2HN9A

Crystal structure of the uridine phosphorylase from salmonella typhimurium in complex with thymine and phosphate ion at 2.12a resolution
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
253
structure length
253
Chain Sequence
MSKSDVFHLGLTKNDLQGAQLAIVPGDPERVEKIAALMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPMEFPAVADFACTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRRFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPNAETMKQTESHAVKIVVEAARRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Uridine phosphorylase
publication title Crystal structure of the uridine phosphorylase from Salmonella typhimurium in complex with thymine and phosphate ion at 2.12A resolution
rcsb
source organism Salmonella typhimurium
total genus 84
structure length 253
sequence length 253
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2006-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2hn9A00
2B94A 4R2XA 1ODJA 1PBNA 1PKEA 2GUWA 1K9SA 1V41E 1TCUA 4YO8A 4M3NA 4LDNA 1CG6A 5EUBA 4NY1A 4D8XA 1LVUA 5JPCA 1V45E 3ONVA 3KUKA 2ON6A 3NBQA 3NM5A 4NSNA 1T0UA 4MCIA 3UAVA 4TXLA 2QTGA 1OTXA 3P0EA 5K1ZA 4WKNA 5CCDA 4D8VA 1B8OA 1OV6A 1U1FA 3ENZA 2QSUA 4GMHA 1Z35A 4QARA 5I3CA 4D9HA 4TXHA 4YNBA 1Z39A 2H8GA 1OUMA 4IP0A 3LBAA 1N3IA 2AI3A 4P54A 4F1WA 3DPSA 4DAOA 1JE0A 1V48A 4MCHA 1ECPA 1LV8A 3E0QA 4BN0A 1VFNA 1RXUA 1U1GA 1TGVA 3UAWA 3SCZA 3LA8A 3DP9A 4PNPA 1Q1GA 1JE1A 1RSZA 2OC4A 4H1TA 1A9RA 1PR4A 1Y1SA 1T8SA 5F7OA 5FAKA 3MMSA 1YBFA 1PK7A 1SQ6A 1Z34A 4TTJA 3O6VA 4R31A 1G2OA 4QFBA 5CXSA 3ODGA 1YQQA 3KHSA 3O4VA 1OVGA 1Z38A 1JDUA 2HSWA 4GLJA 1PK9A 5F7XA 3UAZA 2HWUA 4DAEA 4QEZA 1B8NA 1Y6RA 3FAZA 1SD2A 4M7WA 4L5AA 3BL6A 1Z5PA 4UC0A 1JDTA 3KU4A 4JWTA 3QPBA 1JDSA 4JOSA 1K3FA 1Z33A 1Z5OA 3EUEA 4WKCA 3PHCA 3KVRA 3K8OE 4OGKA 2A0WA 1Y6QA 1A9TA 5IFKA 5CYFA 1I80A 1U1CA 4LZWA 1U1DA 4DANA 3OF3A 1K27A 1A9QA 1T8YA 3FOWA 3PNPA 2I8AA 2AC7A 3EMVA 1A9SA 4DA8A 4U2KA 4EB8A 1NC3A 3OZEA 2A8YA 1RCTE 2OXFA 3FNQA 4MARA 5F76A 1YRYE 5F78A 1JDVA 4RJ2A 1C3XA 4BMZA 1RXCA 1V3QE 4F2PA 3NM4A 4L5CA 1ZOSA 3LGSA 4TS3A 4TXNA 1T8RA 1V2HE 1ZL2A 4R2WA 3D1VA 4GKAA 3P0FA 5C80A 3GGSA 2OC9A 3MB8A 2RJ3A 5ETJA 4DABA 1OU4A 1TCVA 2QTTA 5KB3A 5IU6A 3OZCA 3DJFA 3EUFA 4G41A 4D8YA 4KN5A 4F3KA 1NW4A 3PNSA 4YMLA 3T94A 4YJKA 1LX7A 1OTYA 3EEIA 5B7GA 1JPVA 4I2VA 1JP7A 4OF4A 2I4TA 1Z37A 2AI1A 2QDKA 3OZBA 4G89A 4LKRA 1RXSA 3K8QA 2HRDA 2OECA 2IQ5A 4F2WA 2A0XA 4WKPA 4GLFA 2Q7OE 1RT9A 5F7JA 1ODLA 4L0MA 3FWPA 3INYA 1PF7E 1YQUA 1JYSA 1U1EA 3OCCA 1PR6A 4M1EA 2A0YA 1PR1A 3GB9A 1RFGE 1QE5A 1Y1TA 3C74A 4DA6A 4BMYA 3PHBE 1VMKA 4L6IA 4DA0A 1XE3A 1PR5A 4PR3A 3OPVA 2PGAA 2XRFA 4OY3A 4QATA 5CCEA 5F7ZA 5F73A 2ISCA 1PR0A 4X24A 4OEHA 1A69A 3NM6B 4QAQA 1Y1RA 1RXYA 5EFOA 1RR6A 1JDZA 5F77A 3BJEA 4BMXA 4E1VA 1ODIA 3BGSA 1RYZA 4K6OA 3DDOA 4OJTA 2P4SA 3OOHA 3UAXA 1PWYE 3E9RA 1Z36A 5CXQA 3BSFA 4FFSA 4OGLA 4JP5A 3E9ZA 4TS9A 3UT6A 1VHWA 4WKOA 4WKBA 1Y1QA 1SJ9A 1TD1A 1ODKA 1A9OA 1FXUA 4LNHA 5B7PA 1TGYA 4L5YA 1NC1A 1ULBA 4TXMA 1ULAA 4TTAA 2HN9A 4DA7A 3KVVA 3IOMA 4TYMA 2QPLA 3KVYA 1YR3A 4G8JA 3UAYA 4TXJA 4F3CA 3IEXA 5B7QA 1CB0A 3TL6A 1T8WA 1Z5NA 3F8WA 5B7NA 5DK6A 1SD1A 3OOEA 4EARA 1WTAA 4DARA 5CYGA 4NS1A 4ECEA 5EPUA 4TTIA 1PW7A 4LNAA 1M73E 4QASA 1A9PA 1V4NA 2AI2A 3U40A 1VHJA 3OZDA 4D98A 3DF9A 3FB1A 1PR2A 2BSXA 3FUCA
chains in the Genus database with same CATH superfamily
3K05A 1XVTA 2F3TA 5DRTA 2NTYC 5C34B 3K2BA 5HGJA 3VR5A 4UE6A 2YQZA 4QDTA 4Q7JB 2P30A 1G9SA 1I3MA 3M6WA 3O1IC 1XALA 1Q77A 4PU0A 5DSXA 1D6MA 1FQWA 2MHCA 1BQ3A 1AQNA 3QOYA 2NGRA 5DSTA 1BG6A 3FJYA 4ASUA 1HV8A 5A0FA 1Z83A 4W8HA 2FFHA 4DY4A 1RYFA 3MJDA 4R5HA 1XRSB 3ONVA 3OIGA 2EERA 3SE0A 4RLHA 1GQFA 3CLVA 5H1YA 1WSBA 4LYFA 2E5LB 2PSJA 4M6WA 5FO1A 4W5TA 1QV9A 2GWHA 3D3KA 3I8SA 5DT9A 1P8AA 3T3DA 2X5XA 1U11A 4X20B 4DDHA 1BDIA 1Z75A 1PFKA 3ET4A 2R6CA 1FBNA 4YRDA 2CJXA 3L6OO 1ZCJA 4FSXA 3GWGA 3PNYA 4IW3B 4KYTA 2P7HA 3AHFA 3VHLB 3BE6A 4FB4A 3L8FA 2AYYA 1YDWA 5AKHA 3U3XA 3V46A 3N2LA 2D62A 2X6RA 4V2IA 2NZWA 4WY5A 3RW9A 1CUVA 5FLKA 3NETA 3FI0A 3KPJA 1LLUA 4N82A 1OV6A 5AM5A 3U4GA 4Z7OB 3U09A 3KQLA 1FSGA 1QHSA 4JJ4A 4B47A 1GU1A 4JBWA 2BFEA 3H7AA 4RMNA 3AVYA 2NXEA 1DQYA 1LWOA 1NN5A 1WVIA 4M8IA 4F11A 1NIJA 1JAZA 4HMOA 3RROA 4HB2A 1GPH1 4LNUB 4QYSA 3L8ZA 2DB3A 3P0RA 1U7HA 5HVNA 2AA3A 3SX0A 4FFPA 4BN4A 1Y1PA 4PG8A 2HMWA 3NNSA 2W48A 1KH1A 1HDEA 2JH3A 1FNBA 1JPJA 4KYUA 2BHSA 3WQHA 4DVGA 4O4IF 1CUJA 1GA1A 3G2MA 5TQ0B 2G25A 1NRXA 3EUWA 5HW0A 1DRJA 2H00A 1UM8A 4XA8A 4D5GA 1FP6A 1PKXA 3R5SA 2AV6A 5HCIA 1V48A 2JVJA 1YZGA 4CMAA 1K6JA 4RLFA 4TV9A 3WRVA 2WNIA 4G5RA 3GT0A 1E1CA 4LF6B 4RIIA 3ONEA 3O3CA 1RW4A 1M1YA 1F20A 3ETNA 3EXIA 1I0IA 1FOEB 1FB5A 1RKXA 1IXKA 2Y1CA 2ZTUA 4FQ8A 4Q3NA 1YA4A 3QJ5A 1WBJB 5AKYA 3LTEA 3UAWA 2Q8PA 3MMPA 2Q9UA 1YZ3A 2QRPA 4N7BA 4RA6B 2QJTA 3U56A 1PYGA 2CZGA 4BV2A 1O8BA 2P2YA 4CN8A 2PFSA 3T9FA 3IBFA 3I32A 1Z7GA 1BDBA 2FPIA 5KNBA 5KVVA 3J81A 4NCKA 3HCNA 2HZBA 1KHHA 4LOHA 1T8SA 1Q0RA 5G0VA 1HC7A 1KZYC 4QSMA 3IQFA 3IAUA 4CFYA 3HO1A 5AIBA 3GJZA 4P53A 2GERA 2K7ZA 5AOCA 1SQ6A 2QKYA 2H5IA 5DNWA 1FXWF 4EMUA 3ZGNA 1VG9B 1RRFA 