1EHYA

X-ray structure of the epoxide hydrolase from agrobacterium radiobacter ad1
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
293
structure length
282
Chain Sequence
AIRRPEDFKHYEVQLPDVKIHYVREGAGPTLLLLHGWPGFWWEWSKVIGPLAEHYDVIVPDLRGFGDSEKPDLNDLSKYSLDKAADDQAALLDALGIEKAYVVGHDFAAIVLHKFIRKYSDRVIKAAIFDPIQPDFESWYSQFHQLDMAVEVVGSSREVCKKYFKHFFDHWSYRDELLTEEELEVHVDNCMKPDNIHGGFNYYRANIRPDAALWTDLDHTMSDLPVTMIWGLGDTCVPYAPLIEFVPKYYSNYTMETIEDCGHFLMVEKPEIAIDRIKTAFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (SOLUBLE EPOXIDE HYDROLASE)
publication title The x-ray structure of epoxide hydrolase from Agrobacterium radiobacter AD1. An enzyme to detoxify harmful epoxides.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Hydrolase
total genus 108
structure length 282
sequence length 293
chains with identical sequence B, C, D
ec nomenclature ec 3.3.2.10: Soluble epoxide hydrolase.
pdb deposition date 1998-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ehyA00
3WIBA 2QJRA 2Z5GA 4HXEB 5YASA 1XZKA 4HXFB 4X6UA 1ZGBA 2K2QB 2WIGA 5CXUA 2WHPA 4EB0A 3IUQA 1H23A 3I2JA 1UKAA 1NU6A 2G5PA 1YR2A 5D3KA 1SC9A 1XKLA 4DNOA 1BRTA 5ESRA 2GYWA 5FPQA 4A16A 1D07A 1H22A 4YASA 1WHTA 3I6MA 3WWPA 4BC0A 4V2IA 1ZOIA 3IUJA 5D7BA 4AXBA 1THGA 3KD2A 4GI1A 5CT4A 4GWLA 2J3QA 3ESCA 1CRLA 1AZWA 2WJ4A 3C8HA 4MJ3A 3U0VA 2XLBA 2NW6A 4Y9SA 2BUAA 3VVMA 2QXTA 1EVEA 3FAKA 4RPCA 1LPSA 4JYMA 2WTNA 4BP9A 5AKEA 4C87A 3ICWA 2HA6A 1GPLA 4XVCA 2JIDA 2HA4A 4LXIA 2XQIA 1CUWA 5JAPA 4QNNA 3WK5A 3STYA 5I7UA 2RI6A 3ED1A 2QT9A 1CUBA 3O4GA 2XB6A 3IULA 2J4FA 1A8QA 4Y2JA 4Q3OA 3D4LA 5DWDA 1R3DA 5A7GA 5KWIA 4C4XA 5EHNA 3FLAA 2OQIA 4H77A 1MPXA 2WHQA 4XIIA 4H35A 1WPRA 4ZGBA 3F9CA 3WWCA 1ZI8A 1EA5A 4AO8A 1K63A 5CT8A 4Q05A 5CBKA 1ZJ5A 2OPHA 1HKHA 5SYMA 1QZ3A 4JEIA 1CUFA 3GFFA 3SK0A 2HA0A 1QIGA 3O4HA 1GPKA 4LYEA 5K3DA 1J07A 4FKBA 2XQKA 2B4KA 1ISPA 1W52X 3O0DA 4TGLA 1FFBA 5FXMA 4BC1A 3WKAA 3RM3A 1KU6A 1L7RA 1K5PA 1SCIA 3OTQA 4EHBA 1EB9A 1WOMA 3DLTA 1QIJA 5ALRA 4KE9A 3HACA 3FWHA 1YB6A 1YASA 5AOBA 4TPKA 4DYHA 5JD5A 4H7JA 2XUOA 1DT5A 2IITA 4P9NA 4B84A 1ZIXA 1TK3A 4DSAA 4E46A 4MEBA 5HCUA 4J0KA 4HZGA 3A70A 4C6HA 2G5TA 2AJBA 1C7JA 3QVMA 4X94A 4MWTA 5E4TA 3C87A 2WFLB 2WKWA 4WJLA 4BBZA 3H19A 1QIEA 1ZD5A 1EB8A 2HDWA 1CLEA 5I9IA 1XROA 1QLWA 5FOQA 4BRSA 1UFOA 4OSEA 3WKEA 2BJHA 4BTVA 3PUHA 3A2NA 1DWQA 3G0DA 1HBJA 2VT7A 5LZ2A 4X71A 1MO2A 2VAXA 4RNCA 3R0VA 4OB8A 1P0IA 1CUUA 2AJLI 5DNWA 5HKAA 1MU0A 2BGRA 1MX1A 5ALQA 2OCKA 5CTAA 3STVA 4AZ3A 5HFNA 4Y2SA 2JEZA 4H7EA 3QPCA 3IUMA 2HA2A 2PSDA 3I1IA 2OAGA 1J06A 3DYIA 4QDOA 4X85A 5BWBA 1UK6A 2ZSIA 3HI4A 1TCBA 5LIPA 1DQZA 2ZYRA 1MNAA 1XZLA 4G8DA 2HFJA 4G8BA 4BAUA 4CCWA 5JAHA 5C8VA 2HRRA 2WU3A 2JGFA 4FNMA 4IQ4A 1XQXA 1CUJA 4BTLA 1XRNA 3ZLTA 4GHWA 3PUIA 3V9AA 5LZ4A 2CJPA 1CIJA 3R3YA 2LIPA 1XZFA 2XQJA 3FLBA 1VXOA 4CG2A 1YCDA 5JAUA 2DQYA 5LZ8A 1A88A 1QJ4A 2BGNA 2HFKA 1O6GA 2XMDA 1E66A 5ISMA 2XUDA 3CXUA 1FFEA 4WFJA 4IH9A 1JFRA 5AK4A 4CIAA 2QMQA 2RGUA 2WG1A 3CCBA 4AB1A 1U8EA 2I3ZA 4FFWA 5HZGA 3G0GA 2H7XA 1UXOA 2JF0A 4AMYA 4N5IX 4X97A 2CBGA 4M0FA 1AUOA 3TGLA 5EGNA 1VA4A 4L3WA 3ZLUA 1SCQA 4J0GA 4B0OA 3SX4A 3C5VA 5JZ9A 5BOVA 4KE6A 3X3HA 1QIHA 5AH0A 5ALUA 2VF2A 4EUSA 4FOLA 3EF3A 2XMSA 3EIOA 2P8SA 4I3FA 4NS4A 2WJ3A 4FLFA 1XZMA 1MAAA 3FVRA 1FSSA 5AP9A 4WFKA 3WWEA 1GT6A 1QGED 3AJAA 1DX6A 3HEAA 1BCRA 3I1YA 4QWWA 3OG9A 3QPAA 4GXNA 2GYVA 4X91A 1W75A 4EY6A 4MQLA 3T4UA 1TCCA 5AIAA 1BEEA 2JGMA 4B6GA 4RE5A 2ZJ7A 3D5EA 4LYDA 4G8CA 4KR0A 5T4HA 2OGZA 4J0CA 5K3FB 1JJFA 5ALXA 1W4LA 5DYWA 2HU7A 2CEKA 1CVLA 2YYSA 1XRRA 1J2EA 4AO6A 1QO9A 3I2FA 2JEYA 3RKSA 4U2CA 3H17A 5FLKA 1MNQA 2OCLA 3DS8A 3A6ZA 5JASA 4K6GA 1YB7A 1Q83A 2XQFA 2E3JA 3ZWQA 4IHAA 3W05A 1BEZA 3RLIA 4C4YA 1EI9A 2H7CA 4ROTA 2DHDA 5JADA 3WK8A 5IVKA 1Y7IA 4B9EA 3AZPA 4KEAA 4Q3LA 5ALYA 1PJAA 3DEAA 3LP5A 4QDXA 3I28A 3S2ZA 2JGJA 4ARBA 2WIJA 2HU5A 2D5LA 3D3NA 2VJBA 2RAUA 4IH4A 1VOTA 3GBSA 3BJMA 1GKLA 4G1FA 3FYUA 3H18A 5CT5A 1TIBA 4FBMA 3AFIA 4MXDA 5AM2A 3H04A 1UZAA 1YA4A 2VATA 4FTWA 3FCXA 3ZLVA 2FX5A 4Y2UA 4Y2YA 1R88A 2V9ZA 2XLCA 2PVSA 3TJMA 3KOOA 1C7IA 3OC0A 2QRUA 4J0IA 4F0JA 1DWOA 3MUNA 4J0DA 3AIKA 2OCGA 2VA9A 1X2BA 4B80A 2CKMA 2XUHA 5KWJA 5FRDA 2OGSA 2GBIA 3IBTA 1H2ZA 2V98A 3A2LA 5AJHA 3MGAA 3HJUA 3I2GA 1TAHA 4AN1A 3O9MA 4OPMA 2Q0XA 5AKYA 2ROQA 3C6BA 2Z3ZA 2PBLA 3HZOA 3AILA 3BDVA 3HSSA 3FSGD 1ZJ4A 4S0XA 1UK7A 2VJDA 3EQ8A 1WB4A 4UFOA 4L0CA 5LKRA 1JMYA 4WDRA 3FOBA 3WKBA 1RYYA 3Q8WA 2XUKA 4AN0A 1FFCA 2C5FA 4H7HA 4UHCA 3I6YA 3F8SA 3TRDA 5D3ZA 4M0MA 1E8MA 4W1SA 3ANTA 4LKOA 1EVQA 3C43A 4MWSA 4E15A 2WILA 2EEPA 5JATA 5HQ3B 3DL7A 2HADA 4JUIA 1MX5A 1LBSA 4CG1A 1U4NA 1CUXA 1N5RA 4X92A 3HRHA 4W1RA 4AZ0A 5AK5A 1CUVA 4W63A 3L1HA 4UBJA 1CUDA 2O2HA 3OOSA 4UUQA 7YASA 4BYMA 4I4CA 3VVLA 2JGLA 1VZ2A 4W1PA 2GYUA 5DYTA 4RE6A 5SYNA 4UHHA 3EQ9A 4W9RA 5AKKA 3R41A 4BVLA 2Z8ZA 1YA8A 2ORYA 4LIPD 4ZXFA 3IIIA 3IURA 2ZVDA 3H2JA 3V1NA 4I19A 1LPAB 3DDUA 4CI9A 3GROA 5HF8A 5AM1A 4C89A 5JARA 4KAFA 3LS2A 5CURA 1P0MA 1EHYA 1CEXA 3H1BA 4BVJA 3OM8A 5LZ9A 3G02A 2X5XA 1N1MA 1XLWA 1H2WA 2PUJA 3V1LA 4GLBA 4DMKA 4DTCA 4B9AA 5DNUA 