2HN9A

Crystal structure of the uridine phosphorylase from salmonella typhimurium in complex with thymine and phosphate ion at 2.12a resolution
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
253
structure length
253
Chain Sequence
MSKSDVFHLGLTKNDLQGAQLAIVPGDPERVEKIAALMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPMEFPAVADFACTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRRFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPNAETMKQTESHAVKIVVEAARRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uridine phosphorylase
publication title Crystal structure of the uridine phosphorylase from Salmonella typhimurium in complex with thymine and phosphate ion at 2.12A resolution
rcsb
source organism Salmonella typhimurium
molecule tags Transferase
total genus 84
structure length 253
sequence length 253
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2006-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2hn9A00
3D1VA 4TXLA 1TCVA 3FNQA 3LGSA 5F78A 1JE0A 3ODGA 4YO8A 1TD1A 1PR5A 1Z38A 1A69A 4L5YA 3DJFA 1RYZA 1NC1A 3NBQA 5CYGA 1JDVA 1JDZA 4G8JA 2OC9A 2A0YA 1ZOSA 2AC7A 3FUCA 4TYMA 4TTIA 4BMXA 3OZBA 2QTGA 3E0QA 1K3FA 3EUEA 4TTJA 1U1DA 1Z39A 2H8GA 5F76A 1NC3A 1ZL2A 1LV8A 1RSZA 1SQ6A 1JE1A 2AI3A 3OZCA 1Q1GA 4L6IA 1CG6A 1Y1SA 3UAVA 1PR4A 3FAZA 4YJKA 4TXJA 2Q7OE 3NM4A 3OF3A 4QARA 3IEXA 1TGVA 4OY3A 4U2KA 3OZEA 4MARA 5CYFA 4X24A 1RR6A 4MCIA 4LDNA 4KN5A 1Z5NA 2HWUA 5IU6A 1PK9A 3UAYA 4M7WA 2OC4A 2QDKA 4D8XA 3TL6A 5CXSA 1RCTE 1V45E 3PHBE 3BJEA 4LZWA 2ON6A 4D8VA 4TTAA 1PR1A 3KVVA 1PK7A 2OXFA 3QPBA 4R2XA 3LBAA 3FB1A 3PNPA 1V41E 1JDUA 4YNBA 1PR6A 1JDSA 4WKNA 1PF7E 1JDTA 4DARA 4NS1A 1T0UA 4L5CA 3O6VA 1A9TA 1VFNA 5B7NA 1YR3A 3OZDA 1ULAA 2GUWA 2AI2A 3O4VA 4OEHA 4GLFA 4TXHA 1V4NA 1V2HE 3DF9A 4TS3A 1V48A 1U1FA 3KUKA 3OCCA 2QTTA 2P4SA 2RJ3A 3BL6A 4UC0A 1PKEA 5F77A 4DA0A 4DANA 3C74A 4D98A 3INYA 3P0EA 1Z35A 1Y6QA 4OGLA 1RXUA 1ECPA 4NSNA 4LKRA 4BN0A 4EARA 4PNPA 1I80A 1OUMA 3OOHA 1ULBA 4I2VA 4QAQA 3EMVA 1U1GA 3E9ZA 1RXYA 5EPUA 4L0MA 1Y1QA 3PHCA 1A9OA 2AI1A 3DP9A 1VHWA 4F1WA 1RXSA 1TGYA 3BGSA 5ETJA 1A9SA 3KVRA 1T8YA 3KVYA 2I8AA 1G2OA 5B7PA 4DAEA 4TXNA 1RT9A 4WKBA 3NM6B 4EB8A 5CCDA 1FXUA 2B94A 2XRFA 1VMKA 5JPCA 1M73E 1OTYA 1YBFA 1PR0A 3BSFA 2QPLA 4OJTA 1LVUA 3F8WA 1ODKA 1SD2A 1N3IA 4D8YA 4E1VA 4LNHA 4YMLA 4MCHA 3UAZA 4JOSA 4IP0A 4ECEA 1Y1RA 4L5AA 1VHJA 1Z5OA 3NM5A 1T8RA 3OPVA 1RFGE 5C80A 1Z34A 4R31A 5F7XA 4GMHA 1JP7A 1ODJA 4NY1A 3FOWA 1PWYE 4K6OA 4WKCA 4D9HA 4JP5A 3KU4A 4OF4A 5IFKA 1YQUA 1PW7A 1K27A 3DDOA 3GB9A 1U1EA 5EFOA 4OGKA 4F2PA 4RJ2A 3PNSA 3P0FA 1WTAA 1Y1TA 4LNAA 2HN9A 3LA8A 4DA8A 5I3CA 1CB0A 4BMZA 1ODIA 3GGSA 1JYSA 2IQ5A 3MB8A 1A9PA 5K1ZA 4DAOA 3E9RA 3ENZA 4F3CA 3T94A 4M1EA 1Z36A 4G89A 4QEZA 5F7ZA 3UT6A 1RXCA 1QE5A 2HRDA 3ONVA 4P54A 5CXQA 4WKPA 3K8OE 1Z33A 5F7OA 4M3NA 1C3XA 3DPSA 3IOMA 1OU4A 4GKAA 3UAXA 2PGAA 3MMSA 5F73A 1Y6RA 5B7GA 1V3QE 4F3KA 3SCZA 4DABA 5FAKA 4TXMA 1B8NA 1Z5PA 1PR2A 1T8SA 1JPVA 3OOEA 3KHSA 1SD1A 2ISCA 1TCUA 4DA6A 5B7QA 4PR3A 5EUBA 1A9RA 2HSWA 1YQQA 3EEIA 2OECA 4BMYA 5F7JA 4WKOA 1U1CA 2A0XA 1B8OA 4QFBA 3EUFA 1LX7A 5CCEA 2QSUA 1OV6A 1K9SA 2A0WA 1YRYE 4F2WA 2I4TA 1XE3A 2BSXA 1A9QA 1SJ9A 1Z37A 4GLJA 4TS9A 1T8WA 1ODLA 1PBNA 4DA7A 3UAWA 1OTXA 4H1TA 5DK6A 4G41A 5KB3A 3FWPA 3U40A 4QASA 4R2WA 2A8YA 4FFSA 1OVGA 4QATA 4JWTA 1NW4A 3K8QA
chains in the Genus database with same CATH superfamily
1TTTA 1TYDE 1KP9A 1MC4A 1YE5A 3B3JA 5I6DA 1AUOA 1Q19A 1R6VA 2RK6A 1V26A 5J1SB 1HRKA 5EINA 1SIUA 2XNCA 3W5HA 4HPWA 2H07A 5KOJA 4FFDA 2PPLA 2QA5A 3OSUA 4IBOA 2J46A 1ESDA 5TLSA 1DTSA 5E9JA 4ZAVA 1VL5A 2R6FA 3L5OA 3H8WA 2OXCA 2RBGA 1EK0A 3IDFA 2DFTA 2MJLA 3MLEA 4WXEA 3SBOA 1SXJD 1RQRA 3DH0A 4MUMA 1I4TD 3BRSA 5JLJA 4MR9B 2V6FA 1NG9A 4J0QA 1L5ZA 3PITA 3TLCA 1CY2A 2PQ2A 4FJ0A 2D0IA 4CFSA 2RC6A 4EG5A 2VQEB 3MTJA 1VMEA 1E20A 2O2DA 5JS6A 4FHDA 1IVYA 2V9PA 2XJ4A 4NCHA 3FJ1A 3R5HA 2RE8A 1AK1A 2VKTA 2YL2A 3GFVA 4ER5A 4PLZA 4I8DA 4JLBA 2N9UA 1Z7BA 1E99A 1C8VB 1OXTA 1JKFA 5B4VA 3OLQA 3UBTA 1A2KC 1QIMA 3PEUA 4GS5A 2PS1A 1C9DB 3EFEA 4JKOA 1LSUA 2IUSA 3SHQA 4F0JA 4C0SA 1GWNA 2FW9A 4LXGA 1ZVQA 2FUCA 4JEUA 4XSVA 4ZVMA 2BDUA 2Q1XA 1ZAKA 3A6LA 2XTNA 3MM4A 4OBXA 1LF5A 3QPVA 4HAYA 4K46A 3BJZA 4RSRA 4WXMA 5BWCA 4EY6A 5HZMA 2HK7A 2QXTA 2NM0A 1C5KA 4I46A 4LHVA 4JUFA 1DKLA 1PLLA 1P4HA 4I7EA 4CCAA 2RSLA 2XE4A 3LPMA 2QBYA 1HTTA 3E82A 5HS6A 2GPAA 2RHTA 4KN8A 3LHKA 3UWSA 1OX4A 1US8A 3ZQJA 2GCEA 3LHSA 2O5RA 2I2XB 4E12A 2O06A 2Q8QA 2X40A 1P91A 4NYJQ 5H4HA 4PQGA 2CNLA 4LDNA 3ZCQA 1JFVA 2FN3A 5LBTA 1EFRD 4H1HA 2UVDA 4NZOA 3KM0A 4R0NA 1H0HA 4NU6A 3RASA 1VJDA 5IU6A 3UUGA 2ACVA 1LC0A 3VZRA 5BOSA 4DR6B 1VMDA 2EERA 1V95A 3RRNA 3SHWA 4BVKA 6PFKA 3H16A 4DIUA 3AUYA 4ZYLA 4AS1A 5KVVA 2JAPA 2Z5GA 2ODQA 2C94A 3JTEA 1DIHA 4RFLA 1IEWA 4DNQA 1H5UA 1E2JA 4CM8A 4B6GA 4I55F 1X74A 2ANBA 3S40A 3R0XA 4IOMA 5KOHA 5FBLB 5K09A 2BMVA 1RPAA 1XA4A 3I92A 4X45A 5ALUA 1V45E 5IC4A 2V3WA 3OAAD 2C88A 4WESB 3EG5A 3LCRA 2IZ5A 2V7VA 2WKQA 4PHFA 5BN5B 4ERXA 1P7ZA 3A06A 2VH5R 3M6VA 3WWZA 2HADA 1J2EA 1OASA 1VZ2A 1R4ZA 3SJCA 1FLAA 4I14A 1EEXB 5DTRA 3S70A 5GAJA 4XGNA 