1VSVA 2OTCA 2TECE 3PKIA 4BB5A 5IKEA 4I5FA 2QGFA 4UHJA 4UTZA 4Y2UA 5GPBA 2ZJ3A 2OFFA 3K0AA 4RABA 2EC5A 3EQ7A 3ZKAA 5JMTA 4PCLA 2C5LA 3I2KA 1O4VA 3PKJA 4D80A 1P2DA 5BMVB 3AFNA 5T4FA 3E7XA 4QQ8A 2I91A 2Q2QA 2WHEA 1HOXA 1P0QA 2HADA 2VBFA 3H11A 3IOYA 3RYFB 1DBPA 1Q14A 3FNRA 4W6ZA 1T6XA 2PL1A 2J67A 1CXZA 1OLXA 2R8XA 5DN9A 1HMYA 1IB6A 1XQVA 2G77B 4C7MA 3EZFA 2H4YA 1A8SA 1PQWA 3C97A 3I2HA 1IZYA 2OCPA 2E6UX 1FFGA 2DBZA 2WHRA 2ZRNA 2FXIA 3M6FA 5KYUA 3FBGA 1T29A 1FFDA 1DUSA 2O5VA 4LQCA 2OO5C 1CRPA 1W59A 2HTEA 3F0TA 4RWEA 3KR0A 1N5DA 3R7WA 3EDCA 3QLVA 3L1JA 4MR8A 1MAUA 5B12A 4XWWA 1V1MA 2FSFA 4C4XA 2BM9A 1AKVA 3HL4A 2YCLA 4MV8A 1II9A 1MX5A 2BR3A 2GEJA 1RRPA 2I55A 3KKQA 3R41A 4KQIA 4PCAA 2X0DA 3R9WA 4HLUC 1KDRA 4EUSA 4AI6A 1QGED 2Z3WA 2JFYA 1QGUA 3NEJA 3NRJA 3MF4A 4BRZA 4WWHA 5CFNA 2QMQA 4QULA 4BKOA 4OK6A 3L7BA 1ADYA 4IL5A 1EBFA 1RQNA 4R9VA 2C96A 2OAGA 4GX0A 5KS2A 1A1SA 2GAJA 1D6NA 1R6BX 4JUBA 3KQMA 4K9OA 3V1KA 3ZE0B 1YVEI 2MT9A 4YRIA 3AUXA 3SQDA 2KM1A 2OHFA 5DMHA 3W5JA 4G0QA 4ZZ1A 2XUJA 2P9CA 5GV7A 2IYYA 2R1UA 1F9AA 3GDWA 5TC4A 1BO6A 3K8OE 1QG4A 2A0WA 4OLFA 3NHZA 1HT2E 4G8CA 3NT4A 5CVVA 1GTRA 3TNFA 4QNNA 2V7UA 2OV4A 1NW7A 1QXSA 3B6EA 4IRXA 4Q4JB 3WL3A 4QJ3A 5IS2A 1L5OA 3FLMA 1OW3B 1T5BA 2IPLA 3O8QB 1Q12A 3P9ZA 4FBMA 4RADA 5KKNB 1F2DA 4DCGA 4IQFA 1MIOB 2PD6A 1GO2A 2ZRAA 3RV3A 4J7XA 3HKEB 5G3ZA 2CYBA 1CUHA 1OZGA 2AKAB 3DBLB 3KSMA 4J1SA 1L4BA 4EPXA 5KNCH 2BEVB 4K9NA 3IHTA 3VPSA 4M1ZA 3MWLA 4XWOA 4JOBA 2PUAA 3KKOA 1WCXA 4YB8A 2F8LA 4N7RA 3QVKA 4UHEA 4RVCA 1FFHA 4G86A 3ZWMA 4AMGA 1J2EA 3K8ZA 4FE7A 2JA1A 3WGTA 1WQ1R 3LUJA 4QTTB 2GF2A 3IT2A 5FADA 3PC2A 1DG3A 1TM7E 4BP3A 4F06A 9GPBA 1JU9A 4A5OA 4H7DA 5ALFA 1U0BB 4UBIA 1XA4A 2GPAA 1AQIA 1ZRMA 2FPWA 1UH5A 3BDAA 2Q5LA 3RRFA 5AW0A 1WHSA 1W35A 1VPTA 2DFNA 4XVRA 4ER6A 3ABOB 3PPVA 5JATA 4IEFB 4GKBA 2UYYA 4XYGA 5L3VA 1MAAA 2WJ3A 1RTTA 2YVUA 4NS4A 4TRMA 1RKBA 4EVIA 1G1AA 1Y8QA 3NBXX 1DIOB 3EQ2A 2MYNA 5JH7B 2GBCA 2QD2A 4EPVA 3QXXA 2IV2X 3IAM1 5IC6A 4JI3B 2J0VA 1QFJA 3OFND 2P90A 2Z1MA 1TLLA 3TMYA 4DLWA 3W8RA 2DPMA 3IBSA 4QFDA 3WDKA 2YMQA 2FPOA 4PG7A 5BQ5A 1F6WA 4OG2A 4IDPA 1XD8A 2ZW9A 3BMOB 2X86A 4D02A 5T3UA 1TVEA 1H6AA 2HV8A 2BLNA 2OC9A 3AUUA 3VR5D 1S2NA 3IS3A 4I9GA 2HRBA 4NZOA 4U7GA 4L4SA 4LJSA 1YL7A 2VP6A 3BDIA 4IYRA 4WFIA 2FKAA 3SI7A 1P1IA 2RE8A 4LCEA 2Q3MA 4IHAA 6LDHA 3QNWA 2K4MA 2IKQA 3RH0A 4C22A 4CF4A 2PUEA 3Q5EA 4A16A 4AXXA 3QLUA 3OJCA 2GI4A 3AR8A 1KEEA 1QLJA 1K4MA 1ZIYA 4KNVA 3K16A 4PO1A 1KI2A 1KRHA 5AI4A 1DKNA 3PHLA 4MYDA 3LHIA 2WJYA 3CX7A 3EXFA 1EK5A 4TRRA 1G3IA 4RD6A 1WU7A 4LYDA 3Q98A 4ZGBA 4EG5A 2GCGA 1F2TA 1L5MA 2EZ8A 4EUEA 3CG0A 2J3DA 3ME5A 2C9ZA 1XHFA 2RB5A 4J91A 4YDSA 3F6PA 3G9UA 1H6CA 3UKJA 4LV5B 1JL3A 2I4TA 4MMZB 2XDYA 4ZV7A 2I3GA 4FYKA 4Y2TA 2B25A 2YFHA 1UAAA 4MLPA 3UFXB 5IBQA 4TVOA 3QXHA 4GZ5A 5G02A 3IT1A 3NGLA 4IIGA 3I8XA 2DHCA 2UVQA 3MWEA 4UHKA 1GKKA 5H68A 1IVNA 2OXEA 1WCIB 4Q9HA 1RWVA 4JVSB 4WXRA 4EF4A 3QKWA 2QAGA 2FLVA 2NQTA 3M1IA 1O6CA 3QU4A 3AWDA 3FVTA 4GUAA 1P5JA 1RYBA 1EBBA 3BMNB 3BGDA 3C0KA 4LPSA 4TMVA 4WZBA 4OK3A 5D6NA 4Z9YA 1HBJA 2VG8A 2HWWA 1FDUA 1PLLA 3WIEA 4OYLA 1QV6A 4RSHA 3VMFA 4ODIA 4BB6A 1AH2A 3MXOA 4HPJB 5EQTA 2F90A 4GUDA 5T4BA 1W4CA 3Q6NA 1JX6A 1YQUA 2B6HA 4EX7A 2QORA 3KD3A 1P1JA 2F00A 5F3DA 3ZJVA 2X3YA 2QMZA 2YXLA 4K05A 3SQOA 1N2EA 1B93A 1YHYA 4ND5A 1C7QA 3ZJ4A 8ABPA 4PG5A 3FGOA 3U37A 2VWGA 5KOJB 3OCJA 4GT1A 3H3JA 3VR6A 4DLTA 3D6TB 121PA 3Q3HA 4LFBB 5H02A 1TLTA 1PI3A 4Q4AA 1B0PA 1QE5A 1ZJJA 2NUAA 2PT6A 4XUCA 5AKGA 1JEEA 4IMJB 4UW9A 1XZLA 3UK2A 1P5FA 2FE1A 1NOKA 4C30A 4R9SA 5KNBD 1TO6A 3F7MA 1YVDA 3CRZA 4RCVA 3W6PA 1XK7A 3L6CA 3NQ41 2D8AA 5B4TA 2PGAA 3CH5A 1M34B 3E23A 2LGJA 2AYXA 4A23A 3DXXA 3OD1A 3EH2A 2H5EA 4MB0A 2BM0A 2BRUA 2IW3A 1IH8A 1WV0A 2NV6A 5ES4B 1H2AS 4YV0A 3ITNA 3PHGA 4CKEB 1PL8A 4D82A 5JVDA 1FJGB 2PX8A 3WFJA 1PR0A 3RS5A 5D3MA 4X24A 1SUEA 5BSTA 3W0LB 2XIQA 1LZLA 2A9OA 1JQBA 4IIEA 5EWMA 3T5BA 6Q21A 5GIPE 1UBCA 2BFBA 2NG1A 1C4XA 2BEJA 2O5RA 1W88B 2PMFA 2RH8A 3NTVA 2BELA 2I1VB 1U2EA 3VOBA 1RXYA 1VYTA 1GRCA 1UBMS 1YR1A 2E37A 3KD2A 3B3FA 3OHMA 3PIDA 4OJNA 3K71B 1VHTA 1RP7A 4C7JA 1N7IA 1QCDA 4E1BA 5K3EA 3QW4B 1UJ5A 3ORSA 4MLZA 4CL2A 4HUJA 4IXNA 5JH7F 2NU8B 4HDNA 3ZCQA 1JQ5A 4MHTA 4JKYA 5K6AA 2PVCA 4LIPD 3L04A 3CF6R 4WCFC 1QIEA 2H0AA 4MVCA 1P1RA 1Y34E 2WTUA 3VU9B 1TZCA 2GLTA 4OXXA 1WMBA 2PSDA 1FSZA 3DEFA 2WU0A 4PPFA 2JRCA 1CJTC 4FMDF 3WZLA 4E5DA 3GROA 2SBTA 4FS8A 4I50B 4CTOA 1X0VA 1U98A 4PBRA 3E9RA 4V24A 5K2MA 1I7QB 4IIHA 2BLLA 3H2BA 3GK3A 3HDGA 3IP3A 3K9LA 4BASA 2W42A 3DWIA 4OM7A 3FNHA 1E1RA 3ADCA 4JP5A 5I8WA 1LRKA 2OKCA 1JQ3A 3UXYA 1BKYA 1ZD9A 2FB9A 3UWMA 2OHVA 5F1PA 4OH1A 3VU1A 5LQMA 1R00A 1K7FB 1X7XB 1R1DA 2Q8QA 4CLRA 1XOIA 1KH3A 4EHFA 1FDTA 2YOHA 4BO1A 3CLHA 4LMRA 1A9OA 3W6OA 2BGGA 1F3OA 4WA7A 4S0XA 1JQKA 2EX4A 2NUTB 4M86A 3FZQA 2P75A 4Q21A 3TAUA 3AQ4A 4KV7A 1SC6A 3A1NA 3FTNA 4WA8A 4R7GA 3ZWDA 1AS3A 1FBTA 2AUMA 2Y68A 1G4UR 4FFOA 4LAFA 2B6NA 1Y8RA 3JQBC 4HQOA 4O08A 5JC1A 4HR7A 1EE1A 1PAUA 3MRTA 2EJWA 2IPAB 1RDFA 4NFLA 4MV5A 4MPDA 4AROA 1G7TA 4CRWB 3J7TA 2WD9A 5IZCC 1MMFB 1GGMA 1BCSA 3SEZA 1PZEA 4MQMA 3TDMA 3BSSA 1IN8A 