1SUAA

Subtilisin bpn'
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
263
structure length
263
Chain Sequence
b'VPYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLNVAGGASFVPSETNPFQDNNSHGTHVAGTVLAVAPSASLYAVKVLGADGSGQYSWIINGIEWAIANNMDVINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGTSGSSSTVGYPGKYPSVIAVGAVDSSNQRASFSSVGPELDVMAPGVSIVSTLPGNKYGAKSGTAMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGDSFYYGKGLINVEAAAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUBTILISIN BPN'
molecule tags Complex (hydrolase/peptide)
source organism Bacillus amyloliquefaciens
publication title Crystal structure of calcium-independent subtilisin BPN' with restored thermal stability folded without the prodomain.
pubmed doi rcsb
total genus 92
structure length 263
sequence length 263
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 1997-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1suaA00
1V5IA 1VSBA 3DE3X 4C3VA 3CO0S 1YU6A 1S2NA 2TECE 5JXIA 2XRMA 1SN7A 2ZWPA 4CFYA 4YN3A 1T1GA 1GA1A 5FFNA 3T41A 3VYVA 1SIBE 2Z2ZA 1BFUA 2QTWB 1Y4AE 2DP4E 3SICE 3I37X 4NE9A 5ARCA 2Z57A 1Y3BE 1UBNA 4AKTA 1XF1A 1Y3DE 1SCBA 4OMDA 1ZVKA 1GCIA 1SIOA 1WMFA 3DE7X 1AVTA 1PJ8A 1TM3E 4WOCA 5FAXA 2IXTA 1SCJA 1GT91 3D9QX 1SBNE 3LPCA 1CNMA 4H6WA 1YJBA 2W2NA 2HD4A 1SUDA 3I30X 3LXUX 4MZDA 1YJCA 1R64A 1SUBA 1AK9A 5B1DA 5SICE 4LVOA 1C9MA 3VV3A 1SH7A 1BE6A 3I34X 1KDZA 1A2QA 2SNIE 1TO2E 4CG0A 3LPDA 1GA4A 1R6VA 1Y48E 3DE4X 3DWEX 3TECE 5AVJA 1Y3CE 1SVNA 1Y33E 1SUEA 3F7MA 4OV6B 3VTAA 2Z2YA 1DBIA 2V8BA 3UNXA 1PFGA 3LPAA 3WQBA 1SCNE 1Q5PA 3H42B 3GT3A 5CW1A 3EIFA 1GTL1 1T1IA 1TM7E 2ZWOA 3I2YX 2PQ2A 4B5LA 1AV7A 3D43A 3DW3X 2GKOA 4LVNA 1C3LA 1MPTA 2PKCA 3TI9A 4C3UA 1AU9A 2WWTA 1NLUA 4CFZA 5JXGA 3ZXYA 4ZOQI 1SUAA 1TK2A 1WVMA 2PMWB 2ZRQA 3A3PA 3L1KA 3AJ9A 3QFHA 3AFGA 4DJ5X 4HVLA 5JXHA 1GTJ1 3GCXA 4KPGA 5AMXA 1SBCA 4NMXB 1GNSA 2X8JA 4AKSA 5B1EA 1P7VA 3A3OA 1P7WA 1SUCA 3QTLA 5I9SA 1C9NA 3VHQA 1BE8A 1GNVA 1IAVA 1TM5E 1THMA 4H6XA 4BWGA 1SBTA 1R0RE 1ST2A 2SECE 2G4VA 1BJRE 1SCAA 2WV7A 1ST3A 2Z56A 1Y4DE 3Q5GA 5FBZA 4WOBA 3DE5X 3CNQS 1NDQA 2IY9A 2SICE 1SELA 2DUJA 2W2QA 4DZTA 4K8RB 1SBHA 1T1EA 1Y3FE 3EDYA 4J94A 2ID4A 1TMGE 5JMOA 5K7SA 1TM4E 4RYDA 4DWWA 2W2PA 1PTKA 5ARBA 1Y9ZA 4ZARA 4Z2AA 1NDUA 5AQEA 1LW6E 1HT3A 2W2MA 1Y34E 2P4EA 2B6NA 3DDZX 1WMDA 3DVSX 3DVQX 1AF4A 4JP8A 1SPBS 2PYZA 1AH2A 4KG7A 3WIVA 1C9JA 3WIUA 3DW1X 2WUWE 2DQKA 4FONA 1GTG1 1SCDA 1S02A 2SBTA 2WUVA 1BFKA 1KDYA 3BPSA 3HJRA 2X8JB 1IC6A 3Q40A 2Z2XA 1P8JA 1OYOA 1CSEE 3EE6A 1SBIA 1TECE 3BX1A 5AVKA 1KE1A 1WSDA 1DUIA 3PTLA 1V6CA 3VV2A 1OT5A 3AJ8A 3GT4A 2E1PA 1GA6A 3DE0X 1JEAA 2ST1A 3DE2X 3PRKE 3VSBA 1EA7A 4OMCA 1OYVA 3DE6X 4GI3A 4I0WB 2PWAA 5JXJA 1SUPA 2Z58A 2HPZA 1TM1E 1YJAA 2XTJA 3TI7A 3ZXXA 1WMEA 3BGOS 4NE7A 5ARDA 1TO1E 3P5BA 1MEEA 1SIUA 3GCWA 1KDVA 4HX2A 1KE2A 4H6VA 2Z30A 2PRKA 3DYBA 1AQNA 1ZVJA 3DVRX 3WHIA 1PEKE 1BH6A 2W2OA 3OSZA 4KB5A 3DE1X 1S01A 3F49S 3A3NA 4M1ZA 3SQOA 2ID8A 2PWBA 1Y1KE 3F7OA 3QMPA 1EGQA
chains in the Genus database with same CATH superfamily
4ARUA 4RH0A 1N6LA 3CLUD 2WWRA 2VXYA 3AF4A 1AIPA 4QEDA 5CB4A 5BQOA 2OOSA 1Y9JA 3CWCA 3DDUA 2FN7A 3WLJA 1D3AA 3DM5A 4U8HA 1CW2B 2VHYA 2VHEA 1G20A 3AUTA 5DVZA 5HVNA 1G1MA 1URPA 1DBVO 1JEJA 1RFLA 2G04A 3JQBC 3LECA 2B9VA 4EATA 3NVAA 2XSZD 1FC0A 1CF9A 3PEFA 1RLTA 2O7SA 2B99A 1UEJA 1MX3A 2PWPA 2QU8A 3AR3A 3GPIA 2QZZA 1QDLB 1U2QA 2IHTA 3BXHA 4C01A 1E20A 1Z5GA 1CK4A 3LCVB 4FFSA 3G7NA 2OLJA 5GQSA 1JU3A 3V7WA 4Q21A 3ZBUA 4EUEA 4F2HA 4FEEA 1SH7A 2C3UA 1T9HA 2QT0A 1DWOA 3BRWA 3VHXB 2C4MA 3VNUA 1Z5NA 1QAMA 1VA4A 1AV6A 3ZGVA 5KAMA 3WGMA 1E6EA 1RZUA 3I2HA 5BV8A 3NDBB 2V7UA 3BN3A 2FFHA 3L40A 3IHKA 2ANBA 4G4GA 1K7EB 2C5FA 1U0TA 4D9MA 1JWLA 3WQBA 5EZQA 2ETVA 3IJRA 2FOLA 2A9OA 3MWJA 4OPMA 1DLJA 1ZNXA 2ZJOA 2XA2A 3OEYA 1J9GA 4TVBA 3G68A 1S9DA 2XGSA 3Q3IA 4WI1A 5EJEA 2OBBA 3T7CA 2GCEA 3U17A 3MAGA 1IPHA 1UFRA 2ZDGA 4HAZA 3A1WA 3IKVA 4K46A 5IBCA 1I4LD 4GX2A 1LTKA 5D3QA 4F21A 2PMDA 1U9YA 3FLEA 4HH0A 1LZKA 4H1WA 3TVTA 1GNSA 1U4NA 4E7PA 2QIOA 4HWRA 1EHIA 1M6WA 3WIBA 2M2IA 5JSQA 2EIXA 1LDGA 3O92A 5DIFA 3L93A 5P21A 1CJSA 5FA5A 3RYIA 4CLRB 2ZP1A 1GV0A 1X77A 3RC7A 4F3RA 3EY4A 4JC5A 1Q15A 3FB4A 4DG9A 3H9EO 1GRNA 3DXYA 4PONA 3G0OA 4ZZ0A 1W6RA 2J31A 2NIPA 5BNTA 2BFDB 3FHOA 4HRYA 1B6GA 1ESNA 3CMCO 4FU0A 4NBSA 4TL6A 5CX1B 1PAUA 4BJ1A 1OXMA 2LD4A 1R50A 3C3BA 1U11A 1AF4A 3BS4A 3IAFA 3NPAA 4LYDA 1FP4B 3HC7A 4V2UA 1AH2A 2GDZA 4FHCA 2RSLA 1TD9A 3L8CA 4JUDX 3MFQA 3UQYS 5L6LB 2ZJBA 5HZHA 3PA8A 3I73A 2CK3A 1PUJA 5KQRA 4YRFA 1QOZA 4DHWA 1RRPA 3V1LA 4C2TA 1NATA 4BNVA 3RC3A 3E35A 3D8RA 3I2GA 3NT5A 4QNMA 1XBTA 1GNLA 4TOIA 2PH7A 5EXSA 5I9IA 3D3KA 4RDXA 4P3PA 4F1KA 2P9YA 3ON5A 1RXEA 4RM3A 4U02A 4CM5A 4H7PA 4XASA 3T95A 3FFTA 3TW8B 1B0AA 1L5OA 2E6KA 2F9LA 4JXZA 1GT6A 2OHFA 3DP9A 2PWBA 4TLMB 2OHHA 4UCFA 5CCXA 4RTNA 1SVOA 1R6XA 3MJSA 1YJ5A 3QFTA 1N1DA 1S2NA 2VBIA 5ADUS 3FOFC 1IVYA 1JTEA 3GZNB 5EJ2A 1SIBE 4MVJE 1XRNA 2W6ZA 3DS8A 3O8RA 4W8OA 1TKRA 4P58A 5I4CA 2EJVA 1IMJA 3QY9A 4AKTA 2DTDA 1NN5A 5DNYB 1IZZA 1SCBA 2OCBA 4UTPA 2EFJA 2Q6KA 3PQCA 1V39A 