1EHYA

X-ray structure of the epoxide hydrolase from agrobacterium radiobacter ad1
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
293
structure length
282
Chain Sequence
AIRRPEDFKHYEVQLPDVKIHYVREGAGPTLLLLHGWPGFWWEWSKVIGPLAEHYDVIVPDLRGFGDSEKPDLNDLSKYSLDKAADDQAALLDALGIEKAYVVGHDFAAIVLHKFIRKYSDRVIKAAIFDPIQPDFESWYSQFHQLDMAVEVVGSSREVCKKYFKHFFDHWSYRDELLTEEELEVHVDNCMKPDNIHGGFNYYRANIRPDAALWTDLDHTMSDLPVTMIWGLGDTCVPYAPLIEFVPKYYSNYTMETIEDCGHFLMVEKPEIAIDRIKTAFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The x-ray structure of epoxide hydrolase from Agrobacterium radiobacter AD1. An enzyme to detoxify harmful epoxides.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Hydrolase
molecule keywords PROTEIN (SOLUBLE EPOXIDE HYDROLASE)
total genus 108
structure length 282
sequence length 293
chains with identical sequence B, C, D
ec nomenclature ec 3.3.2.10: Soluble epoxide hydrolase.
pdb deposition date 1998-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ehyA00
4MXDA 2OAGA 4ZWNA 2JGFA 2QT9A 1R9NA 3UUEA 2D5LA 4MJ3A 2EDCA 3OPMA 3R0VA 4KE6A 3HLKA 4I19A 1Q0ZA 3D7RA 4IO0A 3KXPA 4F60A 2C5GA 3QMVA 2IIVA 2CMFA 4C6HA 4EY7A 1UOPA 3SC2A 2O2HA 4AO7A 4TVKA 3HRHA 4UFOA 3N0TA 3WL6A 2PX6A 4QEKA 1GQRA 4RE5A 2J4CA 3IURA 1CR6A 1FFDA 4TPKA 1MU0A 3QZUA 4ITVA 1QIGA 3BJMA 4JEIA 2BKLA 2XMGA 5LKRA 2ACKA 2I3ZA 1N8SA 2X8BA 2PM8A 4K6GA 5HQ3B 1H2ZA 1LBTA 3IDAA 2EDAA 5AK3A 3R3ZA 4UBLA 1H22A 4MYDA 1ACLA 1VZ2A 5EFZA 5JANA 2VF2A 4W63A 4AMZA 1BROA 3F67A 4O08A 3H1BA 2HADA 1JU3A 1BEZA 5LYYA 2C0QA 5HFNA 2R8BA 5DJ5A 3PI6A 1AC5A 1AZWA 5HFAA 1EDDA 2GYVA 3W2TA 1CUEA 1EK2A 3BF8A 3IUNA 3A6ZA 3GFFA 5HF5A 4IHAA 4A5SA 4OSEA 3BL8A 1E89A 3LP5A 3V1NA 3HACA 1CUHA 4AXBA 2YH2A 4B82A 3C70A 2DQYA 2FX5A 4DYHA 3HABA 4UBKA 5FPQA 5LP1A 1QLWA 1ETHA 4XJVA 3FLBA 5C81A 1UK7A 3EF3A 4FOLA 3ILSA 4UHDA 5HF9A 5A6VA 3OURA 2PUHA 4Y2QA 5DYYA 2BJHA 5AM4A 5JD4A 2PKYX 1U2EA 4EZIA 1ZGBA 4KE9A 5I9IA 3WJ2A 3A70A 3D2CA 1B41A 1DTEA 2G5TA 3FYUB 5CW2A 4KR0A 1QTRA 2QM0A 1Y7IA 2VSQA 3E3AA 4OD0A 1E3QA 2OLEA 2OQVA 3C8HA 3GA7A 3C6ZA 3H2HA 5A7GA 3ZI7A 4MWTA 1F8UA 1Q0RA 5JD5A 5ALQA 1TAHA 1QZ3A 2HA4A 1GT6A 4DSZA 4CCWA 2OQIA 2RAUA 3FCXA 3NUZA 4OYYA 2XUDA 1UK6A 2XUJA 2WHPA 5K3EA 3L1IA 5E4JA 5IVKA 2BUAA 3JWEA 1QIEA 3K9BA 2VTVA 3FVRA 2WU4A 3O4IA 1UKBA 1CUDA 4QWMA 4IH1A 4LKOA 1A8UA 1LZKA 1J2EA 3G0IA 3DJYA 1JJBA 3T4UA 1K6EA 3ED1A 2K2QB 3PFBA 3GBSA 4BP9A 4NVRA 5AKHA 1ZGCA 1LPMA 1Y37A 5KREA 3BDVA 1CUJA 2DR0A 5AKKA 3ICVA 2QS9A 4PV7A 5E4TA 5AKZA 5LZ2A 1F0NA 1L7QA 4W9RA 3TJMA 5SYMA 2Z8XA 2WG0A 4EHBA 4B9AA 3KDAA 2PL5A 4IH9A 2OAEA 3QVMA 5JZBA 3WZLA 1THGA 2ORYA 4QDXA 1K63A 5FOQA 4HS9A 2ZVDA 2AJDA 4BAGA 2AXEA 4DNPA 1CUIA 5FPPA 4BATA 2H7CA 1XKLA 1IZ7A 1LBSA 1QFMA 1LPBB 2XQIA 2OXEA 2XUHA 5ALPA 4B6GA 1OILA 3E0XA 3R40A 3QPCA 3R3XA 4HRYA 1GPNA 3FOBA 3N2ZB 5T4BA 1XRLA 4X97A 2HA0A 1H23A 3I2GA 2HM7A 1E8DA 5ALOA 4KRXA 2CBGA 5JD6A 2H7YA 4DMKA 4OB6A 4HRXA 3C87A 2GZSA 1W6RA 4WJLA 5ALYA 5EIAA 2JIDA 2XMRA 1LPOA 1DWOA 3WYNA 3WWEA 3WWOA 2C7BA 3A2MA 1TRHA 2HA7A 4PW0A 4ZI5A 1FFBA 1UWCA 3QPAA 2JBWA 2ZYIA 4FLFA 3H2JA 3H2KA 3W9UA 4ZRDA 1CLEA 3O4JA 1BU8A 4FHZA 3AILA 3AIKA 4H7JA 5ESRA 2Y6UA 3WI7A 5EHNA 1XZLA 1PJAA 5LZ9A 3I2JA 3H18A 1QIKA 1IUPA 5T4FA 3OG9A 2DHEA 3ZLVA 1MPXA 3C8DA 4JH0A 4HZGA 5ALHA 3PDCA 4UHFA 2XE4A 3DCNA 1IMJA 5ALZA 1N5RA 4Y2JA 2HL6A 3CN7A 2HFJA 1W1IA 3C5VA 2OCKA 2IX9A 3HXKA 3WKDA 3ZWQA 1OCEA 4LYEA 4FBLA 4WCVA 4DSAA 4Y2UA 5AI5A 3MVEA 4NS4A 3IIIA 1CQZA 4RNCA 4X6UA 2XUIA 2HA3A 5AH0A 3HJUA 2XMDA 1CPYA 5AO9A 3WL7A 2ES4A 4BAUA 1BCSA 2JGMA 5HQ3A 5AIAA 1W76A 4UBOA 2Z3ZA 4ARAA 1RP1A 2WHRA 4BVJA 4U2EA 4K6KA 4G9GA 1TKRA 3VDXA 1KU0A 2PU7A 5IH7A 4XVCA 4Q05A 4FKBA 3KSRA 4BCDA 3FYUA 3D0KA 2V98A 4S0XA 1XZMA 2C0PA 3HSSA 2BAGA 2WJ4A 3WL5A 3TRDA 1C4XA 1CUSA 1EK1A 3IA2A 5FDFA 3WMRA 3C6YA 1GXSA 1CQWA 4H7DA 4BAZA 4WY8A 3K2IA 4ZXFA 4BRSA 1W75A 3SX4A 4PNZA 3VJMA 3M81A 4ETWA 1LPPA 3QITA 1DU4A 4BZWA 1MAHA 4J0KA 4FWBA 1QIIA 1CIJA 1AKNA 1R1DA 3AZOA 1K5PA 3DS8A 2CUTA 2G63A 4F0JA 4Z49A 2ZYHA 3H1AA 1MX9A 1QO9A 4X95A 1I6WA 4L3WA 3EQ9A 3ANTA 4PSCA 2WIJA 1G4HA 3OC0A 4GW3A 3H17A 2OCGA 5DYWA 4DMFA 4L9AA 3WKAA 3FNBA 2JGJA 4W1QA 5HZGA 1G5FA 3SWWA 1H2YA 4I4CA 1CUXA 5HKAA 1Z68A 1F0PA 2DQZA 3R3WA 5CRIA 1GQSA 4WFKA 2JGEA 3RM3A 3WWPA 2XI4A 3KOOA 2AJ8A 3WA6A 3IVMA 2WSLA 2WUFA 1A8SA 5AOAA 3D2AA 4OYLA 2WFMA 4Y2RA 1QONA 4AO6A 2XUKA 3I6MA 1K4YA 4PSUA 1QFSA 1U4NA 4B7ZA 2DCMA 2GYUA 5JADA 5ALLA 1MJ5A 5AP9A 3S8YA 2WTMA 5IKXA 3R41A 5A62A 4KEAA 1DWQA 4DNFA 4YX9A 3RARA 2PUJA 4WDQA 1JJIA 1WPXA 2H7XA 4CG1A 3QMMA 1QTIA 1E5TA 4G1FA 2XUOA 4EA6A 5JALA 3ZLUA 5JAPA 4DIUA 2XQKA 1DX4A 2PBLA 3AINA 3QMWA 4K6HA 5AI8A 1NU8A 4QE3A 1GPKA 2HIHA 1AX9A 5KBYA 1ISPA 2ZJ7A 4H35A 4H0CA 1XZIA 2QJRA 5ALIA 1XZGA 3Q8WA 4QDUA 3W9BA 2O2GA 1CUYA 1FSSA 3CXUA 2XUFA 4DMCA 2GBGA 4ROTA 3DOIA 3FBWA 5LZ5A 1E8NA 4WFIA 4C87A 1FFAA 4UFNA 4LIPD 4UUQA 1R3DA 1GPLA 4JYMA 2OGSA 4X3CA 3IUQA 1LGYA 1XLUA 1KU6A 4N8SA 4G8CA 5ALRA 1BEEA 3WKCA 4OB8A 3ZLTA 4QNNA 5C7YA 3D2BA 3KWJA 3PF8A 5K3DA 1TCCA 2ZJFA 1MO2A 3BDIA 1ODTC 2HU8A 4RGYA 4OU4A 3YASA 4JYPA 1CUGA 3WK5A 1VA5A 5FRDA 3QYJA 3ICWA 