TN7A 3VH1A 2VHXA 2IXBA 4JP2A 3MJTA 5KKCA 2WM3A 2CVZA 3IDSA 1DC3A 4AJ2A 1LEHA 1E6UA 4FC6A 3DBVO 3QE3A 3ZNPA 4UEKA 4NK5A 4BNFA 3PWSA 3NDJA 2WTBA 4R1TA 2V6BA 4BO1A 2YHIA 4LGVA 3A28A 4BMSA 4IY1A 2NVWA 1BRMA 4D3SA 3UF0A 4WEQA 4LCEA 4ZN6A 4AVYA 1PJQA 1FDTA 5LDGA 1E3JA 1EQ2A 1GZ3A 3M1LA 3D3EA 4OOFA 1JN0A 1GD1O 1NWCA 2VT3A 5MGBA 2HJSA 5A3JA 4RPGA 1XYGA 1O6ZA 1R0LA 1U7HA 1XQ6A 4UULA 4XGKA 3UFXA 1ONNA 2VTDA 4G5HA 3K92A 1LXCA 4G65A 4J16A 3ZV5A 3O26A 2EG9A 2FP4A 1HE3A 2ZIZA 5TLSA 4IZHA 2X5KO 3OJLA 2Q2VA 4DRYA 1VM6A 2QYTA 1DIGA 4QX6A 3BMQB 5CEJA 2X9VA 3JQBA 1A4UA 3JD3A 3O03A 2WWRA 5F1PA 3GHHA 3TL2A 1BG6A 1F8FA 5JFOA 3ZWBA 3BHIA 4S3MA 2BRUA 3BA1A 1X15A 1ZBQA 1E3EA 1LSOA 2HO5A 2FMUA 3JQ7A 2SCUA 4UEJA 1ZK1A 2AEMA 5TC4A 2J3HA 4LVCA 1H6AA 2P9GA 5THKA 2PH3A 4FQ8A 3JD1A 1U1IA 1VL0A 2GZ2A 4I1IA 4A0SA 4EITA 1ISGA 1V3UA 2GN9A 3TOXA 4CMEA 5T57A 1WW8A 3U0BA 4Q9NA 5DZSA 1ZNQO 1XU7A 3WGHA 1R16A 3WLEA 3PYMA 1LSSA 2FOIA 2EEZA 1LSJA 5CAEA 3IKTA 3Q9UA 2C5AA 1EFLA 3HN2A 3ADPA 4YB8A 4FJ2A 2AE2A 1E7SA 2DAPA 3Q3CA 4FBGA 5A9TA 5KTKA 1V6AA 2XXJA 3QVTA 1ZO8A 5JAQA 2VCYA 2GN4A 1CYDA 1YO6A 4E30A 4BV9A 3HUDA 1UDCA 4ALKA 3ULKA 2GCGA 3PDUA 4PG5A 3I4FA 4K9DA 2C0CA 2E4AA 5JCXA 2VHVA 1F12A 4LRSB 4Z9YA 2CDCA 1Q2XA 3H6KA 5ENDA 1E1NA 4MINA 3FBTA 5ENVA 4E2ZA 1NAHA 1EEHA 5A03A 5L45A 5CDSA 3DBRB 3B6ZA 5EINA 1NHGA 4BO3A 2QYSA 4FIZA 3NAQA 4DYVA 2VRCA 1U5CA 2WE8A 2X23A 1RYDA 1IPFA 4NG5A 2HMTA 5CP8A 1U4SA 4BO9A 3OHSX 2EWMA 1B8UA 1HLDA 2HUNA 1JAXA 2Y67A 3RROA 3W4KA 4BNJA 3H9QA 5CDTA 9LDBA 1UDAA 1JVSA 5ILOA 4KUEA 5BNTA 1Z74A 4N5NA 2BFOA 2EKLA 1JLLA 1K6IA 2GD1O 4M86A 2W2LA 3SLGA 2HMWA 3WGYA 1HE2A 2X6TA 3WMWA 3U4DA 1Y1PA 3ZW9A 3RASA 4YBZA 3DAFA 3RIHA 1GTMA 3HWRA 2X9NA 1VC2A 3KTDA 1NVGA 4R1UA 3WYBA 1W4ZA 2B36A 4FFRA 4R1SA 4PG4A 3MCVA 2HK8A 3PJEA 1VL6A 2OL4A 4J4TA 4B7CA 2YQ5A 1E1KA 3BTVA 1YGYA 3GH3A 3NT4A 4Z3DA 1U8FO 2UYYA 5IN4A 4PLCA 3AI2A 5KWEA 3JQ7B 2NVUB 4RQTA 2D5AA 1RM4A 3VC7A 4ONEA 2AG8A 4RCVA 4BGUA 3INTA 1PS9A 5L40A 1SC6A 1YBAA 4E0BA 1Z73A 3R3JA 2FZEA 5IDYA 4D45A 1A9YA 2Z1NA 3FBGA 1QP8A 1D7OA 4DQVA 2Y66A 3HADA 5A9SB 2FPGA 1C1DB 1PGJA 1ARZA 2FY8A 4TQGA 4YAGA 4ND3A 5ITWA 3B70A 4TSKA 5G4LA 1D1TA 1OC4A 3RBZA 4MP8A 5IF3A 2J3KA 3GT0A 3VTFA 3QLJA 1TVEA 5JMWA 3DMTC 3FNGA 3F3SA 1K5HA 3V5NA 3WQQA 4A03A 1XSEA 2R6JA 1FK8A 1I30A 1HEUA 3EYWA 4XQ9A 3U4HA 5C7LO 1Y9EA 1C1XA 1GDHA 1ZJYA 1ZW1A 3CEAA 4HADA 4BMNA 2DBZA 5K9ZA 1DIAA 3E48A 3OICA 3RFXA 1KS9A 1EVYA 3AY6A 4I5FA 4L4RA 2EJWA 2HDHA 1XG5A 3O8QA 1GAEO 3TZHA 2PKRA 2HCTA 4CM4A 1DHRA 4DPMA 3S8MA 4JLWA 3WWYA 2A92A 2DT5A 1VKOA 4D3FA 2O7QA 4HNHA 2PZKA 1XA0A 1O5IA 3ZWNA 4OGWA 2BLLA 1YOVA 4IQ0A 1ZEJA 2ZTVA 3F6YA 1NR1A 4AJ1A 4PVDA 2ZK7A 5JDCA 4EDFA 3FHLA 3Q11A 1R4NB 1HRDA 1EVZA 3I9JA 5HS6A 3DZHA 3WIEA 4IIUA 3QV1A 1V8BA 2YY7A 4MVJE 1RPNA 1JQBA 1U9JA 2VZ9A 4XYEA 1YB5A 2G17A 2FSSA 2VUUA 4DBVO 1P1RA 2ZYAA 4Y6RA 1F0YA 4NZ9A 1BMDA 3AI3A 1I5RA 4BO5A 4MVJF 4LN1A 4BNLA 1E6EA 1JU9A 3DZIA 3FPCA 5BNFA 2ZTLA 2NU7A 3M2TA 4FN4A 4MP6A 2AXQA 4A5OA 5A04A 3UCFA 5JDIA 3DZGA 3GGOA 5KIAA 3PK0A 3FR7A 2UUPA 1JAYA 4YDRA 2IYPA 4XQEA 2JD2A 4DUPA 4A7PA 3U5TA 4NBVA 5ER6A 3M2PA 4ZU3A 1GCUA 3ZU4A 3PYLA 5CG2A 1FDUA 1N92A 4KZPA 3N58A 2HRZA 2C5EA 1YJQA 3PVZA 2HAEA 2Q2WA 4JXKA 1R4MB 3RKUA 3K31A 1E3WB 1FDWA 3ZHYA 4OAQA 2H63A 1P3DA 1LLQA 4KTTE 2XXBA 3PJDA 3D5TA 5C37A 2XF8A 