2HN9A

Crystal structure of the uridine phosphorylase from salmonella typhimurium in complex with thymine and phosphate ion at 2.12a resolution
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
253
structure length
253
Chain Sequence
MSKSDVFHLGLTKNDLQGAQLAIVPGDPERVEKIAALMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPMEFPAVADFACTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRRFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPNAETMKQTESHAVKIVVEAARRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the uridine phosphorylase from Salmonella typhimurium in complex with thymine and phosphate ion at 2.12A resolution
rcsb
source organism Salmonella typhimurium
molecule tags Transferase
molecule keywords Uridine phosphorylase
total genus 84
structure length 253
sequence length 253
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2006-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2hn9A00
4DABA 3O6VA 1Y1SA 1LV8A 4M7WA 1NC3A 3FNQA 4TYMA 4OGKA 5B7NA 1TGYA 1ZOSA 4MCIA 1C3XA 1RYZA 1Z33A 1U1DA 3QPBA 1PR0A 3KHSA 3BJEA 5IU6A 1Y6QA 1OU4A 2Q7OE 4DA6A 5F73A 4YNBA 2QTTA 4D8VA 2QDKA 2AI3A 3FWPA 3UT6A 4TTAA 4DARA 1PR2A 5EPUA 1RSZA 4F1WA 5K1ZA 3P0FA 4BMYA 1LVUA 5ETJA 1Z38A 4BMZA 3ENZA 1JDVA 3K8OE 1JE0A 1RCTE 1K27A 2I4TA 1RFGE 2XRFA 3OF3A 4NS1A 3OZCA 3OCCA 3OOEA 1ULBA 4OJTA 1T8SA 3ONVA 4DA7A 4EB8A 1ECPA 4JWTA 2AC7A 4DAOA 4GKAA 1PK7A 4M1EA 3IEXA 1Y1QA 4YMLA 1RXSA 1LX7A 1A9TA 2AI1A 3E0QA 3INYA 1FXUA 1XE3A 1VMKA 3DP9A 1SD2A 4PR3A 1JE1A 4WKOA 1Z34A 2H8GA 4R31A 2BSXA 4KN5A 3BSFA 4MARA 4TXHA 4F2WA 3SCZA 5B7PA 1I80A 4YO8A 1Y1RA 4G89A 1PR1A 3TL6A 5KB3A 3PHCA 1RXUA 1V3QE 2I8AA 1T8YA 5DK6A 4R2WA 4TXLA 3O4VA 1Y6RA 1G2OA 1OVGA 3EEIA 1T8WA 1Z39A 1TCUA 1JDTA 2P4SA 2QSUA 2OC4A 4DA8A 3UAWA 4LZWA 1A69A 3OZEA 4DANA 4TS3A 5B7GA 1PR4A 4D8YA 4QAQA 4OEHA 4QFBA 4ECEA 3DJFA 3OZBA 1T8RA 1ODKA 5CXSA 4WKCA 3NM6B 4JOSA 1ZL2A 4WKNA 3MMSA 5CXQA 3F8WA 4FFSA 4PNPA 1PK9A 5EFOA 4U2KA 4TXNA 4L6IA 4TXJA 4LDNA 3NM5A 3T94A 4TS9A 3OPVA 2A8YA 5F7JA 1NC1A 1YQUA 4QEZA 2HSWA 4L5AA 3FUCA 1U1EA 1JDUA 3EMVA 1CG6A 4OY3A 1M73E 1A9PA 1PWYE 5IFKA 1NW4A 1A9QA 1SJ9A 1JDSA 3FB1A 1OUMA 3NBQA 3BL6A 5B7QA 3PNSA 4R2XA 4X24A 1A9RA 1PBNA 3FOWA 5EUBA 3LGSA 3MB8A 3K8QA 3KVYA 5CYFA 1U1FA 3ODGA 4IP0A 1WTAA 2RJ3A 4EARA 1B8OA 3GGSA 4G8JA 4LKRA 2ISCA 2AI2A 1JP7A 1VHJA 4H1TA 4DAEA 1RXYA 2B94A 5CCDA 3KUKA 1ULAA 3BGSA 4F2PA 1JDZA 4F3KA 4JP5A 4L5YA 4RJ2A 1TGVA 1SQ6A 1V48A 4L5CA 1U1GA 4OF4A 3LBAA 1B8NA 1YRYE 5I3CA 1Z5PA 1ODJA 4UC0A 4NY1A 1RR6A 1A9SA 4MCHA 1RT9A 2QTGA 5F7XA 3UAYA 5F76A 1JPVA 2OC9A 1SD1A 5F77A 4G41A 2HWUA 5CYGA 4QATA 1N3IA 4D9HA 4NSNA 4YJKA 3D1VA 3U40A 4LNAA 3GB9A 4DA0A 1ODIA 4BN0A 1RXCA 1Y1TA 1CB0A 3DPSA 1K3FA 1OTYA 5JPCA 1ODLA 2IQ5A 2QPLA 1Z5OA 1Q1GA 5CCEA 1PKEA 4D8XA 1Z35A 1QE5A 4GLJA 4I2VA 4QARA 5C80A 4D98A 2OECA 5F7OA 4TTIA 4K6OA 4LNHA 4BMXA 1A9OA 4P54A 1V45E 3KVVA 4TTJA 1OV6A 2A0XA 2OXFA 2HRDA 3DF9A 4TXMA 3EUEA 1T0UA 1V2HE 5FAKA 1PR5A 3PNPA 2A0WA 3UAVA 4GMHA 4OGLA 3C74A 2HN9A 1OTXA 2GUWA 3E9RA 1JYSA 3KU4A 3OOHA 1Z5NA 2ON6A 4WKPA 1TD1A 3P0EA 2PGAA 1Z36A 1K9SA 4QASA 3UAZA 3NM4A 3UAXA 3EUFA 1YQQA 3LA8A 5F7ZA 1V41E 3IOMA 1PF7E 3FAZA 1PR6A 1V4NA 5F78A 1PW7A 1U1CA 4F3CA 3PHBE 4GLFA 1YR3A 3KVRA 1YBFA 1TCVA 1Z37A 1VFNA 4M3NA 3DDOA 4WKBA 1VHWA 3OZDA 2A0YA 3E9ZA 4E1VA 4L0MA
chains in the Genus database with same CATH superfamily
5DBGA 2XNCA 3I3SR 4G8CA 5ICFA 3FCOA 4N18A 1CP2A 4IUYA 4PV7A 1DWOA 2BEUA 5A5VA 5MGNA 3JYQA 5AJZA 2C0CA 4HATA 4R9NA 4AG6A 3FYUB 3UWKA 2C7VA 4WFKA 3G59A 4LW8A 4V0OA 3GRCA 3WWDA 3SVTA 4Z4IA 5B58T 2HBZA 5EYPB 4MW2A 2BMEA 3B60A 2CNWA 3TFQA 3QOFA 1YB2A 1CKEA 2HDOA 2YN4A 3IPRA 3W2EA 5EMMA 4JKIA 3OLYA 4DCNA 5K3EA 2IOYA 2WWFA 5DGTA 6REQB 1WBDA 5AKEA 1RAGA 5LMZA 1CEEA 2X86A 3URMA 3E2MA 3IUPA 4YJHA 1BQ4A 2XF8A 3TKAA 3GMSA 1H42A 1XCMA 1M34A 2IWRA 4HAVA 4H9GA 4NONA 4JI0B 1RI4A 3INGA 4RCZA 1VBKA 3RBAA 4F9EA 4KR9A 3WGNA 5CM8B 1VDMA 1VSUA 4H0NA 4D9BA 4ZOBA 2R6JA 2WWVD 3U39A 1J2JA 5IJ0A 1RRMA 4TV8F 3SI7A 3ZVRA 4JXXA 4M7PA 1GGVA 4BB6A 4MMYB 1PZEA 1EK1A 2P67A 3GAZA 3ENNA 5AKXA 3TFWA 3S2EA 4U0JA 4B7XA 5A62A 5DI9A 4QPJC 2GCNA 2P68A 4J0QA 2DERA 1LPPA 4QHSA 2O8NA 3F2IA 2GM9A 5J2TF 3QP9A 5FL3A 1QHFA 1PJ8A 3TLGA 2ZBFA 1R6DA 2C84A 2I5PO 1Y82A 4HGPA 1D0VA 3CFYA 2GJ9A 2QD4A 4PANA 2AWNA 3EHEA 3PRYA 4I9HA 4JR2A 4LTMA 5EGSA 2DECA 3MJHA 5F9MA 4ERNA 5JXIA 4ZEOA 5CDTA 3ABSB 3NEPX 2BV3A 3L4SO 3A7DA 3WGZA 2LVBA 2BLNA 2G9VA 3R2JA 4ZU6X 3O8CA 4DUYB 3P0FA 3H04A 2XUZA 3OKAA 3ANXA 1AHNA 4BB0A 2YV1A 3H5RA 2PVCA 2PQ2A 2C59A 3OTQA 5LKAA 3C3DA 3L46A 2MSNA 3NHKA 1IQ0A 3VJKA 3LGXA 1E6MA 1N6LA 1K27A 2Q5HA 2YHIA 1XWFA 1HWYA 2ERCA 3A6HA 4NAHA 2ZVPX 4N8DA 3RTDA 2WRZA 3EG9A 2V6GA 2EGHA 1KO4A 4CV0A 3TTSA 5B3KA 2PKEA 4H2DA 1RS0A 4ME6A 4BLSA 2XNSA 1JZSA 4KFTA 1P2BA 2ZSAA 2QP3A 4KXLA 1VRVA 4QSHA 2ZZKA 5CHEA 5FTNA 3PCTA 3C39A 3F4LA 4O4LB 1W2GA 1KEEB 3G9ZA 3LCUA 4ZO6A 5LYJB 2OGWA 1Y33E 4OGGA 3SMQA 1F17A 1PNOA 1PEYA 1NASA 2PAFA 2XBLA 1CP3A 3LPDA 1IEWA 1V6SA 2JI9A 4KRXA 5AM5A 4BGVA 4WBNF 3O2QB 3K6RA 4MW6A 2WJWA 4FX2A 1NXSA 1SN7A 3CR7A 4IFEA 1STOA 2GWRA 5ALXA 5JFGA 2O2YA 