2HIHA 3CKMA 1N1GA 2CXNA 1JB1A 3TS1A 5CW2A 4UVDA 3WMXA 2W2KA 4QVGA 4IINA 4HGOA 5C1OA 2X8JA 3TVYA 1U7XA 1Z5ZA 2HPAA 3G9ZA 5CX4A 4HQ0A 1QF6A 2QRQA 3O83A 2G0AA 2H7XA 1IAVA 1TKRA 4OJMX 4QQFA 4YAWA 2OMKA 2X77A 4FLMA 5DK6A 1YI0A 2JGKA 4EPTA 1PL0A 2PZGA 2Z2KA 3R5KA 1C3EA 3MFQA 4EPWA 2D2XA 5ADUS 4INPA 3SWWA 4OCZA 4G26A 4FIDA 5J59A 4RTMA 3GAMA 3H5LA 3G7NA 1QX3A 3IESA 2LCQA 1WXHA 5BSEA 3BXEA 2VWPA 3L1KA 3T99A 4NAVA 3MWKA 1QO7A 3FZYA 1X80A 2O20A 3JALA 2WFZA 3NB0A 4J7UA 2PJDA 1A50B 1GZ6A 4WN9A 1Y8AA 3E3LA 3ADOA 3IAM6 5CDGA 4FKZA 1M75A 3NBKA 1Y5NA 3MMNA 5LQKA 2JZCA 2REXB 4QYMA 1G8HA 3AC0A 4JVLA 1SGWA 4EVSA 3AHDA 4PTYA 1GA4A 1U0OC 3BD6A 2R2GA 4GPBA 5EZ6B 1SUWA 1D7AA 4F8YA 1HQCA 1OAOC 1RCUA 3D8TA 3PA6A 4H4EA 3WL8A 3NUGA 3STTA 1KO4A 3ISTA 4II3A 4LN1A 1AG9A 1P73A 1RPAA 2I2BA 2OGSA 3RRZA 2DY1A 3DOEA 1P7WA 1DO8A 3C3MA 1I5OA 3IKMB 5ADVA 2C5HA 3AFGA 1Z4LA 3ZWWA 3TTYA 1Z4QA 3D43A 2NNLD 4UNIA 2ORYA 4EJSB 1EZZA 2J0UB 1PWHA 1G8KA 4E46A 3O1LA 3ESXA 2FGJA 4N18A 1BOOA 5FTKA 4ALMA 1E59A 5I7VA 1OYWA 4EK9A 4NBLA 5E0OA 4CKBA 3RTGA 3UJAA 4AY4A 1UZUA 1CX9B 2WICA 3DLTA 3KQOA 4LA4A 1EX7A 5BUSA 4O2BF 4H4CA 4RQAA 3NBQA 2Z6AA 3GGJA 4MDEA 2Z56A 4OHMA 3TQFA 1XCJA 4LECA 1Z0IA 2N47A 1MVOA 3C8MA 4Y1FA 5JRJA 5A3VA 5IYZB 2O5EA 1GWNA 1JV2B 1YNOA 1H0KA 2Z04A 2TS1A 2DSTA 3IOBA 3NFYA 1QK5A 4G0NA 5K8IA 3ZDXB 4UBMA 3ZI0A 3UYKA 1NFFA 1UP6A 4FT2A 3HB5X 2RAUA 3V1LA 1MW9X 2A5GA 1K08A 4BMSA 4YMTA 5EJ6A 3CINA 5KTOA 1SIOA 2IYFA 5YASA 3S8EA 4HX2A 3Q10A 3S1AB 4I7EA 5AKIA 3H04A 3NH6A 2OXRA 4PFKA 1E6CA 3A70A 4LHXA 2FSPA 2UKDA 2C7BA 3CE9A 3GMIA 4AS3A 5EJ5A 2XDWA 4WINA 5FOTA 5BNTA 5JRZA 1XJQA 4IG4A 3EX7C 4AS1A 2W8BA 2BFFB 2PUCA 2V9PA 5DYNA 4I50F 4LEIA 1DC8A 1XZBA 3D1JA 4US1R 2KX7A 2AT1A 1RQRA 3THOA 1AMNA 3R09A 4V0OA 4IXTA 3TSWA 1ZCBA 5LA6A 1YC5A 1TF5A 5JZOA 3TM4A 1LNQA 1M1UA 4ZDKA 4FFRA 1DQPA 1B14A 2JHPA 2QW8A 3QKRB 2FFAA 5I9SA 4E03A 4QOFA 3I1YA 2B7BA 3FR8A 2ONJA 4XQGA 2GCOA 3N2IA 2C3UA 2AS0A 5HHTA 2GZDA 2Q6VA 3QTLA 1L4UA 1PDWA 1X9IA 3HFSA 4J1QA 2R1VA 1RI5A 4XLTA 2FUG1 5AIAA 3WJ7A 4CR7A 2R7MA 5CA0A 3OTHA 3GEEA 2AFIA 2VWQA 4ZAXA 3D5EA 3N58A 2HQRA 2QZ4A 1QHYA 1XR3A 1KFCB 1ZXLA 5JO9A 2UUBB 2FFBA 4L51A 1ZM4A 2IDMA 1XTIA 2CLMB 4DOMA 3VHXA 4OXIA 3HLYA 5JZ9A 2G1PA 4URZR 3A3NA 4AJOA 1S01A 1C81A 3I5XA 2CVFA 4NOMA 4L0QA 4G5XA 4QT0A 1I6WA 3NKFA 1I9CA 2IVZA 3BYZA 1QBKC 4Y6RA 1U04A 2BFAA 2WOJA 3MAGA 4FFDA 1LBQA 1QH1B 1G64A 3Q87B 3ZQJA 1L5HB 4CIAA 2XB2A 4UBLA 4JBNA 3X1WA 1J9ZA 1WEKA 3EZNA 1VCOA 1TAGA 2V74B 3VVBA 2VDMB 1Z4OA 1Z34A 1Y9DA 3D7KA 3JR3A 1KMHA 1U0FA 4IMRA 4PHCA 4PRKA 3R7SA 3O8RA 1AGPA 4CM7A 3OM1A 4NRDA 4TTVA 1M34E 1CJBA 1ZITA 3G7UA 2YS7A 6AT1A 5LQRA 2Q41A 3MZ0A 3ODGA 2LIPA 3Q3JB 2EG9A 5BO5A 1M6NA 3ZZ1A 3PPXA 1DKLA 1N1EA 4D4LA 1EK6A 5E4YA 3TRHA 2V4ZA 3LX8A 5IKMA 4MA0A 3GFTA 1FSSA 3FN4A 4TTQA 3ROMA 4DBLC 4BJ3A 4L72A 4YAEA 3TLYA 3WS7A 1G41A 2LR0A 5AK0A 3TPCA 1DHRA 5JSHA 3IUQA 3RYCB 1H69A 2FCAA 3HMKA 1L6IA 4IVRA 3Q5GA 3HJAA 2JAHA 2RCNA 4KDRA 4N3GA 2IV7A 3HZRA 3FTDA 5K0GA 4GW3A 1SD5A 4DLVA 3TLZA 2GBGA 1L1QA 2X7HA 1NR5A 3ZDRA 3LJKA 3VPFA 2NSJA 3DZKA 1PHPA 4HP8A 4I08A 5H5JA 1YU9A 2WRZA 1BGXT 3CVXA 1QHNA 1NN1A 1H8EA 2ONZA 2YBEA 1SVSA 4Z1OA 1J8FA 3FROA 4JDPA 1E1RD 1U80A 4OYRA 3MMZA 4MYCA 3RT7A 4LMPA 4ZT3A 2JI6A 2YWJA 4UM8B 2FUEA 4YP7A 3LXRA 4LTDA 1E77A 3ZNQA 2H3HA 4QFMA 1AS2A 3DL7A 2QAJA 1DC5A 1MR3F 2QRZA 2KPOA 5DYYA 4I3GA 3C3PA 2XODA 3WSVA 2MYPA 1ZNZA 1DLIA 1EBUA 3E1SA 2VK8A 4LK3A 1AKQA 2Q45A 1P2TA 2G07A 4N5NA 2A78A 1VMEA 4UHDA 2VA8A 4YRSA 3AEZA 4XZ3A 1HNXB 2RHBA 4DUPA 3SHFA 4TMKA 1FMJA 5AJUA 3FOAA 3X1DA 1N8NA 5DNCA 5JROA 4P4TA 1RAIA 1VTKA 3D5TA 5LL6P 3QY9A 4RH1A 1E5LA 1Y82A 4O63O 2D2VA 1NMQA 5J63A 1BU5A 3KXIA 3I6QA 1YRAA 1M5UA 5PGMA 3ZJ5A 4CL8A 3AEUB 1UWKA 3N8NA 3PZBA 4B6EA 3DMPA 5AJHA 4D92A 5B1DA 4UHHA 3PRKE 3VKFA 2EJUA 3E7DA 2NU7B 4XYBA 4BRWA 3WKAA 3QY0A 4CQMB 4JLJA 4D74A 3VJMA 1FMCA 1MENA 4JXXA 3LUDA 4P3XA 4C4TA 1N6LA 4X84A 3BERA 3N2ZB 2ONYA 4Q1CA 2IUUA 5JCOC 4IXDA 1MFPA 1OXKB 3A28A 1QYRA 2ZB8A 3FNQA 4IH1A 4TT3D 1BNCA 1CZHA 3C16C 4X95A 1DBRA 4JA2A 1L7EA 2XVZA 1D09A 1P2BA 2O2GA 3AKCA 3FNIA 5KYGA 4QGGA 2OA0A 2CMFA 3N2KB 1M7BA 5BVGA 1GTSA 2NP6A 4U6QA 4XH9B 3UJ8A 4E5KA 2XRYA 3SY8A 4ZJZA 3KZCA 4NMHA 4QIHA 4NYIR 4GDFA 1YI1A 4IF4A 1MZVA 4HBGA 4LC9A 1YV9A 2C5EA 5IC5A 5AW5A 4ATNA 2ZUWA 2M98A 3GBPA 2F8TA 3ONFA 1IBRA 4O4JA 1EXWA 3V48A 4XFJA 5ABPA 3ANNA 1N2XA 1ZOSA 4ZIRB 3INTA 2QU8A 3QFHA 1BFKA 2LDBA 3FTCA 2W0MA 1EVYA 4BY9E 2DQKA 1SBIA 1U8FO 1KZ4A 1OKKA 1UMCA 4B44A 4X8LA 4NPHA 3R77A 3EPRA 5C80A 3NWBA 2IODA 1JZTA 3UXHA 2H4ZA 3K1TA 1VL8A 4AQYB 2J4FA 1KE2A 4K81B 2OAQ1 2RHOA 5F2OA 4UARA 1L5GB 4TYNA 4QT4A 2P77A 4G9BA 5CPFA 1RACA 3ILXA 3ENVA 4YRBA 2V65A 3EMBA 3NAMA 4IJUA 4UJ5A 3PL1A 1GR0A 1ICIA 1P4GA 1SUCA 4R1PA 3D7MA 4WERA 3JAKB 3PR1A 3NEPX 4QG3A 4RTKA 3CF4A 1OU4A 2GHTA 3A9TA 4BAGA 2R6DA 2G1AA 3M2TA 4P08A 4PWZA 2WG2A 5JNVA 3HP4A 1VPVA 4NFYA 4KR9A 3N5CA 3DBIA 4OHOA 4OUDB 4R41A 2DFVA 5IU6A 3CW9A 1XVAA 4F60A 1IBMB 4FR0A 1GUBA 2CLKB 3NNNA 3QYAA 3TSAA 2A0FA 4Z3KA 2Z5LA 1N92A 2B83A 3TLCA 1CDOA 4D3ZA 4ZXFA 3MLAA 4F6RA 5BN3A 1EFAA 5LBTA 3VV2A 1MJGM 4JASB 5JS1A 2G1KA 3R3HA 3Q2KA 