1SAYA 4MVJD 4TRNA 3JQAD 4MPDA 5COQA 4EJMA 1E7QA 4BNUA 3L6EA 3EVNA 2QW8A 1WAMA 1NYTA 4WNCA 1AN9A 4EZBA 1XDWA 5KVSA 2EF1A 3IQDB 2D1YA 3O8QB 3KZVA 4JBIA 4GGPA 4MDHA 4CM4B 2NNLD 5IDQA 1ZKMA 5DF1A 3OH8A 1Z82A 3EC7A 3PXXA 5U4QA 1TT7A 4XJSA 5THQA 4JN6B 2PZMA 4IZIA 4RL6A 1JKFA 4D0RA 3GUYA 1IY8A 1Y8QB 3SJUA 3C7DB 4RVGA 3PI7A 1VKNA 3DOOA 2W8ZA 4XJTA 5JCJD 1T26A 4WCDA 3PWZA 4BKQA 1I33A 1P33A 4YJDA 2B4TO 1YL6A 4P8RA 4RDHA 2O2YA 3PHIA 1HXHA 4IXTA 4AJIA 1ZZEA 5EPOA 4CV2A 4CUZA 4D41A 3SX2A 2X8LA 3Q2KA 3GPIA 2FN7A 3A9WA 1HETA 4MOWA 1PGPA 2VYVD 4PLYA 5ES3A 4WOKA 4CM8A 5FYDA 2VNSA 1ZH8A 1WDKA 4FGWA 4CMIA 3LDHA 1E7WA 3ITKA 3OM9A 4HY3A 4R69A 3ZHBA 4RGBA 4NNJA 1GZ4A 1B8PA 4E4YA 4WK6A 4AFNA 7MDHA 3HFGA 4AJKA 3KYDA 4ZD6A 2BHLA 5F1KA 4HX5A 1XGKA 1PL7A 1IHYA 1QYVA 1KETA 2JFHA 4GX1A 2X58A 4C7KA 5IXSA 1Q7GA 3DB2A 3ETEA 4CM1A 1N9GA 1DRVA 1LU9A 3AUSA 3VZRA 4EYEA 3VH3A 3NGXA 3MJEA 4XB2A 4IJWA 3VVBA 3TSCA 1H93A 1T4BA 5G0SA 1H9BA 4L4XA 3GMSA 4EUHA 4MVJH 2HK7A 1LLCA 3L6OO 5GZ3A 3NTQA 1F14A 3BMOA 1GPDG 1X7DA 1R15A 1FF9A 4DIOA 4IMRA 3VZQA 5CFZA 2VYND 4LMPA 2AQIA 3AK4A 4XWYA 4B7UA 1DIRA 4J1TA 1M67A 5BSHA 3JYPA 5JYDA 3ZCXA 4NJOA 4Q3EA 3H9GA 4J1NA 3ZU5A 1HDRA 2QRKA 1NBOA 1N8KA 1PWXA 4DIBA 1ZXLA 4AJPA 3RUAA 3DXFA 4J91A 2NWQA 1BXZA 1DC5A 2ZTUA 6LDHA 4RZHA 2D2IA 1HZJA 3E9QA 1JWAB 4NHEA 4QQRA 3VOSA 2C7VA 3QW2A 1ISJA 3E9NA 1T2FA 3IMFA 1GY8A 1TI7A 1DC4A 3PP8A 4MIYA 5DDIP 3S55A 4E32A 3PJGA 5AXBA 4B3HA 3DEYX 1ZK3A 4YVFA 3VHRA 3AU8A 1I10A 2TMGA 5JSFA 3KSDO 2O2SA 3ICPA 4LMRA 1P1IA 2I76A 4RVHA 3JQEA 4W7IA 4FJ1A 3RUIA 2VHWA 3LVFO 1MV8A 3C1OA 3KV3O 3PYXA 2Q1TA 1J0XO 3JQ6A 3PIIA 2B37A 1GQYA 1GZ6A 4F6LA 1WNTA 3C24A 4JBGA 1P1KA 1MB4A 4CQMB 1PTJA 1H6BA 4UVGA 2YYYA 1BWSA 3TZCA 3OQ1A 1E3IA 3PHHA 4AJ4A 1G6KA 4IDDA 5L51A 4YRAA 2O3JA 1ZVMA 1H0KA 5TIIA 3UGKA 3DZFA 4PIVA 1YRLA 5KNLA 1V9LA 2EKQA 4H7PA 4Z6KA 1U5AA 3HNPA 3AWDA 4CR6A 1NFFA 3B1JA 1M75A 1N9GB 3D4NA 2EW2A 4HFRA 3VTZA 1YQXA 4UUNA 4GGOA 4XDZA 5IN5A 4CLEA 4I5EA 1E0DA 2Y1EA 4WNIA 1N1EA 2BF7A 2GASA 4ID9A 3SC6A 2W90A 3QVOA 5I8WA 3W4IA 3E9MA 3NX4A 4TMFA 3JQ8B 2NACA 5TT0A 1QYCA 4EGFA 1N7HA 2WSBA 1DBVO 2JHFA 3QVWA 3JQFC 3PHGA 5DP2A 3DR3A 2OUIA 2Q1SA 2CMDA 1BW9A 3OECA 3L9WA 2QRJA 1SEVA 3DDNA 1M6WA 4A27A 1T2DA 3BYZA 3HFSA 1E7YA 1I3MA 3CTMA 4P38A 4U6QA 3INRA 3V1UA 1K0UA 1Z7EA 1YS4A 5DOVA 1PS8A 3TPCA 1Q7CA 3CPSA 3RBXA 4Q3BA 4QFCA 3LC1O 4RV9A 3F9IA 1V3TA 4MKXA 1KVQA 1NPTO 5DBFA 2LDXA 5JAZA 2YUTA 4RVUA 3AUAA 3GN2A 1X1TA 3O9ZA 4QXMA 2JCXA 2ZJ0A 2X1HA 3AJRA 4FD3A 5HBRA 3WDSA 4BS9A 1EUCA 2PH5A 4XYBA 4ND2A 6ADHA 1M6HA 5MDHA 3RI3A 3DHNA 3F5SA 5JC1A 4HV4A 1KVSA 3JQ9C 5H82A 4LCJA 3V8BA 1W8DA 1ADFA 1Y5MA 2POQX 3AM4A 3DO5A 4YJFA 2DKNA 1H2BA 2I5PO 1HSOA 1TT5B 1EUDA 1ADGA 2P5YA 2IZZA 2V6GA 1UH5A 1SPXA 1IPEA 4WCFB 4JIGA 3TZQA 1I2ZA 2HJRA 3L4BC 4FOSA 4O1MA 4JJFA 4AJHA 2P4HX 3NTRA 4PG7A 4TVBA 3JYLA 4PCVA 2QZ9A 4BNNA 3EDMA 1R66A 4ITUA 4MIOA 1D4FA 3D4OA 4LVUA 3PEFA 5A4DA 3GA0A 3ZWWA 1KEPA 2VZ0A 3GAFA 4XKJA 1MX3A 2E82A 2EIHA 5KCZA 3STHA 1WMBA 4B79A 2JCYA 3VPSA 2LDBA 5T8KC 3ASVA 1C0IA 4HKTA 1MA0A 3LU1A 3T7CA 3I6IA 4GMGA 1HE4A 3G0OA 5IZCC 1CETA 1WLYA 3OIDA 3MWEB 3G3EA 1IL0A 1EK6A 1VI2A 3ROQA 3VPHA 1ISIA 1GUYA 3KBOA 2H5LA 1Q7BA 2J3IA 3ICCA 1SB8A 3DOCA 1FJHA 4N18A 4KOAA 2GR9A 3GDFA 4BV8A 1YQGA 4YEDA 1M76A 4WCFC 4CLHA 1DC6A 3ANNA 4JP3A 5TGDA 3RD5A 