1EHYA

X-ray structure of the epoxide hydrolase from agrobacterium radiobacter ad1
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
293
structure length
282
Chain Sequence
AIRRPEDFKHYEVQLPDVKIHYVREGAGPTLLLLHGWPGFWWEWSKVIGPLAEHYDVIVPDLRGFGDSEKPDLNDLSKYSLDKAADDQAALLDALGIEKAYVVGHDFAAIVLHKFIRKYSDRVIKAAIFDPIQPDFESWYSQFHQLDMAVEVVGSSREVCKKYFKHFFDHWSYRDELLTEEELEVHVDNCMKPDNIHGGFNYYRANIRPDAALWTDLDHTMSDLPVTMIWGLGDTCVPYAPLIEFVPKYYSNYTMETIEDCGHFLMVEKPEIAIDRIKTAFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PROTEIN (SOLUBLE EPOXIDE HYDROLASE)
publication title The x-ray structure of epoxide hydrolase from Agrobacterium radiobacter AD1. An enzyme to detoxify harmful epoxides.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
total genus 108
structure length 282
sequence length 293
chains with identical sequence B, C, D
ec nomenclature ec 3.3.2.10: Soluble epoxide hydrolase.
pdb deposition date 1998-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ehyA00
3A2NA 4YX9A 1EXWA 1EK1A 3R40A 3QMVA 3FLEA 4AXBA 5AKIA 1XZFA 1USWA 2C0PA 1QIMA 1UXOA 4OYYA 1P0PA 3IIIA 4G8DA 1AGYA 4EY7A 3R3UA 5LKAA 2O2IA 3CXUA 1UOQA 4Y2TA 4Y7DA 3ESAA 5IH7A 4L9AA 3FYUA 2XQFA 4HVTA 5HF9A 4F21A 1VLQA 2WHPA 4JEIA 3DCNA 3JWEA 2VSQA 4CCYB 4M0EA 3AJAA 4W9RA 4BCBA 1CUXA 3I28A 1Q83A 3BE8A 2FX5A 2VT7A 5JARA 3ZPXA 2B61A 1Y7IA 2PX6A 3PI6A 2HM7A 4FOLA 4J7AA 4X00A 1BN7A 2QXTA 1DT5A 1QIHA 1BCRA 1ZGBA 2WIGA 2RHTA 1XZJA 4QWMA 2OQVA 1QIIA 2OCLA 4ZI5A 3LIIA 3DL4A 1CPYA 3BWXA 3AINA 3LLCA 4QDZA 5HFAA 1F8UA 5AKEA 4X97A 2ONCA 4OB7A 2WJ6A 2FJPA 5CXUA 3UMJA 2OGSA 2BGNA 3HRHA 4BYMA 1XZAA 5LZ9A 2WUGA 2WFLB 5CTAA 2DCMA 4F0JA 2GBCA 1F0PA 1LPAB 3EF3A 4HRYA 1SC9A 2JF0A 3WK9A 4Q1VA 3WKBA 1VZ2A 2HRRA 1C4XA 2XQJA 2JIDA 5AKXA 6YASA 5DNWA 1R4ZA 3FLAA 4DNOA 4X6YA 1UK6A 1SCIA 1ZD2P 3FSGA 4DSZA 1CRLA 1QONA 4BDSA 4BE4A 5JD4A 5CURA 1R50A 3D5EA 5JALA 5LLSA 3R3ZA 1GQSA 4Q82A 2XMSA 3FOBA 4AO6A 3PFCA 3F8SA 1QIKA 2H7CA 3X3HA 3C6ZA 2BGRA 1O6GA 1P0IA 3FYUB 2QZPA 3QM1A 1ZD3A 2WHPB 3QYJA 3R3VA 1Y7HA 1DWQA 5T4BA 2AJCA 4N8SA 1B41A 1AX9A 2ACKA 2PL5A 4PW0A 3R41A 3Q8WA 2EDCA 2ZVDA 2RHWA 5HQ3A 2H1IA 4GI1A 4B80A 4B83A 3JW8A 1QTRA 3I2JA 2XUHA 5LZ7A 4DMHA 2AXEA 1OCEA 1QTIA 2WJ4A 1MT3A 3RK4A 3AILA 3TEJA 1GQRA 1CLEA 4X3CA 4HZGA 1GZ7A 2PKYX 2XMDA 1X2EA 3V9AA 2QM0A 4M0FA 2Y6VA 3VJMA 2GBFA 7YASA 3H1AA 4AN1A 2X8BA 5ALWA 2O2HA 2ZYIA 3BL8A 4FHZA 4IQ4A 2XUDA 2H7YA 1J06A 3C6YA 4K2AA 4CG1A 3ED1A 4AQDA 3EQ8A 1CUSA 1W6RA 1AUOA 2ROQA 4G4JA 1K8QA 4DSAA 2GYUA 4BRZA 2NW6A 1ODTC 2JGLA 3TJMA 1G66A 1VXOA 1ZI6A 4GLBA 3D2CA 5JD6A 2UZ0A 1MO2A 5IVHA 4WCVA 1EHYA 1ORWA 5LZ2A 4B0OA 4DGQA 2HA4A 2HA3A 1FFCA 3BF7A 4QNNA 5K3CA 3WLAA 3H17A 1XLUA 5JD5A 2WG1A 4TGLA 3RM3A 3W9UA 5FPPA 5DNVA 1CUUA 1ZI9A 4JNCA 5D3KA 1DT3A 3LS2A 1K5PA 2XB6A 3WYDA 2OCKA 3STYA 5HZGA 3DKRA 3VVLA 2GYWA 5DNUA 2VEOA 1GPKA 2BKLA 3BJRA 3B5EA 1VZ3A 3DYIA 1CVLA 4AO8A 4KACA 1EH5A 1DU4A 4U2CA 5HQ3B 1GT6A 3N0TA 1CUAA 5HKBA 4AZ3A 4EB0A 2CBGA 2HFJA 5HKAA 1QO7A 2VTVA 1H2WA 5ALEA 1L7QA 5CMLA 4NS4A 4G4IA 1XZGA 4H18A 3IBTA 3GUUA 5JIBA 1ZD4A 3PFBA 1CUVA 2WFZA 3FYUC 1P0MA 1CUHA 3IURA 3WA6A 3PDCA 4I3FA 4DMKA 2IITA 3UUFA 4G9EA 5ALTA 4PF1A 1LZKA 2RI6A 3GBSA 2PPLA 4PSDA 1CR6A 1WM1A 3H2KA 3PE6A 4N5IX 3D2BA 3WK6A 2YYSA 3H2JA 4RPCA 5FXMA 3HSSA 1DX6A 1JU3A 3F67A 4C89A 2B9VA 1U65A 3WYNA 4LHEA 5HK9A 3NWOA 5AI9A 3ICVA 5E2IA 3BIXA 2ZSIA 3WL5A 1N5RA 5HF6A 4IH1A 4X90A 4GXNA 5D3ZA 1Q84A 2HU7A 4GECA 4KAJA 1CUZA 4FLMA 4H7EA 3HLKA 5AK4A 3IUMA 5CW2A 4WY5A 2PSHA 2HA2A 3VISA 1E3QA 2QOEA 1TKRA 4MWSA 2G5PA 4UHCA 3L1JA 4KAAA 3WKCA 5DTJA 4B81A 4BZWA 2Z5GA 4LXGA 3D2AA 2BUBA 2X76A 1UK7A 4Q3OA 2ORYA 3DL7A 3LP5A 5IVIA 4MWTA 1QGED 1XLWA 3G9XA 1WCYA 3E3AA 1VXRA 2P8SA 4C4YA 4Y2UA 2QRUA 3GA7A 2WFMA 3ZLVA 1XKTA 4E15A 4U2EA 1IZ8A 4K6KA 2QMQA 1GKLA 5EI5A 2QJWA 3G0IA 4UBKA 2PSEA 2C5FA 4S0XA 2CJPA 2RAUA 4OB8A 2HA0A 1H22A 5ALQA 1XZIA 4BZZA 5AOAA 1QIGA 4Z49A 5JAPA 1THGA 2WU3A 3K9BA 4H7IA 4ITVA 4J0JA 5ALDA 5BOVA 3AIOA 4C4XA 2Y6UA 4P92A 1CUYA 1WPXA 2RONA 2XUOA 1ZOIA 5A7FA 4O08A 1FFBA 4V2IA 5ALUA 4KE9A 4C01A 1JFRA 1GPLA 5KREA 3WWCA 3C5WP 2H9YA 4FWBA 5AOBA 1XRLA 1G4HA 3O9MA 1Y37A 1ODSA 2I3DA 4JYMA 5ALHA 5FRDA 4MEBA 4I19A 1BRTA 4AO7A 1AURA 4BB0A 3FWHA 1PFQA 1BEEA 5AK6A 3H18A 3C5VA 4K6GA 5AP9A 2JEYA 3T52A 3AFIA 1YAJA 1MX1A 5A2GA 5EHXA 1EX9A 1U4NA 3LIPA 4WFIA 4OU5A 4H7KA 1CUIA 1W1IA 5DJ5A 5BV7A 4UBOA 1WB4A 2EDAA 3O0DA 3V48A 3OPMA 1T4MA 5ALMA 5C7YA 5FLKA 3G9UA 4DMFA 4EBBA 3DLTA 5EHNA 5AKJA 1DTEA 2FJ0A 2OXEA 1A7UA 3M82A 3EQ7A 1W4LA 4ZWNA 4OYLA 5F4ZA 1E66A 1VE7A 2XQKA 2PUHA 3G9ZA 1KU6A 3D7RA 4GWLA 3CCCA 3BDIA 3H0CA 4BVKA 2IX9A 1VA4A 5AKGA 4Y2VA 4AZ0A 3FNBA 5D7BA 5KWJA 5K3BA 5T4FA 1OXMA 4ARAA 4H0CA 3W04A 1X2BA 1I6WA 2OGTA 2XMCA 2VJBA 4BDTA 3IDAA 2VJCA 1QZ3A 3I2IA 4H35A 3QPAA 3WK5A 4B0PA 2WJ3A 1MU0A 2JGKA 4X94A 4BTVA 4KJXA 4RE5A 3OURA 4FLEA 2ZJ6A 4P9NA 4UHFA 5A6VA 3DDUA 5A71A 1QO9A 4HXEB 3STWA 1DQYA 1IUNA 1LBSA 2PM8A 4H7JA 5LYYA 4Y2SA 1ZJ4A 4XVCA 4X6XA 5EGNA 5I8PA 4BAZA 1XZKA 1K6EA 5CT6A 2VT6A 1LGYA 2XUJA 3BDVA 4J03A 1YSCA 1YA8A 3HXKA 5ALLA 4X71A 2G63A 5I9IA 5HF8A 3DOIA 2FUKA 1TCAA 3FVRA 3GZJA 