4PS1A 4MHTA 4JIGA 1ECPA 2B7BA 1BWSA 3FCUB 3ZQ6A 1WUYA 4DTIA 5JDIC 1DKOA 3T9AA 5EAIA 3LXUX 1VPEA 4BP8A 3KSDO 4I55B 4IIDA 1BHO1 2CHVA 4WFQA 5E7QA 2O3UA 3AEYA 2A0WA 1XLUA 2IP4A 3LQRA 3Q9NA 1FFXA 3QIAA 3H13A 3UBMA 3LPDA 4MWBA 3ZVNA 4EFLA 1YKFA 1RLJA 3I09A 1UPAA 4KXWA 1DBRA 1IY1A 1P7YA 3OJEA 1K5DA 2WNHA 5IP5A 1EFTA 1HRKA 1Q0UA 1KC3A 3CY6A 3PVSA 1FDVA 4AWBA 1KI9A 1Q7RA 4HDRB 3S55A 3W7AA 1HZJA 5DK4A 3TM4A 3H4VA 4TYWA 4IDAA 3EHEA 4KZKA 1NVTA 4YALA 3RVJA 4M53A 3OIYA 3QXJA 3USCS 1HR0B 1RI3A 1RVV1 1UQTA 3HB1A 4PPNA 3CIOA 2PA3A 1FTSA 4HXEB 4JP2A 5AK4A 1Z6ZA 2HNAA 2Z5FA 3K0FB 3MJRA 3P9CA 2FUG1 3GEMA 4FXPA 3I52A 2ZRFA 2O2DA 4HXGA 3UKOA 1VSTA 3LRTA 4FBMA 2QT9A 2YWHA 1KFCB 1RBYA 2X5XA 3OZEA 1FP7A 1ZCZA 2GRUA 2V5AA 4I1YA 1A97A 3ZE7A 1O94D 1T3HA 2BGTA 1QF6A 4BQQA 2P2DA 3IKLA 2ODQA 4RPHA 1K1EA 2XMBA 3NRBA 2CUNA 3OAAA 5A5DA 4Z4HA 2E85A 1FRNA 3MA0A 2YJ4A 3LY9A 3QSGA 2P4QA 5EWLB 1ZDMA 2YN0A 3KOMA 5IM4F 1XZJA 3D02A 1UKZA 1PT8A 2JAUA 1AX9A 2EP7A 2IW3A 1LFAA 2WJPA 2WUGA 3BSYA 4MKRA 4C7BA 1GR1A 3L8GA 4LJ4A 1KOFA 1Z0KA 2QVGA 2XNHA 4NZ9A 4UD6A 3INYA 1RYEA 1SXJA 2JEYA 2QUIA 2AG6A 5ED4A 5D86A 5LQAA 3TSYA 1PQYA 3D8SA 3COVA 2P5SA 4DUPA 4YR7A 3I04A 1CY2A 4HZIA 4FW8A 4CM4A 1OLXA 4HH3C 3VAAA 2I87A 3VO1A 3W2HA 3PXCX 2QRZA 4UHJA 4WNAB 4KI0A 1FJGB 2NTNA 3IGFA 3ZHUA 3P52A 5B3KA 9LDBA 5ADHA 1Z25A 5KX5A 1UOOA 2Q3BA 3JAWA 1FMFA 1PBNA 4O29A 3A26A 2PZBA 3ZXXA 4PF1A 4N7RA 1N6IA 1WEKA 1B8VA 3EIUA 4GR5A 1PKXA 3IP7A 5BWOA 4I9HA 3HUDA 1ZVQA 1B93A 2C31A 1GLGA 4OA5A 1RAAA 2IX9A 2XYQA 3S7TA 3T4EA 3ZCXA 4CXMA 2AG5A 2JFVA 2HAEA 5TQ2A 4BVEA 4OUDA 4IHJF 4CCWA 3BH0A 3DE3X 3K2EA 3VU0A 2G8LA 4NCAA 1M2GA 4BNJA 5KKCA 1JDNA 1B41A 4MTLA 4PX2A 3RYHB 1NNI1 3BKWA 4I5FA 4J4BA 5EKXA 4PAMA 3G8DA 3Q0IA 2TMYA 1JT9A 2J5QA 2ZJ3A 2ZYSA 3PFNA 1KTIA 2IUUA 4DR7B 1EVKA 2IFTA 3BFVA 3KEMA 2OSBA 4L3VA 3RIGA 1IVSA 5BO5A 1KY5A 1GNRA 2I4OA 2XD4A 4JT9A 4LE0A 3PPWA 5D5HA 5LB2A 4L9AA 1A9XA 2JI9A 1A72A 3CXRA 2PV0A 3Q85A 2QM8A 1MAHA 4C0HA 4UVDA 1E1LA 2QVLA 3N6VA 1Y1QA 3E0XA 3T7IA 2PV7A 3RFTA 2EV9A 3KTDA 4C7KA 3EXFB 4CG0A 1IY2A 4OIFA 3L0OA 4JI5B 5BQXA 4KK3A 2BISA 1P80A 4MW9A 1CUWA 3MLBA 4TUYA 1H93A 2HSDA 3J7TA 2IYSA 1C3XA 1B1AA 2QR2A 2J09A 3M9LA 5IANA 2X0JA 3FGPA 4C0WA 4FZJA 3WLIA 1L5RA 4RU1A 5E7IA 5JS7A 4CKZA 4XYEA 4Z6KA 2BE9A 1LDNA 4NCKA 5J40A 4IH1A 1YA8A 1KY4A 3ABSB 4J0CA 1R6UA 3U7JA 4D80A 1PSZA 2VXOA 3VKUA 3GCXA 4ND7A 4RH1A 3NKVA 4B3IA 1LSUA 1R9MA 3N7UA 4WECA 1N5DA 2PAAA 3DLAA 2BWJA 2DBQA 3GPDG 2Q3EA 5FA8A 1JSCA 1D9ZA 3L7YA 4PC3A 4AKSA 1JZSA 3TF5A 1CUZA 2ZBEA 1G5QA 4HLUC 5A4MS 4HTFB 4LRYA 1OD6A 1UBGA 3F2VA 1AHIA 1MT0A 4WKPA 2A92A 2JCVA 4E32A 2VDWA 3WNQA 3NM4A 1V1JA 2QG6A 3K5WA 1Z2OX 5FL3A 3UAGA 4DZTA 2NZJA 3GX1A 3GD7A 3NDRA 5BYAA 4J94A 3P9RA 1PV4A 2EATA 2B0JA 2R7KA 3JVEA 1RSZA 3EZ2A 3GVHA 4V3CA 4ZAWA 3IIMA 4U2KA 3E05A 2Q3FA 3GXOA 4YRBA 5A5GA 2XYHA 4F5DA 1PJLA 2E4AA 2QZ9A 3VPFA 3FFWA 3T94A 1FW6A 3VJMA 1ENYA 2PUDA 1I7PA 2QRMA 2BKUA 4NBUA 5DM0A 4J0EA 3WP1B 1LLDA 4Q3DA 4DYVA 5C0OE 1ULTA 2J0UB 3F74A 3LVBA 3BL5A 3SDZA 4AROA 2ZM5A 3OHPA 1AXRA 4K9SA 3NPMA 4RSRA 4YDHB 2ZE8A 1SHZA 3M4XA 2XKKA 5H3HA 1JXQA 2IOHA 4CMCA 1O8BA 5CYFA 1MB4A 4FKBA 2PY6A 3I9MA 4Y2PA 5A03A 1U8TA 5DTIA 1GEGA 3H1FA 4EWLA 1TA9A 2Q3HA 2ATCA 4HGNA 1ZI8A 1K7YA 4R1TA 5FUXA 4EVSA 5T7BA 3SI7A 3QX3A 4AL4A 5L3QB 1MA0A 1EVZA 2ZSBA 5DW3A 2Z09A 5J2TB 2ZR9A 1II9A 2GESA 5G0VA 1XMVA 4J9UE 1HZZC 2NM0A 1WAMA 1M74A 3NMUF 3AC0A 4P3NA 2P67A 3EVEA 5F77A 1ZCAA 1DMRA 1EJ2A 3Q88A 2P9GA 3N3AC 4NWIA 1K06A 4LXYA 4UBMA 5E4TA 4RFSA 2VUHB 3MS2A 1D09A 2R6R1 3AX6A 4WN3A 5JSYA 1AHNA 4JP3A 4DWJA 3TLGB 3ELWA 4WLEA 3OJOA 4BAZA 1BTOA 2WIAA 1JR4A 5M29A 7MDHA 4E0BA 3GG2A 3PFHA 5EIWA 4F2DA 2MSWA 1TM2A 5IJWA 1OLSB 3E8XA 4NX2A 1SBNE 2IYEA 3LBHA 4RW0A 5E8JA 2J45A 2QS9A 4PBTA 4Q34A 4X7PA 4BE9A 2B7CA 2UYGA 1HORA 3UG7A 2AG1A 2EG9A 1ZI9A 2C83A 5CUQA 5CCDA 5HXAA 5IJ0B 1LBEA 1BU5A 1KRHA 3CLTD 1N92A 3GMTA 4J1TA 4M9XA 4M1KA 2G80A 1QRRA 1SAYA 3B48A 2BHTA 5CW2A 4RLHA 2CJWB 4JLDA 4CM8B 4PO1A 1XJ5A 4QARA 4CBVA 3BWMA 1JEYB 1NF8A 5FH9A 2V8BA 4UUNA 2X4LA 5AK3A 4E13A 1WCYA 2PUTA 2ZAOA 2WB4A 4K6CA 5DCUA 1BU8A 4HR7A 4C2BA 3PXGA 4GPD1 5B53A 1MPTA 3EWSA 3LUKA 4LJSA 4CN9A 4Z99A 1L7DA 3KSBC 1RBMA 1JDTA 3IB3A 4QUEA 2FPRA 4F97A 2H2AA 4II7A 2PBRA 3KBOA 4WCVA 3WADA 4FX5A 2SKCA 1HYEA 4G4IA 2JASA 2CF5A 2JGKA 5C8ZA 1ZN7A 5GOTA 3WB2A 4DCGA 2HXSA 2ZSUA 2I4NA 4YBZA 3ILYA 3UH0A 5HRAA 4H6PA 4Y0AA 3D4NA 5LA6F 4GKBA 4MWCA 3GGPA 2LGJA 2O2YA 2PL1A 4RMJA 5FWYA 2V1UA 1Y98A 2Z9CA 1TUIA 2HTEA 2IY8A 3T5MA 4R0NA 4CI9A 3VA7A 1N33B 3BJIC 1TOAA 2A7QA 2HWUA 1C81A 1ZK0A 1KDTA 1SKBA 2PX3A 3D31A 1W0KA 4FCTA 3KJGA 4PZAA 1HDGO 4TMKA 4JDPA 4EM6A 5JQGB 1JLKA 2F8TA 4N6OA 1Q1GA 4E5KA 4WASA 4Z8YA 1QRAA 5TVGA 4DC1A 1T8YA 3T3GA 3KYCA 1AK1A 3DKVA 2KLHA 1QVVA 3L0SA 3LTEA 3KKLA 1EK2A 3P9PA 3QEKA 4U2DA 5AHRA 3VDQA 5BP7A 1M67A 3R4VA 3TSOA 3QUAA 1X1DA 2IZ6A 4LIPD 3X1JA 3VSEA 2Q62A 3WOVA 1J21A 1FVHA 3A1VA 3EA4A 3M4YA 3FNQA 3CPEA 5K0GA 5AVKA 3LZCA 4EENA 1H8EA 3WRYA 4UAGA 1VLLA 1IG3A 2IUEA 3N5KA 3NGLA 4RCYA 3UHFA 2HQ1A 5CFQA 1RQGA 4JJ7A 4CM7A 3EXIA 3OZUA 2OTCA 1XP8A 5G3YA 4ID9A 1EWKA 1KERA 1I4OA 2CDAA 4FNOA 