5JYEA 3HE3A 3F4BA 1QR6A 4ZQHA 1XHLA 2B5WA 4RLHA 3ZNNA 1B8VA 1BDMA 3N7UA 4B4OA 2JJYA 1MC5A 3V2HA 4DREA 1DFGA 1U2GA 4J4HA 2NM0A 4FFLA 1WXDA 1Q0QA 3UICA 3OMLA 4OSPA 5IFLA 1BTOA 2NLOA 3GK3A 4TVOA 1WPQA 1ZSYA 1N1GA 4R3WA 1LDNA 4IBOA 3VAZA 3E6AA 3QY9A 3WBBA 1LC3A 1AE1A 3ZNQA 1NQ5A 3RVDA 1EK5A 4GX5A 2BD0A 1L7EA 1YE3A 4YJFB 5FI5A 4DIFA 4PG8A 3M1AA 2BFMA 2O3SA 2YFHA 2X5JO 1NPDA 3I83A 2OP0A 3NYWA 4BQPA 4PLWA 4LRTB 1HKUA 3K30A 5F5NA 3KSZO 1LQTA 4ALMA 4BNMA 5A9RA 2NUAA 4J43A 3VZPA 3D0OA 1UAYA 1TB4A 4W82A 4XX0A 3OP4A 1SB9A 3G49A 4J2HA 2BFPA 1KC3A 4B3JA 3Q6IA 1I2CA 2QQ5A 1YH3A 4E33A 2WYVA 1P1FA 3ZGYA 9LDTA 2WD7B 3ZWXA 1GUZA 3ZW8A 3BTSA 4EEXA 4XCVA 3JV7A 2ZATA 4YAJA 4IDEA 4ZICA 2D5CA 4BB5A 1QRRA 3JD0A 3NUGA 2X0RA 1UDBA
chains in the Genus database with same CATH superfamily
1KQPA 1YZ3A 2XAUA 4LXGA 3TBFA 1WA5A 2OCAA 4L72A 1JEAA 3OAAD 5GZ6A 1D2RA 1KPHA 5KYGA 2I6SA 2YDXA 4B2YA 1JHOA 3MWFA 1DTEA 3CRW1 4LYJA 1Z6XA 3GCGA 2E5FA 3FPKA 2TMDA 2C2GA 3COSA 4FE4A 5TPZD 2M9MA 1NI4A 1SBHA 3OQIB 1N6IA 3ZKWB 4CMCA 2OM6A 4AJOA 3SEFA 1YZYA 5F1YA 3DE5X 4PZPA 2V0CA 2HA4A 4K9PA 3GEHA 1HDEA 1PZEA 3AHHA 3CH5A 3LK6A 3QPCA 4Q18A 1MN6A 3T0GA 2NSLA 5F98A 1SCKA 4S1TA 4C7JA 2QL6A 1O97D 3E5MA 4B4UA 1QK5A 3T3IA 1DPGA 3DBIA 3AC0A 5KX5B 2VP9A 1BS1A 1FFBA 3O8CA 1KQOA 4ZDWA 4YRCA 3I0NA 2FNAA 5D3MA 4J0FA 2JD0A 2Y1XA 4EABA 4Q1FA 4FOOA 2WHQA 2X5OA 1M2OA 4JYCA 2XDQB 3HLTA 4O2AA 3ROPA 5H3HA 3AEUA 5B37A 5GTDA 1EVEA 2EWWA 1FW6A 1T5BA 3GLQA 4L5CA 4ZC8A 3ZWDA 2WIDA 3AESA 3D3NA 4KRYA 3ANTA 3IVGA 1UC8A 4ZEWA 4M8KA 1A8PA 4XFDA 2BGIA 3K16A 2VHUA 3O1IC 3KLPX 3Q9NA 4NFSA 3GZTB 5H7XA 3R3HA 4D46A 2ZCJA 2A1UA 3QWIA 4IDBA 4HS9A 4LZAA 3UW1A 1RKBA 3WGKA 3NU1A 1XYVA 2GXSA 4L95C 1V16B 2VQSA 4A91A 3EVDA 4OQEA 1K88A 5K51A 3ZWYA 1Q1ZA 5LVAA 2FPRA 2WIGA 2BCGY 2JLUA 3FF1A 5ALKA 2JJ1D 3AXSA 2IE8A 3AIMA 3HY6A 3K1ZA 4PYMA 5M5BA 1UR5A 2QTZA 1EDBA 3B60A 4TLAA 4Y9UA 5TGZA 1O0BA 1VL5A 4HSEA 4CQNA 3S2YA 1NRJB 4RS3A 5ADHA 2Z2IA 4XX0B 3LO5A 3CLTC 4B74A 1K06A 2YZ7A 4F2GA 3IEMA 1LBIA 2R1UA 4WBNF 3HRHA 4ZVVA 4UHHA 1O6GA 2HU7A 1YASA 1P60A 4UVEA 3NYQA 4L76A 4RMGA 4QTUB 1G8JA 1XALA 3QUCA 3SXUB 2C2WA 1PR5A 3JQAA 2HHCA 5J40A 3EVAA 3HN7A 2D2EA 3ELDA 4YLEA 4H6VA 3D7NA 3WB2A 5TQJA 3HEBA 3V1YA 4OKNA 3ZKAA 2JFFA 3Q40A 1BNCA 2EGUA 2Q2OA 1LDGA 3CVOA 1XCOA 3G13A 3H9UA 3Q3EA 3QNUA 2O0HA 4JJIA 1HZZA 5JV5A 1CJUC 5J3JA 2C88A 2FUG6 3PIRA 2Q5LA 1XFDA 1OVGA 1OW3B 4N8EA 3ICVA 3OPNA 4KYVA 4CQLA 4D44A 1WZEA 1Z36A 2RAPA 2YIDA 4N4AA 1FTSA 1PQPA 2MOKA 3NXKA 4X3CA 5IWAB 4O3FA 3RS3A 4BIIA 3I32A 4G5FA 3Q8KA 3HDVA 3IQEA 2DVMA 4HJXA 4D3DA 1EBUA 4AQDA 4EFNA 4WGGA 2C2YA 5CCEA 4W1SA 2UVPA 5KYYB 1QHYA 1WWKA 3K15A 1NF3A 1Y8RA 3BIXA 3D4LA 1F9AA 2R84A 4BNKA 2IWRA 3PDHA 4LWQA 1VKRA 1C5KA 3D59A 4LY9A 5L8VA 4NQRA 1D8TA 3DYVA 3OURA 3QE4A 4AZ3B 3UM9A 1LA2A 2PXAA 4U7HA 2FKAA 4C6TA 3PFHA 4LQ4A 3TAHA 4DIMA 4QG7A 1CPYA 3PBKA 4J3FA 2PNFA 4P98A 4ZHQB 2YZMA 1I3NA 1FW8A 4OXKA 5DHRA 1CIJA 3CXRA 4YQFA 1PR4A 4AICA 1XZQA 4JMLA 4TYWA 3UZUA 3OX1A 2C58A 2VHQA 3WG9A 1RSZA 1US8A 3AHCA 2C29D 4J0KA 2UYGA 1YR3A 2DJ5A 5HILA 3Q2IA 4JY7A 2ETXA 2WQZA 1EX1A 1C7QA 1Z17A 4O4JA 4N5MA 1IZ8A 3EQ2A 1FS6A 5DIZA 1EUQA 1GT6A 3C3YA 5H83A 4K9RA 4DRZA 5JD5A 4P32A 1HDCA 1LBHA 1KI7A 2W2KA 2XUDA 1GGMA 1RQGA 5DRYA 3VAAA 4BCCA 4M6WA 4PAQA 1UODA 2WAXA 1EQUA 1H2YA 5I7EA 5JEDA 3O0DA 