1EHYA

X-ray structure of the epoxide hydrolase from agrobacterium radiobacter ad1
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
293
structure length
282
Chain Sequence
AIRRPEDFKHYEVQLPDVKIHYVREGAGPTLLLLHGWPGFWWEWSKVIGPLAEHYDVIVPDLRGFGDSEKPDLNDLSKYSLDKAADDQAALLDALGIEKAYVVGHDFAAIVLHKFIRKYSDRVIKAAIFDPIQPDFESWYSQFHQLDMAVEVVGSSREVCKKYFKHFFDHWSYRDELLTEEELEVHVDNCMKPDNIHGGFNYYRANIRPDAALWTDLDHTMSDLPVTMIWGLGDTCVPYAPLIEFVPKYYSNYTMETIEDCGHFLMVEKPEIAIDRIKTAFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The x-ray structure of epoxide hydrolase from Agrobacterium radiobacter AD1. An enzyme to detoxify harmful epoxides.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Hydrolase
molecule keywords PROTEIN (SOLUBLE EPOXIDE HYDROLASE)
total genus 108
structure length 282
sequence length 293
chains with identical sequence B, C, D
ec nomenclature ec 3.3.2.10: Soluble epoxide hydrolase.
pdb deposition date 1998-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ehyA00
5ALEA 1D07A 1J07A 3BF7A 3O0DA 2AXEA 4KEAA 4DMKA 5CURA 3C70A 3AJAA 3EBLA 3GBSA 4B7ZA 1HBJA 5JAUA 3HEAA 3E1GA 3M3DA 1PFQA 5AM0A 1J2EA 1QLWA 5CMLA 2IIVA 5YASA 2J4FA 4B6GA 1TCCA 3H2GA 3K6KA 2XDWA 3GZJA 4LXHA 5AKZA 3G0IA 3AUKA 1A8QA 4OYYA 4PF1A 1VXOA 2PVSA 2PSEA 2OCKA 4OD0A 5ALFA 5T4FA 5JAPA 4N8EA 4KE8A 3WKCA 3OC0A 4G5XA 1JKMA 2OCIA 3IVMA 5EIEA 3C8DA 3R3VA 3G02A 4QWWA 2D5LA 3DS8A 2VEOA 3JWEA 3NOXA 4J3JA 5FLKA 4L72A 5DTIA 4J0CA 1XROA 2AJ8A 2CUTA 4OB7A 1SCQA 2Y6VA 1VOTA 1YSCA 1ORVA 1U8EA 4G9GA 2OAEA 3WQHA 1YAJA 1HPLA 3W04A 1H2ZA 3OOSA 3VVMA 4KJXA 4RE5A 4MJ3A 3ANSA 4C4XA 2QJWA 4B0OA 3EIOA 4UFPA 4DNQA 4X90A 1DWOA 1ZI9A 2O7VA 1B41A 2HHAA 4GWLA 1KU0A 4CFSA 3PFCA 4J0HA 2V96A 3AIKA 5KWJA 1ZJ5A 2GBFA 2QOEA 3ICWA 4X7BA 2V9ZA 3VKFA 2XUFA 4BE4A 1USWA 5ALOA 1JMKC 4XIIA 1J1IA 1YR2A 2WQZA 3G9ZA 3RM3A 4M0EA 5E4YA 5CH8A 5ALYA 4XVCA 5DLPA 2WFZA 2GYUA 1C4XA 2OG1A 1XRQA 4IO0A 3BWXA 3I6YA 4ZV9A 3GUUA 1U65A 1BRTA 1CIJA 2ACEA 2PBLA 2XUIA 1IMJA 4X71A 1R9MA 3D2BA 3H1AA 2WUFA 4UUQA 2XQJA 3QPDA 2ZYIA 1G4HA 1QIHA 1GZ7A 2H7XA 5EIAA 1ACJA 3VJLA 1QZ3A 2QXTA 5EFZA 3SC2A 4KAJA 1BROA 2AJCA 3FWHA 3H17A 5AOBA 5FDFA 1E8NA 2X8BA 4S0XA 1CLEA 5CT6A 2V98A 4B80A 2QT9A 3L1JA 1YASA 5ALGA 1UKCA 1J06A 1THTA 3ZLUA 1F0NA 3O4JA 2VATA 1BN7A 4UHFA 5A7FA 3WKAA 4KR0A 3DQZA 3W9UA 4UFOA 5E4JA 4W9RA 4LXIA 4ARAA 5CH5A 4XJVA 5AK6A 2CJPA 3D7RA 1DT5A 3AINA 4P93A 5AICA 5K3CA 2O7RA 2V97A 4LIPD 2YASA 4UBOA 3H0CA 4H7IA 2RHWA 3WIBA 4U2DA 1VXRA 3D0KA 4JYMA 3QPAA 1A7UA 1XLUA 3O9MA 5CBKA 4B84A 4X6UA 2HA5A 2Y6UA 2ZSHA 3GROA 1QO7A 3TEJA 4KRYA 4H18A 3C45A 3TGLA 1R4ZA 4FNMA 1H2WA 2QKYA 5AKKA 5FOQA 2GZRA 3BJMA 1XRRA 5FRDA 1AKNA 4OU5A 2FJPA 1C7IA 4ZGBA 3G0DA 4NVRA 3LLCA 3S8YA 1YB7A 1SOMA 3LS2A 4BTVA 3IIIA 5AH0A 5D7BA 4AB1A 1DWQA 1BCRA 5ALXA 2WLSA 1A88A 4U2GA 1UK9A 2QVBA 3MGAA 5DTJA 2GYWA 4KAAA 4FBLA 2HA4A 2HU7A 2BJHA 1AQLA 5C7YA 3PDCA 1UK7A 3WWOA 2BFNA 3FNBA 3CN7A 1GT6A 4X95A 5ALJA 1DWPA 4DMHA 1G5FA 1ZD4A 1CUSA 3WA7A 5CXXA 3DKRA 2DFPA 3FLAA 1LPBB 3T52A 1WM1A 3WYNA 5ALNA 4MEBA 4B82A 4AO7A 1TAHA 3HSSA 1MPXA 5LZ8A 4EY6A 2WHQA 4QLOA 5FPPA 5LZ5A 1P0PA 5EHZA 2AJDA 3PF8A 5IVHA 3RLIA 2BUCA 3VDXA 1K63A 2WG1A 5AI4A 4YK7A 2EEPA 5FPQA 1GXSA 4G4IA 4P08A 5AKEA 1SCKA 3V1KA 3Q8WA 1MX1A 3C6BA 4G1FA 5I8PA 1RYYA 4KE9A 3WYDA 3FCXA 4FHZA 3A2NA 1P0MA 1CUGA 4MEAA 1JU4A 4BAGA 5IVIA 3O4GA 1R3DA 3V48A 1GPKA 3BIXA 3H2JA 1ZD5A 3WLAA 1VZ3A 1HDEA 5LIPA 5A7GA 3GELA 3SWWA 1ODCA 4BCCA 2AJBA 1ZGCA 1CV2A 6YASA 3WL7A 3B3QA 4P92A 2R11A 4HRYA 5LZ9A 1EDBA 1QE3A 4JNCA 4CG1A 1UKBA 5HF6A 5AKHA 2Y1KA 3I2IA 1DT3A 4HAIA 5SYNA 3C43A 1QIDA 3BF8A 4WFIA 1OILA 5EHQA 1CQZA 1XRLA 4DLNA 4GI1A 3WK6A 1W52X 5ALRA 2ES4A 1NU8A 3R40A 2I3ZA 3BIWA 4WDRA 4X91A 5D6OA 4C4YA 2QJRA 2QUBA 4W1QA 2OGZA 4QDXA 3G9XA 3MUNA 2DSNA 5FKJA 2PSJA 3UUFA 3PE6A 2PM8A 1AZWA 2GZSA 4K6KA 1X70A 3W2TA 1JI3A 2AJLI 1XZGA 5AP9A 1XZHA 1NX9A 3H2KA 2CZQA 2RHTA 2I3DA 2RIPA 1XRNA 5ALDA 5HFAA 3N0TA 1IUPA 4Y2UA 1HKHA 1KU6A 4CIBA 2OQIA 3GA7A 1XQXA 4FOLA 1CUVA 5JZ9A 3STWA 5C8XA 2O2HA 3QMMA 3EQ9A 2HU8A 3U1TA 1UFOA 4U2EA 2QS9A 2JGEA 3DEAA 4Y2JA 3G9TA 4AMYA 4HXEB 1UOQA 4DIUA 2ECFA 4MQMA 3G8YA 3PFBA 1Y7HA 3ZLTA 4AN0A 3KD2A 2ONCA 4Y2TA 3AIOA 4HXFB 5ALIA 4CCYA 3VISA 4GHWA 3B12A 1CUEA 2VTVA 4I4CA 3RK4A 5AOAA 5JAHA 4AZ3A 4Y9SA 1TRHA 4H7EA 1QOZA 3D2AA 3NUZA 2ZJFA 1UT6A 2XUJA 4X6YA 4DTCA 4JYPA 4BBZA 4FMPA 4PNZA 4WDQA 1FSSA 4Y2XA 5I7UA 4Y2YA 4ZRDA 1YS1X 5HZGA 3IULA 3LIIA 3I28A 1CQWA 3DDUA 2C58A 2XQFA 1DX4A 1QONA 5BOVA 1Z68A 3EF3A 1X2EA 1XZEA 3S2ZA 5JARA 4UBKA 3Q0TA 5CRIA 2G5PA 2WILA 2ZYSA 2XT0A 4Y7DA 3SX4A 3YASA 1CUIA 3FYUA 4Q1VA 4HZGA 2HA3A 2WJ6A 2JGFA 3ANTA 2QM0A 1LBSA 5K3BA 2HA6A 1L7AA 1WPRA 5AI5A 1WB6A 3WWCA 3DL4A 4E46A 1ACLA 2BAGA 2WUEA 3BE8A 1THGA 2R8BA 2BUBA 5DNWA 3WWEA 3QBJA 4FLFA 4H77A 3F97A 1W1IA 5HKBA 4QE3A 3A70A 5JD5A 3ZV7A 2JGJA 5IVDA 2PU7A 3R3WA 2WUDA 5K3FB 3G7NA 3MVEA 1QFSA 3FAKA 2J3DA 1ETHA 2X5XA 3T4UA 1UK8A 3P2MA 2YH2A 3DNMA 3I1YA 2DQZA 3H18A 5HF9A 3OG9A 1C7JA 4PV7A 2IX9A 3L1HA 4EZIA 2PUJA 1CUHA 3X3HA 5AM5A 5LZ7A 2VSQA 2ZVDA 3C6ZA 1AMNA 4BTLA 4X93A 2PKYX 3IBTA 1E3QA 3DKKA 1ODTC 1MNQA 