4ESHA 5AW1A 1CVRA 2V97A 4B3GA 1Z37A 1BDJA 3GZTB 5ISMA 1FX0B 2ZXFA 4ZODA 4QODA 4KUGA 1EH5A 4KSBA 4JYCA 3ROEA 5FD8A 5B53A 3KKPA 3D3QA 5TEWA 2EAUA 4KSYA 3OZIA 2Z9CA 2FEXA 3CS3A 3I72A 3FVVA 3PC8A 3JQ7B 4ME6A 5DGCA 2ZCVA 4JC5A 4J1TA 1X1BA 3H1BA 4B3XA 3T7AA 2VNSA 4IQ8A 1DZIA 2WM8A 3M0EA 2DERA 3A3YA 3WV4A 4CM5A 1EIZA 5BXYA 1JR4A 3T7RA 2ZM5A 3ESQA 3PYXA 2FW7A 4YCAA 5J43A 3VR1A 3EB9A 5ALLA 2Q0SA 4WK0B 3FYSA 3TQIA 2D7JA 1ZH2A 2B0JA 5EQJB 4C6TB 3PFNA 3DKIA 4KXUA 4XR9A 3KQYA 3AL0C 3GLKA 5GM2A 1BX3A 2FVXA 2JCBA 3GJ8A 2EFDB 4QQRA 4TUYF 4R54A 4XARA 3FHLA 1FRFS 2ZS9A 4XIJA 4BLPA 3G8YA 4GSLA 2ZUDA 5LMCA 1JIIA 1O9GA 2VQEB 2LIVA 2P8JA 1EDOA 1T2FA 1RM4A 3ZHCA 3A1SA 1UPCA 1WDLA 2ZJZA 3G5MA 1QKIA 1R5NA 2GZRA 3QFFA 2HJGA 4Q01A 2X9VA 2VP4A 3UHAA 3KK0A 1X19A 4KFRA 4YMWA 5COQA 4FGZA 2Y1FA 3NV7A 3WLLA 4BLTA 5AMXA 1B8PA 1SRRA 1UDWA 4MWZA 2FUG6 3G13A 2EKPA 5DLEA 2CB9A 5P8WA 3K35A 3ADPA 2A4MA 4NC9A 3STHA 1VLLA 4GMXA 4L22A 1P7CA 4ZU3A 1W0CA 4DLPA 1E7YA 1TEZA 3PTZA 4QRDA 1H4SA 3UMVA 2QN3A 3Q9SA 4IDBA 5KYYA 5AKEA 5FWYA 2JHAA 1XU9A 3D9QX 3MRXA 2BZ1A 5AVZA 5EP1A 5I48A 4QUHA 2C7GA 5KPDA 3KHTA 5AW3A 3T1HB 1YJAA 4RD0A 1RD4A 2FWMX 4U9UA 1SZPA 3C6QA 3MTQA 3OPYA 2CSUA 3NGXA 4L7QA 2PT7A 2AJCA 2W2OA 3PNOA 2DBRA 1G8YA 3QUTA 5FPQA 5GP1A 3WGNA 4HZIA 1CRWG 1MOQA 2ZYAA 3GLHE 2GZ1A 2HA7A 2I8CA 2YWHA 3I64A 4DV3B 3DWFA 1JZQA 4D0GA 3ZDZB 2OKGA 3CEPB 1HM5A 2QLMA 1X1CA 1T8TA 2B5OA 4M36A 2WM2A 2HU7A 4QELA 1RBYA 4DLKA 4EY3A 5KNDA 2IHVA 4CM1A 3MG9A 5JSZA 1DIBA 3RFXA 1YZNA 4V03A 1DKRA 2PO7A 4AZ3B 4FE3A 4JI1B 2DR0A 5AVRA 2JK0A 3TM5A 3D0KA 4GBGA 3VSDA 1D0VA 2DFDA 1CQJA 2BKLA 3S2EA 3M6VA 2OM2A 1C8BA 4GOOD 2V0CA 3H0CA 1USUA 4YRGA 1JFTA 2I9KA 1IEWA 4WLOA 1H8ED 1I2AA 1HE4A 1ZH0A 3BDVA 2OFXA 2A5YB 1WZUA 3DTNA 3H4VA 3N0XA 4HLDA 4C6RA 1WDKA 4LZAA 2ICAA 4NXMB 3VZDA 1X8KA 3E7PA 1NW5A 3KKNA 4FOPA 1ND5A 2CNNA 2AEEA 2IXDA 4YFVA 3WLKX 3O1JC 4PHHA 4PG6A 2C77A 4FZ3A 5KEIA 1ZBDA 2UUPA 2ZRFA 1AGNA 2QVYX 4ZPXA 2C9BA 4WBNB 1YR6A 2CXHA 1P3JA 2Z8XA 2XOKD 4JAVC 4PYQA 4R2LA 1SJ9A 4R0NA 1EGVB 4W5HA 1Q5PA 1TD1A 4YJGA 1B2LA 4E09A 4LJ4A 4GRAA 2H4HA 3R6GA 4PLPA 4DC1A 3DUFA 4UNQA 1GCUA 3CPHA 3FLBA 2MTBA 1L3IA 2X23A 3PC7A 2HMAA 4TYQA 5FNVF 1U2QA 3ABRB 4EMSA 1HQYE 2NTJA 1HG1A 2GCNA 1BRTA 2CSXA 4AJ1A 3H1GA 5A9SA 3RTBA 3ETLA 5D3QA 1T36B 1RFLA 4LQLA 3WISA 4QZVA 5JMWA 3VNSA 1UR5A 3ZGVA 4Q19A 4UTNA 3FDZA 3HYLA 4XASA 1SXPA 5JDCC 3GLUA 4K8RB 4K86A 2HK9A 3CVUA 2P6RA 1LK7A 1TJNA 1A9XA 2C9YA 4O3MA 3KELA 3SZRA 1XZDA 4ISCA 1II0A 3OWXA 4R98A 4YXWA 1CR2A 2ZM6B 2F55A 1E92A 1UBNA 3U4DA 2EXXA 1D6SA 5B7QA 1DIRA 1SXJD 4G65A 1DAGA 1TL7C 1JALA 1ZUHA 2BV3A 2XA2A 3GH3A 4KGXA 5EPEA 4KL8S 4F6CA 3M6IA 3ZXIA 4MVJA 1T26A 1F8XA 1SURA 1QH8B 2GJKA 5CLQA 5KZMB 1V8ZA 3U4MA 1L7QA 4IPTA 1Q0UA 3HDHA 2QJRA 4XCXA 1KVRA 1BD3A 2FSSA 4NS1A 4ECEA 1X7WA 4AMZA 2AXQA 3E5NA 4BQSA 4I9UA 2IU0A 5GZ3A 2HU8A 3ZWXA 4KQ2A 4OTZA 4U9HS 4BVJA 4M60A 4HWSA 3RKSA 2WIJA 3ELYA 4J7CA 2QN2A 1TYEB 2W6PA 4LFAB 5EA2A 5LQUA 2MR6A 2A35A 2QYSA 4L4RA 4BNMA 5BPHA 1GG9A 1VE5A 1U8AA 2ISSD 4GI7A 4MZXA 1PR2A 2X3UA 3UGTA 4DMHA 4ZDJA 4ESVA 4DR7B 3GGDA 4HWPA 1MEEA 2VYCA 3U3MA 1FVHA 2H1IA 4L57A 5D6OA 3G5TA 4OKIA 2J9GA 2VJKA 2BSXA 1A97A 8GPBA 1OI2A 5KOHA 1OLUA 1DEXA 1QE3A 1K5HA 3BEOA 3TN7A 3BBPA 4E5VA 1PBNA 1R64A 5JZVA 4YGYA 4GI1A 5KX5A 1DIHA 1IDN1 2CKDA 1IIBA 1EFPA 7MDHA 3L5OA 4YT8A 3I2FA 3CUKA 4LZJA 3AFMA 5J9FA 1TCUA 3S3TA 2WU3A 1QONA 4OL9A 4A91A 5FUVA 3AEQB 3A4IA 4FFBA 5E3JA 4EFNA 3GOHA 1V7PC 5EMJA 4DJ5X 4MXDA 4ANFA 2PRZA 4A27A 2XSZD 1FPQA 1XZEA 1FSFA 1VG8A 1Q0HA 5DWQA 1GNPA 4DMMA 2PKYX 3M70A 4QA9A 1XRMA 1I10A 2Q0XA 4GE3A 4KAXA 3GFFA 5DVZA 1J9GA 1PTKA 1KE1A 4EELA 1VPWA 4IGIA 1SVKA 4BECA 4YJ2F 4U1RA 4ZKDA 1MJFA 3LPMA 4N1AA 4EATA 1KS2A 3FGPA 3EXEA 3VSBA 2COUA 2BMAA 3PCXA 3CSUA 4V1CI 1KJIA 1Z45A 3BCRA 4CIBA 3LO8A 1V35A 3PT5A 4FNMA 4I4LA 3MJFA 1R0RE 3UMFA 2L19A 3OFJA 1I4EB 2R25B 4HGNA 1XKXA 4PBSA 1RWPA 2VDVE 1M6HA 2PQ2A 4BVFA 2XWQA 1MGPA 1A7UA 1C2YA 1EK0A 1KDVA 3CX3A 4YASA 4EEZA 5JCJD 1F3LA 2GF9A 3QMVA 3K70B 2JBAB 4Y6LA 2KE5A 2WIBA 1N6RA 4Q1AA 5JXWA 1UZLA 3RM3A 1MIHA 1ULTA 4F2DA 1Z0FA 5ALDA 2CNWA 4EVQA 2EBWA 1XCLA 4TXHA 2DQ4A 4ZXPA 4DLRA 4ZHQB 4PSUA 1ZXXA 2NAFA 1NYRA 3ZVLA 2B5VA 2PT5A 2VK1A 2Y0BA 1H6DA 3DZJA 3ONDA 4FNOA 3M83A 3STWA 3V32A 5SZHB 3KKLA 4AN0A 2CMGA 1IWOA 4DNOA 4EPYA 5JD4A 3T5MA 4ZI7B 3LBAA 5DEIA 1W0KD 2G28A 5C37A 1G6Q1 1MQ9A 2WJIA 3N8HA 3HKCA 4HPWA 2XUFA 3TRKA 1MFZA 2XMZA 2HDNB 1W4BA 2ZB7A 3VGJA 1WBDA 1IL0A 1EVLA 4MCHA 4YFYA 1A4IA 5ARDA 3WHKA 4XCQA 2UAGA 5LU8A 3QW2A 1ZVJA 1CQXA 3IOCA 3RU9A 2FHPA 2UXBB 5HFNA 3H87A 4CL0A 1FTQA 1V7ZA 3G6KA 4L6AA 4ZVRA 1TGVA 5F1OA 3EBOA 1X1DA 1NW6A 1JXQA 4R1QA 2B20A 2H4XA 5DTIA 2PFKA 5K5EA 4PICA 1BCRA 2YW9A 3RSGA 2OC4A 2KHZA 5HKAA 1NBIA 4C87A 4CQNA 2ZJAA 3CW2A 4HPXB 2EP8A 2PA3A 4MUHA 1FUUA 3ANXA 1XAHA 1T0IA 2VYQA 1ECBA 3ICOA 4PSAA 2J85A 4Q7KA 3GAAA 4N6GA 3ANYB 4S1TA 1J24A 1XRQA 1NLMA 4YHBA 4D41A 2ILVA 4P34A 1RU3A 3LX6A 2BDUA 3NMUF 3ZIUA 1U2SA 1GEEA 4HTFB 3R40A 1GG2A 1L1RA 3KQPA 5IN4A 4DUZB 3V1UA 2HX1A 1Z3IX 4AZVA 1R8YA 2ZWMA 3HBMA 4IBOA 5AOAA 5CHEA 2W2TA 1DE0A 2BP7B 2OO5A 2H9IA 2GXQA 1QDLB 3P9PA 3REOA 1ZL0A 1SIBE 