1H5UA 4KH0A 1VJ1A 2WSLA 3DONA 3ENNA 3K9BA 2EXXA 1GR1A 1NI5A 1SBIA 1SMKA 2I7DA 3I39X 3OHPA 2PMBA 3ONEA 4KIFA 5H80A 3VSDA 1FMCA 2QV0A 2GVZC 2RJNA 5KTOA 3HB0A 2OCIA 3SLKA 4RSGA 4P80A 3TCXB 3BH7A 5CDGA 2PUDA 2MT9A 2D8MA 3HO6A 1S7CA 4YROA 3L1HA 3E61A 3PXCX 1G20A 1T9BA 1V6CA 3HJUA 1HOXA 3IR6A 3RIXA 2W8BA 3ORFA 1QVVA 4BHTA 3H6HA 3I2JA 3FCCA 4MZXA 2AI1A 3VV3A 3L5OA 2WA1A 5G3ZA 1D2EA 2LR0A 4LOHA 3EMVA 3L0PA 1SVNA 4IPTA 1E92A 4DA4A 2DFLA 2VYNA 1LX6A 4O4HA 2HFJA 3ROEA 3ZBTA 4JELA 1QDUA 2FUG1 1EVIA 1M1YB 2VUSA 1BX1A 1YONA 1AS0A 1AKEA 1B6SA 1ZD8A 4L7QA 3RS5A 3D2LA 5L3SA 3UPUA 5FOVA 2ZBUA 1CUCA 5TJ9A 2NTNA 1L1QA 3LT0A 3B20A 3MXOA 4GI2A 3ZU2A 2ZJFA 3ML1A 2PUHA 1RABA 2ZS8A 5KVQA 3FUXA 3B8EA 2QUKA 5IKOA 4LDQA 4O59O 5JAMA 4HEHA 4A6PA 2EOAA 2P9QA 2A67A 4XJXA 3WNDA 4DS3A 1UJBA 1T5TA 2R65A 1W4CA 1ULZA 4HH0A 3T5AA 2R1VA 5CX1B 3BRWD 4YLGA 3PDWA 1OKKD 2C8LA 4UU8A 1FU4A 4R81A 221PA 3D3KA 3JQCA 2IEIA 1YDEA 3B2EA 2PR7A 5FWXA 2QD2A 1A2KC 3C6BA 4F3YA 5H4GA 3KB8A 1FIUA 3EIHA 3LY9A 1COWA 3IXLA 1GU7A 3P2KA 1BQ4A 2C9OA 2PUVA 2BMAA 4LTNA 4Q01A 1N1DA 4RWZA 3N53A 4HYTA 4W9NA 4AIIA 2V5UA 3LI2A 4FX2A 2I9PA 3IR7A 4E13A 3DAHA 1L8LA 1ZH4A 2VP0A 2X7JA 1A50B 5AMXA 2RK4A 5K09A 5KOHB 5LP6F 3CMCO 1D8AA 3TLGA 4JV5B 2ODPA 4JYAB 2DOKA 1U0NA 4QSMA 2OXFA 4AECA 1R0ZA 4XWKA 3FLMA 1EP1B 1FFSA 3AOEA 4Z4FA 2JHAA 1X94A 3IP3A 3IPCA 4I4TA 2FZCA 4JLVA 2R47A 4RW0A 1CKEA 1J22A 3PDJA 1U0TA 5IWCA 2IHZA 1VJ0A 1I6KA 3D3WA 2AEJA 3DEFA 4KWIA 5EMKA 4JT9A 4BNIA 2OBLA 3SD7A 4EGQA 3L8EA 4F21A 4JVNA 3KWFA 3L8MA 4DQXA 1E8NA 1W5AA 1BOOA 2D3TA 2K5UA 1BVUA 1II0A 1UXIA 2XOXA 4H17A 1HURA 2P77A 4EI2A 5EJ8A 5DNYB 4QLBA 3EISA 4C4OA 2EL9A 1ZUWA 3ECSA 3VO8A 2K7ZA 4M8LA 2LKDA 4ZVNA 3UIEA 1EM8B 2AMLA 2CHGA 4IQFA 1RC1A 4XDGA 3W9BA 1KZ4A 3BKWA 5C1OA 3FYSA 3ICEA 4AMUA 1JHDA 2HA5A 1UZNA 3ILVA 4URWR 3L84A 2OGUA 3HJFA 2HMYB 3W5UA 1OQAA 1EP2B 4FDTA 1I7PA 1KU6A 1UIRA 2Q07A 4LJ6A 5FTJA 5AW0A 1LDEA 1KP9A 1WVGA 5FPQA 1OH7A 4Z7OB 3VU9A 2HRDA 3PGKA 1IK4A 1EMDA 2G4CA 3OQPA 3CCCA 4NZYA 2YZGA 2P4SA 4HRXA 2G0NA 3B7PA 2IXFA 5IT4A 1CUUA 3JVUA 1NLZA 4RF3A 4OSEA 4ZJUA 3DAOA 2Z3VA 3FGPA 4GLFA 2IDZA 2CMKA 4HDAA 2E9SA 3ZDEA 4M83A 3KXLA 2QL5A 3H3JA 4DCPA 4UC0A 4EKIA 1JFSA 3WR5A 1LWOA 3PX3A 4UCWA 1CJBA 4EB3A 3SDZA 1XRJA 4Q47A 4WNAB 5AKJA 4CBVA 5IG2A 3KQLA 1NXXA 1RC0A 3IOYA 4Q4HA 3V8RA 4DN6A 4G5XA 1M74A 2GN1A 4YRZA 1SU6A 2XUHA 4OF4A 4S2UA 1LBEA 2X5NA 5LZ9A 1TJPB 3OTIA 1YZGA 1QTRA 3HB9A 3M9WA 2AN4A 5CG1A 4MO2A 1N0UA 4P35A 4IUDS 3P1JA 1V35A 1CDZA 1LQ2A 2YWBA 3FDZA 1B6TA 1WB4A 2ZJ1A 2TECE 3R0IA 3ZXYA 4F96A 1M8KA 1HE8B 2QT1A 3A4VA 1W94A 4ZVRA 3RVKA 5LXTB 3VDNB 4DADA 2RSLA 3AETA 5A5DA 3OFVA 3EWSA 3L7MA 3A4MA 3LTEA 3O4GA 2QX7A 3U3XA 1W0JA 4R7GA 2AX3A 3MGKA 2XVZA 2Q4EA 5DYTA 4HGOA 5FHQA 4EPTA 3FWHA 3RYCA 1P2VA 2Q4DA 4MP3A 2UDPA 3PUYA 2XVMA 5DX0A 1KSFX 4D9IA 5ESWA 1XD2B 4M9QA 1NYRA 4DNFA 3SJAA 1LDYA 1KAEA 3VI4B 1OI3A 4OXIA 4D0NA 4E5DA 2BE7A 4YT4A 5DFAA 2IBTA 3NJ8A 4HDNB 2PZLA 3RS0A 2FKNA 2P69A 3OZCA 4JR0A 1XQ1A 4QRIA 3UYLA 3VPDA 4OHUA 3DLHA 3MJRA 1QS0B 1PDOA 5EGNA 3IHTA 1TDJA 5AP9A 3JQQA 1WF3A 5TJHA 1RAFA 1Y37A 4JLDA 1Y5RA 4FW8A 3WSVA 1H94A 3DV0B 4BFXA 4S2EA 1KK2A 3A27A 2XA1A 3LFTA 4UBOA 3HUFA 3ZE6A 2WAAA 1RHQA 2QQGA 3A9UA 3RVBA 3LLCA 4QXPA 1ZIXA 1T1RA 4ZCSA 4P34A 1K3UB 1DKMA 2B0JA 2JAXA 2PX2A 3KC2A 1DLJA 1EDZA 4A2CA 5FUMA 1LGYA 