1GCGA 3B38A 3AB3A 3ZDAA 2GZ3A 1DUSA 4OBEA 3ZCPA 4JLOA 3MELA 3L6DA 2G5PA 2AEEA 3WGLA 1QOQB 1S2GA 3CUVA 5LZ9A 2V7QA 3PNPA 1W35A 3PFKA 3LLSA 1EVKA 4R16A 4A92A 4F5ZA 5KDOA 1PR6A 1M8GA 3NORA 1XKQA 1T0BA 1W34A 5F1OA 3I9LA 3FCYA 3WB9A 2P79A 1CQZA 1OLOA 1ZQ9A 3CC8A 3LKZA 2YBEA 4LOKA 4ZAFA 3NH9A 3T7CA 4F8YA 1L8OA 3BZUA 2IXBA 3MJEA 1Y8ZA 1P9WA 1N2CE 2IODA 1YDMA 2H9YA 3H04A 4CW7A 1BVYF 3BGDA 2WU0A 1Q44A 1IHPA 3DT9A 3TLKA 4B45A 4FR0A 1P39A 3OIVA 3REQB 1SUDA 2FPLA 4E15A 3UJAA 1BMQA 2IPOA 2JGLA 1M1ZA 1TAHA 2P9JA 3QF4A 4TLAA 4CL0A 2X3YA 4ALNA 2XUHA 1OYYA 2E87A 2EX1A 1MJGA 2GUWA 2QMOA 3PFHA 4P33A 2HLNA 1HWYA 2JCVA 4OYRA 3WJ2A 1BN7A 3P97A 4HI0E 3EXHC 3G0HA 3FYUA 2EFJA 4NEHB 4ETIA 2H7VA 1Z17A 2YINC 3NG1A 4IG4A 4MVXA 3F6BX 3WHKA 4ZVSA 5I7FA 4ZCSA 3ZW8A 1QANA 1WZNA 1H3EA 2V03A 1BMFA 2VKQA 2FQXA 5A0VA 3JV7A 1FJGB 1EWVA 2C1ZA 4M49A 4TS3A 2RC5A 4LEIA 3N07A 5A2GA 1QDLB 1QF9A 1HT2E 2OHGA 3PEEA 3RJ5A 1WL8A 4L78A 4OA5A 2IHYA 5L3SB 1FP4A 1OXVA 1TYAE 1SKUA 2RJ3A 3E70C 3IA2A 3MMZA 1I5OA 4LOIA 3TLBA 3SGLA 4HUTA 4POOA 5A4MS 1GR1A 2X2EA 3EXAA 4QTYA 1CYEA 4RSHA 3RLIA 5HDBB 1ORTA 1FPQA 3LH5A 1RP7A 1S0UA 2G80A 1P4JA 4NV1A 4Z4IA 2A5YB 3HCPA 3ELYA 4IG9A 5HTKA 3JZDA 4ZT5A 1AHNA 2QMUA 3WHLA 3RAFC 2AWOA 1JTFA 2PR2A 4ROSA 1U9ZA 3B1FA 3IH5A 1DINA 1RXUA 3DLPX 3M5PA 1Y9EA 2ZRJA 3OESA 3TRHA 3KXLA 3W5SA 2CXSA 1UBLS 2MDTA 4IGEA 2XYGA 1D2MA 4YUYA 2ZJ6A 5ILGA 5K45A 1I80A 4CI0B 4WADA 4G1CA 3PT9A 4L02A 1FMLA 2Q99A 1D1SA 2EKDA 3P96A 3JQPA 1S2NA 4HDKA 1AXGA 1EXNA 2WWIA 3D7KA 3PLRA 4Q1FA 4WTOA 5ELMA 3ZHRA 2PUDA 4DREA 3AIIA 3L8ZA 4H0NA 3AR3A 1HEUA 2QGZA 3DEJA 3FMGA 3KR9A 4XXHA 3WY9A 3F6PA 2C4MA 5JCOA 3WGYA 3WC4A 2GFHA 3ITEA 3TVDA 4C3VA 4N49A 4QZVA 4MUKA 1KQPA 2IFTA 4OAPA 1G1AA 4HVAA 2ESRA 3O3CA 3U44B 4BZQA 2XUJA 3OPYB 2OZLB 3VOAA 3AL3A 3DP9A 3A6FA 3PKIA 1ACMA 2EL9A 4W9RA 4QVIA 3CN7A 1NBME 4MWCA 1ISJA 1L7MA 3NUGA 3QEOA 1MC1A 2YVUA 5FI0B 3K9WA 5G02A 1C7RA 1EFUA 2H1FA 2IRWA 4RFSB 4G9EA 4TN1A 1BDBA 2ODPA 4NBSA 1KU6A 4LPKA 1TUGA 3PGKA 4Y9SA 4ITVA 4F4CA 2P1RA 4MJXA 2AXEA 1O9GA 3AUSA 4KWCA 4ZK2A 4D74A 2BFMA 2QD2A 3UK6A 5EZYA 3TMYA 1Z9BA 4F60A 1CV2A 3G5AA 4BNUA 1RT9A 3JYPA 4WKBA 4HD8A 1JEJA 2UVPA 4TQ9A 1G60A 4RIHA 4EELA 5FNZA 3R9XA 4Z9XA 2JA1A 3AESB 1JVNA 1G4AE 4F7DA 2GPNA 3LFUA 5IXJA 2P4EA 2LTAA 1B0AA 3KSMA 2W2OA 4FT4A 2Z4SA 2R65A 4E46A 3I6IA 2IH2A 4AD8A 3AC0A 4BIMA 3AXSA 2ZIVB 3AYZB 1ODSA 1PAUA 3CLKA 5KYKA 3EEYA 2QPLA 4BJ3A 1DXOA 3DA8A 2FGJA 1QE3A 1ZWLA 1GZSA 3I3SR 5LZ5A 3U80A 4EY8A 4WN3A 4MYTA 1SVIA 2BKUA 2FR8C 5CA0B 2CY0A 5LP1A 3EODA 3FPGA 1ABBA 3HMQA 2AA3A 1SK9A 3CNBA 3L06A 4NNJA 2R6GA 4PLPA 2O2EA 2R6CA 3ZGOA 2NU7B 1E6WA 2R8ZA 4IDEA 4U39A 2CHGA 1ZJYA 3AHEA 1N33B 2JCBA 4MVJI 3HXPA 1W0KA 4EPYA 1RDFA 2CEKA 2OBNA 4PRZA 1MXHA 3ANLA 2HXGA 2IKQA 4KIJA 4JI8B 3UAOA 3LSYA 4PZYA 1JEYB 4FWIB 4K6FA 3ZY3A 1KFJB 3PR3A 5GJWC 1Z6PA 2NO6A 2Q2NA 2DSNA 4EY4A 3RGGA 4QRIA 2IXGA 4GMHA 8AT1A 4EI8A 5BNFA 3M3PA 1P9RA 4MEAA 4Y2UA 5EGNA 5KAMA 4HQ6A 3RUEA 3QU2A 3Q3HA 4Q82A 1CDEA 1YCGA 2BN4A 1M1XB 2BI8A 5HK8A 1L5NA 2FSVA 1KDRA 2WAOA 3Q3JB 3ZS9A 5KSYA 4CIAA 1ID1A 3DZHA 2WPNA 2W98A 5CIYA 4COOA 1Q7GA 1YQUA 3R3UA 1L4YA 3IKJA 3EQ8A 4JP1A 5ALFA 1YONA 3RS4A 5IAAA 1XYGA 5EXSA 5HA5A 2G1JA 2IHKA 4HH4A 1R27A 5HF9A 4EATA 2G0TA 4XUDA 4Q1BA 2A86A 4OGKA 2EVWX 5TF4A 4DLBA 2QGFA 1O94A 5FKJA 1BKDR 3MPUA 3B89A 3K2BA 1I7LA 4AG3A 4OHCA 4HEA6 1ST3A 3AFMA 1RZRD 5M29A 2VHEA 2X9GA 3PD7A 4IIJB 4KPFC 2BF4A 1EHIA 1O97C 3MWDA 2P77A 3VPXA 3SC2A 2UZ1A 1ZD2P 3G17A 5K8TA 2WLSA 2PKWA 2O14A 3AGPA 4LE1A 1K4KA 4WZ6A 4DA8A 2P9CA 4RF4A 2FQWA 4S1TA 4AURA 2O54A 3FNBA 2Q6VA 3NTQA 1PJAA 3EASA 5K9ZA 4OK6A 2WFMA 1NR7A 3KELA 4UPDA 4KXWA 3EZ6A 3MB8A 1O0SA 2QP9X 4NNOA 4C0AC 1EDBA 1HT0A 4KQCA 1DEHA 6ABPA 2MHCA 4RW0A 4I4TF 5EJ8A 1AT1A 1YKFA 2DT5A 2PS0A 1KI8A 2GN4A 3L0OA 4MQBA 1PI3A 3WIUA 5I7HA 4TV9B 4HGPA 1E9AA 4WFQA 5ARBA 1RAIA 5AVYA 1E1LA 3L8MA 4EVQA 4FT2A 3ONVA 3UWOA 2W4QA 5ALOA 1PFWA 2CXTA 2P0AA 3Q11A 3CO5A 3DBLB 3ETLA 3VYTB 3NXSA 1DS6A 2Z3ZA 4LMPA 1EG7A 3I9JA 1JEDA 2N42A 3WL5A 3HBNA 4OL0A 1TZCA 2CDCA 3CG0A 1S3IA 1YQTA 3W1EA 3CJTA 1QH9A 3AERA 3GELA 2P7HA 3GUUA 2CLMB 2FPUA 1UINA 2QY6A 3QG5A 1LJ8A 3N70A 3FYTA 5E6UB 2ZVJA 2AJ8A 3EA0A 3NVMB 4BNJA 3QEAZ 1V96A 4YROA 3T1OA 3PCTA 4HBZA 1N6LA 2ECFA 2QMYA 3LGXA 4JJ6A 1E4VA 1YRQA 1WCXA 2YV2A 1X0XA 2AFIB 4D4JA 1VI5A 1XO1A 2ORYA 2J0QA 1O9HA 3VR2D 1LDGA 4LMRA 5F9MA 2AJLI 1CS0B 3M6LA 3NNDA 2Q0XA 4PYNA 4WN9A 4X66B 2VYVA 1FU4A 1M6VB 5KSOA 1USUA 2ORED 1HDXA 2ZSUA 3Q7EA 4BGIA 1SG9A 2BFEB 5EJ6A 4BOYA 4CGZA 3DOUA 3D3EA 4HT3B 1XL1A 2RG1A 2WSIA 1T8SA 1XCJA 4CMIB 3UJ8A 5ALPA 3M2TA 2OCXA 1TT5B 1SEPA 1J8DA 4Z99A 1U0EA 1KDVA 4AROA 1GVNB 1XD8A 2YICA 2BI4A 4U1RA 4V0NA 4JV5B 3DOOA 2ILTA 1Z82A 2WWGA 1EMDA 2J9YB 4W8GA 1E64A 4AJNA 1OFIA 2HSWA 1S8FA 1SNYA 2JB9A 1VLLA 2Q29A 1UCFA 2VDPB 1H8HD 2W6CX 3L7YA 3NANA 4G8DA 1GDDA 2G09A 4HTFB 4YJ2A 1GU7A 1C9NA 2DPXA 3C3MA 3B6MA 4DADA 3NO4A 1CP3A 1XQ6A 4N5LA 3LLCA 4RHUA 5C5CA 2ZWOA 1HQKA 1PSZA 1IHUA 3P71T 3DAHA 2GKOA 2ODWA 4CCWA 3KXPA 3H6KA 3HKCA 4OP1A 4NPHA 5EJMA 1B6SA 2XITA 4QJIA 4QUEA 4XWOA 1NU6A 1NR1A 3RE1A 4G81A 1XD9A 1I5EA 3D8RA 4OLHA 4LJ5A 4OQNA 1GITA 1KHHA 