5EHZA 1PV1A 1P0QA 4AO8A 4BTVA 5AIBA 2PSFA 1YA4A 5BV7A 5AI0A 5FXMA 5DNUA 3FLEA 4G5XA 1OXMA 4FDMA 1XZEA 3VVLA 1ZIYA 5CT5A 1IUOA 2XQFA 4Q3KA 4W1PA 2VT7A 4B85A 2XUPA 3NOXA 4W1RA 1GKLA 5HCUA 2WKWA 1LPNA 1VE6A 2VJCA 3G9UA 1GZ7A 3G02A 1DT3A 2XMSA 5CXUA 4X7BA 3GROA 3KD2A 5EHQA 4N5IX 5JARA 2CKMA 2YYSA 2AJCA 3P2MA 1QE3A 1JU4A 4J0DA 3G7NA 1BRTA 3F97A 5AICA 4QDOA 4H7IA 3RKSA 4UPDA 5T4EA 2XMZA 3NWOA 4X71A 2HA6A 3FVTA 1G42A 3C43A 4NMWA 5C8VA 1CUUA 2WM2A 5ALGA 2WLSA 4XWGA 1JMYA 3ESCA 3WKEA 3JW8A 5ALFA 5HK9A 4FLMA 4KE7A 1QIDA 4Y2VA 2I78A 4C4ZA 4QDZA 4V2IA 1F6WA 4MYSA 1PFQA 1QO7A 4YK7A 1E66A 2XLBA 3UUFA 1QIFA 5ALMA 4DLNA 2XQJA 1M33A 3FWHA 2Z5GA 1W4LA 4U2BA 3V1MA 4FNGA 2ECFA 3AZPA 2BUBA 4RE6A 4CIAA 3JYHA 1LNSA 5A7FA 2I03A 3PFCA 2ZYSA 2RIPA 1R4ZA 1P0PA 2Q0XA 3O95A 1XROA 3MGAA 2WTNA 5DYTA 2BCEA 2V97A 3PF9A 1UOOA 1VA4A 3AIMA 1ODSA 5ALSA 1L7AA 3AFIA 4Q82A 1W52X 4C4YA 4PO3X 4NZZA 5K3BA 4L72A 3W05A 3BIWA 5CH3A 5DLPA 1DINA 5AOBA 1CUAA 3DNMA 4FNMA 5HK8A 1WB5A 1NU6A 5FKJA 4DMHA 4C01A 3MUOA 1H2XA 4EY4A 4J7AA 4UHCA 1XQWA 2RHWA 3PICA 5A7HA 5FV4A 1UXOA 3FCYA 5CT4A 4BBZA 4KACA 3O9MA 1QOZA 1XLWA 3FYTA 2WIKA 2O7VA 4GECA 4LXIA 2QZPA 4ZV9A 2GBFA 4OUKX 5ALXA 1LLFA 4MEAA 2PSEA 3B3QA 3M3DA 1WCYA 1XZHA 2JGKA 1XZJA 1AURA 3WWDA 5SYNA 1YASA 5C8ZA 1UT6A 4YASA 3F9CA 1C7IA 5LLSA 5EIHA 1MNQA 4OU5A 1BN7A 2OGZA 5CT6A 5AI9A 2V9ZA 1UK8A 4D9JA 3IBTA 5DWDA 1VZ3A 4TGLA 4W1SA 5ALJA 3F98A 3MUNA 2B4KA 5AI4A 5ALDA 4Q1VA 4M0FA 4DNQA 3ESBA 3WIBA 3WIOA 4AQDA 4YPVA 4HXEB 1X2EA 4A23A 3D5EA 2XDWA 4ZREA 4FFWA 3VKFA 3IUMA 3VJLA 4MQMA 1A8QA 1XZFA 2PU5A 1RYYA 1WHTA 5JAHA 1BE0A 2PVSA 2DSNA 2HFKA 3AZQA 4G4IA 4CIBA 3E4DA 4DGQA 4X93A 2RONA 1RWQA 5HF6A 4P9NA 1VXRA 1XZAA 3WZMA 3ESAA 3M83A 5JZ9A 3F96A 2E3JA 2HA5A 1DQZA 1CVLA 3DYVA 3HC7A 2BFNA 4UHBA 3PUHA 4ZV7A 4AZ3A 4HXGA 1XZBA 2FUKA 2CZQA 3HYSA 4EB0A 2GBCA 2Y2VA 5J3JA 3VJKA 3FAKA 4N8DA 1UFOA 5K3AA 3H19A 4EY8A 5HKBA 4U2GA 4J0GA 2VAVA 1HLGA 3DKKA 4HVTA 4B83A 2GZRA 1EDBA 4QDTA 5IVHA 2QUBA 5AKJA 3STYA 2WIFA 1HPLA 3ESDA 4MQLA 4BDTA 4LXGA 4BP8A 4GBGA 5K3CA 3D59A 1CRLA 3Q0TA 5JATA 3EQ7A 2WUEA 1Y7HA 5AKLA 2FJ0A 3O4HA 5A71A 2B9VA 3DYIA 3B12A 3D4LA 4DTCA 1GKKA 4OCZA 1VLQA 3I2IA 4K5QA 1ZI8A 5EGNA 3OM8A 1EA5A 1XZKA 5LZ7A 3B5EA 1B6GA 1XFDA 2HA2A 4DM7A 1XZCA 4XX1A 5DNWA 1XRRA 4H18A 3CCCA 4J0IA 2ZSIA 5EHXA 4HXFB 4GWLA 4E15A 4QLAA 3LLCA 2QR5A 1FFEA 5T4HA 3H0CA 4IH4A 2QJWA 1DX6A 4M0EA 1YS1X 4Y2XA 4CFSA 1YCDA 2PSDA 3I2KA 4EY6A 5JZSA 5ALUA 1LPAB 1WOMA 4U2FA 2J3QA 2HU7A 2YASA 4B84A 3AUKA 4PQEA 4BCBA 1ORVA 5AM2A 2WFLA 5BWBA 3DL7A 1XQYA 1O6FA 3QH4A 2ONCA 2WFZA 5K3FB 2AJBA 3WQHA 1JKMA 4JNCA 2OPHA 5CT9A 4GLBA 3GZJA 4B81A 1YAJA 1H2WA 5BOVA 1XRPA 3I28A 4PF1A 3V9AA 1EB9A 2RGUA 1T4MA 5AK4A 3RLIA 1YSCA 4XIIA 3LIPA 2VT6A 3FLAA 3I2FA 2WHPB 4P08A 2W6CX 3VVMA 3A2NA 1EVQA 4GI1A 2OCLA 5JASA 1QJ4A 1G66A 3O9VA 2NW6A 2JEYA 3WKBA 4BYMA 5KWJA 5FUMA 5LIPA 3SK0A 1YA8A 2AJLI 1DQYA 3I6YA 3QBJA 1YB6A 2WHQA 4C89A 1J1IA 3UMJA 5AOCA 3V1KA 4QLOA 4X00A 1LPSA 1YAHA 1CUCA 3PUIA 4BRZA 3WA7A 5K3FA 2YXPX 1ODCA 4HTAA 3WJ1A 3BIXA 1K8QA 3IULA 1WB4A 2J3DA 5ALNA 3O4GA 3D3NA 1MAAA 3GELA 4GEGA 1ZOIA 5AKEA 4UBNA 2OG1A 1GGVA 1YS2X 3TEJA 1A88A 4E11A 4X91A 2I3DA 3E1GA 2Y1KA 4CCYB 4CG2A 4B0PA 5JIBA 1EI9A 3R3VA 4FLEA 1CUFA 3ZPXA 4KJXA 4H77A 5AK5A 1BCRA 2CJPA 5JAUA 2H9YA 2JEZA 2VJDA 3AJAA 5AM1A 2ACEA 1ACJA 1SC9A 5YASA 2OCIA 1CEXA 2QTBA 1UZAA 4X6XA 4G8BA 1XRMA 1L7RA 3F8SA 5EIEA 1E8MA 5IVIA 1U8EA 3LIIA 1XQVA 4B80A 4BC0A 4G8DA 3DKRA 1TQHA 5CBKA 3EBLA 1JMKC 4BVLA 2XUGA 4BCCA 1ZICA 3OOSA 5I7UA 2WJ3A 3H2IA 1VOTA 1JFRA 1VKHA 2EEPA 2Z3WA 5E2IA 4DNOA 1EHYA 3WLAA 3A2LA 4F21A 2PPLA 4FTWA 2XMCA 4H7FA 4I3FA 3EIOA 4N5HX 5CMLA 5EI5A 3HI4A 3T52A 2QMQA 1VJ5A 4GHWA 3ZV7A 4LHEA 1UOQA 1ZD3A 2QXTA 5KWIA 1HQDA 5CTAA 1AMNA 2V96A 3FSGD 2R11A 3DD5A 1CUBA 3G8YA 2WQZA 4BE9A 4FFVA 4AX4A 2WUDA 5JAOA 4E46A 3G9XA 1KEZA 4RPCA 2PSHA 1Q83A 4U2DA 3G0CA 5DTIA 3AIOA 3C5WP 5F4ZA 3STXA 4Y7DA 1FFCA 3LS2A 1AQLA 1D07A 1SCIA 1EX9A 2CB9A 1WHSA 1QGED 1N5MA 4X6YA 2QVBA 2VEOA 5FP0A 2XLCA 4IQ4A 3BXPA 2IITA 4INZA 3TGLA 4GDMA 4Q34A 4J0CA 3WK9A 3G9ZA 7YASA 3BE8A 3VXKA 4AN0A 2QOEA 4E14A 1T2NA 3IUJA 3KWFA 2D0DA 1ZD4A 2JGIA 4WDRA 5C8XA 5I8PA 4Q3LA 1BS9A 2HDWA 1XRQA 3I1YA 1FJ2A 1IVYA 3CN9A 4A16A 3PE6A 2OGTA 1MT3A 5AJHA 1MNAA 5HF8A 5LZ4A 5AM0A 3WK4A 4J03A 1O6GA 1WB6A 4MWSA 3QM1A 1Q84A 5LKAA 2G5PA 3LCRA 5BWCA 1XQXA 4KE8A 2PSJA 5CURA 2XMBA 4CI9A 3DOHA 2XT0A 3STTA 3H2GA 2H1IA 3R3UA 5D6OA 1EH5A 2WU3A 2GBIA 2JF0A 1X2BA 2QKYA 4J0JA 4B0OA 1CUZA 1HBJA 4BTLA 4M0MA 5E4YA 2WIGA 1HL7A 4OPMA 1ZD5A 2JGLA 1A7UA 4K2AA 3G0BA 3OTQA 1R50A 1TIBA 2WG2A 1SCKA 4F5ZA 3C6XA 2VJAA 1MX5A 4J0HA 2B61A 2P8SA 2LIPA 5CT8A 1YB7A 3GUUA 4P93A 3STVA 5D3KA 2XUQA 4EY5A 2VAXA 1QIJA 4ARBA 2XB6A 3QPDA 1EDEA 4CCYA 4ZGBA 5D3ZA 3L1HA 3I6ZA 1CUVA 2QUAA 4B9EA 4Y2SA 3K6KA 4AMYA 1EINA 1XRNA 1DWPA 1CUWA 2UZ0A 5ALTA 4FBMA 4BVKA 4BE4A 3G0GA 2RI6A 4J3JA 3HEAA 1TK3A 2BGRA 2QRUA 4EBBA 5AHXA 2J4FA 4FMPA 1UK9A 4UHEA 3ANSA 5D7BA 1XKTA 2Z8ZA 1SOMA 2G4LA 2ROQA 3R3YA 4QZVA 2WUGA 2HRQA 4G9EA 1ZIXA 3DL4A 4QWWA 4X90A 1TCBA 1AUOA 3STWA 1TCAA 3CCBA 5ALWA 1N1MA 5ISMA 1EVEA 1QIHA 1WM1A 5CXXA 