1H23A 4B6GA 3WWOA 3B12A 3QVMA 5ALPA 1CFJA 3WKEA 3ANSA 4BVLA 4E14A 4H7DA 2WTMA 4ZV9A 5DTIA 2R8BA 4W1SA 2XUAA 1Q0RA 1IVYA 5K3EA 2XUKA 1BS9A 3F96A 1JMKC 5JZSA 5CH5A 5FUMA 2DSNA 4G4GA 4DMCA 3O4IA 2GZRA 4FMPA 5LZ8A 1BU8A 2AJ8A 2XUPA 3HYSA 4OD0A 5T4HA 1CUFA 4EUSA 1UKBA 3NUZA 4B9AA 3ANTA 3OC0A 5AIBA 5CH3A 1J07A 1S8OA 1TIBA 1A8QA 4FFVA 1MAHA 4ZREA 3OTQA 5HCUA 1HKHA 5AM1A 3HC7A 3WIBA 2XMQA 2WUEA 5C8XA 3QMMA 1UZAA 3O4GA 2PSJA 3IUQA 4B9EA 1ZIXA 5JATA 2Y1KA 4CIAA 1HDEA 3V1NA 2JGJA 3U1TA 3MUOA 4XWGA 4ZXFA 2O2GA 5JASA 3FCYA 3W06A 3C6XA 5JAHA 3IVMA 1VE6A 1R88A 3FLBA 1XQWA 3W9BA 1N5MA 1IMJA 1QIJA 1QOZA 4LIPD 5ALRA 1XZCA 4GHWA 2VAVA 3GELA 4BE9A 2D5LA 3C6BA 4KEAA 5KBYA 4AX4A 5ALKA 3EIOA 1TK3A 3DD5A 1J1IA 5LKRA 1IZ7A 3ZWQA 1HL7A 3M83A 5AK3A 3I6YA 3PICA 1W52X 2I78A 3K6KA 1QIDA 5ALSA 3RLIA 2K2QB 3VXKA 2OAEA 3STTA 4PV7A 4J0GA 1YS1X 2WG2A 3V1MA 2HA5A 2PVSA 1JU4A 3VJKA 3PF9A 5EHZA 4Q05A 3I2GA 3WJ1A 1XFDA 1E5TA 1ACLA 5C81A 1GGVA 3I1YA 4WJLA 2QUBA 5FPQA 5ALZA 3PUHA 2AJBA 4CIBA 1PJAA 4Y2YA 4ZRDA 1D07A 5AKLA 1E8DA 3G0BA 5JANA 2QXUA 1VOTA 4MYDA 4UHEA 3H19A 2WQZA 3A70A 4LKOA 4UPDA 5AI0A 3DYVA 3AZOA 2PSDA 4GW3A 4UFPA 2ACEA 4BP9A 4LXIA 3N2ZB 5C8ZA 4X91A 5ALGA 4MQLA 4F60A 4AN0A 4FBMA 4GEGA 2Y2UA 2ZJ7A 4HS9A 2LIPA 4BP8A 5SYNA 2QT9A 4WDRA 3QH4A 1MNQA 4Y2RA 2J4CA 5BWBA 1TQHA 4DIUA 2R11A 4FNMA 3WK8A 4KR0A 3HEAA 4B7ZA 4LXHA 5AIAA 3R3WA 1WOMA 1EB9A 2G4LA 5ALFA 5D6OA 4EY6A 3VVMA 2QTBA 2V97A 1XQXA 2XI4A 5KWIA 5DWDA 2DHEA 1MPXA 4HRXA 3LCRA 4C4ZA 3V1KA 2OGZA 3L1IA 4H7FA 5K3AA 1MX9A 1BCSA 2ES4A 4C6HA 1QFMA 1RWQA 5AKYA 2JGEA 5AI5A 4NZZA 4QLAA 5HF5A 3ESCA 1IUOA 1X70A 4B85A 4KE7A 3V1LA 2C58A 2XT0A 5AH0A 5AKZA 1TAHA 5AKKA 2H7XA 3CN7A 1EDDA 1QE3A 4QDXA 4UBNA 5JYCA 3G0CA 3H2HA 3O9VA 1YS2X 4ZV7A 3W05A 2HRQA 3GFFA 1SOMA 5AI6A 2OCIA 1BE0A 4UHHA 1EVEA 4J3JA 5JADA 3WWEA 5ISMA 4WDQA 3PUIA 4PQEA 1M33A 2V96A 2O7RA 2JGMA 2WUFA 2PU5A 4X95A 3FBWA 2W22A 3GROA 3KD2A 5JAOA 3WJ2A 3P2MA 1ORVA 3WL6A 5T4EA 3F9CA 1F0NA 1EDBA 4G8CA 3D59A 3B3QA 3IUJA 1MTZA 2JGFA 1UK9A 1CEXA 3WKAA 4W63A 1EVQA 1G5FA 5BWCA 4FTWA 3C8HA 1R9NA 5K5EA 5HK8A 4PO3X 2WHQA 1QIEA 4QDTA 4OUKX 4ARBA 5ALVA 4MXDA 4F5ZA 1EA5A 3EQ9A 4C88A 2XMRA 4U2DA 4K5QA 3QZUA 5ALJA 4L72A 3IULA 2OCGA 5LIPA 1W75A 1XRQA 1TCBA 5HFNA 4EA6A 4KRXA 2WIKA 1E8MA 5AHXA 4JYPA 1P0QA 3G8YA 2WSLA 3WZLA 4OU4A 2GZSA 3ESBA 5AJHA 3K2IA 1WB5A 3G9TA 5IVDA 5ALOA 1CQWA 2HL6A 2WIJA 5JAUA 3I6ZA 4BC0A 2XLCA 1A88A 4BBZA 3R3YA 5AOCA 3R0VA 3HABA 5EIHA 1LPSA 1E89A 4W1RA 4P08A 4X93A 1XZMA 4KYVA 3AZPA 1JT2A 3NOXA 5K3FA 2J4FA 3H2IA 4OSEA 4RNCA 3MVEA 4U2FA 1RYYA 2YH2A 3ICWA 1HQDA 3CN9A 5FOQA 5ESRA 3BJMA 3DJYA 5AICA 1MNAA 2WLSA 4X85A 2ZSHA 1JJIA 1BN6A 1SCQA 3KOOA 2Z8ZA 4MYSA 3L1HA 1K63A 1EI9A 1EINA 3C87A 1JKMA 3SK0A 4Y2JA 1L7RA 4XJVA 5FKJA 4ETWA 1HPLA 4XX1A 3WA7A 3KSRA 3R3XA 1CUJA 4FFWA 2GBIA 4YK7A 2HADA 5JZ9A 4BAUA 2WKWA 4ROTA 5E4JA 3IA2A 2JBWA 4MQMA 1U8EA 1CUGA 1LBTA 3M81A 3HACA 3E0XA 1U2EA 4G8BA 1UKCA 2CB9A 4BCDA 1GPNA 3EBLA 1CQZA 1DINA 3ZV7A 4QWWA 2YXPX 5AM4A 1UKAA 2DQZA 2WILA 3ESDA 2WTNA 1PV1A 2ZYHA 4INZA 5I7UA 1MJ5A 4A16A 5J3JA 5C8VA 4E11A 1ODCA 2XMBA 1XZEA 3VJLA 4A23A 1VA5A 3WWDA 1ZGCA 1LNSA 1BEZA 4G5XA 4OCZA 4EHBA 5FV4A 4LYDA 1DX4A 5K3FB 3C45A 4WFJA 1CUWA 4L0CA 2DHCA 1NU8A 1XQVA 4RGYA 3WI7A 1YCDA 3OM8A 5LZ5A 2WIFA 2XQGA 4BVJA 2QUAA 1GXSA 5AM5A 4EZIA 1C7JA 2XUFA 1XZHA 4J0DA 4Y2QA 3BF8A 2VQ6A 2QVBA 4EY4A 5ALNA 3FVTA 4U2GA 3QPDA 1WPRA 3WMRA 2HHAA 3C8DA 2AJLI 3I2KA 3FAKA 2CEKA 2PU7A 1LPBB 1LPNA 1N1MA 4RE6A 4L3WA 2PSFA 1XRNA 1GKKA 4OB6A 3T4UA 1KU0A 1AKNA 3ZLUA 4KRYA 1MX5A 4TPKA 3WK7A 4TVKA 5E4YA 1E8NA 4HTAA 4HXGA 3WIOA 3QPCA 2WUDA 4MJ3A 3BIWA 4XIIA 4EY8A 5YASA 1AC5A 3KDAA 2RGUA 2OPHA 2V98A 3O4JA 2BCEA 2WHRA 2OLEA 5A62A 2OAGA 2HU5A 1LPPA 2CMFA 4UHDA 4DLNA 2QR5A 2OG1A 3AIMA 4JH0A 2Z8XA 2DQYA 4PNZA 3D4LA 3E4DA 4PSCA 4UUQA 2VATA 1FFDA 3C70A 2JEZA 3WK4A 2Z3WA 3STVA 5CT5A 1XKLA 1NU6A 1YB7A 4PSUA 2XQIA 5JZBA 1AQLA 1C7IA 2OQIA 3QITA 4UBJA 1UK8A 2HA7A 3VKFA 4UBLA 1H2YA 1H2XA 3RKSA 2CZQA 4X6UA 2C0QA 2ZYSA 4FLFA 2VA9A 3A2MA 3S8YA 2JGIA 4G1FA 4QZVA 1CUEA 4QLOA 5AM2A 4C87A 4CCWA 1CUDA 4GBGA 4DNQA 4QEKA 2BUAA 3H1BA 1LLFA 1A8UA 2AJDA 1UWCA 4YASA 4A5SA 1EB8A 2BAGA 2QJRA 2XMZA 4DYHA 2HFKA 1JJBA 1WHSA 4KE8A 3I2FA 2GYVA 4WFKA 3WKDA 5LP1A 2B20A 5EHQA 2WU4A 3VDXA 3WQHA 4N5HX 1ZI8A 3G02A 4W1QA 1SCKA 3SX4A 2CKMA 3KXPA 4CI9A 4N8DA 2J3DA 5AK5A 3BXPA 1H2ZA 2Q0XA 2V9ZA 3HI4A 4B84A 2ZYRA 4CG3A 3RARA 4IHAA 3DS8A 5AI4A 3KWJA 1R3DA 4DM7A 5AO9A 4BCCA 5CXXA 3DQZA 1IUPA 4DTCA 4GDMA 3QBJA 4U2BA 1XZBA 4J0IA 4DNPA 1TRHA 4FKBA 2W6CX 2BFNA 1NX9A 4Y2PA 3WZMA 3PF8A 4IH9A 3A2LA 3NGMA 5EFZA 1A8SA 3I1IA 1TCCA 1CUBA 1FJ2A 4Y9SA 5A7GA 1MN6A 2XUQA 5FP0A 5AKHA 1VJ5A 4CFSA 2DR0A 4AB1A 2HIHA 3S2ZA 1JMYA 3Q0TA 1CUCA 3TRDA 2XMGA 3O4HA 3SWWA 1XZLA 4K6HA 1Z68A 5EIEA 1YAHA 4KAFA 1AZWA 4OPMA 2O7VA 4N8EA 3F97A 4H77A 5DYYA 4DNFA 1ZIYA 1BROA 1Q0ZA 2I03A 1ZICA 3WL7A 3WWPA 2J3QA 4BATA 3G0DA 4G9GA 5IVKA 4Q3LA 1F6WA 4KE6A 1THTA 4IH4A 3STUA 1WHTA 5AM0A 4UFOA 2CUTA 1HBJA 3O95A 1LZLA 3DNMA 1N8SA 5DYTA 3STXA 1EK2A 2D0DA 3H04A 1OILA 1T2NA 2HA6A 3ZLTA 1EDEA 3DOHA 1UOOA 5CRIA 2WM2A 4AMZA 5SYMA 