1SUAA

Subtilisin bpn'
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
263
structure length
263
Chain Sequence
VPYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLNVAGGASFVPSETNPFQDNNSHGTHVAGTVLAVAPSASLYAVKVLGADGSGQYSWIINGIEWAIANNMDVINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGTSGSSSTVGYPGKYPSVIAVGAVDSSNQRASFSSVGPELDVMAPGVSIVSTLPGNKYGAKSGTAMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGDSFYYGKGLINVEAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (hydrolase/peptide)
molecule keywords SUBTILISIN BPN'
publication title Crystal structure of calcium-independent subtilisin BPN' with restored thermal stability folded without the prodomain.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
total genus 92
structure length 263
sequence length 263
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 1997-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1suaA00
3I30X 1SCDA 4JP8A 1TO1E 1PEKE 5AQEA 4WOCA 1PJ8A 4H6WA 2PYZA 3DE3X 2W2NA 1Y3BE 1C9JA 1AVTA 1SBTA 2WUWE 1WMFA 5JXJA 1AH2A 4GI3A 2ID4A 2Z56A 3AJ9A 3LPAA 1IAVA 3QFHA 1R64A 4WOBA 1JEAA 2B6NA 2SECE 2HPZA 3SICE 3GCWA 3WQBA 1Y3FE 1EA7A 3P5BA 2X8JB 1NDQA 3EE6A 1BH6A 1TMGE 1BE6A 5JXHA 1BJRE 2X8JA 1ST2A 4OMCA 3F7OA 3DWEX 2ST1A 4RYDA 4K8RB 1Y1KE 4ZARA 2DUJA 3DW3X 1TM5E 1SUBA 4OV6B 5AMXA 1TM7E 5SICE 2W2OA 2G4VA 1GNSA 1PTKA 3VTAA 5B1DA 1SUCA 1BE8A 3F7MA 3QTLA 1SN7A 1WVMA 2GKOA 2DQKA 1YJBA 2SNIE 3VV2A 3DYBA 1SELA 3VSBA 5ARDA 1CNMA 4NMXB 3HJRA 3PTLA 4BWGA 3DE4X 4C3VA 1SUAA 1R0RE 4KB5A 3T41A 3ZXYA 1SIUA 5ARBA 2PWAA 4HVLA 1ST3A 1UBNA 3AFGA 3DE7X 2Z30A 5B1EA 1C3LA 1XF1A 1MEEA 1AF4A 1AK9A 1V6CA 1WSDA 3VYVA 5AVKA 1WMDA 1TM4E 5JXIA 2HD4A 2Z2YA 1EGQA 1BFKA 1NLUA 1MPTA 3QMPA 5FAXA 4HX2A 1T1EA 2Z2ZA 1DBIA 1SUDA 5FBZA 2Z57A 1BFUA 3DVRX 1SIOA 1Y3DE 4DJ5X 2ID8A 1TECE 4NE9A 3GCXA 3I37X 3WHIA 3Q40A 1SCJA 2ZWOA 1Y4AE 2IXTA 3A3OA 1LW6E 2W2MA 1ZVKA 2W2PA 4MZDA 1T1IA 2ZRQA 1YJCA 4I0WB 1AU9A 3DE0X 1S01A 1GT91 3DDZX 1Y33E 1Y48E 3TI7A 3VV3A 3A3NA 2DP4E 3BGOS 2PQ2A 2W2QA 1CSEE 1TO2E 5JXGA 1Y9ZA 1KDVA 1A2QA 2Z58A 4NE7A 3EDYA 1PFGA 1S2NA 1VSBA 3Q5GA 1KDYA 3WIUA 4LVNA 1Y3CE 3DVSX 3BX1A 1GTJ1 2SBTA 4FONA 3H42B 4AKTA 1TK2A 2IY9A 2E1PA 1DUIA 3CO0S 4M1ZA 5JMOA 2TECE 1P7WA 4ZOQI 2PMWB 3L1KA 4OMDA 1SBNE 1SUPA 2QTWB 3VHQA 1GTL1 1SBIA 3EIFA 3PRKE 1SCNE 1YJAA 3D43A 1TM3E 2SICE 5FFNA 1WMEA 1IC6A 1SUEA 2WV7A 4AKSA 3GT3A 3SQOA 5I9SA 2WWTA 1SPBS 4H6XA 1T1GA 4B5LA 1HT3A 2ZWPA 3DE2X 1KDZA 1SBCA 3LXUX 4CFZA 1SBHA 4J94A 3I2YX 1OT5A 1SIBE 3UNXA 4YN3A 4KG7A 4KPGA 3LPDA 1SH7A 4H6VA 1OYOA 1SCAA 3F49S 1NDUA 1Q5PA 3TI9A 3CNQS 4C3UA 3DE5X 2XRMA 1TM1E 1GNVA 1GCIA 1SCBA 1AV7A 3OSZA 3AJ8A 2V8BA 3D9QX 5AVJA 2P4EA 2XTJA 3DVQX 3WIVA 4LVOA 5K7SA 1Y34E 2PRKA 3DE6X 3I34X 3DW1X 2WUVA 1GA6A 4DWWA 1C9MA 1SVNA 4Z2AA 1V5IA 1AQNA 2PWBA 3DE1X 4DZTA 1R6VA 1C9NA 1GA1A 3ZXXA 1P8JA 1KE2A 1THMA 1OYVA 1P7VA 1S02A 1GA4A 1Y4DE 3BPSA 1ZVJA 2PKCA 3A3PA 1KE1A 5CW1A 1GTG1 4CFYA 3GT4A 3LPCA 2Z2XA 3TECE 4CG0A 5ARCA 1YU6A
chains in the Genus database with same CATH superfamily
3HKCA 1QGDA 3LRTA 4MX8A 4W5WA 4AECA 1SCDA 4NYIQ 4MEBA 1TO1E 4MPDA 1PLJA 1NVKA 4X1KA 1HDOA 4E14A 1W0JD 5IARA 5A2GA 3EDMA 3GW8A 3WGVA 1OV6A 1CJKC 1GRCA 1NDHA 1T35A 3NHKA 4A0RA 1C9JA 3GRRA 1ZZGA 2Q1YA 5LQNA 2ZSBA 2I3ZA 2QMOA 2REXB 4G67A 4OHFA 3FXAA 1E2IA 1FVHA 4DG9A 1W46A 3G2NA 2BEVB 3OFJA 4OXYA 3H9QA 3COJA 3WGMA 3M6IA 1SHUX 1CW2B 4HBZA 1SC6A 2GOYA 1Q0LA 4QM6A 4QOGA 1SQFA 1ZOOA 2GBLA 3D3KA 3G2QA 3H1EA 3L4SO 4HB3A 2PKQP 3QW2A 4C43A 4E3ZA 3HSYA 5ALMA 4WOBA 3TTVA 2H9YA 4V24A 2FWJA 2NO0A 4L27A 5EKDA 3RANA 3UJDA 3GLIB 1X87A 1AA9A 3FWZA 2DFDA 2RHOA 5LXTA 4FEGA 3HXLA 5AXAA 1FNBA 1SG9A 4UD2A 3KQUA 3KWFA 3OCYA 1MTZA 3QPDA 4DRXA 3T0IA 1J9GA 5HIMA 3WQBA 5J4VA 1DIBA 1YZKA 4JNCA 1JR3E 1TUIA 4HDRB 4LXYA 4AF8A 3AKZA 4DLLA 1R9MA 4PZCA 1NDQA 1N2SA 3B2EA 4DT1A 2ZYTX 2HA6A 3BIOA 3VVCA 2DR0A 3KPVA 3C1AA 1AZWA 1H1LA 2EW8A 3NTUA 4KQ2A 4JIGA 2YWBA 1E7RA 3IQXA 3S2UA 3EGXA 3C1OA 2ZIEA 4DCPA 4E09A 2PS3A 4NJMA 1H66A 5EY5B 1KA9H 1G42A 4RTNA 3B52X 1BJRE 4J6EA 3TOZA 1UEXC 3TJMA 1C4KA 1ST2A 4MKZA 3EXAA 3U4DA 2GBIA 3LHIA 2PZKA 2B30A 4Q4JA 1Y9DA 5F3DA 4YRIA 3R9XA 4K2AA 4FMCF 1D2AA 3LVBA 4GXNA 2P6OA 4IDOA 4YCBA 3BDVA 3H6HA 3DDNA 2G9RA 1JEJA 4W8GA 3L4JA 2WEKA 1JHUA 1CY2A 3O4GA 3I4FA 3MRSA 5EWJB 4Z4FA 1HE2A 1ZMRA 2FX5A 3P96A 2JJ8A 5HE8A 3T9FA 4KRXA 4UM9B 1JWAB 3NGLA 4EG4A 5LZ4A 2LE0A 5HKKD 4GSLA 1L5WA 2RH8A 3AR5A 4CEHB 3V4ZA 2FOXA 4W8OA 3NWJA 1NI4A 1FFCA 2QTVB 5AMXA 1S4MA 3TNLA 1X94A 4BNIA 3AY0A 2PIDA 3A37A 1R12A 2UVPA 3CN7A 4H4EA 3EPHA 2C5BA 2ODBA 2UZ3A 3EGDA 3DLPX 3GVHA 1WM1A 3JCZA 3O84A 2I54A 4F9EA 4A8JB 1HYBA 4KYTA 4DIBA 2PPVA 3DTTA 1M2OA 2EG9A 3QX3A 2PUDA 1M2KA 2FG7C 4NBRA 4F1WA 5BSKA 3K9FC 1S3GA 3KJNA 2GYWA 1QPZA 4UMEA 5FUXA 2ONKA 2W9XA 5TLSA 5H3HA 2JJMA 3OVMA 1RXWA 4OHMA 3MRXA 3KWLA 5DHUA 4A5OA 1DXQA 1FFXB 3NM4A 1N1DA 1EDDA 1O94A 2D1YA 2PGNA 4ZZ2A 2GCEA 1OT3A 3D64A 1RPTA 2EWMA 3GVCA 2IUUA 4RV5A 3VC3A 1KRWA 1GG5A 1NBEA 