4QDOA 2W22A 4EHBA 5ALPA 4F5ZA 5FP0A 3BL8A 4C6HA 5DNVA 2XQIA 3WA6A 2Y2VA 2QXUA 1XFDA 1TKRA 2Z8XA 3HRHA 1TCAA 3E4DA 5AK4A 5ALZA 4J0IA 3TRDA 5ALUA 3KOOA 3LIPA 3G0CA 3OTQA 4UHDA 4ZV7A 1AURA 2FX5A 4E15A 3AZQA 1IUOA 1GPLA 4L0CA 3ZPXA 3WL6A 1P0IA 1MO2A 4OB6A 4WY5A 3AZPA 2WUGA 5AOCA 2XMRA 2CB9A 2XMGA 3DOIA 5ALVA 1EDEA 1Q83A 4B9AA 2Z5GA 1FFDA 1R88A 4JUIA 1CUJA 3AFIA 1ZIYA 1ZICA 4BATA 5AM4A 5K3EA 3K9BA 1MT3A 3ESCA 4UHCA 2J4CA 7YASA 1FJ2A 4HTAA 2HADA 2WIDA 5DNUA 4KE7A 4FKBA 5HQ3A 2HA2A 3O95A 4CCWA 3H19A 4EY5A 1YA4A 1TCBA 3F9CA 1QIJA 3CCBA 3WWPA 4BVLA 4BP9A 2RONA 1ISPA 4Q05A 2Z3ZA 4H7JA 4K6HA 4RNCA 2JGIA 4J7AA 5LZ4A 3WKBA 1A8SA 1XQWA 3FVTA 2QMQA 3FSGA 5C81A 2PPLA 4BB0A 2WIGA 4W63A 2XMZA 1H22A 3WK5A 2ROQA 4X00A 3C5WP 2H7YA 4XWGA 2G4LA 3HZOA 3IUJA 2LIPA 3FCYA 1A8UA 4OYLA 1CUUA 4NS4A 3WK7A 4U2BA 5JASA 2W6CX 4H7KA 4J0GA 4A23A 5LKRA 5AI6A 4Q3LA 2JGLA 2QTBA 1H2XA 4GW3A 5KWIA 5CH3A 3R3ZA 1OXMA 5AI0A 4B85A 4K6GA 4ZWNA 3UMJA 1F0PA 3H2HA 3G0BA 2GYVA 4BC1A 4ITVA 1WB4A 4YPVA 3O4HA 5JYCA 5AK5A 1CUXA 4IHAA 3C6YA 4BAZA 1N1MA 4AO8A 2OLEA 1JU3A 4UPDA 1EK1A 2K2QB 2BGRA 2HFJA 4U2CA 4QDUA 1QTIA 4MXDA 3N2ZB 1WOMA 1U2EA 5BWCA 2I78A 4AX4A 4L3WA 3V1NA 4O08A 3ZWQA 3G0GA 3PI6A 2IITA 2VJDA 1G42A 3BDIA 3HLKA 5HFNA 1TIBA 4INZA 4DYHA 2NW6A 1ZD3A 4OPMA 4DNOA 1XQVA 1CVLA 1F6WA 2Q0XA 4WFKA 1VKHA 2ZSIA 1MNAA 5JZSA 2VF2A 1DINA 3C5VA 4IH1A 4G8BA 1IVYA 4LYEA 3BDVA 5AKYA 4PSDA 4UBJA 4GLBA 1FFBA 2PSFA 4EB0A 4AZ0A 4G4GA 5AM3A 5HQ3B 1AUOA 5A2GA 1L7QA 4DGQA 3D2CA 1AGYA 5A71A 5EI5A 5J3JA 1EB8A 1P0QA 2XUPA 4Y2PA 4UBIA 3PICA 4KYVA 2XMQA 4OCZA 4Q3OA 1QIGA 2CKMA 1R50A 5ESRA 2HL6A 3OM8A 3WZLA 3H2IA 3HXKA 4U2FA 1IUNA 4C01A 3FLEA 5AKIA 4X92A 4HRXA 2XMSA 3TJMA 1WCYA 5AM1A 3FYTA 3ESAA 4UFNA 3WJ2A 2RI6A 2HDWA 1VJ5A 1QIKA 2WIJA 2Z8ZA 5C8VA 4AO6A 4FTWA 3E3AA 1S8OA 2XE4A 4EY8A 1H23A 2ORYA 4DSAA 1UXOA 2WJ3A 3V1LA 4E14A 3I1IA 1MX9A 5HF5A 4N5IX 4QA9A 3WK8A 3AILA 1RWQA 4EBBA 4BRSA 2XLCA 2EDAA 3WIOA 2CBGA 1T4MA 3ZLVA 4C87A 3PUHA 5JADA 5AHXA 1YA8A 4BCBA 1PV1A 1BU8A 1CPYA 2VJCA 4ZI5A 1LZKA 1E8MA 4Z49A 2XUHA 3ESDA 1LPOA 3VJMA 2HFKA 4H7FA 4BC0A 1QTRA 1W76A 5CT8A 4EY4A 3I6ZA 1CUFA 1MU0A 1LNSA 5T4EA 1SC9A 5JAOA 4Y2SA 5HK8A 3AIMA 3QPCA 4RGYA 5E4TA 1QO9A 4OB8A 1YAHA 4N8DA 1E8DA 4DM7A 4EY7A 1MJ5A 2P8SA 1QFMA 1MX5A 1ORWA 1Q0RA 2QR5A 2BGNA 2QUAA 3A2MA 4LKOA 4ZXFA 4M0MA 4ARBA 2XQGA 2JGMA 1JJBA 1FFEA 4MYDA 4M0FA 2XUDA 2C7BA 2WG0A 3WKDA 3RKSA 2WIKA 3F98A 4UHBA 1HL7A 3QITA 3WL8A 4HXGA 1BE0A 3L1IA 1XRMA 3PF9A 4N5HX 2J3QA 1XZFA 5BWBA 1XKTA 2B9VA 3MUOA 1GKLA 4G8CA 4GBGA 5C8ZA 1WB5A 5DJ5A 4EUSA 3HC7A 1RP1A 1EINA 2XUKA 1DQZA 1R9NA 1EI9A 3WKEA 5ALKA 4FNGA 4BRZA 4PQEA 3WL5A 4GDMA 2ZJ6A 4E11A 3STYA 1AX9A 4DNPA 3RARA 3M81A 2XMBA 4GEGA 4BVKA 5KBYA 3KWFA 2XUGA 3ESBA 1UOOA 1E66A 4LXGA 5I9IA 4JH0A 5AKLA 1XZKA 3H04A 1N5MA 2OXEA 4DSZA 4H7HA 3W06A 3LP5A 1CFJA 1BS9A 4CG3A 4OSEA 1EB9A 1GKKA 5AK3A 1LPNA 1BN6A 2WM2A 3ILSA 4Y2VA 1HQDA 2XUAA 1EVEA 5JANA 4FLMA 4ETWA 5DYTA 3NWOA 2PSHA 1T2NA 4UHEA 3STXA 2GBIA 2DHEA 3R3XA 3PUIA 1CUZA 3DYIA 4AQDA 3FSGD 2JEYA 4LYDA 3VXKA 4PSUA 4F60A 3KWJA 2WJ4A 2OPHA 4X3CA 3WWDA 1ZGBA 2DCMA 1O6FA 3FOBA 1CUBA 5CW2A 3VJKA 3DOHA 2WHPA 1U4NA 5K5EA 1DU4A 1XLVA 3WMRA 3HI4A 5LZ2A 2XUOA 3M82A 5K3FA 4BDTA 4BYMA 2WTNA 2B4KA 5D3ZA 1FFCA 4BDSA 4FLEA 5ALMA 1XZCA 1XZMA 2C5FA 1LPPA 4TVKA 2UZ0A 1LPMA 4X94A 4AN1A 4X6XA 4NZZA 1ZD2P 5CT9A 3SK0A 2RAUA 5ALQA 4K2AA 2VT6A 2WKWA 2XMCA 2WHPB 4PW0A 2JBWA 5CXUA 4RE6A 5E2IA 1QIIA 3H1BA 1G66A 4B83A 3WK4A 2HRQA 1X2BA 5CT5A 5AKXA 4F21A 3QYJA 2BKLA 2ZJ7A 1UOPA 3W05A 2XI4A 1XZBA 1VLQA 3BXPA 3ICVA 3F96A 3HABA 4QNNA 2C0QA 1MN6A 2FJ0A 1LGYA 3UUEA 2VAXA 2VJAA 4FDMA 2DHCA 1UWCA 4AXBA 1Y7IA 1EVQA 2ACKA 3GFFA 4BCDA 3EQ8A 5A6VA 2FUKA 1XKLA 1H2YA 1XRPA 3I2HA 1N5RA 5AI8A 2C5GA 3D59A 3WK9A 4BE9A 1K8QA 4XX1A 3FYUC 3O4IA 5LYYA 1K6EA 3IUQA 4I3FA 5FXMA 2B61A 4IH9A 1VZ2A 3R3YA 1ZOIA 4CIAA 1E5TA 5K3AA 2D0DA 1YB6A 1CUDA 5CTAA 4CCYB 2PSDA 5AO9A 1CEXA 1VE6A 5T4BA 1ZI8A 2WU3A 4V2IA 4BVJA 2WIFA 1LLFA 4MQLA 3ZI7A 5AKGA 1IZ7A 2WFMA 4Q3KA 1JT2A 3I2GA 1BEEA 4QEKA 2G63A 1PJAA 1TK3A 4W1SA 4CI9A 2BCEA 3G9UA 3STVA 4JEIA 1VE7A 5AI9A 1CRLA 4MYSA 3DL7A 3DLTA 1JMYA 5EHXA 4H0CA 2G5TA 5F4ZA 2B20A 5LP1A 4B81A 2GBGA 1Y37A 2PUHA 4UBMA 3I2KA 3W9BA 5ISMA 4QZVA 1KEZA 1I6WA 3FVRA 4BZWA 2I03A 1B6GA 4OUKX 2PU5A 5HK9A 1WPXA 1BCSA 1XLWA 4H35A 4Y2QA 1WHSA 1ZI6A 4I19A 2JGKA 3R41A 4A16A 1XZDA 3BJRA 2HIHA 2JIDA 3JW8A 1ODSA 5AM2A 3IUNA 4ZREA 3QVMA 5ALLA 5SYMA 5KREA 4FFVA 2X76A 4WFJA 1K4YA 5JD6A 4GECA 3C87A 3I2FA 2VAVA 3QMVA 1LZLA 1W75A 3WJ1A 1DX6A 2WFLB 3D3NA 2RGUA 3I6MA 4TPKA 3V1MA 3CCCA 2H9YA 4H7DA 4WJLA 3HJUA 2HA7A 2OCGA 2O2IA 2E3JA 5IH7A 1N8SA 2WFLA 4HS9A 4MWTA 1M33A 5ALSA 4WCVA 4FFWA 1YS2X 2VT7A 1GQRA 1NU6A 1CUAA 3FLBA 4KAFA 4G4JA 2CEKA 1Q0ZA 4PO3X 3JYHA 3WI7A 3F8SA 4KE6A 3ED1A 4G8DA 5ALWA 4X85A 1JJIA 4N8SA 3IB3A 1UZAA 1OCEA 3FBWA 3IA2A 1EA5A 3EQ7A 4D9JA 2C4HA 1GPNA 3FYUB 5DWDA 4MWSA 1EHYA 5LLSA 5JATA 5JZBA 1EH5A 1XZAA 4B0PA 2ZYRA 4DNFA 1TQHA 1LPSA 4P9NA 3O9VA 2XLBA 5DYWA 1UK6A 3QM1A 4C88A 5D3KA 2H7CA 2Z3WA 3K2IA 1LPAB 3STUA 1QIEA 2WG2A 4A5SA 3LCRA 1XZJA 3KSRA 4G9EA 2OGTA 4C89A 4FBMA 4KRXA 