4YX9A 1XZAA 3HXKA 3DKKA 3W2TA 4B82A 2WHRA 1F0PA 2B20A 2WM2A 5DTIA 5DTJA 5ALPA 1NU8A 1E5TA 2WJ6A 2RONA 3ESAA 4HS9A 3R3WA 1PV1A 1EK1A 1EDDA 3E1GA 3WJ1A 2WHPB 4H7IA 2OG1A 4A5SA 4QDUA 5CW2A 3PE6A 4EY7A 1EDEA 3K9BA 1IMJA 3DOHA 5LP1A 2XMQA 3D59A 1YAJA 4KYVA 5FKJA 3KSRA 4UHBA 1W1IA 5CRIA 3VJLA 5CH3A 2QTBA 4FMPA 3TEJA 3ILSA 3UMJA 4J03A 1T2NA 1FJ2A 1XRMA 4DNPA 2XUIA 3VXKA 1P0QA 5EIHA 1AMNA 3G9UA 1ODSA 2C4HA 3ZPXA 1L7AA 4INZA 2WG2A 2XUJA 3S8YA 3ESBA 1E8NA 1Y37A 2XUAA 4PQEA 5HFAA 3DNMA 3KDAA 2OXEA 2VJCA 1ZIYA 1K8QA 4BCDA 4MEAA 4F21A 3QITA 2G4LA 2WFZA 2ECFA 3HYSA 2XT0A 2DHEA 2AJCA 1E3QA 4AQDA 2ZYSA 5KREA 2G63A 1SCKA 3R3VA 2OCIA 2PU7A 5ALLA 1TRHA 2RHWA 2PPLA 2BCEA 1QO7A 4P93A 2I03A 1VE7A 2HM7A 1XZIA 4OD0A 1ZI6A 2GZSA 4UFPA 1XRPA 4OU5A 1HPLA 4OYLA 4UBMA 1IUNA 2BKLA 1CUHA 4Z49A 2QUBA 1N5MA 1OXMA 3PF8A 1XZJA 1GQSA 1MJ5A 3B5EA 1HL7A 1MAHA 4NZZA 2JGEA 3N0TA 4X7BA 1EK2A 1IZ8A 3O95A 2EDAA 5A7FA 4HTAA 5AHXA 1UOOA 3C8DA 5A7HA 1BU8A 4Q3KA 3I2HA 1EH5A 1G66A 2PKYX 3WK7A 5AM0A 5AI5A 5IVDA 1J1IA 3YASA 1FFAA 2ACKA 5F4ZA 4DLNA 1R4ZA 2QM0A 1ZGCA 3BF7A 4CG3A 5LLSA 4CCYA 1Z68A 2H7YA 4PF1A 4YPVA 1EINA 2I78A 2BUBA 3LIIA 2WIFA 3G8YA 2XMCA 4Y2TA 4X93A 3Q0TA 3I2KA 3WYDA 5A2GA 2PU5A 5ALTA 4AMZA 2XUFA 5E4YA 5IVIA 3QH4A 4QEKA 5AKIA 4D9JA 1IZ7A 5EIAA 4UBOA 1OILA 4HVTA 5A6VA 5JZBA 4AX4A 1UWCA 4ARAA 3C6XA 1ACLA 2RHTA 5LZ5A 1ORVA 3M81A 3L1IA 5FPPA 2CMFA 4PSCA 4KRXA 2PM8A 5ALVA 1BS9A 4GDMA 4H18A 3WA7A 4UHEA 2V97A 3WI7A 1WM1A 4G5XA 1E89A 4WY8A 1DX4A 3L1JA 3HABA 3O4JA 4UBLA 4M0EA 3BWXA 3WQHA 1XKTA 3LCRA 3DD5A 5LZ7A 3WKDA 3M82A 1WCYA 4BDSA 4CCYB 2C5GA 1CUGA 2CUTA 2WSLA 1LPMA 1TCAA 1JU4A 1GKKA 4ZV9A 3GZJA 2GZRA 5HF5A 1R9NA 5AK6A 4PW0A 3IUNA 1GZ7A 3WK4A 2QOEA 5AOAA 4K6KA 2JBWA 4B0PA 5A62A 3STTA 4ITVA 2C0QA 1NX9A 1CV2A 4J0JA 4K6HA 3AZQA 1AGYA 1UK8A 4DIUA 1G42A 4BATA 1JJBA 3E3AA 2Y2VA 4LHEA 5K3AA 5AK3A 4H7KA 3WZMA 1LPOA 3R40A 2WUEA 3WYNA 3QM1A 4G9EA 1S8OA 5K3EA 4WCVA 1RP1A 3KWJA 3FVTA 4FNGA 3STWA 1HQDA 1CQWA 2JGIA 3G9TA 5EIEA 4KAAA 1FFDA 4J3JA 4N8SA 1H2YA 2AXEA 4YK7A 1CUZA 4PSUA 2O7VA 2V96A 5IKXA 5HF6A 3KWFA 2HA5A 1KEZA 2VJAA 3D7RA 2WFMA 2BUCA 3WL7A 1Q0ZA 3LIPA 3BIWA 4Y2RA 1W76A 4Q34A 5T4FA 4MQMA 1AX9A 4P92A 4UBKA 2HA3A 3WL5A 2ZYIA 3D2AA 1X2EA 4OB7A 3DYVA 4MYSA 4EZIA 1MN6A 3CN9A 2Y6VA 5K3BA 3O4IA 4IH1A 3QMVA 3FYUC 2VEOA 1AURA 1YS2X 2WUGA 3W04A 1XZDA 5HF9A 5KBYA 1DINA 3NGMA 1F6WA 2VTVA 3G9ZA 2HIHA 4BZZA 2I3DA 4UPDA 4BCBA 2XQGA 4N5HX 4UBNA 4X3CA 2XUQA 4BCCA 4LXHA 4OB6A 2YASA 1USWA 4BRZA 1BROA 1JJIA 3IDAA 4KRYA 4BB0A 1B6GA 4BVKA 1PFQA 5K5EA 5CT6A 2O7RA 4W1QA 5IH7A 2WIDA 2ZSHA 3R3XA 3U1TA 1QE3A 1AC5A 1LPBB 2PSHA 4HAIA 2OQVA 2XMGA 3QYJA 3D2BA 3QPDA 4TVKA 3FYUB 3H1AA 4X95A 2WIKA 1ETHA 4L9AA 2DFPA 2IIVA 2FJ0A 3K6KA 5BWCA 4RGYA 2PSEA 4HXGA 3AIMA 4CFSA 2CZQA 4F5ZA 3WK9A 2VAVA 3WA6A 4U2FA 5FDFA 4U2EA 1DWPA 2X76A 3PF9A 2XE4A 4GECA 1EX9A 3VISA 5ALEA 2QZPA 3NWOA 4Y2XA 5ALMA 3HC7A 2Z8XA 2WUDA 3N2ZB 4JYPA 5AI0A 3FNBA 4QLAA 3BE8A 3JWEA 5AM5A 3H2GA 4UHFA 1VZ3A 2J4CA 5EHZA 6YASA 4BZWA 4KE8A 4XX1A 1LNSA 1Q84A 1LLFA 3WMRA 3VKFA 2X8BA 4N8DA 1BCSA 1GXSA 5AKHA 2QR5A 3G0CA 4C01A 1Q0RA 4AO7A 4MYDA 4B81A 3WKCA 1THTA 1AKNA 4FHZA 3KXPA 2RIPA 2XI4A 5AM3A 1MX9A 1XFDA 4CIBA 4J7AA 1CUCA 2R8BA 2YH2A 1WPXA 3C70A 2XMRA 1QIIA 5H3HA 5E2IA 1QTIA 2VQ6A 2AJDA 1QIFA 5JAOA 1QIKA 1HLGA 4K5QA 5JIBA 1CQZA 1ORWA 4H0CA 2ACEA 3ANSA 2QVBA 5HK8A 2J3DA 4ZWNA 2XMZA 4EY8A 2Y2UA 5AI6A 4Y2QA 4Y2VA 3STXA 1VE6A 3QMMA 1QIDA 3PDCA 1XZHA 3C6ZA 3V1KA 3K2IA 1JU3A 3CCCA 4E11A 3PFCA 4QWMA 5DJ5A 5A71A 4UHDA 2QJWA 5LYYA 1A8UA 3E4DA 4L72A 4DMHA 1U65A 1OCEA 2QKYA 4KJXA 4X6YA 5EHXA 1H2XA 2FJPA 4DNQA 3NOXA 3ESDA 1LZKA 3MVEA 4G4JA 1BE0A 4PV7A 3SWWA 3V1MA 1XZEA 3W06A 1VA5A 4FLEA 4Q1VA 1VJ5A 1W6RA 4HRYA 1LPNA 1XRLA 4EBBA 4BAZA 3ZV7A 3WK6A 1IUPA 1KU0A 3G9XA 2ZJ6A 3DOIA 1TKRA 4KE7A 4G9GA 5C81A 1IUOA 1YS1X 4DSZA 5ALGA 2WFLA 3RK4A 1CUSA 5ALJA 4IO0A 4DNFA 1B41A 3W9BA 5JANA 2Z3WA 4OU4A 2XUGA 2O2GA 4B83A 2BAGA 1QFSA 1XRQA 4BP8A 4K2AA 2XUPA 3AZOA 3DKRA 2H9YA 4B85A 2HHAA 2B61A 5HKBA 1GPNA 4G4GA 2QS9A 5ALFA 1UKCA 3FYTA 3WLAA 1GQRA 5JALA 4BE4A 5C7YA 3M83A 5C8XA 5JD6A 3DJYA 2CB9A 1ODCA 4DMFA 1BN7A 1CPYA 3IA2A 4HRXA 3G7NA 1SOMA 1MTZA 2UZ0A 1CUYA 5IVHA 1XZCA 4DM7A 4U2DA 5ALKA 5ALOA 1JI3A 2ZYHA 5AKXA 1SFRA 5AKLA 2VT6A 4XWGA 5AI4A 3O9VA 4O08A 4ZV7A 4X90A 1ZD2P 5AO9A 3VJMA 4LXGA 1WB6A 5AKZA 3AINA 5K3CA 4BDTA 2Y6UA 5DYYA 2PUHA 2ZJFA 2EDCA 3DQZA 4FDMA 4A23A 3OURA 5T4BA 2HRQA 3VDXA 5BV7A 4OUKX 2PSFA 2OAEA 3I2IA 3WJ2A 2DCMA 2O2IA 4PSDA 2WG0A 4UBIA 5EI5A 1JT2A 2R11A 2XMBA 3SC2A 3WZLA 2PX6A 4EY4A 3FLEA 4ZRDA 4E14A 4NMWA 3RARA 5D6OA 5AICA 2JGKA 4Y2PA 3BXPA 3EQ7A 1U2EA 4ZI5A 1ZICA 3V48A 1HDEA 2OLEA 5AOCA 1A7UA 2WQZA 5ALIA 4G4IA 1ACJA 1N8SA 1XQYA 4P08A 4X00A 3STUA 2C7BA 1CR6A 1F0NA 2DSNA 2OGTA 4Q82A 2PSJA 1LBTA 3HLKA 4C4ZA 3UUFA 5K3FA 3ZI7A 3M3DA 3BF8A 1BN6A 1QOZA 3EBLA 3QZUA 3P2MA 5CH8A 3A2MA 4FBLA 1DQYA 1UOQA 3VJKA 1XQWA 2B9VA 4X6XA 4ZREA 4ETWA 4H7DA 1DT3A 3QMWA 5EHQA 5ALZA 3FSGA 4WFIA 3QBJA 3IB3A 3B12A 4OCZA 2HU8A 5ALSA 2FUKA 5I8PA 1GGVA 1UOPA 2AJ8A 4WY5A 1K6EA 4JNCA 5ALHA 5HK9A 4WDQA 5JD4A 1AQLA 1CUAA 3H2HA 3BJRA 4OYYA 3E0XA 