4FBMA 4O4JA 5MFPA 2Q3CA 4MA4A 2IEYA 2ZBDA 2ECPA 1T2FA 3QKUA 2JJQA 2Z4RA 3NEAA 2GPAA 2W58A 1NPTO 1ZAYA 3K1JA 3UB3A 3JRXA 3B6EA 3GJ8A 2Q4EA 3ISJA 2YC4C 5B4VA 5LD2C 3AHHA 3Q85A 4IDEA 4S1TA 4UCFA 5FLKA 4EA9A 1X1RA 2NQ8A 2O6HA 3AF0A 5D87A 4C14A 4F86A 3VA7A 4AZ0B 1QO9A 4CEIB 1JE1A 1DFHA 1I51A 1XTKA 1Z0DA 4GW3A 5K01A 1AUQA 4ADSG 3QEBZ 3BXZA 3G0IA 1KNXA 4K6CA 2QENA 4K2HA 4X7BA 3EXG1 4TXHA 2O7RA 5KNBD 2GN2A 3DC7A 2Z58A 1XXHA 1QG0A 2FPKA 4F1JA 3IA7A 1QBGA 2P9QA 3TL6A 4EW6A 5EVJA 5KVVA 5A2QA 4R1LA 4A3SA 1J1UA 3SK0A 5JNTA 1XVIA 2V6IA 3FYTA 4AQ7A 4B3JA 5LUAA 1M6VA 3A0UA 4TXLA 3WWCA 1EDDA 1UBHS 1Q83A 2IU0A 2XWPA 4Q47A 3BJZA 4QQNA 2YINC 2X7XA 3DC2A 4V0QA 2I55A 2YKGA 4R6WA 1CRZA 3C6MA 1IY0A 3GLSA 4M54A 5K8JB 1Q50A 4R40A 4NYIR 3V1TC 1ZD5A 3GHYA 3P1JA 2BHRA 4ZVQA 3AEYA 3PNBA 1ZUNB 5AKHA 5F1PA 1W36C 3OIYA 4JL5A 5KTTA 2EFGA 5YASA 4Z4CA 3C3EA 3OE1A 4H7FA 5AM2A 5J4KA 1RKBA 2NO9A 4A7PA 4O33A 3THWA 3KEGA 4KR6A 2C00A 5DRYA 2VOEA 2ZW9A 1ISIA 2A1UA 5GIPE 1E0AA 5AXCA 3L9WA 4B2LA 5BPFA 4C05A 1YZYA 2QTAA 2JKYA 2GD0A 3AUFA 1U0TA 3O4IA 2OILA 3OY7A 4FFNA 2EARA 3AIMA 2IHZA 3DOFA 1P2TA 3EXHB 4QOEA 4YEDA 4DLPA 4I4TF 3D6TB 4BY9E 3BRQA 4OFWA 4YN3A 3TPFA 3LMKA 5HEKA 2ST1A 5JJLA 1P5ZB 5CITA 2O0LA 3HHEA 1D2EA 4EA8A 4WBXC 1QZTA 1ECFA 4QFBA 4MS4B 4F3YA 4JBIA 3IAM6 1O96B 3VGJA 3U3OA 3OFJA 4H0CA 3X1KA 3TLAA 3ZZUA 3D3WA 2AK3A 2WIFA 4RIGA 2FOLA 1EBUA 5AXDA 1RW4A 4XQCA 3SEQA 1I4WA 3ZQJA 3RAGA 1CQWA 2ZTLA 1JIXA 2PY6A 4TQAA 3AF6A 3UYKA 4A91A 1BC5A 3JD4A 2CFCA 2WUDA 1ZGCA 1QOZA 1FFSA 1YBVA 4QOSA 1QF9A 1QGYA 2CYBA 1O94D 4MRSA 2H59A 5KNDA 2G88A 5KYGA 1GILA 1ISSA 3STTA 1EHYA 3R23A 4D56A 2D00A 4MQMA 4BASA 1YRAA 3CA8A 3JQGB 3GVXA 3NM5A 3OIVA 1GUZA 2DQ4A 4J0KA 4Z0NA 3IFSA 2DFPA 3ZWOA 1SZJG 2PZLA 3D0KA 4N3NA 3RJMA 3UOGA 3CIFA 1BTOA 4AX4A 3I8SA 4EJSB 4NRDA 2KBEA 1E89A 3W6UA 4YFVA 3C5VA 4WW0A 1JTEA 1RC1A 2BMDA 3GIDA 4JHLA 4OSPA 4OXYA 5D6NA 3VDQA 1RHUA 3ZNQA 2CLSA 2PD6A 3GVHA 3GG2A 1WUYA 1Z8HA 1UK6A 3H87A 1Q7GA 3PFFA 4XKJA 4MW0A 5FWDA 9ATCA 3QJ5A 2N1MA 3JQBC 3DEHA 2ZRAA 2H4ZA 2VXYA 5KTRA 5EZYB 1A2KC 4D0LB 2Z5VA 2VSQA 3GJ7A 3HU3A 5HGXA 3F2VA 4B7CA 3BWCA 3VR6D 2X0RA 2XYRA 3HU5A 4G5OA 3KEOA 5EEGA 1P0FA 1AV7A 4UCXA 5HQTA 1BMTA 4HX9A 2JRLA 5AJXA 5FPYA 1G6Q1 1O5IA 4AB1A 3KVOA 1NTOA 1XZEA 6Q21A 3SKVA 1QS0B 3RABA 3C41J 1L5NA 1S7CA 3SZLA 4N01A 3WLTA 1M7HA 2QG6A 5IM4F 4CQLA 1ONOA 3GYGA 4LFAB 4YRTA 4EKYA 2DKNA 2FLKA 2JHGA 2YXDA 4RK1A 3L8HA 3MXOA 1HG1A 4IIYA 1V1JA 4WLVA 2NU8A 3FOWA 4Q02A 1N5JA 1GGKA 3SHTA 4B31A 4RL4A 2WHYA 4X6UA 2BM0A 5TQ0A 1L5OA 1PT9A 1WTAA 3NGXA 1WMDA 3MUNA 3F73A 5KNCD 1WF3A 5LA6A 1W9MA 2G25A 1IBKB 3QLVC 4V0KA 1DC4A 4JYAB 1G3QA 1F2VA 2MYPA 2W48A 1CRQA 3DTVD 4F6RA 1L1EA 3ZDYB 4ER5A 5SY4A 5BW5A 3ID6C 4RPIA 3VYVA 3FH0A 3M9LA 2BR3A 2H17A 4WA8A 1DO2A 5TGDA 1JQBA 2C7BA 2B8JA 4CYMA 4H1TA 4YT4A 4DSTA 2AUMA 1QP8A 3AR6A 4K26A 1H9AA 4MVJG 3CNOA 5ALOA 3IV9A 3A3KA 4LBVA 1V7QA 3G2NA 1HI9A 3OP1A 3HDGA 4IMRA 4RJ2A 1SQ6A 1TF5A 3U62A 4FD3A 1OE0A 2CDNA 3I72A 3CSSA 4PLWA 3ZHQA 1MC1A 3Q8WA 1TW2A 3HSKA 2QVZX 3HWSA 2GLXA 3K9GA 4JC0A 1GQRA 4KTTE 4R7GA 1OYYA 1F6DA 2PYDA 2XQFA 3AF1A 4A0RA 4DMGA 4EKNB 2NTJA 1XI2A 4ARAA 4Z86A 5I7HA 2C0PA 1KJNA 4MKFA 3W5IA 4DCUA 5EJAA 1JR6A 1EB9A 1XQ6A 2C4VA 5FBHA 3ZLBA 4RHTA 3WLHA 1XZNA 3M82A 3HYNA 3NOQA 3LFHA 4ZVTA 1BXRA 2OZLA 5C5IA 1VGQA 3O8OA 1PJZA 4KBGA 1YDHA 2HRCA 4Y6QA 3UPUA 4N7MA 4KXFB 2KE5A 1GKYA 4EF5A 3ADOA 5LM3A 2DH5A 3CLTC 5EIBD 2GEUA 4D3SA 4RK6A 2VAWA 2IE8A 4WL0A 2ODAA 1VM6A 2PA0A 3FETA 2GD2A 3KDPA 1NLFA 3DLIA 3KR1A 4R1UA 4GKVA 4GVLA 1J9GA 5CP8A 5IKEA 3IO3A 3HJFA 2EZUA 3MGGA 2WY2D 2FB9A 5A2GA 4W7HA 1CRPA 4D9NA 2C83A 1ZK1A 1QORA 4GMXA 4I1IA 2IOFK 1XZAA 1MTZA 4WY2A 3JZMA 2AT1A 1QK4A 1U6IA 2QX8A 1YZGA 2X1MA 5AKIA 4G0VA 3QPDA 4DIUA 1XNQB 4X61A 2CWWA 3MT0A 4Z6KA 4P5DA 5C1BA 3H97A 8OHMA 1D2GA 1N5KA 4B4UA 5FL7D 4JYPA 1WUIS 2WW8A 3SNKA 2J5KA 3V48A 3EVNA 3JCZA 3X1WA 3GEEA 2ORIA 1FU7A 3IR7A 4BFCA 1N8TA 2GTHA 3VOAA 3LUPA 3IBGA 1Z0FA 2IQ5A 3CGGA 4M1YA 4GI1A 1YQGA 3JATB 3K31A 1T5TA 2NO5A 1V6AA 2HMUA 4OI0A 1MH1A 4MHSA 2Y99A 2ASEA 2GCOA 2HU2A 3QXJA 3DYVA 2E1PA 3WFZA 4RXTA 3SYRA 4URYR 1TJ4A 1N2IA 2CEKA 2UZ1A 1AGNA 1XYGA 2WFLB 2WUVA 3MTDA 3ODPA 4CM1A 4XGNA 3OTOB 3HTXA 4P4UA 3LI2A 2NU9B 2IODA 2JIBA 1KHTA 4F11A 3WB1A 3E1SA 4L28A 3F6RA 2ZSUA 4GZMA 1R8XA 3S70A 4POOA 3NHFA 3RGGA 1ZM4A 2WHEA 2QX9A 4YWHA 3ML1A 1M6NA 1QWSA 3VNUA 3Q3HA 3NPMA 4A2QA 1KQGA 3QWHA 1UF9A 2VIIA 1IVYA 1C9YA 1I9CA 3BK2A 5LYYA 2D4AA 3P9NA 2CWDA 2QM8A 1QFXA 3FCEA 3S5JA 1G41A 1KAHA 2Z3WA 4TXMA 4K8RB 1EDEA 3JQDA 3L4BC 1ECCA 2EP8A 4PAQA 1FIUA 4EVQA 2MCFA 4DQXA 2REBA 3OEWA 4NJEA 3V1UA 3RVQA 2QX7A 3IQFA 1U0OC 1G21E 4I1OA 4QT0A 3SVLA 1NSFA 2WVJA 4UEJA 3MMXA 2DBQA 3OI7A 2GXUA 1W581 3FPEA 1W48A 3F5MA 2OFXA 3ILSA 3DMRA 4BFSA 3RYHB 3QM1A 4JP1A 3T7KA 3D6NB 4IH4A 3C7DB 3VZQA 1I6MA 1FP7A 3HPQA 3R7NA 3RS3A 1N36B 2EP5A 1HRKA 1TK3A 2OEPA 3RROA 3OT4A 2GA8A 3U3XA 3ZIAD 2G5PA 4C08A 4BRSA 3NWEA 3RE1A 4OLFA 3ZDZB 1DQNA 4REQA 1DZIA 5DTRA 4DQ0A 1PJLA 3MLAA 3BD6A 3LYAA 5IKMA 1G20B 1MO3A 1EJ0A 1P9OA 2Q1SA 3DWIA 3FHJA 2PMEA 4IIVA 4JLJA 3A4LA 2R1ZA 3IXLA 4I5EA 1XCOA 1GCGA 2ZUDA 1NXPA 2AKYA 4J03A 