4GXNA 4J0JA 3KXPA 5DYYA 4DMFA 3D4LA 5AKJA 2VA9A 2VQ6A 1F8UA 1SFRA 2HU5A 1IZ8A 5IKXA 1XZLA 1GQSA 1W4LA 4HVTA 1XQYA 3IUMA 1EDDA 4ROTA 4LHEA 3I2JA 3R0VA 2XQKA 1QGED 4W1PA 4IQ4A 2PL5A 1Q84A 3DCNA 2XUQA 1K5PA 4B9EA 2PX6A 4UHHA 3OURA 3QZUA 5JIBA 5BV7A 3F67A 1QJ4A 4TGLA 5HCUA 4UBNA 4QLAA 5AJHA 4Q34A 5CT4A 1R1DA 2JEZA 1CR6A 5K3DA 3IDAA 5EGNA 1MTZA 1JJFA 2YYSA 4PSCA 1WHTA 1E89A 4Q82A 3CN9A 1GGVA 3DYVA 1UKAA 4C4ZA 3DD5A 3KDAA 4W1RA 4YASA 1EX9A 5A62A 4BP8A 2H1IA 1L7RA 2DHDA 2HM7A 2OQVA 1XZIA 2QRUA 4F0JA 3HYSA 1W6RA 4BZZA 1CUCA 1CUWA 1FFAA 3HACA 5EHNA 4K5QA 2OCLA 2O2GA 4CG2A 1LBTA 5JALA 3B5EA 2HA0A 5T4HA 2WU4A 2HRRA 1CUYA 3DJYA 5HF8A 4BAUA 4AMZA 5FV4A 2WHRA 5ALHA 2DQYA 1YCDA 1DQYA 2OAGA 1QIMA 1VA5A 3E0XA 2QZPA 2CMFA 5ALTA 4KACA 5FUMA 5AIAA 2DR0A 1JFRA 4RPCA 1DTEA 4X97A 4J0DA 1HLGA 4OU4A 4QDZA 4FWBA 1MAAA 5HKAA 4UBLA 2C0PA 4IH4A 3V9AA 5AIBA 5LKAA 3U0VA 5JD4A 4L9AA 1EK2A 2Y2UA 2WTMA 5IVKA 3C6XA 1ZIXA 2EDCA 2YXPX 1VA4A 4YX9A 2BUAA 2GBCA 4DMCA 5H3HA 2WSLA 3QH4A 4EA6A 1ZJ4A 1MAHA 1QIFA 3M83A 1AC5A 4QWMA 2XMDA 3A6ZA 3QMWA 1EXWA 2ZYHA 3IURA 3AZOA 4J0KA 3NGMA 3R3UA 3WZMA 2OGSA 4QDTA 4J03A 5EIHA 3STTA 2XB6A 1SCIA 5A7HA 3D5EA 3VVLA 3OPMA 3C8HA 3A2LA 2JF0A 4Y2RA 1O6GA 1BEZA 4WY8A 2VJBA 3CXUA 4NMWA
chains in the Genus database with same CATH superfamily
1ZN2A 2BFFB 5ALEA 3KTOA 4UOZA 4KDEA 4IM7A 1J07A 3EGXB 2CFOA 1U3VA 3UH0A 3LUKA 2AXEA 2G0NA 2V7GA 4FT2A 3AVPA 4DMKA 4EABA 4UE2A 5BMVA 4KPUB 2E4WA 3K96A 4HPXB 4E5SA 4ZHQB 1ZUIA 3AUXA 2IYRA 1RPZA 4PLCA 4Y6SA 5I4CA 5HEKA 1PNOA 1PFQA 4M83A 1J2EA 1YI8A 2M1XA 3DW3X 4J8PA 4TLMB 5CMLA 5G0VA 2LRHA 4WKNA 1AUVA 5B64A 4E2FA 1RLOA 2NZ8A 3A4NA 4BMCA 3V34A 1X7XA 1R0YA 1KI4A 2DSTA 2IIVA 4RD0A 2IXEA 3IMKA 4REQA 1XX6A 2J4FA 5LLTA 1TCCA 3H2GA 5BR8B 2XDWA 4R0VA 1D09A 1VKRA 3I23A 4KLCA 4Y98A 4S1PA 4YRGA 5J43A 4UUNA 2D7CA 1UPUA 1Z2EA 2VDKB 4R69A 1FRFS 1UDXA 4H1HA 2KM1A 4OYYA 5DU2A 3X1MA 1NW5A 4HNSA 3N3AC 4JI4B 1L5NA 2OCKA 3K0CC 3IDSA 1LBIA 3COVA 3CSSA 4OL9A 3WYBA 2IL1A 4KH0A 4WLUA 4J2TA 1D2HA 1QC5A 3O8CA 3VPDA 3B3FA 1PLLA 4HH1A 3HDYA 4XVUA 1IOLA 5KOJA 2JZNA 1QZUA 4DLZA 5HKOA 1CW2B 4YJ2B 1NVTA 4YJGA 2DBRA 3WQSB 3FSEA 3P0RA 1ZR2A 2NZVG 3CJQA 2FW1A 3OOHA 2VYVD 1JKMA 3TR0A 2FFJA 2H0QA 2OCIA 3IVMA 1T5SA 2OSVA 3HM2A 4ZVKA 3DS8A 4WA7A 4ZZ1A 3JWEA 1P6QA 2FSGA 3I9KA 2WMYA 4CYMA 5FLKA 3CX8A 4L72A 1RWMA 3LTEA 4QU5A 2HGSA 2NQ8A 5EPUA 1L5KA 3LRPA 3TF5A 1AQ6A 1OH7A 1VG0B 4JFRA 4PSVA 3KLBA 2Z1MA 3ZNQA 5ICCA 2G5CA 3I3OA 2QORA 1VRVA 4OQNA 1UZMA 1IONA 1SOUA 2Y6VA 4WOCA 4QNMA 5KMGB 5LXTB 2CJWA 4NU6A 3OWHA 1BMFD 2OAEA 3TRHA 3WQHA 4URXR 3A9VA 2Z58A 3C4QA 1Z0IA 1J00A 1V37A 3AW8A 4HAXA 1GIAA 3TPCA 3LVRE 1ZM3A 3W04A 3DEYX 2QTTA 3I12A 1L7NA 1KETA 1NT2A 4Q93A 5ILOA 1OZHA 2QTRA 3OOSA 2CLLB 3BSWA 2FKAA 3FKSA 4DRZA 2DFKB 3PTZA 4KJXA 3PKJA 4MJ3A 1M1YE 4PRZA 1NW8A 4RE5A 4BVFA 1FMTA 4IFTA 4B0OA 1C14A 1KP9A 1E3TA 1R66A 4U7HA 5DCYA 4RJTA 3R23A 3SDZA 2GXAA 4MO9A 2PRJA 4NRDA 3AR5A 1T2EA 1A5SB 4MWEA 4RULA 4X24A 1JLMA 3KR9A 4NDAA 4DWJA 4ZOQI 4BNDB 5AUPB 3KVOA 3OIFA 2FMTA 1KXZA 4XLTA 1QCDA 1DWOA 1NMXA 2UXDB 2RJNA 3L8HA 2B6HA 5AXAA 2J9GA 5CVUA 4YS6A 3M33A 5EMMA 5BUQA 3DDOA 3FKSD 3RTAA 2IHZA 2V96A 1KZ4A 1EEXB 1P5RA 4IRXA 4L0MA 1FRNA 5KWJA 1ZJ5A 1DHTA 2FHSA 3VU9B 4ILKA 2P5YA 3I5MA 5KJFA 5BVGB 1NW4A 5EYPB 1BVYF 4KHZA 3VKFA 2FB9A 5B1HA 2WQ6A 1SU4A 4L9RA 3ZNOA 2XXAB 3OFNA 2QA5A 2X5OA 1JMKC 1M9NA 2NTVA 2WJPA 3FDZB 3WR5A 5B3LA 1S4MA 4X45A 2WQZA 2TYSB 3FDIA 2IE8A 2YR0A 2QT0A 3GEIA 4M0EA 1NSFA 4XX0B 5E4YA 3JRNA 2V7QA 1Z4PX 3UWKA 2HEIA 2XKBA 3AYXB 3HYRA 5ITSA 4BJ6A 5K8UA 2Q8NA 1MHTA 1NXQA 2J48A 3DV2A 3DE4X 1JKFA 2CEAA 3BHNA 4CM9A 4CT5A 1EAMA 2VJMA 4XUGB 5ECGC 4Z9AA 2D5BA 1K7FB 2M32A 1NQAO 3N53A 1TEZA 1Z07A 4IDQA 1ZK0A 4RD2A 3BWXA 5EXDA 1GN8A 5D5PA 1XCGB 1KMMA 1R6TA 4RJJA 1KI8A 4HWOA 4MTCA 4PCUA 5HQJA 4ALKA 1KQGA 1BGXT 2X9QA 4YQZA 3UOWA 4CFYA 1P4SA 3CH6A 3GUUA 4FOPA 1AXGA 2ACEA 2XUIA 1EBFA 2ICAA 5T5QA 5CFMA 1ZZEA 2JGDA 3CEPB 3C1OA 8OHMA 3H1AA 4RD3A 3U4QB 4RF2A 4YJHA 3MF4A 4EF4A 4JOCA 5DBOA 5IJXA 1L5QA 2UZAA 1HKUA 3NTXA 4UUQA 3CF6R 3GPIA 2ZYIA 1PWHA 2D62A 3GPCA 4IUBS 2VDWA 5K0LA 4TTJA 2R8OA 3RRNA 1IAQA 4YJ2A 1JXMA 2PUWA 3WWZA 4CMGA 5LLDA 5JJKA 2ZB4A 3FOFC 5A4AA 4V3CA 1W5BA 4HBGA 4JQSA 3SFZA 5KJCA 2DGDA 5AOBA 5FDFA 1C80A 3LTNC 2IZ7A 1C0KA 4BXOB 4MULA 1HY3A 1TQDA 2O7QA 2PUDA 1U1EA 3EISA 2EW8A 3FPGA 1K88A 1WQ1R 2NTEA 2QT9A 4OYHA 2W0MA 3KXDA 1UKCA 2WOJA 4KXQA 1PVVA 4QO7A 3NUQA 4EO7A 3GO4A 1F0NA 1EXDA 1O08A 3IOEA 1ST2A 2Z2IA 3O4JA 1KRHA 4UHFA 1T9HA 1X1RA 3R0ZA 4RD6A 3LY9A 1L3BA 5EE0A 1L5LA 5A7FA 2BSXA 2ZW9A 3T3OA 4TWRA 3TW4A 4WLVA 4Q4CA 1K3TA 4QYIA 1DC8A 5H4HA 3SHFA 1SHTX 3LLUA 5A1JA 3IV7A 1L7PA 3W3AA 4MPDA 1NTRA 5AJYA 4YMLA 1NI5A 4BFUA 2GZDA 4RJ2A 2YY7A 1UMDB 2ZR9A 4LYHA 1XJWA 1KP2A 4MV3A 1CF4A 4W9RA 1EVZA 2QTVA 3DFZA 5JWRA 5JSKA 2OFPA 1JIVA 2BC9A 4R6WA 2RAVA 2XRMA 3D7RA 2R6GA 2I6FA 1U4OA 5CHYA 1D6MA 3GYGA 3HUEA 4P93A 4TV9F 1J8DA 5E0KB 2O7RA 3U7RA 3VR5D 1ONSA 1ZXXA 3NTOA 3SSMA 2ZSAA 2YASA 5AHKA 4MV6A 3AUTA 3WQBA 1V5IA 3IUEA 1C4KA 3H0CA 4FP9A 4H7IA 3WIBA 2H9AA 4FFDA 5IH3A 3S40A 3QPAA 3QUAA 4YQYA 1IJBA 1A5BB 4K9NA 4U5XA 1KTIA 4YMHA 3O9MA 