2YQ5A 1ZK3A 4HDAA 3SOPA 5LYYA 1VL0A 2I9KA 3ZDZB 1YA4A 1Z4OA 2M32A 2QM3A 2AG8A 2YS7A 1D7OA 4Q9LA 1A5BB 1ZXLA 1FS4A 2EAUA 3ENNA 3LZDA 1SG6A 1T1EA 3TZEA 4DR1B 3IVGA 4MI9A 4R84A 3PXGA 1BXZA 1UKVY 3DB1A 5CPBA 3LUJA 1B93A 3PI6A 2JDID 4K26A 3UXEA 4J2TA 5CG1A 3H9GA 3EY9A 4G5FA 2EWWA 4YIKA 4KQHA 2J0SA 2C31A 2ZVDA 3MS4A 4RZXA 2FWJA 5ILQA 4L4YA 4H1TA 5CGQB 4UU7A 3VR6H 2DUJA 3GEIA 2KPOA 2UZAA 4NPCA 3RC2A 2CV1A 2BP7B 1XHLA 3FSGD 3LQYA 1UXKA 2ECQA 4ZYZA 1RC0A 3PHGA 3BORA 3CINA 2CVZA 2YWRA 2Q5LA 3AP1A 4U7GA 1U04A 1K4MA 3O93A 4LGMA 2CK3A 3HBAA 5CB4A 3C3JA 4BLPA 1SCUB 2GO1A 3HA2A 3K94A 3OIFA 3OIUA 4MPJA 1U11A 1HZJA 2OQVA 4B3BA 3RVJA 2OILA 5CYPA 1A7AA 3JW8A 3DEHA 1W4RA 1IBRA 4KQEA 5EJIA 3ZXXA 2PJDA 3DW3X 3IDAA 1EX1A 3MOGA 4Y2SA 3T4EA 1JQ5A 5LWQA 1J70A 4Y3UA 2P9QA 2VDWA 4CLEA 1ZGHA 3GDGA 1K89A 1H2HA 1B16A 1JXQA 2A84A 1VBNA 2VVTA 2B98A 3DWGA 1TVKB 3TTTA 3AI3A 3ZGZA 2EJWA 3F5MA 1FNBA 2JHPA 2ZBPA 3FKQA 3MFQA 4DGQA 4P82A 3DZCA 2CBZA 3CNEA 5JV5A 4JC4A 1E2FA 1D2AA 1NUTA 5AI4A 1AZLA 3KZMA 1NR5A 1CUGA 2SECE 2NXCA 4RZIA 3EC7A 1KZ9A 4MGKR 3KV1A 3VQTA 3RD5A 1TRHA 1VG1A 5E8JA 4EDFA 1SC9A 4DA4A 3O8QB 2OD2A 4FR2A 1U2GA 2J3DA 3G59A 3EGEA 3NBXX 2EEPA 5B1YA 1JHUA 3SIXA 2OWEA 2D2XA 4HX5A 1QCZA 4RPJA 5AUNB 3CZCA 3O26A 2IF0A 3PHJA 2PZBA 4TYMA 2X5OA 3S8YA 1XJCA 3T3MB 1TF5A 3SZLA 1G8MA 2G1KA 3Q5DA 1QHHA 1ESCA 4OATA 4F45A 3PQ5A 2FEKA 2RHJA 1C9MA 3OJFA 3HGQA 1MGPA 3AF1A 4AC9A 4LY9A 1MB3A 1QPBA 3GLTA 1QO0A 4GQIA 1SOAA 3SKVA 4CV1A 1KI6B 2GEKA 3CISA 3I2JA 1RXEA 1TDJA 2FFHA 1P5RA 4EQ6B 1KK1A 2WJGA 3B2EA 2C4HA 4M36A 4Z4CA 4DB4A 1PWZA 2Q6LA 3KSRA 3EPHA 3OU2A 3A6HA 1DU4A 3KQQA 3PHHA 5IH3A 2GJAA 1CG6A 3D8BA 1V35A 2KB0A 3GH3A 1EKXA 3NKVA 4BQEA 5CTJA 4J0HA 4R54A 5CVVA 3N7AA 4JVSB 2A88A 3TFQA 1DXYA 1XYYA 2EV9A 3WGGA 4XGQA 4C03A 3OJCA 3V97A 2FAXA 3GEEA 4TLLB 4FFOA 3GWGA 1Q7CA 3F9CA 4D9NA 1X3SA 3LNTA 2Q4BA 3DV9A 3OZEA 3PPVA 1N8SA 3DM5A 4FLMA 4PCLA 4PVDA 2VG8A 4WECA 4Y18A 3V00A 6AT1A 5EXTA 5F4BA 3EPKA 3U16A 2YMQA 3PS9A 3TYXA 1IRIA 3GRPA 3HEBA 5I9MA 2OHHA 4NBVA 4NFYA 4ZAXA 1P17A 5D7BA 4DR4B 1R88A 1OXUA 4KXUA 5L6MB 3JD3A 4FYYA 4HH0A 4IGIA 4M7WA 4MQUA 2QDKA 2JGRA 2QUHA 3TLJA 4OQPA 5ENVA 4MR8B 3P0HA 4D8XA 3TLYA 5TF0A 3DXZA 1ZNYA 2XDAA 4JSYA 2EZ8A 2I80A 3GFBA 2WG2A 1UXIA 3IHWA 3PJDA 4IOJA 4L73A 4X6UA 4B71A 4ESHA 1D2RA 1N7GA 2I67A 5DM2A 2VIIA 4ND3A 4PAQA 2PUJA 3CZRA 5CP8A 4B0OA 4RGBA 3OPYI 3U7IA 4L28A 5FQNA 2B7BA 3BIOA 2FN8A 3O90A 3HV0A 4EBBA 1ISGA 5HOQA 1QHYA 3OZVA 3SQDA 1A2QA 2VJOA 5B64A 5HZHA 2GAFA 2QEQA 3T7SA 4A27A 3P0IA 4M89A 3H4VA 4LX0A 2M6LA 1G8KA 3DE5X 4YCAA 3SS9X 4BVHA 5SZKB 5EJ9A 3LPNA 2VAXA 1ND5A 2P0YA 2DE0X 3STTA 2C9DA 2H1HA 2GDJA 2NGRA 4QDUA 5SYMA 2CN1A 5KJ1A 3TF5A 3T4PA 2OV3A 1UBFA 2J48A 1FW6A 1QH1A 4EO4A 3JQ8B 2HLPA 4U7HA 4MV7A 1OBVA 3T61A 4AP6A 2ASEA 3R5JA 4XDHA 1UP6A 3AHDA 1G17A 4RK4A 1T4MA 2ZWMA 3CNNA 3G02A 4BP3A 1WVIA 2QQEA 4BRZA 4QXOA 1T3SA 2Q49A 5DNYB 2DLCX 2XGJA 3I6YA 1YD7A 2PS9A 3IFSA 2QYHA 4E6EA 3IUNA 2WJJA 4BEWA 4GG1A 4K9RA 3A9UA 4CQLA 3QHAA 1K7FB 2CZCA 3QU9A 3RYCA 2HDWA 3IPYA 3OZDA 5MN4A 1QYVA 3GMSA 3KXIA 1T5SA 2AVNA 3B1WA 2ZS8A 1CUWA 1TA0A 3C4QA 4AULA 3C43A 1DEKA 3FWZA 1C8KA 3WLMA 5AW5A 1L5OA 2X3FA 2HU8A 2YHSA 1J9ZA 1KI2A 3SIWA 2XXAA 1PVVA 2FEXA 2Q5JA 4ZQHA 2GK6A 4XCQA 2W11A 1HE8B 3ECAA 5JS7A 1KRHA 3N8NA 4IRUB 3KKEA 3M5DA 3QOYA 3M6MD 4BBAA 1B8UA 3ZBPA 4RVCA 1X8KA 3AOGA 1H42A 1KI3A 2QTVB 1HXHA 3GD5A 3KEOA 3PDJA 1QVZA 3IAUA 4YREA 5EIAA 3VR4D 1DZIA 2GASA 5FTWA 3X2EA 5EZ5A 3ZK9A 4A0GA 5CFRA 2PQ0A 3JQAD 2O3SA 1SOVA 1M5UA 1MN6A 1VXRA 1Z8DA 4LX8A 2WSMA 2VZEA 2YJ6A 3S29A 3HGMA 3V8QA 3SXUA 4CKEB 5AOBA 3BEDA 3UHAA 1WPGA 3WFIA 3CLRD 1EVIA 1FVHA 1S7CA 5ED4A 4QU0A 4ZARA 4Y1RB 5JJBA 4RKYA 13PKA 4EPXA 3S2IA 5JARA 3THWB 4LFAB 1M8FA 3W8NA 4JB0A 5KSPA 3H7AA 3LU1A 2LV8A 4OI1A 2ZKLA 4YRNA 1KEWA 4JXXA 1QG2A 4CM4A 4F7WA 4D9JA 4E4TA 3GMDA 1E5LA 4QXRA 3SXPA 4CKCB 4ZQGA 1JLLA 3CSDA 1WW3A 1SFRA 1N6OA 5LDHA 1U8FO 2O0LA 3QE3A 1SB8A 3Q2IA 4GD3Q 4QDZA 3WGOA 3JQ9C 4JLVA 1Z45A 2GZ2A 1SCDA 4I9FA 1V1JA 1B43A 1O54A 3GXBA 4FGKA 4HLUC 3H9UA 2G1UA 2F6RA 5EXDA 2HHLA 5EIEA 1N4DA 4C2UA 3KV3O 5HQTA 4DIDA 4YJGB 4AIIA 5IJWA 2WIGA 1XX6A 4R81A 4JP3A 2GTPA 4RIGA 2P35A 1GKKA 3E7XA 3K3PA 5IKMA 3WBKA 1L5RA 2BFDA 2Y1OA 4FS3A 2CYAA 3CH5A 1EFTA 1MX5A 3G2MA 2EEZA 2PFSA 1JX6A 3AR2A 3M81A 3FUVA 4JJGA 3T3PB 3V4ZA 1XQ9A 3E8XA 1GTSA 4Q0MA 4ENTA 1ULHA 1M2NA 1IEQA 2ZR9A 3C24A 3V1NA 3ER8A 5HRUA 5TVKA 4G01B 1SAYA 2E4VA 1YFKA 3UMYA 2HJGA 4CTOA 1F48A 2GS9A 1JQDA 2VTEA 3C6KA 4DCGA 4YV0A 1VGQA 2BGLA 2QNBA 2GD6A 3N7TA 3VR3D 1L4LA 2W58A 2YBDA 2V1XA 2B6NA 1NP3A 2X8WA 4MR7B 1H9AA 1QRUA 4N40A 3T7RA 2F1HA 3LQ4A 1U7UA 3IUJA 2JIDA 2GCPA 3KEFA 1CP2A 2DY1A 3PWSA 3I8XA 3A6DA 3HJNA 2O7NA 2JHCA 4L50A 5KNCH 4G4IA 4HQNA 2G4LA 1OTYA 1MO4A 1YBFA 4G4SO 4X94A 5L3RA 2OK8A 2ZB8A 4D46A 3B7GA 1IU9A 2WTUA 3HO1A 1E3MA 3KDPA 1MJGM 4MICA 5AHXA 5ADUS 3FSRA 3CZPA 2CVPA 2PKEA 3CBQA 3FUXA 3PX2A 3HWRA 2WP8J 3N2ZB 4R3NA 2I22A 4D0RA 2HIHA 3ZZ1A 1IHXA 4FNGA 4KZKA 3OFSA 2Y6UA 4L4XA 2EXXA 1T0IA 2ZTUA 3IQGX 1OCEA 1L5YA 1ORWA 1CYDA 1WWKA 5CLFA 2XMCA 1N3YA 3NBMA 1N5DA 4L5AA 1QP0A 3V6LA 2WFLB 4B85A 2CNNA 3F0TA 3O95A 3OJOA 2WZBA 