5JHGB 2B1RA 2QLJA 2Z2JA 3L9WA 5BOSA 2PUFA 1NYQA 1E1YA 1O5TA 2Q1SA 2Q4OA 3OQBA 3PC6A 4HGYA 4QPJC 4XJXA 1W1WA 2N3ZA 1DFHA 2VRCA 3L0PA 4M9RA 4IICA 5L6MB 3WX0A 3C5EA 5ECYA 3ZEAA 5JNRA 1MAUA 4FB5A 4QGAA 1BCRA 2J9FB 4NH0A 3SC2A 2B36A 4Q9LA 2FSUA 3PF8A 2P6NA 1V5IA 2X9VA 4D45A 3LO8A 4OP1A 1MP0A 3K6KA 3PLAE 1NVMB 4H15A 1P9RA 3GJ8A 2OY0A 2FPPB 1DOAA 1E2LA 1NMEA 4FD3A 4RHEA 5CK4A 2BRUA 4JB3A 3IHLA 1D2NA 1UEXC 2QTRA 4GE0A 1T8WA 2CZGA 2X9QA 3KB2A 3DBIA 3LSYA 1UWCA 3JYHA 1GQSA 2FZGA 4YP6A 1MOQA 4AWAA 1ZVKA 3TRKA 1S1MA 5FJJA 1ONBA 2PL5A 4IMIB 2DR0A 1TADA 3R9KA 4IX9A 2YL2A 1GT91 1OFVA 3UHOA 4B83A 4EUSA 1CRPA 3D64A 3OU2A 1WHSB 4U2GA 3W90A 2QL9A 5CR9A 1HC7A 4HAIA 4JT4A 4MJLA 4ZEXA 2ATEA 3ZUPA 1BDIA 3QIVA 2PKQP 4HNQA 1TCUA 1IY8A 3P2YA 1YL6A 3TECE 1NU8A 4AF8A 1SG9A 5HKKD 1JPJA 3ILXA 1Q17A 2DWPA 4TSFA 4CDRA 1Y89A 1T2UA 2IPNA 4MR7A 4EG1A 3ETEA 2Y4NA 4CV3A 4O8ZA 1F7UA 4B3DA 3F3KA 2H7VA 5CNJA 5KTPA 3AL2A 1VG1A 2QVYX 4UM9B 1RU3A 3TOCA 1JKMA 1JE0A 3E9RA 4DQLA 3CISA 3JAWB 4ZVRA 5KX5B 3PCRB 2FXIA 3NHJA 2EBUA 4TSRA 3OA2A 4OM8A 1WVMA 2PUHA 1XTPA 1JSRA 2AW3A 1L7RA 2F3QA 5L4SA 5IDXA 2H16A 1V7CA 3I3OA 3ZCPA 5AW6A 2NSHA 4XYMA 3HR7A 1JAYA 1UXJA 4BVAA 5KC8A 3RVMA 5B1EA 3CRZA 3ED5A 4R71A 4FFLA 5KMGA 1BHQ1 1L4BA 2VBGA 3MEQA 3VPSA 4QGHA 1SR8A 4OJMX 1D7OA 3IIJA 4TWAA 2A67A 1GPH1 1TQDA 5EZSA 3ZU3A 1Z6QA 4B6EA 2R8RA 3C6QA 4TWJA 1Q91A 2CJWA 3PC8C 2EL9A 1Z38A 1AKQA 2M6KA 2XCQA 1JEQB 2PJUA 4OI1A 2FE4A 3SC4A 1GUZA 1L5NA 3PR2B 4OBBA 1KEUA 2CVOA 3PICA 3UZUA 4A73A 1RCUA 1TUBB 2GPNA 5TPWB 3WI7A 1P1IA 1GCAA 1NN0A 4F6LA 5J3JA 2PL3A 4K6MA 1T6NA 4JXJA 3QF4B 2LBPA 3NIBA 3GLGA 2ZUEA 3JU3A 3PX7A 1FDRA 4FDTA 1PQPA 3SX0A 4REOA 4GPIB 1WXHA 2DY1A 4Q7MB 3MQ4A 4QSMA 4CEHA 4C22A 1QCDA 1TQ8A 3C5WP 1A8UA 2OO5C 3TEFA 3Q40A 2H4WA 5ELLA 4MVJG 4N49A 5CRIA 5ILQA 3VSCA 2IYRA 2Q6TA 5AYVA 2Q28A 3I2JA 2BBTA 5BSUA 5U4QA 4B9AA 1L4FA 2QWXA 1ANKA 3JWGA 5ALVA 1A9OA 3FVVA 1NVUQ 3NYRA 4UQPA 3W5CA 2LCIA 1U7OA 1P45A 1Q16A 3DKPA 4FR0A 4H3KB 4NZYA 3WL4A 1CYEA 4MUFA 3GEHA 4CFSA 3GP3A 1M6YA 4KB5A 5TMPA 1A1VA 4QT0A 1YB2A 4ITRC 1ODIA 1J8YF 1XZNA 2WWHA 2UZAA 1U80A 2A1IA 4A8HA 1J0EA 2G0TA 2AV6A 3WB0A 3PFWO 3DE7X 1YS4A 2JDIA 2FPMA 3DHNA 5REQA 1O3YA 4Y1RB 3O8QB 1WF6A 4KR0A 5GJWC 3LDFA 1KK2A 1E7RA 1JR3E 2XVZA 3EXG1 3PDIA 4HFJA 2FI1A 5FI3A 3ZBQA 2PIDA 4LJ5A 2NVBA 1E0DA 1Y3BE 2QX9A 3QEJA 1A98A 1PG2A 3E3MA 3DZKA 3EB9A 3EZFA 4RIHA 1OXKB 2K6GA 3UW1A 3IVCA 2Q0SA 5K20A 3KWLA 4Y2YA 3KUKA 2BTQB 2R8YA 4I1VA 5J4LA 4JJGA 3JRWA 1YJBA 2FY8A 4MUNA 4AUNA 1E1CB 1T34A 2PSHA 2WUDA 2XD9A 4ALLA 4N65A 4YAJA 2Y77A 1QORA 1NQAO 3BJZA 1PR2A 2YWBA 4FD2A 1I0LA 1A69A 1VCNA 1Q50A 3QLJA 3OF5A 1EINA 2ZQ5A 1C0LA 2ECPA 1US8A 1PW7A 1FRQA 2GBGA 4I2NA 1DCTA 2O07A 1GR0A 1X1AA 2Z83A 1WDTA 3VTAA 4FB4A 4MDFA 2AHRA 4N0DA 5GZ6A 2M1XA 3AZPA 1FFSA 2VQSA 1SUFA 3EVBA 3KYBA 3K94A 3OLVA 1J0XO 1BQ3A 3D4LA 3K0SA 3STUA 2B35A 1D03A 5EN4A 1JRLA 1Y5MA 1XRMA 4GZMA 3L1KA 1BS2A 4K8OA 4AU1A 1Q7CA 1WF3A 1E2QA 3QVMA 4HH4A 1SB9A 1TIKA 1UPXA 2X8JA 4BLPA 1GYRA 5AOCA 3V2UA 4ARZB 1NMQA 3DLHA 4ZT5A 3AIOA 2PJRA 4A6EA 3DMNA 3S2IA 1M76A 3NTVA 1J0CA 2WFAA 3V9PA 1J23A 1BC5A 3ZI0A 1N78A 3JQAA 2ECQA 4TPKA 3WMEA 5BNZA 2Y4OA 1QXSA 4WZAA 1BXGA 4ZQEA 3NWJA 2Z9DA 4RY2A 4CU5A 2H31A 3ANNA 3BCHA 3OCYA 1LQUA 2JJMA 4RZIA 5KYUA 1ZC3A 4NOKA 3RNLA 3SPXA 4ZEVA 1NHWA 3M4NA 3AVPA 3T5PA 1B42A 2Z5VA 4PN3A 2H9AA 4W5QA 1RRFA 4Z2AA 4RK0A 3D6UA 3TJZA 1T3SA 3SYMA 1M1UA 2HLDD 4W5WA 4D25A 4Z4IA 2YZMA 2BZ1A 3HZOA 3HZZA 4IFBA 2PSFA 1I1HA 3UY4A 4C14A 1IHYA 4J9VA 2WU3A 1U0HC 2DG2A 5MN4A 3BERA 3HKBA 4MWDA 2CFIA 3PRYA 2GI4A 1H3FA 1DC3A 2Q8QA 1ISIA 3GBSA 3OLQA 4ZAVA 1RJ9B 2DVMA 4HN9A 4XDGA 5F4ZA 1XG5A 1F7VA 1Z47A 2OCGA 1XC7A 1QDEA 3HCPA 3F67A 5M2QA 2Z6UA 1B2RA 3QEMA 3QITA 4EYEA 4KJZA 3AFOA 3IR5A 2BF7A 1AGRA 5CAEB 2FQYA 3RGWS 3SR0A 4KFCA 1SXHA 3KZCA 1OCEA 2PPVA 1X7ZA 2WF6A 3PEUA 1ETUA 4B6PA 5LMZA 2VA9A 3FNIA 3H4IA 3HCNA 4A7PA 2IYFA 1M1ZA 1VLHA 2D13A 2H4YA 1HE1C 4LI3X 4LJAA 3V6MA 3PQ5A 1GLNA 5C18A 1SVUA 5K5EA 1JW9B 3UW3A 4W5JA 2P9JA 1E2HA 1FX1A 3R40A 1V25A 1H6DA 4LS3A 1CE8B 3THWA 3B51X 1NR7A 3CRW1 2BEWB 3O3CA 3N87A 3SZ3A 5HOQA 2V0GA 2EDAA 5JCPA 1EXDA 5LIRA 1AQJA 1CZKA 2IU6A 1NZJA 1X2EA 2BHSA 4WXPA 1DWUA 3MWLA 1ORIA 4BZZA 1MRNA 1JHPA 1HEYA 1F2TB 4YAKA 3FZQA 3IP8A 2ZRNA 1TZ2A 4KE8A 4X1YB 4W9MC 1K66A 2FQQA 1SOAA 2WF8A 2GZRA 3UAYA 1UMBA 3JZIA 3O0DA 4X20B 5HTKA 2GBLC 4PNEA 3NCTA 4LVOA 2CFSA 1X7XB 3CNNA 3S70A 2NTEA 2C8LA 1UDRA 2EEPA 1E3WA 1RI4A 3EVTA 3I34X 4YONB 1A2QA 3GLIA 3N2LA 1TO2E 3EXHA 3JQFA 5IF9A 1HK7A 3SJUA 4XQ0A 4Z2YA 1N2XA 1LB1B 1ZJ4A 5LXTB 4GRAA 3UH1A 1JHQA 3CH4B 1XU4A 3HA3A 3EYAA 3IRVA 5B36A 5C3MA 3AVWA 2BEKA 3AIIA 2ORIA 4NAHA 3PDIB 4PR0A 421PA 3ZIUA 4REQA 4PYQA 2EJCA 2V9PA 3OOHA 4IVPA 2QE7D 1OXVA 1LF0A 4HCJA 4C0XA 1O2DA 4Y6RA 5EP3A 1CZLA 1E7QA 1CU1A 4F4DA 1F4LA 4BO2A 2VWQA 2I6GA 1KNXA 3HCWA 4DJ5X 4G0WA 2O8FA 1UDXA 1U2RA 1M2VA 2QF7A 1IDN1 2VJMB 3NLLA 3V8QA 4WJLA 5J2UB 1OTXA 2J33A 3O8NA 4V39A 2BGUA 4HB3A 5I3CA 2YFYA 1XCPA 4MQBA 2QQ5A 2WQZA 3SS9X 4PIVA 4WNIA 3EPHA 1YE8A 3UJCA 3EISA 5GMOA 4DCMA 1Y3IA 3AW8A 1Q1NA 1BHJA 2ZSAA 5JCXA 2QRUA 4RMNA 3CYFA 1XD9A 4HLDA 4MQEA 4EVRA 