1P0PA 3GA7A 1C4XA 1JKMA 3F67A 2GBFA 4QLOA 1QFMA 1F8UA 1Y7HA 2IX9A 4Y7DA 1R1DA 3MUOA 2VSQA 4FWBA 1CFJA 4BAGA 1A8SA 3C6YA 1JMKC 5CH5A 3F96A 5CT9A 2DR0A 5C8ZA 4QDTA 3B3QA 3WIOA 1WHSA 3BDIA 3D0KA 4QDZA 1ZI9A 1G4HA 5FV4A 1L7QA 1UK9A 1XZGA 2W22A 5AM4A 2H1IA 2DHCA 2HL6A 1XZBA 4N8EA 5FP0A 1LPPA 4FFVA 5T4EA 4U2GA 4H7FA 5ALWA 1YSCA 2GBCA 3DL4A 5JYCA 2C58A 3BL8A 3WL8A 4EA6A 3D2CA 5LKAA 1X70A 5ALNA 4C88A 4DMCA 1IVYA 1CUIA 1ODTC 3AUKA 3C45A 1I6WA 3PICA 1EXWA 1WB5A 3OPMA 4FLMA 4PO3X 1YAHA 2GBGA 2WLSA 1VXRA 1CUEA 4U2BA 1G5FA 3LLCA 1XLVA 3C5WP 3H2KA 1LGYA 3AIOA 5DNVA 1K4YA 3PFBA 3H0CA 3GUUA 3GELA 1MT3A 5ALDA 5HQ3A 5CXXA 1UKBA 3FCYA 4GEGA 4GBGA 2YXPX 5DLPA 4BE9A 1ZD3A 5CMLA 2QUAA 1RWQA 1DTEA 4QZVA 3PI6A 4EY5A 5AKGA 3F98A 1ZD4A 1EDBA 1DU4A 4NVRA 3WWOA 2W6CX 5AIBA 3I6ZA 4F60A 3ICVA 2XDWA 1M33A 3F97A 1QIMA 5J3JA 2BFNA 2HA7A 1R50A 4JH0A 4QE3A 2WU4A 3WL6A 3BIXA 3UUEA 2DQZA 1E8DA 1VKHA 3G0IA 3T52A 1VLQA 1O6FA 1UT6A 5JZSA 3JW8A 2D0DA 4KAJA 3W9UA 3NUZA 3JYHA 1XLUA 1XQVA 4PNZA 2PL5A 5E4JA 4B7ZA 4XJVA 5EFZA 4GW3A 3R3ZA 5AI9A 3WWDA 5AI8A 2C0PA 3H2IA 1T4MA 5FUMA 2WTMA 1QTRA 1LZLA 2ES4A 3CN7A 4UFNA 3IVMA 1R9MA 1TQHA 2Y1KA 3G0BA 2QXUA 4QA9A 2WUFA 3DCNA 4DGQA 1QONA 2ONCA 3FBWA 4J0HA 5AKJA 3R3UA 4KACA
chains in the Genus database with same CATH superfamily
3E58A 4NYMQ 1C7ZA 1H6BA 4QYSA 3SJAA 3OHPA 1KP9A 2Q2QA 1A2OA 3FCUB 1YMUA 4L16A 1VP9A 2Z5GA 5DI3B 3VZCA 5YASA 1ZGZA 4F3NA 3PZRA 2PLAA 4Q18A 5DM70 4U7JA 2RDMA 3GX1A 1KIAA 3QFFA 5F78A 4LXXA 2APJA 2VRNA 3E9ZA 5EFOA 4I3HA 4EB0A 3VC1A 3WLRA 4MI6A 2FPGA 5JC8A 1L6IA 2R6CA 1HEIA 1V5GA 2HJ9A 2ZUVA 3DKPA 4L9WA 4LRYA 1NU6A 4RADA 4Z51A 1E3WB 1UKYA 1V4BA 4OJTA 4U7HA 3DZ8A 4A4DA 1YR2A 1J21A 2OZLB 1IK6A 2R5FA 4MB2A 5G0UA 1EFAA 4FFMA 3N0WA 1XKLA 4DNOA 3B53X 1KEWA 4ERXA 2AKEA 3HCBA 2HUNA 1C0EA 3WTBA 3JVEA 1PVOA 3RHSA 1E9EA 2A78A 2PKWA 4FYWA 2E89A 4LXYA 3IA7A 5L4NA 3OCJA 1NA5A 4QYXA 2QYOA 2R6HA 3CRNA 4ZJPA 3G5LA 5H1YA 1TFUA 5BQPA 4QTYA 2ID9A 3JARB 3MMXA 3FPAA 4X7RA 3LL7A 2HT1A 3R6WA 5C5EA 1DKUA 4JVSB 1DQNA 2P27A 3RYCB 4HGYA 3WWPA 3TRFA 2CE2X 3PSAA 4O4LF 4EYSA 4DSUA 5L40A 3RT9A 1PZGA 5JI3E 1C41A 3EGXB 1U31A 1THGA 4LZAA 2E48A 1T4DA 4FFSA 1JLLB 5EIXA 3LLSA 1J97A 3EY9A 2HH9A 5CT4A 2IE0A 3JTMA 5EZYA 4QBTA 5KQGA 4XFKA 4BOYA 2OM6A 2AEFA 3KVRA 4PLHA 1OYVA 3UAXA 4IMRA 2WJ4A 3A31A 4YMWA 3C8HA 3I34X 4JLVA 3WQBA 2XLBA 2NW6A 3K5HA 4S12A 5CVVA 1H8ED 3EMDA 3UW1A 3SQXA 3I9KA 3OQJA 1KYTA 3K9WA 4PLVA 3R7DA 3EVAA 1UPXA 3LHFA 1EVEA 3FAKA 4G8JA 2O5VA 3K0HA 4UVEA 1LWOA 5JMWA 3KEGA 3JAKB 4ZVRA 1LXCA 1KY4A 3O8LA 2AC2A 4ZKDA 1M34B 5HZKA 2PE5A 1ESNA 2WTNA 4JYMA 3Q4GA 3M8KA 3W7VA 1FEZA 3ST7A 1NXPA 2OHXA 3KT6A 2WWWA 3VZBA 5B6PA 3GT7A 5IVPA 2I3AA 3VVCA 5MGNA 2AUNA 3OE1A 3QEMA 3VBEA 1BCSB 3H2ZA 3ICWA 4D3SA 1JJAA 3BRQA 2FRXA 2CNKA 1PJZA 4LJ8A 1GPLA 3ILHA 2AFVA 3MRSA 3H84A 4JXKA 4WKPA 1ZAYA 1R4NB 2HJVA 2PJZA 4QFBA 1EXVA 3UBTA 4LXIA 4N01A 2XQIA 3VU0A 1CUWA 3GB9A 3I8SA 5B7GA 2C1ZA 4BKRA 1QHGA 3EWSA 4S35A 2VNJA 1F2VA 3UVEA 4OQ4A 4ZMBA 4Q1DA 5JFGA 3ZWPA 1J8DA 1I2ZA 5IBRA 3ED1A 2EZ8A 1CUBA 3NALA 5JPDA 3NIDB 4H1UA 3RQSA 5COBA 2VZ8A 4CJXA 1JG2A 3FDJA 3IULA 4MK4A 1U0NA 4BMZA 1UMCB 3JALB 3PFFA 2XOKA 4Q3OA 3PQ5A 5HDBB 3CY6A 1G7TA 4AJNA 2ATXA 2OD9A 4UEJA 2GN2A 1FU7A 2NUAA 4G1UC 2HXYA 4KO8A 3SJCA 4B32A 3LUPA 3U4CA 2N46A 1PR4A 1Q0SA 3EBOA 3NDPA 1XVUA 5KPDA 4DA0A 1ANKA 2QQEA 3JXEA 5CJJA 4QT4A 2OC4A 1V16A 4TT3D 2W2LA 2ECQA 2JHFA 3GEEA 1ZJZA 1PYGA 3SXPA 4ZI7A 4XXHA 3N5KA 3M5WA 2VHEA 3SGLA 4H35A 4ALLA 2BFPA 4ND8B 3EXFB 2I6GA 4BNVA 2NT4A 3N05A 3AO0B 2DSTA 2ZYDA 2FPIA 5AQEA 3ZY3A 1EA5A 1ONPA 2B6NA 2HKIA 2FFAA 3I05A 2VNHA 2A1IA 3OTIA 4ETMA 3I9V1 3RV4A 1SBHA 1BDIA 1QV9A 3A3PA 4EPVA 3RABA 4HK4A 4N7RA 4Q05A 1L5SA 1F4VA 3E03A 4RVGA 1P4AA 1QYIA 1ZJ5A 5CT8A 4ZQFA 5TMDA 5KYWA 5SYMA 1QZ3A 3DW3X 5T3YA 1C1XB 3WNDA 3K1YA 4DPMA 1I8TA 4UM5A 2WWGA 5FH9A 3OD1A 4LYEA 2Z57A 2XTAA 2ZTVA 3EC7A 2XQKA 1RHMA 3QUBA 3ZJ5A 1JTVA 1DZ3A 5EIWA 5G0WA 1WR8A 2BBTA 3WYGA 4K8RB 2NU8A 1RI5A 3QE3A 4JROA 4X1KB 1E4EB 4KGXA 3AFNA 2INGX 2NOAA 4UTNA 3CMMA 4TGLA 3X2FA 1W4AA 3OZAA 4FSDA 5E9JA 4RIGA 2ID4A 4D9CA 1JQDA 1ODIA 3RTCA 3KYCB 1TEVA 3THYA 4R41A 3R8CA 2VTDA 1UWKA 1WTCA 3FHTA 1BMTA 1S96A 821PA 3EMBA 4FCWA 1DOHA 1NP7A 4UD2A 2AMYA 5CCDA 1KIFA 2HRDA 3NIBA 4WH0A 2ZULA 4PGHA 5FNVB 4IEEA 5DNEA 4LYJA 3OTQA 2O19A 4FQ8A 4EHBA 1EGQA 2CXXA 4CKEB 1P4GA 1WOMA 2OWEA 4Q3EA 4QPNA 1GNPA 1RRKA 4OK3A 1FNBA 4Y6RA 3J81k 3JD4A 3N76A 1JFSA 1SKYB 3EMVA 3TIVA 3HWSA 4PHHA 1ZIDA 5IMSA 4N7JA 5JQGA 5HZHA 1JDVA 3WDLA 1YB6A 4NDZA 2SKCA 1OFUX 1X1RA 3KUUA 1U28C 2VDJA 4FR5A 2NU6B 4IGEA 3CKKA 1N7JA 4XH9B 1FQOA 1IM2A 1KH3A 1SCJA 2RARA 1ZCZA 2Q5EA 4LC1A 4OIFA 1Q0LA 4PZEA 2WKPA 2OORA 1ESEA 1I9GA 3DUFB 3PQCA 3B6JA 3C5CA 1S9HA 2VI5A 3C1TA 2XHZA 2XUOA 1DO0A 3C3CA 4OHYA 1R74A 4DCMA 4P9NA 1RCFA 3AOEC 3A6DA 1FU8A 1D03A 3O2JA 4JX8A 3RS7A 4B46A 1TK3A 1Q14A 2DUUA 4B7UA 1ICIA 5A4DA 4R2KA 3JD1A 5MHTA 4CQNA 4R31A 4CR7A 4J0KA 4CW7A 2P1RA 3USZA 2VRBA 3WYFA 3OSUA 1ZOPA 2AJBA 3DMFA 2WV9A 4QEZA 4ZKEA 3I4FA 2UU9B 3C87A 2WE8A 1WXDA 2C04A 4XPIB 2HW8A 1U1DA 2YV3A 3RSHA 2PZEA 2FX3A 2IPXA 3UH1A 1KQFA 1T6YA 3PWZA 1C3VA 3BICA 