2ZYRA 5AK6A 3I2HA 3FYUC 2HU5A 2HHAA 3BF7A 2GYWA 1MX1A 2FJPA 4PSDA 2C5FA 5ALVA 4LYDA 4BC1A 4Q3OA 3NGMA 4UBMA 3C6BA 2Y2UA 1P0IA 4JUIA 2X5XA 3WL8A 2XMQA 1EXWA 4UFPA 2B20A 3HZOA 4Y2TA 1JT2A 1HDEA 2X76A 4UBJA 4BB0A 1THTA 4OB7A 1XLVA 4KRYA 2W22A 1SCQA 1S8OA 2ZSHA 2WJ6A 3WK7A 5LZ8A 6YASA 5DNVA 4MEBA 5JYCA 3G0DA 2VQ6A 5ALKA 5IVDA 1ZJ5A 2DFPA 2WIDA 3BWXA 5CH5A 3WWCA 1U65A 2RHTA 3FSGA 5AKYA 5CH8A 1IUNA 5AKXA 3RK4A 1CV2A 3V48A 2VA9A 1ORWA 1ZI6A 3O0DA 2C58A 4G4JA 1SFRA 2CEKA 1AGYA 2DHDA 3L1JA 4G4GA 3WYDA 4AZ0A 1HKHA 2BUCA 3WK8A 5AKIA 4LXHA 1BN6A 2C4HA 4KAAA 1CFJA 1YR2A 5ALEA 3DDUA 3W06A 1EB8A 4UBIA 1WPRA 4X94A 1R9MA 1C7JA 4X85A 4X92A 5H3HA 1UKAA 1UKCA 4H7HA 4EUSA 4U2CA 4UHHA 1ZI9A 3W04A 4KYVA 3DQZA 4Y2YA 1MTZA 4L0CA 5AM3A 4GXNA 4H7KA 1IZ8A 3M82A 2VATA 1LZLA 4HAIA 2O7RA 4WY5A 1X70A 3WK6A 3BJRA 2VJBA 4QA9A 1JJFA 3H04A 1VXOA 5AKGA 5AM5A 4AB1A 3S2ZA 1NX9A 3IB3A 3X3HA 3G9TA 2Y6VA 3I1IA 4BZZA 3STUA 1ZJ4A 5DTJA 2QXUA 3V1LA 5K5EA 4H7EA 4KAJA 1R88A 2XUAA 2BGNA 3VISA 3U0VA 3C45A 5FLKA 5A2GA 1QIMA 4Y2PA 1JI3A 4BDSA 3EQ8A 4Y9SA 2XQGA 2DHCA 1J06A 1P0MA 2WG1A 1J07A 4C88A 1ZD2P 4C4XA 1MN6A 1DT5A 4AN1A 3DEAA 1VE7A 4N8EA 4CG3A 2WILA 3U1TA 1USWA 2ZJ6A 4WFJA 1XZDA 2WFLB 2HRRA 2O2IA 3DLTA 4P92A 4KAFA 5AI6A
chains in the Genus database with same CATH superfamily
1MRSA 5KTRA 2RGXA 1DAKA 5FH9A 5IDVA 4L5JA 1M6VA 2D5LA 1HKUA 4MJ3A 4V0SA 1HFKA 3OPMA 4KE6A 1CZKA 3HLKA 4ZU1X 3R7AA 4F60A 3R5XA 4IO0A 4X62B 1RAHA 5F9MA 3TK1A 2EU8A 2IIVA 4Z1MD 2YVLA 2IS4A 2CMFA 3LWZA 1ND6A 1O5IA 3A4MA 3VR6D 1EP3B 1U9ZA 4C6HA 3OQMA 3VSDA 2QNRA 4D8YA 4EY7A 4IIJA 4AJ4A 4K8OA 3THYA 2ZRIA 4OFZA 1X1DA 2DUUA 3SC2A 2XCTB 4KQJA 3JQGA 3V80A 4I50A 4AO7A 2R6AA 3PFHA 1E2JA 3QI7A 1H93A 3NTOA 4S1VA 5D8DA 4YPFA 1E92A 5HRUA 2HV8A 3HRHA 2YINC 1YRAA 3NDBB 3KE9A 2NZVG 4XYMA 1VSTA 4UFOA 5AHOA 4OBWA 2JIPA 1V3VA 4FDLA 4RHYA 4PPQA 2AL7A 3W6UA 3WL6A 3TX6A 2PX6A 3ZH9B 3FF1A 2J3HA 4BGVA 1ZM4A 2VUSA 1CR6A 3KAJA 4RIIA 3G2PA 1CB7A 3FXAA 3JQGB 3I9NA 2W43A 1MJGA 4M9CA 1EUCA 3GHHA 3GT3A 4RQUA 3LRTA 1R18A 2BKLA 2G08A 2FI1A 1CY7A 4CPDA 4KSCA 4H17A 4QTUB 2I3ZA 2JAPA 1AV6A 3QKSB 1NP7A 2X8BA 2JK0A 2PM8A 4K6GA 4PYLA 3TLJA 5HQ3B 2BFOA 2H4HA 3ENWA 3IDAA 3HKEA 4WADA 3JYQA 4FEYA 4MHSA 3PLAE 2QPAA 3FFTA 3FKJA 3HP1A 4PGMA 4TV8A 8AT1A 5KWSA 4MS1A 2DZDA 1WVMA 1H22A 1UINA 4UBLA 4ENRA 3PTZA 4CMIB 1P8JA 3DONA 3QRWA 2BN4A 3Q2IA 4AJIA 1E99A 3K6SA 4A15A 3PQ6A 5HRAA 5FOTA 1FYVA 1VZ2A 4XR4A 4XPIA 5EFZA 2VTBB 3WLTA 4AMVA 1E6UA 2VF2A 2BI8A 2VHVA 3PV0A 4PBRA 4EJFA 5HCNA 4P58A 4LRXA 1AIPA 1BROA 1Z5OA 4JGGA 5KOHA 2YS6A 4HPJB 4FKZA 3AP2A 5AYVA 2HADA 1IULA 1MQSA 2W2XA 2ZIEA 5IKOA 1P72A 5DZSA 1PNRA 2G8LA 1BEZA 4JLMA 2H8KA 4AU1A 1X9IA 2C0QA 3BA6A 1XEFA 3EW9A 3OLWA 3KEQA 5HFNA 1KFBB 2AFIE 3IUSA 4BX8A 5LJIA 3JSXA 3QEBZ 3ZJVA 5HJEA 4TYNA 1N5JA 2AK3A 3FJYA 4PWYA 521PA 5HFAA 2GYVA 1J49A 3OY2A 4CW7A 4XX0B 3ZCVA 1G41A 1L4GA 2Z0MA 1KVRA 3PNBA 3WHPA 4BNHA 1ABFA 1AUPA 1SOUA 1V35A 1VCMA 1LI7A 2GEKA 2ZRMA 4KQ9A 5KWEA 4W9NA 4PX5A 4LXQA 3BF8A 3IKJA 2GAFA 5HS6A 1ARZA 1HOTA 2C84A 2G07A 4O3MA 1ECPA 4M36A 4YJ3F 5ADVA 3U5ZB 1SKYE 2BC9A 2QDXA 1WAMA 3J81k 4CODB 2K87A 4D3DA 1FUIA 1VSBA 2WT4A 3IR7A 4OHKA 3GFFA 5LBTA 4CKEA 4KXUA 3LQ2A 3NJRA 3OPYI 1M0EA 1NONA 4A5SA 2PWYA 2R751 4XUCA 5T3YA 1Q1QA 1T6BY 1D6NA 4PX2A 5D5QA 3K8YA 1VHLA 2VRNA 2DJIA 2NSLA 3HACA 1Z25A 5E2BA 2P9FA 4AXBA 3C70A 5KYUB 1GGKA 4KPEC 5IJ0A 4XWYA 1BX0A 4FEEA 4GU5A 2FW0A 2XX3A 3MWJA 4DYHA 3BE6A 4H4DA 2BMJA 1JEDA 3I04A 2OTCA 5FPQA 3RREA 1TYCA 4EEKA 8OHMA 4BMZA 5L6MB 1H5NA 3FLBA 4PNEA 5C81A 3P1JA 3HYTA 1DIBA 2DQ4A 2L42A 3A6DA 3LA6A 4JUDX 4Q18A 3VR4A 3OZAA 1QCCA 4FOLA 1DBVO 2GM5A 5F98A 3M5CA 2GNAA 1P1RA 5HF9A 3QFFA 1YB4A 4JJ7A 3QOXA 4Y2QA 3RYFA 5IEJA 2WK1A 1EUDA 5DYYA 1L3IA 3TUZC 4O4HA 3LXRA 1M8GA 3Q11A 1XJWA 3F1LA 4BPBA 1U90A 2XXAB 1AHHA 2XSZD 2H57A 1NVKA 1SZJG 3WB0A 2FPMA 1V47A 4EATA 2FPRA 4QXOA 2IOYA 1OAOC 1Q0PA 4KE9A 1RTTA 2CE2X 4IVQA 4E03A 2I2DA 5I9IA 2H1WA 2E9SA 2IHUA 3JAWA 1TF5A 1M6YA 3OZDA 1SBHA 1ZQ9A 2WVGA 3PC3A 3DFIA 4IDPA 2R6FA 3DUFA 2UKDA 2RAPA 1N78A 1DTEA 5CW2A 2C5LA 1JHUA 5LYJF 4XSGA 5JYEA 1C4OA 4QM6A 1P19A 4I9NA 3RVJA 3WYCA 4BNMA 2C31A 5CG2A 3KZCA 6Q21A 1S1CA 1VC2A 1MIHA 4IHJB 2FMTA 1DI0A 2Y27A 3LUHA 1NAHA 2ZQYA 2A14A 1HE8B 2B0CA 2IHTA 4HYYA 1YONA 2XNJA 1L1FA 1DAGA 3RUEA 5KX5B 2HHCA 2R0QC 1E62A 4D5EA 3DMPA 3ILVA 3SM3A 1A5ZA 1GGEA 1WXGA 2V7QD 2SKDA 2GI4A 3CA8A 3EY4A 3KQQA 3QWAA 3BK1A 3R76A 5A4MS 5FOSA 3H4MA 1GJRA 1NP3A 3PBKA 1XMVA 3KUCA 4JASB 4ZYUA 3ZS9A 3AR8A 3U3RA 2ZJAA 4OQLA 4YP7A 2IW1A 2HA4A 3BB3A 2BKXA 1JDTA 3GRPA 1M6HA 3IBFA 2QGZA 3F1KA 4HNQA 4ZU6X 4BO8A 1WD5A 3RFUA 3NUZA 4NJMB 1KI9A 3AB8A 4PX3A 2H4ZA 4HFJA 4CMCA 2A35A 3E9MA 4I8DA 3QLVA 2XVZA 3KYDA 3PRHA 3ZNPA 1U5AA 4OHCA 4B74A 2VQFB 2IZ6A 3FOAA 1OWMA 4H1TA 1MR3F 2WHPA 3P0EA 1QYIA 4WXEA 1E1CB 1P9RA 4AYTA 2PUBA 4KYTA 4UM7A 4II2A 4W5TA 1QIEA 1FSZA 3M6UA 3MTBA 3OZBA 2DKOA 3GGOA 4JQZA 2WU4A 1VGVA 3FWNA 5DDIP 2H4XA 4WUTA 4I4TA 2VJMB 4CMIA 4LKOA 1NQVA 3QXHA 3ZEIA 4AD8A 1G2OA 1C7FA 1M7HA 4LBZA 5HS4A 3HJFA 3QFCA 4S0ZA 3GNTA 3OICA 3T4UA 2NYAA 1TFRA 2JFVA 2X3UA 4DA8A 2Y4OA 1WU7A 3OZCA 2JLCA 4RY9A 4G0VA 2PQ0A 