5HQ3A 3QXSA 4B4OA 3IMEA 1QG2A 4EJ0A 2J3IA 1U8XX 5HCUA 4ZARA 5HIMA 3NYIA 3R77A 3DVQX 4O4JA 5I9LA 3GJQA 4WADA 5AW5A 4IUDS 2VDPB 3VQTA 3EZ9A 1KMHA 4TSFD 3P94A 3TBKA 5C9ZA 4KQXA 1S3FA 2AN3A 1CUFA 2AXNA 2FZLA 5GPBA 5IBPA 1X8LA 1P2BA 3H9BA 4UUAA 3UJ6A 3EE6A 4TT8A 4QOJA 3SC3A 4D4GA 3WK8A 4P8RA 1IZ9A 2W2KA 2GBFA 4GF5A 1KE1A 4LPSA 3VV2A 3RHZA 1JEOA 3E9EA 3PEVA 1BQ4A 3CN9A 4FN5A 3VPCA 5T4HA 5C53B 2IOQA 5DLQC 4H60A 4KQEA 5CVEA 4L7QA 3SEZA 3I39X 4XUDA 4D82A 5JJIA 3C48A 3FB1A 3D5TA 2E37A 1FFCA 1MC8A 1C8KA 2JFOA 3HKCB 4QUDA 4R1SA 4X71A 1E62A 3I0MA 4CM3A 5AXAA 3W2FA 5K8IA 3IIEA 1ODFA 1NF9A 2WNIA 4MRPA 3KFVA 2DBYA 3NBYC 3U3KA 5C4MA 2PIAA 4P82A 3LWZA 3R5JA 1ECGA 2VWGA 2AZTA 4DMCA 4YXWD 1J25A 4GPAA 1PZFA 2RFLA 2YVUA 4MK4A 2X7XA 4QVGA 4RANA 1L8LA 4BGDA 5L7TA 2WFLB 1PGQA 1ZZGA 2XBUA 2O7QA 1T2EA 1KSFX 4WOPA 1LLUA 2GPSA 4OHVA 3UMSA 4HGRA 3UWKA 5L3SB 5ALDA 4KODA 3KOYA 4O2AF 4BFSA 1WP4A 3PQ6A 4D4KA 2C9CA 4O4HA 3L49A 3SEFA 1THGA 4RKRA 1QMGA 3B9QA 3L7NA 3UJ8A 4URVR 3EX7C 3OF3A 3RV4A 2AX3A 3M6UA 2WT9A 5JS2A 1EXVA 4QBIA 5F7JA 3ZHBA 4LGMA 4J2TA 1YDGA 1BDHA 2BM1A 4QXMA 3FDZB 4EKNB 4Z3KA 1EFPB 1T5TA 3E1GA 2JRCA 4LMRA 4P4LA 4A15A 1TAUA 5M7EA 1OBOA 3ZQ4A 1IHPA 1H3EA 4R4JA 3MJ4A 4LJ8A 4CW7A 1Q7GA 1OGYA 2BGLA 1YBVA 3V8NA 1G18A 1TLTA 2ZUWA 4XAQA 5I7UA 2R4TA 2G6BA 3C97A 2A30A 1R5BA 1YZYA 2YBDA 1A27A 2XTNA 3NASA 2POQX 3IAHA 3ODPA 4P54A 4DZRA 3C6KA 2W6QA 4EHJA 4EPRA 2I67A 4M88A 3WAKA 1V26A 2VJPA 3OT1B 4DSTA 2VT7A 6LDHA 3Q11A 2HHAA 1G8FA 1Z4NA 2RG1A 1EX9A 1I0IA 2YNMC 2HMVA 3ESQA 3G5UA 3QWFA 3UWDA 5C4IA 1V9LA 3KEOA 3QBEA 5IUKC 1E1DA 1EM8B 1QHFA 1LGYA 1GQ2A 1VG8A 2IPXA 2WPDD 4FSDA 2YC4C 4JU8A 3UBTA 1BXKA 1DT3A 1NXXA 4Y2UA 3OP4A 4TYPA 1B74A 1EGAA 2FETA 3DTVB 3ONWA 3PDCA 4P3XA 4UATA 2Z95A 3TOVA 1NQTA 3W2GA 1PNQA 1M6VB 1N5KA 2QV0A 3TIXB 1QYWA 4OYLA 1KR2A 1Z6XA 4WOJA 2P75A 1FE8A 1GGMA 2AMLA 2MSDB 2F6RA 4U7HA 2M6LA 4ZN6A 4GOJA 1YZGA 5KYXA 5EEGA 1DDOA 1CP2A 2A94A 3QQPA 5A4JA 3IBSA 3NVMB 1GAJA 4HEA1 5H8WA 4LYJA 3EC7A 5IXJA 1XD2B 4OB7A 4PCLA 5SYNA 4R98A 4ZFNA 2PLNA 4HLQB 2DECA 4X00A 4CV0A 3CF0A 3LRPA 4KQMA 3GQVA 3ICCA 5D3KA 5AKHA 4CRWB 1WXQA 4MVYA 4B6JA 2WSMA 1SKMA 2JIZD 3AETA 2D74A 3N3BC 5GZ3A 3FGNA 2DPHA 3G0IA 3MJVA 3PNYA 3R5FA 1E66A 4HJXA 4DCNA 3L8HA 4YP1A 2WFLA 4X8LA 2GLTA 4Q4AB 1NYRA 1S2LA 5K0EA 4ZOLF 1XKLA 2WF9A 4KR6A 4A27A 1RWKA 5I8WA 1E9BA 5KNDA 3WLFA 3AM1A 4A0RA 3A9RA 3R7SA 3N28A 4MWTA 3RIEA 1GIAA 3KJZA 1HE2A 5A62A 2R7AA 2Y9MB 4YMTA 1DRWA 5CLGA 4RORA 1KGSA 1LBQA 1ORWA 1LBSA 1UF9A 1WB5A 2JFBA 2VDUE 2JLAA 3A9WA 2IEAA 3K92A 3LA6A 1Y8QA 3QYJA 5A6VA 3K35A 2YY7A 4Q1CA 2PUBA 4TUYB 1EVIA 1GPKA 1DX6A 3LUGA 4YMGA 5KNBD 1RXWA 2CVQA 4ITVA 3CX6A 3TLKA 2B21A 2X14A 4KWIA 3G2NA 5I7EA 1JTVA 2WJ6A 4PNHA 4BNUA 4HUJA 3DEZA 4U3JA 4LVUA 3BJRA 5JIBA 5C51B 1LUAA 1J97A 2FEOA 2PEZA 3PD1A 2HA2A 3ST7A 4IDNA 2ASVA 1JG7A 1JSXA 3QVVA 4L5BA 9LDTA 2CJYA 3OWHA 2X0RA 5LLSA 2FPOA 3I45A 5DMHA 1Y1TA 1EGMB 2VG8A 3T61A 3NTRA 2YJNA 4GSLA 5IZ4A 4MW4A 3JQAB 1K3TA 3G23A 1LI7A 4MS1A 5GJBA 1J0DA 4G9GA 4MR9A 2YZ7A 2MMCA 3EY9A 2WVAA 4MB2A 5EJAA 3SVZA 2RGGA 1USWA 5CPBA 1V8DA 2B0CA 2OP1A 3COSA 3QVSA 4H0NA 3DMTC 4QDXA 3VKGA 4I81A 3HP4A 4HMQA 2PD4A 4J7UA 3KJEA 5AI9A 8ABPA 3RRJA 5JRJA 2PEYA 3FA2A 5FQOA 1PQ4A 1M8FA 4BMSA 2DWOA 3WOHA 3JQCA 1K88A 1N5MA 3M6XA 2DPYA 4EB6B 1DVRA 3ZDAA 2CMKA 4J1TC 3WGYA 4ER7A 5CDFE 3CUWA 2SNIE 4I5GA 5THQA 3RSGA 4B2IA 4N6NA 3OEWA 5I9MA 2PG3A 1I3KA 3BUSA 3K9BA 4K2AA 3EMDA 3REQA 2V7QD 2JANA 4C30A 2G70A 3DOEA 3KOZA 3MGCA 3UXYA 4QO8A 4PYNA 1FDTA 1HT0A 2GKGA 1W5EA 1L3BA 5IZCA 4M4SA 4EEZA 1T5IA 1FTYA 3QEMB 4B5LA 5EE9A 3F4KA 4HADA 1N5RA 1K0UA 3TI9A 3H9CA 5DLDA 1T8PA 2CXHA 2ZSFA 2H29A 3ESZA 4RE5A 4BAGA 1V4BA 2YYSA 2AJLI 7AT1A 1YJ8A 1VXRA 2I1LA 4E2ZA 1QP7A 2D4HA 3NHBA 1SXJB 4UDXX 1C4XA 1SBCA 1Y37A 1NJ5A 2XVXA 4WCFC 3O94A 3MLAA 3T3IA 1FP6A 1CZHA 2I5PO 3SCZA 4TMZA 1SQFA 4I50A 5FDFA 3U7HB 1TM5E 1WSAA 3NQ41 3JQ9C 4Y6QA 3UMYA 4D8WA 5AM3A 1VBNA 3IAM1 1R74A 3LQ2A 3SHTA 8MHTA 2NUPB 2C3OA 1XVAA 4CUJA 4DCOA 5AI8A 4QGGA 1D7AA 1P5RA 1GNPA 2Q4EA 3LXXA 1ODJA 1FL9A 1U1FA 3CF4G 4TL7A 2W2VA 3NBMA 4N01A 4MGZR 5DASA 2XT6A 3EZ7A 4MYDA 4Q4HB 3T1OA 3BBPA 4AICA 4WVLA 3TW4A 3C3KA 5BRNA 3GH1A 1Y34E 2AOUA 4WKNA 5K6AA 1DV1A 3T4PA 2V7EA 3WMXA 1IY0A 3MBOA 521PA 4MGKR 3I42A 3W8FA 1FFXB 3EGVA 1X7XA 1OJ7A 3MMNA 1S3SA 4ZO8A 4AX8A 3C3XA 2I6TA 3AQ4A 5I7RA 1MGPA 2LV8A 2W8ZA 1T5DX 1XU9A 2IWRA 2J9ZB 3RU2A 1GZ3A 1N0VC 2O3RA 3ET5A 2E7ZA 4PHTA 1I1OA 1ESEA 4I4TA 3GNSA 3C98A 5MFPA 4ZODA 5T41A 4EL0A 3GZJA 3IT2A 2W90A 3MIIA 5A3VA 5JI2E 3Q9LA 1XK6A 2QROA 2NSDA 4FFWA 3U5TA 5F9FA 2R4UA 3OKFA 4DMGA 1DO2A 1BOOA 3FNGA 4GEGA 4B40A 9GPBA 1YR1A 4NMWA 5EWLA 4L9WA 3BDVA 4YR9A 2XNSA 4IKPA 1GN8A 2O8FB 1A96A 1RQNA 4FGJA 1T5HX 4JLVA 3ZUGA 1G2PA 4QPNA 2ZWAA 1RXIA 5L7YA 2Q2QA 1KH3A 3K1AA 1O6GA 1UDCA 2I2AA 3H5LA 2DPGA 1YS2X 3IILA 4YCMA 1IBMB 4LCBA 2XADA 5C8YF 3MOIA 4D4JA 5L4LA 4AUEA 5EI5A 2QDXA 4A82A 3NWOA 5A2GA 2V1XA 3GJTA 5IPFA 5JVDF 5M34A 4RELA 4B71A 2VJNA 2AS0A 3TOXA 8OHMA 2QD2A 1DWPA 2OKGA 3FUXA 2QZSA 4FR2A 1Z29A 2COEA 4YT4A 1NJFA 1TF5A 2WTAA 2JGFA 3CC8A 1PWEA 4JJFA 1TYZA 4EG6A 3LPCA 3GLVA 5ICEA 4JBNA 3TKAA 