1C9YA 2EAUA 1CSEE 3H19A 4IQ0A 4RTRA 3HB9A 3N86A 3NZEA 1ND5A 4NNPA 2TMGA 4MPDA 1B16A 1EB8A 1FX1A 3RFXA 1RYBA 2CXRA 3KYDA 3ZWCA 4EJ6A 1XAIA 4PAWA 1L9KA 2QNRA 1AKYA 1HC7A 1NXWA 2GJ9A 2P5SA 4DCTA 3THXA 1U2GA 1M1NA 4JC0A 4CM4B 1ZD8A 3PQ7A 4G5SA 4TUYB 2C84A 1WDMA 3BD9A 2X15A 1EFPB 4MMYB 2BJHA 1NASA 3WIEA 3BJEA 1GN9A 1Z6AA 4S1TA 2W4QA 5JAMA 4WNAB 1DAMA 1XAJA 3DEZA 1O2DA 3I01M 1OFUA 2XCTB 4YAEA 4QD3A 1D5WA 3QY0A 1HBJA 4WASA 2GBLC 3SX2A 4DCCA 4YT8A 3LKVA 3KT0A 2G0NA 3MXOA 4ZZ3A 2YNMC 3QEBZ 5BSEA 4GO1A 2AXPA 3RVOA 5U4QA 4DUGD 4L02A 4V03A 1GZDA 2BFBB 4B3IA 4YRNA 2BM0A 4KODA 2A0KA 1CUUA 2O3QA 4U8GA 5H82A 4FYYA 1IULA 1MU0A 2BGRA 3I01A 3PJRA 5F98A 1DG9A 1KXJA 1EAYA 1OU4A 4QFCA 3KZNA 2EJCA 4UTOA 3D6HA 3PYMA 3CF2A 1WTAA 4V39A 5D5PA 2JDID 5HFNA 1EWTA 4F9TA 5LMNB 1PL8A 3QPCA 1JEJA 2PV0A 3IUMA 5A3VA 5TX7A 1GKUB 2G9NA 3F2VA 2HO5A 4FEAA 3VA7A 3RJ9A 1RZRA 721PA 1J06A 1L7VC 2BMWA 3GZ4A 2VTEA 4G1CA 4KC0A 3JQ7B 1IB0A 1Z0KA 4OHZA 1Y81A 4PZAA 2R0QC 2XHEA 3LX5A 2CBXA 4X1YB 2VT2A 1T9DA 3V2UA 2C5BA 2QRHA 3RYFB 1SN7A 1ZVMA 1M8GA 3LCUA 4MV0A 1WETA 2HRZA 2BSXA 4RYLA 3Q0EA 4MUHA 5E3JA 1GDTA 5FTWA 2X7JA 3P0JA 4A6XA 4RKEA 5JAHA 5C8VA 3L7OA 1MJFA 3TDKA 1QRSA 1VJCA 1YO6A 3QI7A 2B4AA 4W6ZA 1IQ0A 1XELA 3ZE7A 1G1AA 4AIRA 3VZDA 2BFMA 1XIVA 1IB6A 3B6ZA 4QG7A 1DG3A 3ROEA 2PBRA 3V33A 1T2VA 4OUDB 1JLHA 3IQDB 4RTNA 3GZNB 4PFJA 1AY0A 4G07A 5JU6A 4YP5A 2AE2A 1X1EA 5LZ4A 1NYLA 2W5UA 3R3YA 2COKA 4JI6B 3FFXA 1NM5C 2EF0A 3FLBA 1VXOA 4W6QA 2ZB7A 1M72A 3RNOA 2DQYA 3ZDRA 3RVSA 3GDFA 4YJFB 2QEQA 4JENA 4CM6A 4R9UC 3UENA 2DBQA 2OR3A 3CXUA 5KOYA 1JYFA 4LZLA 1DXOA 2O2SA 4WFJA 2C3OA 4IIDA 4Q1FA 4ZEOA 5ABPA 1QU3A 1KJWA 1J8VA 1XBTA 4MVJF 2C9MA 3O3MB 5D3MA 4ZHQF 3LJKA 1LD3A 2VYCA 3ZIUA 1BAPA 2O8DA 2X23A 4QBHA 4WXYB 5HZGA 4MCJA 4FFNA 2VDLB 2AZ4A 4A10A 1M2OA 4KIWA 4CM3A 1OXKB 4P7FA 3IIMA 4ZQHA 3HKCA 4BLQA 2W6NA 2A94A 1X1QA 2WF5A 3TTUA 3G7UA 4M0FA 1GGMA 2F67A 5EVJA 1G20A 4E5YA 3EUFA 2QMZA 2XE8A 4XQEA 3SC2B 1ITZA 5IFLA 3L82B 2NUTA 1KTIA 1S01A 1UDAA 3FNGA 1Y3DE 4H3VA 1RRGA 1S1CA 2O8CB 2NSJA 3OLVA 4HWOA 3AXSA 2O05A 2GJAA 4WD3A 5DTQA 5G4KB 3W5DA 3B5IA 2NT3A 3CYFA 1TA0A 3C6MA 5GV8A 4BIMA 2VJPA 3R3SA 1GQFA 3WMXA 4C5CA 5JZ9A 2Z1NA 3QWAA 2ZP1A 5BOVA 3VR4D 4BO0A 5JRZA 2W9XA 3TE7A 5JZOA 3KV3O 3C2QA 1N5KA 3NGLA 4NJOA 1GU1A 3M6IA 4L75A 4YECA 5I48A 5IEJA 1ECPA 2IKQA 3CH7A 1RW4A 2FEMA 5DGHA 1OWNA 3G5MA 4WNCA 2EKPA 2JGDA 4TL8A 5KVQA 3IBSA 4EUSA 4LVOA 2VNSA 2XMSA 2XZPA 2Q9AA 1IBMB 4HWGA 3T1VA 2C7QA 1C9JA 2C2HA 3M1YA 2WJ3A 4NS4A 2Y0DA 4KMOA 4EO4A 1TYZA 3EH1A 1OBOA 2IHUA 3AEKB 1KE1A 4RK5A 3TUIC 1CP2A 5LYJA 2FOLA 1FSSA 5AP9A 1Z29A 3KQSA 1DV1A 4B17A 3Q9UA 3VSCA 4LDNA 2QG4A 4JJFA 2QWXA 3HLTA 3WSWA 5DSXA 4H2DA 5FWAA 5FBZA 4O5OA 2YWHA 3AJAA 1F20A 2FRDC 4YAFA 3S5JA 4RZUA 1BCRA 3PSHA 3RFVA 4Z3OA 4D56A 2CXNA 4JT8A 3ROPA 4DSOA 2ZB3A 5CA1A 1WZCA 1UBFA 1QHHB 1C5KA 2ZPUA 5JJIA 3UK0A 2GYVA 2QTMA 3IJRA 4XARA 1F4PA 3UAWA 1W75A 4EY6A 2IEBA 1PCXA 1G98A 1YQTA 2EVWX 3LPMA 3GGPA 1YJCA 5DHRA 3A58B 1PI3A 4B6GA 2ZJ7A 3LY9A 4WACA 5LP6B 2EJBA 2YNMD 3BMQB 1AQUA 2XD4A 3CH6A 1B76A 5HG0A 3GLFE 5L7TA 2QMHA 2I2BA 3X2SA 1OWPA 4TL7A 3KYJB 3RBVA 3RIHA 5B5SA 3LTNC 2FLKA 3MT0A 1J0CA 1NVEA 2NAFA 3UK6A 5LA6F 2HQ1A 3DGFC 2IPOA 3U09A 4N54A 5KHLB 4A8JA 1HZZC 2C54A 5HDQA 1X19A 4OGFA 2CEKA 3OJFA 1Y5LA 4X8OA 4RTPA 4M1YA 2G1UA 3IC5A 4UTXA 1U2TA 3UC5A 1QO9A 1FRFS 3B82A 3I2FA 5K0EA 3QYPA 4ZMRA 2FSSA 1BQ3A 3H17A 2G7ZA 3BTUA 3DKIA 5DBIA 3SQLA 3OWHA 4EI8A 2FMTA 2KE5A 1U5CA 3O4VA 4REMA 3MWDB 4ZVMA 1YB7A 1HMYA 1N6KA 1WUYA 1HNXB 1JQAA 4LJAA 4PZCA 1LW6E 4GPZA 3W5AA 4ROTA 4A8JC 3JQ8B 3WMWA 3WK8A 1OWOA 1Q57A 3CF0A 4LMBA 2IKSA 3HFSA 4JUCA 5IVKA 3DZBA 4E51A 4HPXB 2YN2A 2F9FA 3JZIA 4C7XA 1MMFB 2I1WA 3BMOA 1V9CA 4IIVA 5CIQA 5EE9A 5SZKB 3RTDA 3U4HA 3VBCA 3U44A 1EIWA 1GSAA 2O57A 1L7MA 1D1QA 5C4IA 3UOGA 3OY7A 2ISSD 4ZOAA 4IGFA 4B7CA 5I45A 3S2ZA 1O96A 1NPYA 4JFAA 3AU9A 5FD8A 1W93A 2WIJA 3AERA 2JCGA 2VL7A 4J2HA 4Q39A 3DHYA 3WHPA 3L7LA 4IDDA 3TI7A 1F3OA 1QWSA 1VOTA 1U3DA 1YOBA 2XSZA 3GBSA 4UMDA 4W4TA 3R0ZA 3GRAA 4G56A 4EW1A 5CDYA 3SF8B 4G1FA 2FG7C 1N2SA 1AGRA 3DE3X 1M5UA 2IYAA 4MVJG 1B23P 2QU8A 2J41A 2RAFA 4HUTA 3CVJA 4F6RB 5AM2A 4MXDA 1X38A 3DBHB 5E8RA 3H04A 4M9ZA 4PR3A 5B7QA 1UZAA 2ZANA 3G8BA 2H5EA 5DBEX 2ZT6A 5CD9A 3ZLVA 4CKYA 2EGUA 1JDBB 2XLCA 3W3AD 1FYXA 1UMBA 4RGBA 5K1ZA 1DUSA 2ZUSA 3TKLA 1C7IA 3K3PA 1K68A 1ZCJA 4I8DA 1TF2A 1SUWA 3FUCA 2QRUA 1NTRA 1Y82A 3D9QX 3FPBA 1AXRA 2FSVA 4Y9RA 1DDIA 4F0JA 1QTQA 3VO8A 3K73O 1NFRA 2WNIA 3RO7A 4GPTA 4CL2A 3VKHA 4OH1A 1E1NA 3AM1A 2J5BA 1OFIA 3KALA 1Q2XA 3GYGA 1HK7A 4HFRA 2CKMA 5HKLA 1J1ZA 4LJLA 1H9AA 2G9RA 2HSDA 3WLMA 5KWJA 5J2TA 4IHJB 3ZDFA 4F4UA 2OPBA 2ZXUA 1KR2A 1Q3KA 2CV0A 4KFSA 4HB2A 4YQEA 3S55A 1QO0D 4ZCRA 2ZDGA 1EEXB 3LGSA 1KI3A 3A2LA 2VJMA 1JA0A 2PWZA 3AHDA 4BMPB 4GGOA 2NPIA 2ZI3A 3I2GA 3KL2A 1BMFD 4GX1A 1NW7A 1NDHA 4KWTA 1F9AA 2AMJA 2C4MA 4JBGA 4WBNB 3H8VA 1CQIA 2AIRA 3MHPA 2AG5A 2LDBA 3C7AA 1K0UA 3DMTA 4QQKA 2WVJA 4COKA 1PDVA 5I8PA 4UHKA 2F4NA 4IDGA 1QVVA 1U9IA 2BEWA 2NSYA 2Q5LA 2ROQA 2PMKA 2VUUA 4P54A 3ZCRA 2F3PA 4F3RA 1BJRE 2WWFA 1U99A 3ZV4A 3AILA 3DV0B 1CF2O 1PX2A 3KTAA 1V8OA 