1POXA 1XL0A 2K2QB 3ED1A 2HXGA 3E7PA 3WGZA 5C5IA 3EDYA 4RVNA 2VDLB 4UUNA 1RWNA 2DFLA 1K86A 1F2TB 3WAJA 2P40A 2W6NA 3A6PC 3H3JA 3LUJA 3SDSA 1EP2B 2PZMA 1LPMA 4MVJI 5KREA 1T29A 1JLLB 1TECE 2IYUA 3LNCA 4RGVA 2ORIA 4WAUA 4CM1A 3AP1A 2UXBB 4XFDA 1T0JB 1PZHA 2RHJA 2VT2A 3DTNA 3IP1A 3RRZA 3SE0A 4LC0A 5A5DA 1R8JA 3NBYC 4V0ME 5FPYA 5GJCA 4RO0A 4PV7A 4R1SA 3G5MA 5EYPB 4L9RA 5JY6A 5KDDA 1G8PA 4KK4A 2HWXA 4O2BF 1GRRA 1N7IA 5LZ2A 5SZJA 2MSDB 5A4IS 1JHZA 2ZVPX 4FYYA 1EFRA 3EEOA 1INLA 1M10A 4EHBA 1W5SA 3R0JA 4O29A 2A0UA 2PL5A 1Y8QB 3I01M 1KJQA 2I7DA 4WNAB 2ZT5A 1KSGA 2NO4A 5JZOA 3TYXA 3HWWA 1L5RA 2DCUA 2YXBA 2P68A 4LE1A 1C1DB 1CVIA 5FAKA 2CL5A 1R0BA 2WV9A 3EG5A 3M3PA 3NATA 2BEVB 4UEOA 4JL6A 2N1BA 3HFJA 4LQCA 1C0EA 2QN9A 5AUNB 3LKDA 4M37A 2O1EA 1XTZA 1CUIA 1E61A 2IUTA 1CQJB 3SKVA 2D1FA 4DJEC 1NW4A 4B7CA 4BATA 5GZ1A 1TXGA 4HWRA 2C2GA 2I1LA 2M6LA 4E3ZA 2H7CA 3EX7C 4NJMA 4MDFA 2F3SA 3F3KA 1MQAA 1XKLA 4U7GA 3GGSA 5A3VA 2POCA 1QDEA 1NXPA 2XQIA 4FXOA 2OXEA 2ZULA 4JLKA 2WJVA 5EIWA 1CT9A 1P4SA 2JW5A 5JVDB 1A2BA 1EP9A 3KJEA 4FCCA 2QTZA 2RHCA 3E0XA 4J0EA 4OFWA 1YZVA 1NRWA 4KTTE 4ZGGA 2BFBA 1W8IA 2OFOA 2W48A 4HATA 1H65A 3I4LA 4BEWA 1XTKA 2QMYA 3FOBA 4C30A 4YJGA 5AVXA 1FW8A 4RTKA 3OX2A 4NCBA 4RPHA 5JE8A 4JN6B 1TM4E 3SSMA 4LOAA 3TI9A 3HWSA 1RJWA 1BGVA 2PMKA 5M29A 4X97A 1A9ZA 3C39A 5IZCC 1NOJA 3JZDA 3GAZA 1OXUA 3I2GA 4J16C 2HM7A 1LBIA 3BFKA 3RYIA 4C0HA 3USCS 2JLZA 3BGVA 1NUUA 4D9FA 4L8LA 4KRXA 3W7AA 4HN9A 3UGKA 1FNMA 5JD6A 2JARA 5HQJA 1XNHA 3DP9A 2H7YA 1U31A 2C8JA 5FI5A 3WFJA 4DYVA 5IUJC 1QDUA 1W6RA 4WJLA 5DF1A 4B4KA 1JHXA 4EUHA 1WUHS 2IHJA 5IFLA 3R77A 3TR0A 4V1CB 7MHTA 3K96A 1KE1A 3CV3A 4TLLB 1JAXA 2RDMA 1U0RA 3RKUA 3VR4D 3ZXXA 4F6CA 2IK8A 1V8PA 4RK1A 3L7AA 2J9FA 1VRVA 1IRIA 1G7TA 1QX3A 2AFHB 2C0CA 2WTBA 3PSHA 4JLVA 5F1KA 4EF5A 1T2AA 4LF7B 4I9HA 3QE0A 3U4HA 3SXJA 4CU2A 3BHIA 3WGHA 1F17A 1FFBA 1OFTA 3IT0A 2CLIB 3BT7A 4XVUA 3D1LA 1VKJA 4DIBA 1ZJYA 1IJEA 3SS8A 3CPHA 2V7QA 1CR2A 2XZLA 4QDJA 1LX7A 5AJUA 1TIPA 4EB6B 3PS9A 5KB3A 1UJ6A 4TSRA 3HSYA 1RQXA 1YOVB 5ADUS 2JFBA 3OZRA 4XQGA 1Z73A 2JLYA 1T9KA 2UZAA 2FETA 2P69A 3QKIA 5KTNA 4TTVA 1Y4SA 2IYLD 2YOFA 3ZZNA 4R71A 5C8YB 1XZLA 1JLHA 3W5CA 4DIMA 3GRRA 2QNBA 4E5UA 2H92A 5BMOA 3TE7A 3I2JA 3CUYA 3GT4A 4PLZA 2DMRA 2FPOA 3BUSA 4RZSA 1IWOA 1TM5E 4V1CI 5JZMA 4KH1A 5KKCA 5LJLA 1FB5A 3DVAA 1WULS 2JJMA 2AA3A 4M7PA 3NDRA 1KI7A 1G17A 3HFGA 1T4CB 2OC9A 4JH0A 4WA7A 1L5KA 1ADJA 1VSQA 2RBKA 3KYIB 3OWOA 2NO5A 3PUZA 2QLFA 1TFUA 3D6UA 3WXBA 4N0MA 3L0OA 1PVOA 2ZE7A 3E9YA 2XE4A 2GN2A 1IHDA 1FRZA 1ESZA 1SJ9A 3FPSA 1N5RA 4ZD6A 3RF6A 1RM0A 3ZK7A 1X7WA 2HFJA 2A0YA 1ILEA 5HQTA 3C5VA 1DV1A 3OQVA 2EWWA 3SBXA 2P4EA 4IMRA 3O3OB 3ZWQA 3HBLA 3MFYA 3ZCUA 1K1EA 3EFOB 3RB8A 3OZTA 3ZHXA 4EX7A 3LT4A 4YROA 4FBLA 1P6XA 2HMUA 3B78A 4QC2A 2J0VA 1TVKA 5GM2A 4E2XA 4BXOB 3TAXA 3H83A 1COWD 2VNAA 4LN1A 1OMOA 4Y2GA 2ZYVX 4X6UA 1GHTA 4TL9A 1BD3A 1N2XA 1L5MA 2Q7OE 1PVDA 2DR3A 2F00A 2FZGA 3UJBA 3VOTA 1MGOA 3HJUA 1ZONA 1ORHA 1IAVA 3WL7A 2ES4A 3SHQA 4B45A 2Q1YA 2HNKA 3IV9A 3PD0A 1U28C 4GRDA 4JJAA 5FWYA 5HQ3A 1Y81A 3MN1A 1G5IA 3C74A 4PZ9A 5AIAA 3VZPA 4HRAA 4US1R 3IQZA 1X92A 1DKQA 4NFHA 4Z7QB 5CFZA 2VJKA 4H3HB 2VP0A 4ARAA 5IC6A 4ENQA 5M3BA 3U2QA 4BVJA 5CCEA 4B31A 3T5GA 1UR5A 2LE0A 4LWQA 1KDZA 1P3DA 3PHGA 2YRWA 3HB9A 3NNNA 3PLNA 4O2BA 5CM8B 5EJIA 4D8TA 4PANA 4Q21A 5IZCA 2NAPA 4G9GA 1V2HE 1TA0A 3VDXA 1U0TA 3EOAI 3C24A 4RVDA 1OTYA 3B85A 3GUVA 3W5SA 4CF6A 2NTYC 1KU0A 5C7IO 1SXGA 3DA8A 4R8MA 4PTYA 2Z5VA 1J33A 3EVAA 4FW8A 1U98A 5IH7A 5EIBD 3V7UA 2OBBA 2QTGA 5HX7A 3V7WA 5KOJA 3EAQA 4TXHA 1D5WA 4TMTA 3PPWA 4U2KA 5L3QA 3V8NA 4NHOA 3UJAA 1IPHA 3NZEA 1V45E 2LPMA 3PEEA 2LXNA 3ZJ5A 3SC2B 2CWWA 3O2SB 1XZMA 1P2DA 3V8QA 3W4KA 2ZM6B 3P0RA 4R6XA 3IL2A 3F6PA 3HM9A 4CMHA 4K6OA 4J90A 1WEHA 2PQMA 3AEZA 1U4SA 4ZEXA 1CUSA 1EK1A 1YDWA 3O90A 3O8DA 4M0UA 1QP4A 2B0JA 4R01A 1GXSA 2H8GA 5AW7A 2Q5OA 4H7DA 1JP7A 1U2GA 4RSHA 5LQDA 2N47A 4UUMA 3CR3C 3QLEA 1O5TA 4TL7A 2P79A 3HBAA 4UD2A 3KZOA 1N0HA 2BD0A 1GCAA 4V0RA 2QP4A 2XADA 2HWYA 3C7KA 4Z6KA 3FM9A 5JI3E 1GUBA 1GXSB 1RZ3A 2FR8A 1LPPA 2EKQA 4JSTA 4ETWA 2HHJA 3HCOA 4JLOA 1HX7A 1W0JD 3MIZA 1MAHA 1JNYA 5DKFA 2W6JA 2J4DA 1XQ6A 2P2CA 4J0KA 4AX8A 4V24A 4KXQA 4Q4CA 2VL7A 5ER6A 5K20A 1KTVA 2BTQB 3LYUA 5IUKC 2JPDA 1Q20A 2RH5A 3AZOA 3AI1A 3DD1A 4WVFA 2WYOA 3R9IA 4YUZA 3RYHA 3OCJA 4NZOA 1USUA 1YXMA 1MDBA 3BMOA 3Q1LA 4NATA 1MA3A 2JEOA 3D7MA 4PEVA 3AI2A 1KZ1A 3PHHA 3AVXA 2J46A 1UMCA 1EWKA 3GBPA 5DPMA 2OZEA 2ZE8A 1RWOA 2QTVA 3UJPA 3CVWA 2PBFA 3EQ9A 3HM2A 4H6WA 2JZOA 1NJSA 3MILA 3VH1A 1XZNA 4PSCA 3Q0EA 4OATA 1QMGA 3ADDA 3MWDA 1PNTA 2FW1A 1F6BA 1YC5A 2E4YA 2UYYA 3BXOA 1LX6A 3H17A 1A8HA 1UJNA 4PAOA 4DYDA 1G20B 2J0EA 2JS7A 2PTHA 2W00A 3ZNQA 4MJXA 1KVUA 2N46A 5JISA 1EFUA 4B7AA 1H3FA 3ZE8A 3DDSA 4LHZA 4XASA 3O84A 5H68A 4FMDB 2VPYA 2CHFA 1A76A 2BRUC 4INJA 4A6XA 4F06A 2DQSA 3UHPA 3QEMB 1EHCA 2XGMA 4H16A 1QK3A 3ADOA 3BH6A 4K9KA 5J2TF 3U3ZA 5T8KA 5HYVA 4K1LA 3ST7A 1G5FA 2X9QA 4IO1A 4Q3BA 5F7ZA 2CD9A 4A8HA 5I51A 1H2YA 2JFYA 2CMDA 2O48X 1XA4A 5HKAA 1GL6A 1ZGJA 2XA9A 3TO5A 4E33A 4LZZA 4KBYA 4Z4FA 1Y1RA 3W8EA 1O57A 2HCJB 4GSKA 