4M0MA 4BRSA 2DHDA 1KEZA 2GBGA 5E4TA 4QA9A 4E46A 1AMNA 3C43A 3D3NA 3I6MA 1R1DA 3QMWA 3MGAA 2XUIA 4MEAA 4W1PA 3OOSA 1RP1A 1UFOA 2EEPA 2Z3ZA 5CT4A 2Y2VA 5CH8A 1ETHA 4QDOA 4LYEA 2IIVA 2XDWA 4Q34A 1J2EA 1QJ4A 1G42A 2BJHA 2C4HA 4J0CA 3I2HA 1DWPA 4ZGBA 2PBLA 5K3DA 1YA4A 1LPOA 3FSGD 1FFEA 2DFPA 5LZ4A 4HXFB 4UBIA 1XQYA 4Q3KA 2QKYA 4H7HA 4X92A 1YB6A 1O6FA 4FNGA 2HU8A 4NVRA 1VKHA 3FCXA 1WB6A 1JI3A 4YPVA 2WG0A 1XZDA 4FBLA 1ZJ5A 3UUEA 3U0VA 2I3ZA 4BTLA 1QFSA 3IB3A 2E3JA 5ALYA 5ALXA 3JYHA 1W76A 1FFAA 1YR2A 2HDWA 1ZD5A 5DLPA 4Y2XA 2WIDA 2C7BA 1QLWA 3A6ZA 3AUKA 2VJAA 4BC1A 5FDFA 2B4KA 1LPMA 5AM3A 1UOPA 1K4YA 2PUJA 3AZQA 2VJDA 4J0HA 2G5TA 2X5XA 1MAAA 3IUNA 1YASA 4D9JA 5A7HA 4IO0A 4CCYA 2C5GA 4HAIA 3DEAA 3KWFA 1CIJA 3SC2A 1DWOA 5EIAA 1QIFA 2BUCA 1CV2A 5H3HA 1XRPA 4J0KA 3CCBA 4UFNA 3OG9A 1XLVA 3D0KA 5AI8A 2RIPA 3H2GA 1ACJA 4FDMA 3FYTA 2ECFA 4UBMA 4EY5A 4AMYA 4BAGA 3M3DA 4QDUA 2ZJFA 3TGLA 1FSSA 5CT8A 1B6GA 2XUGA 2XE4A 3ILSA 3ZI7A 1ISPA 1SFRA 1XRMA 2XLBA 1R9MA 3AIKA 4CG2A 1DQZA 4WY8A 5DYWA 5ALIA 5CBKA 3E1GA 4P93A 3W2TA 4JUIA 2YASA 3DKKA 3WL8A 5IKXA 1XRRA 1XROA 4QE3A 3F98A 4X7BA 3G7NA 1L7AA 2WFLA 1UT6A 2VAXA 1HLGA 4B82A 3HJUA 2VF2A 3MUNA 3HZOA 3YASA 4UHBA 4NMWA 2QS9A 4I4CA 3G0GA 1JJFA 5CT9A
chains in the Genus database with same CATH superfamily
1U8XX 5B55A 4FYMA 2HJGA 4GBMA 2R1VB 1Z6PA 1XZNA 4MA4A 2G0TA 3QBDA 1VSQA 1JLLA 1G6Q1 1Q22A 1V39A 2PIDA 4ZDIA 4RTLA 2BE9A 4B3HA 3B1JA 5F2EA 4PFQA 3B9PA 3R40A 4RGQA 4JI5B 4YTEA 1OASA 2PJDA 3W5UA 2O8EA 1WW3A 1WTAA 1PJLA 2O2DA 5F4BA 3HUUA 1DIRA 5AKIA 1ZBDA 2E4YA 3PPYA 3NANA 5JEDA 4YV2A 1EA7A 3B8HA 2HIMA 1XTIA 4HTFA 1QIMA 4D3FA 5AIAA 3JYLA 1ID1A 3BGSA 3U37A 4ZTBA 4PINA 4F8YA 4F56A 5H4GA 4YP6A 4L8FA 2WWGA 2E5FA 4E4TA 4EY7A 4J4HA 3F0TA 3K09C 4JU9A 5PGMA 1J8YF 3LQ4A 2JI4A 3VZPA 2O2IA 3CXUA 4LOJA 1VLHA 4JI6B 2OM6A 3BWYA 2ID4A 3KYDA 1NVXQ 4A0GA 2ZAIA 5IH7A 5HQTA 3GT0A 4FGUA 4ILKA 4ZYYA 2ZRPA 1C7QA 1FFHA 4JOSA 5HF9A 4D6XA 3MJ4A 5CTJA 3HXOA 3D7SA 3DCNA 2GEVA 1GU7A 3M6IA 3UOWA 5IABA 4BXOB 3JWEA 3WQSB 2GPJA 1T8UA 4S12A 4F2PA 4BCBA 2BR4A 4PGFA 3PGA1 2YWEA 5DF1A 3RC1A 1TI7A 1I5OA 1NQAO 2AK2A 4JLNA 1SQSA 1SUWA 4M46A 2VTEA 4MQ4A 5E2BA 1IJKA 2F3UA 2PEYA 1JQEA 1NJGA 1N0UA 1PLKA 1X8LA 1ZM7A 2E4AA 2IP4A 2FETA 4RFSB 2B61A 3ZV3A 1VLJA 4RD6A 2B1GA 3PI6A 4DVJA 5IKMA 4KXYA 4GOXA 1Z34A 3BWDD 3I53A 5EWMB 4FHCA 4X00A 3MMNA 1BN7A 4FR5A 3IAAA 2X0FA 2QXTA 1FVOA 2HI0A 4F93B 2PJRA 1ZGBA 3L6BA 1JDBC 2BBTA 2RGXA 2WI8A 3LECA 2A67A 4TV9F 1NG9A 1PHRA 2G4VA 2Y1CA 3L8CA 3KXIA 2O19A 1UXIA 1SCNE 4I14A 2P65A 1FLDA 1QIIA 2OCLA 2PZLA 4KQ9A 3UK0A 1IWOA 3FW1A 3NORA 2W2VA 3L01A 3OY7A 4O4LA 2BIFA 1FF9A 3B5JA 3BWXA 3LLCA 3ORRA 2IXAA 1Z0FA 4G09A 4QDZA 2PH7A 1T2UA 5JW6A 1M67A 1AT1A 5AKEA 2VT2A 4N12A 3IPCA 3HM9A 1WY5A 4Q7MB 4UNPA 4W99A 2Y66A 3C8ZA 1UAAA 1ECFA 1M2VA 1KF0A 3ONEA 3A7EA 4XTRA 1M3SA 3JZAA 4Q3NA 4RAOA 1G0OA 1IHOA 1C2TA 1T43A 3DBLB 3HFGA 4WLFA 4BLVA 2H0AA 4TS1A 3UMJA 3G6KA 4D42A 1UMDB 4RTMA 1P1JA 3HRHA 1NP7A 1UZNA 5FOTA 1NF2A 3D1LA 2PFSA 1E32A 1ZHHA 1L7VC 3SF0A 1BU5A 4BFUA 4M6WB 4ZHQB 4BQRA 3NHFA 4WKPA 4BYMA 1REQA 3GRCA 2ZBFA 2P0YA 4N7RA 2HNKA 2ODAA 2X1VA 3QKSA 1H6BA 2P91A 4M8IA 2DCMA 1NJ8A 1PS0A 1JFVA 4IHJA 2FK7A 2XW6A 1P18A 2GBCA 4GPAA 4F0JA 5IM4A 1F0PA 1LPAB 3EF3A 1CNEA 4HRYA 4IAOA 2I65A 2JF0A 1QHFA 2Z6AA 1RXVA 3FJOA 2ZLBA 1B76A 2LIVA 4CTMA 3VSAA 3WLEA 2RHGB 1KNXA 3M6WA 5LIRA 4ZVUA 3RHZA 2B5WA 1QV9A 1L3BA 2F3QA 4BPBA 4BWGA 3EXG2 4X1YB 4BX2A 4Q6WA 2QE6A 4CM6A 4UD6A 4TXLA 4AWBA 5IH3A 1S3IA 1PLJA 3T7SA 2BFPA 3EIXA 1AQJA 1LDGA 2NMVA 1QHXA 1ZD2P 2JFHA 4D92A 4EHKA 3K71B 3SS9X 3K8YA 1PDOA 5KB3A 4BDSA 3P9XA 1KFKB 4HVAA 2HEIA 3EGIA 4MWDA 1R50A 3DMHA 2J3HA 1QRDA 3DKIA 4IMIB 4LRUA 1X9HA 2C00A 1LSUA 4K6OA 1B3RA 2Z95A 4NBLA 1HE3A 5IAEA 1RRPA 5A4JA 5KYWB 5BQPA 3WMFA 3N8KA 1BS1A 5EE5B 2R8RA 4XSGA 2WHEA 1INLA 1AIPA 3A1FA 4QUHA 5KMGA 1IZ0A 1QOPB 3SYKA 1SZPA 2B8JA 2Q6OA 1N6RA 1H5QA 4AO6A 1MFZA 3PFCA 1LDBA 4LC0A 2BFDB 5BMVA 3EOZA 2VJNA 2IYLD 5CEFA 3LXUX 1QQ7A 5KTNA 2J09A 2VBFA 1KDTA 5EIBC 2BGRA 1N33B 1Q7TA 1Z2CA 3NKLA 3OHPA 3PIIA 5BP7A 1P0IA 2X8LA 2OKGA 2J32A 3FYUB 3QM1A 3QBTA 1FB5A 4II3A 1DLIA 3RAFC 4G89A 1TEVA 2PBRA 2COKA 3RT1A 3UK7A 3VU1A 4K9SA 1TX4B 1D3AA 1SHTX 1DWQA 1UBJS 2QRVB 1UJ6A 1DMRA 2EKQA 3B78A 4ZEWA 3UICA 4ENVA 4EP1A 3N7TA 3NEJA 1OTXA 1XL0A 4XQ0A 1B41A 5FD8A 3RRMA 4DN6A 1C9KA 1T3GA 4RS3A 1G7RA 3OVMA 2WTXA 2WWTA 2GKOA 3F47A 1H2EA 2DWCA 4KIFA 2WYUA 2O14A 2EDCA 3I04A 5FBLB 3QELA 3IELA 3UAOA 1YQQA 2GLTA 1ICEA 5I01A 1AMUA 2R47A 4D26A 3ZE2B 2P11A 1USKA 4JV5B 1V9CA 3PHGA 3WDKA 3PDHA 4EB3A 5B53A 4YWHA 4PTZA 3I5XA 3L7NA 2AXEA 1OCEA 1QTIA 4MIYA 2EKDA 1H0RA 3LW7A 2DT5A 2XBMA 1U3DA 3K9QO 1LVUA 1HO3A 1E5LA 1VSVA 2F90A 2H1LA 3OZWA 2E2WA 3PNKA 4DLYA 4LAFA 3TJRA 1SUCA 3EODA 2QMYA 3ANLA 5FEUA 3UXMA 2OO7A 2YHIB 4FFNA 3HXLA 3O2NA 3BT7A 3AL0C 4X3CA 1O6BA 2H4YA 2ZJ1A 4HADA 1GZ7A 2G9ZA 3EB9A 2WJGA 3C4JA 3F7NA 4A10A 4OQFA 5ESXA 4C7KA 4JC0A 4B6RA 1VLMA 1N0HA 3PC6A 5KZMB 3PUVA 4DT1A 1JDVA 2F1RA 2FTKE 2I2CA 2I54A 5FAKA 4KUGA 1RJFA 1VIVA 2Y6VA 3VJMA 2GBFA 3VPAA 3SM3A 4C5BA 5A5DA 4TYQA 3H1AA 3IESA 1EFVB 4KV9A 3USZA 5CA0F 2OBBA 3QKWA 