4HDSB 3OESA 4X7MA 1CHDA 1OHHA 1RMQA 3QWBA 3ZHOA 1R6VA 3IOEA 4Z53A 1KOJA 2NZWA 2OBLA 3JD3A 3MGGA 4NU6A 1UK7A 5BSMA 5PGMA 1PG2A 1PJRA 3FPFA 3G2MA 4J4BA 4E2FA 2QAGB 4Z7OB 1DPFA 2GSWA 2SHKA 5LBIA 4EUFA 4WCFC 5SZIA 4B6FA 5EXPA 4MS1A 4LKRA 2B37A 2OL4A 2Q4DA 4F5EA 3NEAA 2ZYTX 1G18A 4B87A 4JA2A 4C6RA 3P9XA 3K70B 4DR3B 1B43A 2XXJA 1GDDA 4YC7A 4X64B 3SDBA 2WHYA 3B1WA 1C7FA 4H6VA 4P4NA 3DEYX 2V6IA 2XUKA 3WOVA 2C5FA 3L0SA 5CYPA 5IJ9A 5K45A 3R09A 2IEIA 4RK0A 4PGGA 4L8FA 4BFSA 2WUVA 1J0AA 4RA6A 3K6SB 3ZDCA 3L46A 3OJ0A 4J9UE 5TS3A 2OO7A 5FEUA 1ZUD1 3LVRE 5D3ZA 3T54A 5EMMA 5LQKA 2Y4OA 4JB2A 4RSRA 5IJXA 1KZ9A 2ZUDA 1XEFA 1E8MA 5ADUS 1O3YA 4II2A 1NBWB 1YFKA 1MR3F 2I91A 2AX4A 1RJ9A 3C43A 1H8HD 1P18A 3LWBA 1NVVQ 1LVUA 4RTLA 4LSZA 3PPVA 1IPFA 3QKTA 5I5EA 2O8FA 2QRJA 3GJ3A 3ZHXA 4CIXA 3DL7A 2HADA 3LGAA 1HI9A 1FDTA 1O8CA 4RXTA 5AJTA 5L45A 3OZRA 1W5SA 4DV5B 3KHUA 5EMHA 1JBKA 1U4NA 2ZE5A 1SQ5A 4GSKA 4P8RA 1CUXA 1EWKA 3IGFA 5FO0A 3RC9A 3FPJA 4ON9A 4X92A 3HRHA 3KUKA 1DJLA 2DLDA 1YRWA 1Z4OA 3IP7A 5F1KA 1QZZA 2QG9A 3DVLA 4INAA 5K0CA 2IVFA 4NYIR 4G37A 4W63A 3O2QB 4HNAA 1KPIA 3HS3A 2DWOA 2PS9A 4P4UA 5D1NA 4G1VA 4UBJA 1CEYA 4WBXC 1E3EA 1QX4A 3AP1A 3H87A 1XUOA 2C7VA 3TFOA 5DTRA 1K27A 1X7HA 4QFDA 2ONYA 4I4CA 4JSYA 4RZIA 1VZ2A 2WHEA 4W1PA 5BSWA 4C4AA 2ZRJA 3PDHA 5IWCA 5DYTA 4AMGA 1K06A 4RE6A 2FV8A 4TV9A 2P90A 3KVYA 2PGNA 3LF1A 4FGJA 2QRZA 4I4NA 4W9RA 5JDCA 4BVLA 1NL3A 4V24A 1M6NA 1UQTA 2OCDA 3U5TA 3PXGA 2C2BA 5LQRA 3IIIA 3RVNA 4I1RA 3PE3A 5CPFA 1LWNA 3WC4A 1VHLA 1NMXA 3W8RA 3B2EA 3KPYA 1EMDA 4NBUA 1SULA 2ZRKA 1V4VA 3G8CA 3F3KA 4I19A 1LPAB 1I01A 4UJ5A 2FW8A 2UZ1A 1TJ5A 1VLVA 4LAFA 3GROA 3SJBA 1J2RA 3GAMA 3I0ZA 4H27A 4R05A 1RPNA 3LPAA 3KV1A 1DLJA 2ODEA 4M9RA 1YE5A 1F8YA 3GGOA 3KZCA 1ZJYA 4CMJA 2XWSA 4KAFA 2J6BA 5CURA 4OMDA 2FX2A 1EHYA 2WSBA 3O1LA 3QELA 1JKFA 3OU2A 5CK5A 3TX2A 2WZCA 2NO1A 2D5CA 5CGQB 2BHTA 7REQB 1TPYA 3GLGE 3U1BA 4B33A 2BTOA 3CF6R 1N1MA 3INGA 2CVFA 1AUPA 1L4NA 1I7LA 1QBKC 1YB1A 2OMKA 1KBOA 3I83A 3C3MA 4X5OA 2Z1MA 4LSWA 4OQDA 2G5GX 3P4XA 4R2XA 3EY4A 4EL0A 4KYTA 5KOJB 4GR9A 4ACBA 3GQBB 3N5CA 1T5TA 1IDN1 1PYDA 3HXKA 1K0FA 4AUNA 1FYEA 4AY4A 2QNBA 2HQRA 1TKAA 3VHXB 4ENRA 2YHBA 4I1UA 4GOLD 4PFQA 4AG3A 1OH7A 3R6LA 3UJ6A 1RPZA 1F0PA 2EWVA 4FMBB 4FDTA 4WZBB 4XLZA 5DLDA 5AESA 3DDSA 2I4IA 3NRJA 3DLBA 5DGCA 4NCKA 1JEQA 2V7TA 3KE9A 4HC4A 4UASA 1X1TA 4JQZA 4HAVA 4S24A 2MSDB 3PHIA 2I2WA 1E5TA 3OECA 3T41A 1C30A 4CR8A 3ESAA 4MTCA 1Q16A 2H4HA 2CLEB 5E7MA 3JTEA 3E0QA 3B20A 4HLNA 3CWQA 2GZ2A 1Y5IA 2QLNA 3BREA 2I4TA 3EOAI 4QGBA 3KU4A 1PV1A 1W9MA 4IG4A 3ZTWA 3EXIB 5IYZB 1N6PA 1N0UA 2CJWB 2F8LA 3VAZA 2WHPB 3JYPA 5HOQA 1QQAA 1XU7A 2Y1GA 5J5CA 1SBQA 1XA3A 2YV5A 2GGSA 2A86A 3GHHA 4A5SA 1E2DA 3OD5A 5CP8A 1O9HA 1R0SA 1ELOA 1VE3A 1RRVA 4OSPA 4ROSA 2D62A 1WZUA 1HORA 1PWZA 5CW2A 5FLYA 2J0VA 4BECA 2DTEA 5KX5F 2XW6A 4EZBA 4JNKA 5BWLA 3SN6A 1SC4A 1T3SA 3DOHA 1ST3A 1W94A 2ENUA 2XCUA 3VTZA 5KYGA 5LP1A 1IN8A 4U6SA 1NUPA 4UZEA 1YAJA 5EJMA 1D8TA 1FUUA 1C1DB 1J8MF 4ZZIA 2YHIA 3Q40A 4MUEA 4PSKA 3H9QA 4LGMA 4RGVA 4FSXA 4JLJA 4UHBA 1N75A 1A9XA 1M10A 3O26A 1W1IA 5A02A 1AU9A 3VJLA 1P1RA 1QQ6A 5TDHA 1PN3A 3RHFA 3CUYA 4HQFA 3PCXA 1DCTA 2QTBA 4K46A 3OE4A 2FQQA 3UPDA 4MR8B 5AVQA 4B4OA 3NXSA 1XB2A 3LVQE 1G21A 4TRJA 3ILSA 1D2MA 3T5GA 4TLBA 5DKFA 3V8MA 1U0TA 1X14A 3UMJA 3R2JA 3ET5A 2WE7A 3S7ZA 1DXYA 3NUGA 1Z5VA 3CG0A 4EYGA 1XRMA 3EPKA 3L7IA 3QV2A 2XUIA 3FKSD 2YY6A 3I92A 2GK4A 3PXXA 4REOA 5CBPA 3R5FA 3QLJA 3FGPA 2D3WA 4XOIA 3DBIA 3QENA 5CFPA 5EIHA 3A6LA 1CX9B 1GO2A 1QHXA 2SCUB 4NENA 3MM4A 2HPHA 1ODSA 1NBME 4IM7A 1E62A 3R9XA 3DLIA 3AY6A 4C7MA 2IL1A 2VT3A 2NU7B 1A77A 3AW9A 3N8GA 2YIDA 5I9MA 4I1IA 5DNDA 4C0AC 1QSGA 5H02A 4URXR 1K5GA 3DZIA 1G7CA 3GEMA 2RD2A 1DAIA 1P75A 2GK6A 3ZCVA 5DN6D 3O3OB 5REQB 1PO7A 3AG5A 5TV2A 1T1GA 1TT7A 4LQDA 1HE2A 4A0SA 4ZICA 1Z0FA 2JRLA 1U0BB 1WUJS 1GL3A 3DNMA 3P0HA 1E2HA 1T1RA 1ONOA 1IXKA 2PZBA 2D1SA 1VE1A 3KDAA 1ZIYA 4HXYA 4K9OA 1QJCA 4OQPA 2VZ0A 5CXQA 3FRHA 4JC4A 2ZROA 2VF8A 4OJQA 4O2LA 5CNJA 3RDPA 4CV3A 5BN1A 1KOFA 3QITA 2D7CA 4JV5B 5K7SA 4J75A 3FFWA 2AF3C 2H5IA 4GT1A 4KUGA 1E3QA 5ILOA 4AQDA 5EQTA 1NC3A 4PFKA 4RH1A 4OHOA 4R1SA 1I1HA 5KREA 3ZDDA 1WZ2A 1HL3A 2G63A 4LK3A 3ZHTA 1AG9A 3CSSA 4PPYA 5E1OA 1SCKA 1RXCA 2ZYWX 4RL4A 1M2KA 3I45A 5E9WA 3WP1B 1LK5A 4MS4A 2Q3DA 2C29D 2HC9A 2RHWA 3E84A 4OL9A 5J5AA 2CK3A 3KQWA 4GZLA 5HRAA 3CT6A 3AF3A 3W8NA 4JIGA 1FBNA 1Z28A 3F7OA 4QG3A 3EVGA 1UP4A 5TPZD 4F2DA 4F9GA 1HTBA 4DZZA 1E9RA 3HDJA 1SVLA 5F2KA 1RIFA 1Z6YA 4LNAA 1GYRA 5ETJA 3NAGA 4NMXB 1KZ7B 4UAVA 4PINA 1IY2A 1TECE 4O3MA 2NLOA 3JQ9A 4UFPA 1MV5A 2OUIA 3A1UA 3OO1A 1P29A 2FKNA 2L42A 4OU5A 1J5PA 3FD8A 4R3NA 5CVCA 1XNQB 3IRUA 3JRWA 4D44A 2X2EA 3M6UA 1SWVA 5FUWA 4TLCA 3V97A 3NYRA 5IASA 1MQSA 5H80A 1ESZA 3OQIA 4QXAA 1OT5A 1XZJA 4HWSA 3COWA 4GPBA 1QFZA 3EZNA 1UBUS 4G0VA 5J9FA 2BM1A 5A05A 1OB2A 4ZAYA 1Z4PX 3M1IA 1QAOA 1KYXA 2QE6A 1XYYA 4PZUA 3ZXUB 3L79A 4OXYA 4NZZA 2FDCA 2JGEA 5EJ7A 4DR4B 4X7BA 2FHSA 1G9SA 1ZFNA 2PYIA 1VMAA 1W30A 2ZUWA 4RS4A 3S4YA 1A8PA 3HP1A 3UUGA 1IZ8A 3O95A 2VUTA 4ONEA 4PG8A 1I6KA 1MG5A 2DKOA 3W8EA 3T1YB 3B1XA 3OUUA 5A7FA 