4D0RA 3VOAA 3I6MA 5CBKA 1I3CA 4G86A 5K8VA 2ZRDA 1HFKA 1TU4A 4YPVA 5HFAA 2J7PD 1EP1B 4L50A 1KAHA 2WYWA 1JDZA 2ZOSA 5IASA 1FZTA 1B3RA 3Q8MA 3AV3A 2GBLA 3KZKA 4MA5A 3E9YA 3TZEA 4DVJA 2QY6A 2AG8A 4YJFB 1OASA 5FWXB 2ZJZA 1OBVA 4LX8A 4YCAA 4JASB 5COBA 1P62B 2IYOA 4GW3A 3BVPA 4MO2A 3RYHA 1VZ2A 1TZBA 1EUDA 4JODA 3A28A 3H1BA 1V3TA 1R8JA 2NQ8A 3UMCA 2F1KA 4FC7A 5FV7A 2CJFA 5JXGA 3KVNA 4HAOA 3OMLA 2PNFA 2R87A 2A0FA 4RX1A 3LJKA 5KNCA 1XDWA 3E15A 4ZC1A 3RAEC 2GN9A 3IJ5A 2VUTA 2WIDA 5BUCA 1EE2A 3B60A 1HE4A 5JYDA 4AURA 4BMVA 2GRAA 4B74A 1IQUA 1A7KA 2ESRA 3ZD6A 3GCGA 3KHTA 1F1JA 1AKNA 3L6BA 4EPYA 4MJ3A 5CDUA 2RGDA 5L51A 2I22A 2OCIA 4I46A 4CQNA 1E8DA 1L4EA 1OJLA 1ZI6A 2RI6A 3F3SA 3L1IA 4ZVVA 1PLJA 3IBFA 1Z4OA 4WKOA 4N8DA 3SZGA 5JMOA 5DN6D 3VR0A 2G9ZA 3BL6A 2GKSA 3OJWA 4Y1GA 5CLHA 3S2ZA 4DBVO 5D87A 5EJIA 3UV7A 5JRDS 3HABA 4B48A 1WU8A 4A8JA 4RA6B 1CR1A 5LVAA 2OO7A 1U2SA 3C3WA 5K0ZA 4XWYA 2IYUA 5AVOA 3BE5A 1KYXA 3H04A 1KZ9A 3K1AB 3P9YA 3MMXA 2VPWA 3BFPA 3FNRA 5AW9A 5F3WB 2HX1A 2PGLA 3DXFA 3QWIA 2IOFA 4JFRA 1EX1A 2I03A 4ED9A 3K0EA 1UZMA 1DUIA 1T5OA 1CZUA 4C29A 1KVTA 2XVYA 1ZH8A 5CURA 2WIGA 1G63A 2E1PA 4HWSA 4IYJA 3MTGA 5ER6A 5C5CA 4TUYF 2Z2IA 2J59A 2YFHA 2WPDA 1FRVA 1L9KA 2EBWA 2GF0A 4BO8A 3EH1A 4BEJA 1VE5A 3FWPA 1C8BA 2ZB3A 4HGZA 2WG1A 3AR4A 3B1XA 3IPRA 3QKTA 1S1CA 1ZZEA 1QBGA 1P7CA 2AR7A 4NBKA 3UMJA 4LVCA 2GBIA 3GEEA 3VH2A 1E6CA 4DLAA 5KVSA 4CI0B 4YT2A 3D2AA 3WQHA 2P1RA 3OCZA 4IG4A 3O8OB 4BO9A 1GYQA 3A2NA 3VDMA 1XZMA 1QFZA 4B3TB 1U3DA 4DSOA 2TECE 4DRXB 2MR6A 3CG4A 2C7PA 4R2WA 1UBKS 3C3CA 3QA3E 4MUAA 4CLOB 4KLZA 1O0SA 4X7MA 3HLYA 4RSHA 4BN5A 2A88A 4L8LA 1Z75A 3DEIA 4GLBA 2BVNA 2KLBA 5B3JA 2EX1A 4B46A 2CC2A 3ZGOA 4QUIA 4C7OB 4I4TB 1Q1AA 1QX3A 1W49A 3NGMA 3OUZA 4WOCA 4WPGA 2FWBA 3TGWA 3QM1A 1C3JA 1J2TA 1W2HA 1MIOB 4TYMA 3LUBA 1UFVA 2CXUA 3LLSA 1CUXA 2Y93A 5EEHA 1WULS 1JBQA 3U4IA 4ZYWA 5IT9A 1PUIA 1T15A 2QPAA 2PAFA 1U98A 5ALEA 4C08A 5A6SA 3RJ5A 1U8ZA 5IXSA 2F3RA 3R09A 5F64A 3GT3A 5C5EA 4KFUA 1HNNA 4I4IA 4X93A 5BRJA 3KWFA 1T13A 1YQQA 4MS4A 1UK9A 1NF3A 2QQFA 4H7KA 3H5TA 4UEOA 2AE1A 4FLEA 2Q9UA 4WLNA 3WSVA 4UM9D 3N1UA 4ZOQI 3BRQA 3M83A 3ZD7A 1GZ5A 1CUIA 4MQ4A 3BD7A 4B45A 1ISGA 1DQYA 1U1CA 7MHTA 1VJ5A 1QHYA 4M86A 4RZXA 4HFRA 3TRHA 2WF5A 1DKUA 1NF2A 4JJAA 4JB2A 1E89A 1JI3A 1FYWA 1WM1A 2ECFA 2WTXA 2RH8A 3SN6A 3O1JC 1AGPA 1ENOA 2OK8A 2C5EA 3HBJA 4YRKA 3CVJA 2QM7A 2NZ2A 1IAVA 4UCXA 3W2IA 1YCHA 2BZGA 3ND8A 4PGFA 3VC1A 2OBYA 3EIEA 4Y9RA 4PNZA 4KE9A 3DMHA 1PI3A 4Z7OB 3D6MA 1PNVA 3UQZA 2QSYA 2X40A 4M8NE 4RZSA 4EB3A 4DV4B 1EPUA 1ZESA 1C7RA 1XROA 3C43A 3LLMA 2AKYA 4IZHA 3PRHA 3S1AA 3VTKA 4MIYA 2OQVA 2BI8A 3AK4A 3NFYA 1X7DA 2EFHB 4DV6B 2PCJA 2GFHA 1VMKA 4PFJA 5JWRA 4IJ5A 4EHKA 1YKGA 1ZUNA 2P9CA 3ORQA 4NECA 5LYJB 1VJGA 2OB2A 4HZGA 4FN4A 1Y8ZA 4ZOLB 2DCUA 3RLFA 3TJMA 1SJ9A 2HN9A 2Z2XA 3IMFA 3INRA 2NADA 3M6WA 1JA0A 4RZQA 5AK6A 1XN1A 1OLUB 2OHVA 2X6TA 1U3VA 4DQ0A 4DUGD 1Z2DA 1OGJA 2YZ2A 3N8NA 4B85A 6ADHA 3G8AA 3ZU2A 1U2DC 1XIVA 1U7WA 2RH5A 3ZH9B 3LI2A 4LGVA 3UJNA 4GYYA 4N18A 4ZQIA 1SMKA 4RCZA 4IUYA 3TH5A 4LHSA 4RY8A 1B15A 1Y81A 2O3QA 4PSDA 2FP4A 4KQKA 1Y80A 3U1VA 1K8QA 4KDEA 1NI4B 2JB9A 2F43B 3A1EA 3QP9A 4LMAA 3ZTWA 1RXYA 1USVA 1MDFA 3FOAA 2W2OA 4L2IA 1JQAA 1ND5A 4JR0A 3S4YA 3TUIC 3A3NA 1NWHA 2BE7A 5FT9A 1J56A 1WV1A 3DO5A 4DMUB 4D97A 5FHRA 4B09A 5DCWA 2P2GA 2W6JD 3GVPA 4BFVA 1JFFA 1Z68A 3PC3A 2PMBA 1PL6A 3F97A 4PC2A 4PE5B 4ZHSA 5JQWA 1CEYA 2OV6A 1NUSA 2ATXA 2FEPA 1Y4AE 3E81A 3LCRA 1A8QA 4TQAA 2ONYA 5DP2A 3SM9A 4LRSB 2W93A 3GPBA 1K3UB 1SU8A 2C0PA 4J75A 4ZO6A 2RAFA 3DV2A 3QNUA 5I7VA 2R00A 3ZV5A 2MSEB 3DVLA 2HLDA 3E7WA 2H63A 5I7SA 1NIPA 3U9TA 4YLYA 4A0HA 1WTAA 3AEUA 2YJTD 3QOFA 4LYEA 3FNBA 2DHCA 3ITKA 4IV0A 5BNIA 1AZTA 4G5GA 5EOVA 4C04A 4IGFA 4CVNA 4ALKA 1Z6YA 2WW8A 4D4IA 2V7VA 2C88A 1QH8B 1TT5B 1R00A 2DTEA 4PXYA 1TVCA 5LQRA 2AN4A 1XR3A 2JJYA 4WK2B 1P3JA 4IM7A 3VR4A 4QT4A 3SQXA 2X3YA 3AR8A 5HJ7A 1BE0A 3ZU6A 5CHEA 2WIFA 3U40A 3TAXA 1GGNA 3O82A 3NVKI 1NQVA 2ATIA 1NZFA 1P75A 5ERYA 3MW8A 3G9TA 3R74A 5FOSA 3SIXA 4DANA 1EWTA 3N2NA 4G9EA 1T29A 2JFHA 3D6TB 3T0GA 2VKTA 4KAXA 4Q00A 2JVJA 3V5NA 2Q41A 1OB5A 1ECLA 4IDEA 1E2PA 4D41A 4P5EA 4JLBA 3R3UA 1GSIA 1SVLA 4R9SA 5MDHA 2V55B 3BJEA 3TQTA 4CF6A 2FFBA 4NBRA 1EBUA 5CFRA 1F0YA 2ZQYA 4F4HA 1SIWA 1L7PA 3BC1A 4HX5A 4Y2JA 1YC5A 5I9SA 3BK7A 4WVFA 4BNYA 4YHBA 2IDMA 3PG5A 5A4AA 2WDZA 2BM0A 3I62A 4H1TA 2G7MC 3GEPA 4K40A 1L5KA 5IG2A 2SECE 4HUTA 4YUZA 2NP7A 4TM8A 1RWVA 2H2HA 2IUFA 2XT0A 3I9FA 4MV6A 5MHTA 4WTOA 4W7SA 1DARA 3FXAA 4KRXA 1KI3A 2A2ZA 3VDNB 4UQLA 1YFLA 3T34A 4WZZA 5CDHA 4JOQA 3SOPA 5J63A 5LC1A 1BZYA 2R5WA 2X58A 3PE4A 5ARBA 1QLHA 1JAIA 3RKRA 3SYKA 1IBSA 3OO0A 3UJ3X 2E55A 4TTJA 3TCXB 2JG3A 1HT2E 1AQIA 2Y2UA 4IDFA 1SURA 4FNGA 4ZK2A 1QP4A 3DL0A 3IA2A 1NULA 1HRDA 4LYAA 4O2BF 5AJYA 2NAPA 1C9JA 2JK1A 3MD0A 2V4MA 3PDUA 4HDSB 4KXVA 5GJCA 1O03A 5ITZA 2P90A 3PQ8A 1IN4A 2Q5FA 2ZYIA 3C6YA 2FW1A 2CCKA 1OHHD 2QG9A 3L1VA 3NHWA 1Z2AA 3EVCA 3KPWA 4P7FA 4TRNA 2C9OA 3WLKX 3ZHTA 4NBLA 2C8JA 4X7BA 3PXBA 1FUUA 2J9XB 3HPQA 1XZGA 3PSHA 1WZ2A 4PRLA 4GI2A 3SFVA 4UEJA 2VEOA 2YMPA 3H2YA 4F3YA 2B4KA 3TS1A 4XD7A 