3UYLA 2O2HA 3MRSA 3N6RA 3NHAA 5E4FA 1WA5A 2GEBA 1BQEA 1IY1A 4IQ4A 5I7SA 5EQFA 4LK3A 2E4ZA 2WJPA 1G41A 3GGCA 3C6YA 5GVSA 4BFTA 1D2RA 4XPZA 2AB0A 3CNOA 4I5IA 2EWWA 4B3MB 4YV1A 5GZ1A 4FDAA 4K2AA 4CG1A 1DIGA 4M1SA 5CU7A 1QJCA 5HX7A 4TV8A 5AVTA 2ZVPX 3OTGA 2JIQA 4WI1A 3LC2O 3ED1A 1U0RA 2ID7A 3H5WA 4LJKA 1CUSA 1KAEA 1KP3A 1C0LA 1KVSA 2IZ0A 3IBYA 2ROQA 1PSWA 4KQFA 4YRQA 3STHA 5L7TA 2CDNA 1Z7WA 4YJFB 4CU2A 1HYQA 3O8BA 1KJIA 3OKAA 5DXJA 3GT4A 4N9QA 1AVTA 3NBMA 4IWYA 4JCOA 3HFRA 4R9NA 3EWIA 3LWBA 4D9MA 4IX9A 4LJYA 3TJMA 1G66A 1L0BA 4G56A 1TFRA 1ZUD1 2YWXA 4JGIA 1NN3A 3HVRA 1K27A 4GLBA 3AY0A 5K0ZA 1R4AA 3DV2A 1QLHA 1XAHA 2UZ0A 2QJTA 2G4CA 1MO2A 3ENWA 4GI5A 5IVHA 1HOTA 4UVDA 4ZZ1A 4DUZB 2ZI5A 5B1IA 4TSKA 1M1YB 4I08A 5FUYA 2WE8A 1WQ4A 4B0OA 2P9FA 2OV6A 3NALA 5CBPB 5KNDA 5H8WA 3WMWA 3FWKA 1FFCA 1VGRA 2Q6KA 4QNNA 5D3MA 4UTVA 3WLAA 1FJXA 5JD5A 4YMSA 1H69A 3BZWA 2VDJA 5FPPA 1LXCA 5DNVA 4BJHB 3I3SR 1ZI9A 1DUSA 3KR2A 4REMA 4IVQA 1T1GA 4ARZB 3E0QA 2XD4A 3B3JA 2O8FA 1SBYA 3MILA 4HNUA 2YWDA 2VHTA 1DT3A 2GSWA 3LS2A 5J2UA 4L8GA 1Q7BA 3Q5DA 1P7CA 2Z2XA 3GJ3A 4N3CA 3EDMA 4W9NC 3STYA 5J2TB 2ZYDA 3JAWB 3NU1A 2IT1A 2X5OA 2CXTA 4ZHSA 5HZGA 1NL3A 2WJAA 3F3MA 4MO9A 5DNUA 5BNZA 4LPKA 3P9QA 1EBUA 3LPDA 1USUA 4UC0A 4WERA 1ZD1A 4JX8A 1L3CA 3AUFA 5CYOA 1KO4A 3NGLA 4MARA 4MPJA 3W5SA 1YACA 1XJ0A 1EX1A 3B5EA 3GU3A 4IJMA 4LZOA 3UHJA 4KACA 3RIXA 2D74A 4UQOA 5DYNA 1AHPA 1TYEB 1HYHA 1H0HA 4HLQB 4AQYB 1NUTA 4XM0A 1RC1A 1BKSB 1VMEA 3FNRA 4R68A 3ON5A 4I8XA 2CUKA 4HB4A 2RJOA 4LJ4A 1ZGHA 4BV2A 5JRJA 2HFJA 3P96A 3W8RA 3IBGA 2IYWA 2LPMA 2NU6B 4XLTA 1H2WA 1K06A 4N0DA 1WR8A 2B0JA 3H7AA 5C32A 3LHSA 2FZWA 1SZDA 1VPEA 4QOEA 3T1YB 1MQ8B 5A3QA 3AERB 1WMAA 2AG6A 3NUQA 3AR5A 5F3DA 4EX7A 5ALEA 1OH7A 1E1QA 4NU6A 4G4IA 4DJJA 2HCBA 3EWAA 1U5AA 3IBTA 5AVQA 2Z1DA 3ZGLA 4MW2A 2Z0MA 3ONFA 3W3ZB 4KGVA 4OFBA 4OHMA 1A9ZA 4UULA 3KZCA 3CONA 2D1TA 2WFZA 4PG5A 5BNFA 4Z53A 2P62A 4AY3A 3TSWA 4C6SA 4H17A 4J3NA 1IY9A 3REQA 5ICCA 3BA6A 4ENSA 4LSGA 3O84A 1ZONA 3K32A 3KE9A 4K87A 2OECA 3BAZA 2NAPA 1YB1A 2W11A 3PDCA 1O2DA 1QPZA 4GRAA 5AHOA 1KOLA 1WPQA 3JATB 1BMDA 1N9ZA 2VNJA 2AN9A 3OIDA 1EWTA 1B8PA 5ALTA 4MQBA 1N9KA 1LLCA 2L17A 1HMYA 1EE1A 1IFXA 1P77A 2QTRA 2REBA 4QQRA 5K05A 3P2OA 3FCCA 3X2SA 4PF1A 4NBKA 1E1LA 3BYZA 3IVXA 4XRRA 3EQ6A 1TF7A 2IZ7A 2PPLA 1HY3A 3L6RA 4TS3A 4E2ZA 1YFJA 1G59A 1WUKS 2IYFA 1CZRA 1WM1A 1NE7A 2FJUA 1FLVA 2DF8A 2XIQA 2YYSA 3D2BA 2O6HA 4PRKA 1U3WA 3KALA 4YAKA 3RFCA 5FXMA 4U9HS 3FGOA 4N5DA 4ZCLA 4XSHA 3I64A 5BVGA 4BNHA 1MAWA 3NT4A 3OZ7A 1X7DA 4JP8A 3F67A 2B9VA 4KXNA 1EP2B 2YVUA 2P79A 4RPJA 1OAKA 1JU9A 4DLSA 5HK9A 2QBYA 3NWOA 4O2BB 4YRKA 1C4WA 2H5LA 5E2IA 1IM5A 1ZBQA 2FOXA 2WKPA 2Z04A 2ZSIA 2DAPA 3OFSA 1KZ9A 3L0DA 2QLTA 2J3LA 4IH1A 2UVPA 4FYYA 4QPNA 4WCDA 4X90A 5ELMA 1CJMA 2ZI6A 1L5HA 5ENZA 3TH5A 3TIGA 1H2FA 4AP9A 1Q92A 4I9NA 4KAJA 1O1YA 4D81A 2AC4A 1NQVA 1W2HA 3TL6A 3QLJA 3K1AA 1EFUA 3HLKA 5FUVA 4IIUA 4B2PA 2Q6TA 2H0RA 1Y3FE 1R0KA 5CW2A 2QY6A 4OLAA 2BHLA 2V7PA 1AGNA 4ND8A 5JAQA 4KO3S 3DEZA 2F3SA 3VISA 1D5WA 3RJMA 3LWZA 4B46A 2HHHB 1VKJA 4IIVA 2WWHA 1B0UA 1D09A 3PTLA 3RYTC 5KNBD 1E3QA 2QOEA 3O83A 1Q1EA 4MWSA 3T1OA 1Z5NA 3L8EA 5LD2C 3WYGA 3LF1A 1B14A 4YJHA 4KAAA 5TT1A 3D7NA 2ZRAA 4LOHA 1JKFA 1QH8A 1SZJG 3NZEA 4ZAFA 4Z6KA 4ZV4A 1BWQA 2Z5GA 4BGEA 1JHQA 1JQ3A 4ZQGA 3VI3B 2PMWB 2X76A 1L7MA 3HNRA 2BTEA 3OPYA 4IFIA 1YOBA 2XBLA 2ZIXB 4LG1A 5F64A 1X77A 4JJIA 3FPBA 3DDCA 5EJ2A 4ER5A 1H1TA 5HZKA 1U9IC 5IVIA 4V0OA 1FJHA 4PYNA 3IE0A 5BSUA 1S6YA 2FN8A 4ARIA 5JSYA 2F3RA 4KDCA 4YRNA 4S1VA 5CG1A 3PSAA 3HBFA 3G9XA 1FX1A 3SFVA 1WCYA 2RK4A 2JNWA 3IP5A 2P4HX 3W6UA 3E3AA 5K4HA 3A9SA 1IJBA 3HN6A 2P9HA 1M0TA 4Y2UA 5K3OA 2WJWA 3EXHA 1RI2A 3Q2OA 4W5QA 5CCEA 4KQMA 1GEEA 2I29A 5HWSA 4Y9TA 2N46A 3DQQA 2E82A 3HY3A 3LUCA 4J0QA 3AFNA 2Z9DA 2Y71A 5HBGA 3THWB 4IOMA 1AA9A 3HYLA 2IUYA 2PX8A 3A04A 1WXWA 5IJAA 3RIHA 1D2CA 3HJAA 3T7KA 4D3DA 3Q5GA 5I45A 1IN1A 4EL0A 3T3NA 1P2FA 4YPFA 1QK5A 3IDQA 4S0XA 4DSTA 4ZO4A 1KBZA 2VF8A 2OHOA 3LGXA 1YZLA 3PGKA 2BF7A 2VLIA 2Z57A 1W5AA 2WSSA 2BP7B 3V8NA 1LLDA 5DM70 4D5EA 1H2RS 1FQOA 1YFKA 3PB3A 5KTPA 4NCJA 4JL8A 4F2WA 4DQXA 4B6PA 3CEMA 1QKIA 1VBKA 2VCEA 1YHNA 3CF2A 5DFAA 3ABZA 2NVWA 2OVFA 2X22A 3KAQA 4MAFA 2WZBA 3T95A 1G21B 4NICA 2EYUA 3UNXA 2YYYA 4BZZA 4KTTE 4UM5A 4BO3A 1E1NA 1M8JA 2D0PB 2VHZA 2VZLA 3VR5H 2O0JA 1ZNQO 1NLZA 3BSYA 4JEUA 1PHPA 1TM3E 5HGJA 3TLMA 4Y98A 3W5IA 4Z49A 1NZDA 1V9LA 2OEPA 1GT91 4ISCA 1THGA 3K9BA 1XK7A 4J0JA 2J33A 4FHEA 4PQFA 4WK2B 4OQDA 2Z9CA 1V6AA 2JFGA 2OV1A 2VHUA 5CVTA 1UC4B 3L6OO 3O3OB 1RWKA 3ZKWB 2NWQA 4HB3A 4NH4A 4C07A 1MO6A 1W85B 3MA0A 4C4XA 2CLHB 1CUYA 2OFOA 3NIBA 2RONA 2IHKA 4P7JA 4HV4A 4BHTA 5E8RA 1E69A 2DT8A 2PX0A 3KYCB 4HQNA 4PZLA 4DR4B 3NYRA 1FFBA 2PZGA 4NFLA 5ALUA 5M5BA 2KSQA 1QK3A 1HDRA 3A9WA 3V42A 3JAMA 1VJ0A 2RG1A 3FKQA 1ULBA 2ZUUA 3OCJA 2CLSA 3ZBUA 2W71A 4NCIA 4JLAA 2X6RA 3LI2A 2PJZA 1F1JA 4IS2A 4MUFA 5A3SA 2HBZA 2V6MA 4DG5A 2HWYA 1I9CA 1E64A 1OI2A 2H57A 2HZBA 3QVXA 2H9YA 2QQFA 4O0MA 2OHHA 4FWBA 4XWAA 3R7LA 2I8AA 3CR3C 5AOBA 2QX6A 1OAOC 4OJQA 1JA1A 1YVEI 4V1CB 4FYVA 1XMQB 2O8CA 3LU1A 1XHLA 1ND5A 3NIFB 3RV3A 