2QLMA 4J0IA 2RBGA 2P78A 4KO3S 2Y0BA 4TRNA 4C6HA 1ZC3A 4EKEA 2VK8A 3K9FC 2WBLC 2QN8A 2BE7A 2G80A 3QXGA 1KVQA 3MT7A 3EWSA 4PSDA 2HHAA 5FT9A 5H3CA 2EDCA 2CUNA 5EKUA 5JOQA 4CQNA 4P9NA 1W29A 4WH0A 5CMLA 1OX4B 2BEUB 3ED1A 4BHTA 1SCIA 4LJ8A 2FSFA 2IIVA 2QR2A 5KC9A 1JTVA 1UOOA 3RBZA 4TVBA 4FFVA 3VVMA 1R4NA 4BNFA 1WOYA 5E4TA 1NIPA 1TMGE 1RM0A 1G3IA 3INTA 5HCNA 1GJRA 1FFXB 3PI6A 4J6EA 4WUVA 3PGMA 5JVDB 1E3SA 3U1BA 2QYHA 1CY7A 1OC4A 1LPNA 1Z37A 3L7LA 5THXA 4JI5B 4DJEC 3GROA 1F8XA 4FZ3A 4URZR 4B4WA 2RJOA 4PPFA 1JZTA 1YE5A 1COWD 3ORHA 4E5UA 3RVSA 4PG8A 3THYB 3E9ZA 4PSAA 2GZ2A 4WK6A 4U2DA 4UTPA 3BXEA 1EWVA 2OBNA 4HTFA 2FHPA 2FWNA 5C46F 3KWFA 1PZXA 5HG0A 3T06B 2IHVA 2QJOA 4H15A 3WA6A 4DIBA 3ORSA 3BM5A 2NYRA 1VCIA 4G2TA 5F2EA 5BYJA 4ER6A 2CHUA 4E2FA 4G9BA 1KI9A 2RD2A 1BVRA 5J1TB 1WB4A 2RGEA 1UMBA 3PXXA 1M66A 4CCSA 3PUKA 5BRJA 1M3SA 3PUIA 3W8FA 4HDRA 4C4TA 3QVGB 5IEBA 4PX3A 4CTKA 4RTSA 4K9SA 4I46A 3M6XA 4UBMA 1EEXB 2VRBA 4Y9DA 3LK6A 5JIBA 2AVNA 2I4IA 2VNKA 3BSSA 1TT5B 3C8ZA 4L5IA 1Y89A 1YACA 1ZYUA 2X6TA 4DCGA 5ELMA 3BIFA 4BN5A 1OCEA 2FN4A 1XJ0A 3JARB 2FQXA 2LXNA 1H2XA 1NI4B 3GWGA 3CE9A 4B6JA 5IU6A 4U7HA 3CVVA 3FTEA 2OQRA 3PICA 1OB2A 2NZWA 2QEQA 1NHWA 3ADKA 3HL0A 3DAGA 1MQAA 2CBGA 4BGDA 1RPTA 4WK2B 1VMIA 2QAGA 4QU9A 1VCNA 4M6WB 3WLIA 2E5WA 3VU9B 1OU4A 3CO5A 2OQ2A 3E48A 5EP3A 3ZU5A 2CKMA 1LBQA 3ZNNA 4ABTA 4WESB 4KIGA 2QSZA 4KHPB 1EFUA 1MB9A 3CM0A 4BO1A 2XYHA 2QDKA 4GF5A 4NOKA 1Z73A 3ZHXA 3A3PA 4D5GA 3CLUD 4X92A 2GESA 2WHPB 3D3NA 3G0DA 3I6ZA 5DBEX 3G8DA 3UMRA 5A1TA 3IHKA 1XAJA 3VISA 4IICA 3Q9LA 3R7FA 1UH5A 3RQSA 1EGQA 4L5BA 1IE3A 1S3GA 4FDVA 4LVOA 4ZVLA 4OHZA 4JL8A 1NF8A 4NWIA 4F8JA 1BS9A 4RSMA 5ICCA 5IPFA 5HTOA 2AJLI 2DRIA 2CJWA 5KSWB 4F1WA 3A4TA 2BMJA 4EEZA 1OYVA 1MEOA 4RVDA 3EF3A 1QIGA 2VUSA 3PUJA 4G86A 5A3JA 2J3EA 2QI9C 1Q7RA 1RAHA 3DZDA 3TRJA 1WCXA 1TVMA 2G6TA 4HQKA 5IW8A 2GNAA 1N6IA 3ZE1B 1DWUA 2ZKLA 3C85A 3OPMA 3PE3A 1MA3A 2WF8A 2X8AA 3PBKA 4MR9A 4R0MA 1SVWA 2RI0A 4UUPA 1YZLA 1SXJB 2XMCA 2OBLA 4ZRNA 1I3NA 1V1MB 2JGLA 2POQX 4ZI3A 1TMYA 2Z9DA 3OQBA 4GM4A 3WX0A 3H86A 3PDJA 5JJCA 2GN4A 4JT9A 1AXRA 2I6XA 4DHWA 1YJ8A 2W9XA 2HF9A 1U3DA 2HMWA 4OFXA 4DSUA 3KALA 3KZVA 5GWXA 4KMOA 2F3RA 2CHQA 4OJTA 4WERA 3UWPA 2N46A 3L1IA 3OSUA 5IJWA 2CLCX 3QU7A 4MKZA 1WUHS 2ETXA 1OXVA 1MT0A 1U9YA 4GQAA 3QUBA 4DWVA 2BEWA 1DMRA 4YHBA 3IEXA 4KR0A 3L0IB 2PV7A 1G2QA 1AT1A 3JY6A 3OKPA 5K3OA 4ZJPA 2FZEA 4Y2GA 1VMKA 4EI7A 1FNNA 2FPWA 4FZRA 2HIHA 1LPAB 4FNOA 1JSLA 4PCLA 4PXAA 1CHDA 2QZPA 3PPWA 1EVYA 1I3LA 2OMKA 4GSLA 2R44A 1DAFA 1SD2A 2ZBEA 4YREA 3S6JA 4EHDA 1IZ8A 1P9NA 3DMTC 3GDWA 2R8EA 3GZJA 3SLRA 4EPVA 3RUHA 2BHSA 4JJ8A 2G71A 3QFCA 4DTIA 2DB3A 1KYTA 4IG9A 4JA2A 4RH0A 3O1IC 2I3GA 3EAQA 1EP1B 3MCVA 3PR2B 4A26A 4M1MA 3T3GA 3L2OB 3IUQA 3RJ5A 1G3MA 1L5WA 2X0DA 3BZUA 2GB4A 3ZX4A 4PRYA 4UNIA 2RGYA 2I78A 3L1VA 5ENDA 3ANSA 1QGAA 1TKCA 1MTOA 3I01M 5E8JA 4CKEA 3AY0A 4ZIRA 5AW7A 3KV1A 1XPOA 1TZ2A 1GZSA 2I8AA 3INNA 3HDHA 2ZBGA 1NW5A 3HDVA 4LZAA 1GRVA 2A9PA 4BO4A 4BV3A 2BM1A 1E5TA 1K7EB 1Z8NA 3UN1A 4LGVA 1W6RA 2CDBA 5A9SA 4F92B 1OVGA 1QR6A 1L1FA 1CJBA 5DI3A 1Z39A 2AQHA 1I4DD 3WNQA 2K6GA 4NQRA 4QXOA 5ILQA 1OC2A 1TCUA 1UP6A 1SUBA 1JDTA 2PWBA 2ATIA 3IT0A 2MSEB 3DMGA 3EPJA 2V7WA 3PPXA 1JFFB 2WKQA 4KE9A 1H0RA 3WYAA 3CEMA 3FPHA 1TQDA 4LXTA 4WLUA 1C50A 2Y6UA 4TLMB 3TNFA 1ZITA 1MIHA 2BJWA 2F3PA 2PLNA 3OHSX 1A4IA 4CEHB 1GU1A 1BCRA 5DNWA 2JJ1D 1TTHA 4JX9A 4H6PA 3BVPA 1S4MA 1U8UA 4MW9A 1ZGZA 4KE6A 4W1PA 1JFRA 4W5WA 1N5IA 1TKAA 1WLYA 3F3KA 1MJHA 3IVMA 4PBTA 5AVOA 3KKZA 3MRTA 4Y6PA 1EU1A 2GM5A 2C5FA 2XWQA 3JQGA 5AKYA 3VR3A 2HMTA 2IXFA 4LPKA 4EVRA 2JFHA 5C18A 1ZVVA 1BE8A 2Y9MB 4ZVOA 2HBQA 3E05A 3EE6A 2Q07A 2XNDD 3AFIA 3H3XA 3WB9A 1N5OX 2QZ4A 1KTVA 4FBGA 1WD7A 1GNTA 2X1VA 2ZU6A 4EYSA 1K7YA 4XQEA 3TECE 5FL7A 4FU0A 2QRMA 2O48X 4D57A 1ZK4A 1FFEA 4Y1FA 1GO2A 1PZFA 4OMCA 4RH1A 1BG6A 1XEAA 2CVFA 2LDXA 2OR3A 4WKNA 2ZRBA 5JD4A 1SU4A 3ZCSA 1UJ5A 4Q00A 8ADHA 1ATIA 4IJMA 2PZ8A 1BHO1 1MC5A 1ENPA 3KL4A 4P7JA 3D59A 4K86A 1Z13A 2C1ZA 1PL0A 2G9ZA 2I54A 5BW8A 3Q12A 5IBCA 4ZVRA 1J6UA 5HVNA 1SCBA 3IKMB 2V1XA 4B7ZA 5B1EA 3KOXA 4DPKA 3U2QA 4O4JF 2YFQA 2PUVA 5AOBA 2RHBA 3HUEA 2QS9A 3M2TA 2GILA 3RTEA 1U8FO 2IT1A 2OLEA 3D1LA 5DLEA 2ILVA 2HV9A 4D3DA 1COZA 1KJIA 4G4SP 3IBYA 3WWYA 1FRFS 2Y4OA 1H2RS 3N39C 5K8LA 2OM2A 3JQPA 4ND1A 3RVMA 1KFKB 4H08A 3TI7A 4EJ6A 4FYJA 2JCXA 5L3ZA 4BO7A 4JGGA 1BOFA 4IZOA 2VPWA 3ICVA 5D3QA 4DRXA 3Q6MA 1DCFA 1NVBA 1U7OA 3IPCA 5FI1B 2AZXA 2I6GA 4BO9A 1EQ2A 2YV4A 3TZ6A 2QE7D 4Q3LA 2LZ0A 1U90A 4EGQA 1QIKA 3H0KA 1RWMA 2GZAA 4PTLA 5AIAA 4Z9FA 4COOA 2QRVB 5CFLA 3CH6A 3CX8A 3JX9A 3K8ZA 1GUDA 2QTVA 1LTHR 1PJQA 5EG5A 1F14A 2OBBA 3FPBA 4LV6A 5I9SA 1U2TA 1EE1A 1UMKA 1XFDA 4PZCA 1EUDB 1GAEO 3NIDB 2JDID 3V4RA 4Y6SA 5A04A 5LNK1 4FUQA 2ILTA 3P9ZA 1G291 1Y4UA 3UUEA 4F71A 1TVKA 2EIXA 4D4IA 3FM9A 4MV4A 3ABQB 4EHBA 2J08A 3A1CA 3GI1A 2ZB2A 2PJDA 1MUUA 2BW0A 4MVYA 1C9JA 2FW0A 1P39A 1NKSA 3ASYA 3C7AA 3DVSX 1UKEA 1WXGA 2J41A 2V7BA 4GGOA 3WHLA 3CZ5A 4KGDA 4O08A 1S7GA 4ZVNA 2WJJA 4PLVA 1J2TA 1RM5A 2RK4A 1XNJA 2FF7A 3ADPA 5TY0A 3WL5A 5J2TA 1VSVA 1W36D 2ANCA 2VCYA 1CJSA 4JB8A 1CVIA 4JUBA 