1XTSA 5TF4A 5T3YA 4AZ0A 3N39C 3A6FA 4PX5A 1WQ4A 2OXCA 5E6UB 3PPYA 2YRXA 2FSIA 3IAM6 3Q6NA 3L84A 3DMFA 3K73O 2Z30A 3R20A 1KE2A 3PQ2A 3RKUA 2GPTA 3T7KA 2BBWA 5HNKA 3ZDDA 1W34A 2BZ0A 5C34B 3E23A 3RWMB 1XK7A 3P4UA 3L8EA 4BO1A 5ETJA 1R5NA 2ZQZA 2IUYA 4RXTA 1ZUNB 3GI1A 1MB3A 1UT8A 1D8TA 4B3XA 4C3VA 2XRZA 4BNMA 1QJ4A 2R79A 3I9JA 5H3CA 1ML4A 4HEQA 3TFQA 1OXUA 1RVDA 3ICEA 5ILOA 1WJGA 3E82A 2CXSA 4MUHA 2C2ZA 3E9QA 3NAQA 4AIIA 3FWNA 3VGJA 3BWDD 1C5KA 4N3GA 1Y7TA 3GROA 3D4IA 1H9BA 1A2BA 1K98A 5AW7A 1COWA 4MO9A 4HVTA 5DM2A 4EGSA 4K86A 4MWSA 4QQNA 3V4SA 3C6ZA 3QKRA 1F3LA 5ES3A 1JJVA 2CNNA 4HK4A 5SZJA 4BCDA 2C92A 2IXAA 3LL4A 3R0XA 4FYMA 1V8FA 1CUUA 2Q6VA 1WXDA 4TXJA 1KP2A 4NCIA 3RVPA 3KKOA 4DLPA 1HSOA 1VDMA 4HQRA 1D6NA 1JIUA 1V47A 2BDUA 1HDCA 2C2WA 2ZYHA 4RQTA 1YOVB 3I9OA 1W96A 4IQFA 2UUOA 3HU1A 4ABYA 1UBUS 3R0QA 4NEHB 3DOCA 3AUSA 3K31A 1WV0A 3GF4A 4JI0B 3GDOA 1Q5PA 4DBZA 3HJFA 1S8AA 4QOSA 3IUJA 4GX5A 3IELA 2G07A 4KPUB 5JVDB 1DFGA 4W8HA 3V7NA 1J70A 2YY5A 1Z15A 2JHCA 4LOKA 3F73A 1W36D 3KD2A 1J1UA 1K7FB 1P60A 3BMNB 3MXOA 1C8VB 1Y7PA 2J6BA 1MO2A 1OH8A 2IEYA 1GTJ1 3B6JA 1NFRA 3TZBA 2IYAA 1Z62A 4GPTA 5B6IA 3NU1A 3T3HA 1BWPA 1FLDA 2BELA 3D8UA 4IH9A 1KJWA 2B4YA 4LI0A 2NQTA 3T5TA 1IXSB 3IKTA 4HY3A 1R0RE 1PDOA 1L1EA 2YIVX 4NY1A 3GNQA 2EWMA 3EQ2A 2HZ7A 1O94C 1Q0SA 1SXGA 1SELA 3SXJA 1QU2A 1H8HD 3H5NA 3IEXA 1EFDN 3RVKA 2JVIA 2ENUA 4JI1B 4DV2B 4DWWA 1BVRA 1PTKA 2YVLA 3P2OA 1W9HA 2GF2A 5JWOA 1KQ3A 2HV9A 3U3MA 2UU9B 3UHPA 2POCA 2ZANA 1I6WA 1HOXA 2RHHA 4RKEA 3KPVA 5KJEA 1G3IA 2EARA 3EODA 2HRQA 4LOIA 1W59A 1GPBA 3ZWYA 4AZSA 5IT0A 1ZJWA 4C3ZA 1C1DA 3JZAA 4OI0A 4KMOA 4JZYA 1BYUA 5I8ZA 3ZJUA 2G7ZA 1HTTA 2VK8A 4KI7A 3T0IA 3ZVRA 3WK7A 3IQWA 4GM1A 5FEUA 1J7JA 1Z5UA 3VYRB 3QLUA 3X3HA 3RUDA 1BXRB 1YO6A 2BMJA 2BDEA 3E27A 4I1RA 1TAQA 3D1LA 2CNWD 1AXEA 4XM0A 3QKRB 5FBLB 4TLEA 2WE8A 5I7HA 5F2NA 3KUDA 3ANMA 2DEUA 1ZJZA 4I3FA 1N0HA 2E4YA 3K9NA 2AJCA 3LKZA 3PGA1 4UVEA 3R6LA 4WN9A 5JAIA 3N58A 3THYB 2GCIA 3EWAA 4XLLA 1QIGA 1EBBA 4A2CA 3A4LA 4TL8A 4WNYA 3AEKB 3FE2A 3K4HA 1MVOA 1X9IA 4D02A 4H4CA 2Y1XA 4WGGA 2VSNA 3RSFA 1YK0A 3JQDA 1Y4ZA 2F1RA 4US2R 3COJA 4LFBB 2BH2A 5LP6B 1U1GA 2PH1A 2FTKE 5J1SB 2IODA 1FY2A 1N6RA 1ZD1A 3L05A 3N5CA 3QPDA 4QECA 1JFSA 1E2GA 2XWJI 3NRJA 3U37A 5EKDA 2J48A 5LQNA 1OAAA 1I4EB 1VHDA 4OQYA 1VL5A 5E7MA 4EMSA 1DX4A 4FEAA 5AW4A 1D1SA 4RFVA 1IB6A 3IAXA 4GI7A 4UTZA 5CYPA 4IBOA 3SQDA 4OXQA 4B7UA 4DEVA 4XOIA 1FVOA 3TB6A 3NDPA 4OU4A 5KWEA 3W5AA 4AQYB 5LPNA 1X7ZB 3N2YA 3G17A 3UANA 3BQMB 4M0FA 3HKBB 1NNLA 1KDZA 1H85A 3FFAA 1J49A 1VLZA 1RS0A 3W9SA 4F12A 5F5NA 2FMUA 1UDBA 4C21A 4R05A 1QE3A 3F7MA 4E08A 2GWHA 1N5JA 1DV2A 1KOLA 1Z8HA 4N8SA 1HYGA 2HK8A 1WCIA 2I0FA 2ET6A 4Q4LA 4MWZA 4OQDA 1NUTA 1V3QE 2YMQA 3GFGA 3IULA 2WR8A 3R44A 2FP4B 4LWPA 1BXZA 4KGVA 3T1YB 1KU0A 1PWZA 3BL8A 3X1KA 3K20A 3LVFO 2Q8NA 5KHOC 3ZI4A 1XKTA 3PXUA 1PEYA 4GFDA 1YHZA 2JCYA 4IMPA 3IIKA 2BEWA 3K05A 1X94A 4ZYXA 5K99A 4PAOA 5FNVB 1K27A 2YQ4A 1R10A 1UFQA 4XWOA 1GCOA 2JCXA 2CMFA 1BMFD 2R1VA 2VC2B 2ZUVA 3BMQB 3DKKA 4B6QA 3UPTA 3N0VA 2AD1A 4R51A 3U16A 1OF1A 3GZ4A 3DB2A 2EZ9A 3PHHA 2GA9A 3CCCA 3L9XA 5HKBA 3BF7A 3J7AC 1PO7A 1ADBA 4N3CA 4NYIQ 3U7QA 5HZKA 1M66A 3VISA 3IO5A 3HUFA 2BV3A 3LGSA 3GJ5A 5AVZA 4EA8A 2PX4A 4HX9A 2ORVA 3UGJA 1I9GA 1EP9A 1VKRA 4Z0HO 1WCV1 3KETA 3SF8B 4YASA 4BWFB 2XXAB 4D3SA 5J2UA 4MV7A 3HCBA 3DL7A 1CSEE 1P5HA 3MPOA 2X0EA 3X2SA 2AQHA 4POOA 3SZMA 3WJ1A 4EKYA 3CEMA 3WKCA 3PTLA 3G8BA 4J8PA 3ZKWB 1VKZA 3UXMA 3L06A 5HMMA 3N70A 2WJGA 3HJBA 3PGMA 3OOJA 1T3GA 4MXDA 3K0KA 3ADCA 4PBSA 5LU8A 3ADPA 3SHVA 3TI7A 2F8MA 4DLLA 3ZIAD 1PZGA 1RYBA 4F93B 2JLUA 3NCHA 4LMBA 3SHQA 5ELXA 3IDZA 2KX7A 4X9XA 2BIFA 2G63A 1YQDA 5BURA 4J43A 2J3EA 4UE2A 2BONA 2EP5A 5DW0A 2QPOA 2REQA 4WCDA 3NT2A 2P5YA 3C15C 5KWVA 2H06A 1NONA 3IQIX 1AD2A 5D6NA 4FS8A 5AM0A 2ZDQA 4EW6A 5DLEA 1NRIA 2IZZA 2W5UA 3QLEA 4YYZA 3TNJA 1XVVA 2PRSA 4N6GA 1DKQA 4OMDA 3O7MA 2WWWA 2P4HX 1RLUA 5CX1A 5SYMA 4ANFA 4TYYA 4GOMD 4HAWA 4UPDA 5FLXA 1QTRA 3AM5A 1T8UA 2EBHX 2UUCB 5C8DA 2EFCB 1LK7A 2JGDA 3FVTA 3VKWA 4R0MA 3N2IA 4YQFA 1A8IA 3EMKA 1X2BA 3KV1A 1G2QA 4O02B 3H1PA 2R6FA 1TZKA 2F48A 4RTOA 2BD0A 2XA1A 3KTAA 4YDQA 2PR2A 3I76A 2BFBA 2WE7A 16PKA 1SU4A 3VBEA 3G89A 1HFEL 4KE7A 4NQRA 2VXCA 3UOGA 3WHLA 1ULAA 1SD1A 2KJQA 2YZKA 3DVAA 1B8UA 3WNBA 1TW3A 2CWWA 3LPAA 2QMOA 5C4GB 5HK8A 4YIKA 5I7WA 1H5UA 3MRTA 2GJKA 1I2DA 4I19A 4TN1A 3S5UA 3EASA 2GPWA 4HL6A 5ELMA 3JQ7A 3EXIB 3P9QA 5HIAA 4B7AA 3ZIDA 3FLBA 2YWGA 1M33A 1YR8A 2FOIA 2H3HA 3MERA 1U0JA 3B13B 3RF6A 4DAOA 5DNEA 2R68A 1GPAA 4RJTA 1DEOA 3DDOA 4XZ3A 2F64A 2AVNA 3BAFA 3UJAA 5AJHA 2L0XA 4U7WA 4ZZ3A 3LS2A 4I5DA 5LFAA 1UMCB 3WSWA 2YXLA 3PKJA 3OEHD 4B0PA 2HGSA 1JMVA 2HZBA 4WBNB 1RD4A 1WUJS 2Q46A 5FYQA 3JSXA 2P5UA 1E9CA 4MB6A 2ZI5A 1WCXA 3K6SA 2PLWA 1UPBA 1XJWA 2C5LA 2QUJA 2VNAA 1NGSA 1X87A 2ZIFA 3CUEF 4K8RB 3A8TA 3U3RA 2NGRA 3VOTA 3TSAA 4UARA 1K7SN 2ZB4A 1VLJA 2XUIA 1P77A 5TLSA 2W98A 1OTHA 1A5AB 3K9HA 3B8HA 3DL2A 4B8YA 3AHIA 3B9PA 3TXXA 3VC2A 4GBJA 3WNCA 4CTOA 3PFGA 3FPHA 2FMIA 1V5WA 3DF7A 1JHDA 1O6CA 1WHSA 3WIVA 3MBIA 4DS3A 2FJPA 4KFRA 5FUMA 2AUNA 2ZBGA 3ZZUA 3EBLA 