1L5FA 5CJJA 2I3DA 2XAAA 3HO6A 1MHTA 2PQ0A 2DQSA 3DR3A 5FHQA 4QTUB 3ZVRA 3K0BA 4MEBA 3T1QA 1G8GA 1JVSA 2FZ5A 5D1HA 1ABEA 3PUKA 2ZRKA 6NULA 3BH0A 4KVAA 2O3RA 3Q8LA 1F2VA 3D3JA 4MV5A 2X1HA 1YR8A 3K9CA 5AR1A 3C5VA 4DCMA 2RCYA 3CBGA 1J8VA 2C42A 3K94A 1MB3A 4LHSA 4PANA 1KFEB 1QFJA 1W87A 3T52A 3ZDYB 2E1PA 2HV8A 3MM4A 3VKUA 3O03A 5A2GA 2R9VA 3Q15C 1NVMB 2IYEA 1FRNA 1L9KA 3WHPA 1CP2A 5AWFC 1XK6A 4HPJB 3LIPA 1G8PA 4WFIA 1NW8A 4H7KA 3VR4D 2JBAB 4ESVA 2XZDA 4OHPA 4GR9A 3EVGA 4LGCA 5FPTA 3O3CA 2H17A 1L5QA 4E5PA 2J0VA 4YAGA 5BV7A 2FPLA 1EM6A 2G8LA 1NRJB 2YJ5A 1KERA 5DM2A 1WB4A 2R6CA 4I5DA 3SMVA 3UGTA 3VHXA 3W2EA 4YIHA 3KQHA 3D5QA 3Q40A 2IU6A 2PLWA 3VR6D 3DHNA 3S8EA 2OXFA 1XJWA 3BXHA 3H11B 4ZU1X 1WE2A 5ALMA 3GG9A 4OP1A 3RVPA 1Z4IA 3REFA 4BN4A 4MX8A 5FLKA 1UJ5A 3R3HA 4LJ9A 2CNLA 5F1OA 4YUXA 1U7ZA 3A10A 4E12A 4P3YA 1Y80A 3H8JA 4HPXB 4ZTUB 3T34A 1BX0A 1JH8A 3HCCA 1JQ5A 3SSMA 2IYXA 3SQLA 1OQAA 2QTGA 2EIHA 2FJ0A 2PRSA 4GSKA 5FNVB 1L5VA 1DC6A 4RY9A 3FLMA 4DAEA 3FZEA 3EQ7A 1W4LA 1XDUA 1JG2A 5HTOA 4G5FA 1ZNZA 3LQKA 1KEWA 2V7WA 2GDZA 1NAHA 1RM0A 2BZSA 3H2BA 1MPTA 5F4ZA 4YUVA 3UJNA 4KLRA 2K87A 1G4UR 2I5PO 1POXA 2GEKA 3RVOA 2JLQA 4H3HB 3H4MA 4LDJA 2ONJA 4BLQA 2MSCB 4YMHA 2J6IA 1YIOA 2FMIA 1X7HA 2OBMA 5CXSA 3BDIA 1VM6A 4FFOA 1XI2A 2FAXA 2WD7A 2IX9A 2XTZA 2GFHA 1O94A 3PJGA 2ZEJA 4FE7A 5H1YA 4ZEOA 2DPHA 3WAGA 5AKGA 5LD2B 3IP9A 2QE7D 2R6JA 2A4MA 1HE5A 4JYCA 2RGWA 1JHZA 2NSYA 4DLXA 5SZJA 4YQEA 4J9UE 4KPUA 2NUAB 5D7BA 2GZHA 3JASA 1HDCA 1OXMA 2Y1EA 3I4LA 3QENA 5K3BA 4ARAA 4F3KA 4QUGA 3W04A 1T3HA 2OGTA 3LXXA 3KJQA 4BDTA 1Y6RA 4QUAA 3IDAA 2LCFA 2VJCA 4HI0E 1ZITA 1IY0A 2XNDD 1Y5RA 3L6DA 2IC5A 3TX2A 1L8AA 2C4TA 3HDJA 4M7WA 4KHPB 4DCTA 3R6WA 4WKOA 2PPVA 3GK3A 1ECJA 2A5FA 2JFXA 4PO9A 5EQDA 2NXWA 5DM60 2QTVA 3RVLA 1WCWA 2WJ3A 3TRFA 4X94A 5DASA 4BTVA 3TTUA 3IPAA 3IEMA 4O4IA 2I6XA 1CJKC 3MPOA 1OXBB 4MQFA 4Z99A 4FEEA 5JR3A 1KJ8A 2YIDA 1F9AA 2B6HA 3EBPA 4HDKB 4MGYR 3WNDA 4Q4AB 1X3LA 1N6PA 1QO9A 4HXEB 4L75A 5TARA 3LX5A 3NHJA 1DBVO 1DQYA 3D7MA 4CVNA 4AY6A 5K20A 1LBSA 3N2NA 5KHOC 4H7JA 3ZJUA 2EQ5A 2RHLA 4NU8X 5P21A 1I30A 4Y2SA 5AW2A 1M0WA 1ZJ4A 2WF8A 4ALIA 5I8PA 4BAZA 3I83A 4HS4A 2BI8A 1AQYA 1SXJE 4FOOA 5CT6A 2YVAA 4OOFA 3PPVA 2QWXA 3AJDA 3A6PC 2VT6A 1EFLA 4GMDA 3PKIA 2L19A 3BDVA 8OHMA 5FQNA 1YSCA 1YA8A 4JJEA 1DO2A 4HEA6 4RPKA 5HGXA 5ALLA 4EJFA 3LFTA 4E07A 1MB9A 1P5FA 1FX0A 1NWHA 2AA3A 2GCOB 3EF1A 4RW0A 5DTJA 5HF8A 1N1GA 3DOIA 3MUEA 4LXQA 4D02A 3SICE 3KQNA 2Y0CA 3OKFA 5AW9A 2A1UA 4Y7CA 2X9QA 3FVRA 1I3LA 3KEGA 2Q21A 2VP9A 5GTDA 1R9GA 3S7TA 3ZNNA 5TB5A 5JWOA 1KK1A 1IPFA 4IIJB 4MRNA 2H06A 2H2AA 3WWOA 3B12A 3I4FA 1NV9A 1CFJA 5CIQA 4QBGB 3N53A 5EXSA 4LV6A 3RJ9A 3DTYA 3A32A 2B25A 1UDCA 3T61A 5TMPA 1ZM9A 1DLJA 2G5GX 2OBNA 3OT4A 1E98A 3BWCA 4L4UA 3LBNA 4GAEA 4H7DA 4JUBA 4F12A 2VRNA 2NO1A 1T0HB 4S1PA 1PR9A 3UJAA 4MGHA 3RODA 5LU8A 3PNVA 2D00A 1ZUIA 2ZAOA 4WKGA 1VHLA 2GT1A 2YFKA 4X61A 1IZYA 2GJSA 3CINA 2AZTA 1THMA 1XA4A 3ZWKA 1N7GA 2X4GA 3D54D 4JODA 3UANA 4PC1A 1KP9A 2F9FA 4QYWA 4E5YA 4N54A 2GZDA 5TEWA 4O02B 4BNNA 1AKEA 2HLDD 4DMCA 1JBKA 5M2QA 1GNLA 4MV6A 4B3TB 2V5UA 3DULA 2GZRA 4MMXB 4R1QA 4UTOA 2WF5A 3Q11A 4H6WA 2PD4A 3CR7A 5F5LA 5T4HA 1PX0A 3RTGA 5JVDF 4EUSA 1FYVA 4OP2A 1GYRA 4D0SA 5E6RB 3IUBA 4H6PA 3DBHB 5BR7A 1GY8A 3VU9B 1CB7A 4QPZA 5LLDA 1PLLA 3TOXA 3EMKA 4P3PA 5JBNA 3C48A 1Q21A 4UMEA 3H6GA 5CH3A 2NV2B 1Z47A 1QORA 1C1YA 1S8OA 2I66A 2KYRA 2WHYA 3L02A 4LSZA 3W6NA 5A06A 5J58A 2CLEB 3HUDA 3OZXA 2ODNA 2YCBA 4EYQA 1KQ3A 1NBME 1NXPA 2GKGA 3KOUA 4MWOA 4Q3AA 4ZREA 4DUYB 1NATA 4ZT5A 1HKHA 2VP3A 4DCSA 1YR3A 2B1IA 1YIAA 3HC7A 4C0AC 2XMQA 1CXZA 3AIIA 2JB9A 3P26A 5BV1A 3V4LA 1IAQA 4AZ0B 4F3TA 1PS8A 2C92A 1K8ZB 1JWLA 4JI8B 4JI4B 2W00A 1OH5A 1YS9A 1ZG3A 1OLSA 2PQ6A 3MGKA 1PN3A 2G7ZA 4BO8A 3QOWA 5JATA 1NBMD 5F52A 1GTG1 2HQBA 2ID8A 1RS0A 3BHMA 3WGQA 621PA 1E1RA 3RWBA 3EXHC 1HDGO 2B69A 2HCFA 3PPWA 3UB4A 5LYJF 1GRNA 4N39A 1HDEA 2JZCA 3V1NA 3F5SA 1Y4ZA 3MUOA 3OI7A 5AVWA 1G8KA 2CWDA 1RYZA 1WDTA 1DKOA 4JQZA 5F5XA 5FBKA 3ABOB 4ZXFA 2IY9A 2EHJA 4G5SA 1X80A 2WSSD 3NRBA 4I7EA 5FOSA 3C6XA 4LF4B 3IVMA 1AGXA 4FDUA 1RQPA 1B0PA 4FGKA 3EHEA 4TL7A 1GCAA 5BYAA 4A8TA 2PBZA 4AF6A 3ZYCA 1MA0A 4W7SA 4K1LA 2OXRA 4AXXA 1E5XA 3BMCB 1XZCA 3HSKA 4J0FA 5A5FA 4GHWA 5JS7A 2ZXFA 1F12A 1P2BA 4AF8A 3OLXA 3AEXA 4LMAA 1IEXA 1G1MA 1Q7EA 1SWVA 3QV2A 4IDCA 3TLEA 3GW8A 1OH6A 5BQ5A 4GU5A 3EPKA 1H1LA 3K9FC 4FDVA 1XTTA 1TVKB 2A4KA 3C5HA 3DFUA 3L7KA 3L8GA 3EIOA 2GLXA 3DD5A 3G2PA 4RWEA 3GLRA 5L53A 3DV9A 3GUYA 3OQBA 1OVGA 2PSSA 3JV7A 4QC2A 1KVUA 1HL7A 2F8MA 3FWPA 3M83A 1WTCA 2ESRA 5AK3A 1C8LA 3RAGA 2X3FA 3O4RA 3PQ3A 3EQZA 4HEJA 1E0KA 2M6SA 4DABA 1ZIPA 3K6KA 4CT5A 4EITA 1Z8DA 1GIAA 1QHYA 3AI2A 4MSUA 2JIBA 1ILEA 2W42A 3NNDA 1IB6A 1W9HA 4ZN6A 2P7IA 4LVOA 3MTDA 4O4JF 4EYKA 5MGNA 4J49A 4K28A 4EFMA 5C1OA 3GRFA 2JFOA 4DQUA 4GOND 1OJ7A 3ZWYA 4PV7A 1IM8A 3GP3A 4GMKA 2ZYUX 1UWVA 5ENDA 1VG8A 4J0GA 2I6GA 3SJ7A 5HNKA 2REOA 2XT9A 1KMNA 3CUUA 3URMA 4B74A 3V1MA 4C08A 4HGYA 4XRGA 4JS0A 1DOAA 2HA5A 1TZCA 2VYFA 3OLVA 3JZFA 4R1TA 4IHQA 4WCFB 3WLHA 5C4IA 1GZ6A 2IUSA 2WT9A 3CT6A 5KYUA 4JWKA 2PLFA 3EXEA 1Z0JA 