4P84A 4BMCA 4ZQBA 1L8AA 1L5RA 2AYZA 2ZCUA 3W2FA 5FBQB 5AK6A 3FA2A 3O74A 3VKGA 2C5SA 3PD1A 5G0WA 5TARA 5IKXA 1IMOA 4FZRA 5B7QA 1D2NA 5ERXA 4BBJA 2P6PA 5AIBA 4AN4A 4ZDKA 2R79A 3EFEA 5AJTA 2OPBA 5HUQA 3VKHA 2OFWA 3L79A 5DEIA 2MYTA 5DKFA 1DEHA 1DDOA 1CIPA 1YCGA 2GAIA 3NAGA 2PX0A 3ZDRA 3AEKA 4HVLA 4XFKA 5HKBA 1ES9A 5HRUA 2NXCA 4EX7A 4U2GA 4Y2TA 3UV6A 3BIWA 1IBCA 5FB3A 4AM8A 5DYNA 3VGPA 3PXXA 4D96A 1MKYA 4HH3C 2YVLA 3A2MA 3VTKA 3EXFB 1VE1A 3ENWA 3V5NA 2FCRA 4UHHA 2JLAA 4LRUA 1N9GA 5HX7A 3GLTA 4AMBA 3U7GA 1WSDA 5BOSB 1PHRA 3K6RA 1LJUA 2WFZA 2VXBA 3OETA 4HX5A 4LQDA 1FLNA 1MAUA 4OXIA 4UM5A 4YLEA 5DGDA 3V8PA 1ODCA 3DZCA 1Y63A 4TXMA 2QW1A 3RF7A 4N7JA 1BMDA 3FYHA 2R4UA 4HJXA 4HYQA 2P5SA 5K3AA 4E5NA 5JMTA 3IV6A 1N77A 2EGHA 2A0FA 1C7QA 2G4CA 2Q50A 4XFJA 3E8SA 3ZE0B 4FZJA 2P90A 4EB3A 2QX6A 4M1KA 3O31A 1A2OA 2B2CA 2HJGA 4YAGA 1QGOA 3C1UA 2FE1A 3NYRA 5JCPA 3HMKA 4LG1A 2ADMA 5C35A 3DL7A 4UXHA 4JJKA 5EQTA 3F4BA 2XOEA 5GMOA 2BVNA 2FW9A 2QTLA 4IYRA 1DOZA 1LNQA 1TZCA 3ASVA 4B44A 4ZQHA 3NBFA 2HK6A 3OQHA 1WLYA 3MWYW 4FDVA 2HWWA 1Z0IA 4DJ5X 5EJ7A 4DA8A 2VSXA 5TMBA 2RGYA 1KI2A 4ZMSA 1EH5A 3PUJA 4IEFB 5BV1A 5F3WB 1R0CA 2B2NA 3KVVA 4GPAA 4L0QA 4NSNA 2GO1A 2OD7A 2VT3A 1MAHA 4G5HA 3AVQA 2OCDA 4ZKEA 3UTDA 2DQZA 2R4TA 2WF5A 5F5LA 5G0UA 5BUSA 3VH1A 4DGSA 3CPEA 1E6WA 1T3GA 5U9CA 5C1DA 1P61B 3G89A 1Y0BA 3R0JA 2GZDA 1GKYA 3L0ZA 1VIAA 3Q6NA 3FPBA 1JFLA 2BGKA 3GRYA 4XH9B 4H1WA 3N53A 5AOAA 3BRWA 3K0SA 3A1NA 4JJGA 1P5HA 5ICGA 5DGXA 3IOMA 2DETA 2ZS9A 3CZ9A 3UKOA 2ZTLA 3NP7A 1NW9B 1XI2A 3EQ9A 4BTVA 1YZGA 4MA5A 1QZ3A 1U0HC 3HEAA 1JE1A 1WV0A 2HIGA 4UMDA 2PL1A 4IIJA 5EHIA 4BKRA 3OZDA 1LSUA 5GJWC 4I55A 4BQSA 5JNUA 5HJ5A 1RMYA 2JLUA 1OWLA 3WLJA 3MK31 4O2AF 1F2TA 1AX9A 1TTPB 3C39A 3PQ5A 4MIEA 1T34A 4ESEA 4ZJPA 1U2QA 3G7NA 3JQ7A 4X84A 4EHNA 3C14C 2OK8A 4H7JA 4S04A 3M1IA 4JDPA 1NVXQ 1A7AA 3A3NA 5J9FA 3LPNA 5B1HA 4ZC8A 4FGLA 5EMJA 3JAMA 2QAGC 1TD9A 5CFMA 2CMFA 3L05A 3G0CA 2XD9A 3MZ0A 4EKNB 1U80A 5BW8A 4CF3A 4P83A 4AKIA 1Y9ZA 3SX4A 3JATA 1P39A 2X9QA 3ZGYA 5JOQA 2Q6IA 1XL1A 4CWAA 4KNWA 4ACAA 1IFXA 1D09A 4RD0A 4S05A 4IF6A 1I13A 1ZSYA 4JYMA 2O3RA 5HA5A 3Q9UA 4EF4A 2NZJA 2QY9A 2JIZA 2VDLB 3O3NB 2VDPB 3I3SR 4G09A 2YYYA 5FQNA 4DEVA 1U3GA 2BEUB 2WFAA 5CDTA 3ZHOA 2RGRA 4AY5A 1KSHA 1AOXA 1Y3CE 3PITA 3QFFA 3UKJA 4AUEA 1G9TA 1G0NA 2BE7A 3LT0A 4EJSC 4QICA 4C0QC 3JAWB 1OZAA 1XEXA 4B3SB 1A8PA 4UBJA 1YDHA 4AO7A 4YCMA 3BD9A 2IZ5A 5GAJA 3TM4A 1E3LA 1P75A 3BA1A 3BX1A 1B74A 1WUHS 3PWTA 1JDNA 4GOND 3OPYA 2WF6A 5AYVA 1XPOA 1MO6A 1ZQ9A 3H42B 3WGNA 3PTAA 1GAWA 2Z6UA 4I5GA 2AOTA 3FH0A 3FOBA 5BQ3A 3NM6B 1VL1A 3JYQA 4UVHA 1OTHA 1ZG3A 2I55A 1XAJA 2QVBA 2RJOA 3PXBA 2DTXA 3KUXA 1YFZA 3PI7A 4KVZA 2W42A 6REQB 3JQAB 1YMUA 1QH8A 3A6LA 1T3ZA 3C3XA 3L82B 3LS2A 2QV0A 3N0WA 3VZDA 2IU4A 1Q11A 5FOSA 1GVNB 1U7OA 2EIHA 4YCAA 5TPZD 1NE7A 1YJAA 1E1QA 3CLTD 2ILTA 3DZDA 3ESDA 3KKPA 4PLVA 1MX3A 4XJVA 1KI6B 2IQIA 3KKNA 4Z9FA 2G76A 5IVIA 1XQWA 3FYSA 1O96B 2Q0QA 3KHSA 1U98A 1EK1A 2FPMA 1X2BA 4KU4A 2R8PA 3U17A 2FPIA 1JIIA 2RGCA 3SN6A 3AUJB 1ZXBA 3RVJA 5DHQA 1PQUA 2FY8A 3GARA 1IY0A 2J5RA 4MUGA 4Y2XA 4YRZA 3N07A 4J76A 3CB2A 1EFCA 4Q4HB 5CR9A 1QLJA 3V1YA 2XMSA 4ZO7A 3MINB 3O3MB 2IDMA 4OU4A 3LW7A 4PHTA 4BX3A 1DAGA 2ZWPA 2LUOA 3V4LA 4C7VA 4CKCB 3LBAA 5I7VA 3IEKA 2QVXX 3LXUX 2CXQA 2Q21A 4OHXA 1OAAA 2V03A 4L7QA 3QUSA 3BWCA 3KAPA 1A8IA 2W58A 1OHHD 4TRMA 3H11A 4UREA 1YS7A 1FTNA 1ULHA 4HFJA 2AH5A 3E7XA 3VOAA 1BCSB 4KDCA 4PLHA 3WL5A 2OBLA 2CLDX 4WA7A 2F1OA 5HEKA 2V7BA 3OESA 3BTSA 3N7UA 3PQ4A 4AL4A 4CR8A 5B36A 1APBA 3IEMA 4F9TA 2D0OB 2F3UA 1B8UA 2VFAA 4WNIA 4EO7A 1YKGA 1QGUA 5A03A 4D4LA 2PPLA 3OLCX 3DCIA 2C7PA 3FUVA 3HGMA 3UOWA 4ZCRA 4MVJD 4H6VA 4QG7A 5C3UA 1TQ4A 1SCAA 3G6WA 3DMTA 1HG0A 4EVSA 3Q5DA 4XSHA 1IN4A 4CMJA 2QJOA 4YAFA 3HO8A 1I30A 5H16A 5K3EA 3MTEA 3PDWA 1Y6RA 4NYJR 3FSJX 5K4AA 4I5FA 1LDYA 4NOMA 4UJ3A 3MWKA 4U02A 1VG0B 4IMIB 1ATIA 3G2KA 1XFAA 3JQ9A 3QF7A 4UEJA 3ZLJA 2F1RA 3BBPA 1XT6A 1K4KA 2HIMA 1U3CA 2HMAA 4KAJA 5T6BA 3SY8A 1MB2A 1J39A 1W0KA 4MPRA 3DV0A 3K5IA 4GLFA 1FMLA 3VPCA 2ZB4A 1R1DA 5KCZA 4IPTA 3PRJA 2JFWA 3FPGA 1XZCA 2YRFA 3C48A 3IHTA 4GXQA 3TZEA 4GPTA 4KZKA 4N8SA 3U4CA 4S1TA 1FDWA 3KKOA 3IOCA 5FBHA 5A4DA 4C3ZA 2FR8A 2JFQA 1XAHA 3I09A 4LYYA 2X2EA 3U4AA 1V8PA 3CVOA 5DVZA 5BN5B 4BLRA 1E0DA 3PA8A 1CJVC 5LLTA 1DP4A 3N9IA 2UZIR 3ND6A 1DJOA 2P75A 2ZRNA 1GNLA 3TZ6A 2Q4TA 4TL9A 3KUKA 2A9PA 1ECGA 2WWFA 1Y1PA 1KP2A 2JVKA 5JCOC 5LP1A 1JIUA 3ZDQA 3IR6A 2EVWX 1QH0A 1PO7A 4PTZA 4CV3A 3I2FA 4P7BA 1YFJA 1ODKA 4UAGA 1WS6A 3N7AA 3NKLA 1GA6A 1Z7WA 2C07A 2C92A 3HZOA 3P2YA 4D46A 1FF9A 1TJ3A 1SVNA 1XHLA 3GP5A 2G0AA 4BVFA 3FOFC 2X5NA 4EY6A 3QU5A 3U7JA 1D0VA 2GB4A 4TSRA 1Q7GA 3NV7A 4DWVA 4FD3A 1EGMB 3FHLA 3JQFA 4H6PA 1P4HA 4NOLA 3G49A 3HCCA 1EK0A 4FHEA 2CDAA 2JI7A 4HJRA 3NNSA 1ZD8A 4ETMA 1TEHA 3FHTA 4EHJA 3S1AA 2OM6A 1XEAA 1MDBA 2H11A 1D1QA 4QXOA 4RZXA 2A67A 2LDXA 2NZUG 3AONB 3GNLA 4EA8A 1X6VA 2VDOB 1ICEA 2P69A 3L46A 2OXRA 3MGGA 3PNYA 5AJVB 1MIHA 3CX3A 2RC5A 3FWNA 4F5ZA 1XLTA 