4J29A 2NP7A 2ZUDA 4JOCA 1I4EB 1KFJB 2HI0A 2O8DA 1WW2A 2X8JB 3EGXB 1HE5A 4UM8B 1Q83A 4MRVA 1U99A 1ZOSA 4DEVA 1TTTA 2B30A 2I34A 2HX1A 2VTVA 2FEKA 4X1OA 2VK8A 2Z2XA 2FWJA 8OHMA 3PA8A 2H65A 3CC8A 1G8GA 4XUGB 5DGTA 5BQPA 3ZX5A 3KOMA 4Y98A 2W6OA 4P33A 3V80A 3P9YA 1HWYA 3O1LA 1H8HD 4HNAB 4I1SA 1ADJA 1JXOA 3OQVA 1ZU4A 1Q6ZA 3LVQE 3WVNA 4ZGGA 2WLSA 1MJ5A 1IJBA 2M32A 2ZQ5A 4O8CA 2ZR7A 4WK4B 4BFWA 4X8OA 5KVVA 4OX9Y 1UZMA 2ZB8A 1ZA1A 1U7OA 2VAXA 3OPYA 4LHYA 3LXRA 1KDPA 3WGIA 5FV7A 5J9FA 2NO0A 2P9CA 2GPTA 3B13B 5KHOC 4UAGA 5E38A 2QYHA 3C74A 1E5VA 4UHBA 5IM5A 1U3CA 4RIEA 4QOJA 3HYSA 2C2HA 1Z4KA 2A8YA 3OZIA 3NTVA 3VC1A 1UT6A 3HCWA 5FJJA 3UMCA 2JDID 3JYOA 1TFUA 4R0MA 3A2MA 3QYFA 3SHQA 3URMA 4PSVA 3AIOA 1K7EB 1X7XA 2NP6A 1JSXA 2H57A 2BTQA 1IAVA 3NHSA 3QBDA 3E22A 1HYGA 1ZI6A 3RLFA 1POWA 3EAQA 1O9GA 5D86A 1FLVA 2ZIEA 3M5CA 3P2EA 4K3VA 4DLXA 5ICMA 1J1ZA 2AOWA 2PYZA 4KMRA 1TLTA 5DN9A 3RYHB 4XOIA 4D42A 1WD5A 5CBPB 1U7PA 2ZBVA 5J4VA 4UJ5A 4PNZA 2FH5B 4H7HA 2BKVA 1SU4A 3AP3A 4MLPA 4HR7A 5ALQA 3TM4A 5JNUA 1X3LA 4L15A 5LC1A 4O4IB 3R24A 2CHFA 4TZKA 3TZKA 1BCRA 4QDTA 5HKOA 3PXBA 2NT3A 3R5HA 5JFGA 3U09A 1LDBA 2GHRA 4GSLA 3DBHA 3UANA 2M2IA 4LY3A 5FA8A 3C4JA 3EA4A 3VOBA 1F3LA 1N2IA 4MUMA 3PC6A 3CH6A 1DIBA 1SUPA 3DNPA 2VAPA 4R1OA 3WFIA 1E9DA 1SOVA 3EFOB 3L43A 3N2EA 3TVYA 1XNRB 2Y92A 3BMOB 1XAHA 5HQ3B 1LH0A 4HK4A 2QLTA 1Q7TA 1ZBDA 3M9LA 1MF7A 5JXIA 4AO7A 4E3WA 4YI5A 5AD1A 2J0SA 2GN8A 3KL2A 3LKBA 3OO0A 4LJ5A 4YYEA 3OTWA 4O29A 4WPGA 1OMOA 5C1IA 2C4VA 4LV5B 1MUUA 4Y9DA 1N9KA 5KHAA 3JYHA 1RMQA 2ZR8A 3QMMA 3UK1A 1FTWA 1KYYA 3ONFA 3NETA 3RUFA 1YL7A 3GVXA 4TWRA 3SIPA 1P39A 3EUFA 3OAAA 5SV2A 2IE0A 4L28A 3W04A 3G2OA 1XAIA 1UBUS 2QL7A 3MUFA 5EZYF 4J6FA 2IJGX 1M66A 1ZNZA 3RS7A 4DJFC 1RP1A 1T6XA 1H85A 2WJHA 5DKFA 1MAUA 4K05A 1GL9B 3HJTA 2UXBB 2WJ3A 1NLUA 4G85A 4GDMA 2SKCA 5TPZA 2XB8A 3U37A 2DUUA 3ODGA 2YNMD 3BFKA 3ZJ5A 4FWBA 3MWJA 4DLYA 1IEXA 3GNLA 3IHKA 4J0GA 4TMKA 4UREA 4UBJA 3OKAA 3U7QA 4G0YA 4E2WA 4XYLA 5K3AA 5IUJC 4CIDA 2CJPA 2OHFA 4NOMA 4RPHA 4URHA 4CQMD 1JTVA 1V3VA 3DWIA 4JGBA 2JLXA 1RWQA 3D7LA 3MGCA 5CLFA 2RI0A 4YFVA 4ZQGA 4DANA 3I64A 3NDBB 1BYUA 1JALA 3RSCA 1YBVA 3G0BA 3JRWA 5AVZA 1VE6A 1Z2CA 5DV9A 3DLIA 2WWXA 3A6ZA 4P22A 3WQSB 4RDXA 2VLIA 5TQ2A 3B7WA 1LWNA 4EW2A 1KI6A 3SX0A 5KOIA 1JDVA 3QMWA 4G8DA 5DK6A 3EEYA 1BXKA 4LF7B 4EMBA 3VU0A 1YC5A 4I50B 4NICA 3E4DA 1V48A 3MFYA 3IEPA 4HEA1 3QWAA 1I7NA 4ZOLF 3TSYA 1EIZA 5HK9A 4TV8B 4J1TC 4EK9A 4UOEA 1XPOA 1DV1A 2B4AA 3OJFA 1U7DA 3QU4A 3BTUA 4H7IA 4KQXA 1CUBA 3QEKA 3UWDA 4GI7A 2C7QA 4G81A 2GMWA 2GZRA 2P6RA 1RZVA 4KXMA 3K70B 3UPTA 2BYTA 3BH0A 2O8EA 3OU6A 1OI7A 1AKNA 2CMFA 2PX0A 4U2GA 1ORTA 3C5HA 4GWKA 1IQPA 2RH4A 1KYVA 2VJQA 3GJ3A 1JU4A 1WZUA 3C5WP 4DJEC 5L4LA 1IPHA 3PNPA 4KSCA 1NA5A 2BR4A 2QNRA 1FE8A 2X4GA 1DKQA 2Q5EA 4HJRA 1F0PA 4RSMA 1WCIB 4RMNA 4NE2A 3A36A 1QOPB 3P0EA 3QMPA 2X6RA 3R5TA 1FDVA 1FRNA 2JJ1A 3BSYA 1QVWA 2WG1A 1KL7A 1N3YA 1WY7A 1NU8A 3N0VA 4AM8A 3RHTA 3CVVA 4RZUA 4ZMSA 4J1SA 2BGGA 1V1JA 1GPKA 2V8BA 1N3BA 2FZKA 1WXEA 4O3MA 1JP7A 4X20A 1E2NA 3OOWA 5I7UA 2RGYA 4IRMA 5AK0A 5HM6A 2EZTA 4C7BA 4FR5A 4OB7A 1LJ8A 3WJAA 2X0DA 4IWXA 4HCJA 4UUOA 1TZCA 4K03A 4NBTA 3BMQA 1E5LA 5I7FA 1WSDA 1N7IA 4N54A 4EHJA 2R00C 2PGXA 1I1OA 3AEQB 3VH4A 4EGSA 1QMPA 4A2WA 4N5LA 4BMVA 4MW0A 2GCPA 4OQPA 4HXFB 1CY8A 1AZSC 1NJ8A 