1NTRA 1C9KA 1G7RA 2Z2XA 4O2AF 3RVQA 4TTTS 2ZUUA 3UOAB 1OI7A 2G1UA 2B9EA 4NECA 3ND5A 3RRFA 3WB2A 3HA7A 3T41A 3U49A 2JGRA 1BQEA 5DM4A 3M1LA 3FMPB 2QZ9A 4Y9DA 1CF2O 2ZRQA 2YHIA 4QRIA 2YX1A 3OTWA 4W82A 5A3SA 1Y1SA 3M6LA 3AUYA 2ECPA 1A8SA 4XVQA 1WSAA 1P7WA 3HDQA 2IJGX 4Y2RA 2R85A 5LOVB 3A0RB 3A10A 1AE1A 4TV8F 3KK0A 2R7MA 1QONA 5LUAA 4AO6A 1J21A 1COWA 1K4YA 2XUKA 3I6MA 4PSUA 4V0QA 3Q41A 5JCJA 2IW3A 3O92A 5CXQA 5LQKA 1REQA 4L4UA 2J45A 4M8KA 1M67A 1O94A 2XYRA 4N3GA 5KNDD 1RWKA 1PNVA 4HH1A 3GRVA 4DR6B 3DH0A 1I7QB 3LGSA 3TSAA 2PCLA 4N0EA 4G0XA 2HTEA 3WO0A 3OPQA 3NU1A 3ASYA 3BWEA 3NALA 4IQ8A 3VPGA 3LBIA 4A92A 5IKXA 4B6EA 2X40A 1WNFA 2FZLA 3MJRA 4EJ6A 2BOVA 3EARA 4LYYA 4YAGA 2RGBA 4E12A 2ZIVB 3DZ8A 4ARZA 2IEZA 3UPUA 5FL7D 5A62A 5MFZA 1J4AA 1E64A 3JQ7B 4J91A 3KZ1E 1X3LA 3R0IA 2GPAA 1DWQA 2WU8A 1A5AB 1FK8A 1Z35A 2XBUA 3LGXA 4YX9A 1YJAA 5U4QA 2V4UA 1JZQA 2IYVA 3EXHA 4KODA 4WDQA 1JJIA 1UMDA 3OJWA 4NSNA 1W35A 4CG1A 4JJEA 4WK4B 1C9YA 2AHOA 3ILHA 1PL8A 1IXKA 1T9AA 3NS7A 4JENA 5CLFA 4EA6A 2P9ZA 3R8CA 3BXEA 2DTXA 3JQ9C 5JALA 2Q6IA 3AVPA 5KHAA 2P30A 1D6MA 3M33A 4FFNA 2ZUEA 3GCZA 2XQKA 3PNLA 2FFRA 2JKVA 3CBGA 1HK7A 1E0JA 1SQFA 3JVIA 3P45A 3GYGA 3KKMA 3ZW9A 3KT0A 1DX4A 1IK4A 3NM6B 3NONA 3WB1A 1AD2A 3JASB 3GCXA 1DC3A 4G8JA 3GPDG 4QSMA 1IK6A 1TJ4A 3HR7A 1XUOA 3D6TB 4X8HA 1B23P 2RJOA 1HEIA 1DAEA 1N9KA 1BXGA 1V8ZA 2WKPA 1T6NA 2HIHA 1WSDA 3N74A 3OQPA 4MUNA 4FSXA 5I4CA 5HKKA 1VLHA 1JBKA 2H18A 1O94C 3GD7A 1QM5A 1V1RB 4B6PA 5EE1A 2I2WA 4GX2A 4JBWA 2ZJ7A 1IG3A 4H35A 3JTMA 3HLYA 3ZV4A 3OE4A 1ETUA 4DPMA 1UJCA 2INGX 3UPDA 5JCJD 5ALIA 1XZGA 4ZN6A 4QDUA 2ZCVA 3IALA 3W9BA 2O2GA 3BRWA 2CE7A 4IV5A 4HNAB 3KYBA 2LNDA 4WXPA 1S96A 2XUFA 3SGLA 5FA8A 4NARA 4URHA 2H1OA 5H8WA 4ISCA 1E4VA 3FBWA 3HGQA 5LZ5A 4JP5A 4OQZA 4UFNA 2WJYA 4H6XA 4BE7B 4LIPD 4EB8A 4UUQA 1DPGA 1VMKA 5JTTA 2IZ5A 1GPLA 3ZOZA 2AE2A 4N7JA 3KKQA 3GRYA 5EWLB 1XLUA 1WZEA 2BHLA 1H1LA 1WD7A 1LW6E 5GONA 3S1SA 5C7OO 3RTAA 3ZLTA 3P8ZA 4QT4A 3QJ5A 2PWZA 5TC4A 1AKUA 5JXIA 1C14A 3RC9A 2FMIA 1BE8A 3VNAA 3F6EX 3O4FA 1DJMA 1CRZA 3LHFA 1NSYA 2YY6A 1EFKA 3E35A 4NCKA 4DQXA 3D2BA 2PKQP 1WL8A 5K3DA 3WMFA 4AK9A 1UM8A 2PT7A 2UV8A 2G1AA 3B7GA 4J4BA 4YO8A 3OM9A 2QTAA 2FSSA 1AS3A 3BDIA 4MYRA 1J0CA 3TRJA 2ZJBA 2JLBA 2PLRA 5JH7A 2ZB3A 1P2TA 3OF5A 1ODTC 4PR0A 3R7NA 1RBYA 2HCBA 3AHJA 3GGGA 4RGYA 4D3XA 2ODEA 2BKAA 3LAWA 2GBLA 4PRLA 4W8GA 2NXEA 4UU1A 4LYAA 1I3NA 4MB2A 3ZIUA 2VWGA 4J7UA 2J5RA 4PGAA 5EUQB 4U02A 3CTMA 4RF4A 3WBKA 5AMXA 1YFZA 3ICWA 3NIDB 3X44A 1VP9A 4BTVA 2PSFA 1YA4A 2WMNB 5E9QA 1KYVA 3ICOA 4HDSB 1WUYA 1MABB 1UXHA 1U0HC 3AF6A 3ZBQA 2JHPA 3FD8A 4UMDA 5FXMA 1SCBA 2B36A 2P9YA 2ST1A 1XDDA 3L8FA 3I05A 3FLEA 4PIPA 1OXMA 4QATA 3L7BA 3UK0A 3TPFA 1NHGA 1L5HB 2H29A 5ITZA 4CKYA 4REMA 1IUOA 2WJPA 1JHRA 4Q3KA 2QRLA 4ALLA 2XB4A 1P2BA 1XHFA 2EKZA 2VT7A 3W5IA 3VGJA 1XEXB 3DC7A 1ISIA 4EECA 2ZIAA 4MCAA 2ETXA 2OZVA 5F7OA 1P4AA 3WDSA 2JAQA 4JI7B 1U0NA 3CLHA 3DB2A 3KKLA 2PGDA 2HF7A 3GLSA 1VE6A 3A1FA 1FJXA 1W5TA 3PNVA 3EC1A 3SY8A 1GZ7A 1PV2A 3ZZTA 3F47A 1ZEJA 1AGXA 4YP0A 5CXUA 4JJFA 4Q48A 1CC1S 3T06B 2VPXA 2EF0A 4PSVA 2ZYUX 4Q4JA 1YT5A 1YL7A 2NT3A 2RJ3A 5EHQA 3UHAA 3EBOA 4CEJB 5JQGB 4ZO6A 1WHTB 4DT1A 5IC5A 2HR1A 3MLAA 3PUYA 2XRMA 5D2CA 3T7IA 5EKSA 4RJJA 4OUDA 4A36A 4GM4A 4M0KA 3W3AA 3LO8A 4FD2A 3F4BA 4JOQA 3TXYA 2GR9A 3FB1A 3RUPA 4G36A 1BMFD 1J0XO 1JU4A 1PSDA 3L0PA 4G01B 2OGUA 1BRTA 2KPOA 3N53A 1H2HA 2B78A 2H5EA 5AICA 5G41A 3T0IA 4G5HA 2N75A 5CD9A 5EJAA 1E7MA 2C2WA 1Y6QA 4NS1A 4DEYA 3EIUA 4IICA 1GNPA 3WXMA 4L8YA 3O82A 5ABPA 4XB6B 1U4OA 5TDHA 1Y7PA 2GN9A 3SHTA 4X71A 3T9BA 1KJZA 4QGAA 1G42A 1KHTA 3IPLA 3P97A 4KVGA 1TO2E 2CVOA 2N42A 5D3QA 4EH1A 2WM2A 4AKEA 4EVSA 4MVJP 1C7RA 1PI3A 3NKFA 4D0NA 5AW5A 1G5PA 3U39A 2GPTA 4GRIA 3OLCX 2GCGA 3QV2A 5C4MA 2CBZA 1O3YA 2XDQB 3H8SA 1U0EA 5EXTA 2HK8A 5ALFA 5CA1A 4PYIA 1CFZA 1VL8A 1SM4A 4PBTA 4TS3A 5IJAA 1WXIA 4CF4A 4WZBA 2IH5A 2HOQA 1B0UA 5ECDA 4BKRA 2AX4A 4OI1A 2AYZA 4X8LA 4H59A 3QWFA 2QM7A 3OKCA 3RFFA 2VR1A 4D4LA 5K6RA 3RF7A 3BWYA 4EEZA 1FNDA 1RWXA 3VU9B 3WIUA 2NTEA 4FB4A 3A4NA 1IN8A 5K8VA 5IVPA 5H9VA 1QO7A 1CCWA 5FPSA 1E66A 1M1UA 2VJOA 5IJZA 1TU4A 3R9XB 1EA7A 1QIFA 4INAA 4Q3NA 4MW5A 4MPDA 1PJ3A 2JDID 4DLNA 4WGFA 1EK6A 1DTWB 1OBOA 1LLUA 1S8NA 2O0KA 2C2MA 4OGGA 4AKIA 3W6NA 1KZ9A 2COEA 2QPTA 3ACDA 4FPXA 3MJCA 1WJGA 5ERXA 1ZRHA 3ABRB 1T0PA 1J97A 4U2BA 4FNGA 1PG0A 4R51A 2WQ7A 4YRDA 2I99A 1Z2EA 1C7EA 3VPSA 1CR4A 4DOMA 5CVJA 4QO7A 1P1HA 1HG1A 1YK1A 1O6CA 1JTFA 3AO0B 3EMKA 3P9IA 4E88A 2I3GA 4ZHQB 1OFVA 5A7FA 3ZLBA 3C3BA 3PVCA 4ZTUB 5KNDH 3PFCA 2DETA 2NPOA 2ZYSA 1ZC3A 2VDMB 1KNXA 2I7TA 1R4ZA 1WMDA 3A3OA 1UDRA 1G9TA 2V7VA 4RZHA 1KBQA 3TVTA 1QP8A 4DJJA 1L7DA 1Z28A 5HUQA 4BLQA 3KKPA 1BGXT 3O95A 3ZS8A 4DMGA 4C05A 3CXRA 3M5PA 4JT2A 3VC7A 2X6RA 1T8TA 2WTNA 4P5EA 5I7FA 5HZKA 5DNDA 3W8RA 4WKNA 1OQAA 1VHWA 3OE7A 2C4VA 5JZVA 3PFKA 3UK7A 4BY9E 2O05A 4AURA 1EGHA 1ODSA 4HAWA 5ALSA 1FS4A 2YXDA 2HBYA 2IL1A 3Q7TA 5LLTA 1OXSC 3K9HA 3Q8KA 5F23A 1K6XA 4D9CA 5KVVA 2DKNA 4KO1S 2G1PA 1JHQA 1J2UA 4FJ0A 4IXWA 1KEWA 3VPAA 4C4YA 2V6IA 2Q3LA 3WE7A 2YOHA 5IT9A 4ZQEA 4N76A 3IP6A 5BSMA 2JGDA 5JWRA 5DSXA 