2Q3LA 1Z2NX 1EUDB 4HADA 4GI2A 3KZOA 1W48A 3OZGA 5KMGB 1KOLA 1P7VA 5BN4B 3VHXA 2I2CA 3QLTA 2OZLA 4HOYA 2VBCA 3EG9B 3LX6A 4P82A 1H8HD 2FAXA 3AB8A 4YFYA 3PC8C 4EHDA 5HTOA 3ZHSA 2TMDA 3LGSA 1T6ZA 2XJ4A 1ZAKA 3R4CA 4BGEA 4BCCA 3HXQA 4AAYA 4B3CA 3WLHA 3VKUA 4YLYA 3LY9A 2DPGA 2NP7A 2H0QA 3UWDA 1J21A 1T0BA 2AFIE 3B8EA 4GWGA 1EEHA 3H3JA 4JP2A 5AJXA 4ZT6A 5J58A 4FSHA 2PO7A 1PZNA 1KOGA 3KYCA 4DDTA 1IXYA 2IC5A 4IL5A 1GR0A 5B2ZA 3HJNA 3AG6A 3MRTA 1Z6GA 3PT9A 2FZ5A 2ZLBA 1AKVA 1U8CB 3PFCA 4N49A 4DPLA 4B3TB 1PLKA 3GJQA 4NENB 2X7HA 1N92A 1GG9A 1X1BA 1QO0A 2JZCA 2Z3VA 5ILQA 4CCSA 5CA1A 3DNMA 5JO9A 1RCUA 5A5GA 4XWKA 2BSAA 2IP1A 1ZUNA 5BSMA 2D2VA 1E4OA 4C0JA 3LK6A 3ZTYA 2Y1FA 4YEDA 1N5IA 2KE5A 4WBNF 2XSZA 2C2OA 4QJIA 3Q10A 4CG0A 3W5DA 4AZ0A 2CJWA 2A9JA 2OAQ1 1E7WA 1I5OA 4Y9UA 1J07A 2ZROA 3RTCA 4MJ7A 4XQGA 1D5WA 5EE1A 5J1SB 1Q50A 1MJNA 2M9MA 2LWIA 1T36A 5REQB 4Q9KA 3PRYA 4QQNA 2UYOA 4Y18A 5K3BA 4HRXA 3UH1A 4CJXA 4QRHA 4MI1A 3WKBA 5JJCA 2D4HA 1WMFA 4JL8A 2WTNA 1BHQ1 3LXMA 3ZQ4A 4M87A 4MR7B 1S8AA 4LSMA 1R6BX 1V26A 2HK9A 3T4XA 1EFPB 1EVJA 1P0PA 4BKOA 5GJBA 2EYQA 2CVOA 3BAZA 3ZCXA 3AFIA 5KYXA 3MSCA 2JFGA 1RKUA 1DWQA 2B0JA 4PBSA 3WRXA 3B9RA 4BVBA 2YICA 1ZGCA 4L9SA 4J0GA 3DXFA 5H0IA 4AKGA 1UAYA 3LAWA 4TYWA 1K4YA 3WLOA 4PC7A 1CUBA 4JUDX 4FN4A 3N8IA 1W4CA 4PV7A 4TROA 5ICEA 2P41A 2A92A 4R69A 1HFWA 4G5OA 4OPMA 2WT8A 1DTWA 2G9VA 2IELA 2SKCA 4Y2YA 3OLWA 1XJCA 2DPMA 4Q7KA 1I80A 2M6KA 1FP1D 1XEWY 4ZOBA 1T2NA 1OLXB 1ZH4A 4CTOA 1MOSA 1XSEA 2CEAA 1QIDA 2XOKA 3OPXA 4U8GA 2P7HA 1YA4A 1ZW6A 2EL9A 2P2SA 2GDZA 1WZ2A 2P62A 4O4LF 2HSWA 3H2ZA 3RBXA 3DTYA 3OTWA 4CV2A 1RFLA 3G23A 3VR5H 2PJZA 3GRVA 4HDMB 2O9JA 2W6IA 4LJ7A 3G8BA 1P77A 1U3TA 2M6RA 4Y1GA 5F1YA 4BP1A 3M34A 4ZGBA 4MPJA 1Z0KA 1V96A 3QF4B 3TSOA 2YL2A 1E2JA 2GNPA 3LDAA 4RZQA 4YRNA 5M5BA 2OWEA 4R2JA 1Y4ZA 5B6PA 2WLSA 3Q8KA 5JI2E 2E89A 3KE9A 1Z2PX 3KS9A 4IH4A 1EFTA 5JWHA 1L7NA 1WPGA 3SX0A 3HBFA 1T8PA 1SNYA 1RXCA 3Q8MA 1QLHA 3Q0TA 1ZXXA 2GN1A 4F8EA 2ST1A 2ZCJA 5DI3B 5CLGA 1DBPA 5KQGA 2WDPA 3LHKA 2I3BA 4N0MA 4WERA 2WJYA 2OCGA 5FTJA 3REQA 2NO9A 1BEEA 1WR8A 5G4KA 2G5GX 3MGBA 4AXXA 1TFUA 1M8FA 3KR2A 5IXYA 4CBVA 3WY9A 3EXEB 2WR8A 2BI7A 2XUPA 2GF2A 2JB9A 4ZAWA 3NAMA 5EZQA 2ZU6A 4JEMA 4II7A 4Z99A 2O0KA 2OXEA 2BMDA 1UEIA 3JWIA 3QMMA 5DWDA 1V48A 2EG5A 1XNJA 5TE9A 4MUMA 1YBVA 2WZCA 3FAZA 5LB2A 4URWR 1ZD3A 3CWZA 3PXEA 1XZQA 2JFNA 1JL3A 3OD5A 4N03A 3HWRA 4NQRA 5DT2A 3FSRA 1CDZA 2AEMA 3PVCA 1EKXA 2VNJA 5EXTA 2FZGA 2JKVA 2ISSD 3QLUA 3UATA 5KX5B 3R3ZA 1Q15A 2GCPA 3T99A 3M6AA 5B1DA 1XKTA 1PT5A 5K0TA 1G8JA 5FO0A 3R9KA 3I9JA 3TGWA 5FWXB 5C4MA 2M98A 3EC2A 2KPOA 4YJFB 4JLDA 1NW3A 1QMGA 4XGIA 5AJYA 3EIOA 3PIRA 3QLVC 4XJXA 5LCXA 1X7HA 4EHIA 4EB8A 2VEOA 5F64A 3SM9A 2PZ8A 2G5PA 5G1OA 4N48A 4AYWA 4XCQA 3ZKWA 4BO6A 3CIFA 2P30A 4QQFA 1B6GA 2GBFA 4FWTA 4B81A 4J0KA 1VMKA 4TLDA 1YQGA 2KYRA 3DEAA 2CMGA 3D6FA 3EZLA 1MDFA 3CUWA 5C51B 3E3LA 4RLQA 3C3DA 4GUAA 3B38A 3OO0A 3R3UA 5ARDA 1A5AB 5B30A 1L7EA 1MD9A 4H1VA 4G0UA 4AI6A 4ECAA 1ZHOA 2UUCB 2XUGA 1VI6A 3PTLA 1DFGA 4WE3A 1K6IA 1B6SA 1S3IA 2R86A 1BHO1 1E7MA 5BPHA 1X7YA 4N7BA 3H8WA 1RBYA 4FIDA 3DPUA 2C5HA 5ICSA 4OQDA 4PG4A 4WINA 2Q6TA 2BFNA 2GFQA 1IVYA 1KETA 4PAQA 3SEAA 3TTUA 3UVEA 3ZTWA 4JP1A 1TZJA 2PQ6A 4BEBA 4I9FA 2XCOA 3GFBA 5JTTA 1CY0A 4C20A 2IZ1A 1P1CA 1C3LA 4MR8B 2PDAA 4GPBA 1JPVA 4NU8X 4HNTA 5G3YA 3PPXA 2JJQA 3ZDEA 4IO0A 2RGGA 4EVIA 3IOYA 4RVFA 1ML3A 3H4MA 4E3WA 3A06A 2X14A 5HOQA 1HEYA 3PF9A 2ZE5A 2R4QA 3U7RA 2ZRPA 5EHNA 4BWFB 4W99A 4L7VA 3U56A 4NBNA 2Z9DA 1G3IA 4X93A 5KEIA 1PX2A 1TVCA 2NU7A 2ZAYA 3CNOA 2C3PA 3FI9A 2AQHA 3R6DA 1QHFA 3CKKA 2GSWA 1IM2A 1I7NA 2Y6VA 3LGAA 4XOIA 3A26A 1TA9A 3BF8A 2FB9A 5EGNA 7YASA 4Y98A 2WUDA 4YR7A 1CB0A 3RS2A 4WRRA 4NCAA 1BWPA 1WQ4A 5IH7A 1I14A 3P4XA 2UXBB 4MNTA 4F2HA 4QPZA 5A0VA 1OTYA 1TIKA 4X41A 4JXKA 1FRZA 4BB5A 3QMPA 4GHWA 4J43A 2COEA 2WB2A 1QOZA 3KTAB 4IUDS 5KNBD 1J8FA 2Z2ZA 4PLTA 1DBIA 5LMUB 4E46A 3H97A 1CHNA 1Y1RA 1VHQA 3ST7A 4UBNA 4C2TA 1KVRA 1BFUA 2C2WA 3EAGA 4QUKA 4AYTA 1QE3A 4XQ0A 1U7WA 4B73A 5FEUA 3BA6A 1N33B 9GPBA 3C6KA 1F7UA 4BAGA 1YAHA 4HMQA 4W5OA 4ZCQA 4K5QA 4JL6A 2XKAA 4EJ6A 2Q27A 3FPCA 2JBWA 4M1QA 4DC1A 4EAAA 1SKBA 5AI6A 1RRPA 5EIWA 5LBUA 3GHYA 3M9LA 3X1KA 1SR8A 5DDIP 1K7FB 1W94A 3ZGOA 4CGYA 3G0HA 2JGRA 1IHXA 1AQYA 1XCBA 1GUFA 1ONSA 4IDEA 4QEKA 1QC5B 4FILA 3IUYA 1UQRA 1PL7A 2R1VA 1GXSB 2I29A 5TGDA 1GG8A 1MGPA 5KQPA 1AUQA 1NBAA 1U0TA 3CVYA 1PV4A 4YR9A 2PT9A 1H6CA 5DBFA 1UOOA 4WKBA 3VOBA 2FR0A 1EGHA 4NXNB 1QJCA 1O5OA 1OUMA 2HC9A 4YRDA 2O2CA 1WG8A 1CJSA 4FCTA 5AIAA 3SK0A 2XVAA 1ZESA 3UWOA 1S01A 4LJKA 2YZNA 3O4VA 4FJ0A 4E5UA 1Q1EA 3PEWA 3WNBA 1XCGB 4G1MB 4L85A 4LXGA 3ZHQA 3H0EA 2FPGB 2IF0A 4AFNA 1MW8X 5JRDS 5DMHA 1PD1A 3FNBA 3ZH2A 1YFKA 1SKQA 5C0OE 4EGSA 2JLZA 1B23P 2BEJA 5ER6A 4G5GA 5GGXA 2BTQB 1BXKA 4J4TA 3E8MA 1RQNA 4LNAA 4WSOA 5EIBD 2C4VA 2W7TA 2XMBA 1X2EA 5EZYB 3WKDA 4DNFA 2C9CA 3A28A 3IJPA 3D3WA 3PE6A 3NHAA 4MS4B 1UP4A 3AQIA 3HBMA 4WXYB 1WE2A 1ZSNA 1GKKA 3FR7A 3BXGA 3HZRA 