3CUEF 3CUUA 4MUJA 5A1TA 4KXNA 3HDYA 3HU5A 3K9CA 2ISCA 3E5NA 1J21A 3F6BX 3KSAC 2EBFX 3ZC3A 1Q1EA 4XPIA 1M5RA 4G5SA 4QUIA 1NW4A 2AFIA 3B12A 1O58A 4M8SA 5FF9A 5FHRA 4XDYA 3K70C 2JLWA 2N3ZA 4MQFB 2I3ZA 5D5QA 2HHJA 2FGKA 1PWZA 1TEZA 4WLVA 1DAHA 2FWPA 3NVDA 4N7JA 4LBWA 3KXDA 4FXOA 3N6XA 3LUGA 4JLNA 3MCWA 5KTNA 3FOBA 4MMYB 4KP7A 1EUDB 4YQYA 3W8RA 3C7TA 2FSPA 2EERA 1E9BA 1NOIA 4DGQA 4ZIRA 2IYAA 2PYDA 4K3UA 2EVWX 5DWQA 4CT0A 1FTNA 3AINA 3FLEA 1DUIA 2APJA 1OGIA 2VJNA 2NSHA 2BBSA 5IVHA 1Y3AA 1A9XB 2JEOA 5ECGC 3SAJA 1ZCAA 3TBHA 4V1CB 3OBBA 5IARA 1NVUQ 3RGWS 4C20A 1QLHA 4RO0A 4W9MC 3WLKX 2YX1A 2Y1OA 3QOYA 4XUDA 3GUHA 3RSQA 3DBRA 3L0DA 5K0ZA 2DRIA 1O5OA 1Y9AA 4WK2B 3GP3A 2QRUA 2QMHA 5ALZA 5GIPE 2FETA 2VSFA 4CL8A 3NIWA 4WE3A 4W4TA 3C43A 4YUVA 1QG6A 2JGFA 2H7CA 1RJWA 3H1TA 4ZOQI 1TIKA 3IL2A 1MG5A 4X7BA 2W6JD 3U4CA 3TQFA 3EW7A 4YXFA 3T5DA 3ON5A 1QHHB 3OKFA 3E18A 2ATCA 4KIJA 2LD4A 1KXZA 1BJKA 4XGRA 3T95A 5B4UA 1ACMA 3DMTA 4BB6A 4DSZA 1R6BX 2XTMA 3WZ2A 4EELA 4F5YA 1DU4A 2WWIA 1YMVA 4A3SA 3M5WA 2EBHX 4N82A 1DDOA 2WD8A 4BZWA 3OTHA 1AB6A 2JFUA 2RHOA 4O1IA 2ZUEA 3AU9A 3AB8A 3RBAA 5ALLA 3EZ6A 3JALB 5M29A 4KHZA 5C53B 2X2PA 3WJ7A 4D8UA 2QGZA 4WMLA 1M8PA 4M0UA 4YR9A 3C4VA 1KIFA 5JNLA 3JARB 1I1NA 3V55A 3MINA 4KR0A 3X2EA 4EHNA 3N74A 5I7VA 5JJBA 2G07A 2GPBA 1TL7C 5BSKA 1U28A 2IYUA 2ZAOA 2A5JA 4B76A 4MQMA 1MIOA 4G23A 4F4HA 2NVUA 1GPMA 1G98A 3OM1A 4EG3A 5C7YA 1Y3CE 3VM6A 3I9MA 2EKZA 5B1HA 2VTKA 1UEJA 3OPYI 2XGMA 2DULA 3FOWA 4QPCA 4NV3A 2O3UA 1A5ZA 2NXNA 1HG0A 4CIBA 4OAPA 3RRNA 5JT1A 2IOQA 1PR9A 5A06A 5T64A 5LA6A 4OJTA 2QT0A 4JITA 3UUEA 3BREA 4BFSA 2GK4A 4NXNB 1SUSA 1DX9A 3CG0A 5GJVC 1IRXA 5HVNA 3BRWA 3RYIA 2HA6A 1OKKA 1G0NA 1QV6A 2C54A 1BS2A 2DQZA 4M9CA 1K8XB 2GTIA 1R8SA 1ZOOA 2WY2D 1KYQA 4RAQA 4FCCA 4U3JB 4EX7A 2OUKA 3X3HA 1ZH2A 3C1AA 4XX1A 3GVIA 4MV3A 2BM0A 4B3SB 2O2DA 4K8OA 4DFDA 1TF7A 1QKIA 1PFUA 1QTNA 3K9NA 4MRSA 3UK2A 4RIGA 1PAUA 2Z6VA 2ACEA 2WJVA 1N2CE 1TJNA 3E9CA 3MWYW 3UWOA 4AZSA 4L5BA 3CRVA 1WV0A 3TR6A 1IOLA 1N5JA 3L0YA 3LWZA 3PKIA 3T9DA 4AMZA 2V97A 2RJ3A 3CLKA 3O6VA 1N78A 2KPOA 2OCKA 2ZJ7A 1XU9A 2A0KA 1AGNA 1TK9A 2O3TA 3OOEA 4DM4A 3C3PA 2ZRKA 4A9AA 1JLKA 1MX1A 2FW8A 4US1R 5LOVA 1GU0A 1DG9A 3G79A 3OCVA 4YV2A 2VRNA 3P71T 1PV2A 3ZBQA 4OYYA 4PTLA 1WUTA 2G1PA 1C0KA 2IDMA 2JCBA 4CUKA 3GMDA 2Q6VA 3L1JA 1X42A 2J5BA 3ICQB 5G0VA 3OJOA 5TPWA 5FNVA 1H23A 5FWAA 4MVYA 4RPLA 5F3DA 1W36D 2YHAA 3ORQA 1JKIA 1R0WA 1MO4A 3F78A 4LGCA 3KAQA 4Q5IA 1U1EA 4QYMA 4ZVKA 1CVRA 1NFRA 2DHCA 2QKYA 2V59A 2F1RA 2BMJA 5KKAA 5KNBH 3NM6B 2IEDA 5EYPA 3RCBA 4DARA 5JVDF 3SQWA 5FWYB 2FX2A 1LI7A 2EP8A 2VATA 2AQHA 1G18A 3EH1A 1U8XX 2DU8A 3RJ5A 3PUHA 1EXDA 3PG5A 3U80A 3H05A 1C9KA 4TMZA 5CBKA 3UJ3X 4Q6BA 1JE1A 1H6CA 1BHSA 4OQZA 3ZLUA 2OCBA 5JCOC 2AE1A 2JD1A 3GRAA 1VI5A 1M2KA 3CY6A 4G1CA 4AS1A 2C4WA 3E35A 2PVCA 4G8CA 3WNQA 4EHLA 3PGMA 2QD3A 5D3MB 5CW2A 3GEMA 4QPNA 3NEAA 4XB6B 3KL4A 5JBQA 1M2OB 4WLUA 1QYIA 4UVDA 1ONPA 4O2AB 3L7BA 3K53A 1QIIA 3AEUB 3H1EA 3P0FA 4HFMA 4O8ZA 5G1PA 4C5CA 4E3ZA 1NNLA 4X0EA 1U8YA 2B9VA 5DM1A 3GGDA 2XNJA 3AESB 3EG9A 4N5DA 1CQIA 5G4KA 4NARA 4JI7B 2SKDA 4TL6A 2LNDA 4DC1A 2HRRA 4UJ3A 2HADA 4L8VA 4QOEA 3CZAA 2VSOA 5IPFA 1PJLA 2C82A 2CZCA 3BB1A 1R4MA 4RFLA 3FYHA 4D3XA 3BAZA 4J2OA 5EP2A 4PYJA 5KJFA 3ONVA 4DL9A 4IIJA 3B1KA 1LTHR 4J0CA 4DWWA 1PWHA 1PQUA 1FJ2A 