4DLXA 2I6FA 2ZS7A 2GO7A 4B81A 4DNPA 4K2HA 2PUWA 4KH1A 3IR7A 1ECFA 2VQSA 3ZK7A 4FFVA 1ODJA 5A5EA 1KAGA 1QH8B 3DC7A 3P5BA 3COWA 5LQNA 3HUEA 3AR8A 2H4JA 4DYHA 5JSKA 1FP2A 1GUZA 1QHSA 1IY0A 1J8QA 1N6RA 2HBRA 2YC2C 4PLVA 4PWYA 1RRGA 1NUHA 3DVAA 4CWAA 4DBZA 1EZZA 4OF4A 2B5OA 1QFXA 2JANA 3M70A 3SZOA 5F2KA 2BD0A 2PL9A 2YQ4A 1PW7A 1P29A 3LLMA 5T41A 3VU8A 1K27A 1RYNA 4Q18A 3DDOA 4Q00A 4BV2A 4QELA 2QVXX 2WINI 3PNLA 5YASA 1R8SA 4TVSA 3PC2A 3UTDA 3DOCA 1L5HB 4X3PA 2BZ0A 1NF3A 1X39A 2AK2A 1GQYA 4KMMA 4CLOA 1DKRA 1J0CA 2GYYA 2XI4A 5CFOA 2IK8A 3A9SA 1JHMA 3EGOA 1RJEA 3RYIB 3DCIA 2NPFA 1CFZA 5BWLA 2YVLA 1U98A 1ZSVA 4MP3A 3M7IA 3UKOA 4DMGA 5DYTA 4Y2GA 2ZG6A 3LV8A 3WZ2A 4BWFB 4RQAA 1YS6A 2JW5A 2NUBA 2OOSA 5DI3A 1GAXA 1PT9A 2O7QA 3FGZA 5BWMA 5AWFC 2ZJ7A 4UTNA 3M9LA 3PFBA 4TTPA 3WKDA 4BFYA 1ZM3A 3T1HB 4FDAA 2RHMA 4GNKA 3TH5A 3WISA 1U28C 3CH6A 3DCYA 3RRYA 2LD4A 2FJPA 4C0KA 3I6MA 1WZEA 2C9OA 3K5IA 5K2MA 1IC6A 1NAHA 1YFLA 2XSZA 3WMXA 4RHTA 3RBVA 2PL3A 1CIJA 1ZNXA 2Q5HA 1T15A 3ORFA 2XVXA 1ZK1A 1L8LA 2DKNA 3RTAA 1WY5A 2D4HA 2BKLA 4TMFA 5AYVA 3T3OA 3MWEA 2ZAOA 4MMXB 4S2UA 3RB8A 1H0SA 2CLLB 2R7AA 4J3JA 2XYHA 4J1TC 1HNNA 3GR6A 2PY6A 4EHJA 2I2FA 1P6XA 2I87A 4LV6A 4M9SA 4FN4A 1K9VF 1BJRE 4AN1A 1GFSA 1VSTA 4E21A 5A3VA 1T6XA 4BMVA 1EK6A 2FFQA 3E1SA 4ALKA 5EE0A 3JPWA 5DCWA 3KQPA 1F6WA 3A1VA 4DY6A 4MUEA 1XU9A 3KEGA 4RKQA 4ALMA 1LK5A 3BILA 3I2FA 3COZA 4CVNA 3OLXA 4KQ9A 1XNHA 4IDAA 2R7LA 4D42A 2SBTA 4MO2A 1DHTA 1EDZA 1Q0QA 4Q9HA 5KHAA 1J21A 1G21A 3FI9A 1FLNA 1TB4A 1VLHA 2XCOA 4OIFA 4U6NA 3REOA 2YFKA 3F5DA 3U3ZA 4OQYA 2C5SA 3ZJUA 2IQIA 2PT5A 2QNIA 4ZOBA 4MH0R 1XGKA 1NN1A 4KXYA 5CLIA 1IYZA 3K70D 2QNRA 2Y1XA 5AM2A 3DZ8A 5CJPA 3KZKA 4HXEB 3KALA 1R0KA 4PE5B 2NYRA 1J09A 4ITUA 4E14A 1P81A 4HP8A 1P2GA 4HDNB 1HURA 2DFPA 3E3AA 2R1ZA 1TKRA 3DYIA 2I3AA 3MQ2A 4HXYA 3CVWA 1IXRC 4IYRA 3LX6A 4ZK6A 2X0EA 2NAFA 1N2HA 2JF0A 1W6RA 2OSVA 3AKEA 1EGQA 3T0FA 5AIBA 4XQGA 5DNAA 3G82C 1MV8A 2W6QA 4BP8A 4AG6A 3A6EA 2IU4A 5EERA 4WUTA 2AN5A 1EJ6A 5CW1A 2PN1A 3MCAA 2X76A 1HT1E 3FZQA 1YRHA 4A5OA 1RPNA 3DFZA 1Q0HA 4ILKA 3FFBA 3LAWA 5D5QA 2C5BA 4H17A 1A7UA 1M7BA 1M9NA 1TIBA 4P84A 5H68A 5EEHA 1HFEL 3ZDYB 5T4EA 4K1LA 3AEUB 3QE9Y 1QDUA 3E7PA 3SYTA 3ZWDA 4EB6A 3EDYA 2ACWA 3GXOA 2RB4A 2R0QC 3WKAA 4HDCA 3KB6A 2SICE 4KC0A 3TTVA 4B6PA 2V7BA 1FDOA 2JJQA 3Q15C 4DUPA 1QFMA 1KIMA 2DQZA 3KHTA 1JDJA 2H08A 1HEIA 2QD3A 2UXDB 1D3AA 5D3MB 1ZJ5A 4RTRA 4JOQA 4TROA 1KDPA 1RZVA 5JVDF 3R8XA 1CJKC 5DLPA 1Z25A 2I6SA 3L1JA 3NB0A 2DPYA 3C3WA 4G0VA 1Q20A 1J39A 2FE4A 2Y27A 1F1JA 2HCBA 2WF8A 3CQ9A 1THGA 1XALA 3KEQA 4DBVO 2LBPA 5K8JB 3KSDO 1AQIA 2G7MC 3KZ1E 4WA8A 4JI1B 2VRCA 3DAFA 1C4XA 1OTHA 3TIIA 4E32A 1HYQA 3F78A 3ND5A 4ZPJA 2QL7A 4LZNA 2J3JA 3GDWA 4C88A 4AZVA 3HP4A 3FWPA 3CKMA 4UCWA 3W6PA 3U60B 2H2IA 4UXHA 3R75A 3DOFA 2GZHA 3UPUA 5LKAA 3WQSB 1OXSC 2DUNA 3BTOA 3I8OA 3PFNA 3LW8A 3WI7A 1CR6A 4FOTA 4OSEA 2HSJA 2NSDA 5GOTA 2PMFA 1B6TA 4ZOQI 5CITA 3ZJVA 1Q21A 5INTA 3DZDA 4WZAB 3C5HA 4REQA 1VE3A 2WY2D 3HCFA 3EX7C 4AMYA 1QFSA 2HNBA 2OBXA 2OVBA 2P3SA 4NYJR 1XMVA 4UVDA 4R1QA 1N9GB 2J7KA 3RKUA 2GKGA 4ETMA 1DBSA 5KJ6A 1GP2A 3EQ2A 2X9NA 5DYGA 5JDCA 5F12A 1VECA 1B6RA 4YJ3F 2C9BA 1E3EA 4ZXPA 4ND2A 3WFZA 1YRLA 1ZCZA 1GARA 1NHWA 3R6DA 2OCPA 3BXEA 1JE0A 2E4XA 4UFOA 4XI9A 1Y6GA 1B2LA 3SHTA 2B9EA 4M8IA 4DCNA 2DERA 5A0TA 2GEFA 3MJCA 5L4SA 1PNVA 2C0CA 1Z38A 4CM9A 1Q1NA 1W75A 2VHYA 4HNRA 2OP0A 5DXFA 4S3MA 1NX9A 2ZYHA 1DJLA 3Q9LA 4WZBA 4RK0A 5EJEA 4YO7A 2YX1A 4EGFA 2IYAA 1LFDB 2K5UA 2XYPA 3B1JA 3E15A 3KKQA 2NW6A 1M54A 4NF2A 1XCOA 4C4OA 4PQEA 2YWHA 3TZ6A 1N2BA 2R48A 2QN8A 3E22B 3K05A 1N36B 1J00A 1WDLA 3HI4A 1TM1E 1E63A 3RFXA 1HX7A 2CXPA 1R0ZA 1KY5A 3L3BA 4BMXA 3GAMA 4O4JA 1SVLA 2HO5A 2ZRFA 5MGNA 3ZE7A 3UJ9A 2I4NA 2P78A 1LS6A 1M6WA 4H31A 4PRYA 5KEIA 1SD5A 3IR6A 2PUVA 1U1DA 4U9HS 5ITSA 4ENQA 1PT6A 1RVV1 2VI5A 3TRKA 5F76A 4BLWA 4KYUA 1JZSA 1XK6A 3FJOA 5C8DA 1KS9A 5CT4A 3MPOA 3WGIA 1B1CA 4U2BA 1SQFA 1P1IA 3ZQKA 2WVHA 4RS4A 2HQ1A 2H16A 4IFEA 4E4YA 4EJMA 1FDTA 1FFXB 4XH9B 3SX0A 4CEIA 4KREA 4KQJA 1FW8A 1YI0A 1E2GA 2G28A 3CS3A 4XJVA 3KAJA 2GEBA 2KE5A 3GA5A 4IHQA 1F51E 1T24A 2LVBA 3BXFA 4NONA 2CLHB 5EESA 3CEPB 5K99A 1Q11A 2FXVA 2OLEA 1WEHA 4ZZ1A 1K7XB 3IIEA 1TMYA 3F4KA 5IABA 1S7GA 1SXJA 3K31A 4O0MA 1H23A 4IDDA 1PT8A 2EZ4A 4GI1A 2WILA 3IPXA 1Y3BE 5ER9A 5AKYA 2QN7A 3MRXA 1BVUA 1GKIA 1RYEA 4TLDA 3D7SA 3GG2A 4C0LA 4F72A 2VRBA 3AOEA 3G2OA 2YOHA 1U8YA 1ZOPA 3AU9A 3K1ZA 3LC1O 3CVXA 2I6XA 1TOAA 2CVQA 2KW5A 4OKNA 4WNIA 2D0DA 3CVOA 3EEFA 5KCMA 3UV3A 1NW8A 1UT6A 3U1BA 1LDEA 1WW2A 1YXMA 3NKFA 2F9MA 4Q1CA 4Q4JA 4C6TA 3P9QA 2WVAA 1BEEA 4PHTA 3AWDA 1KYYA 4PLYA 5JSZA 3K09A 5LYJF 3O8RA 1PYGA 1N2IA 4N8DA 1U2QA 4UNPA 4QYTA 3EFBA 4DCTA 1MRSA 5KYTA 2YY5A 3QEMB 5COAA 4LQCA 1JFRA 4PZ9A 1XDZA 2W6ID 3CXRA 3O8LA 4R1TA 3F7NA 3G49A 1H3NA 5REQB 2N1BA 1JR2A 2QX9A 4NBNA 1YB7A 4QQRA 1CUHA 1VE7A 2HJSA 2ZT5A 3O4FA 2Y0CA 3ZGYA 4YAGA 1NVFA 1VKZA 2QAIA 2XQGA 3RU2A 3RYTC 2OAEA 4OREX 4JI7B 1Z4NA 3UVEA 3KZXA 1LDYA 1XELA 1BFDA 4G07A 3K6SB 1B7GO 1XZPA 4BVBA 5K0JA 1ZY2A 2P0EA 1NE7A 2XQIA 4JSRA 2NU6A 1ONNA 4Q4LA 3TIXB 4BB5A 2VDVE 2OE2A 5DYYA 2NZYA 3AFOA 5CVJA 