4CLDA 1PEYA 1FZTA 3MS7A 3WYGA 1JTVA 2ODEA 4K9SA 3ICWA 4OSEA 3K30A 5ALKA 2VP5A 1EDEA 2Y0EA 4RO0A 1P0CA 3VDXA 2AE1A 3V97A 3VV3A 5I47A 1U7ZA 1LB1B 2D1TA 1E7QA 5HK9A 1HPLA 1OH5A 4HLUA 2I3ZA 4WNYA 4KPUB 3F74A 4P5DA 3G59A 4B85A 1TMKA 4G01B 3L1VA 1U8EA 5F2EA 2MMCA 3IPXA 1IZ7A 4DYDA 2JAOA 3A6HA 3B2NA 3FX2A 4RTRA 1U4OA 1XYGA 1SWVA 1ML3A 2VRCA 3LWNA 3FAZA 4FONA 4TV8A 4UTXA 3WBBA 3RRJA 5HJ7A 1OU0A 3H4MA 5KQRA 4F6LA 3NGMA 3GEDA 1NQOA 2JI8A 5LR6A 1LPMA 2QX4A 5IBRA 1B8UA 3GGOA 3I34X 4CMBA 1U7DA 3D8BA 5AW9A 5JCXA 4QU0A 2BGKA 1Y5RA 3R20A 4HVCA 3E27A 5GAJA 1FRNA 4NR0A 4DV7B 2VJNA 2H6EA 1ZK0A 3PQ6A 1U31A 4BCDA 1N32B 2F59A 3AF0A 4EHHA 3OJXA 3QPBA 4OQFA 3BB1A 1POXA 4I9HA 5M5BA 1OGYA 4I66A 4CEJB 4EWLA 2XGJA 1Z33A 4GM1A 5C8YA 5EJ9A 5DMXA 1PVDA 3IP1A 2IF2A 4KXWA 4X1IB 1Q1ZA 1Z0DA 3UJBA 4C3VA 1KKUA 1VYVA 3LT0A 4OJKA 5DHPA 4QUBA 2WVGA 3LZCA 3T4XA 3RBXA 1L7VC 4B0OA 3D2LA 2O7RA 1GGEA 2VSOA 3LUAA 3KU1A 2PSEA 4QVIA 1S1CA 1UK9A 3I9MA 3LUBA 4LZWA 2O0JA 1PZFA 2ONKA 3S8YA 2CXQA 2ZAIA 1R18A 4GX2A 2JLVA 3EUAA 4L3VA 3LRTA 4IH4A 4NESA 2OD2A 1FU4A 1I7DA 5FYQA 3THXA 2ZJBA 3I9OA 3PRJA 1XWFA 2ZPUA 4CCSA 1DC4A 5CLJA 4KITB 3H17A 4LDZA 2V45A 4ROTA 2FOLA 5EI5A 5B2ZA 4AICA 1Y81A 4Y1RA 5KU7A 2GJSA 3CRMA 3K20A 4MGEA 2R4TA 5B3AA 4J4TA 3VTZA 2Q2OA 1QX4A 4ALJA 2OXFA 1VECA 2PK3A 4OQZA 5IDQA 2FWAA 4PGMA 2PV0A 3E7WA 1JIQA 5D85A 3VO2A 5F78A 4E13A 1NUAA 1H0HA 3COPA 4RJ2A 1T25A 3IDZA 2GFHA 3U4QB 3WO0A 2VSXA 2GILA 3G0DA 1M1NA 4GC5A 3JQCA 3CY6A 2PJZA 3G8AA 5CAEB 3SBDA 1H2HA 2CE7A 2XNDA 5TIIA 1KPIA 1OAKA 2JJMA 4WV3A 3BORA 3KC2A 2VTKA 2BE9A 3B3QA 2ZB3A 3E9MA 3L46A 3P96A 2BEUB 3PXXA 4F2PA 4NZYA 4Z4CA 4NH0A 4EJ0A 1QORA 3FWZA 3PGLA 3A31A 3HXOA 2OILA 4JYZA 5DBIA 2YXEA 1DQZA 1T43A 4LVNA 4FCTA 3G0GA 2I7XA 1F17A 4JIGA 4C05A 1RLTA 1SCBA 1E8NA 3B7PA 4QUGA 1L5WA 4L3WA 2C2YA 3H9BA 3VO9A 2C9DA 2AOXA 1R2QA 3PUIA 3RARA 3E1KA 3BRWA 1Y4ZA 3GGSA 5JD3A 3URMA 1TU4A 4YRCA 1SUIA 3BIXA 1VL0A 1XCBA 2WDPA 4XIYA 5B3LA 5IF9A 5IFLA 1VKRA 2IY7A 1XVUA 4LMAA 2N1MA 3WWDA 3FW1A 3ZLTA 2A92A 4OQMA 3MB5A 3ILYA 2HYDA 4TVSA 1SZDA 4RFVA 2Q4RA 4AMUA 1GSOA 3M6UA 1LJLA 1COZA 2F3QA 1J1ZA 3HN2A 1SXHA 4PQYA 2C2GA 1JR6A 2O3TA 2V3WA 3DQPA 1VPDA 4JP3A 4XGQA 3D64A 3RFCA 3WAJA 2PGLA 1DC6A 3GFGA 4X41A 5D7BA 1O87A 2AG5A 3WB2A 4BCBA 2WQ6A 3A2LA 4TOIA 1T8PA 3PNSA 5ALGA 1AN0A 3TNJA 5IAAA 1BXGA 2Q1YA 2Q9CA 2ZUSA 3HV0A 3RR2A 4REQA 1BC5A 3C85A 4ETNA 1Y6FA 1FFAA 5B7GA 4O2AA 4JXKA 3A05A 4PIMA 2V6BA 1XYVA 2JNWA 1HG0A 3DH0A 3EASA 1SWWA 4L2IB 1PUIA 4JLWA 5M34A 1KJQA 4JJAA 3RWOA 3JWGA 2Q5OA 1I13A 2DH6A 1II8B 4OAPA 2CHVA 4OX9B 2X1MA 4HMPA 3GNQA 3MGBA 1NYLA 5DGHA 3SICE 5B30A 5CB8A 3I83A 2I67A 1UXIA 1CS0B 4GBED 1SU6A 5DX1A 2HR1A 1EM8A 2R44A 3NEAA 2R8RA 3SC2B 1UKCA 3PNBA 1YZHA 5KSWB 1V9LA 1KERA 2ZUCA 3HDYA 4K28A 4RUKA 5BRNA 4EB0A 3G82C 1RRCA 4DRYA 1N0IA 4B4KA 2HMYB 3GP5A 2F9FA 3MJVA 4GLFA 3ZHRA 5CDFE 4BXOB 1CJMA 1OLOA 3EN0A 3HUDA 2E7ZA 4BZZA 2P3SA 3PXCX 2VJPA 3DBRB 3E5MA 1THMA 1OWMA 5HQ3A 2DPXA 4L0MA 1YASA 1NQAO 3OAAD 1N6NA 3C5VA 5EY5B 4V38A 3TCNA 3CTMA 1CHDA 2E1RA 3FWPA 1HGXA 3T8YA 5BWBA 4MWGA 1C0KA 2NV0A 3JVEA 2R48A 1BXZA 4WXPA 2GN0A 3WWEA 3GRUA 3LVBA 3W8EA 1JHYA 5H59A 2I03A 3AHEA 4FYMA 5EJFA 3UANA 5C7YA 3HA5A 1EXVA 4DGSA 2NO5A 3V5NA 3TZKA 3AB8A 3O95A 2HO4A 3KSAC 3GG2A 4HH4A 3ZR4B 1ZM2A 5MN4A 2EWVA 2VBGA 4ZC1A 4CJXA 1R9GA 2BFCA 2ASEA 4MW7A 2IFTA 3K1JA 3RFTA 5KOYA 2O8DB 1J09A 1RFGE 3PQ4A 2WPNA 4B74A 1SBHA 4WAUA 2P67A 1HLPA 2B2NA 4H7JA 1WPGA 1Y3CE 3N87A 1E7WA 2REBA 5KWSA 2RHGB 4JEUA 1UKVY 2CFSA 2DWPA 4JITA 3L6RA 4H3SA 3AF1A 2G04A 3DKKA 1CYDA 2XVXA 3OLVA 4G9EA 4LXYA 5IVDA 4F91B 1QHHA 1T9GR 3CU5A 1X8JA 3LK7A 3OPVA 3PVSA 1NY5A 1YBAA 1Q17A 4LY0A 5CM9C 4I3HA 4DR5B 3LU1A 3H6GA 1YDGA 3NR2A 4QLOA 5AD1A 3H5NA 4U7WA 2PVPA 2BZSA 3HC7A 3DNPA 1EAMA 3IA2A 3H4TA 5IWCA 4RTSA 1XMOB 2AMYA 2JJ1A 2ID4A 1WWKA 2NT3A 4LRXA 3AVTA 4UJ3A 4Y67A 1UBLS 3ET5A 3U81A 2VRNA 2QJFA 5EUMA 3JRWA 3T3GA 2JK1A 4B84A 1UMDB 3N0TA 2R62A 4ZQFA 5F5NA 1ATZA 2VUUA 3L7YA 2CDBA 3W2GA 4B6PA 1VC2A 4WCFA 3OQHA 2BGTA 4CUZA 3LGXA 5C8DA 2IH4A 4COKA 5CLGA 3IPAA 2DKOA 3EQ9A 3ED1A 4GNRA 3L01A 3UV3A 1UQUA 4DIBA 1KPGA 3ZJTA 4HWGA 2ECOA 3ZE7A 5FOXA 2FA9A 3NIWA 4BEJA 4YI5A 2IK8A 3DZCA 3I0MA 1DUIA 1YD7A 3JWIA 1XO1A 2VHXA 3OOJA 1LVGA 1UM9A 5CB4A 4JR2A 2I7VA 4LXUA 2O2YA 5BRAA 2K6GA 3MJEA 4DWWA 4H3VA 1HR0B 2YWBA 3SYRA 1VJ5A 4UQOA 4QHYA 4B6JA 1CEXA 2IY9A 2QTVB 1L9XA 4M83A 4LTMA 1TNDA 2FDRA 2HPVA 4MWBA 3AMVA 3CTPA 2YFKA 5BXQC 2G0NA 5DIZA 4XSVA 5M7EA 3D81A 3VR4A 2H1FA 1K6EA 3FDXA 4H31A 2EBFX 3U7RA 5J23A 3U2QA 3VAAA 1U3GA 4YCMA 3HI4A 1OB5A 2NSDA 4LOIA 3WA7A 1FDVA 3EDRA 3F8SA 3ORQA 4QJBA 3IE1A 1JR3A 4GF5A 3K72B 5E6RB 2FRVA 3PU6A 1RIIA 4BO9A 2AQ8A 2WSMA 1GRQA 3JQBA 1I0ZA 4JUDX 3Q6IA 2P5UA 2Q6OA 1YRWA 3V55A 5I8PA 5IDXA 1U4SA 2OR3A 3ADDA 3VTFA 2O2IA 3TMAA 2IPXA 4FHZA 5D84A 3IIJA 1E2PA 1E99A 2G36A 2P11A 3R76A 4WXYB 4B4OA 3OHSX 3UKOA 1N2BA 3RK1A 4XGIA 5AUQA 3B1JA 2W4IA 3KR2A 3ZCTA 4GP6A 5B7PA 5TJHA 3V7WA 2GYVA 1KI8A 4PAWA 3B60A 2W83A 3SFTA 3R5FA 4OQ4A 1GPMA 3OSUA 1RPJA 3CM0A 4PCVA 1KGDA 3OTQA 3V4SA 4KQJA 2OZPA 2QRNA 4U8HA 4DQ0A 2WG0A 2ZJ0A 1BWRA 1Y98A 4LRTB 3JQ6A 1JI3A 4DA7A 3QLTA 