1T4CA 4XFDA 6REQB 4XSHA 1A50B 4N1AA 3Q5DA 4F97A 1PT6A 1H4VB 4MJ7A 3ITEA 4BPRA 5LMZA 1TUEA 2C3MA 2PY6A 4KX3A 1FUEA 3OCXA 4ARUA 3SSAA 2QAIA 2I3GA 3I2HA 3NIWA 5L4SA 1UM9A 3TGPA 5IW8A 1T10A 3E05A 2J9FB 5IZCA 4L3OA 1E6UA 4RHFA 3UMBA 1IY1A 5AM0A 2JLYA 1QCZA 4U7PB 5FPTA 3ZDYB 1G5QA 4AMVA 2PT7A 2X5NA 3MW8A 3X1DA 4C2UA 1J1IA 3GT3A 1SCUB 1YJBA 2QTAA 2Q27A 2P4SA 1L5VA 1VFNA 2V0NA 2DUMA 2ACKA 1FYWA 3QG1A 4GRDA 4IBOA 4MWEA 4W9NA 4AF8A 1TJNA 1M2NA 2JPDA 2VPWA 1KH2A 1L0BA 2HLHA 3H1EA 3D8TA 3HMQA 3Q8LA 3PX7A 1Z68A 3QVXA 3WG9A 3TMKA 2AR0A 5KHAA 2H7YA 2NO9A 2P4HX 4ISCA 4PF1A 5CDSA 5KYYB 4UJ3A 5EESA 2Q1WA 1EINA 5FBKA 4KG7A 2BUBA 4FYJA 4ALNA 1JZSA 1KEEA 3EXEB 1EX7A 4R6XA 3F2IA 1U98A 2XMCA 3W6UA 2P7HA 2IQ5A 1IZ9A 2VH1A 3EAFA 4O33A 5FR2A 3CISA 3T5TA 2ZU6A 1FQKA 1UXKA 1V8BA 3I2KA 1WVIA 2GEDA 2JFXA 4JBNA 4B3DA 3QVVA 1MOSA 4P22A 5ALTA 3FSRA 1CEQA 2ZWOA 1G6OA 3EXAA 2FZVA 4MCHA 4AMZA 1FPMA 2JCBA 1U4SA 3QH4A 1KDTA 4KFUA 1OIWA 3V34A 4BGIA 1RXVA 4DM3A 4D9JA 1ODJA 1PNOA 3OPQA 1T26A 2V6JA 3BSWA 3ZU2A 5COQA 1KJJA 5A6VA 5DU2A 3F3SA 1Q7TA 2Z56A 1L5FA 1YRQA 2N75A 4MW6A 2R6ZA 4DDHA 3EARA 1SEPA 2ZG6A 3H9GA 3RU3A 2J3KA 2ZLBA 3KJZA 1B1CA 3DVSX 4TXNA 4ALJA 5JJLA 4F45A 3MJTA 1RT9A 3FI0A 2RH5A 3FF4A 1PT7A 3Q7IA 4FS8A 1Y4UA 4GYWA 4LE1A 4C0JA 3HCRA 4LWQA 5FPPA 5BSVA 3CB2A 4D02A 5KOIA 2CZCA 1T8SA 3S7TA 3L6DA 2R44A 3B6KA 2ZJ0A 3ONDA 3RJMA 1HTTA 3C3JA 3N2LA 1E96A 2ISCA 2X8AA 3WI7A 2Y4NA 3D8UA 1XA4A 1V5IA 3BWDD 3P9RA 4E09A 2VQEB 1FU4A 3O5AA 4YJKA 1JWLA 2QBYB 1WSWA 1J22A 1YZUA 4GX0A 3L1JA 3T7JA 3RIYA 5B2FA 1OI3A 3O4JA 3SBDA 4AN4A 2H8GA 1P0CA 4O59O 3VR5D 4FWIB 1ZZGA 3N7TA 4I4LA 1TU3A 3M1LA 1TKCA 3UT0A 4MHSA 2B83A 4F11A 4YV7A 2QSYA 2VH5R 3LSTA 4PC6A 4EHJA 1UAYA 3MERA 4RPJA 4NMLA 2GPAA 5AJXA 4ZRMA 2ODQA 2RH8A 5LZ7A 4TZ0A 1WCYA 4R1PA 1BA2A 2GN0A 4F9FA 2O3TA 4HDRA 1Q74A 1DHRA 2WV7A 3UJ7A 2V7XA 3W7AA 3Q9NA 4CCYB 4PCLA 3LTEA 4MKXA 2HCBA 4YJGB 1LI7A 1CUGA 1TB4A 1NLZA 3FTDA 1Y48E 3D8HA 3G2NA 2LRHA 5AJUA 1G8FA 5TPWB 5TQVA 4YAWA 4V1CI 1JR3D 2KS6A 4DILA 2VDWB 1YRLA 1JU4A 1B26A 3HXMA 2HGZA 4M4SA 4ZP1A 2DERA 2MSCB 1VL5A 4R16A 1QGAA 2R8PA 4GI5A 4PQFA 5HF5A 4C6SA 4B3FX 2XF2A 1R9NA 1H2AS 4BNKA 1ZVKA 5EJAA 1CE8B 2G1PA 3ROZA 3UGQA 1GZ7A 3AWDA 1RP7A 4RZQA 2ZT7A 3JQEA 2QU7A 1MC1A 2QOEA 3T3GA 1TJ4A 3HCEA 3BRWD 5GM1A 2JBWA 2IODA 4KX5A 1MO6A 3DLPX 4OF4A 2YVUA 5A62A 3AVYA 2NSHA 1BEUB 4ITVA 5A0FA 2Y3IA 3D43A 4LNUB 4IOMA 1RWBA 3LU1A 1N1GA 5G3YA 4Q5IA 1YFJA 3R7LA 2A88A 2HQSA 2B36A 3AZQA 1NR5A 2GK7A 4P32A 4GSLA 1CDDA 2MHCA 3KZ1E 4NCHA 5JH7F 1NW5A 1LLQA 1UK8A 2QUHA 5J2UA 4DIUA 4JBYA 3GJZA 3OUTA 4QHYA 2UZAA 2H2AA 3SVLA 3LDFA 3IKJA 3K16A 5I4IA 1JJBA 1TVKB 1EP9A 1NVAA 1H6AA 4MQEB 5K3AA 4J43A 5KCZA 4AXXA 4H7KA 2QD2A 1GAWA 2WFAA 1W47A 1AQYA 5J47A 2XRZA 4EB3A 4TLEA 2G6TA 1JZQA 2A9FA 2XWJI 3CPEA 4JQCA 4MZDA 5JISA 5AVZA 2ATVA 5FWDA 2WA1A 5KTPA 4PHGA 5FTLA 2BW0A 3G8AA 4UARA 1VPTA 3IELA 10MHA 4CPDA 5GWXA 3IQXA 2DY0A 5TRTA 4LVCA 4WCVA 1WY7A 3PZBA 3R7BA 3G1WA 4HSGA 3ZZNA 3JVIA 2JFZA 4HEA6 3FVTA 3P96A 3STWA 1AK1A 3WNCA 4PHCA 1HQDA 2UV8A 4L0MA 4N39A 4O4LB 4WL0A 4NU0A 4AY2A 3AEYA 1OZAA 4ASUD 5DZSA 4L8YA 2OVBA 4HQOA 3G9TA 2IY7A 4R0NA 4MP8A 3E70C 5E4FA 4KAAA 1ZQ1A 1Z74A 5TGZA 1FFDA 2CFIA 4NAVA 4HAWA 3ISVA 3H5LA 1D4OA 2DLNA 4MVJH 4MW0A 1S3GA 2AXEA 2RBEA 4OFZA 2EL9A 3KB2A 4CNQA 4FX5A 1NHGA 3LLMA 2D6FA 3ECSA 1QLJA 4BUJA 1C8BA 1QS0A 1FOEB 3LX6A 4PSUA 4WEOA 3BC1A 8LDHA 5FOVA 4AZSA 4PZZA 1Q1QA 1NOIA 2FLWA 4BFUA 2YMPA 1OFVA 2ZCVA 3CSDA 4RM3A 4UKDA 1KYYA 2GDZA 2GLXA 4URZR 3BFPA 5AUPB 1YDHA 3HV0A 2HA5A 1KEZA 3TK1A 4WJKB 3PDJA 2FVYA 2VYVD 1D2HA 1X80B 2M6SA 3NDRA 4GVPA 3IT0A 4YALA 5JRJA 1Q44A 4P81A 1VPWA 3Q8KA 1EXMA 2IZ0A 1PTJC 4Q4JB 1W36C 3AUSA 3ESRA 1K8ZB 3U2QA 3ZVKA 3QYFA 5IM4A 1B8VA 3OJOA 3QA3E 4Y2RA 3MLAA 1VG0B 1DEXA 1GFZA 4MIYA 1JIVA 2H2WA 5KYUA 5JVDF 1MCZA 1RQRA 2W2VA 1GTG1 1R16A 3VI4B 1IE3A 4IX1A 3QXJA 4K6MA 4K88A 2GXUA 2IYZA 2FF7A 2VP2A 3NYWA 4C0QC 4XIGS 4OB7A 1J99A 1QUFA 1OXSC 1KJZA 1XZ8A 4QARA 1ZK1A 4BO6A 4K3VA 4R54A 2WA2A 4DQXA 1LBEA 4CQMD 4KKVA 2ISQA 4E07A 1TYAE 3F71A 4J29A 1DO8A 3R0QA 5HKKD 4AUEA 3HVJA 1KKMA 2YKGA 1UBMS 3E82A 5K3BA 3ZGXA 3SM3A 1JPJA 1XU9A 3DTNA 4AS3A 2VXYA 5DHAA 1FPQA 3D0QA 2BFEB 2ZVQX 5J40A 3VMFA 4D3DA 1ZAKA 3IT3A 1YS2X 3UJDA 1W73A 3BTVA 3KUXA 2XDQA 1RJFA 2TSYB 3B38A 3K5PA 3MYYA 4FD3A 4KWEA 2W2TA 5CA0F 2VSNA 4TMYA 4PIVA 2AN5A 4ZAZA 2X6TA 3OOHA 2HIHA 3KNZA 5ADVA 1B14A 3IXQA 4UPDA 3RCBA 5ESDA 2OY0A 4QIHA 4YPFA 4BCBA 3WGUA 2VDOB 5JBIA 1E2JA 3ZOKA 1L5QA 4OHWA 3FHJA 1BXGA 4X3CA 3TWOA 4EJSA 1COZA 1SG6A 2C4WA 4ZEVA 3CINA 4BKOA 2W6IA 1L4HA 1ZXLA 1NQTA 2DJIA 2IBTA 4P7JA 4GZ5A 1B6GA 4M0CA 4BVKA 3FNHA 3MQ2A 5IARA 4QXOA 1PLJA 1KE2A 2FDRA 2RGNC 4B3MB 4Q3DA 3I5AA 4P3XA 2WIDA 3OPXA 1DEKA 1KZ4A 1VRWA 1SZCA 3FUWA 4CMKA 3ZE2B 4IUCS 1VG9B 2XB2A 4BX2A 1XDSA 4EK9A 3R6DA 2EZTA 1CB7A 1NMSA 5K0JA 1IJFA 2XMGA 3OFNA 1P6UA 3H9EO 3NU1A 1MOPA 5BR7A 1D6JA 1G59A 2CDCA 4TVKA 1I4TD 3LBHA 1VI6A 2BT4A 3IH5A 4CV0A 3IPXA 3FN4A 4L9AA 2PR7A 4CM8A 1BYUA 2J9GA 4NULA 2ZAYA 2FJ0A 3RUCA 5J43A 2DHRA 4HP8A 1K1EA 1NVWQ 3KL4A 1GPYA 1LB1B 1SCBA 2RCNA 3VZQA 4CETA 2CLIB 2X40A 5GGYA 2H5LA 4JB0A 2W6QA 4F5ZA 