4O6VA 5DYIA 4UMEA 4WN3A 4D9MA 3H6KA 3AG5A 1OIVA 3WYCA 2GXSA 4OH1A 2HZBA 1KC1A 2F1HA 2B0JA 1P2GA 3T5MA 5I6DA 3HNPA 2OQIA 3AESB 3KUDA 5HOQA 4HKTA 2ISCA 3NNSA 3ZDRA 4AZ3B 2CJPA 4P4GA 3SEAA 1KSHA 3VC7A 3DCIA 4B6GA 4OTZA 3VO1A 2HQOA 1XK6A 2JJ1A 5FA8A 1KMMA 4M0KA 4TPKA 4JKOA 1J99A 1JB9A 1T1IA 4ODIA 2AE1A 3F3YA 1ZD1A 2H2WA 3OJXA 3AIIA 4IIJF 4M9CA 5JI3E 1CS4C 1XDDA 4F3KA 1VLHA 1XO1A 2J3HA 5IYZF 5DN6D 5JAHA 3FRIA 3I3OA 1O0SA 1TGVA 2FR8C 2WYIA 4IDOA 3R5FA 4Q9HA 2HJVA 2W6JA 2PN1A 1K8RA 2RHHA 2FEMA 4GUAA 5FP0A 2IHBA 3OEHD 1QHNA 3WMWA 3DG9A 2Z5GA 4RVGA 1C3OB 1DAHA 1ORIA 2O7QA 3K16A 1U02A 3ZTYA 5JMOA 2OMEA 2GO7A 1V8ZA 4A0QA 2C20A 1UJ2A 2DHRA 1IBSA 2DT8A 1ISMA 3IUMA 4IQFA 2QLJA 5H3LA 5J2UF 2A88A 3QTTA 2P40A 2OB2A 4CCYA 3ND5A 2EFDB 4AJLA 4M1WA 5IH7A 2FR8A 1JA1A 3GZNA 1E0JA 2CXSA 2HA6A 4DJFC 2HWWA 2O0JA 4TS1A 1VPLA 4HWPA 3RU9A 2YYYA 3FMFA 2REQA 9ABPA 4ABYA 5GM2A 1BD3A 1YONA 1ZRNA 2VTKA 3WNBA 4QRIA 3DUFA 3PYXA 3P0RA 2CUKA 2IDJA 1H2ZA 3PQ8A 3X43A 1QE0A 1FYFA 3E9DA 5LPNA 4QATA 4RF5A 5ENZA 1CWUA 5HFJA 1CUVA 2PKWA 4AJOA 3HGQA 4ISBA 2M6SA 4HWOA 1EXNA 3P2EA 1U8ZA 5DBOA 3ET4A 1U4NA 5KYYB 3DZHA 3T0IA 2C2XA 3K0KA 3KKLA 3QVVA 4XZ3A 1J7JA 1XRQA 4C0XA 1FY2A 5AI6A 1AU9A 2NU9A 1NVMB 4AM8A 1PVVA 2L2QA 5JSUA 3LUHA 2ZPUA 1C9EA 1GRNA 2WVAA 3BXPA 2BLLA 3O3MB 3PT9A 5H0IA 3RSOA 4AAYA 2WZBA 1FMFA 4WCFA 1SVSA 1M1NA 5LP6A 2BBTA 3VR5H 4PAMA 1OTYA 3U4QA 2NMVA 1NN5A 3A9CA 4QYMA 1DVRA 1L5GB 5CCBA 1EP9A 1UFRA 4J90A 1J2EA 2BMFA 5DHSA 2IH4A 4CNBA 3KYIB 5TGTA 1WAMA 2H48A 2HBRA 5G3YA 2ORYA 4ZMRA 3EBOA 4M0MA 1BGVA 3V33A 1OFHA 4MROA 1QFSA 1E61A 2ASVA 1S89A 2BVNA 3IL2A 2HTFA 3FOAA 1W25A 2Q4BA 5DISB 4GQIA 4PO1A 4MW1A 4C43A 1A98A 2XLCA 2CL6X 3LU1A 4I2VA 3NWPA 4JZKA 3ZBPA 5AW3A 7REQA 4R81A 1P8AA 3N87A 1H85A 3EVAA 1UOPA 5K3SA 1KFCB 3IMKA 5JVDF 3D2AA 3T35A 4I7EA 3R41A 5B2ZA 2ZB3A 1LLUA 2KBFA 1K8YB 2L0XA 3PDCA 4H1VA 1G5RA 2WD7B 3HB1A 3TG2A 3L4KA 3R0JA 2HRDA 2C4UA 4OQYA 3Q9NA 4CBVA 2ARKA 4UU0A 3LK7A 3ECCA 2V7GA 4HRYA 5HUJA 4DB2A 3L93A 1UDCA 3ITKA 1UAYA 4CMJA 2IW3A 3R9KA 2AFIB 1ZY2A 1B8VA 2ECKA 2FRDA 4RGVA 4ZDIA 3RREA 3GUHA 1QXSA 5A5DA 1WXIA 4K6GA 3EIUA 2OCXA 4LJ4A 5AVQA 4QYIA 1NXWA 3GRRA 4EG5A 3L02A 4EWLA 3GD5A 5BYAA 4CKZA 2ZUEA 3H1PA 2WYUA 5FOUA 5L40A 1CJCA 1O2DA 3SFZA 1FDOA 3WBFA 4PPYA 2VUUA 5DHFA 5GY7A 3EEQA 2G67A 4E1BA 2HQSA 2YBDA 3CSUA 3KHKA 4KVGA 2GUWA 4N6NA 4YDHB 5GGXA 1H94A 1U2GA 2FU5C 4Q18A 1W30A 3QU2A 4B3IA 1TD1A 4QLOA 3P0EA 4CTNA 4CM4B 1G2IA 5ALTA 3OG9A 1MNQA 3A9SA 4R05A 1XK7A 1XZKA 1M2NA 2NGRA 1KMIY 4YMIA 1NM5A 3A1UA 3KJXA 5FBZA 2PE5A 3JRNA 1CQIB 1UINA 1B41A 5BSUA 2G4CA 1AGPA 3U80A 2FW8A 4B5LA 1P9LA 5BO5A 1GGNA 2IYRA 2VI5A 4MRAA 2NQ2C 3UAXA 1QK5A 2C2HA 2MSCB 5IK2D 5JRZA 4LZZA 2XRYA 1SXGA 3E7DA 2CXRA 1WB6A 5A71A 2CE2X 1Y5LA 1B6TA 1R5JA 3W77A 3RSHA 4JOQA 2XMBA 3LUKA 4A6EA 1Y7TA 3KKKA 1K92A 4MKGA 1E7RA 2DBRA 3GH3A 1EFDN 1LWOA 3MLEA 3GEPA 3RKSA 2R11A 3AKYA 4Q93A 1AZTA 4DYHA 1LZKA 5IVPA 1OWOA 1B76A 2FV8A 1C14A 3GGJA 4H3KB 4YAOA 4ZAGA 5T41A 3OIWA 3VPBA 3GZTB 5AW5A 5DM2A 5I7FA 1XMOB 1L1RA 1K6MA 3NJRA 3O73A 2O57A 4KLCA 2YMLA 4LTNA 4R7TA 3EVGA 4IGIA 2XT0A 1NR5A 1XN4A 3KS9A 4Q05A 1A3CA 3A14A 3VJLA 1GDHA 1QWOA 4C0JA 1M1YE 3DDOA 4WKBA 3SX0A 1R37A 2V8OA 2BY4A 4E1VA 3W34A 3F7NA 3N0WA 5IDVA 2CXHA 4EP1A 2ZJOA 3MTQA 5CFPA 4KQ2A 2PJZA 5FEUA 1P1RA 5EJ4A 4IVRA 4PRLA 3IXMA 1ABEA 1Z9BA 3NATA 5AKGA 1XF9A 3T0GA 3LQFA 2QAGB 4LC0A 4BBPA 2XYGA 4FDTA 1IZ0A 4RIHA 3R5XA 1P61B 4UEOA 3WNCA 1JAYA 3QNWA 3W2GA 4X94A 1EB8A 2WTMA 3ZLUA 4EHJA 2FZVA 3TG8A 4RL6A 5F21A 4M0EA 3BL5A 4HG2A 3PFNA 2GAOA 1CULC 2VZ0A 3AF2A 2WJYA 2ZB8A 4L75A 2XV1A 1WP9A 4NU0A 2CB9A 4Q3EA 2QGFA 3A70A 5J5AA 2CXNA 3UA3A 2WG1A 3WGLA 1XYVA 2XNDA 4QOGA 4QXRA 1QHIA 5TDHA 1BH2A 1JKXA 3M6FA 4IHJF 3NHRA 1USVA 2V5VA 4OVKA 2ODNA 4R8MA 1RYBA 4H1WA 5K3CA 4ZVSA 1G59A 1L7XA 1N5RA 1RABA 4UTRA 1UZAA 2CEAA 4ZT2A 2RGGA 5ALIA 1DELA 2VT2A 1PWEA 4JD5A 4PYLA 2MSDB 2ORED 1XT6A 1CRLA 2I3BA 2X0KA 2Q6VA 3P97A 4HWRA 1I2AA 1BCSB 3KEMA 4NAUA 5KINB 4MNTA 2O0HA 2JBAB 2EZ4A 4RACA 1FNBA 3EEYA 3LFTA 4MYDA 3GFVA 1WLSA 6REQA 2BUBA 3F5QA 1DIOB 1J8DA 4F96A 5DCUA 1PK8A 3T1TA 3HYSA 1FX1A 5KQLA 3TTWA 5B7NA 3WSWA 5BMVF 1QHHB 4XDHA 1DARA 4PNHA 4EH1A 4URFA 2E85A 2RH5A 2ZIUB 1JU9A 2P5TB 5TSDA 3KE8A 4X8HA 4NBTA 4L8YA 3BIWA 3ORRA 2DY1A 1AHHA 4CTMA 1XNRB 4BMYA 5BNIA 1ZHFA 4P3XA 2CV1A 3PNKA 1DKUA 3O84A 1T2UA 3P19A 2J5RA 1SULA 2R1VB 3BTUA 3ITNA 3RV3A 3L07A 4OHFA 4MQUA 3C1UA 4JUCA 4I1YA 2C4TA 2XRMA 3UENA 4KIWA 5J63A 2JFXA 2ZRKA 1X0XA 1LLCA 4ZHSA 1E6KA 5JDCA 3E82A 1JJBA 1CE8B 1D09A 2V7UA 2RHRA 1R5NA 2I2CA 1VYHA 4N5LA 3EA5A 4QYWA 1YDEA 1RU3A 1W49A 1LDGA 4IVQA 5F1KA 3BJRA 4CDRA 5IG2A 1Y8RA 2AMVA 2H7VA 2P6NA 2YY6A 4UTZA 5FYQA 4R68A 3QUSA 4FMPA 4D3ZA 1TYZA 2PS9A 1B93A 3CUUA 2WNHA 5FUQA 1Q3HA 1Y98A 3RUDA 1QFMA 1VHTA 3MS4A 2WYVA 4JWTA 4WRRA 5H68A 1U7DA 3UWDA 1DP4A 3FX2A 2FPMA 3CG0A 3BCRA 3FPJA 2CLLB 3ES9A 1X1EA 5DO9A 1A9TA 1N9GB 3INYA 3SIPA 5GTDA 1GTVA 2O2GA 4ESOA 4W6ZA 2Q5CA 3KQPA 3IQIX 5EQFA 5IYZB 1OR8A 4G85A 4UTOA 3VHRA 5DLDA 5AM3A 1AKUA 1JLHA 1YBAA 2ZJ5A 4FHEA 2DFLA 4RA9A 5DM0A 4HS9A 5I3ZA 1XJ5A 4KN5A 4G5SA 1UBCA 1DEXA 1ZNYA 1I1NA 3QHAA 4MARA 5G0UA 