1JU4A 3KKMA 1MJHA 1GILA 2XOEA 4P83A 5EHZA 3COWA 3AR9A 1NZJA 2XWJI 1HQKA 2E48A 3TLJA 1RXYA 4F06A 3WJ1A 1QVVA 4MS4A 3L4SO 3CS3A 1QKKA 4MUXA 3A1SA 4OI1A 2OILA 2ZYAA 1PGNA 2YFHA 3BD9A 3WQRA 2Q3BA 2F62A 3O94A 5I7HA 4NE2A 2YNMD 1KQGA 4GZ3A 4D9EA 4XDYA 3UH1A 1NN1A 4K9PA 5C7IO 5K8JB 3WB2A 2EX4A 1PT9A 3ROPA 3LCCA 3PUHA 2I6SA 2CUNA 3H05A 3TEFA 4CV2A 4CIBA 2HKIA 2XZPA 1OBHA 4Y2YA 1BWSA 5FX2A 3DPSA 1VMIA 3L7LA 1T6ZA 3AOGA 2AUTA 4I9UA 4MUNA 1HDYA 4YYEA 2VP6A 4KOAA 1DTSA 3ZIAA 5JE8A 3OZIA 3I39X 3U17A 1NVVQ 4CW7A 2IBTA 4OA5A 5CA1F 1BX3A 3IUYA 1E8DA 4OX9Y 1EVZA 2X0IA 1VOTA 2AOVA 3H19A 1C3JA 1TAGA 4LF8B 2AKYA 3KHUA 1W36B 5M3BA 4OO3A 3I01A 3EW9A 4MS1B 5JZVA 3HA3A 4EPWA 4TKLA 3RFFA 4YGYA 4LWQA 1PT5A 4V0RA 1UJNA 2EATA 2BN4A 1WCIA 1H65A 3QVSA 2H4XA 1C0EA 1Q95A 1MMFB 2JD1A 1PJ2A 2FE1A 2YXEA 1I3OA 3CY6A 1QYVA 3ONDA 3C3YA 1TGYA 2PUGA 1PO7A 4BP9A 2P8JA 4CHGA 1AK9A 3GFRA 4F2HA 5ALGA 5LP6F 2L69A 3URKA 2XECA 4F60A 4LNAA 3GOQA 4F6CA 4P34A 5C51B 1Q1BA 5IZCC 5KYYB 3RYCA 1Q12A 2Y2UA 2ZJ7A 3OZFA 4GEGA 4PSVA 1PEYA 1TYZA 2G1KA 2HMYB 2LIPA 4AJHA 3NP7A 3LC1O 4C29A 5LQJA 4KFSA 2N42A 5D84A 4NIMA 5CX1B 5KSWB 1PJTA 2OBXA 3B2NA 1PFKA 1MNQA 3QH4A 4FYIA 4ZOBA 2AOXA 1SBCA 1XCLA 4Y2RA 4N48A 2J4CA 4UUOA 2C3YA 1EXVA 2XXJA 4G6ZA 1SQ6A 5DGCA 3VPCA 3FM9A 3DMGA 1DXOA 4XQEA 2VJMA 2OO3A 2PT6A 3MZ0A 4RKYA 4DBVO 5DV9A 4B3DA 4EUNA 3AH8A 1LFDB 1HE1C 3HEAA 4B7ZA 1H94A 3ZIDA 2NADA 4CQLB 1U8CB 3ETCA 1ZN2A 3R3WA 3HMKA 2Z5LA 3AUAA 3FPFA 4IFTA 4YJ3A 2ET6A 1WOMA 2HMSA 3M89A 5ALFA 3RRJA 5D6OA 3E2IA 4EY6A 3VVMA 4CMKA 4W82A 2HQOA 4DL9A 2M98A 4LX8A 3ZD7A 2H29A 4QSMA 3A0RB 4Y3UA 2XNCA 2ZBQA 3S29A 2RGCA 4G07A 3VGJA 1YDWA 2NTNA 1LQ2A 3N2IA 4OQPA 4DA4A 3NVKI 2OPBA 1Z8NA 4YRFA 2YWHA 5C37A 1EXMA 4QVKA 2NU9B 1MPXA 2PWBA 3C24A 4RHUA 3EHDA 1QHIA 2DG2A 1XXHB 3L84A 1KETA 2PJUA 4TTTS 3BAFA 3UXEA 3UIEA 4DJAA 3RROA 1GL7A 1GA6A 3GXBA 4I8DA 5CYPA 1C30B 2GI4A 2JCYA 3K4QA 4YJDA 1Z88A 4LYHA 1MX9A 3N2KB 2A5LA 5K3AA 4F6RB 4KKVA 1Z28A 1J2YA 1IU9A 3OLQA 3AEQB 4TL9A 5KQSA 2H1WA 1E18A 5AKYA 5EXDA 1Y1PA 2JGEA 4FCVA 5CDUA 3GRKA 1P61B 5FTMA 1E3SA 4LJLA 3TZQA 3FPSA 2W8BA 1JHPA 4EVQA 5DTQA 4HVLA 4YT4A 1X70A 4MS3A 4J1TA 1Y4AE 3LFHA 2A84A 2Z98A 5DW3A 3VPSA 2EFDB 3IQIX 2A9FA 1JH9A 2ZR0A 4KXFB 1TW3A 1O9BA 2H92A 3I23A 1DAFA 3TMKA 1GUDA 4JT4A 1FPQA 2ZJ0A 1MUUA 4MJLA 5EWJB 2ECPA 4KWTA 5FULA 1NIPA 3CN7A 4AVYA 4DDKA 2CY0A 4QDXA 2XPCA 2HSWA 2NIPA 2AW5A 3WO0A 1E6CA 1G19A 2NO7A 4AJLA 5FFMA 3O9VA 2FSIA 4PZZA 3RYHB 2QL6A 2JLXA 4BMOB 1CE8B 1VCHA 2HRQA 1IEVA 4HQ0A 5LNK6 3CUKA 1P9WA 1ZR4A 2H31A 3DH0A 4L07A 3ZWPA 4B6OA 1SOMA 2I91A 3A9CA 4IWXA 2X41A 1K8XB 5BV2P 2ADOA 4YT2A 2OG2A 4WN9A 1BE0A 1X94A 1T5TA 4M7PA 3LX6A 3ANYB 1NI4A 4R2KA 5CM9C 2Q9AA 4U1RA 2PMKA 3COPA 1AY0A 4RKQA 4UHHA 4H59A 7ABPA 5JADA 1N2EA 3WWEA 1FTQA 1S2NA 3L06A 1YMVA 1PAUA 5JTUA 4B8YA 1TZKA 4OHXA 4HNAA 3KKEA 4OK6A 4BLSA 5F7OA 1SXPA 2V96A 5G40A 2O7RA 4OYRA 4PGMA 4TQGA 4ZYZA 5LB2A 2Q4BA 2G70A 4MWGA 4BE7B 3C8MA 2WUFA 3QX7A 4P4GA 1JJVA 1HK7A 2YVLA 4LI3X 4X95A 1R9JA 3UOGA 4R2LA 5DBIA 1PVVA 1HLPA 2O54A 3RUCA 3KD2A 4HPWA 4MQUA 5BWOA 5EJ8A 5F7JA 4IJ5A 3JQ7B 1AKWA 1OROA 1X1AA 1N7HA 4KFRA 3M0EA 5T4EA 1ZFNA 4TUYF 1YCFA 4LE1A 3IQEA 2D0IA 5JBIA 4YY3B 2XKKA 3GLGB 1XMPA 1NHGA 4E2FA 3GT7A 3UT5A 4DWVA 1A7AA 2CLIB 1EDBA 4GC5A 1H42A 3BICA 3FNFA 3ZCQA 1R00A 3VZDA 5L95A 1F8XA 4DZTA 5FQOA 3D8UA 1R6UA 1SU6A 1MTZA 2HF9A 2BI4A 1NBHA 1UK9A 2YW2A 2NQ8A 3E22B 3U7EB 3S70A 1NV8A 3TRJA 4QQNA 4CU5A 2XNHA 3GXOA 1ZJ6A 4FC6A 1Y82A 3WKAA 1GPAA 2BMVA 2D13A 3ZHOA 1GN8A 1Z4LA 3MS4A 2GAJA 3C8HA 1QS0A 4WBSA 3WLJA 4IS3A 3V46A 3ULKA 4ZEVA 3FZYA 5K5EA 1JKJA 5HK8A 1RXIA 4UJ5A 1FFGA 3D8BA 2Y68A 2ZQ5A 4GICA 1UMBB 4OUKX 2Q5JA 1N1EA 1TRKA 2NOAA 3EVTA 2XVZA 3IAS1 2HN9A 3T3PB 2NYRA 3LUPA 2Z2KA 5F7ZA 3IJEB 1NXWA 3ZNQA 1XCBA 1FYDA 1S8AA 1YDFA 2CK3A 4OHCA 2B99A 3FMGA 2ECKA 3I73A 1J0BA 3PX7A 1BH6A 4EJSA 5I47A 1H3NA 4YCCA 5KYTA 2QG4A 4A1FA 2V03A 3J80A 2QNBA 2QF7A 5EJFA 3IULA 1POWA 4LZPA 1QP4A 5LIPA 4V24A 1W75A 2CFCA 1TCBA 4YJGB 2GN6A 4EZEA 3NAMA 3DHYA 1B42A 4I1UA 4KRXA 4Z0HO 1QRUA 3NTRA 4TT8A 3CUVA 5G41A 1R5NA 4JYPA 2V7TA 1P2VA 3N6VA 4Q9DA 4DIBA 4DG9A 3OT1B 5DWVA 4X64B 4CM5A 5BORA 3BX1A 2A0FA 2GZSA 3ESBA 1WB5A 3G9TA 1UBUS 3IKVA 2PGAA 5KWEA 3VYWA 1RMYA 2QRNA 5ALOA 2ZRBA 2GFIA 3CLTD 3GHYA 4Z1MD 5CB4B 2PYZA 2OOSA 7REQA 1CY8A 1OZGA 4EB8A 3JVIA 2GA9A 5LWQA 2PUFA 2XLCA 1V5WA 1IEQA 1F2TA 3SHFA 3PITA 3L6CA 5J9FA 1L4MA 2PZFA 4OM7A 3AVTA 2JLZA 1S7CA 1PFYA 4PQYA 1ULZA 4NK4A 3WRYA 4CMAA 4I50B 4QARA 2UYCA 3CF4G 2VC2B 3LC0A 4J2OA 4LTMA 4P08A 4KSCA 5HRCA 3O6VA 3IV9A 3FN4A 4KQ6A 4RCVA 3M1IA 3VTFA 4U7JA 2V0CA 3JR7A 3EEOA 1WS6A 4KYVA 1C29B 4E6PA 2R7NA 1ICIA 4LK2A 5DHRA 3NOXA 3U5ZB 4EO4A 4QPDA 5AW4A 1CCWA 1FYXA 1Z4MA 2QUJA 3PRYA 3DL0A 3ZV6A 1HQCA 1KAQA 3QWFA 3W5AA 4YP5A 2IWRA 2QN7A 2F1JA 1PD0A 4FYHA 2YH2A 4C4OA 1SQ0A 2R751 4BKMA 1HQDA 2O4CA 3CN9A 1P9NA 4RV4A 4UE6A 2FRVA 4R0NA 4ACBA 2WRZA 2R8XA 3DPIA 3T5AA 1EESA 2OK7A 4AJ4A 521PA 3PUXA 1NVUQ 2W6ID 5D85A 2R3SA 3JARA 5GINE 2FPSA 3PWTA 3GLHB 2L42A 1A96A 2O2YA 3UAZA 4A8JC 2NUTB 5J2UB 2IU4A 4GMGA 4HDQB 1H2HA 3R6DA 5CDFE 3PLAE 1SCQA 3KOOA 4S05A 1KIFA 1XNJA 2GR9A 