5BSWA 2YWRA 3IAEA 3U4MA 4KDCA 4HNVA 2QLJA 3RLFA 5C3MA 5C34B 4KIGA 3SVZA 1GSIA 1L3BA 1PJTA 1SBCA 1YRBA 2ISSD 1TD1A 3DZFA 3G2OA 5KJEA 4AZSA 2C2OA 1QGZA 3WNZA 3D4PA 1P61B 3DNMA 1A9SA 1FLNA 5HK8A 1WB5A 5DB4A 3OP4A 1W93A 1NU6A 2Y0PA 4OA8A 4WWHA 5CJJA 2VCHA 4P32A 5IAJA 2O8VA 1JRLA 3MUOA 3NHJA 4Z4HA 4W5QA 3EEBA 4HKTA 1VJDA 3F7OA 4IYJA 4AMUA 1ZK1A 3V32A 1KR2A 4XPIB 3T7KA 1P0FA 3MT7A 3T7CA 3PPIA 3PICA 4HL6A 1RKVA 3VNRA 5A7HA 3FX2A 4EAAA 4RLFA 3AK4A 1OYYA 1UJBA 1A5BB 2VDWA 1WDWB 3PTLA 4V3BA 4EYEA 1QOZA 2GKSA 1MC1A 3AUSA 1H69A 4JKYA 8LDHA 3OEEA 2WIKA 2ZTVA 2O7VA 1ITZA 2ESRA 4CT5A 5CDYA 1OBCA 4MIKA 3L4JA 1KMNA 4LXIA 1M8KA 1H4TA 4UCQA 5EVJA 3LWNA 3D3EA 3N6VA 4BQPA 1XF1A 1EFTA 3C5EA 1XXHA 4OUKX 1G5QA 5AUPB 1PL6A 1TB4A 1L8QA 1NVXQ 3M3DA 1M8FA 1TIKA 4EF4A 1JQKA 2VJQA 1WCYA 1XZHA 1O97C 2D2VA 2OXRA 1S7GA 2C5EA 1WF6A 2GNOA 1IDOA 3A11A 1F1BA 1UZNA 3B8HA 3EXIB 3G89A 4PRKA 5FR1A 3G2QA 4B5KA 3T9FA 3T3MB 2WVAA 4G65A 4WX2B 5C8ZA 3VHXA 1UT6A 2ZSFA 4JVMA 4BLPA 3MM4A 1PD0A 2W5UA 5EXXA 4L8FA 3BXXA 5MF6A 2CMKA 4W7IA 5LLSA 1IB0A 4M54A 1I9GA 4E08A 4N48A 2CVQA 5KSYA 2H0AA 4BNDA 6ABPA 2RE8A 3PC2A 4UUBA 3FCSB 3BDAA 3D1VA 3I9JA 3IBTA 3GLGE 5J5CA 4F5WA 4W1SA 3CLKA 1JIQA 1N4DA 4ID9A 3MUNA 1Q7TA 2BMDA 2Z98A 2ZJ8A 5DU2A 1PHRA 3O6VA 3GLGA 2WD7B 4F5YA 5AI4A 2NYVA 4EI8A 2GRJA 5ULLA 4E2FA 4NICA 4Q1VA 4B2YA 4DNQA 3QX3A 4XEUA 3F9RA 4ZVSA 4YRMA 3A1WA 4KITB 3PJRA 1ISRA 1X2EA 3EZ2A 1C8BA 3NVAA 3C3DA 1FYEA 4EYSA 2D74A 3FDXA 2XDWA 3LBYA 3O8BA 4EJ0A 5EP1A 5K0SA 4DM3A 2YHBA 1WDLA 4YRZA 4IKPA 4IIFA 4FFWA 2WJIA 3HR8A 3PXAA 4TX1A 4HNTA 2JFZA 4C22A 1FCJA 1KZ6A 5L3RA 4JQYA 2PX8A 1OI4A 1ND5A 3NHYA 4RH0A 4FOTA 4P0TA 2CNLA 1A8QA 4RJTA 4L0QA 5DNEA 1J8YF 1CYEA 4RDXA 4GZ6A 2IU6A 4WKGA 5G40A 5BMVA 2AZMA 1RYYA 2GKGA 5LOVF 3RTCA 4YQZA 3W7BA 2G70A 3CF0A 2BGJA 3AZQA 5CGQB 4TTQA 3E4DA 4QTZA 3V6LA 3H75A 4IIYA 3DBIA 3ONWA 1F0YA 3OQIB 4KW7A 2XD4A 5CIWA 4CRWB 1NSTA 1X7DA 1FVFA 1TLTA 1U7ZA 4P9NA 2OO5A 1CF4A 4FD3A 3WZMA 5FF9A 3M83A 1GV0A 5CHEA 3S2IA 4DMMA 2CXUA 1RE1A 3EGIA 3I8SA 1CS4C 2E3JA 2IT1A 1KH1A 1KI2A 2QD3A 1MUUA 4P5PA 4XYLA 4DJFC 2W2NA 3CF2A 3G6WA 2DHQA 3HC7A 3BCHA 2BFNA 1K4KA 1NVTA 4IIHA 3PUHA 1ORDA 3ORHA 4UHBA 5A4KA 2WDZA 4AZ3A 4D98A 2PGJA 3JQ8A 3B6MA 1O4WA 1SCUB 3GJYA 2IV2X 4GLOA 2NQ8A 5A04A 1FX0B 2IU0A 2AOVA 3CW8X 5CAEA 1K89A 3PG5A 1GTZA 3T5CA 5GVSA 1QKKA 4NU8X 4MKGA 3AGQA 3LX4A 5J3JA 1Y3DE 1WUJS 4MB6A 3ZW8A 4GMGA 4YPOA 3K0SA 1V8BA 2IYEA 2VYVA 5HDBB 4YRTA 5FYDA 1IJKA 5G0VA 5BSRA 4COOA 4F6LA 5L6LB 5E3JA 1TM1E 4HDMB 5J2UF 2IIQA 2JHCA 2XB9A 3OCVA 4QGFA 5LDHA 1LY1A 2PX2A 4P7JA 3WBFA 4EY8A 1YHYA 5TPZA 2GTHA 3EULA 4GX1A 5HKBA 3G1UA 3X1DA 1CHNA 1V71A 5KDOA 5EWJB 4KLZA 2NOAA 1M1ZA 3DULA 3L46A 3IAHA 3L77A 3QP9A 4BFYA 1EIWA 3TCXB 2VAVA 2WYHA 1A9OA 1HLGA 2ZUVA 3CO5A 2L17A 2QIOA 3F5DA 2GPWA 6REQA 2PLAA 1FU8A 4LJRA 5CA1F 1EDBA 4BMOB 1E58A 1TZJA 4HUQA 3MB8A 1AQ6A 1TJ3A 3QQ5A 2QUBA 4C06A 3MAGA 4DLTA 4FGUA 4R5HA 1Y5NA 2H4JA 2C20A 3C3JA 3PRJA 1K4MA 4JJIA 4R1OA 3FPGA 2KLBA 2FUEA 3NORA 3HKBB 1GSAA 4IJQA 5K3CA 4X0EA 4AG5A 4H9GA 1CRLA 1GPYA 4BZQA 3JQCA 5JATA 1PT6A 1DRKA 4P2GA 4M0PA 1GYQA 1JVNA 2ZAYA 3EQ7A 4MDYA 2WUEA 4AMGA 4DV4B 2FJ0A 3DTVA 4MICA 3KJXA 3DZIA 4X7MA 5AKLA 5A71A 4GLLA 3ZVRA 4C21A 3E8MA 3IYLW 1F20A 3NOQA 4F71A 3B5IA 3EXFA 1E98A 4Z51A 5KTMA 1F0KA 4MDHA 3NTRA 4DTCA 4E22A 4ZMBA 3VPCA 5C5CA 1G0NA 1GKKA 4OCZA 3WLSA 4O6VA 1MZVA 3CEMA 1T2DA 2CYCA 2E4VA 3SS9X 3QGMA 4UZFA 2WWXA 2ZU0C 2CXXA 4MRRA 3DPIA 5EGNA 3OM8A 4IZHA 1J8QA 4JBIA 1O96B 4N9WA 3E5NA 1TJPB 1UP4A 1XZKA 2Q2OA 2EW1A 2QN7A 2Y76A 4JWTA 5EL0A 2NWQA 5LZ7A 5LMNB 3NTUA 1XTTA 1XZCA 2REQB 2VG8A 2D6FA 1HA3A 3NH9A 3WLLA 4RMHA 3WOVA 1W4CA 4ZI7A 3BMQB 1QRAA 2ZG6A 3EGDA 3LPAA 1QP7A 1CHDA 2ZSIA 1UFVA 1ZM3A 1E59A 3JCZA 5EZQA 4XIJA 1OASA 1XDZA 3GPCA 1QHEA 2F3TA 2P9EA 4DR1B 3V97A 1HL3A 3LLCA 3IJRA 5JROA 1GKYA 5TPZD 4PYRA 3AI7A 2P65A 1SCAA 2VPTA 3AHDA 2KBFA 3IHWA 5GQSA 3BWDD 3UTCA 5GJBA 1IM2A 2G7ZA 1QZZA 2VSNA 3KXLA 2VDNB 4ALJA 2AMFA 3GR6A 4ZT2A 3OAAA 2PSDA 2RGWA 1YTLA 2EATA 3N05A 3UK1A 5DLQC 4B4OA 3I4FA 3OKFA 1DC4A 5JZSA 1K98A 4MUXA 4S2UA 4N40A 4DM4A 3G0HA 1YDHA 4HP8A 5EQJB 1M2GA 4U2FA 2J3QA 2QYHA 3AEQA 3U3XA 3KOUA 1VM6A 4B84A 2R79A 3H1EA 4LYGA 4PQEA 4RZUA 2ZBVA 3UA4A 3UT6A 5AM2A 1N3LA 1EQAA 3IQWA 2CFIA 1ENYA 1QGOA 4RDCA 5THKA 4UEWA 2Q1TA 1OYWA 5L7WA 3DKVA 1D9XA 4V0OA 3JY6A 2QBYA 1RVV1 4HX2A 2H48A 5K3FB 2C99A 3LE8A 3R0ZA 4HNUA 2AJBA 1FRQA 3QVOA 4PZDA 2A94A 5ILGA 1W34A 4NR0A 1G6OA 3UAZA 3BQNB 3DE6X 1LI4A 4JJ4A 4AXXA 4B81A 1GRCA 2LWIA 4NBSA 1WCV1 4Q4HA 5FPHA 1XRPA 4PF1A 4FEAA 1UC4B 3CNEA 3UCFA 4EI7A 1IQ0A 1KYXA 3BMNB 3FJ1A 1MG0A 1VYHA 1BGWA 4K87A 5FL7A 1EB9A 3PQ4A 1KY2A 2V0CA 3DW1X 4K9SA 4KAXA 1JQBA 4L3VA 4ON9A 2CHGA 1DRVA 1GZDA 1I4OA 1LC0A 1T4MA 2PDAA 5AHWA 4JI3B 1N2JA 4WTOA 2ZRAA 1ZL0A 3L9WA 2JAHA 1HDGO 5JYDA 2VT6A 3FLAA 4ISBA 4P08A 5KOYA 3VVMA 2VJNA 3L4EA 3QWHA 2FZWA 4KIWA 3S27A 5IK2D 4JJ8A 2A5FA 1KMIY 3C3KA 3GQVA 3TMKA 2PZAA 5CG1A 5JRZA 4WN9A 3WSWA 2QRJA 3NBZC 2H54A 4ZMRA 5JASA 1G66A 3IJEB 3ZZ0A 3O9VA 2YR0A 1H1DA 1ZA1A 5EHGA 4I14A 1LQTA 3ZC3A 1PWXA 3Q7PA 4PZEA 3ZKWB 5LLDA 5E8RA 2CT8A 3SBDA 2GDJA 3IP8A 1AK1A 1UEXC 