1KQNA 1IJEA 4KXUA 3SC2B 2JAWA 5CAEA 2HCTA 3NB0A 2IITA 1Y3HA 4Y98A 1JR3E 1AIPA 1BEUB 2A9OA 4MRPA 4OYYA 5HIIA 3L1KA 3JVIA 1DQZA 4YGYA 4ENQA 1QNLA 2GAJA 1CR2A 1CUZA 2YY5A 2HLPA 3FTFA 1K5PA 5I7UA 4DEVA 1YDMA 2IZ0A 4R2WA 4WJLA 3MQ4A 2HWKA 1FS6A 1F0NA 2WIGA 3IC5A 3LOPA 3NUGA 1DKLA 2FUG1 3O4VA 2Y1EA 1LI7A 4X6YA 4CIBA 3FOZA 1XEFA 2YOGA 4XEHA 4BNVA 2FZKA 4Y2YA 4IFIA 5LOVF 1UXKA 4LXUA 1PZHA 2HU5A 2OAP1 3GJZA 3JQAA 4L50A 4U3JA 4UAGA 2ZS7A 3BMOA 4JEIA 2AOUA 1V11B 1Q0LA 1XUOA 4EAQA 1AMOA 3R24A 2B20A 4K1LA 4N48A 2VP5A 3L7CA 4NFHA 3EARA 5BN3B 4E3WA 3Q41A 5SYAA 3PKJA 4N5DA 4WZBA 2CLMB 2PEZA 2YOHA 3STYA 1K4YA 3KSDO 1UDXA 4RSRA 5K2OA 5BXQC 4MMXB 4QYXA 1NUHA 3RWMB 2RH9B 4J4HA 1GA6A 4RKFA 4WNAA 3KQQA 3BGOS 4RTMA 5D86A 4A8JB 3WAKA 1HG0A 1U5AA 2QGZA 3IAM1 3QYPA 3VKGA 2BF7A 3C8UA 1GDTA 4MUIA 4LF7B 2R6R1 2W98A 1U4SA 2PRYA 3OA0A 5DK4A 3C6ZA 4E94A 1GG2A 2BI4A 2HPVA 2O5RA 4LDZA 1ZISA 3DBIA 1ZDMA 4YFYA 2WZDA 5AOVA 2WOOA 2C92A 2JIMA 3WDSA 1OX5A 2PGXA 3BILA 4UHEA 4NATA 4XARA 4BFTA 3Q0TA 5F35A 3O4RA 4PG6A 2ZS8A 3FHTA 4EFKA 2FN8A 1P80A 3LX4A 1XDSA 4BNHA 5CB0A 2R8YA 3K30A 1OA0A 5FTWA 3ANYB 1UK9A 1OJ7A 5B53A 1PU2A 2AR7A 3BRSA 2J0UA 2XDQB 2HBYA 4W5QA 3LT5A 3GLGB 1SXIA 3GJ0A 3B1ZA 3EOAI 1J9ZA 3BIXA 2DPHA 4ZXPA 5P21A 3FZNA 1Q77A 1RACA 3MWEA 4JB3A 4OQEA 2X8JB 4IUDS 2E18A 2EP7A 3GQBA 4S12A 4X9XA 5D6OA 2UXDB 3TIXB 1VBMA 2KSQA 4M6WA 2NUAB 5JS6A 3AQIA 3NWBA 2B5OA 3EFBA 4GRAA 4X7RA 3UOWA 2IHYA 5SV2A 1F5SA 4F3TA 4HPXB 1AZWA 2G9RA 1R00A 1ZOPA 4R2JA 1CZHA 5JW6A 1A50B 4GX5A 1U9CA 4FBLA 4ZVPA 4JMLA 4EA6A 2H1VA 1W8IA 1OFUA 2I7DA 4O5AA 5C8XA 3AF5A 2R3SA 3NC4A 2WWWA 2HPHA 2ID9A 1SCUA 2HDWA 5HF9A 1V43A 1MDBA 4BO2A 3UMJA 2FG5A 1JTFA 1ZLYA 1IHDA 3FAKA 3UJ9A 1ENYA 1XZQA 1NUQA 5ITVA 2QROA 3O3OB 1XKLA 2CNLA 1NBAA 1W0KA 2GK6A 3SZRA 5IFKA 1FJGB 1QH0A 1IM8A 1YB6A 3CKYA 3A11A 1A9QA 2YJ3A 3P9XA 2AOXA 2ZJFA 3FSRA 2JIZA 2B9EA 3WRYC 1F1BA 2M1ZA 2IHNA 1UXJA 2Q21A 2XUOA 3BTSA 3NBQA 2P91A 2A4KA 3FMIA 2W22A 2IWHA 5A3QA 4S04A 4JU8A 2GN9A 3A05A 4B83A 3VZCA 3SF8B 5CBPB 4DR6B 4RWZA 1XHFA 3GAFA 1OXXK 1US8B 1T2NA 3UEOA 1C29B 3MB8A 2ZIEA 2ZTSA 4WXYB 5EJMA 4GYWA 1KYYA 3FCAA 5DGIA 2QNBA 2P65A 4DNXA 3SQDA 4LJLA 3BHIA 2HL6A 1TC2A 3SXUB 2WZCA 3GPBA 2WVHA 3IILA 2NSDA 4IO1A 3TLEA 3QI7A 1N5LA 3W04A 3PFHA 4DIMA 4EARA 3TM5A 1SUFA 3X44A 1XZLA 1RZRA 1J5EB 3LWDA 2ZRFA 3N7AA 2H63A 1XJCA 1GCAA 1HYEA 4AS2A 3OX2A 1CNMA 3CZPA 2BBOA 5H83A 1GPNA 3WGUA 3NTQA 1ZJ4A 2BGNA 5IAEA 4C29A 5CXUA 2RGCA 1NVGA 2VNJA 6LDHA 2FPGA 4JXJA 1HT0A 2BOVA 1SOAA 2NYAA 1Z28A 3ZWVA 2VQFB 1NY6A 4PZAA 3M34A 1BXKA 3UV7A 1YZTA 4HWGA 1BWSA 4EUEA 2IUYA 1TUEA 2JJMA 4LJYA 1XTJA 2AQKA 1X7XB 3C5HA 3O74A 4TMWA 4NCBA 2Z98A 3M33A 4JLNA 1YRYE 4LXGA 4DL9A 3ICEA 4N7BA 4M83A 2H1SA 2Y0PA 2H4HA 1OMOA 1Z3CA 1MZVA 3FJYA 4KH1A 3GLKA 2ORVA 4AY4A 3R9XB 3P9CA 4Q34A 3TBFA 3WHKA 3ZD9A 5E6RA 5CIYA 3BMNB 3Q8LA 1JKIA 4UHHA 4Z1MD 5CDUA 3HJGA 1F4PA 3MCZA 4KODA 4MCHA 1CY1A 1LBEA 5DNCA 5EJ5A 4O2BA 5FLXA 5B12A 2ES4A 2EF0A 4RTJA 3DXYA 1RJWA 5K0TA 3SM3A 1KQPA 1NMYA 2OOKA 1VZ2A 2X6QA 4LOIA 3DNFA 3OBBA 5E8RA 3RVPA 4ZJZA 3RYCA 1T3HA 2AF4C 1M2GA 3GGPA 3F1LA 4KEAA 5BUSA 4JXZA 4E33A 1WCIA 2AR9A 2E7ZA 3MOIA 4TRMA 4UQPA 4Y2UA 4DY6A 5BOSA 5AW0A 4S3MA 5I9MA 2F1RA 2F43B 3PC6A 4QPDA 3WQRA 1GL7A 3NTUA 2HMSA 3CS3A 5TVKA 2WHXA 3LL7A 4JSYA 2B36A 3GUUA 1PDWA 4DQKA 1H2YA 2E5FA 1QCZA 5EXPA 1Z4MA 1FTSA 2KX7A 3IT1A 5A7HA 3THSA 1E4YA 4HBGA 3BMCA 4EKIA 4XGKA 4C6SA 2FW7A 4LNAA 3GB9A 5C4IA 5BUCA 1SPXA 1ODIA 1GAJA 1DBPA 3K09A 1E58A 3OESA 1KFEB 3DKPA 3Q0IA 4KYTA 3R7AA 2AYYA 5EN4A 1I7LA 5FBRB 1TMOA 5D7NA 5KJCA 3PK0A 3ZH2A 3AOEC 1YI8A 2W8ZA 1MZPA 4HLDA 1GFWA 3AUSA 2JVIA 4JC4A 4L85A 2E37A 3MTIA 4E51A 3RC2A 4MINA 3L7IA 4CQJA 1Z6YA 4FX5A 3OPYA 1PBTA 4BVHA 3X0DA 4HXFB 1ZOOA 2CBXA 2YWBA 1ZH4A 3FDFA 3FYSA 3HS3A 3L7NA 4TTVA 1D7AA 1Y7HA 3EVDA 3NT2A 2OFFA 5IZ4A 4MQ4A 5TMEA 3HRHA 1DJPA 1DJOA 1CQXA 5KTPA 3OJCA 3O9VA 2R1TA 3AF3A 3G0BA 4HNQA 3TAHA 2J0SA 2AK2A 2QD2A 5GADl 3W8NA 3QWBA 1ZU4A 3X2SA 1P2VA 2RGBA 3WHIA 4C07A 4C87A 2ZR7A 4MKRA 4MWEA 2Q0XA 1S3FA 3ZDCA 3SDSA 1X1SA 1XGKA 1BDHA 6ADHA 1R6UA 4WOJA 3W5JA 2WM9B 3EVCA 4LNHA 3EODA 4CV3A 5FDFA 3E3OA 4GLLA 5EE9A 1NAIA 1SCAA 2NXEA 1U3TA 1I2ZA 1M83A 5TVGA 3TLCA 2GVZC 4FD2A 1AGYA 1VJ0A 2ZU0C 4KN9S 1WZCA 3GUYA 4MWTA 5GOZA 2AC4A 3MAGA 5FO1A 2FFAA 3ZYCA 1A9XB 4CM3A 1NN3A 3H0EA 5AICA 2TMKA 3PGVA 3QA3E 3BAFA 1G98A 2FGJA 3CT6A 4KDFA 2VR1A 4C1NA 4F5EA 1F7UA 1U8YA 2PNJA 5KHAA 3B48A 1ZMOA 4F85A 3AUTA 5TJ9A 4O4HB 1IAQA 1ULUA 5CJPA 2UZ3A 3U0BA 2IU6A 1QGUA 1BN6A 1EFVB 5EHZA 4MO9A 3LZCA 2GASA 3USZA 4II2A 1OLSA 4XJXA 4MPDA 1QGOA 4X1KA 1EG7A 1A0OA 2UAGA 4AKSA 5HRCA 5IJXA 2BFCA 2ZB7A 4ACBA 1N25A 2VHQA 3BXFA 5DLPA 2QQGA 5AVKA 4QDZA 5ITWA 1Z5NA 1L4EA 4Q1FA 4MB0A 2NO4A 1PZGA 3GA0A 1RWPA 1XPUA 1TVKB 4PHTA 4ARBA 1FX0A 2IDMA 5AR1A 5MF6A 3DQQA 2EX1A 4NZOA 3AO0B 4RVCA 1MO2A 3V4ZA 2B2NA 3GYBA 4ZU3A 3STHA 3ZWMA 1U0FA 4NP6A 5JTTA 4HQLA 2GM4A 1P1FA 3QMPA 1KI7A 3B3FA 1GKUB 2VRWA 4RQBA 1ADJA 1TECE 3FD8A 1AD2A 5TEVA 1W4LA 2JFYA 5M2QA 4R4JA 3QXXA 4UBOA 3UICA 1V8DA 2QVXX 3C5CA 4PC7A 3C3XA 4JHXA 4E12A 4AO8A 1E5XA 1K9VF 3H5NA 5DHQA 4H7PA 1DZ3A 3D7LA 1W36B 1IHOA 1NKVA 1HE2A 