1U28A 3C7TA 3F4LA 3V32A 1E3WB 2IF2A 3L40A 2DSNA 2TSYB 2IUFA 1O95A 1XQ1A 2GI4A 3A4TA 4UUBA 4UUOA 4QECA 4DA7A 3IQWA 2R2AA 3COYA 2Z1DA 4RLHA 2VBIA 4MEAA 1G4UR 3DV2A 5DF1A 5LA6B 1Q7EA 4MUKA 3CNNA 3K5PA 3RTAA 1RHMA 3WIUA 3G88A 2B1JA 3ZWPA 4Z0NA 3G2PA 2HMVA 1E9RA 3MVEA 5BR7A 1O08A 3AOEC 5FUVA 4BP3A 1IN6A 1XXHB 1U63A 3W90A 2H9AA 3FDXA 3QIAA 5A4KA 2WK1A 4O4IA 3RPEA 4DCUA 1JEDA 2QSUA 2WHPB 1F2DA 2WIFA 3RJ9A 4JT8A 5JO0A 3MB5A 3DC7A 3B20A 1XQYA 3DKIA 1KDRA 2G77B 1HMYA 1ESEA 2GHQA 3EDCA 1Z88A 3LVFO 3OEHD 5A1TA 5AHWA 3GLHA 2PYDA 2XDQA 3NALA 3AM4A 3GGOA 4QRIA 4WTOA 3RNOA 2PLWA 3LQ2A 4QDZA 2JC3A 3L06A 5DHTA 1CQJA 3B2QA 1SBIA 3SIWA 2AYYA 3FHJA 2JANA 1L6IA 3K0EA 2I4OA 2VT2A 3EQ2A 3H8SA 2DR2A 2V0GA 3OZSA 4JJEA 4U7PB 4LXQA 2D1RA 5NLLA 3X3HA 2QUZA 2B5OA 4DFDA 2I91A 1J5XA 3OY2A 1AHPA 2EBWA 3CZMA 1Q0ZA 4HATA 3NANA 4R40A 1T9HA 1TK3A 4B8WA 4PZUA 5DNWA 2IY8A 2AOVA 4I6JA 1H6BA 2AR7A 3O73A 1U2DA 2XMQA 4MCJA 3WYEA 2JASA 1QAOA 1RT9A 2YXBA 5JWRA 1SPBS 3PNKA 4LDPA 1V4NA 4B35A 4F9FA 3IR5A 4QDXA 1QV7A 3WWZA 4URXR 2EJUA 2ONYA 5A04A 4XPZA 4JZYA 4F3NA 5IU6A 1YUNA 3D7SA 4WN3A 1BXGB 4X1IA 2BLLA 3PU6A 3KE8A 4BMPB 1PFQA 2CHFA 3DGFC 1Z0FA 4J1NA 2HSGA 2NM0A 3HJAA 1YHZA 3O2NA 4M0UA 1W5EA 2ALJA 4D4GA 4CXMA 2ZJAA 4C7OA 3LT2A 4TS3A 221PA 4TLLB 4L8GA 4F1JA 5CYGA 4KR0A 3CQ9A 5IEJA 3LWNA 1KJJA 1B41A 4RTRA 2VAVA 3DCYA 2FEPA 5JATA 4YS6A 1OAOA 4X8HA 3OQIA 3HB1A 3TRFA 3VH4A 3JQBC 1BC5A 1YUMA 1LKZA 3RNLA 1NT4A 4PGGA 2REBA 4QU8A 1N7GA 4RLFA 4BDTA 5CDGA 4NK4A 2WQ7A 1V3UA 1N3IA 2Z4SA 5K0BA 5G1PA 3DBRB 1GU0A 1P17A 2NZVG 1WB5A 3I8XA 3GJ5A 2F6RA 3DDCA 4HB0A 4IFTA 5M7EA 1RI2A 1NQ5A 2PQMA 3HXPA 1T6BY 1RHJA 5L4SA 2ZIXB 1L4FA 2VF4X 1W4AA 3UMMA 2QR2A 3OPNA 2ZI6A 3TNFA 3JVVA 3AHJA 1E1RD 3AW9A 2ZRKA 5IAGA 3S2GA 2C7RA 3ODPA 1CUSA 2QN2A 4UU8A 2VPIA 2NO1A 1BVUA 1T4BA 1O9GA 2GM3A 5JAUA 2NVUA 4NBWA 1TF7A 3IPXA 4RKEA 3B1JA 1Y8CA 5L4NA 3VHLB 4NR0A 1ZJZA 3GRAA 2ZAGA 5F7ZA 1OXTA 4AU1A 2I6TA 3JPYA 4OJKA 4RVCA 4EYEA 1RACA 1DPGA 2PGXA 1F8FA 4TUYB 1DV1A 4HLUC 5U4XA 3T1TA 4Q24A 1ORWA 3VR4H 2POQX 1VBFA 2X0IA 2O57A 1TYEB 3TCNA 1Y34E 4E7PA 4TTQA 3TSZA 1SO8A 4WFKA 3R6LA 3K2EA 1C4WA 2Q3EA 1WCYA 1VE7A 2NZXA 3KWMA 4Z4GA 2B21A 3VDMA 3HJGA 2C7BA 1CRQA 1QJ4A 1JLLB 2E6UX 4LXHA 5TV2A 3KSUA 1Y6QA 2PU5A 3FUWA 3W3ZB 1N0IA 5EJAA 2YOHA 5EMLA 3N2ZB 3GL9A 3VO2A 4ZIRA 2F55A 2H3HA 2YZ2A 1AE1A 2PX8A 3F5FA 1E9CA 2ZRFA 4S3MA 4Y9RA 2FRXA 4BC1A 4ZEVA 2IBTA 1AJEA 8ATCA 4I1RA 3LQKA 1F1JA 1PJSA 2BGMA 1WCV1 2X5KO 4RC9A 2PAFA 4C9BA 2O07A 1G1MA 1H4VB 2PWBA 5ALDA 1T10A 1ORIA 1QH1B 3UGQA 4DZTA 2BR4A 4ZDJA 1JYSA 4K3VA 3AJEA 2Q8PA 3SKVA 4CCYB 2A94A 3V48A 1CUFA 3K6KA 3GPLA 3CE6A 4FK8A 1KZGB 1C9NA 5DXJA 5KSPA 3AY3A 4I2VA 2IPNA 5TQ2A 3NVAA 3UXMA 4I3GA 4DLTA 1Q74A 4CIYA 3RHFA 2HN9A 2O05A 1A5TA 2WOJA 4JT2A 1NF9A 3AHDA 3O92A 1L7RA 1VKHA 3AEUB 4J7AA 5FPYA 1BHJA 4ZT2A 1KE2A 3COVA 1SQ0A 5CDYA 3Q7TA 3ZU6A 3ZXUB 2JARA 1KQGA 2X4GA 3T3EA 1H5NA 1FDTA 3CBQA 3LY7A 3WMFA 3DZKA 4YJ3B 3PLRA 1OYVA 3U1TA 2AYXA 3E7PA 3I28A 3PC3A 5ALXA 1DRKA 1KZ1A 1OJLA 2CXTA 3PPVA 1W36B 2RAPA 4FBLA 3H5RA 1DQZA 3MD9A 3U80A 2YWDA 4CM4A 1Y9EA 2IE0A 2Z4RA 3ESAA 4ALNA 1GZ7A 5FQOA 1I2AA 4DDUA 2VA8A 1QRRA 3B1VA 5LDDC 2BZGA 1LDBA 2G9ZA 4PSCA 5ESRA 1U5BB 5K0SA 1N34B 1HE3A 1E0SA 5E7MA 9MHTA 2JAXA 2AG0A 1RKQA 1XEWX 3RO7A 1XNHA 4LX0A 3T5CA 4MQBA 5HFJA 5C8VA 2YWHA 4KQGA 1CX9B 1RADA 4NKRA 4ACBA 1GTG1 1BW9B 4LTDA 1VG9B 2DKFA 2EBUA 4XWTA 4F5DA 5L45A 3WMXA 2RSLA 3HBJA 5DTMA 4WX2B 3AVPA 3GT4A 2V0NA 4K81B 4XW2A 2R6ZA 1HKHA 2C9MA 5A7GA 1FYVA 4LS3A 1EIZA 4OHVA 3CVVA 1NV9A 1WSWA 4N6NA 4RMHA 5KYWA 3A8TA 3M83A 2WSSA 1K98A 5T4FA 5AW1A 2HBRA 3IVRA 3O7MA 2IGBA 5KOJB 4EGQA 5I5EA 1Q57A 1R5BA 4XFDA 2EARA 3P0RA 4BLOA 3GU3A 3RLIA 3CKYA 4WECA 4MQEA 3OEYA 1E6UA 2EW1A 4JXXA 3LXRA 4Z53A 5JNSA 1U0JA 1PEKE 3HPQA 4DDVA 2BUCA 2YDXA 3DZFA 2R6HA 4BLVA 1IDOA 3RIHA 3WKCA 1ZFNA 3STYA 4XGNA 1MNQA 4IHJA 3LCCA 1UJCA 1NQWA 2WWRA 3EGOA 5C7YA 5B4VA 1BX0A 2B4AA 1WUTA 4AP9A 2IYAA 3ITEA 2HSZA 1X92A 4DLRA 4J1TC 4X45A 3Q0IA 3U6BA 2VL7A 3BAFA 1U1IA 3EVTA 3FNGA 3GGCA 4YJ2B 5IX8A 2GRJA 4OP2A 2F59A 121PA 1GSOA 3EAQA 4QA9A 3R3HA 2Z9BA 4XQCA 4YP7A 4F4FA 3BMXA 2QHXA 4L9WA 2CL5A 1NRWA 3GV0A 3ZGVA 2Y1KA 3SC2A 3A4IA 4I4TB 5EEGA 5J23A 3OZCA 2VTVA 2GD6A 1FQWA 1VA4A 1TCUA 3NJRA 3WGQA 1HQCA 5EWLB 3RRBA 5C18A 4Q1BA 3SXUB 4B3FX 4LX8A 3D6NB 3E2MA 1UJ6A 3DDHA 1P6UA 2W4QA 3DOIA 2VZ9A 1KSFX 5E9AA 4ZXPA 4NHEA 1XVIA 1MB0A 2GLUA 1EB9A 2YS7A 2QJRA 3CT6A 4UXJA 4DLPA 1EA7A 2Q3FA 3FETA 2AFRA 3A1EA 3RUDA 4BV3A 2O2DA 5JDCA 1DU4A 1FU7A 2VLBA 5JSZA 1YZYA 4I8IA 1IWBB 1USIA 4K9QA 1KAOA 2HWUA 3B5EA 4TM7A 5BWLA 3AR4A 5EG5A 4MO2A 1M8KA 3JW8A 4KV9A 5B7NA 2ZBEA 3BZBA 2WJGA 3H4VA 1NUAA 4G5XA 4ALLA 1BH2A 4ESOA 1ZR4A 4YUVA 2A8YA 3U31A 1AUVA 3CEHA 3ZE7A 2BKXA 1P7ZA 1I7DA 3FNHA 1MEJA 3T0FA 2JW5A 4UBOA 3ID6C 2HADA 5DBIA 1UANA 2BGUA 3KG2A 2CLCX 3TH5A 3V33A 4FNAA 3WV4A 2R11A 3DMFA 2WWVD 1WL8A 4JYBA 3UEOA 4HUJA 1HZZA 1ZCAA 4CDGA 1UJBA 5AM3A 2QF7A 4X54A 1QCZA 2H59A 3MWLA 2W11A 4DIDA 2EZ4A 1U7DA 1BSVA 1Q0PA 3NORA 