5ICGA 1FP4A 1QH0A 1QXSA 2Y0PA 2GPBA 4A8PA 3K31A 4U2EA 4HATA 3LT0A 2CNOA 5TGDA 2IS6A 1G5HA 3O82A 3PF9A 4E31A 4EX7A 1R4MB 2CYBA 3CH4B 3P9PA 3WLJA 1NSFA 4LEIA 5JMPA 1E2QA 3LQYA 3DP7A 3OZGA 5ALEA 1PS8A 3GJXC 5HJ2A 3LL4A 1JHMA 2DRIA 4KV9A 3COYA 5ECWA 4L5AA 5E8JA 4B31A 1K08A 1MUUA 2R1TA 1NSYA 1BFKA 1J2TA 2NQTA 2J33A 3L7DA 4DQLA 3LT2A 2FY8A 3AJDA 2QLFA 1QVZA 2VCEA 3ZQUA 4NYIQ 2W2KB 5AI0A 2LKDA 4QLAA 2GLUA 3B1ZA 3BE8A 2Q6OA 3D3QA 1OB5A 1NY5A 1H66A 3H2GA 4N4AA 3NUQA 3WLTA 1L3CA 4EH1A 3COZA 1OAOA 2KM1A 1JS1X 2CXQA 4RW0A 4RSGA 1GNTA 2DKNA 1QYXA 1XJQA 4KE8A 3RSGA 2QTZA 3BXXA 1CZRA 5L7YA 1Q84A 2BKXA 2R68A 1T0JB 1LLFA 2VK1A 4YONB 2HWWA 2QZZA 4X41A 2FXIA 3K0CA 1N8KA 1FW8A 4QSMA 4DLXA 5L3QA 2FPOA 3KRTA 2PYDA 2GHIA 3ORFA 5A04A 2FPUA 3ZOZA 4R2JA 3MJCA 5B1DA 3CVOA 3EF1A 3LE8A 1RIIA 3GEPA 1HE1C 1Y6ZA 2OVFA 3I8XA 1H1LA 3NH6A 4OBWA 4DE5A 4DYDA 1NNLA 4YLEA 5F1PA 2IX3A 2IBSA 4PNPA 3NS7A 4MIEA 4A0RA 4AO7A 4GUDA 2AF4C 2YY7A 1RBQA 5I9TA 3Q2IA 2ZBQA 1XQ6A 3WKCA 2A3RA 5AW2A 1EDOA 4BNZA 1THTA 4F3YA 4O0LA 1Z45A 2MDTA 1OAOC 4CMEA 4B3BA 4K7JA 4HNUA 5AM3A 5BSGA 3KSBC 5JZVA 3KUDA 3E23A 5IDQA 5IBPA 1U5BA 4FSHA 4CVNA 4J7AA 3WLOA 1CUCA 1TVCA 4DBLC 3DMNA 1WF6A 4WLFA 3NTOA 4BJ5A 3AU8A 1DFIA 2ZJAA 1YOVB 4H17A 3C70A 4MKFA 4KXFB 3IVAA 2J8ZA 2GPJA 3R7SA 2PA3A 1KY5A 1QIIA 5ENDA 4LFAB 3MUEA 3O91A 3P27A 4GKAA 1LF0A 3AJ9A 2JAPA 1VHJA 3TNJA 4ABYA 4OBXA 1P8JA 3MGBA 3E9NA 1Z83A 5B12A 4B8YA 4N5LA 1P81A 3R5TA 4MH0R 1RQNA 1CQZA 1YT5A 4D9BA 2CC2A 3M7IA 1ORWA 1KI4A 2DMRA 3SJUA 4B5LA 2ACEA 4DWJA 2QVBA 5HK8A 4U3JB 1WOYA 3WGHA 1TOAA 1UJ2A 2PEZA 5FOXA 3UICA 1I3MA 1O5TA 2H54A 4U7GA 2R6GA 3TSZA 4EQ6B 4AU1A 1J56A 3LOPA 1WQ4A 4W7IA 1JVNA 3GJSA 4P58A 4ZWNA 2BGJA 2XMZA 3INYA 4OP3A 2ECKA 3A6EA 1Z0SA 2QV0A 1SXJE 2D74A 2I33A 1KXZA 2Q49A 3HCWA 2VTKA 1N36B 1T25A 4RHTA 4R98A 2IRWA 3QWFA 5DW3A 3VR6D 1PZFA 3KQPA 4FJ0A 2J5QA 3QMMA 4QLBA 5F9FA 2AXNA 3BS4A 1S1MA 1YZLA 4MVJI 4BQFA 5E6RA 1DKMA 4KQ1A 4BYGA 1GSOA 3AESB 4R8MA 4RKFA 2XGOA 3WICA 3ZI0A 4EJ2A 1Y6FA 3V1KA 2RKOA 1I2CA 4B40A 1ZESA 1M0WA 4Q19A 2XBMA 4RKQA 1Y9DA 3I6BA 3CCCA 1XT6A 2CN1A 1TM7E 1N5JA 1N9KA 2QX6A 2W90A 2WJPA 2ZI9A 1C80A 2ZOSA 4L5JA 2JAUA 3T99A 3IO3A 1WPQA 1N2EA 3LC2O 2JG3A 4PYJA 4V0RA 5JC1A 3O4FA 1QZXA 2GJ8A 4MRAA 3ZC3A 1G8PA 4CT0A 5CLHA 2WB2A 3OEYA 3M33A 4WESA 1P39A 4B5KA 3V8EA 4X6YA 1XN4A 1L8OA 4X8LA 5JPIA 2W8BA 2E4VA 3AHCA 3EQZA 3HBNA 4DNQA 2JARA 3FTPA 3KPJA 2WF7A 5C80A 1JQJC 5KTSA 3PWSA 1NULA 4L27A 2FSPA 1YE8A 4IV0A 4WADA 1XE3A 2CXPA 3QXCA 2YQZA 1QVWA 3AL0C 4IRUB 2QAJA 3CA8A 5H3LA 3TKYA 3SWWA 3D1VA 2Z5LA 1Y1SA 1UXGA 3W06A 2SICE 4QYIA 4ZHQB 4FLEA 1Y8QB 4Q1VA 3WLHA 2AFHB 2CNNA 4RVCA 1DRVA 4MQBA 3G49A 5H16A 4ZEMA 1E4OA 1KEUA 3FWNA 3GLVA 4TKZA 1FFXB 1L5HB 4HRYA 5I7EA 1LPNA 1FQWA 3ZTTA 4KMMA 2OQ2A 2PQ0A 2QZ4A 4ZTBA 4F4CA 4XASA 2UZ4A 4BAZA 1SCNE 1V8FA 1L5KA 4KIUA 3UATA 2NZXA 2XUZA 4Y1RA 3ZD7A 2PUAA 1G55A 1Q1GA 5ADHA 4YRJA 1AF4A 3HRKA 2CD7A 1R64A 1KU0A 2P9GA 4KBFA 9MHTA 4K81B 1T34A 1V8DA 3WFJA 4KI0A 4LISA 4MCIA 3MB8A 4QHTA 4X63A 4PLWA 2BFDA 4F4FA 1IUOA 2PZMA 4IDHA 1ZEMA 1KO4A 1LJLA 1NN1A 3DT6A 3DCYA 2A57A 4DY6A 2G70A 3T4EA 5LOVF 4RQUA 3FNIA 2WKRA 4YHBA 3FXAA 1ICEA 5ALGA 3L7CA 3X44A 2IELA 3AI2A 1CUSA 3T9FA 2WJGA 1H2RS 1U2DA 1JHUA 2XF8A 2XT9A 3SU8A 5BWNA 4PN3A 2J9YB 3DFIA 4NYJR 4ZOQI 1M7HA 3W9BA 5JANA 1TJ3A 4E5UA 1ZXXA 3PPIA 5HZMA 1II8A 4HNGA 3GMDA 3ZH9B 5E6SB 4HX9A 4HZUA 3C8UA 1GTMA 1I6MA 4YJ2A 2A4KA 2XNKA 4OQEA 2CNDA 3PL1A 3NCHA 4L78A 1OLSA 2WHXA 3H1FA 1I5OA 4L6CA 3KPUA 2Q5QA 3IXLA 4RLSA 4A2PA 1IHDA 2AMLA 4N65A 3DZCA 3JWJA 2HJSA 1Y8CA 3ISJA 4L8GA 1N3IA 1L1FA 5IXYA 2QTCA 5LU8A 4RMHA 2PQ6A 2K6GA 2GSDA 3PXCX 3SXUA 3PQ6A 3T1OA 1Q1EA 3VYRB 1GPNA 2AFIB 1P4SA 1QQ7A 4LNHA 2DWCA 3FDZB 4Z9YA 2ZT8A 4URWR 4HGZA 2JLRA 1TYBE 1YQXA 3IQGX 1G5RA 2HK8A 2SKEA 4G4GA 2QRGA 4OFBA 2H4WA 5EIBD 4JN6B 5M3BA 2OXIA 3I64A 3FYTA 3WLAA 2PHZA 2E1PA 2GF2A 1GQRA 4RZ2A 5KNDD 2BFFA 2F2TA 2FEPA 2HCFA 5CEEA 3KBOA 1TVMA 1U3UA 2V7QD 1ISFA 2JFOA 1DBIA 2CFTA 4Y6OA 1RMYA 5LA6B 2YZGA 3HCFA 4B7XA 3HR7A 4BMVA 4ER3A 4OKSA 3GF4A 5HTKA 2Q5JA 2P77A 4WEQA 2I54A 3HJBA 5L6MB 4N5MA 4FE3A 2PXCA 5IAGA 2HTFA 3EXHA 4DR7B 4DQ0A 3CBGA 4ZYYA 4Z0HO 2GNOA 4BVFA 2G5CA 1Z34A 2UAGA 1XZCA 4DM7A 1HDRA 5ALOA 2BWJA 1Q2UA 1SFRA 1FNSA 4F93B 4HRAA 1MW9X 1Y4DE 4J8PA 1C50A 2OCPA 4IMIB 4HDMA 4G5QA 4LOHA 5HP4A 1EX6A 1QQTA 1UPUA 4O4JF 1XYVA 4X90A 3QNMA 5IJWA 1EFVA 3RGWS 2ZWIA 5BVHA 1ZD2P 3FYDA 3GLIE 3F6CA 2A58A 4Y2GA 5FL7D 2XZTA 2HMWA 3HY3A 2EBHX 3BCHA 1U7TA 2AQ8A 3EUAA 2BTQB 4D0RA 1GSIA 1QF7A 1U2SA 2WJYA 4ZVUA 3K1TA 3E2PA 2ZIWB 1KAQA 4KXYA 4KQ2A 4O5AA 4OFXA 4D6XA 1A9YA 1QK3A 2JKVA 1DOAA 4FMDF 4QO7A 2AEMA 4IDEA 3W8FA 1PL6A 5GONF 3THSA 4Y8VA 4KQEA 4DHEA 5EE5B 1CY2A 1RRCA 1QU2A 2R8EA 3ZXYA 1CBUA 4YI5A 1RACA 2C9CA 4R2MA 3WAKA 1XPRA 2UUPA 5EP4A 2VQDA 3BGDA 5G53C 4MV4A 4OLAA 3HY6A 5C7IO 3SHTA 3OIYA 3TD2A 3WGMA 2BLNA 2OBYA 3VDXA 5HBRA 4V38A 1M8FA 4JDPA 2QVCA 1I14A 2X0KA 4C04A 2ADOA 2JLUA 3WOHA 3I2IA 4NARA 3WJ2A 2CHQA 2WM8A 4CQLA 1G6HA 3ZZUA 1KI2A 2DCMA 2O2IA 4PSDA 4RFSB 1V1JA 1E9VA 1JT2A 3MTDA 2Z9BA 2J67A 3PNPA 4AJIA 3L02A 1GCGA 1RC1A 3ADBA 2XYQA 3B9QA 2WT9A 2XMBA 3MB5A 