4RUKA 3MTJA 4JEMA 5AT1A 2YWHA 2DX7A 3PTLA 3GLIE 1JTFA 3RK1A 4EPVA 5C4GB 3GQVA 3A3YA 2HA5A 3UWPA 4JBNA 2Y6UA 4Z9BA 4CTKA 2FN9A 1PFWA 4R1TA 1KK2A 1KE1A 4US2R 1Z5ZA 5A4DA 5CLJA 3JD0A 2B0JA 3AP3A 3L40A 4YBZA 1F3LA 5A5DA 2NVOA 2WJGA 4KWCA 1ES9A 3VDQA 4D9FA 2HNAA 2Q1XA 1K6XA 3CV3A 1URPA 3MBOA 1KZHA 2R5WA 4H18A 4P8RA 5G1NA 4MUBA 1IJEA 2OCXA 1XDBA 4GVXA 4FWIB 4M7WA 1UANA 3V8RA 4AFNA 3WTCA 1VRCA 1MOQA 3WS7A 4XVQA 3KLMX 4RVHA 1BVUA 3GMIA 5FRDA 3L4JA 1L5VA 2AK3A 3LDAA 4PLHA 1LTQA 2NAFA 1CS4C 2WD7B 3U3DA 1NI4B 1JI0A 1ZCAA 2XH8A 1S2OA 1WRBA 5CFOA 2ZUTA 1XCMA 3G0DA 4XSGA 3J80A 3NVKI 2QLBA 4NVRA 1UM9A 1VIAA 4WXMA 1YR1A 2PK3A 5E9QA 2YWJA 5FUQA 1G2IA 1I0IA 1K7YA 1N8NA 4N9QA 1SR8A 2J1LA 3R9IA 5JSHA 3S8YA 2C78A 3UC9A 3QX3A 3GRUA 1OHHA 3DR5A 3H6GA 4KWHA 5D7BA 3GGDA 3DMPA 2EZ8A 1N3YA 4M0UA 4J07A 2VDUE 3GPBA 2XTAA 4FDAA 4Y3UA 1HE1C 2GETA 3CZAA 2WLSA 3DT8A 3GDHA 3MOSA 5ALXA 3SBOA 4BKUA 2K7FA 3ML1A 2H5IA 3TRJA 4Z4FA 2XV1A 3PQ4A 4I2VA 1CCWA 1NNSA 1C2YA 3UZUA 1DTSA 4IJ5A 4D8UA 1PT9A 4S1VA 5ENVA 2R2AA 5I9MA 4ZT3A 2I71A 3ANLA 3E7DA 2BJHA 1HMPA 1RJ9A 3DAPA 2ZBRA 4IR7A 2R1ZA 3H9GA 4AM8A 1U28A 3N2KA 1QWOA 3PYLA 3M6MD 4ZVTA 5GPBA 1UK7A 5A5VA 3WWOA 1HZZA 2IBMA 4R2MA 4BEWA 1ZUNA 1QYXA 2ZJOA 2I54A 2UVDA 3Q6IA 2A78A 1BKDR 1U9IA 4OH7A 3CN7A 3ZS9A 4KFUA 4B6JA 1Z5VA 1JWAB 3EXFA 5K99A 2F3UA 3A14A 4I3HA 3QLUA 1TGYA 4DMHA 1G5FA 1T3HA 1VL8A 2PRZA 4B31A 4BJHB 1CUSA 5CB0A 1QHHA 3GXBA 3I9NA 5F1PA 5L7TA 2DFPA 4UTOA 3DMNA 2AXQA 1EKXA 1Y5IA 3T52A 1YZYA 2CLCX 2CVOA 4V38A 3SXUB 1OFIA 3KJIA 3OCVA 4OKIA 3WYNA 3UTCA 4A9AA 4REOA 4CEJB 2Q3DA 3ZK8A 4QQ8A 1TAHA 1JEQA 3C14C 4P5DA 4TV9B 1BOFA 5AW2A 5BO5A 3AFMA 5HMLA 4MI6A 4WH0A 3IMGA 1HLFA 4C30A 3RLIA 2H06A 5JSFA 1K63A 2WG1A 2G07A 1QKJA 3H9BA 5F9FA 4YK7A 3LUHA 4PG5A 5FPQA 1GXSA 5KHLB 3AB3A 2GCIA 3JALA 4KXVA 2CE2X 3FHLA 4P08A 1Q0PA 4MRAA 3N76A 1Q3TA 4WA8A 5F1YA 5AKEA 5F2NA 3AEQA 1BMFA 1U9IC 2Y1GA 3BTOA 4KTVE 5EJ2A 4TYNA 2JRCA 3BJIC 1MX1A 3SCZA 1DGQA 2PWAA 3IE0A 4D9MA 1VM6A 2PZFA 4RQBA 2VJNA 3FCXA 3O21A 3DTVB 2GCNA 3WYDA 1FIUA 2PKQP 4D4KA 5DGHA 2HLDD 2PD4A 2PFKA 2QG4A 5JNLA 5EZYA 1CUGA 2ISQA 3JAWB 1OB5A 3AESB 3RF6A 1E2QA 3PG5A 1JU4A 3COWA 2C8JA 1O6BA 4J6EA 2AMVA 1AGXA 1R12A 2GZMA 4HXYA 3AV0B 4ZAWA 3O4GA 1NV8A 1CWUA 2C5AA 1R3DA 5IVIA 4DM3A 5IXSA 1NDHA 5JMWA 4OGLA 3OZAA 3QLJA 3CNEA 3UTDA 2PAAA 1N36B 2BE7A 1T13A 1U3WA 3EEIA 4R2JA 5KYVA 3VPCA 2J59A 1WPGA 3T1YB 4Z7NB 4LV6A 3B6JA 4IMJB 3NHJA 4YY3B 1NBME 2QX4A 2GPTA 1RJGA 1NUHA 1R00A 1E3SA 3MCVA 4M1KA 4XQGA 4BCCA 2O59A 1ZGCA 2WINI 3N7AA 3NPMA 1C8KA 2AOXA 2OD9A 4BEVA 4HWRA 3EWNA 1SK9A 2VHYA 4RTLA 3OUUA 3UXEA 3HZZA 2Y1LA 5KHAA 2VQFB 4HVAA 2PZMA 3UHOA 5BV1A 1EDBA 2BMJA 3DB1A 4Z0NA 4GMFA 5T67A 3WO0A 2XTMA 2BYTA 3B13B 1Z0KA 3AEKB 4IIJA 5F64A 5CM8B 2FR8C 3WSVA 2IUEA 4KQXA 3PNLA 5BN5A 4XCVA 3MB8A 5BYBA 3HCCA 2E2WA 3E9ZA 3I2IA 1Y6JA 4FMCF 4GYYA 3EPLA 2R60A 1LA2A 3HZHA 4Q3BA 3W5VA 3DLAA 2PHZA 4U6QA 1QIDA 4YJFA 4WFIA 3S44A 2B2CA 3FMIA 3TLKA 4F45A 2ADMA 4L5IA 4DDHA 3KFLA 2GUWA 2C9MA 2BFEB 5HGJA 3HXMA 3OP1A 3MWGA 4EF6A 2FWJA 1CQZA 1QG0A 2QRHA 1WF6A 4R3WA 1XRLA 1UPXA 1XQ6A 2RGXA 4DLNA 1RQLA 4FW8A 1L1QA 3E70C 6AT1A 2CYCA 4DREA 3D7LA 1M8FA 1QVWA 4P80A 3WBBA 3V8BA 1B93A 1W52X 2C1ZA 5HJ2A 4YP6A 1Z17A 2R6DA 1Z7WA 4AJIA 1TO2E 4DWOA 4ZI7A 5BMOA 1P2VA 1VB5A 2ES4A 2FVYA 4D80A 1ZCZA 5DW0A 2YXDA 4C0LA 1BC5A 1ESCA 2EFCB 2GT1A 3NYIA 3OTGA 4GZ3A 3WLFA 2C5LA 1EE9A 1MOSA 1YQUA 2OGZA 2XNSA 4PIVA 4QDXA 4YCMA 3CRZA 4G8JA 4JN6B 4N7MA 1QUEA 1Q3KA 1Z06A 3KOZA 1PL6A 3LXMA 1QH1B 4PG7A 4Q3EA 2BP7B 3HBAA 3ACBA 1D04A 4YGXB 1E2UA 3QOFA 3RS8A 1AO0A 4L4YA 2D8AA 1NUTA 2RHDA 5DLQC 2C8VA 3PE6A 2O8CA 1W47A 4D9KA 3VC3A 3BHJA 5BR4A 1E5QA 1YB5A 2GZSA 4FHEA 4JBWA 2Y92A 4K6KA 1X70A 3OHMA 1MIOB 3QHPA 2YIVX 1TQ8A 4L8FA 4XUDA 4XPIA 2JA2A 4NBSA 3W2TA 3ZZTA 4N39A 4EG4A 3EE6A 5CB4F 4IV0A 2GO7A 4PO1A 1BYUA 5AP9A 2C4MA 1C1YA 3HI6A 1XZHA 2BHSA 1T91A 4DRYA 1Y4ZA 1VLMA 3QSGA 3NHFA 3DHYA 3WIDA 4TSFD 4CTMA 1XI2A 2WTXA 5HW0A 4KLNA 5J2UB 3ZIUA 4IDNA 5IAOA 4RZUA 3SQXA 3BZUA 4KKXB 5CIWA 5FPKA 2OV1A 3OSUA 3RG8A 1UXHA 2PLFA 1LU9A 5ALDA 3E81A 1DEKA 4RIIA 4ENWA 1UH5A 3CNQS 3RAFC 1UP4A 1T8SA 1O03A 1ETUA 3ZHCA 3O8OA 3SYLA 1VE3A 1Z5NA 2NO0A 3PX2A 1IUPA 1ZM7A 3MQFA 2YZ2A 4HQ6A 4IJVA 4Y2UA 2Z2ZA 1KU6A 3ABIA 4KX3A 3GA7A 1DFHA 3OKCA 2M98A 4GH5A 5B4UA 1UCFA 2DG2A 1CFZA 5FV7A 1RLTA 2O06A 2JLXA 1GL9B 4QBTA 5EE3A 6PFKA 2RG1A 5IC5A 2JLQA 1GTZA 3L7YA 1TGVA 3ZW7A 3N0XA 3HXPA 1EBUA 1NUAA 2D6FA 2VYCA 4UM9D 4KO2S 5D8DA 1RD4A 3U1TA 4EX7A 2WSYB 1WJGA 3OJWA 4BNDA 3BWMA 2A3RA 4MVJI 4Y1RA 2VHTA 2WE8A 4JJ8A 1V8ZA 1PEDA 2APJA 5CYFA 4U0KA 2A3NA 4HXEB 1ZESA 1B3BA 3PT9A 1UOQA 2ZIAA 3W1WA 1C3JA 3OEWA 1X1AA 5KSZA 2YS6A 3A6FA 1TLLA 3NGXA 4EY3A 1L5RA 2VR1A 3U3JA 3BM5A 4AY4A 5I4IA 3FPFA 2YN2A 4FFLA 4FILA 3RK0A 1U2DC 2CV0A 4NOMA 4AN0A 4GPIB 3SIRA 1RQXA 1F1JA 1I5EA 2IOYA 2NU9A 4PX2A 4MKHA 5FHQA 4M3NA 4CMAA 4DCUA 5K0TA 3R0XA 2YJTD 1T6BY 1WKBA 2ONCA 3FPHA 1YB2A 2IGBA 3CW9A 1HRDA 2PVPA 4WPGA 4Y2TA 1Q20A 5NULA 5IG2A 3DDNA 1P6XA 3EWIA 2EF0A 3RYIB 1A0OA 2IOHA 2WFAA 4QATA 4RVUA 3PXGA 5CDGA 5BN4B 3LMKA 4R3NA 4PN3A 4Z53A 4TTSA 3P4XA 2BI7A 3SIXA 4ZZ0A 2WAMA 