4E5SA 1K7EB 1J6UA 1TM5E 5K0CA 2R8BA 2QVCA 4X85A 2E5WA 5I9TA 1QPGA 1V43A 3KQSA 4GBED 3D2BA 2WZBA 2J6CA 3DPIA 4EM6A 2A4KA 2I6UA 2G5TA 3KLMX 2ADFA 3MT0A 1TCBA 1VDMA 4MUNA 1WPQA 2G4VA 5IEBA 4R9UC 3VPGA 1TI7A 4AZ3B 1PTKA 1R66A 2BONA 3MAAC 2X0FA 4OCZA 3VR1A 4B83A 4PN3A 1LQUA 4BCDA 3ZWBA 3ORRA 5J63A 1CUVA 2XD4A 3GZNA 2HNAA 4FFRA 1SUCA 3STTA 1UBJS 5EKUA 1BE8A 3WLIA 2IEDA 3A6PC 2W6ZA 1MW9X 4Y2GA 1ZD4A 2RK6A 2BFBA 4LECA 3WL4A 1IK6A 1CBUA 3SE0A 2FVYA 4KLZA 5CT5A 5D84A 3UQZA 2XB2A 1XMVA 3VYRB 1S1CA 4IWNA 3CSUA 4NFHA 5GONA 1D2CA 1VP9A 1GILA 3EHEA 3QKTA 3AUUA 4I50B 2YJZA 1L2TA 1RQLA 1VCHA 2OFOA 4MVJE 1FVOA 4RIEA 1OF1A 3TLGB 5K8CA 2RCNA 2PLNA 1Q14A 3BFXA 3CLUD 3MWDB 4PSDA 4CL3A 4EI8A 2NSYA 5GGYA 3WGZA 4BRWA 5I7OA 3PQEA 2OYCA 2F9LA 1OXVA 2J6BA 3A9UA 3EBPA 5AKJA 4JFAA 5J3JA 3P19A 2BFMA 4WVLA 2GTPA 3HXTA 3ZE2B 1BXRA 1QHHA 4PAGA 3ZZ0A 4FMDF 4UTNA 1Z25A 1G7CA 4YV2A 3JD1A 1QVRA 4JQOA 3BRWD 2JIDA 2GRAA 1EP1B 3TOCA 2CLHB 4LXIA 3KQWA 5KTYA 3AVYA 2C2MA 3IJEB 1Z22A 4BLQA 3QVSA 1JQAA 5M2QA 2WF9A 4P4NA 1NVAA 1YB5A 2ZR7A 1MT3A 4ZN6A 5T3YA 4FT4A 4J29A 1JH8A 3Q98A 2X0DA 1GITA 1JR2A 2DECA 2G0NA 3CGWA 4KBGA 1UMBA 4LRTB 3ZYCA 1TAUA 4LC9A 4OQXA 3TSYA 4F4HA 4DLBA 2WT4A 4KUHA 2W37A 1ZQ1A 1JG1A 2C04A 3MIZA 5DB4A 5FLKA 5LWQA 1DJPA 2BMJA 2NG1A 3PHHA 5EJ2A 5LXTF 2EBFX 4P58A 5IZ4A 5ISMA 4WH0A 3GUYA 1Q2XA 1LPNA 3CUUA 1BFKA 3F71A 4P0PB 3KXDA 1KNXA 2QP4A 1W85B 2RHHA 2J08A 2KMLA 4OGFA 5K0LA 5HQJA 3DP7A 2SCUA 3PICA 1T2EA 1Y89A 4MGHA 2PLAA 5EUQB 5IJ0A 1KQOA 1OFUX 1L9XA 1PD0A 2Y99A 4RTSA 2DWCA 1AT1A 3Q7IA 5GZ1A 1AHIA 1RC1A 3H99A 1V9CA 2XKBA 3JQ8B 5TVGA 1P7YA 2PRIA 3K0AB 4D25A 1R8YA 2F3TA 2Q4EA 4X90A 5TXGA 4E2XA 4DA0A 3BQ9A 3FFBA 5FBZA 5T4EA 2GXAA 2XDYA 3DMYA 2MYUA 4O59O 2OXCA 1NBMA 1O77A 1IQUA 3LWDA 3R3JA 3HA5A 4WBSA 5PGMA 5KTPA 2X3FA 2E3JA 3KBBA 1WNFA 3IEIA 1PDWA 2HQBA 5A3QA 1LFDB 3PCXA 4Y6GB 4YRPA 3SS9X 1KZHA 1I01A 1Q2UA 1RCFA 2ZPTX 3GPDG 4M99A 1P9NA 3T06B 1YMQA 2OHXA 2WNSA 4DANA 1WVGA 5CDHA 1II8B 1GSHA 2IHUA 3QVGB 4GO1A 3JD3A 3AZPA 4IG4A 1XC7A 1F2UA 1N2JA 4O0MA 4Y6OA 3OCVA 1G5TA 2O4UX 4W5QA 1P0MA 3V9PA 1PK7A 1SCKA 1UBFA 3B85A 1W6UA 2QN6A 2XGGA 3EZYA 2IVZA 3NTRA 1ORRA 5JVDB 5DNYB 1CUHA 1GYRA 4OH7A 2F17A 3R7WA 4MKFA 1CR1A 4LUCA 2Q45A 4GQAA 4RGBA 3L2OB 3LA6A 4IJMA 1VIYA 2DJ5A 5LQSA 4J49A 1NAHA 2XE8A 4ND4A 3FYDA 4OP1A 1FYFA 1M0WA 3DE0X 2A5JA 3WBFA 4MWBA 1P73A 2OM2A 3I5UA 1M74A 2QM3A 3T15A 1UKVY 1C30B 4WDRA 2VNIA 5J47A 2ZUDA 4RF4A 4EQ6A 1VL0A 4J2OA 5BXYA 4NNPA 4ARCA 1LPPA 4I08A 3AO0B 1RQ2A 4LOAA 2XQVA 1SCUA 5KYVA 2WKRA 3NEYA 1KMHB 2XBLA 1O97C 2G1AA 1AGRA 2ZBRA 4XB1A 1VXOA 2H3EA 4QUEA 4XOUA 5CNIA 1CULC 3AZOA 1CCWA 2IYWA 1H0SA 4PZYA 1KMIY 2QN1A 4QUJA 3X1JA 4K86A 2H2DA 3UJCA 3QEBZ 1HETA 1XLUA 2WJHA 2A5LA 2ZYRA 3LRXA 3TD6A 1QP7A 2IYEA 2X4DA 3DBLA 2G9QA 4FTWA 3FFAA 5SY4A 2BR5A 1M6YA 2QB5A 3P9IA 5DCUA 4FYJA 3RHSA 3OQ1A 3AZQA 1BMFA 4IMRA 1AQUA 1MABB 2IL1A 3HU5A 4JQCA 3VYSB 5M34A 4CZ2A 2OSBA 3WSVA 5BUQA 3U7QA 1KI7A 3R4VA 4RTJA 4CUKA 3B89A 3D5QA 2LKCA 1P3Y1 2EWWA 1I3LA 2ZU0C 1CS0B 1N8SA 2ACWA 2ZSIA 3EWIA 3LE8A 4FXOA 4H3VA 7ADHA 2AFHB 3A1TA 4J4HA 1ODTC 3H5OA 4FM9A 4YREA 1KC1A 3QE3A 1Z2DA 1BKDR 4PY2A 4CG1A 3BIJA 1DQSA 3GJZA 2WF7A 3HS3A 1DUSA 5ALQA 3JD4A 4P7GA 1OW3B 4CE6A 5I6DA 2IU0A 3L1KA 4V1CB 2J9FB 5FO1A 3P1JA 2GX6A 2FA9A 3EY4A 3NIDB 4MINA 2EP5A 5ANRB 1GN8A 2DBYA 4MO9A 3VHQA 6AT1A 1NRIA 2V5UA 4U9UA 1NVFA 3O8RA 4D8XA 3KYJB 3U7EB 2C54A 1P2FA 3ZCQA 4Q9IA 1FC0A 3ONFA 3QNMA 2Q6KA 2WWGA 7GPBA 3H9CA 4RE5A 1P1JA 3KZNA 1I4WA 4IIHA 2IYXA 3VYUB 5BORA 4JB3A 3AEYA 3GOHA 1RXIA 3CF4G 2Y0CA 3NYWA 2BRUA 2MSCB 3LFHA 3TR5A 4H9GA 1J7JA 3KOXA 4PQFA 5FOUA 4ZHQB 1KEEA 1XAIA 2GHRA 4FGUA 1WB4A 1PNTA 5LYJA 3SFZA 1J8MF 3ABOB 4LRQA 3RRZA 1CP3A 2C4UA 2HA7A 2RAFA 4GECA 2DTDA 1ZBDA 3DOCA 4DHEA 3EA4A 2X2FA 4JKYA 1XK7A 4D3DA 5HF9A 2BGNA 3L8YA 4PZEA 3IP3A 5AR1A 1BDJA 4FXPA 1PQYA 1BG6A 2FZWA 2XMPA 3F9IA 3WOVA 4EPRA 4HLNA 3WGLA 3B6IA 4I5DA 1SBHA 3O4HA 4J94A 3N2IA 3QPUA 3OE1A 1A9YA 3K9GA 2NU9B 2FEAA 2MDTA 4G5RA 4RKRA 4HWGA 2TMGA 1PSZA 4EPWA 4LYGA 5CX1A 3V7NA 3DPSA 3D8RA 2NW6A 2H1VA 3AGPA 2II6A 3CISA 3ISVA 1K6XA 3F46A 5KTNA 1U0GA 2YNMC 2NUTB 3HU1A 3RK4A 1DKMA 3LPDA 3L43A 4RDHA 4WV3A 4L5YA 5FNZA 1QCCA 2RI1A 1RQ7A 1X1CA 2XYRA 4MKIA 1OV4A 2C4MA 3CNQS 1WDLA 2JI4A 2AG8A 1HFKA 2IT1A 1UWCA 3AUTA 3TDNA 1BIFA 4BNVA 1MVLA 1NHGA 4BBAA 4L4RA 1M1UA 2JFPA 4MI9A 3D0OA 4LE0A 4D8WA 4Q5IA 2P79A 2WD7B 4DGQA 2BH2A 1PRYA 4C30A 2FRDA 5HJ2A 2FPOA 4ZV7A 4RACA 3SHVA 4TTJA 4R8LA 5KDLA 1HDZA 4C22A 1JVNA 4GX5A 2GDJA 3RB8A 2R96A 4A82A 4DJTA 3E15A 1DLIA 3GF4A 4EG0A 4EUHA 2AQIA 1OWMA 3EC7A 3R8XA 3W5HA 1KJ9A 1UM9A 4LN1A 4EVQA 4I81A 1EBBA 4YMIA 3OLYA 4D44A 3F73A 4QVKA 2HQ1A 4LBZA 2BBTA 2IBMA 1AS2A 1XMJA 2XTJA 4ONEA 1RDFA 3RUFA 3DVQX 3RAFC 2W6PA 1S2IA 3A6GA 3QWHA 2J0UA 2Z5LA 1YRHA 3NUGA 4I19A 2QQFA 4LOKA 4KXFB 1VLJA 4Y6QA 1OMOA 4QOEA 4E1AA 5LIRA 3L6CA 1DIGA 4JOSA 2QNIA 4YONB 4OSPA 2WC1A 1M1YE 3SXJA 2Z6VA 2VT7A 3N5KA 1I7PA 5EWMB 3FI0A 1UZMA 3ZWQA 2HTFA 1GAQA 4UD6A 2Y4NA 5CYPA 3WLTA 