3PQDA 4TQAA 1GL9B 4GFDA 1OYWA 5FIUA 3WB2A 4PPQA 2ZRQA 3O83A 4IKOA 4ZRDA 3OSZA 2J30A 4QNRA 1XZQA 4DV0B 3G1TA 1FVXA 4LA4A 4CCSA 4FFBB 4KO1S 4ZARA 1X6VA 3RUAA 3ZHUA 3KM0A 2B8WA 1XTBA 1W34A 3PJFA 4P7BA 3QKRA 5LD2C 4EKIA 1BOOA 3D4IA 4PX9A 2OB2A 1AO3A 4FS3A 1ZR2A 4EYOA 5LVAA 4PNEA 5GVRA 2O0LA 4P98A 2GARA 3EQ7A 3T7KA 5I4BA 2QX4A 4NSNA 2P3SA 4PAMA 4B6EA 4KKXB 1KVRA 4LTDA 3IKVA 1JILA 1M6VA 1ZICA 2FQWA 4HQ6A 1JSXA 3SFVA 5JJKA 2VBIA 3AVUA 5A0VA 1SK8A 2P4EA 1H9BA 1EXDA 1DMRA 2WB4A 3PQ8A 4LOKA 4F3TA 1PVVA 1V43A 1V1MB 2FSGA 2UYOA 1Z3IX 2Y8EA 4EMBA 1T9HA 3K92A 4I4TA 4BMDA 4MIOA 4URHA 2YXDA 4TMXA 5DXJA 1GPH1 3IIKA 1CD5A 3ZCQA 2OXFA 3T7AA 3QWIA 1S3SA 3ZWXA 2Q41A 2ZI6A 1N8SA 4IPTA 4X00A 2QPAA 1PGPA 2R1VB 4LWPA 3WBFA 4Y67A 3TF5A 5DLEA 2ZPTX 1YVRA 4KTTE 4D8VA 3ZVMA 1SPXA 2O2YA 1Z2DA 2QP3A 2C7BA 3D7MA 2HV8A 3E8XA 5EHGA 4ZD6A 3SQDA 2O1SA 3BA1A 3EIQA 4EVRA 5KWSA 3UJPA 2X1LA 4UZFA 3IUPA 1MW8X 3DVAA 1P5JA 3IAHA 4ZT2A 1I5EA 4Y6SA 5BN4B 1LBTA 4ZT5A 5JPCA 3G6KA 3R0JA 4UU7A 4ER6A 5EMLA 5BN3B 1X7ZB 2PX8A 5GY7A 5K3FA 4UUMA 5NLLA 2D7JA 4MGHA 3P1JA 1VRVA 2YWJA 3O8NA 5THXA 1K3UB 3OP4A 3DC2A 3JQCA 4YAGA 5CG1A 1R0XA 3QW2A 4Q16A 1AA9A 2WR8A 3UHOA 1O95A 1QOZA 3EBLA 2AZMA 4I3GA 4B3XA 1G9XA 4CLXA 2BKEA 3A2MA 2WT4A 4OXKA 1G8HA 2DBYA 5EAIA 2YFHA 3I37X 3WLQA 5AVYA 2JZOA 2OENG 2LTAA 2F3SA 4LZNA 1UOQA 1X9HA 5DM1A 2DQSA 3T9BA 2R6DA 2PYZA 5AXCA 2C88A 3GLSA 2BOVA 1JPVA 1YVUA 3ABQB 4LI0A 4RPKA 5EWLA 4JASB 5C8DA 2W2PA 3PDWA 1M9NA 1SKAA 4QEDA 4KQWA 4CDNA 4CT5A 3WY9A 1C7RA 2Y92A 2F55A 1YIDA 1P17A 3K4PA 2MSKA 3L8CA 3OIWA 1DT3A 4H7DA 1KZHA 3TO5A 1RAAA 2AZTA 3F8WA 5JTUA 2FCRA 2N47A 2TMYA 5EHQA 3FSGA 2PFKA 3ONVA 5CLLA 3ZU5A 4WFIA 1R8SA 1P77A 1F3LA 3OETA 3A05A 4U9IS 1OLUB 1AIPA 2ZS8A 1T8WA 1U1GA 2Y93A 3Q3JB 1DC8A 3KQNA 4DMGA 3B12A 4OCZA 1V8PA 2E0IA 1DV2A 1KZYC 4UE6A 4Q93A 3TTTA 1ARZA 1U3TA 1W4CA 1IAVA 4OGLA 5DF1A 2AJ8A 4D4KA 4WY5A 4Q1CA 4E4RA 3CVWA 4JNCA 3EA5A 3W0LB 1NI4B 3CKYA 2ZKLA 4MTLA 9GPBA 2YVKA 3DMRA 4WDQA 5GTDA 3GVCA 5BWMA 2A1UB 4TOIA 2BR5A 3RYHB 1QHSA 3SQMA 4TTTS 3RYIB 1CUAA 3H2HA 2Z6VA 1LTHR 1PFVA 3BJRA 1SWWA 3COSA 4TL6A 3PKJA 3U9SA 1FSGA 2DAPA 5BPFA 1VYHA 2JJ2D 3P7MA 5T7BA 2A67A 3LPLA 3F67A 4V2UA 4QLOA 1BU5A 1KI6B 5TNXA 1K86A 2R8RA 4V0QA 4W5NA 3EFEA 4WPGA 4JS0A 4F8YA 2ZRPA 1N7GA 2GWHA 4KSYA 1CFJA 2NV6A 4PWZA 1TXGA 3PC6A 1Z5ZA 2CV2A 1V7PC 2VYND 2ZR0A 1T0UA 4ESVA 5HE9A 3AUYA 5C8ZA 3AW8A 3H05A 1WHSA 3BDIA 3ORRA 4MKGA 1GV0A 4Q7KA 2E5FA 4QXPA 2AMFA 4GPIB 3MINA 1ZXBA 3ZWBA 3PGVA 3EHDA 3SD7A 1XZGA 1IY0A 3UPTA 4YTEA 4BFWA 1Q7RA 3KQUA 5E0OA 5AM4A 4MPTA 5FBLB 1E2BA 2WD7A 4DSTA 1DUIA 3SHFA 1M2EA 2XECA 5AUOB 2FUNB 2GJ4A 4RD3A 4I1OA 3QVWA 1O8BA 2HMTA 4HMQA 3C4QA 3KG2A 1TYEB 3DXZA 3ZWKA 5TMPA 4U2GA 2X0FA 5ALWA 4LQCA 4OQZA 1SVMA 1TDJA 2ZBPA 3JR3A 1QVAA 2ONKA 5JCJA 3K0SA 5HJEA 3L5OA 2FW0A 4LVUA 1RABA 1PP4A 1YRBA 2I1QA 3C4JA 3VR3A 3CEMA 2G82A 4EA6A 3D2CA 5I3ZA 5LKAA 5JR3A 3JCZA 1XZPA 4YWHA 5JRDS 1RS0A 1M6HA 1WSAA 1VJDA 3JYLA 3UMSA 3ZX4A 3GNQA 4JLNA 1Y6RA 2AHOA 2EZ9A 5FA5A 2X7XA 4I50B 4XWTA 5J1SB 4RVNA 1OQAA 3OPMA 1VL0A 3NT5A 1F51E 2VYQA 4FLMA 1V45E 4PG7A 4Y7CA 4YRTA 2CMGA 3JD0A 4NBKA 4PO3X 2ZUBA 3HUTA 2GBGA 1UODA 4LVNA 4Y98A 4EENA 5BURA 3QKSA 1OIXA 1U8AA 2WLSA 4C21A 1V6CA 4W82A 2I7DA 3CLVA 4PC1A 3CW8X 3JATB 1Z2NX 2V7EA 4IS3A 4CTMA 3V2GA 1FF9A 3ME5A 3RAJA 3T0FA 3WLPA 5JSHA 5KX5B 3THWA 1VSVA 2A5YB 1RE1A 2OSBA 2AE1A 2VDUE 2N42A 2BGGA 3RODA 3H2KA 1N2IA 4MAFA 1E3LA 5DNVA 3VM6A 2JFFA 1K4YA 4KYIB 5MN5A 1M2VB 1AV7A 3ILYA 4C0HA 1P2FA 2J87A 3A4VA 5KYXA 3A4MA 2PXAA 4WOPA 2MMGA 5C35A 1BMQA 3BWBA 4Y1GA 2Q6KA 3EDQA 3GG9A 1JR6A 2PVCA 3MJVA 4HNHA 3PR1A 1WMAA 2V4MA 3E9YA 3UT5A 2N0SA 2F64A 3OO0A 1FP2A 1HT1E 5CXXA 4YMVA 4DZRA 4C0LA 4EAQA 1Z07A 2GAJA 4GEGA 2ZJOA 3KKMA 4RIEA 3NLLA 4BN4A 4BV3A 2G8NA 4Z0PA 3H16A 3D7LA 1WDLA 1EEHA 2RB4A 3CZQA 4M7OA 3PL5A 2VQFB 1AF7A 3VPFA 4KWIA 4UVDA 2PMWB 4I8XA 2NO5A 2B0JA 1ZVJA 3VR1A 2ODAA 5CMLA 1E5QA 2LCIA 2QUAA 1MLDA 1NKSA 4LCBA 4TLMB 3CKLA 1B73A 3I30X 1L4LA 3AHEA 5DI3A 2Z5VA 5B3JA 1H05A 3PDIB 1SVNA 3W2EA 4QZVA 1BSVA 1ZM4A 3QX3A 2IDZA 4BNFA 3F98A 4MDHA 4UVIA 1ZD4A 1EDBA 4V0MA 4HYEA 4NVRA 2W6CX 3TJRA 3I6ZA 4N82A 4CLRA 4Q9AA 2RH9B 2ZDQA 3FYSA 1D0VA 2REXB 2J45A 3NM6B 3F97A 3LUHA 3PJGA 4FZRA 5KNBH 2CDBA 2GEFA 2JLQA 4WWHA 3LA6A 1R50A 4JH0A 5F76A 4HH3C 4D9MA 4YUAA 2M6RA 2WU4A 2OZLA 3M5CA 3WL6A 1NW9B 3UUEA 5B4TA 2NQ8A 2DQZA 3IJPA 1E8DA 2VDMB 2CL0X 3LXRA 4M37A 4IUDS 4KJZA 4MA0A 4NJMB 4URVR 5CPBA 3G0IA 3AVXA 1OA1A 2BZGA 3C7DB 3QXSA 2AI3A 1VLQA 1ZM9A 3U26A 1UT6A 3UC9A 3NVDA 1GNSA 3CIFA 1WZEA 4U7FA 2XH8A 2HHJA 3GRKA 1NF8A 1GYQA 1OPXA 2YRWA 2XTZA 4RMGA 2G9ZA 3RYCA 1N5OX 1TZMA 1T2FA 2WM9B 2C8JA 2VRCA 2WZBA 2YIVX 3OZWA 1C1YA 5KEIA 2E4AA 4DREA 3Q6MA 1KAOA 1LX7A 1XLUA 1FFGA 1XQVA 3JYHA 3DLHA 2PL5A 2WYHA 5E4JA 5AOVA 4B7ZA 4ARCA 3SEZA 4DA6A 3W79A 1JLLA 4UQLA 3R3ZA 1RC0A 3V4PB 3ROGA 4XVUA 4GH5A 3UB3A 2C0PA 2QUJA 3BM5A 3CB4A 2SECE 3GT4A 3N8IA 4M89A 4P2GA 2JVJA 2YWEA 1PU2A 4MWBA 4EYEA 3OLZA 3DBLB 1QTRA 1LZLA 3KYBA 4KQMA 4LS3A 4R5HA 4RA9B 5EP2A 5SY9A 1A8HA 4AG6A 2ES4A 4EB6B 3FB1A 1STOA 3BD8A 1TQHA 2RHMA 1N2XA 3DDCA 2VZEA 5KWEA 4H08A 3FY4A 2WKSA 3OOEA