3QOFA 1Y1QA 3QNMA 4DRXA 4R1MA 4K9QA 3DZ8A 1QDEA 4MYSA 3MGBA 3IVAA 2GD6A 3W4JA 4ZHQF 2HR1A 3L1HA 1K63A 4CEHA 1I1NA 1EI9A 4MIOA 1T1IA 1W4ZA 4NABA 4P7FA 1EINA 1T9DA 3C87A 3EUAA 4DFDA 4FB5A 3FY4A 2Q0QA 3NBKA 3SK0A 1G2QA 1QHHA 4P4LA 5EE1A 3PQ5A 4XJVA 3RKUA 5AVVA 5HRAA 1R6BX 1V2GA 1NE2A 4E3ZA 4ETWA 1FJGB 4B8ZA 3EZLA 1HPLA 1XJQA 4M53A 3TKYA 3V5NA 5CFRA 3RBXA 5EJEA 3WA7A 2C20A 5L3QA 4BEBA 3KSRA 3IQZA 1DRVA 2YJTD 5A1TA 1HG1A 1CUJA 1QMGA 1VHJA 1E63A 3EZXA 3HCNA 4OGKA 5IDQA 1V43A 1Z37A 1K7EB 2CD9A 2GN9A 2J7PD 2P27A 1C9MA 3HWWA 4G5YA 5GJVC 4NCBA 4CDMA 3PCTA 2VBGA 3S5JA 4LF5B 4BAUA 1ZNWA 2WKWA 5E4JA 5B12A 2JBWA 3A1UA 3DLBA 1E0AA 4V0QA 3AWIA 4MQMA 3ZIUA 2FR0A 2E55A 1PL7A 3WLFA 3D0QA 4B3RB 2G9UA 2GA8A 5K01A 3KSZO 4MLPA 3HACA 5B4VA 1F60A 2ZIVB 5FIUA 5JQWA 2PA3A 2QUIA 5CNIA 3E7PA 1BFUA 4QOSA 1UKCA 4W5JA 2GB4A 2BBSA 2QLLA 2QN9A 2FVYA 2ZWVA 3WYBA 3X2EA 4BCDA 4EATA 1SBNE 3QJYA 5KOJB 2FPPB 3B9RA 5INTA 1NF3A 4PAWA 2W6JA 4HHEA 4Q0MA 1BD4A 3U9LA 1LDNA 4CG0A 1DINA 1BVHA 2C83A 4B73A 1I0ZA 2P77A 5GONB 3WHKA 5ITZA 5JCJD 1LTHR 3UHFA 3B1WA 4BUJA 5LDHA 1TCVA 1P6UA 2V4MA 2YXPX 3R3SA 4JJ6A 1YMQA 4WKCA 5AM4A 3NT2A 3A3OA 2DQZA 3KV3O 3GQBB 3L9XA 4G0MA 1FOEB 1NOKA 1TQ6A 1AS3A 5CIYA 4JU8A 4OX9B 1YB2A 1EGVB 5BNIA 3HWRA 5D8DA 4N49A 1LBHA 1FDUA 1K6MA 1JSCA 3D6UA 2XVXA 3UPDA 3UQYS 3T94A 1VBNA 1WIWA 3ZOZA 2O1SA 3HQ4O 4W7HA 4XB1A 1KNQA 1Y4DE 3E1KA 3KJIA 4B71A 1MGPA 4Z9AA 1Z0KA 3CPSA 4ZGWA 4E11A 1EFPB 2P0EA 2QL5A 2RK6A 1P0CA 2OORA 5KIAA 1KP2A 3CRRA 4LI0A 2H3EA 3U7FB 1UOEA 2X8AA 4V02A 4M98A 1WXXA 2XOKA 3VR4H 1BEZA 1Z8FA 3ZZUA 4EARA 2X2OA 3BH6A 4KQJA 4K81B 2VPPA 3WNBA 3NETA 3SIWA 2PL3A 2GPBA 2QR3A 5U9CA 1Y9JA 1UT8A 3AVVA 2J8ZA 2F17A 1XLTA 2ECOA 1ML4A 1P4SA 3A4YA 4H16A 4JQSA 3P2JA 4LYDA 5K99A 1YMUA 2BSXA 3I5AA 1NYQA 1TJNA 3O73A 4OXRA 1EFHA 3VC2A 4CLDA 5AVZA 2ZUFA 4L0CA 4HGRA 4EA7A 3HBMA 2OM2A 3ZZNA 2Q4EA 2V65A 1NU8A 1TD1A 5EY5B 4HDRB 4K3UA 2FR1A 1U8AA 1XGKA 4TVOA 4URZR 4PCLA 4OY3A 2D06A 5F7XA 4MTLA 2O5RA 1CETA 4MINA 2PKQO 2V0GA 4P58A 4UCWA 1PYGA 4F1KA 5CFZA 3BWEA 3ZQ4A 3HL4A 2PGJA 1OWLA 4Q21A 3S40A 1E6MA 4CPDA 2FVXA 5B6IA 2XQGA 1SC4A 2I22A 3OMXA 5IBPA 1GXSA 5H80A 4BQEA 3ETJA 3ZD9A 4E0BA 4QUJA 1DIBA 2XUFA 3DT9A 1XZHA 3NJ4A 4J0DA 4TXJA 4I5GA 3E8SA 4Y2QA 1PR1A 4XWTA 4EMUA 4F4JA 4PFKA 1W581 1SG9A 2W98A 3OEEA 2YVKA 1XU7A 2QVBA 1M6HA 5ALNA 1PP4A 2WSBA 4OLHA 3FVTA 4BQFA 2PZEA 3TQFA 3TOSA 1WPRA 4IL5A 4CKYA 1U98A 4IXMA 3V4OA 4C30A 2LV8A 4YB8A 2HHAA 1XVTA 4AS3A 1LRLA 3C8DA 3PV0A 5C18A 3FAKA 4JN6B 5H70A 1CVIA 2CEKA 4Z54A 1JZQA 4F9EA 4CF4A 1OREA 1L8OA 1Y9DA 1T5SA 2FSUA 2YOGA 5TJ9A 2H1RA 4US0R 4IQGA 2PXHA 2EJCA 2A2ZA 2YDYA 3A58B 3GCWA 4KRGA 4GT1A 1RYMA 4C7JA 3Q7SA 3IJRA 4OYHA 4F4DA 3OEHD 1GKKA 1Z7GA 4OB6A 2IH5A 1KU0A 2YDXA 1JS1X 1J97A 2WZQA 1N6LA 1KIAA 2PVPA 2XWBF 4M9UA 3GGDA 5CG2A 2YC2C 2OGWA 2KPOA 4FD3A 4TPKA 2P4UA 1JDNA 1MQSA 3EZ7A 3D1VA 1RJDA 5IMSA 3TLCA 4HDNA 1Z5OA 4OG2A 1IONA 4KJZA 3ZNOA 2AYYA 1NUPA 4KVGA 4YRDA 1K08A 4BYGA 1ACMA 7ADHA 1Y8QB 2QPAA 3GI1A 1ZNXA 1E2LA 2EKPA 2J08A 3F6PA 1YONA 3UO8B 5AW8A 1II8A 1P75A 4IO1A 3EG9A 3HBNA 4CKEA 3EIEA 3C6QA 1Z17A 4B32A 5DN6D 1GL9B 3FHTA 1QBKC 2BZ1A 3RIGA 3CUWA 4XIIA 1Z0IA 1P1FA 2AKAB 1S3FA 4J1SA 4ZMBA 4TQAA 4EY8A 4RJIA 3AR8A 5YASA 4YMGA 2OHIA 2OESA 4W8GA 1S89A 1ZN9A 1ZVMA 3BULA 3R5XA 8ADHA 5IFKA 3ICPA 3O4JA 2BCEA 2R00A 2WHRA 3E9DA 4I0WB 4NY1A 1CJSA 2QUKA 4H31A 5J2TF 2OLEA 2QSUA 1LF5A 1O08A 4RESA 4WFQA 2VYVD 2GVZC 2XITA 4RSMA 2GPTA 4KW7A 1RBYA 2X9NA 3TNLA 2E4UA 3FZGA 3JAKB 2XZOA 1Z06A 2JANA 4N18A 3COYA 6GPBA 3UJHA 5JD3A 2DUUA 1ZLYA 2I62A 2R8YA 2ZSBA 3LLMA 3P9IA 2R62A 3INGA 4RH0A 4B33A 3H84A 2G1AA 3DLPX 3I2YX 3CO0S 4GLJA 3CEPB 4R1PA 4QJ4A 4UDYX 3V7FA 3WWZA 3K16A 3GRUA 3OCCA 1RM5A 1I36A 1GGNA 1W0JA 2WAOA 1TVCA 1HOXA 2JEZA 1GL6A 1O58A 1YBFA 4B45A 2OV8A 2Z3WA 4ENUA 2N0SA 1MB4A 3HUTA 2BEUA 2FSGA 2Q4DA 2JL1A 4QTTB 3PC4A 1EFRA 1YRBA 1YD7A 1KJZA 1U6IA 5FL7D 5J40A 2BWJA 3N0RA 1PQUA 3IBSA 3PYXA 2CCJA 4XI9A 2YQZA 5JS1A 4HAWA 2QW0X 3AONB 4QL3A 2FHSA 3VZSA 3G0HA 3EIUA 1AQLA 5JNSA 3OQJA 4H4EA 4EJSC 1KH1A 1UDWA 3QF4B 1G5HA 3A7DA 4C0HA 5BSHA 4A6PA 1G8AA 5JS8A 5I8ZA 4K6CA 1Y63A 3HLYA 4L74A 1I4LD 3M70A 3P5SA 1WVGA 1GNQA 1EWVA 3IALA 1V5FA 4X7MA 3WYAA 3EVDA 4M49A 1DEAA 2FLWA 2IE0A 2ZS9A 4HDMA 3VKFA 4WBNB 4B6JA 4RXTA 2QZ4A 4L4ZA 4YR7A 1WETA 1DQNA 5JNTA 1W46A 4PLTA 4LFCB 3OOEA 1V37A 3KBOA 3OZGA 3B7GA 2NV0A 3PRJA 4GOOD 4Q7KA 3L46A 5HDBB 3S28A 1T0BA 1TOAA 4PY2A 1E4YA 1K6IA 3GJYA 4FR0A 2WVGA 3V32A 4LDPA 4HL6A 2EVWX 2Q1SA 1EGAA 3BCHA 4OGGA 4XM1A 2DERA 4QZVA 4OIFA 1RM4A 2C2WA 3ZQ6A 4MW4A 3EWSA 3ETDA 2W70A 1YL7A 2BEVB 4RMHA 4O33A 3SF8A 4Z5XA 5AM2A 4BMNA 2D4HA 2GUGA 3C4QA 4H4CA 2P6OA 2IYRA 3V6LA 3JQ8A 3NO4A 1RAGA 3PEFA 3Q88A 1M76A 3H1BA 1XJ5A 2JLRA 4GVPA 5FWXB 3D6TB 3Q3IA 1RKBA 4GX1A 1H0KA 2FSHA 3Q9SA 4OGWA 3HUFA 1I7DA 1X42A 3NONA 4JBNA 5CAEA 2ERXA 4UNRA 5DXFA 2UZ4A 4O2BF 1L5ZA 1FNSA 3DW3X 1AKYA 1SBTA 3EAGA 5ECGC 1XNQB 1R7RA 2IXFA 2R5NA 1JJBA 1WHSA 2C99A 3DDHA 5I7FA 3UAVA 4L02A 3VAAA 4CL3A 2JDIA 1PR6A 3QXHA 4YMVA 1FTWA 1SM4A 3X43A 3L9WA 4IIHA 4WFKA 1MOQA 2JLSA 1XVUA 2PQ2A 3VZRA 2F00A 4ZAXA 2V9PA 1XDSA 4QM6A 2QQ5A 5LP1A 