5AM5A 5HF6A 1CW2B 3H9EO 4Q7MB 1N5JA 4XVUA 3QPBA 2ZR7A 3O8DA 4GOMD 1OIWA 3PLAE 1F3LA 4YAWA 2J41A 4EYQA 3K6KA 1EFRA 2X9LA 1RHJA 2M1XA 1DQPA 2WDPA 3HA5A 4M86A 3LP8A 2GEUA 3SP1A 4WKNA 3UA4A 1BWPA 3ZLBA 3QXHA 3BE4A 5HR5A 1AMNA 1Q57A 1ZU4A 2C57A 1TLTA 5C8YA 5BQ3A 1EUCA 2GK3A 2F55A 2V54A 4NS1A 2GJ9A 4DMCA 1NMQA 2XZTA 3H18A 3H2YA 3FVRA 1AUPA 3OLVA 4H16A 1I0LA 4XASA 8GPBA 1OA0A 1WCYA 1AM4D 2QTLA 1UAYA 4EHLA 3KUDA 1Z4PX 4JC0A 4JVNA 3R5KA 3BBLA 4UREA 3RIEA 5HXAA 2MR6A 4AM8A 3ZHYA 5BNIA 1N6KA 2AF3C 2YN2A 3M4XA 3OAAA 4MULA 4Q93A 3DXXA 3SKXA 3NC4A 3DHYA 3TR6A 2JKYA 1ZJJA 2D7JA 3F2VA 5JG7A 1WXWA 3VHXA 3R2JA 2ZIEA 4GC9A 4UUNA 5GJCA 1ULAA 4RTNA 3CVUA 121PA 1EB9A 2HCRA 2Q2WA 1PYOA 1PBTA 2FFJA 3UT5A 4EY5A 2FCRA 3N2GB 4GQAA 2BCJQ 2D5BA 3D43A 3OQ6A 1MAHA 3DDHA 1SXQA 3A2LA 2D8AA 2GZDA 2O23A 4WBXC 4CCYB 2AZDA 1WULS 3LP5A 2H63A 1HNXB 1ZP6A 3L93A 1RXIA 1XZIA 1D8TA 1T6NA 3G0OA 5BURA 3O0DA 2WJ4A 5FORA 4KVFA 4DWVA 4EKGA 1UJ5A 3SVTA 5D8DA 4CF7A 3WLJA 4HNQA 1P6UA 4EA8A 1VLZA 4EIWA 3TSOA 2W6JD 4M6WB 3SEQA 3HDTA 4KKXB 5H3CA 3BTSA 1BMTA 521PA 4KO3S 4IZHA 4MYSA 3L84A 1XFDA 1XRMA 3HR8A 4DLKA 3DEYX 4LJ6A 4J0CA 1UBNA 1AS2A 3CRMA 3T3HA 5FWYA 3LVBA 4C2AA 2J08A 4DANA 1SIOA 5H7XA 1YI8A 1XHEA 2PH7A 2JFOA 4TQUS 1E0AA 1H85A 3S6JA 2FK8A 4M55A 3AV3A 5DTMA 1YBMA 2VWPA 5E6RA 3IMCA 3I76A 5BRAA 3L4EA 2KWIA 1N6NA 3TMAA 1WB5A 2C0PA 3NDJA 3VR1A 3AEXA 2VF8A 1R7RA 4J2HA 4RK1A 3STXA 3EQ6A 6LDHA 1U8TA 4JLNA 5KHOC 3NHKA 3RTDA 4X97A 4CLXA 4LY3A 1BE8A 2CVOA 3DDUA 4XX1A 2GPBA 1QGAA 2PCJA 1WCWA 2WU3A 1PJ2A 5IAEA 1X7DA 5I9TA 4AJPA 4KLZA 4B6QA 2QR2A 1NSTA 4H1UA 4HB2A 4CETA 1O77A 2HV9A 2X0JA 5EG5A 3CKLA 5IPFA 1N92A 1J0AA 3DV0A 1VGRA 5BPFA 2AF4C 1AXEA 4WT7A 7ABPA 1R0XA 2BE7A 2FEPA 4GMDA 2XADA 4EGSA 3THSA 1ADYA 1Y3DE 1Q74A 2NTVA 4HDRA 1QNFA 2I4RA 4PWZA 1X7GA 2WVGA 1V39A 3KOZA 3L02A 5HM8A 4TS4A 1D2NA 1Q91A 5FFNA 1E8NA 2DWPA 1RBQA 2UUBB 3ZGXA 1YB4A 2LWIA 1FFGA 3L7KA 5JNRA 2G6BA 1DELA 2RD2A 2W6PA 1RZUA 4DLYA 3GLRA 3O9MA 5AW7A 4YHHB 3PKZA 4CE6A 1IEVA 3DLCA 5AI5A 5I47A 4TV8B 3T15A 6REQB 3R4VA 4PPYA 2QL6A 3A9WA 5D00A 1EBFA 1JKIA 1G98A 1A8PA 1YB5A 3GJYA 2OAGA 1MTZA 3Q72A 4GSLA 4ZO6A 3TBFA 2H0QA 3TZKA 3UXMA 3VUEA 3VPGA 2G72A 3BXPA 3FCXA 3DLTA 5TJHA 5ITVA 2O3TA 1M72A 5DXAA 1OWMA 1E59A 3H1PA 4M8SA 3WL3A 3C45A 3EFHA 4Z4GA 4MGHA 5TPZD 4MEBA 1S1MA 2VPWA 3Q5GA 3WWOA 3DEAA 1W87A 3TCNA 4C0QC 2I4OA 4AZSA 5ELXA 2ZTSA 2YYZA 1NW5A 3IC5A 4MV0A 5MDHA 4FLFA 4L4SA 4GMXA 1JHQA 1YIAA 4O2BB 5B30A 5K0ZA 4JUDX 3I04A 1PJLA 5FDFA 3A4YA 2F1RA 2HOQA 4FM9A 4TUYA 4LXYA 4GVPA 1BX0A 3K8ZA 1LK0A 4NI5A 3V4LA 1JJVA 1EGAA 4OBWA 3KJQA 3KSUA 4NLLA 1F1BA 1MABA 2X5JO 3RRMA 4LJ9A 3D2CA 2WM3A 5L8VA 2VJYA 1YR9A 3OLYA 4JELA 1OJ7A 1ZVKA 2YV5A 4AQ7A 3ENWA 4GM1A 4GOJA 1Z12A 1O7JA 2VS1A 1N9KA 3QKRB 2W2VA 2IUUA 2V3CC 1E7WA 4PAMA 1O8BA 1NG1A 3MA0A 5FUWA 4JZYA 4OHMA 1GTMA 4RY9A 5DCLA 5CDHA 5HOEA 3U56A 4D43A 4CKZA 1Q14A 2QJWA 2XKAA 4IIVA 4BO6A 2SKDA 5LWHA 1I1OA 3BMQA 3BZBA 4I1PA 1U0OC 1VJCA 1T36B 4BVJA 3MLAA 4M8NE 5TT0A 1QGUA 3ZZMA 3QUTA 4LBVA 5HEKA 3QWHA 1T3LA 1S8NA 2ONJA 2XTMA 3PNOA 1PJZA 4RCVA 3HJHA 5DIFA 2BCEA 2NUAA 5KQRA 1LA2A 2PZ8A 5GV8A 4B4UA 2UUCB 3QJYA 5IDXA 2XF2A 3HEAA 4HUQB 2AMYA 3E81A 5LJLA 4X71A 3SE7A 4GE3A 4BNYA 1GUFA 1FFYA 1DUIA 1G4UR 2D1TA 3LCCA 4BMNA 4TL6A 1P0CA 5T5QA 2XRYA 1QIKA 1TJ4A 3B6IA 2JFNA 4JU8A 1TW3A 2QENA 3NYQA 3FNIA 1VOTA 4HDQB 4QD3A 3QPUA 3SIPA 5B3KA 2XVMA 2R87A 3LA8A 3H0CA 4Z1OA 9ATCA 1REQB 3C7CB 3L49A 4D3SA 2AFRA 4M1TA 4EYEA 2IQ5A 2PRSA 3WK6A 4KR9A 2FPSA 2Z2YA 2HK8A 3IDQA 3IPAA 2E5FA 2VO1A 3IT3A 5DX1A 1P2SA 3X3HA 2DJ5A 1ZO8A 4QGFA 3B5EA 5A6SB 3TKAA 3SZGA 4X44A 2X42A 4IJQA 2AZMA 5DFAA 3WIBA 4QEZA 4BO7A 3ONEA 1Y9JA 3HWSA 3IO3A 1N32B 3GDFA 3I5AA 2D5CA 3ZV5A 5CB8A 5HJ2A 3KX2A 4IYJA 5ITZB 1RHKA 1P19A 1WHTA 3IJPA 3HJAA 4R83A 5FPPA 3SJAA 1WZCA 4EJ2A 4FP9A 4WKPA 3ZXYA 1SQ5A 1J23A 2HA6A 3D5TA 5K0NA 4BMSA 1OZHA 1Y4AE 1JF8A 3CNQS 1FZQA 4D6PA 4M3NA 1VTKA 4L8VA 2OGWA 3UENA 4B6OA 5ALVA 1RZRA 1AH2A 1IUPA 2X6RA 3KUXA 1XLTC 3ND6A 3V1LA 4GSKA 1YE8A 4KE6A 2ZYAA 3LLVA 2KQUA 2FEWB 3I83A 4RTQA 3GPBA 3EPJA 4FEGA 3M9XA 4A2WA 4B40A 4PGHA 5LQAA 2XGGA 3OU7A 3V8PA 5IJ9A 3AEYA 1DAKA 1C0LA 2WUGA 1Q1EA 2QXYA 2E89A 1QMPA 3OUUA 3FDZB 4UOQA 5IWCA 5LMUB 3MT9A 4NECA 4EA6A 1JBQA 4CDRA 1DRWA 4I9HA 1DTWA 2H59A 4B7CA 2C3YA 4AY2A 5HBGA 1EEHA 1UP4A 2G76A 3TDKA 1F8UA 1O95C 2Z3WA 4W9MC 2GB4A 1XZFA 1MXFA 1VIMA 2YHAA 3KWMA 1SBQA 4PANA 3AX6A 1IM8A 1N0IA 2H9IA 1KJQA 4PXSA 4EG6A 3WJ1A 1X1DA 1MD9A 3PJEA 2PKCA 1J99A 3W5VA 1QTRA 3JWJA 1PGNA 2LRHA 2OXRA 3DTYA 3EZFA 2ZRKA 5J40A 3ORHA 3HKDA 3ICVA 4BUJA 5TNXA 4NK5A 2VNHA 2ZCVA 4I55A 1JFSA 1ZEMA 3T1TA 1T1SA 2ZJBA 3LBYA 3PRKE 1A9RA 5JR3A 3KQYA 1JT2A 3E7WA 3MIIA 3SX4A 1PEAA 4Z4HA 1WV0A 3NASA 1VE5A 2P7IA 3GP3A 2W5UA 3D0RA 4NVRA 1NUAA 1UKZA 1XXHA 2HI0A 3EEIA 3ABIA 4P9NA 5DWQA 3DWFA 3STHA 5CFNA 2IBSA 3ICPA 4WA7A 1VPLA 1NFRA 1U7ZA 1CCWA 3JYHA 4Q7EA 4I5FA 2EHJA 3OH8A 4XVCA 3VR2A 2YVQA 3K8YA 1NNLA 4WKOA 3UBMA 3JWGA 4G1MB 2EW2A 2Q5IA 4BNXA 2ZXUA 1FFEA 3BA1A 3LXUX 3P4YA 2V74B 3HLKA 1QV9A 4I0WB 4A15A 2H29A 3IMEA 3MGBA 5C1BA 2A94A 3HGTA 1G16A 5FH9A 5FLXA 1I2CA 2PS3A 3OM8A 1ICIA 5FCDA 3ZVKA 2V9CA 