4X7PA 4M1WA 4UEWA 3EH1A 4QJ4A 3JZMA 2XYQA 3C15C 3SZGA 1Z12A 1FS5A 1XMQB 2UDPA 3BIFA 3Q3GE 1IUNA 3FIUA 1ZKDA 1EXDA 4NU6A 4JENA 3ND6A 1IHYA 1V1RA 2N75A 4XPIB 4WLFA 2DQSA 2REQA 5CNMA 2ZPAA 4DNQA 1Z0JA 1MJ5A 1C7FA 3CT6A 4WFQA 1IE3A 1N3LA 3BBLA 1W1IA 3WLFA 3GRVA 4I1YA 4HDOB 4ZMBA 3GIDA 1TVKA 3S4YA 4RV5A 1AKEA 1L5VA 2O14A 5AFSA 1K7XB 4IY1A 3WGVA 4ES6A 2XNDD 4MWSA 1QGDA 1QUEA 2C4TA 2YMPA 1OAOA 2ZRMA 2POCA 4F96A 1NU6A 4BNIA 5TGZA 3VPDA 1YNSA 2PZ8A 1GQQA 3ORYA 5SICE 2AEJA 2Y1DA 3KWJA 4FR5A 4MS1A 3O4RA 4NE9A 3HHPA 4EW6A 5H8WA 1W47A 4TTIA 1CF2O 1V8PA 4UZEA 2NYRA 4XVCA 4FC7A 4PHGA 3NO4A 3N5KA 4UUPA 2CZCA 3WLNA 1PIWA 4KFCA 3KAQA 2OCGA 5FL3A 3FMFA 3OZDA 1E4OA 3DT8A 4D98A 2X2OA 3QHQA 5HOEA 4R6WA 3SR0A 3NWJA 1NBMD 2V59A 2SECE 4L5IA 1IVSA 2J5BA 1NSYA 1P74A 1YDMA 1EHCA 4PW0A 2CEAA 1IN4A 1CT9A 2GAFA 2OHIA 3K2QA 1WW3A 2BUCA 2OGTA 3BXFA 1NVWQ 2ZS8A 3RUHA 4LDRA 5FV4A 4DIFA 2FEPA 3MINB 1SBNE 1U7PA 3HR4A 1EUYA 1XTRA 5FJJA 4DM4A 4RK0A 3ROZA 1Y7HA 1NM5C 4KH1A 1LS1A 4A1OA 1EJ0A 5JFTA 5K8JB 2YVQA 3F9IA 2DXIA 4YO8A 1E2QA 1O6ZA 4LF7B 2V6IA 1CULC 2HA3A 4F9TA 1TFUA 2PR7A 1J07A 3Q7EA 3GNLA 5LN1A 4RYDA 1G7SA 4BNVA 2VOEA 3K9NA 4LJ7A 3FKJA 4TMXA 3VVLA 1G3MA 4DQXA 2FMUA 2IYVA 1ODFA 1FFSA 3N39C 4RY9A 5KVAA 4LQ4A 1MQSA 5KHAA 3FPEA 5HF5A 1JG2A 5ICEA 2PMDA 1X8XA 4LHYA 3C3AA 1KORA 3I62A 1QHXA 3LXUX 3PUWA 3UAVA 1RQGA 3U16A 1TVMA 1S2DA 3AKZA 4XWYA 4K9PA 4PQGA 5KMGA 2WA1A 4XUGB 3G0HA 4TXLA 2QTGA 2C2WA 3T1YB 2DLCX 2VDJA 1CP2A 2P8SA 2XOXA 4A6PA 2EQ5A 4OHFA 2XB8A 4QBGB 5DJ5A 2PIAA 5LVAA 4Z9XA 2WYIA 3RASA 2XITA 4RESA 1S8FA 1KFBB 2P6NA 5DLDA 3W6ZA 5EJ8A 1KSGA 1KQOA 4YONB 1HKHA 3AGPA 2C83A 4B6OA 5I7OA 3AR4A 4RSRA 3DZGA 2JIPA 3IEIA 3BC1A 3QWHA 3EGDB 3K1YA 3UHFA 3IJPA 1XEXA 3WKCA 5DXFA 3BWEA 4EQZA 3FYUB 4A15A 4R83A 2C5GA 3NUQA 3WK5A 1ZOLA 2HBZA 3PDJA 4GS5A 4IUDS 1PGPA 1YQTA 1JA9A 2XWPA 3PCRB 3W4IA 3ZNPA 3WGKA 3TRIA 5IEJA 2NQ2C 3IEMA 5FFMA 5LMNB 4XDZA 1EMDA 4K9KA 5REQA 4PC1A 4B73A 4JI5B 5JLJA 3GQBB 3EWNA 5DHAA 3TW0A 1G20B 2J3EA 2RARA 4UTPA 1N3IA 3PB3A 3NJ8A 2AHOA 5EKTA 3RIHA 4DV2B 1RBQA 2JFQA 1R0XA 5I5EA 1H85A 3DVAA 3EMKA 1HH4A 2ZSUA 3MK31 4TMTA 1VJ0A 1QZXA 5K6RA 3DFZA 3RU2A 3PJDA 5A5FA 1J70A 1LV8A 1VKNA 4F9GA 3EGEA 3UJNA 3O91A 2VUHB 1ZNXA 2YDXA 4N6NA 1VXRA 3S7TA 2ZRDA 1SRQA 1VCMA 3ZWPA 1RXUA 3UGJA 3AI7A 1ZUWA 1Z2NX 1NLYA 1UF9A 1KQNA 5JHGB 3AI2A 2VEDA 3LA8A 1T2AA 1NOJA 3EXG1 3LWZA 2UXDB 5K4HA 1LDNA 1ZMBA 1BXRA 1VSTA 2PEZA 2H0RA 4FEEA 4LYEA 5DPMA 1VIDA 5EIHA 5KYVA 2UZ4A 1UBGA 3A3KA 4EHAA 1SVWA 4M4SA 3KQQA 3NONA 1E3QA 4J2OA 5EIXA 3EE6A 1DNPA 4H3HB 2ZI5A 3V8RA 4AWAA 4C6SA 3HWRA 3GPLA 2UYCA 3OFVA 3KOUA 1N9KA 4ZC8A 3OT4A 3GNSA 2QTRA 4ZT2A 2E4YA 4BS9A 4ARAA 4MTLA 4OHXA 5IASA 3BRQA 4B3MB 3D31A 3MRVA 2E4VA 2JFGA 1OSNA 3D3WA 4TVBA 2FX2A 4FTWA 1H3FA 4BO8A 1TYCA 2WZDA 4WQMA 2Q4BA 3PD0A 3Q88A 3EY4A 1M10A 1RVV1 4HEJA 1KSHA 3RSOA 1FNCA 1QR2A 3D7NA 3UG6A 3IRVA 3T54A 2HPZA 4M0DA 4HDRA 4OM8A 1N6IA 4RORA 4TSRA 2VRBA 4WE3A 2PRIA 2WYOA 4EFDA 3CRVA 2HSJA 4O6VA 1G8SA 2CV2A 3E61A 3FJ1A 1ORIA 1HFJA 3Q8XB 2QRVA 4MRRA 4CM8B 3W3AH 3ZE2B 5DTMA 3UAZA 1YO6A 2NQ8A 4MIEA 2FDXA 1YDEA 4MVWA 1UT8A 3EVNA 1NASA 4LKOA 3UT5B 2IY8A 3ZCXA 2P7IA 5BNWA 2QHXA 3I5UA 4P93A 3T9AA 1UZMA 2A3RA 5B1SA 16PKA 4G97A 4DCOA 2HLDD 5AP9A 3OQMA 1BOFA 2Z08A 1P7VA 3NC4A 2XE6A 3ZW9A 4AW9A 3RYTC 5I7SA 2JGNA 3JX9A 2C7RA 4M9UA 3E15A 2BFDA 3WLSA 1OXUA 2CVQA 5IJXA 2XCSB 1NMSA 3PXUA 4MAFA 5AI6A 4YWJA 4JWTA 3OUUA 3S1LA 1X8LA 4LV8B 3FNEA 2Y76A 5BY2A 1EVJA 4YQFA 1TQHA 1OF1A 4BFSA 2WWXA 1GLGA 3I2YX 4OHBA 4D42A 5A5VA 4KXLA 4E5PA 5LZ5A 4GVPA 5GZ1A 1J4AA 1ESNA 1DAPA 1IOVA 1P9RA 1ZWKA 5CB6A 2EJVA 3FGZA 4V2UA 4WASA 4ZAVA 2ZTVA 2HF8A 4NATA 3REQB 5JS6A 5ELXA 4YYEA 1LNSA 3TLMA 2GXUA 4JSTA 4PN7A 9LDTA 1TM1E 1BE0A 2IHUA 5LXTB 4KFTA 1IWPB 1EDZA 3UJ7A 3V1TC 4DXAA 5JCOA 3VNUA 5DW0A 3IO5A 5DKFA 3FPHA 3LF2A 3C8DA 1NX6A 4EGFA 1OC2A 4B6SA 4C2AA 1OTHA 1LDYA 3LG2A 2VYNA 5H82A 1XMPA 3E8SA 3MFYA 1PEDA 1JSLA 3FOWA 1HZZC 2J4DA 3ZYCA 5GGXA 2ZJ4A 2J48A 2FWBA 2QQGA 3BA6A 2G5PA 1O94A 1XZPA 2C20A 4ZA2A 2GASA 1RRGA 1XN1A 2PCJA 1E61A 1MAHA 4FSDA 2E18A 2Z4TA 1KZGB 1Y89A 3ESRA 4JODA 2D1FA 3CMCO 4DR3B 2VJOA 2Y0DA 4HH3C 1T91A 3SXUA 1L6RA 3G8DA 4LYJA 5H83A 5EZYA 4GMDA 2IS6A 3UENA 3L92A 4CV0A 1GPAA 3LO5A 4KO4S 3MUNA 3C3KA 3BD7A 3PA8A 4YDQA 1ZN9A 3B7WA 1JVBA 2ARKA 2FN4A 1BS9A 3HN6A 3TOSA 4AUEA 4C76A 1CNEA 1D2CA 2RKOA 4JLNA 1R37A 2ZYGA 2VIIA 2BBOA 1QZ3A 1PTJC 3WFZA 1NUPA 3LM8A 4F4DA 3JD4A 1GXSB 1ZNQO 5KREA 1MVLA 1JXMA 1UC9A 4MROA 2XMDA 5KQSA 3NORA 2WJWA 1E9AA 4TWBA 4IZOA 3SU8A 4ZT5A 4H60A 3UC9A 3HFRA 1FA9A 1ZD1A 4TS3A 4TXNA 3DW1X 2NU6A 3QA9A 1KWKA 1N5KA 4JSYA 4R2WA 4D57A 1W4RA 4PZZA 1U5BA 5CLIA 1EDDA 4Z7NB 1Z73A 5FBLB 2D3TA 3ZHBA 1EUDB 1ZUD1 1SHJA 2YC2C 3FBWA 4KRGA 3AHIA 1XTUA 2QR2A 2MJLA 5AXDA 3UXMA 1AXRA 2QMUA 2RGWA 1KMQA 3L7NA 4JN6B 4KIWA 4L8WB 1UDXA 4MR9B 4ZAGA 5J5CA 1QE0A 4KXXA 4EY6A 5BSKA 1MG0A 1YH3A 5AJZA 2QSJA 5HK8A 3TAXA 1FLVA 1ZUNA 1VHLA 2HM7A 5ITZB 1A72A 3M89A 4S05A 3NHAA 1MCZA 2A1TR 4N47A 4C0LA 1ENYA 2GWRA 1OX5A 3ILHA 3AFIA 2OCYC 3J81k 1Z4KA 1CF4A 1XA3A 2WV7A 3DE3X 4K9DA 1E9VA 3S68A 1WHTB 4KOEC 4J0EA 4G67A 4Q9AA 1R4NA 3ZGLA 4AO7A 4D8YA 