5BSVA 3B12A 3I9LA 4J9UE 1G18A 3FNGA 2PWYA 2EJBA 1J2TA 1N6NA 2D2VA 1U7HA 3I4CA 5E7JA 1EXMA 3QNMA 5KYNA 3IAAA 1TZMA 2HHHB 4D6PA 2ZCUA 2VS1A 4HOYA 2OR3A 2XF8A 4JDPA 4OMUA 4Q48A 4MP8A 2JAHA 3G1WA 4BMYA 1JZTA 2ZE5A 2UVQA 2G17A 1E7YA 3RR2A 2PKWA 2ZJFA 3DWFA 3TOVA 2PEYA 1EIWA 3PRJA 2ERXA 1EE2A 1C7EA 3F6CA 4Q3NA 4DXHA 1UAYA 4BS9A 3JX9A 1LEHA 3R7WA 3V8VA 2ZGVA 2Y77A 4DTCA 5H59A 3BMCA 3Q41A 3ME5A 2BEVA 3DE0X 4EJ0A 1ZOSA 1V1MB 2FUG1 5H3LA 1WAMA 4M0CA 3Q15C 4N4AA 3OJEA 3TLZA 3ZJ5A 4ZZIA 2G80A 2CF6A 3PCXA 2BJWA 1FFXB 4DIDA 2POQX 2G8NA 3PC2A 4D3DA 1C8BA 2CLFB 2HZBA 3IULA 5BSKA 1II9A 4JC0A 3PIIA 5JLJA 4JI5B 4YRKA 5G3ZA 3EA4A 4QD3A 5JSYA 4N5MA 2ZQYA 1S8AA 1CQWA 2OZPA 4FS3A 3TSYA 4B46A 1MX3A 3RUDA 2CB0A 2XQFA 2JATA 4K6OA 4JVNA 2NZYA 3RKRA 4DUPA 2GEDA 3PQDA 4N3CA 5BOVA 2FEOA 2VYND 2YWFA 3DEJA 4EQZA 1M7GA 1Z68A 4XR9A 1VSBA 3URKA 2Q3MA 1WCIA 4IHJB 1YQ9A 3FPKA 4RAOA 2NZJA 3OIYA 3T9AA 4R1SA 5JARA 3MT9A 2HNBA 2FUG6 2I4TA 2Y67A 1YS6A 2HHLA 3MJRA 3CINA 2YBDA 3OZTA 4Y18A 2JLRA 4EKNB 1B6SA 5TF4A 2PZKA 1UEJA 1VSVA 2A5JA 5I7EA 4OLFA 3EPKA 4AY2A 4COKA 1OFTA 1R2QA 1Z3CA 4YR7A 5H82A 4FT4A 3RLFA 1AV6A 2GWHA 4KQ9A 3YASA 1NOKA 3S2IA 1HUQA 1G8YA 3TKYA 4YXFA 1Z6ZA 3U48A 3WGIA 5JBNA 4M49A 2FZVA 2OGUA 4HZGA 4ZDIA 1LH0A 3GT0A 2JGFA 2OGWA 3QU4A 5KO2A 3UA4A 1MCZA 1HF3A 3O4FA 3E9NA 3SQWA 3LVQE 3DMTC 5K3BA 5KTKA 3OQ1A 2Z3VA 4POOA 1G8AA 2HJGA 1DMRA 4O02B 3UW1A 5I7WA 1C1DA 1WPRA 5T6BA 4GMDA 1WW8A 2P6UA 3CZPA 3PGJA 4LGCA 2PS9A 4BNJA 4AROA 1F06A 1F2UB 2BMEA 1EMDA 3LFUA 1SPXA 3A1CA 4IL5A 2HIMA 3WWCA 3ZQJA 3VKGA 2B83A 1Y81A 3G9QA 3ROPA 2IHUA 5WRFA 4AMUA 2P2NA 5F33A 1PDWA 2XZLA 4UW9A 3DEKA 2RBGA 1YZLA 3HFRA 3L93A 2FEXA 3OTWA 3PA6A 3RUPA 3F97A 2YCBA 4TMWA 4W8OA 1KZ9A 1Z33A 3FTCA 1T5LA 5FL7A 4CM8B 4JODA 4B35A 2IHVA 5HMMA 1ZN9A 4UHJA 3S8MA 3QFRA 3E5RA 5CP8A 3A11A 3S4YA 4CMEC 1LBEA 1ECLA 4JUAA 5JD5A 1PL0A 2Z08A 3ORSA 1K0FA 4QDKA 3K5WA 4OHRA 4CLEA 1WZNA 3AVQA 1XELA 4I14A 2HMSA 5IVDA 4FE7A 2MSEB 3R8XA 1OSNA 2PU7A 4QELA 4LBVA 3T7RA 2GXUA 1Y5MA 1CR2A 1VMKA 2PBFA 4LTNA 5DB4A 2DC1A 1XCPA 3CNNA 4Q9HA 5IABA 3MELA 2C2GA 2CL7X 1H3NA 5K3FB 3G7NA 3RAPR 5BSEA 2H4YA 1KKLA 1QVRA 2IEDA 1TU0A 5T57A 2M6SA 1D9XA 1STOA 2XADA 3FAKA 4P31A 3G8BA 3UGQA 3DPIA 1DX9A 1FUYB 4EKIA 4ZI7F 3T4UA 1UK8A 2XQVA 4PCLA 1WDKA 3P2MA 5HZMA 1EM6A 2LDBA 4F4FA 4ZOLA 1DQPA 3ZW8A 1FLVA 5AUOB 3GJ8A 3H84A 3K6SA 2JIBA 5IS2A 1QGOA 1EZZA 4G85A 3HWWA 1YU6A 5J59A 3TFOA 1ZISA 3DEFA 4PV7A 1NNEA 2IX9A 3L1HA 4EZIA 4YCCA 4P83A 1DJOA 2A9KA 3ZY2A 3X3HA 2JBHA 4HCJA 2RGNC 5L40A 5GQSA 1Y1SA 3BJZA 3CX7A 1OBCA 2ZRHA 2ZVDA 2NQ2C 1AMNA 3UAXA 2ST1A 3T5MA 1W9MA 2WV7A 3DEIA 4HK4A 4F5WA 2XTJA 3F49S 1E3QA 3IBTA 4I1VA 1HGXA 5CXQA 4CM9D 1RZUA 1H6CA 1UL1X 1WMSA 3ZU4A 4ZHQF 3AY7A 2W22A 2ZS8A 4D3FA 4EHBA 4F5ZA 4JGGA 3HV2A 4E4TA 3BL8A 3T9EA 4K1LA 5FL3A 3U3RA 3HJRA 5A6SA 4ANFA 3STHA 3OM0A 4HUJA 4OQDA 4R4JA 1RQ2A 1SXJD 1TT5B 4IGAA 4C3VA 2EX4A 4LNUB 4J94A 4ABTA 3RU2A 1L5YA 4FCWA 2DYKA 3R77A 2WM8A 4AIIA 2CJXA 1E92A 3N6VA 3A28A 1RCUA 2IEGA 2YHUA 2OYCA 3M8KA 4HMOA 5JOQA 1M8PA 2JGAA 1NLUA 3B2EA 4GLOA 1P5FA 2D1QA 3KOOA 5FPHA 1E6CA 5J9FA 1VB3A 5JPCA 2R5NA 1ACMA 1DJNA 1GGHA 3EA0A 3KQTA 3KZCA 3OTQA 2P5UA 3DONA 2CXTA 2AF3C 1GADO 1LFAA 1NMSA 1NBHA 1G21B 2WB4A 3G17A 3R75A 1E1QD 3WNCA 4C0AC 1MPTA 3CY6A 4NECA 2JIOA 1GCOA 3QVJA 4S35A 5MGNA 3MHPA 4N3AA 1KH1A 4MV5A 4E15A 4WT7A 5BR1A 3BFJA 3AZQA 1KZ6A 1LVUA 1GPLA 1M7HA 1P62B 3P0JA 1KVQA 5I7FA 3ZPXA 3TD2A 3EBOA 3KQVA 2F67A 1ONPA 5JS1A 1O89A 5EZYF 1MO2A 4LRXA 1SB9A 4WUVA 4WY5A 4RKQA 4JDUA 3AZPA 1GPYA 3PHJA 1ISIA 4GKJB 1WNTA 4C1BA 4C6TB 5AOCA 2XMRA 2E6UX 3ODPA 2PO7A 2XMGA 4WOKA 2BLNA 1EDEA 2CE7A 1ZMTA 2CVHA 3EZFA 4AJOA 4XWKA 1CY1A 3E8SA 1TU4A 2WJZB 3C3DA 5A05A 1QU2A 1XP5A 2QP9X 1I9CA 3A9RA 3D6JA 2YW9A 4O2AF 1R88A 5JNUA 4R5MA 5CYGA 4JUIA 2IW1A 2GKGA 4BLUA 1CUJA 3BGVA 5C53B 4FOOA 1FUEA 1KYZA 1ZICA 4EWLA 3NC1C 4DN6A 1HL3A 2VSYA 3C4JA 1OLSA 3EBPA 4ODIA 4CKYA 1WQ3A 5EJMA 1E96A 3U4AA 4HBZA 1P2SA 3MJ4A 4ZCIA 3HK2A 5L3ZA 1FJ2A 3B3GA 4HTAA 4L8WB 3I04A 3AUUA 1J6UA 2Q28A 2XOKA 1LTHR 1G9XA 2FLWA 1SEPA 1Z15A 2HA2A 1CQPA 2N1BA 4DQXA 1YA4A 4FW9A 1QZZA 1VPEA 4N47A 3KM0A 3KYDB 2O0JA 3I76A 1EYZA 1QIJA 4I5IA 4EMBA 1YVPA 3W7AA 3WWPA 5EIWA 5IF3A 4NFYA 2FXVA 3O2NA 3NCHA 4I5EA 1WBBA 3WG9A 1CZHA 3UK6A 1E7MA 1WDLA 4UKDA 1N3IA 2Z3ZA 4H7JA 2JGIA 4J7AA 2V6MA 5K3OA 4RCYA 2H57A 1A8SA 2W90A 1ZVKA 3EGCA 1V45E 1KFKB 2DPGA 3EMDA 2QR3A 3C0KA 3MCTA 3K9NA 1E69A 2XGOA 4GL4A 4YRJA 3L7OA 3UG7A 3KALA 4FYPA 4F3YA 3LV8A 1Z35A 2MSLA 3K1AB 2ROQA 5K01A 1FSPA 1PSZA 3U7GA 1V43A 3VO1A 2GPAA 4C76A 1RHRA 3ASZA 4V03A 4FZVA 2AFIE 4UVDA 3C5WP 3OQNA 1RI2A 3TDNA 1VHJA 2HJVA 4GPAA 1GEEA 1TECE 2P8JA 2H63A 5FA6A 4K9DA 1W4RA 1A8UA 1Q0HA 2J33A 4OYLA 4YWJA 2B92A 3WK7A 4DA4A 4U2BA 3T5CA 4NBTA 4RV4A 2W6CX 4H7KA 2IBSA 1U7DA 1QAQA 4JX9A 4M8IA 3M9XA 5FT9A 1UZLA 4GR5A 3CVJA 4JAVC 3L1VA 5LKRA 2VHXA 4RPLA 4TRNA 1RJEA 3MMSA 4DVGA 3SC2B 2P78A 3R3SA 3KUCA 4OK6A 3ZLJA 3MRXA 1V16B 1UDAA 1T4CA 3EXEA 2YWDA 3Q40A 1KVRA 3LRTA 2DULA 3R3ZA 5C52B 1NQTA 1NN0A 1W85A 2B4QA 3IJ5A 4PTYA 4RMNA 4D4MA 2JLBA 4PR0A 3FRIA 2ZIZA 3W2GA 4V1CI 4ARVA 4G5SA 3IKTA 1RTTA 3LDHA 4KO1S 