3IQDB 3GEHA 1UUFA 3JALB 4PXSA 4DANA 1E6WA 1KMQA 2AJLI 4LSZA 4YAEA 4ZI2A 2GYYA 3A37A 3NBUA 3E9NA 5LP6C 3GV0A 3UV3A 3VOSA 1XWIA 2PKCA 3RC2A 3SYNA 3A1NA 4PAWA 1MAUA 1WUTA 3TQQA 3QBJA 1KEEA 5K8CA 3NGXA 3OA2A 4J16A 4B4DA 1PR3A 1FBTA 3DAYA 4TROA 4YYZA 1D3AA 4C89A 4RC9A 3K35A 3ELYA 4ARZB 4E5NA 2NACA 4QQKA 2BSXA 1TT7A 4PPNA 5G0WA 4DLYA 5KAMA 1Y5IA 4ER6A 4AZWA 4LMBA 3VKVA 3IDSA 4WW0A 5C8YF 4KUGA 1Z6AA 1ZVJA 3D43A 3DWIA 1HORA 1WMAA 4KOAA 4QJBA 3EK2A 1KQGA 4HGZA 4JUBA 4Y1RB 4YP9A 1WY5A 5EP3A 2YRFA 4Y6RA 4HYTA 4F4FA 1ZH8A 4NTZA 4HLDA 5CM2Z 3SIRA 1DX9A 2V7WA 3KD3A 3BMCB 1XCOA 3AH8A 1IN4A 4C6RA 3WJ1A 1OLOA 4L73A 1OXKB 2V7EA 3E82A 1PUXA 2VA8A 3DDHA 3A1SA 4Y0VA 4A1OA 2AZ4A 2P3SA 3IC5A 1IAQA 3O03A 1X1RA 4RTJA 3ETJA 1F12A 1U7HA 4JUCA 1E7WA 1E9RA 4B6JA 3Q10A 4I5FA 3QFRA 4H1UA 5AKEA 3MJ4A 3K4QA 1DKMA 4QNMA 3DOCA 4D26A 2AMJA 2YWJA 1YS2X 4WXMA 2BEUA 1NYQA 3RVOA 3TEJA 3U62A 3QW2A 1ULBA 2Q6TA 1JMVA 3EPPA 1AXGA 2SBTA 4RA6B 2FZ5A 3QUAA 4ENPA 4XRRA 2X0EA 2DWCA 3KO8A 3AJDA 3FTDA 4Q4LA 1DBRA 4OKNA 2CXHA 2Y66A 1BJRE 5G02A 2GB4A 1NXWA 2AK2A 4HDMA 1WCIA 4JT8A 2IXGA 3IOYA 2CVPA 3QPUA 4YREA 1CY6A 4OMFG 3BSWA 2BEUB 1EI9A 2XCLA 2P6MA 1TQ4A 4FYXA 3ZPXA 1U2GC 4B3HA 5CB4F 3ZWVA 4BB9A 5B5SA 1BCRA 4LK2A 1J0BA 2CJPA 5C37A 2GCEA 1U7WA 3ES9A 3KDPA 2H9YA 4GPBA 4XW2A 3RADC 2JEZA 3CKMA 4MW2A 3T5MA 2UZ4A 1PZGA 2ANCA 2RHGB 1ACJA 1SC9A 3QFTA 5AM1A 2BBSA 3RJTA 3TINA 1SCUA 2QTBA 4LDNA 3GAMA 2KJQA 4CE6A 3INYA 4X6XA 3EDCA 2Z2YA 2Z9DA 2VAMA 1XRMA 4HEQA 2PKWA 3KS9A 1VJ1A 1AGNA 2MT9A 1VP3A 4IDNA 4KVAA 5IVIA 1JECA 3HLTA 4OHRA 1GEEA 4JP8A 1U8EA 2QX9A 3PGLA 2C4MA 4IM7A 3CPEA 5C8DA 2BHTA 1RHQA 4C2AA 4XEHA 3KKZA 4K9OA 2YXNA 2I4OA 3CNLA 3QIVA 5TMBA 3V3TA 2V7GA 1JXAA 4FINA 1P9NA 1B73A 2C5AA 2HJWA 1T3HA 4RSMA 2YFYA 2ZETA 4S35A 4HMOA 4TLDA 1KKUA 1TUBB 3AR2A 4BVLA 2FKAA 4ZOAA 1ZVMA 4OJYA 2O9JA 3U7IA 3N7TA 4X61A 5GTDA 3OOSA 1NULA 4P86A 2RH9B 3M7IA 5HA5A 4BQSA 2VUIB 5AJXA 3P4UA 1OU4A 4M60A 1VOTA 5HOQA 3UG7A 2DERA 1CP3A 1ODJA 2TMGA 2QT0A 2Z1MA 1JJVA 2PT6A 4L02A 2J5BA 1W49A 1ZKMA 5EPUA 3ZGXA 2PX0A 3FMOB 3A2LA 2JIQA 5IMSA 4PHHA 3VA7A 3ROGA 2FQWA 2ODWA 4RF2A 1A8PA 4PAMA 2W0SA 4JQCA 2IZZA 1YQ9A 2PUGA 4G1MB 5TEWA 3GA0A 2IYQA 4CM4B 1EFRD 5JSFA 3HJBA 1IBKB 2G40A 2EX1A 3I42A 2FN3A 2CHUA 1LCIA 1GUYA 1QHNA 4YQEA 2GLXA 1D0VA 4LV6A 2BLNA 2XE6A 3G2MA 4WN9B 1E6LA 2JCSA 3LVRE 3THXA 3OZFA 2C82A 2Z2JA 5GZ3A 3L6OO 4M7RA 2QMQA 2GPJA 2X22A 1OZ0A 1ODIA 3N2EA 4YH1A 3E22B 3ETDA 1MW8X 1V4BA 2RGRA 1ZM2A 4RY2A 1ZVVA 1AHNA 5AW2A 5T6BA 3G7UA 1Z7YA 1ZD3A 2GHIA 2WF7A 3FCAA 4UEKA 3WHIA 1I2MA 4RZXA 5FBZA 6ADHA 2ZJ2A 1DEOA 3U3JA 5M34A 4MYHA 4HF7A 2YWFA 1H1LB 2IEIA 3BD6A 2R11A 2A86A 1GZHB 2EBUA 3P4YA 1XTJA 3A6HA 4HGQA 4XIGS 5TF4A 1C3EA 3TPCA 2JHGA 3AL3A 1ZJZA 2ZW9A 3SX2A 2WUDA 4UAJA 1QKJA 3T9EA 2I7XA 1NC1A 3T4EA 4G0YA 1CXZA 3G9XA 4ND2A 4EJSC 2V0NA 4RPCA 2F17A 2QTTA 2CEAA 3HEMA 4GKAA 4RH3A 1TT5B 5K0JA 5EIHA 2QBYB 1G291 5DTIA 3AIOA 2O8FA 3HDYA 1JFFB 3FDIA 1IY2A 3I9OA 4QQNA 5IZ4A 3CGGA 4XQEA 4WK6A 5DTMA 2GO1A 3TDMA 1X80B 5EG5A 1Z15A 4BJHB 3CLVA 3DWFA 1KJWA 1D07A 2DFVA 1EX9A 2H59A 3M6FA 1J0DA 2CFRA 2H2IA 2V5VA 2X13A 4X1IA 4FCTA 2R2GA 2O20A 2CSUA 1N5MA 4X6YA 3RSOA 2QVBA 4OL9A 2PNFA 1YF3A 5FWYB 4Q37A 2VEOA 3U48A 2Z57A 1GADO 3ZWBA 1T9ZA 4DQKA 3IEVA 3DLIA 4INPA 2C2KA 3UAWA 5A5FA 2SHKA 1FC0A 3ONDA 3FHTA 5LYJB 4BTEA 2X41A 2KS6A 3RRMA 2O19A 4Q34A 2WF9A 1KI8A 3USES 2H0RA 4DWJA 2VP6A 3KYCB 1QH0A 4ALNA 3ET5A 3GXOA 5AW1A 7YASA 1JYSA 3BE8A 3I6IA 4RYDA 3NHMA 2EZ4A 4YN3A 4K86A 4NDZA 3VXKA 4AN0A 5HJ7A 1CWUA 1E2PA 1X42A 2PA0A 4R1TA 4TYWA 1IXRC 3OEWA 4FIDA 2NSHA 3WWYA 5IKPA 4QUHA 2Z43A 4HLUC 3NC0C 3VR3D 3UFXA 4ARSA 3PZBA 2BMFA 2HNAA 4BNVA 1I3CA 4YAUA 2PT9A 2D0DA 4P3NA 4MIEA 5C8XA 4JL8A 2BM1A 1LK7A 2HDWA 1M8JA 2IP2A 4BX0A 4U6SA 5G0UA 3W5BA 2C7OA 2CUNA 3H2SA 3ZYCA 2JLUA 1DNPA 3OIYA 2C00A 3NHFA 3HCFA 3KXDA 2B1RA 2R65A 1Z8HA 4MS4A 5FR2A 3ICPA 4M9QA 5KQMA 4IZOA 1W4AA 2FFQA 1K2WA 2XWBF 4WOBA 3CN9A 3JVEA 4A16A 3K8OE 1EGMB 4BLVA 4C3UA 1I4DD 2MSKA 5HF8A 1J5PA 1LI5A 2WV7A 4J6FA 1ONNA 4WXYB 4EHKA 3KQLA 4LI0A 5LZ4A 2C8LA 3B60A 4AUEA 3T7SA 4CLRA 4IIBA 3HV2A 2IY7A 3KOYA 2IBSA 3OEHD 3EA4A 4HWOA 2VFAA 2OBXA 5HIIA 3QM1A 1IOLA 4GP6A 1Q84A 3L8HA 4YWHA 4E5PA 3EVBA 2G5PA 1WXXA 5I9SA 4I1SA 5DM70 1EZZA 5BWCA 2VH5R 3TTVA 1SOWA 3P19A 3OFND 4CR6A 1T9BA 3EWAA 5HKKD 3TSWA 5AXBA 2R1UA 2AW5A 5CPFA 3WV5A 2YWEA 3RBVA 4CI9A 3IRUA 3DOHA 1WMFA 3S68A 1U0LA 3AJRA 1QTQA 1DAHA 4YMWA 3H6KA 3AB3A 2O8EB 2P3LA 1C5KA 2GJ9A 3SHOA 3ZVMA 1QF9A 1OKKA 2BFCB 4GKBA 4GIBA 1UC9A 4JB2A 1EH5A 3R74A 3WGJA 1ZLXA 1NNLA 1XNQB 2JF0A 2QKYA 4J0JA 3JYPA 1ZFNA 3UICA 4B0OA 4EI9A 4DMRA 1CUZA 4DILA 1RHJA 1JZSA 1AN0A 2WP0A 5GV8A 5J5AA 3URKA 3HBNA 2YYAA 4WNYA 3UENA 4BTLA 1ZCZA 2C5HA 3S81A 1YQTA 4TOIA 3UAXA 1TZCA 2GCOA 3HNOA 5K0BA 5TRTA 1BHJA 3RU3A 2JGLA 1WF3A 4QYMA 3FTQA 1P5RA 1DLIA 4B3SB 1C3XA 1V5EA 1I2DA 3EQ6A 3LLUA 4OL0A 4BV2A 2I4MA 4FFMA 4EVQA 2Y93A 5IAEA 1NW8A 3HTXA 4QJIA 2VJAA 4BKUA 4CQNA 3RRBA 1B3BA 1Z0JA 1JIXA 3D7SA 2HJSA 3P9RA 4L8VA 2QJTA 4MWZA 2WTEA 1QVZA 3AYXB 4U9IS 2YBEA 2GPBA 3FNGA 2P8SA 3K3PA 2REXB 1M2WA 2X2PA 1YB7A 4ZOEA 2HXSA 4UVEA 5KVSA 2UUBB 3HUFA 3NDPA 