1Z2CA 1H93A 3AM5A 5CBPB 1ZSVA 3PGXA 4ESEA 3ROFA 2LTAA 1DRUA 1S2IA 4I46A 1RWMA 3TJMA 2QN7A 1AKYA 1EJBA 3LC7O 4OQNA 5HG0A 3BL8A 5AW7A 2O6LA 5DCYA 5EWLB 5ESXA 3KAKA 3HE3A 3MD9A 4X1OA 1KS9A 2H51A 2WLSA 4RA9A 3T9CA 4OF4A 4EKNB 1CQPA 5K99A 5BYAA 2YOGA 2X3FA 3M7IA 4I55B 1GTVA 5BWCA 5C5EA 5KVQA 2AFVA 3OZAA 4K6MA 5HDQA 2ZBRA 3IR7A 5IKPA 4IF6A 4U0KA 2DC1A 4NZNA 5DSZA 2I7DA 5FAKA 1B3BA 3T95A 4DEXA 3WK8A 2WABA 1D0IA 3ILVA 1NAIA 3EAGA 4UREA 2ILTA 2IQ5A 3GD5A 4IOJA 1ONOA 2G0TA 2EGUA 3VR3A 4CG0A 3KL2A 3DCIA 4MK4A 1KK2A 2C4HA 3OQNA 3CJRA 3K0FB 3W06A 5I9MA 3HBFA 3HUFA 3H6HA 2GBPA 1ODLA 1E4EA 2GTHA 1N6OA 5FL7A 1P62B 2XKAA 1FFWA 1O54A 1ZCZA 3OQVA 1LBSA 2P2NA 4MYSA 4E07A 1S2MA 2J6HA 2ADMA 2WIKA 3AR2A 4PSVA 3R7BA 4DLZA 3RVSA 3DJYA 2J4CA 2IELA 3ACBA 4C43A 1ZH8A 1Z4PX 4DCTA 2C4NA 3WO1A 3I09A 2WK1A 4UCXA 3TE6A 4W7SA 4BAZA 1TJ4A 3VYSB 4IV5A 2HQSA 1L4GA 4EFLA 1JMVA 3L6EA 3HGQA 3LPLA 1QIGA 4LOAA 4RHYA 4C21A 1G17A 1SHLA 3T1NA 3R3JA 4C29A 5LXTF 4DNFA 4UNRA 2VL7A 2Z6QA 5EHQA 2XB6A 1KYZA 3HZHA 2WKPA 2ZI6A 4DMKA 4YJDA 1G20E 2X5JO 1GTZA 4L6IA 1L7PA 1BJKA 2WE7A 2I87A 4G84A 2IZ0A 5LZ2A 4X62B 1TM5E 2Z4SA 3IGFA 5HBRA 1MA3A 3MT9A 4OHRA 3RJ5A 3C6MA 1NXWA 4RJJA 4ZREA 3CSSA 4MPJA 1I0LA 2WUDA 4JL6A 3ECAA 4KWTA 3O82A 2OO7A 2R2AA 3GO4A 1N2HA 1FXWA 3DZIA 2Q6TA 3GN2A 4K0RA 4RELA 5KJ1A 1MC1A 1QOZA 2WYVA 4O8ZA 4BC0A 1RAAA 2PGOA 1K3UB 1V5GA 4I6GA 1DPFA 1E89A 4X7MA 4XIGS 2X41A 1T4DA 2B61A 1ZO8A 2OHOA 5F73A 1DKUA 2ZYRA 3ZDQA 5FWNA 2IS1A 2WB4A 4HGRA 1VSQA 3ZS9A 1V26A 3KQUA 4M0UA 3MJHA 3UH0A 1JLLA 2HRZA 5KWVA 3O4JA 1CUIA 2RAFA 4OAQA 4AKIA 1V7CA 1QVWA 1DWOA 5C4GB 5CX1B 4ON9A 4YJHB 2WMOB 1VIMA 4RDIA 3LP6A 1CJVC 4URUR 2NW6A 2I54A 3L9XA 4Z0TA 5NLLA 5DDIP 4DMRA 3PGJA 2PZLA 4V0RA 4RPKA 2XQGA 1GSIA 4JP2A 3SP1A 1JDZA 1I4TD 1ONPA 3UCXA 4CQJA 4P3NA 4Y9DA 5IXSA 3HUUA 3DT9A 2W4MA 4M9CA 2ETXA 4D79A 1VCHA 1G5TA 4E1VA 2PX0A 2BF7A 5KOIA 3LRPA 4U6NA 2W6OA 1FFXB 3OESA 3N8KA 4M1SA 3TD2A 2H07A 2AJTA 2WMYA 2ZYUX 3CEMA 1DGQA 2X0KA 5GMOA 4HDKB 2P2DA 1UK8A 3MOGA 5EXPA 3O8NA 3EZYA 4E33A 3LX4A 4NNPA 1RPNA 4L5BA 1MXFA 2JGRA 1DKOA 3MW8A 4WPGA 4FMPA 3MOIA 5CXQA 1DMRA 3EQ8A 2PXAA 1ADGA 5K0SA 4ND4A 4GOXA 3PDIB 1XZQA 2ATIA 2B3DA 1YZQA 5JDCA 1K6IA 1Q1EA 2ZCUA 5CB0A 3L9WA 1NJ5A 5B6PA 1SKYE 2P9HA 2XZPA 1P2UA 4FEGA 2ODTX 1GQSA 1YOBA 3KKEA 3LDUA 1C9EA 4IDNA 1LDMA 3CNLA 4X20A 4URXR 1PJBA 3D8HA 1IQUA 1NPDA 2VT2A 3DP7A 1JAXA 5K8CA 2FSVA 4BC1A 1Z17A 3Q8LA 3VRHA 1P1CA 4MGYR 2EKQA 3S2SA 4DWVA 2MIIA 1IN1A 2GTPA 1AVTA 2IS4A 3JQPA 2W6ID 1MZPA 1MF7A 4TXMA 2VTEA 1YKSA 4K6CA 2O7NA 4I55F 1RMQA 2HN9A 4PRZA 4D1YA 3ETJA 1A8QA 4QJ5A 1JXOA 2FMHA 1RQ2A 4C7XA 2GPSA 3SN6A 1YTUA 4OQXA 4CNBA 4GEKA 1JA0A 1HYGA 1GIAA 4IX1A 2Q7DA 1UZNA 2VHEA 1E3IA 4LGVA 4LNUA 2EEPA 1WMAA 2XUOA 3RC7A 4XLLA 2IU6A 1CVIA 2IZ6A 1MB3A 1GPDG 2IVFA 4N01A 3F4LA 3VH3A 3T7DA 3H0KA 4HUQB 1CB0A 1IFXA 3O84A 4S1PA 1SCJA 4YMSA 3RS4A 1HLDA 3OIWA 5TQ0A 1KEKA 1XZAA 3D7RA 2AZMA 2ZSHA 5ECYA 5IJ9B 3HEBA 4LRWA 1IJBA 3ND7A 1G60A 2HTFA 4LY9A 4I4TB 5FYDA 4WL0A 4L6CA 4C08A 2XB9A 1Q7BA 5CVEA 4YCSA 3K70C 4E6PA 2C2XA 2IITA 1LBEA 3P94A 3NOXA 4HNVA 3CB2A 2ECFA 1IATA 2OBFA 1BVHA 2B2XA 2XE4A 2PNJA 1G8GA 4FI3C 1QMPA 3SHTA 4BNDA 2AI2A 2YFYA 4JNKA 1B73A 1K8XB 1QVVA 4RHTA 1E1MA 1Y5LA 4RA6A 4Z7QB 4Q3OA 1QANA 3MOSA 5DLPA 1C5KA 4M7PA 4AY6A 2DQZA 5KTSA 3CA8A 1VPLA 2DR3A 1EFKA 2CUKA 3Q0IA 1HXHA 5E1MA 1QVAA 2R87A 2AW3A 3ANSA 4E08A 4JBIA 3HGMA 4RKYA 1XI2A 2V6GA 4KQ6A 4OP1A 3MQ4A 3JS5A 4UMVA 3VDQA 1WZIA 4I1OA 3L0IB 3O90A 1UXHA 5JNTA 3B85A 1FEZA 2OP0A 3S6JA 3A9CA 1K9SA 2JIBA 1U0TA 4M9SA 3T0FA 1R6DA 3MHTA 2QTMA 3I9NA 1IWBB 3ECSA 5EUBA 3RUIA 3EXAA 2HA5A 3ROXA 3T0IA 4AS2A 1W25A 3IIKA 3C6YA 3H5IA 5BMVA 2YV5A 1FNMA 1XZHA 3PF9A 3BJIC 2YWRA 4F7DA 1RBMA 1DAHA 4JUIA 1C8LA 3C4JA 1GZHB 3GL9A 3RYFA 2FP4B 1NKSA 3JCZA 1Q92A 1X6VA 2VTVA 1XMSA 3GMDA 2EIXA 4IZHA 3PHJA 4IVNA 4R1SA 4RK6A 5IKOA 3UJCA 3UWKA 1JHPA 4GGPA 1QAQA 2L17A 4JLSA 1SBTA 1IAQA 4X71A 2WFLB 1OTXA 3KLPX 4FR2A 4NU8X 3BTUA 1UFRA 4IGKA 1EFVB 5DM2A 5JAIA 1M2OB 1RC8A 1QU2A 3PQEA 1FTWA 1RMTA 2Q9BA 3N8IA 4P1ZA 2DT8A 5D1NA 4NHEA 5FEUA 1B8OA 3LPNA 3WR5A 4YCNA 3A6GA 3EXG2 4M8LA 2GM3A 3K6JA 4B5KA 3AM4A 1LS6A 3EZLA 3GVHA 5C8XA 4EA9A 4MGIR 3V9AA 3BK1A 4Q7LA 3OJ0A 2O8VA 3HHEA 5BWOA 3V4RA 1MO6A 1JYEA 3KLBA 1NQXA 4WKGA 3E03A 5JV5A 3NYIA 3EW7A 4FUTA 4F3NA 2V6FA 3GY0A 2Q3HA 3I0ZA 1RQLA 2ZDGA 1A04A 1JNYA 2YUTA 1FNNA 4RIFA 1D2NA 2AN4A 4MKGA 5HF8A 4Q4CA 2H85A 3GJTA 5JY1A 1CU1A 3KBOA 3PX3A 1PFYA 3BD8A 2QR3A 1DX6A 1MV8A 5CD1A 3K6SB 4MDHA 2Q3FA 1U3UA 2QZPA 1FSPA 4FFMA 3NVDA 1Z56C 2EWMA 4Q4JA 4B3DA 3JXEA 3KZXA 4KU4A 4LSZA 3OIDA 5IDYA 1KTIA 2B7CA 3JVDA 3THYB 5ALQA 3NIDB 5E9AA 1MIOA 1JFSA 2I9PA 3SJUA 3HKEA 3HVJA 2QZJA 3TR0A 4ZP1A 3DBLA 1JFFB 4OU4A 1W5EA 1COWA 1DAMA 2OBMA 1D5CA 3JASB 4JJ6A 5E2IA 5MN5A 4D26A 4CKEA 2Y4OA 2A5LA 4XDGA 3NBFA 1ACJA 1XTVA 1YVRA 3AOGA 2AZXA 1LSUA 5ALSA 2AQIA 4H16A 1Y3BE 2TMKA 1XMIA 2Y93A 1K86A 4QNMA 3STXA 4A8HA 3LS2A 3FHTA 3VTKA 5JQGF 1A8UA 1OGJA 3O8CA 2QNBA 2OCBA 1OPXA 5HKBA 2N1BA 3P32A 1UBSB 3BQ9A 2VHZA 4PZPA 4RAQA 4GP9A 1J0EA 4E4RA 2YVLA 2IYNA 2XNCA 4KE8A 2P2LA 3QVUA 2I2WA 1UQRA 3TW8B 1E32A 3GA0A 3QF7A 4R31A 