4L6CA 3UMJA 3ZZUA 4BO0A 2GN2A 2O8EA 2GYVA 1AUPA 1SCAA 3U4QA 3TINA 1WB4A 4Q00A 5E7QA 2AWNA 4UEQA 4JI1B 4UMDA 3E7PA 5DM2A 1TZCA 2ZWOA 5AK5A 1ZGHA 2ZAGA 1YZQA 2A0FA 4IHAA 3BDAA 5FFFA 1FSZA 2N0SA 3GJ4A 5LP6F 1GA4A 4ZTZB 2Q5LA 1DCFA 2CDRA 3GMTA 1JU3A 3J81A 2WY2D 1KOGA 1FYXA 1PL8A 3WQQA 3EA5A 1Z22A 4P58A 4UCQA 2Q1TA 1E1CB 1KSJA 1XA3A 4PC1A 5B1IA 4YREA 2Y76A 5KOJB 1WUKS 3IA7A 3L05A 4U2CA 2FSUA 4O3MA 2DB3A 4ZAYA 3K4QA 4X8HA 2G70A 3LOQA 1J21A 3M6XA 4G67A 4PRKA 4Z4IA 3QE3A 1TQ2A 4OJQA 5GJVC 5EZQA 5L4SA 3V7YA 4LWPA 1G5HA 2IYTA 5FTNA 1M6NA 2IEZA 2I78A 3E84A 5JSZB 3ZWQA 1BA3A 1JZSA 1G21E 3G0GA 1YO6A 2AR9A 4JK3A 3KHKA 2FDRA 3NBZC 1L3CA 4XM0A 3RODA 2EQBA 2XB4A 3Q0EA 1YRQA 4B44A 1LWNA 4OGGA 3RIMA 3WBJA 4RTJA 1SMKA 1BGWA 1TIBA 3U5ZB 1NBOA 4B40A 4DYHA 1ZSNA 1WXHA 5FWYA 1RR6A 1W1WA 2D0PB 2Q29A 4IS2A 3WYGA 3JS5A 1FDIA 1NR7A 5DI3A 2PYDA 1CVLA 3B7GA 3MK31 4M60A 1QVVA 2I8AA 3BMQB 3GV0A 5ARCA 3VX4A 4CDGA 1LQUA 2L2QA 4AJ2A 5JZSA 1MNAA 1JR4A 2SNIE 4FGWA 2VF2A 3P2IA 3RJ9A 3I6IA 3WLSA 2G28A 2QTGA 4QTYA 2ZR8A 3FNQA 2RC6A 3KU4A 3EMKA 1IVYA 1WBJB 2P30A 2Q9AA 1DAKA 3L4EA 2BFEA 3PWZA 4R2KA 4AX8A 3LBNA 4TWBA 5AKYA 4TQGA 3DA8A 4TLEA 3FPLA 4MV7A 5DMHA 1Q14A 3EN0A 4B7UA 4AWBA 1FDSA 2JLVA 2A1TS 2OQ2A 4QYIB 5CVJA 2JRLA 2IS4A 1PYDA 2E1PA 3BHMA 5KDOA 1Q91A 3INYA 1SJ9A 3DM9B 1QBKC 1XD8A 2DQKA 2EFHB 4ND1A 4AS2A 3V8PA 2R84A 1ICIA 3G5LA 1KHHA 2WA1A 3PLNA 1SU8A 1V6CA 3OF5A 3QE4A 1YR6A 4K1XA 1ZU5A 5FOUA 3WRYC 1KJJA 4AZ0B 3L8MA 4JGBA 3RRYA 2P65A 2PEZA 4LXQA 2ODWA 4A6XA 5IZCA 3L7AA 1M1YB 3KQSA 1AGYA 1IOVA 5AVOA 1YJ5A 3A3OA 4CL3A 2C5BA 1U98A 2DKFA 3OESA 4LY9A 5A71A 3VNVA 5FTWA 2GJ9A 3D0RA 5K0BA 4I9UA 2IOQA 3QEBZ 3QE9Y 2WAAA 1UXGA 3HN7A 5DEIA 1U11A 13PKA 1B73A 4H1VA 1GFWA 2B1GA 2C9BA 1RXEA 2OK8A 3O9ZA 4Y2PA 2XMQA 5E1MA 2YC4C 5THXA 4DJAA 4I4TB 5FORA 5HE9A 4H2DA 2FFRA 3UAYA 1QLJA 3P52A 4BB9A 3X1ZA 4G0OA 1MKYA 1R50A 2R3SA 3QVTA 4LTDA 3RYHA 3U4CA 2HL6A 3OM8A 4HLQB 2PIDA 6LDHA 3NT5A 1JB9A 3B6KA 4EJSA 1E98A 5FJIA 1ZNXA 7ABPA 4LTMA 3KYCB 3LUGA 1RJ9B 5DSTA 1YZGA 2GJ4A 4BBPA 1Y8CA 1QMGA 4D9GA 2CL5A 4ALJA 5J5AA 3GLRA 4Z1OA 1EVIA 5FLXA 1JEJA 1CF2O 2QMZA 2R66A 3FLEA 3G2IA 4UNRA 5AKIA 5DBIA 2V8OA 1R8XA 2PBRA 2JKZA 2YL2A 1JAYA 4ER5A 4PTZA 3TJZA 5AM1A 1PJLA 3QW2A 1G60A 1P1HA 2FSPA 1OT3A 1L7VC 3LKDA 4UFNA 4I8DA 1XTUA 2QN3A 3GJQA 3LNTA 2NU9B 1QIKA 2Z8ZA 3AJEA 1QKIA 4LXXA 4L28A 4OHUA 4PQFA 5CVEA 4YHBA 3VU9A 1JXQA 4P34A 4D1YA 4FTWA 5AW8A 1MDBA 2JKYA 2XE4A 4NPHA 2JLZA 3Q8MA 1E5DA 1E9DA 3HDGA 1S2GA 1YE8A 4MDHA 4EY8A 4J3NA 3W7BA 1NXVA 5IXJA 2FV8A 3IXQA 3OIDA 1SXJC 4L4XA 4ZJUA 5HGXA 1PEKE 3GG2A 1W46A 1IHOA 4YT5A 4AULA 4XVHA 4I9GA 5HM6A 3JAMA 2ZP1A 1E1QA 2E82A 4RDCA 3V1LA 1RM5A 4E14A 2NVUB 5C1DA 5KX5F 1RLMA 1RYZA 4XIGS 5G4KA 2BEKA 4YRPA 1YRHA 1I1HA 4IJMA 1G291 2I55A 4HGZA 1OAOC 5EP3A 4BPRA 3QFFA 4BBAA 1I7DA 5F51A 2PZGA 4EBBA 1KY3A 2FCAA 2R65A 1CS0A 4M1ZA 2O0HA 4N3BA 5TJ9A 1NR1A 5K0ZA 2XLCA 2P91A 2HRCA 3WIOA 4JYAB 1HDOA 1R18A 3W2FA 4IZHA 1L5HB 1NNUA 3ZLVA 4C87A 3PUHA 4Y1EA 1G5RA 3E58A 4S1TA 5U4QA 1LDMA 3HNRA 3PHGA 1ZNYA 3PEYA 1NG9A 3EVFA 2VXCA 1BU8A 4JROA 1TTTA 1KSFX 3KBOA 4RS4A 2DOKA 2EBFX 2XUHA 4ZO8A 3ESDA 1OI2A 1X3LA 4X8LA 1BD3A 3GG9A 3LP8A 3OPNA 1WS6A 3GLHE 3ADKA 4K0RA 3SKYA 3CGWA 4H7FA 4BC0A 1Z2AA 1W76A 5I01A 3GC6A 3AU8A 3PUJA 5CT8A 1II0A 1TKCA 3I6ZA 4R7TA 2AC7A 2JFOA 2P3LA 4JXJA 4PNPA 3ZY4A 2H4XA 3TQOA 1RABA 1AUXA 1M6VA 3HP4A 2ZBQA 1G19A 1IY8A 3UJ3X 2FZ4A 3KQHA 1NE7A 4Q1DA 2A9JA 3K0FA 3GJ3A 3Q1LA 4U6NA 1XU9A 2CDCA 2C2OA 3GNTA 2GILA 4BQIA 4MI9A 3ZGLA 3UAZA 1UBUS 1CE8A 3M3PA 1FMFA 4PHHA 4V0SA 4OQEA 5A0VA 3GT7A 3QPCA 1CZNA 1PZNA 1RBYA 3A9CA 1AK9A 2RHHA 3OE4A 4RGYA 5E4TA 1QO9A 5LA6F 3TTSA 2JLUA 1VTKA 3I1FA 2Q2VA 3T0FA 3VDNB 4Z4QA 3PSHA 1ENOA 1X6VA 1ZBDA 2DFTA 2NZ2A 3GCDA 3IDFA 1E8DA 1F9AA 4UE6A 1PP4A 2Q45A 2BMAA 2H6EA 2ZI3A 3L1KA 8ATCA 3A37A 2XZPA 3NANA 1NQOA 5DRTA 4A0FA 2A1IA 4W5OA 1E1RD 1XKQA 2X0IA 1BX0A 2SCUA 1BD4A 3OT5A 4PWYA 2QTZA 4AN4A 1D2AA 3NC4A 3NBXX 5THQA 4E11A 2P9EA 4MQBA 4EPYA 1A9XB 1U7PA 4YCLA 1Y8ZA 1TEHA 4XOIA 4UVIA 3JVEA 4EVQA 2YCLA 1E64A 1E9BA 4Q1CA 1H8HA 1MX5A 2F3PA 3H7IA 4D42A 9GPBA 1ZS9A 2EXXA 4BNLA 3ZVNA 2BGNA 4IHKA 1W88A 4DZZA 2BFWA 4NESA 2BFPA 3RU9A 2C0CA 1PX0A 1GUZA 1O2DA 2FK8A 2PX3A 5FOTA 2QIOA 2BBSA 2EYQA 2QTNA 4M0MA 4RZXA 1E59A 4BGEA 6REQA 1O94C 2WE7A 3NJRA 1E1RA 3SEAA 1O96A 2ID9A 1T1EA 3ZGXA 2VPYA 1EZ1A 3LX8A 1YDHA 2CYAA 4MIOA 4YO7A 3C5CA 1IU9A 5EWJA 2H1OA 1PBTA 1SD2A 1G5QA 2XUDA 3GVXA 2OO5A 2GJKA 3PRHA 3AHFA 3F98A 4NOKA 1M5TA 2SKDA 4OFZA 5TT0A 2FEMA 3O6VA 1S9HA 3IEMA 4Q9AA 2IH4A 2IU6A 2PS3A 3ETLA 3LQKA 3W6ZA 2Q6VA 4G4SP 1XG5A 1VBKA 4LGVA 4LK3A 5BSRA 2H2WA 1HQYE 3CRW1 3EIFA 1XRMA 4ND7A 3N8GA 5ICSA 3JQBA 3PF9A 4KTTE 4KIWA 3ROKA 5LMUB 2XJ9A 4O0LA 3UMRA 4AWXA 2J3QA 2G6BA 2PLNA 3EH1A 3TI9A 5JH7A 3G2LA 5EMJA 1HXHA 1I4TD 3MWJA 2DBVO 1E5VA 3ITNA 1KNXA 1QHGA 3RANA 4Q39A 2NXEA 4X1YB 1N0IA 3UH1A 5FI0B 3SFVA 1Y1QA 3SYMA 3ZWOA 2H52A 2HLNA 1U7TA 2PRYA 3PGA1 4QPNA 5GADl 5JMTA 4JX8A 3DAOA 4Q1BA 2X40A 3M7IA 2BM1A 3V4VB 1DLJA 5BQXA 4TKZA 1VFPA 1DQZA 2C2WA 5FBRB 3WXBA 4B1FA 1EI9A 3L0OA 3FBGA 2A1TR 3HUTA 2YNMD 2PJRA 4WJZA 3TL3A 1T43A 1GFZA 1PG2A 