3HR8A 2B25A 3W1WA 2R7KA 4FHCA 4ZT5A 4Y2JA 3NETA 4P0TA 2I6TA 3BRCA 2UVQA 1Z4JA 3K0EA 2UXCB 4XJVA 3H1EA 2G09A 1L5QA 1J0BA 4IFBA 3DZIA 3WLKX 4CMIB 4EY6A 3VAZA 9LDTA 1R4AA 1C0KA 1PAUA 3KQMA 4B4OA 2POCA 5J1SB 2ONYA 4EJ0A 1PFGA 2AZDA 2QIOA 4TGLA 3KTDA 2IEBA 3RIHA 3SDBA 3V7WA 3J81k 1HTBA 1AKEA 4L3WA 2OSVA 4PNZA 1IG0A 1OBVA 4F2DA 2BGLA 3LUGA 3DTNA 3EQ8A 4S1OA 2ZSBA 4G1BA 3GLFE 2GFQA 1Q0HA 1RKVA 4GI7A 3UHOA 4L0MA 3VHQA 2FLWA 3HC7A 5F5NA 4Z1OA 3FPLA 4CODB 2Z95A 4W5OA 5ALGA 5HZKA 2RH8A 2V59A 3M4JA 4WY8A 3G0HA 4M9ZA 4GOXA 5CNJA 4Z9XA 4DJAA 4PSCA 3ZE8A 1Y7PA 2H2AA 4C5AA 1H3NA 3M6VA 3HFSA 2G7ZA 3L6RA 4XA8A 1WHSB 2DFTA 3NBFA 4IJ6A 4E5SA 4ETWA 1D2MA 2EJTA 3NEJA 1EUYA 1X8XA 4R41A 2WTXA 1U0HC 1CUIA 2GYUA 3DEFA 4LHWA 4QBFA 1QH8A 1GUAA 1C1XA 3TSAA 2IS6A 2CDAA 2Q8QA 4MCIA 2KM1A 5KWVA 1Z4QA 3HBNA 1C3XA 1GZ3A 3E6AA 3JWGA 3QLUC 4MI1A 3MRXA 1LU9A 3B1YA 3WQHA 1NQWA 2Q5JA 3L0CA 2CVPA 1X7YA 4ERXA 5C7IO 1DNPA 3HP7A 1KJZA 2FCRA 1K3UB 4CRWB 3T5BA 1PQ4A 1R0YA 1FTNA 4DCSA 2WUEA 2OQVA 4IIHA 5A4KA 3K1AA 3PEEA 1ZOLA 4P4SB 3LF2A 2IOHA 4DLZA 4CQMD 1JR4A 5DT9A 3OQIB 2AJBA 3OFNA 5EIBC 3ZCPA 5K3AA 3FPFA 2C3MA 4HFNA 3LUFA 5TMDA 3CRW1 5IWAB 3JQ8A 1WXXA 1UMBB 4YB8A 4IOMA 2NYVA 4KX3A 1JLRA 3EZ9A 1RMQA 1T3LA 4CT0A 1L2TA 4BN4A 1GV0A 2FJ0A 3G85A 3U44A 4U9HS 1X87A 4KPUB 5CVUA 5JNLA 2J9GA 1ZD9A 4OK6A 1VSTA 1MPXA 5AK3A 4D92A 5KWSA 3CUTA 4WZAA 4XD2A 4DUPA 1NJ6A 2YWRA 3HZHA 3K0BA 3NEYA 1PO7A 2IF2A 1OAAA 1VE6A 3CMCO 5DPMA 1O5OA 2QTVB 2GF2A 2XUHA 3GOHA 2WI8A 4HPJB 4Y2QA 3PSAA 1RRGA 1H6DA 4MPJA 4EG1A 3NNDA 3OQOA 1X15A 1XLTA 3LPCA 3OOWA 3OOJA 1W1IA 3CZ9A 5K1ZA 3X1XA 3IVCA 4TLCA 4K03A 4LCBA 2BGGA 3V8RA 1A2BA 3KTFA 1U2EA 5B37A 1M5TA 1QM5A 1CC1S 1BFKA 1PJTA 4ENWA 4DOMA 3FYDA 2IU4A 2OKCA 4ZEWA 2ZPTX 4CIWA 4JFRA 4WXRA 4E70A 1L5KA 4FWIB 1JHUA 3OEED 1TM1E 1FQOA 5AP9A 1T25A 2OXEA 2ZR8A 1QAQA 2XVZA 1ZH8A 3DKKA 1HSZA 4GX1A 2SKDA 1H1LB 3VDRA 1SZDA 1MV8A 4XOIA 2W93A 3TEJA 2HW8A 1GNRA 5ITZA 4EPRA 1Z15A 3CR8A 4TMFA 1SXHA 3T4EA 2EAUA 2IUTA 2NQTA 3AR8A 3HKCB 1ZCJA 4LYDA 5EJFA 4YRIA 3ZIAA 5JFTA 4DVJA 2X9LA 4DDUA 2JFNA 1W88B 2C94A 3DEKA 3OTIA 5BWOA 3SBEA 3GDOA 5TPZA 1UR5A 4B7AA 3TSCA 2XYVA 3B7WA 3D5EA 2D3TA 3LX6A 5AOCA 4BNNA 3A1DA 5C35A 1A5ZA 2YYSA 4K7JA 4OU5A 5A6SA 4NQZA 2TECE 3A4NA 4G4IA 4LGMA 4LE1A 4R3WA 4NPCA 5JJIA 3EDMA 1ZJYA 4M1KA 3ET5A 4QC2A 4UZSA 3SYTA 3EY9A 3I39X 1A1VA 1ML3A 2NU6B 4MWOA 1C3OA 5AESA 2ZYIA 1SPBS 2WB4A 4QE3A 3SPXA 5CDSA 4OHYA 4XWYA 4FGZA 2Q62A 5EFZA 1KETA 4LVCA 2WM2A 3NVDA 1GXSB 1XJWA 5BN3A 3UGJA 3PR1A 3H4MA 4N0DA 3CTMA 1QH9A 2R84A 5CA0A 1UANA 4XWWA 1M2VB 3EZXA 4YUVA 4QTYA 2X42A 1QIMA 3A10A 2QRGA 3FVVA 4EL0A 4JJ7A 2N42A 3C45A 2C77A 3DOIA 4WECA 5DK6A 4YMHA 2O54A 4ENRA 1E3MA 2OFWA 1JR2A 4L5JA 1SAYA 2N1BA 1RP7A 4L8GA 5BWNA 1SHLA 3P0JA 1MFPA 4M86A 4PS1A 1FNMA 2PQMA 5CLGA 2NT3A 3ZQUA 3JZDA 4ZV9A 3W79A 5J4LA 1XELA 3H2ZA 4N0EA 1FS4A 1X6VA 3FCUB 3WWPA 2DBVO 1JLSA 1M7BA 1NLYA 3L92A 1RBMA 2G6BA 3FKQA 4JNKA 2PYZA 2C2BA 2K4MA 3PDHA 1MKYA 4LK3A 5CIQA 1KHHA 5F4BA 5FQNA 1IOWA 1SB8A 1ZRMA 1P4GA 3L0SA 3EQ9A 1CZNA 3H2GA 3SS7X 5LOVA 2H85A 3FZQA 5T4HA 3VUFA 4YY3B 3HBMA 1LX6A 4Z99A 1PW5A 4GMFA 1GL6A 5D3MA 1KMQA 2DLNA 1CUXA 4J7AA 4V0LA 4HAZA 3RH0A 3QVXA 4EFDA 3V4LA 2QW0X 1UXOA 4MSUA 1IMOA 4Q3OA 1M72A 1IDOA 3P2YA 4OB6A 1AS0A 3WMRA 5CA1A 1KZGB 4L57A 2P2DA 3L6CA 1VPVA 4L9RA 4LG1A 4HMQA 3C8MA 4PYNA 5E3HA 1U8XX 1PR4A 2CKDA 2WT9A 2WVGA 1I10A 1FRVA 2AG8A 2HF8A 5B1DA 4UHJA 4D8YA 2Q9UA 1THZA 2GERA 3LC1O 3D0OA 4QAQA 2JRCA 1C2YA 3O75A 3QENA 4DQVA 5BURA 4YCAA 2VHYA 1Q1BA 3VR2A 3BGIA 5KOHA 3K94A 4RHUA 1JL3A 2XOXA 1E1RD 1YL7A 2FEAA 5HWSA 4ZV7A 1H3EA 3TLMA 1SIWA 3GL9A 3KPWA 2DFDA 5JDIC 3TRKA 4ZQFA 5JU6A 3NALA 1XL0A 1C8VB 1H2AS 3E27A 2CD7A 3RT9A 3E5NA 1ZN7A 1JEEA 1OFGA 3PEWA 4ZZ3A 4QJ5A 1PK9A 3G79A 1XDZA 4WNCA 3K9HA 2EX4A 2D1QA 5TQ0B 4YJFB 5CURA 5E7IA 1Y9AA 4YMTA 1ZR4A 3GXBA 1WZ2A 2O19A 4Q3KA 1N5MA 4RIEA 1A04A 1E5DA 1SHTX 5ALWA 3ZHCA 3E2IA 3OLCX 4O5OA 1YU9A 2OAQ1 3IODA 3UB4A 3O9ZA 3PHIA 1I7SB 4XFDA 4TS9A 3NYWA 3OPVA 2HWYA 5I4KA 4KR3A 1SXJD 3OX1A 1NC1A 1DG9A 4TLLB 3VSCA 2NO7A 2J6IA 4P7KA 1ST3A 3MEQA 4Q1BA 4DVGA 1JJIA 5IC4A 3P2JA 4AC9A 4IUCS 3RCBA 1J8YF 1DKNA 2AEEA 1AK2A 1GPMA 1SKAA 2EDAA 2Q3FA 3F71A 3T9DA 2G07A 1ADFA 3FVRA 4ESEA 2CXOA 2XUPA 5IANA 4I4NA 3DAPA 1YDWA 2WUFA 1DRWA 3SZOA 5FFMA 4Q12A 3WK7A 1HNWB 1OWMA 3M5WA 2GH1A 4BB9A 3H1AA 3TNDA 4DC9A 1O6GA 3E1GA 3BWBA 2F17A 4I19A 1JWLA 4G5YA 1C41A 5HBGA 2O2IA 3ZWNA 3UBMA 3EAFA 3EXIA 3HCAA 1AUVA 1T4CA 1ZIYA 2ETVA 2OD7A 3E2PA 3FB1A 3GW8A 4FFOA 4UHCA 3UATA 1TLTA 3AR2A 3WAGA 5HRUA 3Q10A 4JQZA 5ARBA 3SWWA 3U1TA 1ENOA 2B1JA 3BL6A 4TKVA 3P96A 4IX9A 3EVTA 3ABIA 2WQ7A 1E9CA 3AUYA 1XQ9A 3PNSA 5GGYA 3ZW7A 4ARUA 4EG0A 2ERXA 3UMFA 3TGLA 2H18A 3KVYA 2IKQA 1C4OA 4H1UA 4LOJA 1U9ZA 1YFKA 1Y6ZA 4IP0A 1NVFA 4E2YA 1SBNE 3QTBA 4BWVA 1UBGA 4X54A 3OF2A 4CMEA 4P0PB 2VK1A 2B1RA 3NBXX 4NNPA 4G8JA 5EPOA 2BC9A 2CN1A 1UPFA 1R66A 1UBNA 4JLUA 4OQPA 4BEBA 1H1TA 4YQEA 1NUAA 4MZXA 1QRTA 4ESHA 3WIDA 5K0NA 4ANFA 1F2TB 4JP2A 3I6QA 3C3BA 4DAEA 3GBPA 2V96A 2HIAA 2YZGA 2GVDC 3C16C 3JQ6A 5DGCA 5G1PA 1EFTA 2PU5A 1UMCA 5HCIA 2IZZA 4K40A 3C98A 1EMDA 5ALHA 5AI0A 2V58A 1E3DA 