1K68A 3K6JA 1UINA 4B47A 4YRGA 4ZMRA 4EKDA 2OV3A 4EY3A 3O75A 1TK9A 5DTRA 2ZE5A 3RG8A 3C8UA 4QTYA 4EI9A 5JDIA 4B3JA 3LSTA 3Q6MA 1RE0A 1AKMA 1PHPA 3TTXA 2BM8A 4RCVA 1GLVA 1QIHA 4WACA 2QR5A 3ZDZB 3TZCA 5L7WA 3I2KA 3U4QB 2Z1NA 4Z0PA 3RKSA 1Y8RA 2XAUA 4BP1A 2ZRCA 3GPCA 1YUBA 4FILA 2DLDA 5EERA 3GJ7A 2CVHA 3GZTB 3HA7A 4HB0A 3T3MB 2XNJA 2J3MA 4DIEA 4HOYA 1Z08A 3BEDA 1INLA 3ONFA 4DDVA 1A0OA 4DIUA 3CT4A 3QV2A 4RF3A 2XSZA 5JBQA 1QQ6A 1YRHA 2EZ4A 1TUEA 3E22A 3OWXA 4MYHA 4XGQA 4LDJA 4QD3A 4R7ZA 3HLKA 3K2QA 4FYWA 4R9VA 4IQ0A 4S0ZA 4N3BA 5SZKB 2ACKA 1BD3A 2V45A 2YRFA 3L41A 4D9BA 3AKEA 3T3EA 4A36A 1QTQA 5AKGA 1YE5A 2G06A 3GLTA 2RH9B 3D7NA 1K5GA 1H66A 1DXQA 2AR0A 2WWXA 4PO8A 1XZQA 1YVEI 2A84A 2ADFA 1C9EA 3K8ZA 1RM0A 4AJ4A 3NUGA 2AJTA 2E87A 4IF4A 4R81A 1AB6A 2JFFA 2P8JA 4FOLA 2YN4A 3HWSA 3HM2A 2PVSA 1JEQA 1VPLA 4OXYA 3BICA 4PAQA 2GLUA 2A6PA 2GM5A 3C2QA 1T0IA 5E9JA 1D2AA 5KYYB 4PYMA 3HTXA 4R31A 1H9AA 3KG2A 5JD4A 3V7YA 3I8XA 3T7TA 1WUIS 1XCLA 4BXOB 3O1LA 2BR5A 1EK6A 1PUXA 2DKNA 5JO0A 3WLNA 1T5BA 4MKZA 3H83A 5CPFA 4OBEA 4RHXA 5IDQA 2GTHA 1WBBA 4L7VA 3UV3A 1PD1A 2O50A 5F3DA 4EDFA 3HXQA 3EF3A 1S2OA 2ZI4A 4TZ6A 2YHUA 4KQHA 4UNPA 4C9BA 5GJVC 3H0EA 2JFNA 3I28A 4URZR 4HYYA 3RPEA 1GXSB 1OWOA 3U6BA 3ZJTA 2WBLC 1TRHA 4ILKA 1CYDA 4RL6A 4CL3A 1DBIA 4UVGA 1PFGA 1Y3AA 4BZWA 4GRIA 3IE0A 1JQBA 1SA0B 1JUDA 3RBVA 1OU0A 1JDBC 3HWX1 4LDQA 4YJGB 5IFKA 4N0PA 3R5XA 1YRQA 2VPQA 3D8TA 1YRAA 2FZEA 4RIEA 1DXOA 4EY7A 4NCNA 3EG9A 4C1NA 5HX7A 4DV5B 5KOJB 2CLLB 4YRMA 3PWZA 3DZGA 3GRCA 1ZIOA 3FWZA 3KKZA 3JAKB 2HO5A 2LDBA 4WFIA 4JBIA 4PGGA 1SB8A 2LP4Y 4NP6A 1CRZA 1HKHA 3LXRA 2JJQA 4EI7A 4EB6A 2EZ8A 1N9GB 4MEBA 1VRVA 4RUKA 3TZLA 1X1QA 2H1LA 1RWOA 1SCAA 1QFXA 2G67A 2Q5OA 3KTAB 3SZUA 1QIJA 3C87A 3E7PA 4BATA 4DDMA 3MOSA 2RGEA 2B1QA 4KYIB 4ETNA 2E1RA 3UHJA 4PC1A 3K0HA 1L4LA 5KQLA 5LSAA 2QI9F 1NW8A 4IIVA 3DV0A 4JLSA 4ENRA 1U2DA 4JOSA 2BGWA 2WP8J 4MCIA 3D8NA 3H2GA 3NIGB 3G7SA 2QKYA 2GARA 1XWFA 2C7VA 2DERA 1YVRA 2AFIB 5JWHA 3QX8A 3FYUC 3HJGA 4P3YA 1L7EA 3QUSA 4NLLA 3A4NA 4HYTA 4F11A 1BMFA 1G291 2OWDA 4FONA 1NT4A 3SBEA 3SSMA 5CD9A 3UPUA 2XE4A 1ZIXA 2X0DA 2FWJA 4BN4A 1TW2A 4P08A 2RKBA 1BX1A 4PLYA 4GHWA 1ORRA 4EA6A 1GRQA 2J67A 3HUEA 3HSSA 4MIOA 1G19A 2P62A 2C4UA 1NKTA 3BOSA 1CDOA 1RYHA 2WTNA 2HDOA 3ZVLA 4D74A 4OOFA 1PDWA 3VSBA 4WV3A 4K1XA 5TC4A 3Q7TA 1VLQA 1MO6A 2OB1A 3B12A 3JZFA 4MH0R 3P27A 4OK5A 4TTRA 5DCLA 1N3YA 4M9ZA 4BVHA 3QSYA 4H4EA 6GPBA 2IXDA 2W2LA 1XQWA 5ICMA 3NHSA 3KSMA 4FM9A 1NC1A 5LDHA 2GBCA 1Q7BA 3GFVA 1S01A 2G82A 4R1QA 2GFIA 1P9LA 4G6ZA 4MP3A 3O4JA 2PFSA 2DETA 1T4GA 3ZWKA 1CY7A 4KQCA 1JILA 1N2SA 3KELA 4CDGA 3KOOA 1JJ7A 2IY7A 3FG9A 2XUOA 3HUUA 4LDPA 4JJ6A 1AGYA 1I4DD 1P1RA 2FUNB 2JGIA 5FBWB 1M5RA 5IKEA 2W0MA 1E3DA 3AI2A 1D04A 3JWPA 3Q0EA 5JSHA 5FWAA 4CCAA 1VQ1A 3CUUA 4PFSA 5LJLA 1UIRA 4TZ0A 3FZEA 3NX4A 3KQTA 3WLHA 3K53A 2HPVA 2IHKA 2ZI3A 3LP5A 1RWPA 1CS0B 1TU3A 2VHUA 3D4PA 2PFGA 4OL0A 4PG4A 3KYJB 3VZDA 2EP8A 2HADA 3F8SA 4XGRA 1TPZA 4P98A 4AJJA 1LC0A 1V1RB 4UUPA 4CMBA 5DSZA 3DYIA 4IH4A 4V03A 4J1SA 4YJ3F 1QQ5A 3C3EA 1J5EB 1RRKA 3ZY2A 4CU2A 1RHUA 1EXWA 3C39A 1J2EA 1P1FA 3L5OA 4RKYA 3WRYC 2VTKA 1HLGA 4PCVA 1FS4A 3BMCB 4UEWA 3M82A 4DLZA 2VQEB 2F8SA 1HT1E 1EK1A 1SC6A 3AUXA 1L8AA 4KZPA 1W4RA 5LA6B 1QGZA 1VCHA 1RKXA 4IFIA 5AP9A 3TTVA 4Z3OA 2PKXA 4AQ7A 1RKUA 1PU2A 3CZ5A 3L43A 2JBAA 3STWA 2G5PA 1P91A 1OU4A 1XPJA 4BRWA 4HDCA 5CNKA 3Q8LA 3DZFA 3IAUA 5ERGB 3I4LA 3UA3A 2IU3A 4J1NA 2RIPA 4U3JB 4R7GA 3CSSA 1WDLA 2E49A 2ILTA 4RSGA 3EFOB 4YXWA 1EHCA 4EKEA 2C9DA 5BPFA 4CQLB 1ST2A 1CE8A 1LLQA 2GO7A 4JDUA 5DFAA 3RS9A 3AY3A 5CYOA 3VU9B 3L4EA 1SXJD 1C1XB 2ZFUA 1KMCA 1RAFA 3A9VA 1NBMD 1LX6A 1X80A 2R96A 4MS1B 3GVIA 4I3HA 3SQLA 4QXQA 2YYAA 5A5EA 5BWBA 4BBAA 4XIIA 5E9WA 2O6HA 1PHRA 2IWHA 5BPHA 4Q66C 4EYKA 1ZFNA 1SPXA 4JLJA 1UBCA 4UREA 3IKJA 4L95C 1HT3A 2AX4A 3WNDA 5KVQA 1LA2A 5BT9A 4DG5A 3WYGA 3WZLA 4K03A 3FYCA 1LQTA 2P77A 2G25A 1AUXA 3PUXA 4MA0A 2JD0A 5DO9A 1XA3A 4B75A 3T4UA 4ECAA 2UZ4A 2EYUA 1W0CA 2B6HA 3OZDA 1YZVA 3G8YA 4UCQA 3BSWA 1B1CA 1VMIA 4YP5A 1RHJA 5GONF 4IHQA 1KVUA 3AXSA 1IFXA 1WTCA 4MINA 1DNPA 1NTOA 4Q3CA 4RETA 2C84A 3BREA 3LDAA 1L5HA 2YXNA 4CKEA 4C7OA 4CG2A 3GJSA 5JS8A 1A9PA 2Q1YA 2FHSA 4C5CA 1Y5RA 3UPDA 3FYSA 1G9SA 3WNVA 1MT3A 1NAIA 2IGTA 3N7AA 1GKYA 4KTTE 3JQ7B 4XIYA 1MIOA 4NFYA 2C1XA 4N5HX 3WFZA 1SWWA 2NTYC 4GX1A 2YJ5A 2AOTA 2O19A 3ZV4A 5EJ5A 2YXDA 1FF9A 2VK2A 3CO5A 3MFYA 1NLFA 5HDBB 1NVWQ 2PXCA 3SKYA 2O52A 4B7ZA 5LUAA 1Y1LA 1PR9A 2QLFA 3FPEA 1O6FA 1RWWA 3OKPA 4JI7B 5ITSA 1ZK2A 1JF8A 4W1PA 2H54A 4H3VA 5JT1A 3TLMA 4DIDA 1CHDA 4ZCPA 1GA1A 3KFXA 4FFBB 2YR0A 1YZTA 3JPWA 4U6SA 3H16A 3ZHSA 4IMRA 4N7MA 2YXEA 2M98A 3N8HA 4HHEA 1CLUA 2Q49A 4MUYA 2Q7DA 4AZTA 1BS1A 4ZVPA 5U9CA 4MCHA 4JI8B 1N0WA 4RABA 3CZMA 5DBOA 1LZLA 1NOJA 3QVGA 3TRFA 3SOZA 2QRLA 1KHHA 2HJGA 3A4TA 4RD6A 4A8JB 3SX4A 4X84A 2ZCVA 1Z36A 4EKIA 2AZMA 4Q01A 3DDWA 1Z6AA 4QLAA 5GV7A 1PJSA 2CDBA 3GQBA 1JH8A 4LZAA 3A3YA 4TMTA 3W1EA 4KAFA 4EP1A 2HHCA 3TSCA 1NV9A 1VCIA 3A32A 4B8ZA 5ES4B 5LQMA 3RNOA 2Q5CA 4IDPA 4FQ8A 3OFVA 1OI3A 2R5NA 1GHTA 2ZITA 1P7ZA 4EX6A 4JLOA 5BUSA 5AVJA 3ID6C 3BXXA 