2CVPA 3OPXA 2H29A 2X7HA 1DEKA 3I30X 3U3KA 3NPMA 3SBOA 1DCKA 1T25A 2R5NA 3X1KA 1KJWA 1D1SA 2JJMA 2AH5A 4J75A 4P9NA 5KI6A 3P9NA 4R5HA 3V7WA 2FMXA 3D6MA 1RZRD 2FPIA 3MQ2A 3COVA 3EPLA 2C0QA 3LGAA 3GFRA 3NHLA 1LVUA 2WT9A 1SVLA 1FJGB 5EHIA 2GXQA 4LZOA 4GPTA 4NJMB 1C9JA 1ECBA 4UBLA 4BVAA 1LLUA 5J4HA 3JQAB 4MKFA 1A96A 1P18A 1WHSA 4N1AA 1RYMA 2PFKA 2G04A 3K5HA 4X6YA 2HK6A 1CRZA 2PD4A 1TU0A 2VVTA 1G7TA 1QNFA 1W93A 2J3QA 2W98A 2HXSA 3TJZA 3W77A 1FLAA 1GGKA 2HN9A 5CGQB 4J9VA 1BA2A 4OA5A 1ICEA 5HF6A 4TX1A 1UK7A 2NZ8A 3AR2A 5AO9A 3B1FA 4U8GA 4W5QA 2II6A 3CVUA 3ILHA 4KQ1A 1F0KA 1Y3DE 821PA 3TWOA 1CQXA 2O9JA 4X61A 2D7DA 2VWHA 4FGZA 4KRFA 3MEQA 3GDOA 2CNBA 1T2NA 5AVWA 2BFWA 1UMDA 5JTTA 1MQ8B 1YRWA 2B78A 2UVPB 1CJTC 2IHYA 3C3XA 3U40A 3OEWA 3OBIA 4NDNE 1Y8RB 1TAUA 1A2OA 4Q48A 4E4TA 2G67A 5JC8A 4FNAA 1L7XA 3CPHA 5EP4A 1H8HA 2H31A 3FTPA 1NVBA 2V1XA 4V38A 5CXUA 3A1NA 1Q3TA 3ACDA 4F12A 4C08A 5JCZA 1YJ8A 3AEYA 5CEFA 3N8DA 5JATA 1EVJA 3CJQA 3SBXA 4D9EA 3A2NA 3GHYA 4UNIA 4MEAA 2GKGA 2YZKA 4DCVA 3Q3HA 5AVYA 3CX8A 4AK9A 5IAKA 3WQRA 2PYIA 1PN3A 1O96B 4RS4A 3SHVA 4YDQA 5KNDD 4Y8VA 1KGSA 1HK7A 1US8B 2CYBA 2DFPA 3DC2A 3QUAA 4PVCA 5LN1A 3SMQA 1RACA 3CEJA 3TTYA 3CF6R 2BAGA 4KQ6A 1N34B 4NBKA 1X7WA 4LF6B 2JDIA 4HFJA 2RCYA 2WYOA 4RY8A 4DXHA 5EXXA 1QB7A 3NH6A 1H2ZA 1HZZC 2IFTA 3KZMA 3LKZA 1S3IA 1XZEA 1XROA 1WMEA 3G23A 1MBZA 2G70A 1I8TA 4M6WB 2EJVA 1EGAA 1N2ZA 2W2LD 1ZOIA 2PMFA 2QHXA 4R2LA 1WUYA 1IE3A 2WUEA 2XV1A 1TAHA 2JVJA 1PG5A 3QI2A 2YV1A 5ITSA 2Z83A 4KGZA 3TL3A 1W4AA 4REOA 1NPYA 1VPTA 1DINA 1IQRA 1QH8A 1DG3A 5FPPA 2R6AA 3UG7A 3KKZA 1LBTA 3IAM6 3LWBA 3QRWA 4MJLA 4JFRA 4GI5A 1HFEL 1S3GA 3N2YA 4P7GA 2JI6A 2I8CA 5K3FA 4ER7A 1IIBA 5BYJA 1K27A 2V65A 2YN2A 3ETLA 4HGNA 5D1NA 3T7SA 4HVLA 2WAOA 3WX0A 1GTSA 3KOXA 2YJ6A 4JT8A 1XK6A 4GMFA 3T3GA 4CR8A 4C1BA 2KE5A 4EPWA 4RPKA 4WNYA 2BSAA 3HDQA 1QOQB 1V5GA 3OZFA 1ZD2P 3RVQA 3IEXA 4GQIA 3O9VA 1JB1A 1OBFO 1T35A 2RB4A 1F2TA 4LMAA 3KYCB 1EZZA 5T3YA 1TVKA 3U44A 4AL4A 3PNLA 1SUWA 3FI0A 3ME5A 1KE1A 4CN8A 4KK4A 4C4PA 3FBWA 3BXZA 4AKTA 2RGBA 1NX9A 1X2EA 5BMOA 4FSHA 4P7KA 5IS2A 1SEPA 2BE9A 4KITB 1HNZB 1WU7A 4MUNA 1G2IA 3LOQA 3TNYA 3H9JA 3P0RA 4EF5A 3JQFA 2GD0A 3VX4A 1QPBA 4CTNA 5ALIA 4XCQA 3TBKA 2VQ3A 1D0VA 3EBOA 2QORA 4REQA 4EHKA 4MR8A 2CKMA 3LXMA 5AHOA 3VC2A 1SXPA 1E0SA 4D8VA 3A2KA 2OBBA 1AM4D 2QE6A 1USUA 3P9IA 3G5AA 2YNMA 3V8PA 3R5SA 4YAEA 4LY6A 5FWXB 4OGKA 3HCEA 3EEQA 3F6RA 4RBNA 2Q5JA 2VHCA 4C3ZA 4KG7A 4EBFA 3BD9A 1WZCA 5MN5A 2AN9A 4CQMA 3D4PA 3CNEA 5IDVA 4FNGA 4UD2A 2HMVA 2HA0A 4ZOCA 1WOMA 1WOYA 3DLPX 4OFXA 2KBFA 1WO8A 1IWPB 3TLGB 2K2QB 3MZ0A 3EULA 5H4HA 5JROA 1V1MB 1CBUA 3PF9A 3QKWA 4QVKA 5JAUA 4IUYA 3WK9A 4M8IA 2JATA 4O2BF 3SXJA 4I4TB 1GQ2A 4GPAA 1Q0RA 3CZRA 1W46A 4HLUA 3HYRA 4JLMA 3WIVA 1W48A 3WHKA 4W7HA 4YP9A 4YV1A 4QUKA 2DHDA 1W5FA 2PZEA 2JC3A 1YJCA 4EPYA 3DTVD 3PDIA 2EQBA 4KQHA 2IPNA 5JTUA 4QWWA 4X85A 1RWPA 5HX7A 3SR3A 3BAFA 4MR9A 3ZIAD 4D9MA 1NG1A 1M6VA 2OMEA 3HVUA 5HKLA 4TROA 1UBCA 4J6EA 4YECA 5IJAA 1YC2A 2XEDA 1WBJB 4YGYA 4P36A 4P53A 2P5SA 4OMUA 4UZFA 1MIHA 1H1LA 3OY7A 1W1IA 2JH8A 2PXXA 2RHMA 1DIHA 1P6XA 1P4SA 5ES4B 1LQUA 1G59A 3ZE0B 3MRXA 4RHYA 5BVGB 4CIYA 4IS3A 2MTBA 1HLPA 4FDVA 3TOZA 3CA8A 3QXGA 3ROFA 1VIVA 4G01B 5IDXA 5IHPA 4LOKA 2EFEB 1JVNA 3DVSX 4DTIA 3VU9B 1S2GA 3KR0A 5B3JA 3ZHVA 2FFBA 2DUWA 5E3JA 