1MG5A 4JYCA 3A1TA 2OOKA 4DNXA 1KMHB 1TAQA 2TMDA 3IPXA 3PCRB 2XUQA 2Y9MB 1AKMA 4WBNF 5FD8A 5KJFA 3Q2OA 3GLHE 4WV3A 1H2BA 2E5FA 4MARA 4YP5A 2FMHA 1UMCB 1GKUB 4EY5A 5ARBA 2BH2A 1CEQA 3ANNA 2ZBEA 4I2VA 4ZARA 3TM5A 5TS2A 4HNHA 2VF7A 4ZYXA 4LAFA 3N8DA 3QPDA 3V4SA 1ZNYA 5KNDA 2OB2A 1ECJA 3G8DA 1X0VA 5EJGA 5BRNA 3ORFA 2D2FA 1Z2DA 4YAWA 1II8A 3E7WA 7ADHA 1CUVA 3Q3VA 3QUCA 1AT1A 2HDHA 3RVDA 3I34X 4KFRA 3S55A 4Q1EA 2BZ1A 2BDEA 4I50F 5B37A 2RCNA 1KY3A 1P7PA 2PYDA 1ZN7A 3SFTA 2OYCA 4F11A 4NH0A 4LJ6A 4H7PA 2D2XA 2UZ0A 1GNSA 2A5GA 2QQFA 4JHXA 1KNQA 4P3KA 4ZC8A 4G5OA 3U16A 3P4XA 2ZCJA 3X2SA 2FPWA 4ZPXA 4BE4A 4C07A 2OY0A 3ESQA 3IMGA 2YHSA 4QQFA 3HEAA 1RXWA 2FEOA 2PD4A 4EBBA 1FDVA 1OYVA 2GAOA 1T4BA 3KHKA 4FT4A 5KJ6A 3QKRB 2UYCA 1QBGA 2WJAA 1WXHA 2FFBA 5HSGA 5AXAA 1U11A 1DBQA 4W4TA 4DLUA 4Y67A 4OLAA 1WDMA 2ZP1A 3LUAA 4ZODA 4EYQA 3EZ6A 4FQ5A 4I55B 3UXEA 1Z6PA 2P7IA 1XKTA 1C41A 3ISJA 1RXUA 4X66B 1HE3A 1L4UA 1A9TA 1GG9A 1R0KA 1T1JA 3LF1A 4N1AA 5E0KB 2WUGA 4UE2A 5BN3B 3CZ9A 3A28A 4G9EA 1DIAA 4MKZA 2UXCB 1PSWA 4GM1A 3RT1A 4B3IA 3AR3A 4I7EA 4JBLA 3DL4A 1L4KA 3TIIA 3AR7A 1E5DA 4YCMA 1FP1D 3N2YA 2VI5A 3LVBA 2X86A 4PONA 4RZ3A 3M9LA 3ZU3A 1TCBA 1XV5A 1AUOA 1JDVA 2QAIA 4HDKA 4JJKA 3STWA 3LUDA 1FP2A 1QFXA 2FDCA 4B8YA 2ECKA 1N1MA 3MTAA 4B3MB 4GBED 3HDTA 2Y1WA 4XD7A 3C3YA 4OO3A 1OFGA 5BQPA 3ZTTA 2EJWA 4DQUA 5LQNA 4OQFA 3RABA 1RYBA 2EYQA 2B4YA 3LL7A 1SG6A 4MW0A 1FFXA 4I36A 3RS4A 1QIHA 2MJLA 2CL0X 3QMPA 3V6MA 2HT6A 3R20A 2IGTA 1RYHA 1NQAO 2ZYRA 3GJTA 4QGBA 1SXJD 5BN5A 2O1SA 5AVZA 4OV6B 1RFGE 3I2HA 2VJMA 3FYUC 3H9CA 5AJVB 2I6SA 5KX5F 2UU9B 3QJGA 3TOCA 2VJPA 3WO1A 1S4QA 2V8BA 3BF7A 4XSHA 5E95A 1ODKA 2QZZA 4ZVTA 5CJPA 2O8FB 4M0DA 2C3UA 2NSYA 1HOXA 2HN9A 4LOIA 1MX1A 1P75A 3G5UA 4PSDA 2PZBA 5E7MA 3DOUA 1VHJA 1XALA 5EIBC 4OHWA 4CKBA 1ONBA 1H0HA 2J3MA 3F9IA 3K20A 3ZZMA 2WYWA 4LXTA 2CXPA 4IEFB 1VHDA 1AHPA 5GJWC 5FJJA 3FDJA 3UJDA 4ZOLF 4Y6OA 1T6YA 4CM8B 3HSKA 4DZZA 2Z5FA 1OT5A 3FMFA 2BSQA 1R4NB 4NCNA 1AMUA 2X5XA 2XECA 3I45A 3WX0A 1NDQA 2XMQA 3M89A 1O96A 3C7TA 2ATIA 3HMKA 1ZMXA 4HZUA 2AOXA 5ICGA 3HH8A 5HR5A 1NMSA 1G5RA 1LC3A 2R6JA 1I2AA 1THTA 3KXIA 4OB7A 4BNNA 3C85A 3FWZA 2KSQA 2IYFA 2OHHA 1FNBA 2OUIA 3FPCA 3PDWA 4BWFB 2JAUA 1NC3A 4QVIA 3L4BC 5G2OA 1U3UA 2Q3BA 2XODA 2V7UA 1DWUA 2W22A 3L06A 1NI4B 2OQ2A 3OJLA 4TMWA 5J2UB 4CGZA 4MV0A 2ORVA 1S8OA 2HQSA 5B4TA 2YWBA 1QVVA 3P9XA 1HTBA 4UARA 5FAXA 5BN4A 4OJTA 5DNVA 1FZTA 3G2IA 3QXSA 1MVOA 4RMIA 2YMMA 4LK3A 2TYSB 1ZD9A 4GYYA 4M0CA 3G0DA 4D3YA 5ALKA 2QLBA 1OIVA 2ZS9A 1ZJ5A 4L6IA 2BFEB 2WIDA 2M1ZA 2ZRJA 4LVUA 2O8BB 2H2AA 5NULA 2F6RA 5F3WB 3JYNA 4EITA 4K9DA 1G3UA 1U65A 4RTOA 3LQKA 2RHTA 5IT5A 2DFNA 1QAOA 1USIA 2YNMC 3M4XA 5E2AA 1Q5PA 3CLRD 1V5IA 2FB9A 2X42A 3B1ZA 3NV7A 5CH8A 1ZRMA 3U6KA 1NVEA 2RHOA 3CVOA 1J9ZA 3C1AA 3CLSD 3Q6IA 3ZV3A 1ZAKA 3OT1B 1DOHA 3MA0A 4LNUB 4N01A 4BBJA 5B6IA 2ZUDA 5LIRA 2V9PA 2VQEB 3T3OA 3ILXA 1ZI6A 1HNNA 4M89A 4RK0A 1Q0QA 3FZGA 3O0DA 2QRGA 3MJTA 4G4JA 3BSSA 2KM1A 1OVGA 3G17A 3LWDA 3SXUA 3ZHUA 5GADl 2BYTA 3ROQA 4KXXA 4OHXA 3JWJA 2GVNA 5D51S 5IP5A 4TSKA 4TWZA 3WYDA 4AZ0A 3AOGA 2ZS7A 1XELA 3AF4A 3A6KA 1I36A 3FVQA 1S4MA 3WK8A 1W85B 3Q5DA 4U39A 3KR0A 4LXHA 3ORRA 3G8AA 4KAAA 1G18A 1ZN9A 1I0IA 3MUEA 3K32A 1QZTA 3KUXA 4R7ZA 3PGVA 4BLRA 4RS4A 1XCMA 1IUKA 2FSFA 1GG5A 2ZE5A 3L7IA 1EB8A 1UDXA 3DV9A 3OOYA 3ITEA 4TYPA 4UBIA 2QRVA 4O2AB 4ZCMA 4CKEB 2ZGVA 1VLJA 2PA3A 1J7KA 3MHPA 3WLNA 2B4QA 2EW8A 1L4YA 1U2QA 1CDZA 5H02A 4X85A 4UKDA 3A4YA 1I2ZA 5IHPA 5JTUA 2D2IA 3SJCA 2OCPA 3KUDA 4IRUB 1FMFA 5CA0F 2DPGA 5JY1A 4CQLB 1NR1A 5I7RA 2VDVE 1H0KA 1QOPB 4UHHA 4LZPA 4O4JF 5JSZA 5FA5A 2I6UA 1NN3A 2WINI 1JPUA 2LBPA 4KYVA 3BHMA 3W04A 4PYMA 3LHDA 1DO2A 5DFAA 3CRNA 4MUHA 1T0HB 4ZKEA 1FDIA 4J07A 2W9XA 4JVOA 2EERA 1U5BB 4H2DA 3HB1A 1BW9A 2QLLA 5DHPA 4ZQCB 3FCEA 1PWEA 1L7BA 2PMFA 5IPFA 4GXNA 1K68A 3COYA 5MGBA 4Q4AB 4YJ3A 3W5JA 3H1FA 3C7DB 2XTZA 4Q7LA 3D5QA 3I6BA 1NVUQ 1UAYA 3EXG1 4HO1X 5IHXA 1LK0A 2R9VA 3KHSA 3MB5A 4ZCQA 4TYMA 3T5PA 2UZ1A 1EWYA 3BZBA 1M9NA 3HG7A 5U1PA 3LRPA 1NYLA 1X0XA 2ODAA 2GSWA 2XHZA 1E5XA 3O47A 3AVUA 5ITSA 1X70A 4RVGA 3OE5A 2YFQA 2EL7A 3AQIA 4OJQA 3H65A 2QNIA 4YJHA 2LKCA 3EC7A 1SOAA 4U9HS 4QA9A 3ZWDA 4KIUA 3H04A 4MIYA 1TEVA 5MHTA 2C57A 1L6RA 1T36A 2K5UA 4MGEA 5DBGA 5DK6A 1OLUA 2JCYA 4AB1A 4P81A 2J0SA 1VLVA 3S2ZA 1LTQA 1NX9A 3IB3A 1ZSYA 1ZXLA 3L8YA 2P5UA 3I1IA 2PO5A 3STUA 4R2JA 5CPBA 2IZ0A 5BSUA 4URFA 3VU0A 1DC6A 2R1VA 2FPUA 3OU2A 3VZCA 5ITVA 5IXSA 2QXUA 1LKZA 5DHUA 1VGRA 1H8HD 3T3IA 4H7EA 3WGVA 5K5EA 4KAJA 4RV9A 1A69A 3V8PA 1E69A 3HI6A 2OAQ1 2XUAA 1Z0KA 1II9A 1H1TA 5C7LO 4DV7B 1YBVA 2FE4A 4O8CA 4ZDKA 4A73A 5LMCA 3D3JA 3NHLA 4A2PA 4IQ0A 4BFVA 3BMOB 1KR5A 2R1VB 4KSYA 3U0VA 4ENWA 1AA6A 3C45A 1UPXA 5FLKA 2YWHA 3MCAA 2I1VB 1QIMA 1ZH2A 1QKIA 2DTEA 3EPJA 1FEZA 1VYVA 3SD7A 2GFQA 1JKJB 3GIWA 3VZSA 1V7CA 3QENA 3ZY5A 1HMYA 3L79A 4PCVA 2DPHA 3G1WA 1ZNZA 4TWBA 3UQZA 4B71A 1FXWA 1TO1E 2B8NA 2WG1A 3PUWA 3Q98A 3NHWA 4QUIA 3LFHA 2VNJA 5FULA 5EJ8A 4BL5A 1VJCA 3PNPA 3W2IA 1DT5A 2ZM5A 1N6KA 1RKUA 3DEAA 4MGZR 2J3JA 2WEKA 3D6NB 5AW0A 1OX6A 1Z5WA 3F5FA 1USWA 1N6RA 1K6JA 1MOZA 2V4ZA 4FU0A 1WPQA 2JLR