2OQVA 4OREX 3LFUA 4P3KA 1I4TD 4HI0E 4TPKA 2O8DB 2J32A 2XSZD 4F86A 1QFXA 1ZPDA 2BEWB 3I9LA 1M76A 4YV1A 2A1UB 2Y1EA 4E4RA 2H31A 2ZRBA 5JECA 4A8HA 1C8VB 4Z1OA 3IKMB 2JIQA 3OTQA 5JH7B 3AVXA 1MVNA 2VTKA 1AMNA 4YJDA 1YL7A 3OOYA 2OL4A 4XLZA 1WPXA 4PYQA 3VH3A 2VQDA 1V2GA 3UV7A 2X0EA 1RRVA 2HOQA 2AK3A 3TB4A 1NUQA 3IPLA 1KPIA 4CI9A 2O3UA 4KO2S 3NIGB 1Z8NA 2ZYDA 1QGED 3P5SA 3ZXXA 1E3IA 3PKJA 2PKWA 2D7JA 4BO7A 2XNCA 1S6YA 2FZLA 4JA0A 4KYIB 2G7MC 4AZVA 3SHFA 4JLNA 1P5JA 3EFOB 4HNGA 1ZIPA 4CMBA 1J1IA 1DEXA 3LT1A 3SS8A 3EYAA 1YFLA 1OCEA 1Y4DE 4TWBA 2QD4A 3W3AA 3RI3A 4QEDA 1G3UA 1E0AA 2VYNA 3Q12A 1UK8A 1IUKA 4X3OA 5ALTA 5C9ZA 2XQJA 2BMAA 1U2PA 2NTEA 1M5UA 2BJVA 3A2NA 1FFSA 1N3YA 5CB8A 1F38A 5I3CA 1ZAYA 4DUGA 3PFKA 1KO5A 3B60A 4U6QA 3BOSA 5NULA 1GQSA 1Z6YA 1T2UA 4NVRA 1F0KA 4KO1S 3H16A 3N86A 4B3DA 2W6ID 2QU8A 4GNKA 2HJWA 3N1UA 1WCIB 2PJRA 3TDMA 1XCLA 4UTRA 2MSLA 2GMWA 3ZD6A 4KWHA 4DLZA 5A4IS 4X91A 1NJ2A 2CLMB 3B6KA 3EN0A 1RWBA 2BHTA 3GWGA 3R09A 1SXJB 3MBKA 3HRIA 2X1MA 3AJAA 1OI2A 1CD5A 2ZPAA 1EE2A 3D3QA 3Q88A 4QPPA 2VHEA 4V0MA 5EINA 1U0EA 1GSIA 3BXEA 1UMDB 1ENOA 4UFOA 1VLQA 1IJEA 4ZOLB 2BFEA 4L5CA 4QTZA 1SKYE 3O9VA 3QE4A 4DCMA 1F6BA 2X86A 2C94A 1J99A 1JA0A 2OHHA 4MGEA 4INAA 5CLIA 4EYKA 5KREA 1TZMA 4EPTA 4EG6A 4WNYA 5GOZA 3A31A 1U2GA 1OXKB 3D6HA 3DBIA 3SFTA 3TLCA 1VKNA 5LLSA 4EY4A 2YJ4A 1LH0A 5IJAA 1X8LA 4GBJA 2JPDA 2JHCA 3TIXB 4EW1A 5KNCD 1EP2B 1JQ3A 1YQQA 1S2DA 1PHPA 4JEHA 5HQ3B 4O5AA 5JV5A 1TRHA 1RJFA 2K2WA 4JB8A 5SY9A 2HMYB 4NYJQ 1OFTA 2CK3A 4OB8A 4F91B 3FMIA 5LLDA 1IL0A 3G2IA 4RK5A 4UDNA 4TYNA 2X19A 2DBRA 2UXDB 2D00A 5DNEA 3T5BA 3QXSA 3HFRA 4OHCA 4AW9A 3B6JA 3BMNB 1I7QB 4X24A 2P5YA 4IFBA 2G8NA 4P33A 4R8VA 2R68A 5JAMA 3GFPA 3D6AA 3FWYA 3MCAA 1GLGA 2HWKA 1RI5A 3E2PA 5FBKA 4DCJA 1YDEA 2X3UA 4CM3A 3SEQA 4Q47A 1Z2AA 2ATXA 1MVOA 1QV9A 2H5JA 1HL3A 3P2MA 1T4CB 4G4SP 2X8JB 3DZHA 4M1SA 3SHTA 4BASA 1WXQA 2PXAA 3D1JA 2IEIA 3F5QA 5BYBA 3MGKA 4AWBA 1MB4A 3H18A 1C4OA 5KWVA 4B4DA 5GPBA 1IDN1 2P91A 1Q1QA 1YAJA 3UOGA 1XTUA 2ZANA 1DBRA 1I5RA 3EC1A 3HVKA 3OUUA 3R3YA 4Q37A 4XR4A 5HHTA 3P9ZA 5JPDA 2Q29A 1F9AA 3QEJA 4PU0A 2P1DA 2R7KA 1R9NA 2B8EA 2L2QA 4J7XA 2J0VA 3DL4A 4LJRA 2XUHA 3BFVA 3HP1A 5ESDA 2LZ0A 1XZDA 1WB6A 3THXB 5DM60 3MXTA 2Z09A 1U9IA 4KAAA 2O2GA 3DO6A 2VT6A 5CD9A 3LC2O 5DM70 3K15A 4PO9A 1P1IA 1G20E 4Y2SA 3JQAD 3OHSX 5EP1A 1THGA 1USGA 5LR6A 3AT1A 2J59A 2AJBA 1RW4A 2JJ2A 4EF6A 2YIDA 2GJSA 2HREA 1MENA 4PXAA 3ZE6A 1SOMA 2ESRA 4YVFA 1BVYF 1DARA 1KMNA 4GE3A 4MB6A 5ALWA 2V98A 4KQIA 2R7AA 2GBCA 2B92A 3C97A 4JQSA 1GZVA 1PJLA 2BN4A 4XLTA 2I9KA 3USZA 3I2KA 3ZGXA 4OMUA 2AC7A 4UVDA 5JZMA 2PR2A 4W9NC 1H9CA 2VP4A 2OHGA 2GZHA 3DOHA 3G8AA 1I7SB 1NL3A 2BBWA 2RBKA 1TAHA 2YJTD 2AKAB 1DHTA 3CONA 3FPLA 5JCZA 2DY1A 5CA1F 4JR2A 1EEXB 3IQGX 3HGQA 2UVQA 3EEBA 1SU7A 5K2MA 2ZOSA 3MGCA 4X20B 1M2WA 1PS0A 2GKOA 2A57A 5AW8A 2AWNA 4FNGA 3AESA 4WCFA 1FQKA 2ID7A 4LWZA 1QPBA 3B9QA 4I1YA 1P7PA 4WEOA 4CQLA 5FRDA 2GK7A 1CLUA 1A8QA 1RPJA 3PNVA 5TMEA 1IB0A 4ZYYA 1PWZA 4RENA 4EA7A 4F3KA 3ILXA 3UFBA 1XHFA 3DBVO 2BGRA 1IEWA 2PSEA 1ZLXA 2WWIA 2RHWA 4BO1A 1IY2A 4QUDA 1PBTA 4I1OA 4LXUA 3EA0A 4X95A 2H1FA 4P0TA 3GLGA 1Q22A 1FPMA 1RZVA 4GKVA 4Q34A 1JEYB 4D26A 2ZIWB 1LTHR 2QG6A 5BW5A 1E3QA 2ORYA 5CLQA 1DAIA 4ZI7B 4OUDA 1CZNA 1N8NA 2F4NA 2NLOA 2BM8A 1QHXA 3LLCA 4KAXA 4TLBA 3E6AA 2VQ6A 4ZU3A 5B3AA 4F2WA 3JQDA 2FV8A 3AFGA 3DEJA 5ALHA 1AKEA 3D7RA 3VJMA 4EHLA 5AM5A 1T25A 5K0ZA 4DR6B 4DM7A 1OU0A 1L5NA 1GT6A 4D2IA 4UPVA 3N28A 4I4CA 3WBBA 2LCFA 3AIOA 4FEEA 1WCWA 2WW8A 2XUJA 2IXAA 2C8JA 1NZJA 3HMQA 4RNDB 1PEAA 1JAYA 4K6HA 1JT9A 3BN3A 2NVOA 5AVKA 5IN4A 1R15A 1XVUA 4L22A 4HNQA 1ZJ6A 4OU5A 1QGAA 1BWSA 3GDWA 5DTRA 1OLOA 4D02A 1AMUA 3QWAA 3EVAA 1JHRA 2V7TA 4KMSA 4H1UA 4QQ8A 1Z4KA 2MSDB 4JB0A 3CEAA 4E5DA 4FFBB 4M22A 2JLSA 3QGMA 3ZIUA 3EXHC 2W4IA 2HRBA 2FSPA 2D3TA 5DFAA 5TY0A 2WKQA 2BGLA 5ALOA 3BK2A 2VTEA 3DQZA 5JRJA 4M4SA 3VMFA 1COWD 2XBMA 3UENA 4WLFA 4DLSA 5CBKA 2JFBA 4Z0PA 5B58C 2V6BA 1JTFA 3WK6A 3V6LA 3W8RA 4B2YA 4A73A 1HFJA 4ND8A 2VPTA 3DVRX 3P71T 4U7WA 4RPKA 1XP8A 5CH8A 2J3IA 3OE7A 2C5LA 2HSEA 1J2JA 1VE3A 2ZDHA 4NJEA 4H35A 3ONEA 1LBEA 2JGEA 4KQ1A 4RE6A 3PXCX 3WRWA 2GASA 2ZWOA 4F45A 3TPCA 1QQBA 2FPSA 3UMVA 4A15A 4KH0A 4M8LA 2XGJA 4KGDA 5EPUA 5I9BA 2NSLA 4NMMA 2W2PA 5GZ3A 4GIBA 2UYGA 1X19A 5E6SB 1R27A 2I7DA 3CNEA 4F92B 4UMFA 1EHIA 3I04A 3U40A 1ZRSA 4KVGA 4GPD1 4EGFA 1XMQB 4OLBA 4F56A 1TYAE 2KQUA 2VA9A 3L04A 1SHKA 3EOBI 4DNPA 1BS2A 4W4TA 4RTPA 4G0VA 5FWYA 2XCLA 1EVQA 2C0QA 1CVIA 2CYAA 1VFPA 2F9MA 2WUGA 2P9ZA 3FG9A 3N2NA 3O1JC 1ZA2A 4MWCA 3BHMA 5B3KA 1MZVA 2M1ZA 4EMBA 2Q4DA 3ASUA 1EDEA 3QKIA 5LQMA 4TVSA 3EG5A 3K1YA 4RA6B 5MF6A 1QFMA 1GT91 2AX3A 3H9GA 2OCBA 3IJ5A 3MT9A 2VRNA 5DEOA 5F2KA 3W8NA 2C2BA 2V1UA 3G2OA 4GI7A 4HGRA 4IILA 1PR6A 2XCSB 1AMOA 3H2HA 3IBYA 2HLDD 5AKGA 3WRYA 1IN7A 1Y8QB 1CY4A 5CYOA 1F0PA 1OIWA 3BGOS 4TTSA 4ZODA 3NT2A 5ITVA 2WKWA 1TIBA 3ISJA 1NUHA 2PX5A 1QG4A 3JZAA 4TMWA 3K9BA 2C3UA 4V0LA 2XB4A 1T9GS 2H5IA 2WHQA 3M1YA 5LDGA 4KQWA 