1THTA 3PHLA 1YL6A 3HNOA 4P93A 5MN5A 1CBUA 1V48A 3ED5A 3DZFA 2C9BA 5LJIA 3CX3A 4HS4A 4IV0A 3DGFC 4OF4A 2VTBA 4OQQA 3PYLA 5A5GA 1Z22A 3C5WP 4MQFB 5E9AA 4FZ5A 3AFMA 4LYAA 3RSCA 2F8SA 4UMFA 1NUUA 1TLLA 3EXFB 3NANA 3WICA 3R77A 2QTZA 4RH3A 1GNVA 1QYVA 3TQOA 4GBJA 1KK0A 2AN1A 2WJIA 5EHIA 2HJSA 1K97A 1JIUA 1IZZA 2GCOB 2ZIFA 3GFTA 3ORQA 3SJZA 4KQKA 4GWLA 2R6ZA 3SLKA 4NLLA 1I14A 2JD1A 1IM5A 1FOEB 4QIHA 1VPDA 4HEQA 1Q92A 4DTCA 4F4HA 5COQA 4QLBA 4Q03A 1ES9A 1IAVA 5IRCD 1EVEA 2Z4TA 1OW3B 3M6MD 4QTUB 5IJ9B 1YJQA 2NXCA 1WW3A 3DV9A 4ITVA 1A82A 5LMNB 1BIFA 3WIUA 1UJCA 3CGWA 3RUAA 5LIRA 5BSEA 5LQAA 4E14A 4QFDA 4GOLD 2CLFB 3EXEB 3ZU4A 4TZ0A 3HCBA 1XKTA 4PQEA 5LNK6 1J8VA 3ZI4A 3OE4A 4DJDC 3DL0A 2WKSA 5B1HA 1FDIA 4CF6A 1N3IA 5ER6A 1HE8B 2A1IA 3MN1A 3O8DA 5FORA 1YU6A 3WKBA 5HGJA 3B38A 4ASUD 5KZMB 1ZH0A 4NULA 1I8TA 1P2SA 1S2GA 4CCYB 4HEA6 2Y67A 1P7WA 3TGPA 1T9CA 2A67A 2IV7A 3BH0A 3MWLA 1G18A 1BSVA 1JDBB 2DPLA 1FU4A 4LZPA 4RMHA 3UMBA 4C0AC 3ZC3A 1SVKA 2AMJA 4MVXA 4A8JA 4WBSA 4NZNA 1M0SA 1X13A 2RCNA 4LISA 4AMUA 1ZEJA 5CDHA 4UEWA 2AYZA 2JIPA 1DLJA 1HGXA 3NC0C 3WK5A 1ZQ1A 2KW5A 3EZFA 3UQYS 1ODLA 2P27A 5ALNA 3IOYA 4NG5A 2VPYA 3PI7A 1KIFA 2EXXA 4LF6B 1Z5OA 1AKTA 2NOAA 5C1PA 3SKXA 3ABZA 4G8DA 7MDHA 2OO5A 3U6BA 2FRVA 3ANMA 4YRBA 3DEZA 2P4QA 1QQ6A 3IH5A 2OYSA 3KSMA 4PE5B 1QF6A 3DD5A 5IKOA 3TTXA 5K8UA 1IEVA 4UMDA 4ID9A 2DR0A 5BR1A 1W2WB 1XQVA 4Q1EA 2PA3A 3WMEA 1HDCA 4QOHA 3ABRB 3FOBA 5E2AA 2D7CA 3DE4X 3FYCA 3MILA 3L4JA 1KR5A 1U9JA 4Q3BA 3HJTA 4KV9A 2AJ8A 4EQ6B 1JUDA 3UWMA 4X84A 3HCOA 1CUFA 1NBHA 2R79A 2XEDA 2OO5C 1S8NA 2ZUSA 1BMFA 1OX4A 1J8FA 4I5GA 3DWEX 3NASA 3LLCA 2NUAA 1U1IA 4J3FA 4C7JA 4D3YA 2JKZA 3OWHA 2ZXFA 1KI1A 2ZQYA 4YGXB 1SM4A 4IY1A 3T3NA 3Q87B 1RJ9B 3DW3X 1ELOA 5EZ5A 3ZS9A 4BLTA 3Q1LA 3VFDA 3ESXA 5B6IA 3PNPA 3R9WA 3INRA 5EJ2A 1ABFA 1E1YA 2XTZA 1K7XB 2RK3A 4KQCA 3NKLA 4MI6A 4BBAA 4DDVA 3GRZA 4BV9A 3G82C 3KOWA 2H1WA 2A7QA 3COZA 4P34A 4JBGA 2HFJA 4PFQA 4A5OA 1VYUA 4LCJA 3RTAA 4GM1A 2I7XA 4NK5A 4EOGA 2IHKA 3K7EA 4M8NE 5EZSA 4HTFB 5TARA 2ZBPA 1WIWA 1HPLA 1WMSA 3K35A 4QOIA 3ONNA 2HMVA 1YCDA 4Q6BA 3AR3A 1HDGO 1VLMA 2O06A 2KJQA 2HPAA 2GI4A 1DJLA 2FFRA 1YH3A 1RLOA 1TZKA 2D0PB 2O7NA 1MH9A 2BGKA 1FMJA 2DQKA 1INLA 1AVTA 2ODBA 2HSZA 3AIOA 2XPCA 4EUKA 1K9SA 1GV1A 4G4JA 1OIWA 4UUBA 4BDSA 3UAZA 1QLWA 1R8JA 1O3YA 1DT3A 1KDPA 1DHRA 1H2HA 1Z56C 1YK0A 2FEWB 1RQGA 2IRWA 4PG7A 3R0VA 1L8LA 3FNEA 1FDSA 2P11A 3PTLA 1SKYE 5M29A 3JQQA 3N74A 1PFKA 2HRZA 4F3RA 2HRQA 3NH9A 4NG4A 1EGHA 1X7HA 2MDTA 4I4CA 4TMTA 2O8DB 1J0XO 2DAPA 4NEGA 3NMUF 4V0SA 2KI5A 4BYGA 3P0HA 2VDMB 2Q8NA 2PO5A 5KAMA 1ZVQA 2B30A 2CHVA 4DDWA 3NDIA 3GLHE 3I34X 5F4ZA 5CLQA 5D85A 1PR6A 4CJXA 3MCAA 5KCZA 1DRJA 4ZCQA 3WHPA 4CKXA 1N2GA 3BA6A 2Z04A 5JQGA 1I7DA 5EYPA 1ITZA 8MHTA 1GZUA 3DDSA 3NXSA 5EXDA 3FRJA 3U4AA 4MWBA 4BAUA 5L3SB 1PUIA 1B00A 3PJRA 1XAGA 1ZI8A 2PL1A 1QZZA 1CUUA 3K0AB 5AM4A 1GCUA 1TCVA 2ZLBA 3RVNA 5CB6A 5ICEA 4ZDWA 3EF1A 1PLKA 2EZTA 1LTQA 3D8TA 3GK3A 3ZWAA 2YUTA 3VKFA 4EVIA 1WS6A 3PPVA 8ATCA 4D3FA 1UK8A 3IPLA 4OAPA 1PYOA 3ZOZA 1L4LA 2HXGA 4G23A 3QE9Y 3UANA 2I9KA 2NAFA 3ZD7A 3I9KA 4M36A 3SBOA 4YJ2F 1U94A 4UHKA 3Q2OA 4Q82A 4LV8B 1BWQA 5J2UA 1DKPA 4AICA 4V1CB 2JH8A 2D0OB 2X3YA 2NADA 3AHEA 1A8QA 1II0A 1NC3A 3DZ8A 3EOBI 4LAFA 4RQAA 5H59A 5DE3A 4KQ1A 1JG6A 2NV2B 3QUCA 1Y5NA 1TVCA 2PUFA 3DVAA 2PVSA 3FNQA 3WWZA 3MT8A 3EX7C 2UVDA 3QKRB 4IBOA 2FUCA 3RBVA 1QDEA 3RG8A 4TYMA 4OGKA 4B3FX 4EHLA 3O03A 4GVXA 4LHYA 2X9NA 2O3UA 1O8BA 3I05A 4OXIA 3LT1A 5AVYA 1U3CA 2W2MA 2QV0A 1PR0A 1TOAA 4IKOA 4IIJA 4TWIA 1TF2A 2EZ8A 4GM0A 4QTZA 4CFZA 3W5BA 3OAAA 1H2EA 3PL1A 4BMDA 3MJFA 3DO8A 1DAPA 5DSZA 5IM5A 3H2HA 1NJ5A 1S4QA 3PS9A 4GU5A 3WRYA 3QOYA 2CW5A 3L8EA 3O4FA 5J47A 4D6YA 1IZ7A 2Z2YA 1T36A 2GBCA 1X19A 2DUNA 2ODEA 1II8A 5DJ5A 5KVQA 1LF5A 4R8SA 3L06A 3VZDA 1U8EA 3DJYA 2CXTA 2AYXA 5KWJA 4FYMA 5CPBA 1QFZA 3I8XA 1E9RA 2GQ0A 1RBQA 4ARVA 3GRPA 5LZ4A 1EXWA 2X0FA 5C4GB 2CJFA 1PTJC 3JAMA 2C2ZA 2EWWA 3CR3C 4JVLA 3ICQB 1Z08A 4RVUA 3RVRA 4I9UA 5BNWA 3D8SA 1GTMA 1BEZA 1WD5A 1JEDA 1YS2X 3BWXA 3KLPX 1LQUA 1UJNA 1PR2A 4IDAA 4LNUA 5JE8A 3TOXA 1EP2B 3CKLA 4DLKA 2GNOA 2DLCX 3LQ4A 3PTZA 1M2OB 2BFMA 3CNLA 2ZOSA 1AK9A 2PLWA 1HDYA 2CE7A 5ICSA 2TMYA 2QLFA 4OK3A 1V2GA 5JSZA 4MI9A 4LX0A 4RKRA 4MR7A 2VTVA 4LJAA 1CUSA 5ETJA 4EI2A 1NVDA 2ZT6A 4KPGA 4FMCF 3VR5D 1IUOA 1D2NA 5B4UA 3GN1A 2W0SA 4TKUA 5BQPA 4BFZA 1UJ4A 1P9RA 1MV5A 2JCBA 3LDGA 4TTQA 4E4RA 5C9ZA 5KQMA 4Z1MA 1IUNA 4DWJA 4FP9A 2G1UA 3JYHA 1B8UA 3FMVA 1KERA 5ICGA 1EBFA 2QN3A 4Q7JB 1KU0A 4I0WB 2P6PA 4JJ6A 4ZYWA 2BKAA 2W6OA 4NPAA 3D4BA 3OQPA 1E2LA 1JLKA 3LCJA 2V54A 1EWYA 2JZCA 3VOSA 1KIMA 4X5OA 3V8MA 1LSSA 2UVPA 2AXPA 2VKQA 3ONVA 3VHXB 3BT7A 2BEVA 1UDRA 5IBRA 4R3NA 4D7AA 4MS1A 4ZT3A 4P36A 5CG1A 5G0TA 2VNAA 2AC7A 2HLNA 3I2IA 4FOLA 1ZWLA 5DYYA 3UM9A 1TK9A 2VK2A 5HIKA 3DPUA 4FEEA 2UYCA 1D1QA 1SBZA 1R9JA 1O77A 4BVEA 5CVTA 1RXSA 3N6XA 3P32A 4OB8A 1LXCA 4A0GA 2RKWA 3DEJA 1AURA 4ZKEA 4P53A 1U2DA 1PGOA 5B1SA 1P73A 1V3UA 3S29A 2YS6A 5B3JA 1E62A 5DOZA 3K0SA 3BTVA 3K9NA 2LCQA 2FXIA 4YAFA 3IXQA 5F64A 5IP5A 4ZYUA 1VCHA 2PD4A 2H8GA 3PQ7A 2PZJA 1SWVA 2C1XA 3LHSA 4UULA 5KTSA 