1Y3CE 1W4CA 1RT9A 1G7SA 2P41A 4HRAA 4P5DA 3T12A 3NIDB 1DO0A 2W22A 2HHHB 1HKUA 3I64A 4KR2A 3K7EA 2C5GA 4DQUA 1UWLA 3H8JA 4TVOA 3LA8A 3S1AB 5JR3A 2X1LA 1W2GA 3N0TA 3HYCA 2WTUA 4CGYA 2D0PB 2YIMA 1UJBA 3A6GA 3HN2A 3QHPA 4M1TA 1RMYA 5ALZA 3P97A 5JSZA 1WEHA 3VR3A 5LD2B 1JGTA 1B73A 1EG7A 1LXCA 2N0SA 1T4BA 3SBOA 1ID8A 1U94A 3GRUA 5JH7A 3M81A 1P44A 2PYIA 3DMYA 4Y9DA 1FJXA 1PKEA 3RANA 5EJ7A 2ECOA 3ZX5A 2D7DA 4ECEA 3B3FA 1MCZA 3OQPA 1YVUA 4KNYA 2I2FA 1I2BA 4RWZA 5KYGA 2D7JA 5CLLA 1CEEA 1JU4A 3D3JA 4CDMA 2J08A 4BRUA 5IKPA 1D6SA 1E4VA 1YIDA 4ZCRA 2YKGA 4E94A 3JWEA 4J3JA 3AKCA 4ZPXA 5I51A 3UCXA 4FFNA 1U4OA 1A2KC 1CIJA 3AUUA 4A03A 1XNQB 1RKBA 1FUKA 3DHWC 2WWIA 4FCVA 1C7QA 4YCBA 4GT1A 2C3YA 3PWSA 1NSYA 5AW8A 2H7XA 5LCXA 2XOKD 4EAAA 1UT6A 4BNGA 2PH3A 1NFQA 4RGYA 5CH3A 3SLKA 2JVKA 3DFUA 3BD6A 1K8YB 2YQZA 3CIFA 3HB0A 4KRYA 4M99A 3O8BA 2NVWA 1GPYA 3T8YA 2DQKA 4CL8A 2BGMA 4ZDKA 1JI0A 2FYTA 3NHZA 2O5CA 2IV3A 1C7EA 5K6AC 5FPYA 2HR1A 1NMYA 2GAJA 1AUQA 3ME5A 4O4LF 1R4ZA 3HA2A 5JLAA 3CH7A 1I32A 2Y1FA 4ZV7A 3PGKA 2WILA 1WOYA 3HHPA 4XCXA 3O9VA 4FYYA 4G5FA 4FGUA 4MV3A 1CLEA 2IS6A 2Y0PA 4YTEA 5H0IA 3S1SA 4O4IA 3ZW9A 3PEYA 2VNHA 2X2EA 4J0QA 1KL7A 4YJGA 5AHKA 5J47A 3F6YA 4LJ7A 5FWNA 3AUKA 3MTQA 4LEIA 1D1QA 4GXRA 5G53C 3D4OA 3ZGZA 3DEKA 1DS6A 4HQ6A 3KDSE 3KL4A 3E84A 2CJXA 2H65A 3AI1A 3NBUA 4BMPB 3I9NA 2NO1A 2QTAA 1R0YA 2R1TA 3V1TC 5AKZA 4BWGA 1RRGA 2J5BA 1J42A 3AP1A 1NLMA 2PVCA 1Y9AA 1ZM7A 4UTXA 1G2OA 2BLLA 2GEFA 4IZIA 2CMDA 1P0QA 1OWLA 2W8BB 1N2CE 2G17A 1EVYA 3GDGA 3TVDA 1YU9A 3HJNA 3RIXA 1IOZA 1T36A 3KZVA 2G71A 1OLUA 2QVCA 3M4ZA 3NTQA 3P0RA 4IKOA 1IHXA 3EMVA 3ROXA 4CJXA 1H2AS 2V65A 4HNAA 4B84A 1CFZA 3W8EA 1L4HA 4CKEB 4D99A 3E70C 2PTHA 3X0DA 4R8VA 2ZRMA 1LKZA 4A9AA 3K09C 3IP9A 4GP7A 2VTEA 3RAGA 1M6EX 2W2NA 4ALNA 3EUFA 4EQZA 3GRFA 4C0KA 2B8TA 2XQIA 4X1OA 3Q5DA 1RABA 4DGSA 1JH9A 4FDMA 3AWIA 3KQWA 1Q19A 2IE8A 1QVWA 2PGJA 2ZIAA 4QULA 1KP3A 2GCOA 2QM0A 5B12A 1HETA 3L18A 4RTJA 5HUHA 2JGRA 2W6OA 1Y5IA 3LCCA 3QFSA 4K28A 3S8MA 4BC1A 4ZI7F 1SU7A 3NTOA 1OUMA 2JIQA 3G49A 4ZANA 2TYSB 4MP6A 4A8JC 4F85A 1VHJA 4DREA 1MX1A 1XDUA 4J0IA 3JQ9A 4IQ8A 4L9SA 3HVJA 1X7GA 4M9UA 3G88A 3O3OB 2I65A 3LF1A 4GO1A 4TWZA 3K1ZA 1NI4A 4NYJQ 1NLUA 1ULZA 5JSFA 4BKRA 4E11A 1XL0A 2ZT5A 2WJIA 1JXAA 1P1HA 3KBBA 4QPPA 4NU5A 1M73E 4RIIA 3N9IA 2HLHA 5GV8A 3ZOZA 1KEZA 1CBUA 1MO5A 2CE7A 4Q1FA 4RIGA 1D1PA 1VHLA 2QJOA 3W3AA 1O95D 3FMGA 4UBLA 1SOUA 1SXPA 1LFDB 4D5GA 5DM1A 3DBVO 3KWJA 4DLWA 1TJ5A 1EHYA 2FJ0A 2OZLB 2Z56A 3A31A 4BDTA 2PVPA 2ZTLA 5ER9A 2SICE 2V0CA 4AZ0B 3RFUA 3EGXA 4TWRA 3M3DA 4PYRA 1P0CA 2VLBA 1A2OA 1ECBA 2P6PA 1V45E 2EJUA 2ZWVA 5E1OA 3OICA 1MD9A 1TF2A 2YJ6A 1L4KA 3AEUB 4WOKA 2VPPA 2RGWA 1XXHA 2JEOA 3DFZA 3O8LA 4BV3A 4D98A 1QPZA 5DN9A 2IXGA 3OY7A 5LXTF 5TF0A 3VFDA 1ZEJA 1FVXA 5CB4F 4UU0A 5EQTA 1CD5A 5K0BA 3DMTA 4YRZA 3BORA 1ZCBA 4Y9SA 2CXRA 1V1RA 2WJWA 2WHQA 4QFBA 4HNVA 3GFBA 2CFOA 2H57A 1DTEA 1P61B 1ZEMA 2G1UA 3K0FA 5I5GA 2KMLA 4BTEA 4ZO4A 4L16A 4OHCA 4DVGA 3EUAA 4RV5A 5BSEA 1Y6JA 1SO8A 1FNCA 4A0QA 4JA2A 1LPPA 3LQ4A 5A04A 5C1OA 4DDWA 2O5RA 1NOKA 3UJDA 4EBFA 2ZYTX 3M2PA 4Y2HA 2Z4TA 4MR8B 5G4KA 1YV9A 1YD7A 4GLOA 4CIXA 1MHTA 3FF1A 1KZ4A 1LSOA 1ZJYA 2JAWA 1N5LA 1KDVA 2B2XA 4R9RA 4QFMA 4UFPA 4MAFA 2CV0A 1GZSA 2HT1A 3V4ZA 2ZU6A 3SG0A 1N3BA 1FRZA 2R8EA 4P7BA 3E61A 4JJ8A 4PXSA 1ZA1A 4CT5A 5B4TA 1HYBA 2O8DA 4OSOA 1SRQA 1VB5A 3KXKA 4I8IA 3R9XB 4QPCA 1H9CA 3CO0S 2FZKA 1DAKA 5IK2A 5CB0A 1I94B 1O96B 4Q4DA 4M1OA 1YQTA 4YFYA 5TDHA 3I1YA 3PU6A 2DUUA 2AQ8A 1P74A 5FPHA 1PGNA 1P6UA 2HYDA 2YY6A 3B89A 3CCFA 1H2WA 3VU9A 5JCZA 1X9HA 3ROZA 4DCTA 4URUR 5E95A 4CM4B 3ZJ4A 3ZPXA 3M5PA 3A2LA 1Y8AA 1U8EA 4X7RA 2DUNA 4GP6A 3UCFA 1X38A 3VU1A 4N03A 2QR3A 3RQSA 4EG8A 2A5YB 1R4NA 1XTBA 4G41A 4OO3A 5DE3A 2AUMA 2ORYA 2GZAA 2IF0A 1AA6A 2VF5X 1O9HA 2O8EA 3W4JA 2HHJA 1CIPA 3AHCA 4Q1EA 1YMQA 3H9GA 5JS6A 1WZNA 2WIJA 1K08A 1W85A 1R6VA 4U7FA 3ZLVA 5BXQC 2W6NA 3CR3C 1ZONA 2X13A 3RUFA 1HGXA 1KQOA 3ZE9A 2JLSA 4XM1A 5B2ZA 4JYMA 3ZJYA 3ZCTA 4LF5B 4FGLA 2VDJA 2VZ8A 3TL3A 1W5BA 4B79A 5BSVA 5K3OA 5K8LA 2MMGA 1IM5A 3DDSA 4N7JA 4EG5A 3U09A 1OC2A 3DYVA 1HG0A 1AMOA 4KREA 4YRCA 5H59A 3O1IC 1PX2A 1VFNA 4PRYA 2H0AA 5DMXA 5IEBA 3O4FA 4KIWA 2I3AA 5LJIA 1RXVA 3EHDA 2QLNA 4P7JA 4PLCA 3DEJA 4TKUB 2DWQA 4OXRA 3C3AA 1UH5A 3ETCA 1E98A 1U8FO 2AI1A 3H65A 4I14A 5DSTA 1MN6A 3UK6A 3ZN2A 2HOQA 3USES 1IMOA 1JQ3A 4P38A 1U8YA 2P78A 3CU5A 3K0AA 3DPIA 3HADA 1OYYA 4P84A 4QOIA 4QYSA 4LRQA 1T2FA 4HS9A 4YYEA 1QRTA 1NVKA 2PFKA 3GLRA 1YZUA 4KQIA 5TPZD 1ZD4A 3FNEA 1CDEA 4AX4A 5I48A 2HF2A 2PUWA 3NHRA 3VR3D 2YJZA 4BEBA 3FPGA 1LX7A 3JZMA 3LLUA 5CD1A 2MCFA 1HEUA 1KI7A 1RXSA 1VDZA 4GLFA 3S7ZA 5C32A 2B78A 5L3QA 3EMBA 5DDIP 3ERCA 1JIQA 1QUFA 2ERXA 5F52A 4LYHA 4X20A 3IEVA 1SZCA 2KHZA 5JE8A 1DFIA 2A59A 3H9QA 1OA0A 4OHRA 1DEHA 2IOFK 2JCBA 2AR9A 1OMOA 4X44A 4TKVB 5KIAA 5MN5A 3SF0A 5JNSA 1XZIA 5E9AA 2HT6A 1J20A 3TSWA 1Q0QA 1BDBA 1OYOA 5EUCA 3ZR4B 3P2EA 5TSDA 3TLGA 1XMQB 4LSMA 1TECE 4FYIA 4GR9A 3M6IA 2VS1A 1YS6A 3IVAA 3H6KA 4B31A 1EZ4A 1XVLA 1GA6A 3UOAB 5F9MA 5ALPA 2PMFA 5KYKA 1KGDA 3DAYA 4LZNA 2WIKA 4OLFA 1V3VA 1YI8A 3AV0B 1PGJA 3RTBA </