4UTPA 4LKRA 1LDGA 2J7PA 3E4DA 3P9CA 1I3KA 2FLKA 1J25A 4NNJA 5F3RA 2WPDA 2ZI3A 3PEEA 5JBNA 1BYUA 1QP8A 2JLCA 4Q7QA 3UXHA 2QPTA 5AVZA 2H0RA 1NVDA 2B8NA 2O5RA 4OHPA 3E7DA 4LDZA 1F5SA 3T1QA 2X0KA 1UIRA 3VYTB 1QRDA 3WJ7A 2MYPA 2Q0SA 2YWCA 1WDMA 4D6PA 3CRW1 1AKWA 4TKUB 4ZO8A 1YKFA 4DQ0A 4ZJUA 2VQ3A 2FMHA 3WGJA 2QPLA 3EMKA 2RARA 3DVSX 3LSYA 5ALRA 1XGKA 2VYQA 3OMWA 2DT8A 4QGGA 2H8GA 3MB8A 1GAJA 1UZLA 1G64A 4P4UA 2CXSA 4YAEA 3NKVA 4JLPA 4BO0A 4C6RA 4X65B 2I4LA 5BN3A 1CZKA 1IHYA 1XELA 3SQDA 2YJ5A 2H8KA 2Z08A 3GYGA 5JG7A 2QNRA 1BRTA 1FFGA 1KVTA 3DB2A 4Z0TA 1CIVA 4TT8A 1MJFA 4WAUA 4NAHA 4D9JA 3ZDAA 2WKSA 4RIHA 1M10A 2HUNA 4LWQA 3BREA 2ZYSA 3O3OB 1EXNA 2R25B 3FDZB 4GH5A 4XYEA 3W1EA 3RRYA 2E4AA 4F5EA 1X1EA 5A0FA 1XZAA 4KEAA 1KDTA 5BR8B 1NPDA 4K46A 3LJKA 3NCHA 3F1LA 3A0RB 1QHIA 3CVXA 1DWPA 2GK3A 6PFKA 2QG4A 4J75A 5TVKA 1A04A 2KJQA 1A95A 3TCKA 2O0MA 3C1TA 1Q7TA 5CAEA 4A26A 4IIDA 2MSKA 1RTKA 3H5TA 3LUAA 5HF8A 1H65A 3MFYA 4XDGA 1C0LA 1I4LD 2I4MA 5JFOA 5LZ9A 2C57A 4DMRA 4ZRMA 3GLKA 2G09A 4WZBA 4UTOA 5IH3A 4AURA 2E4ZA 1VDZA 3C87A 3FN4A 3N05A 5BSTA 2W6NA 2Z0MA 3VPFA 3HB9A 1XD9A 1NJFA 2LRHA 4BNXA 4DBLE 2ZITA 5TMDA 3G9ZA 3WKEA 3UGJA 1UKAA 5DGTA 1K63A 3GA7A 3IXMA 3NDRA 2ZS8A 4GGPA 4R51A 1E2DA 3U4GA 4CM8A 1PL8A 1U0LA 2IU6A 2BT4A 3ELWA 3PC6A 2JHFA 3MBOA 2WJAA 3NBKA 5ILOA 1DRWA 4LJYA 3I2YX 2VIIA 2BGTA 5F9HA 1JXAA 3A6JA 3EYWA 5F76A 2C00A 1SK8A 2JIBA 4MMYB 1THZA 4X0EA 5IYZA 5HZGA 1CR2A 4ZOEA 4DS3A 2C99A 1RRMA 1C3OA 3DEYX 3LT5A 1Z2EA 4IXNA 3VR6D 3L7DA 4HLCA 3C3WA 2KWIA 4Q9HA 4ZVQA 3RWOA 1FFDA 5KHLB 3D7KA 4X8OA 1M0TA 1ZIYA 3QKSB 3AW8A 3D54D 3I1FA 1LF0A 4TL8A 4KO3S 1PWHA 1SD2A 4PWYA 1US8B 3W9YA 5BYKA 4JR0A 3BHJA 3KALA 3NJ4A 4PVCA 3R7FA 1U3UA 2CMHA 4CMKA 4WNCA 4J8PA 2YIVX 1QYVA 1MQ8B 1GCIA 4LPSA 2DH5A 3EUAA 4IDGA 2ZE6A 1WZCA 4BE7B 4P54A 4LHZA 1T0JB 2A58A 2OC9A 3QY0A 4HEA1 5HF5A 1FBNA 5IM5A 4NCJA 3WLRA 4E0BA 1B6RA 4EX6A 2R1ZA 5K4HA 2DRIA 2CN1A 2YY5A 1RPAA 3TSCA 1NQOA 2JK1A 4NF2A 2VUTA 1P91A 4GRAA 4PX3A 2DZDA 3BHNA 1QRSA 4EG3A 4X61A 3RTEA 2DERA 2P4UA 3B5IA 2Z8YM 3BWBA 5I45A 3ZQJA 2AHRA 2ZB2A 2CXXA 5TT1A 1YOVB 1KYVA 3KJHA 4M89A 4ZQFA 5A4JA 4TV9A 1C41A 2WF8A 3RVBA 1ZSVA 1G21A 5K7SA 4FMBB 3M5WA 1V47A 4D45A 4BEWA 3H1FA 4IZ6A 5K0NA 4Y2UA 4UNSA 3NFRA 3SBEA 3V8BA 4RJTA 4YAOA 2M6LA 3N6VA 5EXPA 3B8HA 2BR3A 3KOMA 1HWYA 4PYIA 4QBTA 4W9RA 4F6LA 1X8JA 3FOWA 4GLOA 1IBRA 3M9XA 4QYXA 4DXAA 1NURA 3FNFA 2WSSD 4RADA 1LLFA 1ZO8A 4G8CA 4TLMB 3R77A 4Y7CA 1X1AA 4P4GA 1JG4A 2I4TA 1J9ZA 2FW8A 5PNTA 4V38A 4B46A 1NKVA 4NBLA 4D8UA 2BM0A 1WIWA 2NU8A 4QRDA 1CUYA 4QT4A 3I5AA 1DUVG 2FSHA 3VNAA 1WQ1R 5FBLB 4MLDA 2XMDA 5G40A 4FMCB 1I6WA 1UT8A 1V7CA 1YF3A 5AHOA 2RGNA 1VLZA 1F06A 4RAOA 1YCFA 3LTNC 3KOUA 1VCOA 1RQXA 1PNRA 3VNUA 1DDGA 5A9SA 3ZCUA 2VJDA 3H9UA 1R6TA 1X8KA 2ZUSA 4QUIA 3UJHA 3KFVA 3GLFE 1WDKA 3KUUA 3SZMA 1DO0A 3TPZA 1G1AA 1YHYA 4YWHA 2HYIC 3Q3JB 2CNWD 2Q5EA 3MILA 5AFSA 3AL0C 5J2TA 2P6RA 1CUEA 2O7SA 3LUJA 3RBAA 2ILVA 4QDOA 1FJHA 1F60A 1E1YA 1GA4A 2QENA 1T3HA 2V59A 2AZTA 2QR3A 1OZHA 2ZSUA 4L0CA 1JEQA 2M6SA 3P2JA 4M60A 2VJAA 4MDFA 3ZCVA 2R9VA 4NPAA 3LUFA 4L07A 3F5MA 1QF9A 1SU8A 2C88A 1U6KA 1YIAA 2Y3IA 3QELB 4R54A 1J2UA 4B74A 4DLVA 4P4SA 1U4NA 2L18A 3IAUA 1Z4OA 3MTAA 2G6TA 2P35A 1H23A 1XU9A 4E12A 4IW3B 3U3DA 3IELA 2CHEA 3VJLA 1T5LA 1G8YA 4JOCA 1QMPA 4M1WA 1BMQA 1SXHA 3DEHA 1XTBA 1PG2A 4KTVE 2A7QA 2NP6A 1EB8A 5EJ8A 3PFBA 5D5HA 5ALEA 5FI3A 3EVEA 1LX7A 3QVKA 4MITA 5JCJA 4WLOA 3ZU5A 3PWSA 4S12A 1VL8A 1T3TA 1P72A 4RS4A 2P3QA 2OGSA 5E4YA 3SF0A 2GPSA 3QXHA 3L7CA 3KYDA 5DHSA 3E03A 1Q0SA 3PE3A 4KYVA 5A6VA 5I7RA 2TMKA 2XCUA 1RMTA 3D4LA 4XB2A 3KCNA 1DIRA 4RHTA 5JZOA 1H0HA 4G26A 1VLMA 5F5XA 3TSAA 5IVHA 2IUYA 3QOYA 4LEIA 4H6WA 1W4ZA 5KQLA 2DULA 2GM5A 3NOXA 3TUJC 5ED0A 2XA9A 3KO8A 2YVAA 3GY0A 3THSA 2ZJ3A 1U1GA 4Q1EA 1BDMA 4PLCA 5EN4A 5JAPA 4BU0A 2IZZA 16PKA 1KQ3A 1SC4A 2XVYA 1KK0A 4FGJA 1A9SA 4BWYA 3AF0A 2I2BA 3HVIA 5CFZA 2NO7A 3QYJA 2VEDA 1XBTA 2D2IA 3OX4A 1E92A 4IM7A 3L6EA 3SVZA 3EZGA 2Y1LA 3HGTA 3K0CA 4OHBA 1H1TA 1N0WA 3IKTA 2WFLB 4IIFA 1LW7A 2Y0EA 2ZYHA 3JQPA 3Q3IA 2B6NA 1THTA 3TRIA 3I6MA 4RANA 2C31A 2GGSA 4CUJA 4UEOA 1VXRA 3W5SA 5JNLA 3ZVMA 1K75A 1M2HA 2HPZA 3ZLVA 4RFSA 1LV7A 3DMDA 1AKQA 1AD2A 1YOBA 1QBGA 3ZS8A 1O57A 3CNBA 3KLBA 2HH9A 3ZZMA 3L0CA 1JWLA 2WTEA 3IVAA 4ENQA 5KDDA 4ITRC 5DBGA 3FAKA 3ZY4A 3CE9A 2WI8A 3W4JA 4Z6KA 2I87A 1JT2A 4RSMA 4K03A 1XTZA 3NT5A 2WYVA 1AS3A 3NVKI 4KCGA 1RPZA 1FY2A 4ATNA 1DKPA 2CZCA 5H9VA 2FN3A 5HCUA 5BVHB 1P5ZB 4RVHA 4JOQA 4JVSB 4F8YA 2IPXA 4RD3A 3HR8A 1FDOA 4FDAA 2XECA 4FNMA 2MINB 2QKYA 3LQRA 3QX7A 4C0XA 1WEKA 4HNSA 3HTXA 1DTSA 2ZETA 3CLTC 3UAWA 5HRCA 1W88B 4N5MA 1ISIA 4NZ9A 4QHSA 2RCYA 2FGKA 2GN0A 5HWSA 3ZHRA 4EUNA 1O7JA 4HQ0A 1KKMA 2DUJA 1YE8A 3ORSA 3I9KA 3P4UA 1FP4B 4MRNA 3RUAA 1Y9JA 5A5DA 3SCZA 2VN8A 5I3ZA 2JI9A 4W1QA 4C0WA 1FMJA 5HK9A 5JMWA 2ZSEA 1JHAA 1UMCB 3GLIE 1E0KA 1UKYA 3QJYA 3LVQE 2CWDA 1UWVA 4OV6B 4Y1FA 1NA5A 4QOSA 4AJ4A 1UZUA 2F7SA 2YBEA 2BE9A 3IV7A 1NJ6A 3URKA 4D56A 4E5MA 2BI8A 