4V0ME 3ON5A 3UK1A 3GOHA 3FOFC 3AKZA 1BXKA 4LUCA 3WLPA 1T9CA 2WIDA 4BRUA 2V58A 1NW3A 3LBFA 4QYIA 4I1OA 2FGKA 4MQEB 4W9NC 1ODLA 1M3SA 3ZNQA 1L5WA 4BX8A 3OIWA 4BJ6A 3ELUA 5DK6A 2HSEA 1H8HA 3GHHA 4GRDA 3LYUA 5IAKA 1DBQA 4RK5A 5DNUA 1W46A 2ZAYA 2B34A 3ED1A 3N6VA 4HFMA 3BCRA 2R8RA 4WLVA 2B61A 4C4SA 3IBCA 3ADOA 3NATA 1ARZA 1IMOA 4YX9A 1ATIA 3HYTA 1YZTA 1TZMA 3ZWBA 2VA8A 4QASA 1AGRA 4MRMB 4MEJA 1DUVG 3GAZA 2Q3JA 3GEDA 1EVZA 1XTBA 3HEMA 3DL0A 4FFSA 2CMKA 1OVGA 2DH5A 4NXMB 1Q17A 4B73A 3UYKA 4PZAA 4JWTA 5KC9A 5JCPA 4C87A 4DIOA 2GN6A 2WC1A 4UNIA 5DF1A 3VKGA 4EAQA 3IQXA 1IZ0A 3O8OB 3E3LA 3PDWA 4CR6A 4MUNA 2EOAA 1QOPB 1PE0A 2Z2ZA 4BO8A 1UZAA 3BGIA 3PL1A 4RQUA 4JROA 3R8FA 3FVVA 1SELA 4ESEA 1L8QA 2QD4A 2BEVB 3IAHA 4CM8B 4BVLA 4MI1A 3FETA 4X1OA 5AKXA 5FUYA 1JBEA 2JDIA 1EA7A 3L8GA 2J5KA 4IFTA 2H3HA 4N76A 4GOND 1YJ5A 2IYPA 3D6AA 4JBNA 5EJGA 3MWLA 4UEOA 1HLDA 4Q24A 3M1YA 1M1YE 2ZZMA 4GLOA 4YC7A 4D6YA 4ZJUA 1X7YA 3AF3A 4LXUA 4FI3C 5FA8A 5JC1A 4F4DA 2J6CA 3GEPA 1NC1A 2TMGA 1NVKA 4UUMA 1DJPA 4DMMA 3FSGA 2H5LA 1K98A 4EFMA 3K71B 5BSEA 4GZ3A 5AVSA 1X9HA 4FW8A 1FX0A 1ZXXA 3GF4A 2BCGY 1RI4A 2V7GA 3MWJA 2VZLA 4TYWA 1XU4A 1Y5RA 1FSSA 2IPLA 4FDTA 4LVCA 2PNJA 3T1QA 3VGJA 1IK4A 3A2NA 4F91B 3GVHA 3HU3A 4EO9A 4IUYA 4S0ZA 4KX5A 1P7CA 3UWKA 1OAOA 4FW9A 1VQ1A 4XD2A 1DB3A 3C39A 3DPIA 4DXHA 1CVIA 4CU2A 2O7SA 5HZKA 3FPSA 4GU5A 4C4PA 1QQ7A 1UBRS 2CXUA 2FWAA 3EH2A 3VJMA 1CKEA 3S81A 3GVCA 3K32A 1AZSC 2FW0A 4PG7A 3PJRA 3LJKA 2HIMA 3UHJA 2O50A 1F20A 5ALTA 2YIVX 3ZHQA 1XEXB 4G84A 5HRCA 2YFYA 1Y1SA 1KI7A 3ID6C 3G8AA 3WYEA 1JG7A 5C51B 4NESA 2Z8ZA 4PF1A 4CMEA 2WT9A 2V7TA 3AR5A 4HAOA 5JDIC 4CR8A 1V25A 1P45A 4K5QA 2ETXA 2VSYA 3FHLA 2A14A 3QI2A 4R9RA 4CTMA 2Q50A 2EJBA 1XCGB 3FYUB 5HKLA 4BTEA 1G3QA 2DLDA 1A2OA 2R1VB 3UAYA 1GJRA 2ZBVA 3PEWA 3FBWA 4I4LA 3UV6A 3L79A 2HQBA 2Y99A 1DAHA 3M6AA 1JSXA 4X8LA 2VQ3A 1XK7A 4N6NA 3QE0A 4MGYR 1A76A 3EOAI 5CXSA 4GFDA 1BHJA 4H4EA 3FCCA 4KPUA 5JD4A 2Y1WA 1SBZA 1FP4B 3I45A 3EEQA 4JR1A 3GJ6A 3ZCXA 4B3CA 2G77B 1WXGA 4FSHA 1X80B 1T8UA 2TECE 3IUPA 4AP5A 1L4KA 1OLSA 2NQ2C 1L3IA 3LC7O 4C7OA 1X6VA 3RUPA 4B9AA 1JZTA 3IJRA 1RWOA 2ZM5A 1IN1A 1KK0A 4G3XA 3KYDB 1KDYA 3RWMB 1YHYA 3CW9A 2IOFA 3Q88A 4IZ6A 4HY3A 4TTRA 2OZPA 3GFPA 4BNDA 4CLDA 1QOZA 5LPNA 3PDCA 3ASZA 4YMIA 3UJCA 4PPNA 3AVVA 3W4IA 3UK7A 3W4JA 3N5CA 5DB4A 1I51A 4RY0A 1V9LA 2Z9BA 3OD1A 3AJAA 3RR2A 1X8JA 2AEJA 2QMEA 3JVVA 1FFWA 4PYOA 4HSEA 3E8SA 3NGMA 4P81A 5I9SA 1J0BA 1U8EA 1NHGA 1CQJB 1H6DA 3K1AB 4HDKB 3DUFA 4M83A 5EJ2A 3WO0A 3WLSA 2IIVA 5IH7A 3FTFA 1WMSA 2C8LA 3FPAA 1AK2A 4U7FA 1M0SA 1ZUNB 3QX8A 4G5OA 4JIMA 4G65A 3FMFA 1T0UA 2BBOA 2WF6A 3CRQA 3PQ2A 4WMLA 4ID9A 1WV1A 2VAWA 3FVQA 3A58B 5LZ2A 4G4GA 3CO0S 5PGMA 1CY6A 2IEDA 3HFJA 2F1IA 4IM7A 2P9GA 4M0LA 2NP6A 2GBPA 1E3WA 1XTPA 3BD8A 3W1VA 3T3NA 4ZVOA 1ETUA 1QLHA 2DKOA 1I14A 2GBFA 3L1UA 5B53A 1RI3A 3H2SA 4Z6KA 5K4AA 2J0UA 1KBQA 3LHFA 1J2TA 4RH1A 2QAGB 1L3CA 4D9GA 2QRQA 1NBAA 2QOEA 4BV3A 4GLFA 2QW8A 3WTCA 2WTMA 5KTPA 1AHPA 3J7AC 1RYDA 1ZN9A 1LJLA 1LSOA 1V2HE 1E6EA 2VYND 4U9UA 5ARCA 1FS6A 4PLHA 3A3KA 3WP0A 4DV3B 5E7MA 3WRYA 2V0NA 4FHZA 1Q83A 2ODAA 1GL6A 5HK9A 3MCUA 2QQGA 3ABSB 3R9XB 3DNPA 3A05A 1E0JA 1NPDA 4JLSA 3KSBC 4MMZB 2HSZA 1EQUA 1RLIA 3BL6A 3KU1A 4UC0A 3VNQA 3C2QA 1SCQA 1LWOA 1JH9A 3T54A 3TI9A 4DDKA 3EHDA 5JSUA 5A4FS 4R6WA 4E88A 1M2EA 1XU7A 4KPGA 5DNVA 1ORIA 2B4RO 2JI4A 2ODTX 2X1MA 1T1IA 2A1IA 2FWRA 3H1AA 2VBCA 3DMNA 2HQOA 3OP1A 2NV6A 2H4XA 5LIRA 1P0IA 5A5VA 4J0JA 1VG9B 4KOEC 3U19A 1AF4A 1BEUB 2B4KA 3PNQA 4UKDA 4OK3A 2Y71A 1X87A 1NT2A 3HB5X 1RCUA 1T5LA 1VSVA 2JGJA 2RBEA 5E0OA 4D4MA 1DQRA 1MVOA 4PNPA 3FCSB 1RIIA 3C0KA 3IB6A 3DL4A 3MIZA 2BT4A 3EYAA 4RETA 1NIJA 1ISFA 1VCIA 2FDRA 4PSDA 4WQMA 2C5LA 5IDVA 1L7OA 5GWXA 3B20A 4E11A 1GGMA 1FFSA 1SH7A 1TJ3A 1XSEA 2JGNA 2OCGA 3PGXA 3V7WA 5J2UF 2MSDB 2O9JA 4HWOA 1ZVVA 4L0MA 4TPKA 4XLZA 3G6KA 1CNEA 1XAGA 3L8HA 4BZXA 2BBTA 3WHPA 2OT3B 1SBHA 3ETHA 5JNLA 4NJMA 1W4LA 2VJCA 2BDTA 1PTJA 5CX1A 3VR4A 4N18A 3I4LA 4LHZA 1WTCA 3JQAA 3QNUA 3MEQA 1LTHR 2WICA 1LI5A 5TV2A 2H1WA 3KOUA 2ERYA 3R24A 1Y82A 2PSFA 5EGSA 2O5CA 1N2SA 3PIDA 4YH1A 5JY6A 2XKKA 3CE6A 1XRSB 3SEZA 3O4JA 1DKQA 2YW2A 3AR7A 1DTEA 2O8NA 3WYNA 1ZHFA 5K8CA 3L0DA 1A27A 1Z74A 3N0RA 3QP9A 4F71A 3AFNA 3IT1A 4K03A 1M2OA 3D0OA 1L9KA 1GFWA 2VP4A 2XMPA 2QZJA 4NJEB 5JS2A 5F9FA 1BJKA 3CR3C 1E2DA 1VSBA 4NZ9A 1PNOA 3LT4A 4QYWA 3UUEA 2GPWA 1AB5A 2UYGA 3V1KA 1NGSA 3EZLA 3KHUA 1SHJA 4A8JB 2IZOA 3FBTA 3QKTA 2ZITA 4IRXA 5CCDA 5GV7A 2ZWVA 1KTIA 1R16A 4N9QA 2PV0A 1L7QA 4B3JA 1R6BX 2PO7A 4RMJA 4B34A 1EUZA 5H0IA 2DFDA 4TKUA 3AHFA 1M73E 1W36C 3Q3CA 4UE3S 3WKEA 4DPKA 3OEHD 3BUSA 1X9GA 3Q6IA 2QTMA 3T12A 1JFLA 4PSAA 3SR4A 3G2KA 3Q1LA 2Z83A 3WIDA 3LOQA 4O2AF 5EXPA 4QJ4A 3FPKA 4YRPA 2VYQA 1JB9A 4K9NA 3RANA 4OJTA 5I8WA 3F8WA 1FTGA 1K7CA 1ORHA 2J5BA 4MB2A 4AX4A 1GIAA 3MQFA 4WGGA 1V11A 1PG0A 2R8OA 2GMWA 3DAPA 3ROKA 4JYPA 3UA3A 3PRHA 3HCBA 3SSNA 2CXHA 3T41A 3WK4A 3RSQA 2ERCA 1KZHA 4MRRA 4W1QA 2PBFA 4AIRA 1YZVA 4H3SA 4N7RA 5CDGA 3K9NA 4D9MA 4JI0B 3H0EA 1U31A 4JB2A 4JUAA 1GUYA 2IIPA 4GUAA 4IICA 4EG8A 2QL5A 1YJCA 3PFCA 2CL5A 4JXZA 3HK2A 1NUUA 4N01A 4UUPA 5FV7A 