1DXQA 3BSFA 3WIOA 2BTEA 1ZONA 4G0MA 3ZJVA 4BMOB 5FF9A 3FTCA 4N49A 1CEXA 2EBFX 3A9TA 2W5UA 3F6YA 4QFMA 1MVNA 2MT9A 3ZXIA 2N0SA 3SJCA 2LKDA 2NO1A 1RWQA 1VE7A 3EW9A 5F1OA 4D2IA 4B9AA 3E58A 3UHPA 1KI4A 1F9AA 1JEJA 2PFKA 4QYTA 3ZNOA 1Q11A 1GGFA 1V3QE 4O1HA 1BNCA 2BEJA 3MRVA 4MQEA 1XZMA 1KEUA 1ZICA 3ERCA 3HJAA 3GEDA 5I7AA 3B89A 3HB5X 4IJKA 4DJJA 3OHPA 1CR6A 2VWGA 3QGMA 3R3UA 4AJNA 3IDZA 3N2GB 3FUTA 2OBYA 2SHKA 2P79A 5CT5A 4O2AB 5FFNA 1OZFA 3C14C 2JLRA 2H5LA 4NV0A 1QAMA 4ZOLF 4DG5A 3C3AA 3YASA 5JI2E 1SMKA 1N4DA 2GOYA 1Z7BA 4GMDA 2XVMA 1SHJA 2QPOA 2CCJA 4EF4A 1O94C 1CT9A 2WSLA 1UP4A 1NFQA 2OBMA 2IXAA 2R7AA 3S1SA 2VG8A 1XLVA 2D0DA 3AU9A 3RAEC 1MVLA 2FDXA 3F6CA 3H8SA 3TKYA 3IAFA 2JGEA 4N3GA 1HE3A 2VF2A 2QLNA 3A3NA 4KJXA 3U61B 4DRXB 1C5KA 4QQ8A 1QHEA 2EC5A 4G5FA 1UBTS 4U2BA 1KSGA 3REOA 3SSOA 1OH5A 1PGJA 2OLJA 4FT4A 1J49A 1QF7A 1KI6B 1NQOA 2PIDA 3N2LA 2IHUA 4HGZA 2EWVA 3G8BA 3N70A 3A6FA 4JBWA 5HM8A 1KO7A 3VOBA 5HZHA 4HDCA 2CCGA 1E0KA 1GRCA 5CA0F 1ESMA 3HN2A 4MXDA 5KAPA 5KSYA 1ZJJA 1A96A 4ZDJA 1H0KA 2VAMA 2JHFA 2YQ4A 3I64A 1PKXA 4AUEA 2VA8A 1XEWY 4UVHA 3QEOA 4O8CA 1VLZA 1FLDA 3E5MA 4W1QA 4EGJA 3RVDA 1YHYA 4ZU1X 1KYVA 2X2OA 3HEBA 2E1RA 4CFYA 3SQNA 4DCOA 4DBLE 1QH8B 1WMFA 1E2GA 1IHXA 2HCFA 3ESRA 1E3TA 2ID8A 2C5AA 2IPNA 1PSZA 1ISGA 1ESNA 3H1FA 1A8UA 3M4YA 2XNKA 4OYHA 4AMGA 2ZM6B 4FFSA 3KAKA 1BGXT 1XMXA 2VYQA 3MYRA 4JT2A 5EQJB 4B75A 2V55B 4O59O 4LPSA 3T3EA 1JHDA 2PMFA 4UNPA 3BK7A 1LB1B 2R8ZA 2H06A 3RRYA 1ULSA 2YV5A 3EFEA 4KWTA 4OH7A 5D51S 1YJCA 4P81A 2X19A 4DUGD 4PSVA 1FSSA 1U0LA 5EIWA 3U26A 2VSOA 5BV0A 3OQIA 4QG7A 1QS0A 3HQ4O 4IIUA 3DHVA 1PL8A 2RC6A 3Q72A 1ZK3A 3CEHA 4HNAA 2Q2VA 3ME5A 3QW2A 2PXXA 4NBRA 4XLLA 1UEIA 3KL2A 1DIBA 3ANTA 2J7PD 3OJFA 4M0LA 1UBRS 1J5PA 2HNAA 1GTRA 2E4WA 3EXHC 4RZIA 4OHOA 2X5JO 4B1FA 5ALZA 3FFBA 4KKXB 1FVOA 1NG9A 4DR5B 1SUPA 1P6XA 1P6QA 4I3GA 3GEIA 4MZDA 4CTJA 1OWPA 4X1KB 4MLZA 1USIA 1YI0A 4BQPA 1O0CA 1PWYE 5A9TA 3IAUA 1EP3B 2G8LA 1QV9A 4YBZA 4LJRA 3IQGX 2CHFA 1M34E 2FWPA 3DQPA 3GLUA 3PA8A 1PJBA 4J0EA 2QRQA 4LDRA 3BFPA 3HBJA 3RT1A 4B6QA 2WDPA 4CI0B 4C4RA 4M9XA 3HY6A 4UD2A 4CHTA 1DCMA 2H7XA 2Z6VA 4R8VA 4ZCIA 5FWXA 1HFKA 3OQNA 3HB4X 4LRQA 3D31A 4FC7A 3PHHA 2NVUA 2X5NA 1MJFA 1LFAA 3FGZA 4ZQBA 5EUBA 2BGMA 1SCUB 5CYFA 1H8HA 1CQJB 2UUPA 4OYRA 3MUOA 1SRQA 3KBOA 1G7RA 1RTTA 2A5YB 4F4UA 3H18A 1EWKA 4UM7A 3N8NA 3ZLTA 3G0GA 3OPYB 2GKSA 1RRPA 1R10A 2UYGA 3QXCA 1I5RA 4OHMA 1LS1A 3KKOA 2ZCJA 1C4KA 3ZG6A 5BOVA 3PFIA 1QPBA 1YQ9A 3OLXA 2D7DA 1K6JA 5C4MA 1OAOA 1BXRB 2JAQA 1F5NA 3E23A 3RBXA 3PKIA 3DZJA 5BUQA 3O8RA 2ZP1A 2IX3A 4RPJA 1PJRA 1ISHA 1NOJA 2C2OA 1EM8B 1UC4B 4W5TA 1E94E 3HFJA 1A95A 1SA0B 4RTNA 4LECA 1TM7E 3QRWA 3JQRA 2YHUA 4PAOA 2WK1A 4EW2A 2QM0A 1IY2A 5B3LA 3K6SB 2C4WA 4LRWA 3UJPA 1RKXA 4FEGA 2ZRPA 4N5NA 2GRAA 1MOSA 4IF6A 5KOIA 4PY2A 3ZLJA 3SC3A 1G21A 4YXWD 1RRCA 4PX9A 3GRVA 5ESWA 2CNDA 3QVSA 4XTRA 3V42A 4AO6A 1VIYA 2B9VA 3DBRB 3WXMA 3L6OO 1BU8A 2JD2A 3FBWA 4BVJA 3GHHA 4J2OA 2OXIA 1H65A 1FSFA 2YJ4A 4F5WA 1BWRA 1Z6PA 1EFKA 1QZ3A 3QMMA 3R75A 4PZYA 1OPXA 3I28A 1XB2A 3MJTA 4FR0A 1QVAA 5B2EA 4EGFA 3OLWA 1QB8A 2IP1A 1OI7A 2PL9A 1MRZA 3KUUA 5BQ3A 1F38A 1RHJA 2YJZA 2ZJYA 4X90A 2OY0A 5HF5A 3FUVA 4ZOCA 1ZMXA 6YASA 1XAHA 2BFBA 4CUJA 5CYGA 5JNVA 3MS2A 1MENA 4MI3A 2YTZA 4AP6A 5JS7A 2OYCA 4FDUA 4LI0A 4OQNA 2GYYA 4DE5A 1QMGA 5I8PA 1GTSA 1HE5A 3SE0A 3ROKA 3AHJA 3IULA 4MUKA 4CZ2A 1UWVA 2CYCA 4BXOB 5FULA 4TWJA 4AF7A 1XCPA 3IVAA 4QOFA 1NW6A 1VKNA 1JEQA 3WMXA 3HMKA 5DN9A 4BO8A 4CG2A 5HMMA 5IWCA 5KOYA 1CJVC 1R4MA 4I5FA 4L0QA 3DPSA 1K3FA 1N6KA 1ZD8A 4TN1A 2GD6A 2ZRJA 1WCIB 1E32A 3HVRA 9GPBA 1I5OA 1MQSA 3D7KA 4YT2A 1NP3A 5D7BA 2J3LA 1RYFA 3RC1A 3H17A 1AXGA 4PCVA 4IF4A 3L4EA 3N2KA 1I7QB 3E1KA 2G0AA 3D3WB 3OE7A 4HDKB 4EMBA 2R85A 3W1EA 3GVPA 1JALA 2WP0A 4G26A 2OGSA 4QBGB 4W5JA 4E4YA 1PKEA 1NF2A 2VAXA 4I14A 4KYUA 3SJAA 4EPXA 2FRXA 2VBFA 3WIVA 4CIDA 3HDTA 5DX1A 4LF8B 3B1VA 3KHUA 1V7ZA 2B7CA 4IRXA 1K06A 5A4IS 2PUEA 1SVOA 1TU3A 1Z8DA 3DVRX 3IMGA 4LXQA 3UV6A 2OECA 3V4FA 3NKVA 2J33A 3A1EA 1U04A 3AEUA 3FIUA 5EJ7A 3IBCA 3QUTA 3E7FA 4EABA 2IXDA 5DH9A 3JQCA 1KQFA 1YCHA 4GSKA 1KZHA 2Z8YA 5GM1A 1B0ZA 4EKDA 4DSAA 4NCNA 4DLNA 4YH1A 5LVAA 3E0XA 4WGGA 2XT6A 3MAJA 2QUBA 5ITZB 2EEPA 3VNRA 4F93B 1GR1A 3BEDA 1HX7A 5EIXA 4Q37A 1D07A 3KB1A 3ND8A 4M1SA 4KO4S 2CXXA 1EH5A 1ECGA 5K4GA 2ZBRA 1SKBA 3FLMA 3I1FA 4Q1AA 4BNTA 5IBQA 4J2HA 1QIDA 4NHEA 2PZKA 2QM7A 3FTPA 2GUGA 3KD2A 2Z3VA 3NUQA 3ROXA 1QU3A 3MW8A 1M76A 3R0QA 1USUA 4UNSA 2QUIA 1NT2A 4JCOA 4YI3A 2PTHA 4GP9A 3R3SA 5IAJA 1ZW6A 3NDBB 4U2FA 1V16B 2OCKA 3C74A 4KAXA 3GT4A 4PPNA 4XXHA 4LF5B 5A02A 5IT9A 4NARA 3HXMA 1P4SA 1R74A 1BHQ1 2GHTA 2H07A 5ARDA 1KP9A 2QLLA 1L4UA 3AV0B 1TQ6A 3G1UA 3PNMA 4KO2S 2ZJAA 3H84A 4JOBA 2XMZA 2HH9A 3HB0A 5L3QB 2QBYB 3OO0A 2ADOA 3PJFA 4UTXA 2YRWA 3JASB 1OXSC 2OZPA 3D02A 3NFYA 2ZT7A 4QXQA 4NE7A 1HZJA 3P7MA 3DLAA 4O4IB 3STVA 4ZMSA 3VQTA 821PA 5LXTA 3ESAA 2ZVQX 4KTVE 5CH5A 4RIIA 2KYRA 4PSUA 1K8XB 1REQB 3RF6A 4QXAA 4ZI5A 3LA8A 5FPSA 5HX7A 2HLHA 2UYQA 2X1HA 3ILYA 5BWCA 4PFKA 4MV7A 1PTJA 4F72A 4DPMA 1CS0A 2H5IA 2PUCA 4FSHA 2W2QA 2HY7A 3A2KA 3AMVA 4OP3A 3KDAA 4XLTA 1R0RE