4PQEA 4YJHB 4DYVA 2RI1A 3CT6A 3JWPA 1C1XA 2NU6B 1RPNA 3M6AA 4GDMA 2IP4A 1DV1A 1G2QA 5TQVA 3WL5A 1F7VA 1QPZA 4I6EA 4FMDB 4XXHA 6CHYA 5L8VA 4ILEA 3STYA 1SZCA 3LQ1A 3U0BA 1Y6GA 4H0FA 1EA7A 1D2EA 2ZRFA 4FYXA 5EKUA 1HEIA 1QGYA 1E7QA 2L42A 4HSGA 1TK2A 2C7OA 4GEGA 4MVXA 3ESRA 5KBYA 3IV9A 1NLZA 1US8A 3T6KA 3KWFA 3B1XA 4YP5A 1KAQA 1NZFA 3MJCA 1VKZA 1T10A 3ZCVA 3FX2A 4RHCA 4JITA 5IUNC 5U1PA 5IDWA 2FWNA 3VHLB 1E66A 2H92A 4F9TA 5J47A 2GZAA 3TMYA 3ZV4A 5I9IA 4D6XA 2CK3A 2JASA 2R1VB 2XCLA 3H04A 3BA6A 1ZVQA 4JGIA 2A30A 3SR4A 3W06A 1CFJA 1N5OX 2PTGA 3CR3C 2QENA 5AK3A 3L7IA 4W9NA 3LQFA 2JB9A 3D81A 3UXMA 4DJFC 4BFWA 3UC5A 5JYBA 2NADA 1CR0A 2WM2A 4BFVA 1DFGA 1J5XA 1HQDA 3IKVA 3K5IA 4F4DA 1O6ZA 4QSHA 2VPZA 1I80A 3OZBA 2ACWA 1TTQB 2I7TA 2O3UA 3P96A 3QJGA 4XD2A 3QXHA 4UMEA 3WNQA 3K6JA 5DBGA 1F2UA 4FLMA 4MOWA 5ER6A 1RPAA 5DYTA 3NBMA 2WYHA 4FYJA 3ZXYA 3HADA 3STXA 1FRQA 3LO5A 2GBIA 1VSUA 1X9HA 3CW2A 3R3XA 5IBRA 3AHDA 1FP7A 1M2OB 1P44A 3B48A 3LT4A 3PUIA 3DYIA 4HDRB 2X1VA 3L49A 3FSGD 4IMPA 4LDPA 4NV1A 3L7JA 4TROA 4URUR 1HDIA 4WKPA 3VXKA 2QP4A 4F60A 2C97A 5K0GA 3O8BA 2PD3A 2QL9A 3QF7A 4MVJH 3EVDA 2OB2A 3NFRA 1AU9A 3OSZA 2DCMA 4IX1A 1EWYA 1CRWG 1O6FA 4L9SA 4V0OA 3H1PA 4F8EA 4AZ3B 3T7CA 4QUKA 3OFND 4E2ZA 3R7BA 5K45A 2W6ZA 4WZBA 1E18A 2B3DA 3HEBA 4FGJA 4UNQA 3DOHA 1UBSB 3E9DA 5K8CA 1TX4B 2PVCA 3Q7IA 1NBMD 4LX0A 1M5RA 1DU4A 1I32A 4CQMB 3IDQA 1XLVA 4XRRA 1ZVJA 1VE9A 4HAYA 2Y71A 3WGNA 3ICOA 4RQAA 4XCQA 1AK2A 3DBRA 3JQGA 5K3FA 3LX4A 1YHNA 2XOXA 3R1IA 4W9NC 3T5DA 1CE8B 1J20A 3TVYA 5K03A 2RH8A 5DCUA 1SRRA 4YJ3F 2B4KA 3LX6A 1Z2NX 3PNYA 3SG0A 4BO3A 2OPBA 5ABPA 3T7KA 5CXSA 3FMOB 4MWCA 2L0XA 2H4HA 3AUAA 3MB5A 1CJSA 2BH2A 1U2DA 1VCIA 1Z8FA 2QSJA 1LPPA 1T2FA 2AX4A 3GRVA 1BDHA 1SBTA 4KFCA 4C7OB 1XVTA 3T7DA 4RWZA 1OX6A 3E3NA 3EZ6A 2PR2A 5AW9A 3EAGA 2VDWB 3QG5A 5K0SA 1NHGA 1EWVA 2CVPA 2DFVA 1G0OA 2IPAB 2Z43A 3NV9A 4HB3A 3UYLA 5KYKA 4W5TA 2DQ4A 4XYEA 3AWIA 3D5QA 4B7CA 3TM4A 1MA3A 3NU1A 3NX4A 4OQYA 4P4SA 3HTXA 1V35A 2WIAA 2FRDA 1WULS 4XAQA 2E4XA 1UJ5A 2UZ1A 4GRIA 2A92A 2WMOB 4KV9A 4R9SA 1IY1A 3A1EA 3OHSX 2CVQA 2WKWA 1JVNA 3GNQA 3OH8A 4UUBA 5GAJA 2IV2X 4NE7A 1Q92A 1CNEA 1IHDA 3D1LA 5TVGA 1JH9A 5BSUA 3U7HB 3U9LA 3PZBA 4OQPA 3FRJA 2QI9C 5ICEA 1MEOA 3AIIA 1ZUNB 3NCTA 3R7AA 3EEOA 1C7ZA 4GIBA 5CXUA 2GM5A 1J23A 4FOTA 1XTJA 1N2CE 1GTL1 2BF7A 1TCVA 1A9TA 3ZXIA 4CQMD 4BWVA 4MR7A 1Z08A 2BT4A 2PZEA 1O4VA 3K72B 1CERA 4ARIA 4PAWA 1Y33E 2DLNA 2JD0A 4HDNA 4WNAB 1E2MA 2CMKA 3LCUA 1X0XA 1UC8A 2IPLA 3BWDD 3PXXA 4KK3A 2CLDX 3TSOA 3PEUA 3WO1A 2DFDA 4IVPA 4O4HA 3OT1A 2BDEA 2Y1FA 3ZVLA 1YR8A 1UOPA 3O94A 5KNBA 2ZDQA 3CNHA 2RB4A 2O1XA 1Z4LA 5HUQA 4MA5A 4RVDA 4RW0A 3PNBA 5INTA 3HABA 3QQ5A 4C20A 3T35A 5EJ6A 3BMNA 3LU1A 1FTQA 3AC0A 1VP9A 2R6HA 1NQWA 4KGVA 4LXTA 1E7SA 3UUEA 2ZBGA 3KYBA 3ZXSA 3H16A 3L18A 1M2WA 2IZ5A 3PPYA 1ADCA 2OLJA 4B6PA 4HRVA 1AGRA 1H4SA 2X77A 1MO3A 4Z2YA 3OWXA 1RMYA 1BSVA 4AXBA 3FWNA 3RSFA 1N6OA 2ACKA 3PUKA 4IMRA 4INPA 5AJTA 5TNXA 3WWDA 4JEUA 5GV8A 4FJ1A 3U62A 3ZXUB 4BCDA 2WYUA 3T94A 4LRQA 3I04M 4FD2A 1D4OA 2CXPA 4P32A 5KOHB 4UDOA 4AECA 1B8VA 4KMRA 1WB9A 1PJQA 1QQ5A 2FI1A 1VRWA 1A77A 2Y1XA 3JQAB 2C5GA 3HJAA 1JEDA 3ENKA 3I9V6 4FQ5A 4K8OA 5IK2A 3U4DA 5KYWB 4C1NA 2HAEA 2AA3A 3A9TA 4PLVA 3L7BA 3EGDA 1JIJA 3LC0A 5EMKA 1N25A 2GAFA 1TMYA 3L0YA 3UT5B 3W9YA 1YS9A 1NRWA 3WIEA 2A1UA 4I3FA 4MPPA 3N87A 2FPPA 4L8LA 1Y8AA 2B61A 2V7UA 3T3MB 4A1FA 2J3LA 4IH9A 3H8JA 1FXUA 1PS0A 2VUHB 4LF6B 3KZVA 2P9YA 3DBVO 4WADA 3B2QA 4KLZA 4K2HA 5K3AA 3EIXA 3VYVA 1X19A 3ZCTA 1ZO8A 1E6MA 1UOEA 1VFNA 3TGWA 1IDN1 5K0NA 3H3FA 2FLVA 4AJ1A 2GM9A 2X23A 3EXHB 2IPOA 3FBTA 4EECA 3KQNA 3IV6A 3T1HB 2IP2A 4WZ6A 1D2CA 3BSFA 1GKUB 3G5MA 3I01M 1EJ6A 1P7ZA 1ZJ6A 3NTVA 4QYTA 4TN1A 4B33A 4FKMA 3H5IA 4CU5A 1BS2A 1NTOA 3HCOA 4NR0A 3DZFA 5FTLA 4ML3A 5JSUA 4EA9A 1P6UA 3IELA 3QFHA 3RVOA 3IB6A 1QK4A 3FYDA 3LPLA 2YOGA 5JYDA 2WVGA 3FMPB 4ERXA 2G9RA 2BI4A 5JXHA 1ZGZA 1PJ3A 3NDJA 2IHYA 4PN7A 1BEEA 3V46A 1I10A 1WMAA 4UULA 2JIZD 3DAFA 5IUKC 3M6FA 4DA9A 3LT5A 4KQWA 3ZWDA 4DANA 4PZEA 1TK3A 5KSWB 4PM4A 1RRCA 4JT9A 4P4TA 3AH8A 5J2UF 4ZVRA 2IEBA 2YQZA 1A9PA 2RGCA 3MCAA 2YQ4A 4LKRA 1THMA 4FDTA 5LOVA 5HWSA 3H4IA 5GM2A 2BKAA 3DBHA 3LGSA 1UPTA 2REBA 2ZS7A 1YFJA 5ELXA 4KYTA 1VE7A 1PZXA 2QR2A 4UAVA 3CKKA 3L4BA 1KOJA 1IG3A 2R6JA 3GBPA 4GP7A 1BE8A 2N46A 4X64B 2YKGA 1KO8A 4MIKA 3WLJA 3U7EB 2PE5A 4JL8A 2FG5A 1M34E 1P8AA 3I6BA 1JMYA 5CIQA 4P7JA 5JNVA 2NTNA 3DVLA 5CBPA 4D5EA 1M8GA 4BO4A 1X8LA 4DCOA 2QUJA 5F4ZA 3G0OA 2QG6A 3BGDA 2PUTA 1VKNA 3DEZA 4RHXA 3PVCA 4MWBA 4P7BA 1JHPA 2R8EA 1EDZA 4HRAA 2GBGA 5C4MA 4OGFA 4UBMA 4G07A 1U3TA 2IS6A 3UHJA 1ECPA 2BHNA 4I46A 4R0NA 1FUIA 3MWEA 3TFWA 3QYAA 1GA6A 3TQIA 1KBOA 2ZBPA 1AG9A 3MJHA 5KYUA 4D0LB 2IIPA 2PZ8A 4MMXB 5I48A 3O8RA 3IPCA 4QT4A 1R0XA 4ND8A 2I03A 1A9RA 4GQBA 4FQ8A 2PWZA 3D1JA 1T8WA 4YXWA 3ZVRA 2RDMA 3MAAC 3GZTB 3SS7X 2WTAA 3EOBI 1OGYA 3VOBA 3EIQA 1GPMA 1U31A 4G0PA 1JECA 5BSFA 4J43A 4FB5A 1WHSA 2PLAA 2Q0SA 4I19A 5LQAA 2O4CA 3NW9A 1X14A 3BJRA 2HIHA 2ON6A 3X1YA 1U2TA 3K0BA 2JIDA 5SV2A 3UK0A 3HNPA 1OLOA 3JW8A 3TZHA 2X86A 3DNPA 1S5PA 4OAPA 5IM4F 1D3AA 2A0KA 4V2UA 2O48X 3QE0A 