1U3CA 2FUEA 1SM4A 2WHQA 3G5MA 3VR3A 1RBMA 4P5EA 2IWRA 5G41A 1CC1S 1BIFA 1SA0B 5EHIA 3EFOA 3QE2A 3L8CA 4EZBA 3DO6A 2CLIB 2IX9A 1LPSA 1VMIA 3IUBA 4YUZA 4OA8A 1KVQA 1QK5A 5IFKA 2A7QA 4AF7A 1H65A 1V7ZA 3UQZA 3AONB 2PZFA 4WN9B 4ZALA 4IDOA 3SDZA 1JV2B 4AZ3B 1QU3A 2HPAA 4M53A 3VJRA 3ZWXA 1E6CA 4A6DA 1AQNA 3WV5A 2P41A 4BQPA 3IQIX 4MVJF 2Y92A 3EMKA 5IUJC 1UL1X 1TFRA 2YWDA 3L7MA 3LBHA 5DTJA 1X94A 4GP7A 1G5QA 5JO9A 3R1IA 5HGJA 3GP8A 4W5JA 2JFGA 2ZBFA 3K9HA 2IY8A 4L74A 2O6LA 4ZZIA 2H00A 1MVLA 4HYEA 1EDDA 2HBZA 1WTAA 3NHBA 1DCTA 5ALLA 1E1KA 1NVGA 3GCGA 1DJMA 1VPTA 5CBPB 1ESMA 2KS6A 2QN1A 3AQIA 4B6SA 2WUEA 1DQZA 2AR0A 2G0AA 1N1EA 1DAPA 2BEUB 2UYCA 1BFKA 3PGLA 4MDEA 1UDCA 1SVWA 2QQ0A 4YJ2B 4X6YA 1YJXA 4AMZA 4A0FA 4BFTA 4ZMSA 3EIWA 2Z6UA 3VDRA 1EXMA 2Q3CA 4MQFA 4CHGA 5JBQA 1JHVA 2BRUA 4YDSA 1RTTA 4WV3A 1NRJB 4DCJA 4ECAA 4ZRDA 1BW9A 3ABRB 4HDMB 3RUAA 3NHWA 4AT1A 4ZIRA 5LMCA 1M34A 2ODEA 4JITA 3WB2A 4COKA 4W5TA 1N2GA 1KO1A 5CVUA 4MB0A 1DV2A 2ADMA 3JQQA 2XKJE 3U3JA 4YJHB 2X2OA 3RJTA 1PWHA 4O5OA 4UW9A 1BHQ1 1WQ1R 2IHTA 1K5DA 4WCFA 1F0NA 3ZZTA 1IQ0A 1XMIA 3K72B 1O6BA 4I1YA 4KBYA 5AKIA 4DRYA 2J1LA 1W47A 3HSSA 4PPQA 3GROA 3V3KA 3SLGA 4UPVA 3FDFA 1P73A 1ZVMA 2G36A 1AA9A 2J85A 1DG3A 1U0HC 1U2ZA 2Z5VA 4IXNA 2RGNC 3HRHA 2KJQA 1BROA 3E58A 5E9QA 4XM2A 5LBIA 1DXHA 2OV2A 4GKAA 4INOA 4OL9A 4R98A 3RS8A 3W3AH 1RLOA 2W2QA 3KR0A 4AMBA 4XPIB 4JQSA 5BSRA 2C0QA 1C0IA 4XD7D 3SOZA 2ZZNA 1GL3A 4EHBA 4L95C 5F3DA 1G20A 5E0KB 4X1YA 4CM1A 3NX4A 3RBZA 4ARVA 2IOHA 2QAJA 5EP3A 5K7SA 1PR9A 1V3QE 1V4VA 3U4MA 2QM8A 3ZW7A 5IC6A 3T3IA 5TGZA 4JBHA 5KINB 2NV0A 4GI2A 3B7PA 4HEJA 4JBLA 4EFKA 3KKPA 1FB5A 2VSFA 3RUCA 3RUDA 1Z75A 4DUGD 4KUGA 3S3TA 1YMQA 2WF5A 1GXSA 5TQ2B 3U4IA 1VZ3A 1XP8A 1FVOA 3CCFA 2ZB3A 1R9GA 3LECA 3HM2A 3I58A 4OTZA 2YYAA 1BGXT 5KC8A 1XRLA 4G5RA 1ZUWA 4GKJB 2HW8A 3WKCA 2QF7A 1KPGA 1GNSA 3BWCA 2C5EA 2ZUTA 5A3RA 3IAS6 4TKMA 1ZD5A 1X70A 2WD7B 5C18A 1X1CA 2JAXA 2OMEA 5MFPA 1M33A 1RJDA 3ZYZA 4U02A 2Q5CA 2Q9BA 1GSIA 4PINA 5DSXA 3DL7A 4BCBA 3LT0A 1W44A 3OLWA 1XMOB 1FFBA 3DMDA 1RWPA 1RKVA 4HMOA 3MF4A 4EITA 2XT6A 4GI5A 3HDYA 5AKKA 3RWOA 1SUPA 3TD6A 3ZZNA 4CT0A 4P8RA 1W0JD 1U5BA 4P7FA 5C32A 1Q1QA 1Z2CA 3TTSA 2X4IA 2FLKA 3FLAA 5AKGA 3ZCTA 4ZU1X 4D45A 2JD1A 3ZGLA 1IJEA 1KAQA 2LIPA 4ACBA 4DLVA 2JLAA 3IAEA 1K75A 3DD5A 4MWSA 1P61B 3FR8A 1D0SA 4RPCA 4DVGA 2XAAA 3JQGA 4S0XA 3QFFA 2XUAA 1D7AA 4IAOA 2TMKA 2PZJA 5ED0A 5F2NA 1FYFA 4GLLA 1QG4A 2YJ3A 1AKUA 4IKOA 5G1OA 1T5OA 2GHTA 2BE9A 1R0CA 1U3GA 1G5TA 1Y8QB 1SXIA 1A7KA 3GJZA 5I7VA 3B3AA 3EXHB 3H2KA 2QLLA 4YFYA 2BM9A 3HCWA 3B1YA 1MQ8B 3DNFA 2VYFA 3O03A 1BXRA 4LYGA 3QV2A 3Q3GE 4MJ7A 4DSZA 3AP3A 1MNAA 2QW1A 3HP1A 3LDFA 1V5EA 3OLZA 2ID4A 2H4ZA 1FRFS 4ICIA 2ZBUA 4AN0A 2ENWA 2GM3A 3C3CA 4BAGA 4H0FA 1LBQA 2B78A 1UEIA 3WBBA 4GR4A 3HB7A 5I9IA 4R2WA 4FJ2A 4G23A 5T6MA 1NJ5A 2ZSEA 5LXTA 3JSAA 4Y2VA 4BZPA 4KQ6A 3IQFA 4YCJA 3G2IA 4C06A 1IBMB 4INZA 4KIUA 4ENSA 1E5QA 1O4VA 2OCLA 1A1SA 1A2BA 2W93A 3HXKA 1ZNZA 3Q2OA 2VNAA 5HFJA 2O3UA 2I54A 3V46A 4E1AA 3WLQA 4DIEA 4E30A 3X1YA 2Y0EA 4QJBA 4FD2A 1XVUA 5EIBC 2GGSA 4RULA 5ALEA 5K03A 2JCXA 4U2DA 3B5IA 4XB6B 1UXOA 1QR6A 3Q7RA 5HHTA 2RKBA 5HFNA 1K6XA 2CNDA 3O82A 1EFCA 3GVPA 4RANA 5AKEA 5AVJA 3JX9A 5LA6B 3TR0A 1Q3TA 2ZI6A 1BA2A 1S3GA 5AXBA 4RD2A 4R71A 1Z22A 3HCRA 3MNFA 1PVDA 2QXUA 1F2TA 1E89A 4R8SA 1ZRSA 3CY6A 4F9FA 3BRCA 3LRPA 5A3QA 2GESA 3EVNA 3LXRA 4KQIA 8ATCA 2GF9A 4I1UA 2GERA 2VPTA 2PFGA 3PK0A 1JDZA 1X19A 3C5CA 2LE0A 2Z1MA 1ZOSA 3HN6A 2Z3VA 4KCGA 1LI7A 4J91A 5HCIA 1Y33E 1Y4UA 3FNGA 4DHWA 1QB8A 1M0TA 1BCRB 4Y67A 5DGHA 1JIIA 2ZSKA 3F7TA 5FA6A 1V1RA 4Y98A 5EMLA 3HM9A 3SU8A 5TB5A 1I4DD 4Q03A 5TGDA 3V8NA 4JS0A 1UMCA 2P9FA 1QH1B 1SKBA 2R7KA 1JDBC 3N53A 1LV8A 1OYVA 3HR4A 5CFZA 4A8PA 2E4AA 5FJJA 2EF1A 1MC8A 4BGVA 3I05A 3NNSA 3JYLA 3L41A 2GJKA 3GMIA 1YI1A 4OXRA 1DO2A 3DQZA 3C5WP 1PL8A 1PIWA 4EO7A 1MQ9A 5C1OA 5B3JA 4BVEA 1ONSA 1XC7A 1Z6XA 3RYFB 4V0SA 4EGCB 3QLEA 1USGA 5KNBA 2B8WA 3KB1A 4JN6B 3RIXA 3RSHA 4QREA 1URPA 2C9ZA 4EG0A 2INGX 3D6VA 4CQLB 5J58A 1JQBA 3EB9A 1HE3A 2J45A 3RYCB 3AF5A 4S1PA 4UCXA 5SYAA 2G4VA 3W5IA 1ZI8A 1XQ1A 4P6VF 1ZIYA 1EX6A 1MW9X 3OEYA 3V9PA 3IEKA 3OZTA 5F23A 5EJ5A 1E66A 1X7XB 3AIOA 4OUKX 1D03A 3MLBA 3OPXA 4GZ5A 4QLBA 4YRAA 3GLHE 1VB5A 1HDZA 1TA9A 3OZIA 2XXAB 4TWIA 5BR8B 2Q6TA 4BFVA 3D3NA 3FIUA 4FFBA 2R1TA 3C87A 4HH1A 1WXEA 1YDFA 1XZAA 4OV6B 2LCQA 3KCQA 2OV6A 1G2PA 4RNDB 2J9ZB 1D5WA 3A1NA 1RMQA 4B4KA 1M6HA 1ZGZA 4FYMA 2PZEA 4NK4A 1P0FA 4FU0A 4NBLA 4R3WA 5K51A 4EX6A 4EVRA 3BJEA 4BUZA 3B6ZA 3SSOA 1L4UA 2GKSA 3UT0A 4LCEA 3KTDA 1HL3A 1XXLA 4NCXA 4MVJD 3SXUB 2QWXA 1DADA 2M6KA 1CBUA 3F96A 4FX2A 4KBGA 4X20A 1H1TA 3O74A 2JJ2D 4D8VA 1XG5A 1SHUX 2ICAA 4JQCA 5AM0A 1G8PA 3DYVA 2HMWA 3T5TA 2OXFA 3GUCA 1GPJA 3TZLA 2XMQA 1FJXA 4ZXFA 5IDYA 4CM4B 2XUFA 3DW1X 2RFLA 1YHNA 4JI6B 1GVHA 3OQBA 4Y2HA 3CEAA 1LDMA 3P2YA 2VH1A 4M88A 1ZD3A 4F9GA 2X9QA 5J3JA 3FF4A 5FTKA 1ESNA 1UFOA 4V38A 2V3VA 3HWX1 4UHJA 3FPBA 4INJA 3SEFA 4D56A 4K6HA 1DEAA 4J76A 4IWXA 4AS3A 1NDHA 2YCLA 4EW2A 2P9EA 3BJIC 1I3MA 1A7JA 4URUR 4H35A 2FWMX 2FMIA 2VWHA 2IYRA 2O3RA 4TKVA 2BFDB 8OHMA 1L4MA 1YS4A 3ZKAA 2W6IA 3G2QA 