3IPLA 5ECGC 1QOPB 1XDUA 1RPTA 4OAOA 2XNSA 3NHBA 4FEYA 4QFBA 4RBNA 2HD4A 4RLQA 5JH7A 1UBKS 2V55B 2XMSA 3HDTA 1CZUA 2Y8EA 2D5CA 2I3AA 3KHSA 3KIPA 3DHNA 4I4TF 5AI0A 5EJMA 5FRDA 4QEDA 5K3FB 3VPHA 1OT5A 3GEGA 3N6XA 3OC0A 4PWYA 4RK7A 1ZOPA 1GG8A 3RTAA 4WOBA 1QRTA 3UJ6A 2PM8A 1ES9A 3WB0A 4COOA 3H2KA 4XX0B 3ZVMA 3QPUA 3FOBA 3BMOA 5TS2A 4NMWA 4Q4DA 3S40A 1NVFA 1XKQA 4MB2A 4DAEA 5CVCA 1XDZA 5EE0A 1Y6ZA 3GZ4A 4XOUA 3S99A 4C01A 1EWRA 4GYWA 3OLCX 1E2BA 3KFLA 4Q93A 1IRIA 3G5AA 4TRJA 4YT2A 3HQ4O 2C29D 2Y1LA 1ECLA 3GD7A 3H1TA 3AJRA 3BUSA 3FTPA 2QZZA 4TTSA 3SQWA 1YJ8A 3AUSA 1AUQA 1EQUA 4J0DA 3SDSA 1TJYA 4L3OA 5JYCA 3BXOA 1NVVR 4HADA 2OZKA 2GD6A 2F7SA 4LK2A 5EHGA 1O5OA 1UMBB 1N6HA 1JFLA 1KR5A 4UDOA 3U5TA 1S3GA 1X14A 2RGGA 3R3SA 2UYGA 2WAAA 3GMTA 4H7PA 3WL5A 4MYTA 2RBKA 1NQWA 4ITUA 4W99A 2PG3A 1UP4A 5LLTA 1P39A 3EUEA 1CZKA 3EAQA 3HJRA 3VJKA 1Q0ZA 2BTQB 5C4IA 1KDOA 2RG1A 2BHTA 3DW3X 3KG2A 4BO6A 3Q12A 4TM8A 2HSZA 2L2QA 3B9QA 1E6KA 3AOEC 3UFXA 4JEHA 4HBZA 3K15A 1VCIA 2JI7A 3QIAA 3GLRA 2PRYA 1S3FA 5D1HA 2N0SA 4DM7A 2NXCA 2QUIA 1DXHA 1EVEA 4FYVA 3FUXA 4B7XA 1JSCA 2WWFA 2WJ4A 4F3YA 3BMNA 4HEHA 4N54A 1O1YA 2ZJ2A 2AEFA 3UBMA 2W2NA 1PV1A 3WYFA 3Q9NA 1Y9AA 4CM3A 1L7MA 1W49A 1ZBQA 2J45A 3CNHA 4QSHA 4HK4A 1DQRA 4HMQA 1XRPA 5EXEA 2YIVX 3M4ZA 4MQBA 4N48A 2X13A 1ONSA 1YRYE 1JDVA 3TQHA 3DV0B 3VZCA 1ZVVA 4MUFA 3T7KA 3F5MA 2ECQA 3OA0A 5K3OA 3OZTA 1FYWA 2B0CA 2M6KA 5AVUA 4BMZA 4MVYA 3DFIA 4BQFA 4MYHA 4IIJB 4WLNA 1WPXA 4MZDA 3F71A 5KOJA 3KSDO 3P9XA 2XJ4A 2XXJA 2Q4TA 1E9CA 1MO2A 2CD7A 5FHQA 1AC5A 3DA8A 4R05A 3LGSA 1NT4A 1VDZA 5JAUA 1TTPB 4JBGA 4Y9TA 5TS3A 2H1LA 2DKNA 1FU7A 3II6X 3LL4A 1QTIA 3BSYA 3OZSA 1WSWA 2FOIA 2BDTA 1CB7A 4I99A 2NSHA 2B8JA 2X7XA 3C2QA 3FPCA 3L0OA 4BMVA 3O21A 1M34A 3C3DA 2FN8A 4YUAA 3HJBA 1N2CB 4I9NA 4BIMA 3GLGB 5EJEA 2UYHA 2RI6A 2QV0A 3LSTA 5HFAA 1LWNA 3QYPA 4R40A 4Z86A 2E49A 4UDXX 3B9BA 4N9QA 2INGX 5E9JA 3SQLA 3WI7A 1QP0A 1T1SA 2JFHA 3DL4A 2G9RA 4J2HA 2WU4A 3IJEB 5E2BA 3TZCA 3TOVA 3VHQA 1YOVB 3OZWA 4B34A 1HE1C 3CX4A 1YBMA 2JH9A 1AZSC 4LY6A 2RH4A 2A0UA 3IQEA 3DEKA 1DDGA 1KAMA 2DULA 3ESYA 3LY8A 3QKUA 4QOSA 4E2WA 3MSXA 3DMFA 3TQOA 3ZDEA 4BO3A 2QQ5A 3JQ9A 4W63A 3FETA 1JFVA 1W88A 2ODBA 1WVMA 4G41A 1OXTA 4K9LA 1J8QA 1QDEA 1YMQA 4KN5A 4G8BA 4PF1A 4R69A 2J0SA 1XJ5A 5AKJA 2WPDD 1OFGA 3QI2A 1CRLA 3TZLA 5LQNA 1LFAA 4YJKA 3V7FA 4CKCB 4RPCA 4JYMA 1ISSA 3HJHA 1K89A 4S1OA 4XI9A 5DHSA 2JHCA 2NU8A 4IOKA 1DG1G 1TQ6A 2V8OA 1I4WA 2VHWA 2F1KA 3H3XA 5IJ0B 1GZDA 2ZJ7A 3QE3A 1N2IA 2PLNA 3EZ9A 3LFHA 2R97A 4MVJP 2DTXA 4WJLA 3NATA 5DULA 1G3QA 1CD5A 2O1WA 2XX3A 3MT8A 3BRCA 2ZJ1A 5I9LA 2XD9A 1TJ3A 4EIWA 2DQYA 1PV2A 3P2MA 1OBOA 1IONA 5FUYA 3K5HA 1DRKA 1ZD2P 4P3YA 4I50A 4FOLA 4J9UE 4WKPA 4II7A 2O7VA 4G0ZA 4L02A 3NIFB 3K0SA 4C2TA 2YHAA 4TSFD 1XPRA 3FDIA 1ZCAA 2JGDB 4QTZA 4JI6B 3N0RA 2PMWB 1Y4DE 2VHQA 3HNPA 5ALNA 1TA4A 5DP2A 2VJLA 2X1HA 3AV3A 1EWQA 2XCLA 3ZW7A 2P2GA 1QIFA 2ZIUB 3K9BA 4CUKA 3QZUA 1BAPA 1DADA 1X7XA 2YY5A 1S6YA 3N53A 4X1YB 5BYBA 4OOFA 1VHDA 4UAUA 1CCWA 1ISFA 3RJ9A 4LE1A 2X0IA 3FIJA 4G5GA 1WUIS 2NUTA 4BTEA 2GUGA 1E1LA 3LDFA 1OQAA 5LZ7A 3UHJA 4TN5A 1UPTA 2DHRA 3PGA1 1PEAA 2IUYA 2RC5A 3G2LA 5E7QA 3OQ1A 4J90A 4PZLA 4ZU1X 1NY6A 3N86A 2H65A 2ZIZA 2XDAA 4KUHA 3T5TA 5EXXA 3ITDA 2X9GA 5C7OO 4DHEA 3C3XA 1UQTA 3H5TA 3QBDA 6GPBA 3NVAA 4KPEC 1FYFA 3NHWA 4KV9A 1XE3A 4ZYUA 3TIGA 1O57A 4Q9JA 1EVZA 1T2DA 4AMYA 5FI1B 4TMYA 1KC1A 4JMLA 1WMEA 1DT3A 1E1NA 2HGZA 2OLKA 3IP7A 1B0ZA 1K7CA 1LRJA 3AR5A 3HFGA 3W2IA 3VU0A 2FEMA 1E6LA 3AU9A 4V39A 3FUWA 1SQGA 4QATA 4OFBA 1D5WA 4A0RA 5F7ZA 2ODPA 2ZSFA 5ALYA 1FLAA 1YKGA 2H59A 3H5WA 3IQWA 2QDXA 2MSEB 4IGFA 4KODA 4BVLA 4F45A 4Z51A 1VJ1A 4EG1A 1CBUA 2FUNB 2GR9A 3IQXA 4M1KA 4H1VA 1L5NA 3HCAA 1EYZA 1WDWB 1LSJA 4XJVA 4YI3A 2EVWX 3U44B 1ACLA 1JZSA 1W36B 2A1IA 2AK3A 4J29A 2B5WA 4NG5A 4D96A 1YS2X 1WU8A 3MELA 1YDFA 3QX8A 2G82A 2JLQA 3OQBA 1P3DA 4WECA 3RSZA 1LTQA 2RAPA 2WSLA 2VNKA 2G71A 1EQ2A 1TIPA 4REOA 3T5AA 4K6GA 3N0WA 3S29A 1Z25A 2WF7A 4MUKA 1X42A 2GZAA 3G2IA 1YK0A 2EGHA 3TECE 1FVOA 1OD6A 4I1RA 3QU7A 4B3CA 1BJRE 5C18A 5FIUA 3CLKA 4QXOA 3IDSA 4UM9B 2I1QA 2I2FA 5K3DA 3O8BA 4RKEA 3LYLA 2GXSA 2QUHA 2GM5A 3OF5A 4ZEWA 3ORRA 2J9FB 5E0KB 3M3PA 4WBXC 5AKKA 3AL3A 4RJLA 2F2TA 4EEXA 2VH2A 1W4LA 4F2GA 4MQFB 2IU3A 2MSNA 3TB4A 4J0FA 3CNOA 1ZK3A 3FMOB 3I5MA 5EESA 4KN8A 3SBEA 4EJSA 2OFPA 5HIMA 2VPPA 2AL7A 3CH4B 5TGTA 2J0UA 4G1UC 1WCYA 3WDMA 5JXGA 4AY2A 1P9NA 3CZPA 2BBWA 3FPKA 4MP8A 4RV4A 1JG6A 3E81A 3GLSA 1N25A 4I1UA 4ZCLA 3CX8A 4JI8B 4AJ9A 1SUFA 4LJ6A 4TKVB 2EOAA 1E3WB 4ZQBA 5BV2P 3UMRA 3IE2A 4J4HA 3UT6A 3SEQA 3TRJA 4BMCA 3MCUA 5T67A 3EHDA 4LYAA 5IYZA 2WDZA 4MQUA 1YE8A 4RJKA 3LT1A 1V7QA 4PYOA 2HW8A 2JLRA 2YR0A 3AUTA 4R2MA 1MRNA 2HU2A 2NXJA 4BFYA 5IVPA 3GGGA 3CLSC 2DVMA 1QH9A 1QLHA 2XNHA 1UIMA 2UZ1B 5J47A 1HNZB 1I1QB 5FQNA 2D5LA 3BMQB 2XECA 1LD3A 4XGKA 3Q3IA 2QP9X 5ARBA 2IDJA 3JRNA 2EFJA 1NJ1A 1E1DA 4MUIA 3S1AA 1A9ZA 3BTSA 3IOMA 3NW9A 3QPAA 3QUAA 4UPEA 1H8HD 2CDNA 1CR4A 1E3LA 4QG7A 2IYXA 5BSFA 1Z63A 2CCKA 4LHZA 1Z8FA 3LI2A 5AJTA 3KVYA 4IS3A 4NE7A 1SCUB 5E95A 1RRVA 4PHFA 1NQVA 2BFFA 3VH1A 4YPFA 1VLZA 4BFTA 3IOEA 2CYCA 2PUJA 3VKUA