3VNRA 1L4UA 3HL0A 1AUQA 3NOQA 4C0JA 3R7DA 1G17A 3BMQA 2CW5A 2J4DA 5G0TA 4HDKA 5A9TA 5F7XA 1MG0A 5KTMA 1A82A 3F71A 4ZDJA 3GN2A 2ERYA 1JQ5A 1OA0A 2OE2A 3TG2A 2Z9DA 2JCBA 1GGJA 5KYGA 4P4GA 2C9ZA 1Z7YA 3PL5A 3GGPA 2G1PA 2AFIA 4OKNA 3TK1A 4GR9A 3PPXA 3L8EA 3A04A 5D01A 3LWZA 3PLAE 3LG2A 1QRDA 4IWYA 4TVBA 2I2WA 2XVAA 1U6KA 3JALB 4LYAA 2XYHA 3N5KA 5IT5A 3QMVA 4YJFB 3KZXA 3AJ8A 2KQUA 5FLYA 3KYDA 2WAXA 3RS4A 3ZH9B 2J08A 4X1KA 5ICFA 4JA0A 3ZH2A 1NBMA 3DZDA 3GPLA 1NW7A 4MUEA 3QU7A 2BIFA 3EVTA 4LOAA 1D7AA 3SHOA 3F5FA 5AW1A 1CQIA 2ZKLA 4BN5A 3TD6A 4AP9A 4WJLA 2XRFA 2GPJA 3KS9A 3N70A 1HI9A 3MRVA 2OCGA 2E3JA 3TNYA 1TAQA 3IPXA 3PGMA 4RCZA 1YULA 2K2WA 2JGNA 5D2CA 2C5EA 5E38A 2EBHX 1RCTE 1PF7E 3K9LA 5LQKA 2TMKA 3RUEA 4MW7A 3LAWA 3ASVA 3RD5A 2EGHA 4MWTA 1U9CA 1M33A 5BVHA 1D4AA 3NR2A 4OQLA 5A2GA 4FFWA 2FSFA 3ZDQA 4Q37A 4AG5A 4HDAA 4DB2A 4B3IA 1DG3A 3GGSA 1NU6A 2ENUA 2BMDA 1H66A 2LBPA 3PR2B 2P90A 4JNKA 5EXPA 3ZJYA 4DGQA 1I7QB 2HNKA 2W00A 4Z86A 1MUUA 4AQYB 5EUMA 2CNWD 1GPH1 1XUOA 2MMGA 5K8LA 3N07A 1NYTA 4YRDA 3MS2A 1ZIPA 4QAQA 2J5RA 5ED4A 1ZVMA 4F2GA 2PN1A 1M67A 3GCWA 3UJCA 4HP8A 4G0QA 4ZQCB 1I6KA 1RKBA 1U5CA 2RHMA 4HGNA 1EUDA 3F8SA 3NLLA 1YRBA 3UXHA 3ZX4A 1HDYA 4RA6A 3QXSA 4B3GA 5E3JA 3AR9A 4B3HA 3FPCA 1ZQ1A 4AY5A 3LCCA 1ADYA 3NHKA 4HNUA 1UR5A 3K6RA 1JDTA 1UZAA 4M1MA 3IA2A 4U7FA 1Z88A 2PL1A 1LLQA 2ZRIA 5AJUA 1KQ3A 5ITZB 3GB9A 1YMVA 1OYVA 4WGGA 3DMDA 1DO2A 4DCCA 2IY7A 4D9JA 3L6CA 1GPNA 4PG6A 3SKXA 4CMBA 1D03A 3KIPA 4CV0A 1M0TA 5L7WA 2HPAA 1B0UA 2H4WA 5LDGA 3TQHA 1BH6A 1EH5A 1JDBB 3AUJB 5EE5B 4HL6A 4FBGA 3EDRA 4P2GA 4B0PA 2ZWVA 1DQSA 2ZYRA 4IS3A 2J0UA 1A27A 2W2OA 1RIFA 5GOTA 4K86A 3P32A 4FN4A 1KH2A 1IHXA 1OD6A 2GPSA 2H65A 3KWLA 5DH9A 1G63A 1XK6A 2R4QA 3C6MA 4OHWA 4JVMA 4ED9A 4P9NA 2XLBA 5DYWA 2RE8A 1UK6A 3QM1A 2OOSA 3LUDA 2RGDA 3M70A 3EZ2A 1XNGA 3ZE0B 1NJFA 4ZIRB 2BM0A 4G5FA 3OE7A 4YROA 4V1CB 2Z6AA 3OE1A 3OJCA 1RC1A 1YU9A 2LNDA 2OV3A 3HYNA 721PA 3A2KA 1IPHA 2N9UA 1NLYA 4F96A 4C0BA 4QVIA 1J70A 1Y0BA 4C0SA 1XZJA 1C81A 3D6FA 3FMVA 5KNCD 5C5IA 2ZJ0A 4O1HA 3IQFA 2UVPA 2UZ3A 1NASA 4P81A 2BV3A 4KRXA 4J0JA 1LSSA 3RJMA 1EX6A 3L06A 5HOEA 1TFUA 3DTYA 4YT8A 1M2KA 3OQIA 1PLJA 1FNDA 5DYYA 3TL6A 1KY4A 4PGHA 2C4VA 1T2VA 3D4LA 1V1RA 1YHYA 2QY9A 1DJQA 2VA9A 3WE7A 3R6LA 3LD9A 5KHOC 2NPOA 2I4IA 5EKXA 2II6A 3I72A 3V7WA 1T9KA 2GK4A 1YNSA 3T95A 2UDPA 4TLAA 3TOXA 3WLRA 1SFRA 2YOFA 3P9KA 3EPPA 4GYJA 5LQNA 1V11A 4LDRA 1XZLA 2JZCA 1MAWA 3B52X 4HVTA 2VPTA 3IUMA 1GAEO 2OFOA 4ZU1X 3D8RA 1CHDA 4LHEA 4G5OA 8ABPA 3D8NA 3D0QA 3H5VA 4MGEA 3SLGA 1ML4A 3IXMA 3PNMA 1CC1S 2Q5EA 3JU3A 1PVOA 3JQEA 2JH8A 4HN4B 4JI6B 5C34B 2JLCA 5LCXA 3DCNA 3AOEC 2YZMA 3ITEA 2QDXA 3OZGA 4JBGA 2QJFA 4P1ZA 4WCFB 4WJKB 5EOVA 2HBZA 5JXIA 4BIMA 4Z3KA 1IM2A 2VDMB 3KU1A 5JS6A 1TW3A 4MB0A 2R0QC 4MW5A 2PH1A 4QKQA 5BV7A 1KBQA 2EEZA 3HUUA 3H9JA 4AQ7A 3TZKA 3H0EA 4KBYA 3PC8C 4TGLA 2AX3A 4XM1A 2JFNA 5E1OA 2WQ7A 1U5BA 1BQ3A 2GF9A 2P40A 2ZRGA 2OAP1 3GOHA 3MPOA 4EG3A 4RDXA 1B23P 4FCVA 4KPFC 4X62B 1UWKA 4RVSA 5IYZF 5KSOA 1UPBA 4JP1A 5BYJA 4R31A 4F3NA 1RHUA 1Z6XA 1CY7A 2HWXA 2NO9A 2J32A 2YYSA 1FUUA 1VJTA 3H2YA 3UWDA 4CKWA 5GJWC 1WHTA 5K05A 3CVVA 3CN9A 4M9UA 4J1QA 3OZXA 1P2FA 1G3UA 4RPKA 4WBXC 3CLRC 2X3YA 1Q7GA 1UKAA 2X19A 5M29A 4G0ZA 5IX8A 1EX9A 2AB0A 2H3EA 5EP4A 2F55A 1N5JA 1LFDB 2EFYA 5DFAA 1G64A 4S2EA 1RT9A 4OP2A 1HRKA 2FPXA 4FSXA 2Q99A 5EUQB 4AJ4A 1SXQA 2QRUA 1P31A 5EJ7A 1T9GR 1NVEA 5EXTA 1RAIA 4KN8A 1VMAA 2COUA 1DTWA 1OY1A 1VJGA 3JYNA 4BZZA 4EJSC 3VAZA 5A4FS 2HMYB 3NOVA 3TIGA 2ZVPX 3UCFA 5CB8A 5IAAA 3V4OA 5JDCC 3EW9A 4L9WA 1NQVA 2H16A 2XRZA 3OWOA 4IIYA 4K5QA 2WWTA 3AVYA 1GTMA 1J0CA 2H2GA 5LC1A 3FZQA 2W9XA 3IAS6 1OIWA 2B7LA 4M6WA 4MGKR 4B2PA 1FJXA 2HPZA 2HA0A 2EIHA 3QKIA 2HSZA 2RFLA 3L41A 3HGTA 1YVDA 3ABRB 1OLUB 2OC4A 4MVJP 3I09A 4NJMA 5HF8A 1IQRA 2WHRA 3HR8A 1PT7A 4E5PA 5GONA 2Q1UA 1FMJA 2IYXA 3NAQA 2JAOA 5JNTA 2HLPA 2ZCJA 5EFOA 4JLKA 3SSNA 4CLDA 1WZEA 4BWFB 2W98A 4US0R 4OQFA 4DMUB 4OUDA 2BR5A 2C2KA 1C4OA 1RRMA 3VO2A 4MLPA 1COWA 2GTHA 1DRJA 2UUOA 2DHQA 5JVDF 3QI7A 4TUYA 5AJXA 1AOXA 4BMOB 1OUMA 2J0SA 1SVOA 2YV5A 4L5BA 1F38A 1PEYA 1SC3A 2VP5A 3URMA 1NVXQ 1FTNA 3UW3A 1HQCA 3RS3A 5B30A 1X13A 4E70A 2ALJA 1HLGA 4I5GA 3DYBA 4KSBA 4QDZA 4KBFA 4MUJA 4DEVA 3SSAA 1MAAA 3IBFA 2VN8A 4GC9A 3U4HA 2WTEA 1EP1B 3G79A 4DWWA 5AVUA 4IH4A 4P36A 4BN4A 5EJGA 5LKAA 1JBEA 2IYAA 3U0VA 2QW8A 3VQTA 3SBXA 3WIUA 2X0DA 4L9AA 4YMTA 3U61B 2OFFA 1HEYA 3E8XA 4MB6A 1C9MA 2CLKB 4GI5A 1XO1A 4J6FA 3C6XA 2P9FA 1K0UA 2FETA 4KO8A 4B4DA 1RNLA 1ZIXA 2GTPA 1MXFA 2IQ5A 3EIUA 4KVGA 2CXRA 4JJAA 3JYLA 1U5AA 4G5GA 4ZVSA 5CFQA 5L3SA 1OI7A 1HDZA 5KYTA 5MFPA 4DCPA 5CIYA 2EFGA 4EG6A 3MTBA 3TTYA 1YUMA 1ORTA 3BRWA 3DZHA 1VA4A 4YX9A 1QH8B 3ERCA 3G68A 4IZOA 4QREA 2FQ1A 4RNDB 5IHXA 1SXGA 2VPPA 2HWKA 3II6X 4TV8F 2GBCA 3NDPA 5TRTA 2G6TA 5H3HA 5REQA 5FHRA 3VM6A 4F7WA 2NU8A 4CM4B 4OF4A 2NWQA 4EL0A 3NTRA 4U9IS 2WSLA 2FLKA 3GI1A 4E5NA 1VLZA 4KODA 3ZWPA 4TYPA 5TEVA 5I8WA 1W4AA 1QIFA 1U7ZA 5CGQB 1AC5A 1OXXK 3RU3A 3TLCA 4RVFA 2YZGA 5TQ0A 1WMBA 4M4SA 4F11A 3VH1A 2PGXA 1PVDA 4IO1A 3A6ZA 4ZCRA 4Z2AA 5HS4A 4JHXA 3IURA 1YRYE 3AZOA 3HU5A 3DMYA 4F85