2ZJ5A 3T7AA 3ZKAA 1SB8A 1FTYA 2O8VA 3R5SA 1OU4A 2EKLA 4EJMA 1NVWQ 2Q3MA 4GMFA 1SIUA 1KFBB 3F4BA 1AH2A 4JA0A 1VHQA 2AOUB 3IUEA 3IL2A 2J0QA 2KB0A 2WU4A 3LA8A 3LZCA 4JVOA 1Z5UA 1RHUA 3VDXA 1LCIA 821PA 1VIYA 1P7VA 3HU3A 3WQHA 1S4MA 4Y9RA 1K98A 2CNWA 4N5HX 2PYIA 5IX8A 1SCKA 2NM0A 3CZMA 1IXSB 2B1JA 5K03A 2ZSAA 3SX4A 3KSMA 2I7DA 5A0TA 4XH9B 3DW1X 4M8SA 1R4MA 1HFJA 2L0XA 2P9QA 1RD4A 3WGHA 4JC5A 1H2ZA 4RF3A 1E3JA 1LSOA 2V9ZA 4LHYA 4B84A 2ZYRA 1UFQA 1OYOA 2BV3A 3FUTA 1KY2A 2P30A 2QRPA 2VS1A 1V8PA 3QU4A 4PVDA 4AJNA 1OXSC 1SKYB 4YUZA 2WWYA 4CN8A 2IV7A 5F73A 3G2JA 3AUJB 3DS8A 5IBRA 3T5BA 2I4OA 5K8UA 4DREA 2WOJA 4I55B 4J7XA 3BFJA 5FA5A 5BUSA 2ZGVA 2BMDA 3CVWA 3RC7A 5AO9A 1GR0A 4BCCA 4I36A 2NU8A 2R0QC 3DQZA 3M9WA 4JGBA 1Q44A 4K0RA 4CIWA 1M2NA 1H5UA 2W6JD 3NC4A 1UR5A 2ZITA 5EP4A 2OLKA 3QYFA 2FMUA 1EAYA 4JQOA 2EJBA 1Y89A 4M7OA 4E09A 2Q2VA 4CGYA 5AVSA 2B4AA 3EEFA 3F3SA 3QBJA 4IZHA 4NFHA 4Z8XA 3SEQA 4EKYA 1XZBA 3BCSA 2VYNA 4J0IA 4E30A 3WVNA 5JRDS 1FP2A 4U0JA 3AF1A 1TZ2A 1TRHA 1OIWA 3I05A 3RLFA 3AOEC 2W6CX 3EGXB 4FK8A 3RFUA 4AULA 4LOKA 5BURA 1Y3BE 3F46A 2A78A 4EA8A 3ZX5A 3CRNA 3SSOA 1H8ED 2P9TA 4Z2YA 5C5DA 1JIVA 4LBZA 3H9UA 3CWCA 2B4RO 1A8SA 3RQIA 3UB2A 4JJ4A 4KLZA 1QYWA 3H9JA 3ND7A 4WJKB 3VC7A 4LXXA 4XIYA 1FJ2A 1KOFA 4L6IA 1G18A 3WS7A 2R5WA 3DFZA 2MSWA 4L85A 1W6UA 4X0EA 3T4EA 2KHZA 3EA5A 1AOXA 1CHNA 4EKIA 1DZ3A 2FPGB 3JALA 5KX5B 3AP3A 3WV5A 4I1IA 1GQQA 1XMSA 5J1TB 2OORC 4U63A 1GUZA 4GM1A 1T9GS 4M38A 4Q7EA 4MQ6A 2H08A 2DR0A 4AB1A 1ZH0A 1BQ3A 1L5SA 2QHXA 3WAKA 3ZHYA 4EB6B 1CY6A 1XTJA 1I4WA 2CL6X 5EXXA 3NAQA 4BQIA 2HWWA 2EW2A 4XIFA 1CUCA 1LJLA 4V0ME 4UEQA 3M49A 4HD8A 3PBKA 1OOEA 3CB2A 3VOBA 2CHGA 3KT6A 3U6BA 2WK1A 5E8JA 2J9FB 4LN1A 4EIWA 3AW9A 3SXUA 1OHHD 1XLTC 1D6JA 1RWBA 2PG3A 2IL1A 1D0SA 1JNYA 2CVOA 5JH7F 4B3JA 4ROSA 1GVHA 5F3WB 1Z68A 4ZVVA 2ZATA 2ZCUA 3P9SA 1YXMA 2ZAGA 2TMKA 4NMLA 1J2TA 3KTOA 5EIEA 1YAHA 2HCRA 4OPMA 3ZWAA 3HO1A 4BO0A 4DXAA 3MIIA 4YROA 3KAKA 2B2XA 3T8YA 1E5DA 2RHCA 2ERCA 2ZE7A 3R75A 1KQOA 3KTDA 5CLGA 1YJCA 1V4NA 5CPFA 4JZKA 3SDBA 1A69A 3OIVA 4DCGA 3JWJA 1RVDA 2QRMA 4QBFA 2Q6VA 2OFFA 3RAJA 4NPHA 3G8DA 1OX4B 3HVUA 1L4BA 2J5XA 2W6QA 4BATA 1E94E 5H02A 1OFIA 1AKRA 4YRIA 3EZNA 4Q3LA 1DP4A 5A4IS 3BWMA 3TBHA 2DFNA 1QDUA 1NUAA 1E9VA 2X7XA 1DRUA 3B7PA 1SRQA 3CEAA 1W5BA 1NJ5A 3GJ7A 3H42B 2C9BA 3L40A 3N2GB 4EFLA 4BQOA 4HRVA 1LZLA 1MOZA 1N8SA 2Q41A 5ECYA 3ASUA 1OTYA 1CQJB 5CLLA 3DWGA 3SZGA 8LDHA 4XD7D 3F73A 1GSIA 4N7BA 3H04A 4KXQA 3VSCA 1OILA 3QE9Y 5DB4A 3GMDA 4GVLA 1LWNA 2PX5A 4P5PA 2CVZA 3ZEAA 5EGSA 2O5EA 1O87A 2EZTA 1CTQA 1K7XB 4GKKB 3JQ6A 5SYMA 2ZS7A 3TDKA 1E92A 3ROKA 4BV3A 2CF5A 1SCDA 1KEZA 3F7MA 4G86A 3RFXA 1UM9B 3HCOA 3ONVA 4WXPA 4CI0B 2HMWA 3C43A 1NVEA 4K9NA 3D3NA 3BG5A 4AUEA 2W2PA 2D3WA 1R1DA 3D8RA 4NBNA 5KCZA 4OVKA 4NXMB 1KY3A 3VQTA 2X13A 4GDFA 2WAYA 3L41A 2VH5R 2HRCA 2YY6A 4DSNA 4JP5A 2Z3ZA 4LXUA 5CT4A 2Q8NA 4MUAA 4L5CA 1ZJWA 2VLBA 1BZYA 2XDWA 1MABB 1X7ZA 3AXSA 5FNVF 3ADBA 3LTNC 5DHFA 2GARA 3WX0A 4A0HA 3GV0A 4V03A 3WFZA 4DMGA 3NEAA 4TSFD 1XD2A 1Q0SA 4N6GA 1WW8A 4YXFA 1UBNA 2DE0X 4LRWA 3AI3A 4UZSA 1MA3A 4BNKA 4HLNA 3RDPA 4TKZA 1VI5A 1W49A 2M32A 3DO5A 2G0AA 2R6DA 1AHHA 3M4XA 5TPWB 4CGZA 5K3DA 1CULC 2JIZD 1M1YE 2GH1A 3LUKA 1RE0A 1JMVA 3TUJC 4F7WA 4G2TA 3FSGD 4WGGA 4XEHA 1X0VA 2VL7A 2DFPA 1CP3A 1QFZA 1V3TA 1U7HA 3DE4X 2R00C 3AY3A 3M6XA 4MZXA 4MRAA 5IAJA 4D43A 1EUCB 1JECA 4MW9A 4UBIA 1E6WA 4CTJA 1JHMA 2HEGA 4ZI7F 3AHCA 4H7HA 5K6AC 4N41A 1YB6A 1UKEA 2X8JA 1JHXA 2FH5B 2VHWA 4JIMA 4YCMA 2HU8A 2EGUA 1Z2NX 4Y18A 1VKHA 4Y1RA 3SVTA 3ZTYA 3CF0A 4OJMX 2Y0DA 3UUEA 2HW8A 2QMEA 1Y8RB 3DM9B 3ELWA 5GOTA 4UOEA 1KH2A 3T3OA 2I3ZA 1NN0A 1P74A 3R44A 3QVOA 2E3JA 4WZBA 1JDBB 4F4CA 3P0JA 4FI3F 2WV7A 4ENTA 1F3OA 3A36A 4JP3A 3KKZA 1EFRD 1G5IA 4KFUA 2P90A 1QGUA 1ATZA 5B4UA 4KDEA 1EWKA 3K0SA 3F7OA 3HE3A 2Z43A 3FDZA 3EVCA 1W76A 1TM7E 3C7CB 1FFAA 1YR2A 2ZJAA 3SZ3A 4C3VA 4E94A 4OJNA 3QMPA 1UDAA 5IJXA 4PICA 1JE1A 1H4TA 3G5MA 3MSCA 1PZGA 3I9V6 5KDOA 3E5MA 1NC3A 4JJKA 4DDWA 4ZI7A 5JLJA 1BDIA 2FEXA 3KHKA 2V4UA 2B4KA 2C96A 5C7LO 4AWAA 4C06A 1E60A 2PUJA 2UZ1B 1E79A 2VHVA 4HQRA 5CPBA 1D0IA 2VJDA 4J0HA 4QYMA 4QT0A 3L7AA 4X84A 4L6AA 2OQRA 5LOVF 3VR2A 1RM3A 5GV8A 1D8AA 2WYOA 1G20A 4IOJA 4R0MA 2RHJA 4V3BA 4IO0A 2HBRA 1QHNA 4H7PA 5ILOA 5IARA 4E5UA 4XZ3A 3HB0A 2DPXA 1YBMA 2W2TA 1U8FO 4JUAA 1S01A 2ZRNA 4LZJA 1DWOA 2C8VA 1MEJA 4HWRA 2W2LD 3DVRX 1X7WA 2EJWA 4LJ8A 4E5NA 1CV2A 5MN6A 2DLCX 3DMDA 3HVHA 6Q21A 4RH1A 2FP4B 3LUJA 3FCUB 4MDYA 5A4KA 4ZZIA 4QXPA 4R3WA 2RIPA 2ZR7A 4N0EA 4TWIA 5KUTA 3HKEB 4IIJF 1U7DA 3JZDA 4R9SA 3NAZA 4TMTA 4KPFC 2ECFA 1OTHA 4UBMA 5DM4A 3KQYA 3FNGA 4CDGA 2WP8J 2NUPB 1Z2PX 3B89A 2JEOA 4CMIA 1QUEA 1HDIA 1UMCA 2GTHA 4IV5A 4NECA 1SUIA 3BTSA 2Z56A 4W6QA 2JA1A 1G2PA 1OA0A 1Z4QA 1NNLA 4P33A 4X20B 1Z33A 4DZRA 2Q4OA 3EPLA 3AF5A 1KKLA 2WC1A 3QKIA 1WUIS 4GKVA 5LOVA 3LT4A 2DWQA 2GASA 3OJOA 3RBVA 4ZI2A 5DM1A 3OJEA 3WQBA 2BDTA 1FSSA 3NEYA 1T8SA 1H4VB 2XE4A 4C5CA 3BVPA 3ICCA 4EYOA 1NRIA 3K1JA 2IQ5A 1M2WA 2F7SA 4HFNA 3W90A 2JD2A 2FUG1 1NAIA 5IMBA 3CLKA 4LSMA 5DTMA 1VE9A 4BO9A 5CYFA 3DT6A 1GZDA 1JG6A 5IAOA 2HUPA 4XB2A 2NAFA 1GPH1