4XGRA 4AKIA 4K6KA 1XZMA 3CWCA 3NONA 1MT0A 3DTNA 5DX8A 4C5BA 1CR4A 2IYZA 3ZJTA 1ORRA 2ATCA 2AG6A 2AI2A 1ZKMA 5EYPA 4F06A 1YR2A 3QOXA 2F1JA 4AN4A 5DEOA 3I5MA 4EP1A 1UAAA 4TXHA 1R74A 5CPFA 1TMKA 3AM4A 3W05A 2CT8A 4B7AA 1ZD4A 2RHLA 4JJIA 2O2JA 2RB5A 1ULSA 2GCOA 3KJGA 3O47A 4LE2A 4Z8XA 5K3SA 1UC5B 1WKBA 3U1VA 1KF0A 1W73A 1Z4IA 2WM8A 2C00A 5E38A 4DXDA 2JFFA 2NSLA 3ITDA 2JVIA 2EW1A 3E23A 1DRJA 2P4SA 1W49A 4NE9A 4TSRA 1OWPA 3R9KA 1K6IA 4WD3A 5JCJD 4DDTA 1OZGA 1T13A 5DN6D 1KO5A 1KEZA 5FO1A 5MN6A 4XA8A 4I50A 1A8QA 5CA0F 5B2FA 1QFZA 5DI9A 3OVMA 2O0JA 3F1KA 2YYSA 4M38A 4Z0PA 1MG5A 3ZWWA 1U6KA 3DFFA 2C2MA 2AWNA 2I1VB 3ETEA 4D98A 1Z35A 1U81A 5DLYA 1KAEA 2X8JA 4EHAA 1E62A 1RWKA 5TDHA 4EABA 1RPTA 2B0CA 3T3EA 4B3DA 3M6FA 5AXCA 2XV1A 4NSNA 4B1FA 1VIVA 4DC0A 4C20A 4CMBA 5B3AA 2IPMA 3WQQA 2XDYA 3LRXA 1MKYA 2HA7A 2Q1TA 5CM2Z 1DEOA 3UJNA 1RYFA 1ULBA 2QW0X 2RK4A 3ZNPA 1Z4MA 5GY7A 3L0CA 1KOFA 4KW7A 4KV9A 5IN5A 2WIFA 4Z49A 2B2NA 1T34A 1FMTA 5JJLA 2XX3A 4AKEA 2XXJA 2W6JA 3JD1A 1EIWA 2RAVA 5IKPA 2ZRPA 5DNCA 2GZSA 3JYNA 4IIUA 5DMHA 2UV8A 3T3GA 1RXSA 2EWMA 2QLTA 2V8BA 4B48A 3PXAA 1SHLA 4O8CA 2BM0A 4NKRA 1Y8RA 4XWGA 4ZD6A 2BEWA 1E1RD 2Z4RA 2A9VA 1XZBA 5C8VA 4XTRA 3KJIA 2FZVA 2WIAA 2AUMA 1PN3A 3AVOA 4RD1A 2ANCA 3BFJA 2AOWA 5DW3A 4Q05A 2BUCA 1NLUA 1JFTA 2RHHA 4IIJF 1Z0JA 4IZOA 4NMLA 2VTDA 4CLOB 1OQAA 1F38A 2P3LA 2O2SA 5DJ5A 1FNNA 1S2DA 3LPCA 3P4XA 5JD3A 5KMGB 4MP6A 2OCKA 5AFSA 3PFGA 4ZICA 4Q21A 5C5IA 3TWOA 4BE9A 1SRRA 3CHYA 2F4NA 1K68A 2PKQO 5TS3A 4C29A 5BUQA 1C9YA 1NJ2A 2A33A 2QUKA 1THTA 4TWJA 4KITB 2X0NA 2BFOA 2MWMA 1GPKA 4E0BA 2OBYA 1NNUA 2GA8A 4NX2A 2RGXA 4ENRA 1RI5A 4G1FA 4F4UA 5GTDA 5DI3B 3KKMA 4Q3CA 1IN5A 4II7A 2ZUCA 5AVVA 3KOXA 4J0IA 4NBWA 4DQVA 5BV8A 2YKGA 4F4HA 3LUGA 1NJSA 4AJHA 4I6EA 3VNSA 3C5EA 3ET4A 2WNIA 1LVUA 2HB6A 1ODKA 2ZGVA 3VHQA 2A35A 1LTKA 1HV8A 2AX3A 1EINA 1QVWA 4UVHA 5IEJA 5L51A 1IH8A 4JEMA 4HNUA 1L7NA 2DRIA 5C31A 3FVTA 4BWYA 1P31A 3UKJA 5IASA 1PKXA 1DT3A 1KO4A 3KTAA 2OZVA 5JVDA 1IG0A 2VNKA 2EGGA 2YHIA 1KH3A 1WKCA 3LIIA 1M75A 4CLRA 3EG9A 3B6KA 3CF4G 5H1YA 1LNZA 4B3SB 2MINA 3D8UA 2YNMA 4L85A 4YA6A 1QH0A 3H13A 1LLQA 4LC1A 4Q1AA 1K6MA 4NFHA 4IWYA 2H7CA 2R3SA 1OAAA 1HYEA 4QE3A 2QLBA 2J4DA 3N74A 1SCJA 4RF5A 4Z54A 3RG8A 4QTZA 1E3JA 4N65A 3ADPA 3LX8A 2BJWA 1XAIA 1XTUA 5IJ0B 2QSYA 4R1SA 5TPZA 4HFNA 2AXNA 1YNOA 2WR8A 1G21B 5AI6A 3VGPA 3W2FA 2EFEB 5I4CA 2ZW9A 3AY7A 2BLNA 1U1EA 2GM4A 3FPLA 1RU3A 2IJGX 2FSIA 5JNVA 1HKHA 2I7CA 5G0WA 3WIEA 3GBSA 1N77A 4WOCA 1EUDB 3QEKA 3FFXA 1P75A 1CQWA 2HF7A 5JXIA 3JWEA 4RVUA 2D7CA 5DULA 3PXXA 1AKVA 2ZTHA 4TSKA 4RVOA 2M98A 2VPXA 4BB6A 4BQNA 4BXOA 1WAMA 4IXTA 1XF1A 1X1RA 4Q34A 4Y2PA 3AO0B 3N28A 3SBXA 1QAMA 1T5BA 5EXXA 3J7TA 1YO6A 1UBCA 3ZEAA 4DWWA 1VXOA 3UGKA 2Z56A 4DY4A 1TF7A 1U65A 1VJGA 3BIFA 3N8DA 1XTZA 4IJVA 1H2RS 1VC2A 5COQA 3ENQA 4LZJA 3I9OA 3AHHA 1Q2UA 4WK4B 4FLEA 3CCBA 4D44A 3KG2A 4OYHA 3EMDA 5JISA 4UU1A 1TYCA 3NHRA 4MPRA 3NGLA 1E7YA 3I2GA 3HB9A 1NKVA 3P32A 3T94A 5LLTA 1SXPA 4M1EA 3HP7A 3CUYA 1Z36A 3COSA 2XUQA 2VCEA 4R69A 1M76A 3CX6A 2ECOA 3FOCA 2V6BA 2J3LA 3D3QA 3Q7TA 4B4DA 3JVDA 4DQDA 1PQUA 3TW6A 3DTVB 4LZAA 2HRZA 3VC2A 3JQFC 1GYPA 4EB6B 1A5SB 3LCUA 4BN4A 1TUIA 3DMTC 3U39A 4LDRA 1YA6A 2P2ZA 4BMDA 3ASVA 5SV2A 3OBIA 5C5DA 1UFKA 1BRMA 2QRMA 2F90A 1JFFA 3M0EA 2POQX 5BO5A 1B42A 5F7OA 3TO5A 3ZHVA 2QYTA 3EVAA 2DUMA 4G6ZA 3KQLA 1CR2A 3DPSA 1MR3F 2BFAA 2ZYTX 2NZ2A 3GMTA 1IDOA 1W5TA 2O0HA 3U13A 2B2XA 2W6MA 1RJWA 2F9LA 1DIAA 1QGZA 1YAHA 2HF9A 3KAKA 5BN1A 3FBGA 5E8RA 2ZDHA 5JCXA 1WA5A 1NMSA 4G0QA 5A7HA 1KMQA 1W4BA 1YIOA 3JZIA 2DR2A 2X5XA 5C52B 1H4SA 2ALJA 3A1TA 5B37A 2XTZA 1QYRA 1Z2DA 5FRDA 3WGVA 1CEXA 3PF8A 2XUOA 4CDGA 4DDWA 2ZRGA 4DABA 1MRZA 3V5NA 1NY6A 4A1OA 2FWNA 2GQ0A 3EOBI 2F8LA 1E3DA 3DKVA 4MXDA 4TXMA 2C7OA 5KTKA 1B26A 1JB1A 2FW8A 1S3FA 3BHJA 4NBTA 3FHTA 1C3JA 4JJ4A 1VG8A 1Z6GA 4EB0A 3W9SA 5DBIA 2ZQ5A 3IERA 3C7KA 2QTAA 1R3DA 3GPIA 2G07A 1EM8B 3MCWA 2ISCA 1PFGA 1HFWA 5LYJA 1Y9DA 4C3UA 3TM5A 1IXZA 3R3HA 4XFJA 4TRNA 2C1EA 1CPYA 1JIQA 2YN4A 2I7DA 1B23P 1DWQA 3MCTA 1C14A 2O8BA 2WKWA 3AETA 2DZDA 1WXHA 1XNJA 3O1HB 2R96A 4MDFA 3NVAA 1RKQA 2BGKA 3A3OA 5DLDA 2Z9DA 3BMCA 3DEIA 4MDHA 4RV9A 3KLOA 1ZZGA 4OHRA 3WZMA 1UWKA 3VKVA 2TYSB 1OJLA 3EAFA 3K0AB 3QWBA 4I08A 3DSRA 3QPCA 3DBVO 4BE7B 1V3UA 2QROA 5BPHA 2R8XA 3G0IA 4KFSA 2P9TA 1YVDA 1YQGA 4FCVA 4QFBA 4DA9A 2DHQA 5T7BA 1D6JA 1HDRA 4WZZA 2PMKA 2AMVA 2HRCA 1FYXA 4XW2A 1FTNA 4B3XA 4ZZ0A 2PUCA 2QTCA 1WKVA 2OWDA 3MUNA 3PL5A 4LYAA 4EMTA 3SR3A 1QK3A 1K9SA 1P5FA 2GX6A 2FZGA 1H0KA 2REXB 3AR9A 1CY8A 1TM2A 2VTBA 1R10A 1U9CA 1SY7A 2C3PA 2OV1A 2DETA 4RZQA 5E7QA 3DE3X 4DEXA 1K92A 2EFCB 1HE2A 3H42B 2CKDA 1O57A 5K01A 4WL0A 1YULA 1RPZA 4GI3A 2NACA 3ZWPA 4QHYA 2O8DA 2OG2A 2X8LA 1UIRA 2WTBA 4V0RA 3AI2A 2MSNA 2ZAIA 2JFWA 3L0SA 3PNYA 4LE0A 4KXFB 4PLTA 2O57A 4IV0A 4Z7OB 1OHHD 1QYWA 2PH1A 1DKPA 3PQFA 2QDXA 3WYGA 2J9XB 4GOKA 4CKWB 4H6PA 4Y2TA 2TSYB 1U90A 4R1LA 1EXWA 1IJBA 2A8YA 2OR3A 1ST2A 4MGIR 4UMEA 4CI9A 4UVGA 4RPLA 2AYYA 2GLUA 4UBOA 5IJXA 4BC0A 4JENA 2V6MA 1GPDG 1PZXA 4PNHA 4O4IB 2YY6A 3CPHA 1VG0B 2QTBA 3G8BA 1OC2A 3QVUA 3EDMA 3KWLA 4PFSA 3HR7A 4Q4JB 4UFNA