3OZRA 1SXJC 1XTSA 2OLKA 3B9BA 1A97A 4W9NC 4ZVTA 5KDLA 1KDTA 3LNTA 4B8YA 4PFJA 4P1ZA 1E4OA 3EZLA 1F17A 4W99A 3DL4A 5EE0A 3HB4X 1HUQA 2Z6UA 3NIGB 1ZM4A 3PQEA 4GPZA 4IIDA 5AXAA 1KMQA 3AOEC 5JD3A 3DPSA 4ALIA 2A0YA 1CB0A 4U7WA 2W2PA 1S8FA 5KWSA 1GL7A 3AY3A 3T12A 4B6SA 4R05A 1OXXK 1S3FA 1TQ6A 3DWGA 2FHSA 1HFWA 3DAGA 3NV9A 4U6NA 1ZAKA 4HD8A 3HI4A 1V7CA 1EESA 3H2SA 5K0FA 5EQTA 2DFVA 4ZVLA 4D4GA 4EF6A 1Z2PX 2L2QA 3E5HA 4JC5A 2AG6A 3B9QA 3HU3A 4KIUA 1EFHA 1YK1A 2Q28A 2FLWA 2VTEA 1TT5A 3EB9A 4QGFA 1EJ0A 1P9RA 3FDZB 4RORA 5BV1A 2QT9A 3R7AA 2JLZA 1S4QA 2WWTA 5ALOA 7AT1A 1EJBA 1WF6A 3ZCQA 3O8OA 4L5AA 3T7IA 4I5IA 3TW4A 1E3LA 3FLBA 3AETB 1FUUA 2YQ4A 4GNKA 2PGOA 1B3BA 3E82A 4WY2A 4BX8A 4QTYA 1L7DA 2Y1DA 4UDNA 2UXCB 3Q85A 2ZJ6A 3AW8A 5DGCA 2WHYA 3R7WA 2A78A 1NTRA 2EKPA 1SXGA 2IKQA 3RYCB 4ASUD 1OWNA 2W71A 2VJYA 5BWCA 1B23P 2CBGA 2JZOA 3F2VA 4R1NA 1Z2NX 4KU4A 3BJEA 5BNIA 5AHXA 4CIXA 5CIWA 5AKHA 2AD1A 4DY6A 1NMSA 2VZLA 1VE7A 1Y4SA 1V5EA 1NUSA 3C6ZA 4PV7A 1NJ6A 2FR1A 3TZ6A 4C0LA 2O7NA 4KE9A 5TEVA 2O5CA 3L4EA 2YMQA 4KLAA 3RS8A 5C7IO 4RGQA 1AZLA 1AF7A 3EDYA 3I3OA 3KSRA 2XCUA 1P1JA 3AUYA 3T3MB 1J00A 1ABBA 3PLRA 3O4HA 4YRJA 1SBYA 2FW1A 3QKIA 3MERA 1YQDA 2A1IA 3QF7A 3WGZA 1N8SA 3E9ZA 3HJAA 2Z1MA 5I4CA 5AW7A 3BXXA 4M53A 1FTQA 2I0FA 2D0IA 4RFVA 4C0WA 5EMJA 2C94A 1SK8A 3G2QA 4IFIA 4KDFA 5KC9A 2W6JA 4NOKA 1LS6A 5DGDA 5ER9A 4FB5A 4AY3A 1JEJA 4I2NA 1MAWA 4RF5A 5EPUA 3CH7A 1FBNA 2ZVPX 2RBEA 2X14A 1H8ED 3OTOB 1NQXA 1O1YA 1CY1A 3I62A 1UPTA 4G3XA 5LWQA 4Y9SA 2O7RA 3HNRA 1DXOA 1Y1TA 1B2LA 3LP6A 1XUOA 4ZV9A 4WK0B 5L7YA 3RC2A 4PY2A 1L8OA 3B3JA 1Q92A 5AW9A 1U5BA 4N6NA 3VPAA 3AKZA 1KZ9A 1MENA 3OPYB 4ZRNA 3TQRA 4H16A 4G1UC 3FTDA 4IJMA 4W8OA 4BFZA 3I09A 1M34E 5L7WA 4M89A 2CCJA 3G2JA 4M55A 1RM0A 3W1WA 3FYUB 1IN6A 1CZLA 2ZRNA 1VMDA 3AJAA 3EASA 4C4SA 4FZ3A 2XUPA 5EN4A 4BQEA 3R9WA 1G5TA 2BISA 3P0HA 4DA9A 4ZREA 5F2EA 5CVJA 2YWFA 1CUEA 2R66A 1A5TA 1JIQA 2BTQB 1UOQA 1H66A 1H1TA 1R1DA 2BEWB 4PPNA 3W3AH 3E22B 2J3EA 1CUDA 4MB6A 3WIUA 5L95A 4RK4A 1V4VA 2QN2A 2A1TR 1WM1A 3JD4A 3VYVA 5JZ9A 3RLIA 4YUXA 4EI8A 1L4UA 1A27A 4L4UA 4CKBA 2G36A 2UUAB 4R1LA 3IIEA 4OGFA 2G3YA 1L3CA 4BYGA 1NLMA 4DE5A 5BR7A 3ESCA 2DQKA 2FR8A 4Q9LA 1JL3A 5AJYA 1GUBA 4OMDA 1BHQ1 1L9XA 3JD2A 3FMPB 3SPXA 3AM1A 1ECJA 4LHXA 4BU0A 3LBIA 3DBHB 2FMHA 4NFHA 5JZSA 4B33A 3V4VB 2JFGA 4YMSA 3UHAA 2P6PA 2R7MA 3S0JA 3QVUA 3K94A 1WIWA 3BH6A 2V6MA 3PXEA 1G8PA 1L4NA 1K8QA 1I6LA 1SBZA 1XL0A 2CF6A 2IXGA 1CK4A 1IHUA 1EFRD 4DQUA 3GP5A 4K1XA 4E88A 3LQ4A 1LI4A 3IRUA 2WP8J 3DOUA 4OKSA 4PYKA 2WD7A 3W6UA 4LCBA 3WZLA 5BY2A 4ZP1A 3QA9A 1ZNWA 1C4KA 4GICA 1DPFA 4G0MA 1JZTA 3K5IA 3AHGA 5EUQB 3WAJA 3RJMA 4Q4AA 1ZOLA 3NJRA 1MO6A 3B3AA 4DMGA 3A9VA 1L5LA 4IWNA 4TV8F 3CJRA 3UTCA 2GJSA 2CUZA 2QRVA 4CTOA 2AMYA 4IDAA 3D31A 4LSMA 3WGQA 1RJFA 4CDGA 2ID7A 1QFXA 2P3OA 3ILSA 3P9PA 4FT2A 2V8OA 4EW6A 1F0NA 4QOHA 1T9ZA 4FYMA 1PTJC 3UGJA 2WE7A 2O14A 3K09C 5E6UA 5BWLA 3ABIA 3GJ0A 3IAUA 3A9TA 4JI1B 3EJWA 2A1TS 4HZGA 1JGTA 4IIFA 4JD5A 2DSNA 2YWGA 5G53C 1SQSA 3ZYZA 3A3YA 2XXAA 1CRLA 2GBCA 2HXYA 4LY0A 3NC0C 4AY2A 1R4ZA 4XM0A 1UPAA 1E58A 4BKRA 3JZMA 1XKQA 1F8YA 1UJMA 3N76A 5E7JA 3RKSA 4ZI7A 1KZ7B 1X14A 3F4LA 4QSHA 2XB6A 2JCGA 4K40A 2G82A 1YQTA 4K2AA 3U7QB 1C3JA 3LT5A 4HMQA 5FBLB 5B53A 3SIXA 5IJ0B 3TFOA 3O74A 4B8WA 3OF2A 3LCCA 1XB2A 2OAGA 1P77A 3KFLA