3FMGA 5IAOA 2FUCA 3I2HA 2H2FA 3QVVA 3IAS6 3EZ6A 4DSTA 4QM7A 1QF7A 3IDOA 5FBWB 5AKKA 2JIMA 2AVDA 1DEOA 3P8ZA 5DIFA 4PPFA 4QC2A 5LYYA 5DYYA 1YZFA 2CCKA 5JHGB 1LRLA 3MJSA 3ONWA 3QOFA 5DYIA 4GDMA 1Z08A 2QPAA 1LBQA 2B5WA 1WVIA 3EVGA 3KK0A 3SXPA 4D4MA 1ZGJA 3NTQA 4BUJA 4F84A 4ZCSA 4KXUA 1T6YA 1N2CA 2C2ZA 2PA0A 5DX8A 2FEWB 4LF4B 2QJFA 2YCBA 1ZU5A 1Y3AA 1JZTA 1B0ZA 3EQ7A 3LQ4A 4KN9S 4Z49A 1L4EA 1O0BA 5HM6A 1Q3HA 2P2NA 5YASA 1E4EA 1Y5LA 3DAGA 1RLTA 5DHAA 4R7GA 1RJ9B 1OX5A 2L82A 3W7VA 3G5LA 5TGTA 5FX2A 2J3HA 2GVNA 4IZOA 3V55A 1X39A 3AH8A 2PUTA 3IULA 3TS1A 3GEDA 1QORA 3B70A 5CW2A 2VK4A 5AUPB 1SBYA 4TS9A 2CXOA 4IHJF 4BZPA 4S24A 2A0UA 1CC1S 1UP7A 2J30A 4Q18A 2H1HA 5A5FA 1WHSA 1N6IA 2O2HA 4KB5A 4C29A 3T41A 4JI0B 3MS4A 3SLKA 1IM5A 1B2LA 2ODPA 1O6FA 3I9FA 1XCPA 3ZY2A 4CV1A 5LP6F 5ARBA 5DN6A 3CLKA 3D4NA 3MWGA 4LZJA 4QFCA 5CHEA 2QZZA 5E8RA 1J90A 2B9VA 5ENZA 1N2BA 3AFHA 2JFXA 3CRRA 5A2QA 5KKAA 3OC6A 5IVPA 4BMZA 3DFUA 3SJBA 1UC9A 4UW9A 3LBIA 3L0IB 2J5KA 2IODA 4MUEA 1N1EA 4DZZA 2PZJA 4QDKA 5EIOA 5E38A 3MS2A 1PJTA 2IQ5A 3HNOA 1UDBA 3LO8A 1VLLA 2WSIA 3HKDA 4G8DA 4XXHA 5D3QA 3BD8A 1QOQB 1PEDA 2AC2A 3OX2A 1V7QA 2N42A 2YV4A 3RODA 1P2BA 2CLIB 1Y7TA 4YT5A 3W8FA 5KKCA 3NUQA 2D8MA 3DHNA 2ZUWA 3FVTA 4MYSA 4UE2A 4JI2B 3K31A 4U63A 1ECCA 4PNPA 1X86B 3A27A 1KJQA 4W5JA 1CFJA 4H60A 3T9BA 3TINA 2AJCA 5JJKA 2PIAA 3PP8A 1N5MA 5JZ9A 3GZTB 3KFXA 2V65A 3CMCO 5JQGB 4IJ5A 3SHQA 4G1UC 1F4PA 2AN5A 5EJ4A 4M7WA 5AXCA 2FN8A 3WE7A 1YDWA 4R0VA 1ZU4A 5G53C 1U8XX 5ELLA 4NE2A 2GJ9A 5E1OA 4GL2A 4PRYA 1TPZA 3CUKA 5HG0A 4Z0HO 3ZWVA 1U0SY 2IXTA 3ECAA 4M1YA 4NABA 2XIQA 3HV2A 4KLRA 2H4FA 1RLIA 2BAGA 1FUIA 3A3OA 3HI4A 1AS0A 3PENA 4BLTA 4RTLA 4DG5A 2OAGA 3B7WA 5JU6A 5IHPA 4CEIA 1J06A 4WK0B 4WK6A 2KLBA 2F64A 1Z6TA 4N12A 1QKIA 1XMPA 2A14A 5KTMA 3W5CA 4ZVVA 3F1KA 2QAGA 1L4KA 3OIWA 5HOEA 5T41A 1UR5A 5D3MB 5EFOA 5C8YF 3DL0A 4F6RB 4EHBA 2LR0A 5IBPA 4HDNA 1U2EA 2WZQA 4JVNA 2QZPA 2GPTA 4LBWA 1CEQA 4K9NA 1JTVA 4D98A 4O2BB 4JELA 1FNSA 2Q28A 5TR9A 4CIVA 2JD0A 2GJ8A 3T61A 3ZWOA 2UUOA 4E1BA 4YY3B 1W36D 1MRNA 2HRCA 4J90A 3EEIA 3HHPA 3QFRA 4R2IA 2REQB 4J0HA 2Q46A 2XAAA 3A10A 1EVLA 3DTNA 4EJSA 1NUPA 4IQ8A 5JUWA 5JJBA 1ULSA 1I7LA 5KVAA 3KQKA 2WU8A 3C6BA 1Q44A 4IQGA 4LY9A 1PG5A 2H18A 4YO8A 1EVZA 3B78A 5AI0A 1QZTA 3NLLA 3WMGA 5FFMA 2EHDA 4BQOA 4D3XA 2CHUA 2HK8A 3AI3A 3LCMA 2OSVA 1NXTA 5GONF 3TNYA 3EXEA 4D4KA 4IR7A 1KO4A 1J24A 3N8GA 2B4QA 4YUAA 1CDOA 4FI3F 2WG2A 5KYTA 3BSSA 2BCJQ 4ZO4A 4BGUA 1JQKA 4ERXA 1KS2A 1KKLA 1N1MA 3NWBA 2RKBA 4WLNA 1KZ7B 3SKXA 3J7AC 1A2QA 1ZOIA 1PFWA 3RBVA 3G7SA 2FMFA 2ONZA 1YDGA 4MVJI 2H5EA 4IFIA 4RESA 4N3BA 3IQFA 1R3DA 1RXEA 5LBIA 3V97A 4G8BA 1D7OA 1V8DA 4NZNA 1O6CA 2P2GA 4ZV9A 4EYOA 3GD5A 3QVLA 1M8PA 5JYEA 4XD7A 4UEKA 4H7HA 3KTOA 3N2KB 2LXNA 3UGTA 1POWA 3D3NA 3OO1A 4DWJA 3SZRA 4FVTA 3S44A 3BXPA 2JGIA 4KRGA 1GAXA 1V5FA 4C06A 1Q7BA 1T4DA 1XU7A 2ZI4A 3M6XA 4IRUB 4KSYA 5IAJA 5LZ5A 3K7EA 4G01B 2VOJA 3BMQB 3L84A 4OA8A 2YUIA 4R6XA 4RHXA 4EABA 4FFLA 1JMKC 5HQTA 4FHZA 3N3AC 1KJWA 4WKPA 1TK2A 3EPJA 2I03A 4I66A 1Q0RA 3CO0S 2BMWA 2BM9A 2EZTA 2N9UA 2V74B 3GFRA 2EKZA 4KWTA 3WX0A 4F4JA 7ABPA 1RU3A 1ZJ5A 1HL7A 4MDYA 4GVXA 3IILA 1IPHA 3B1YA 5TC4A 2Q4OA 4I5EA 1GTL1 4EW3A 1N2HA 3AV0B 2GYVA 2RAVA 1X3SA 3STWA 5B3LA 4REOA 3FTCA 1L7BA 3R0VA 1GZ5A 3TWOA 4WLUA 4ZMBA 1P4RA 3DG9A 1V37A 4BRSA 4DYHA 1G60A 2PXCA 2I7VA 2OGUA 1OWPA 4WXEA 3UBMA 3ETCA 3E9RA 4PQYA 4X8LA 3V1KA 1DXYA 4X97A 2EFYA 1IBMB 5IAKA 2A9OA 3BJRA 4I14A 3S68A 3TZKA 2Q4RA 4OQQA 4BIMA 2QSYA 5CXUA 3O75A 1DNPA 2JRLA 3B1ZA 3Q72A 1Z06A 3S70A 3BCSA 2C9ZA 5CYFA 3MRVA 4IRXA 3WB9A 4YRSA 3GZJA 2CXHA 3SIPA 4BYMA 4EBBA 1T91A 2WQZA 1MQSA 4F38A 4Y67A 1PR1A 5L3SB 1ACLA 1E2LA 4KMMA 2Q3DA 1WWKA 5MDHA 2HYDA 1D5CA 1GGFA 2XR1A 4RDIA 2IPOA 2DM6A 4FUQA 1PJZA 1WP9A 4KR9A 5BQFA 3T6KA 1CE8A 3TTWA 3A6DA 3MS7A 4EMTA 2NU6B 4HAXA 3ZOKA 3BUSA 3MTQA 4RTQA 2GEKA 2QTGA 3QXGA 5CCXA 1JUDA 1D0SA 3IX7A 5D6OA 3RUHA 5AM2A 5JJLA 3EJ6A 1I5EA 2QTTA 2PXHA 1I1QB 3OZAA 3QNUA 5DM2A 1OIVA 5CFNA 1JHPA 2QLMA 2R7LA 4LBVA 5FD8A 3FB1A 1VLHA 4AJNA 1E79D 1TTHA 2XUDA 4EITA 4Q6BA 4X5OA 4B2PA 2O7VA 3OJEA 1OYOA 1IY1A 1E61A 4DSZA 2K2QB 3IIJA 1NDUA 1UXGA 4QYSA 2I8CA 2IHVA 2ODEA 3TI9A 3ZWYA 4ZI5A 4FEAA 3ONNA 4F2DA 2FUG6 1SVWA 3T3IA 3BORA 1Q84A 2I4RA 2C3OA 3PEUA 4US0R 2GCOB 2QRLA 3TPFA 821PA 2ADOA 4K87A 3B7GA 1N3BA 2OQRA 5DCLA 1YL5A 3RUEA 1GR1A 3UT0A 4NWIA 1E1MA 1ACMA 3HL4A 3ED1A 3KUCA 1OWNA 2AN3A 2P9GA 2QYSA 4U2CA 2AHOA 2VVTA 3AEQB 4JL5A 5JISA 3ZDBA 3D9QX 5JNVA 1X13A 3JAKA 4X63A 4OUKX 2MYNA 3KOOA 4P80A 1MG5A 5AUOB 1VI5A 4Q9DA 2BKVA 1T5TA 1Y82A 3D4IA 3HVUA 4OHKA 3C24A 4GZ6A 2G04A 2FDXA 4DNXA 1DAMA 5JW6A 1W1WA 3KPWA 4ZDIA 1HNWB 4ARUA 2GESA 3KQHA 3I01M 3HVJA 2F1KA 1GGKA 2KBEA 3R2JA 2FUEA 4J2HA 1U2RA 2R1UA 3DS8A 4M7RA 2WHXA 1OXSC 1QR6A 2J3DA 3KM0A 1F51E 2PRKA 3MLAA 4O4LB 1VGRA 4RZ2A 2P5UA 1RIIA 4TTIA 3S6JA 3V7YA 4OQLA 1XP5A 2IXDA 3WFIA 5CLHA 2ISQA 1K3TA 5HJEA 1BVRA 1N4DA 2VBFA 1JBEA 1QGYA 3V8RA 5BV8A 5JASA 3D8SA 3Q8WA 4HK4A 4RPGA 5EE9A 4R1TA 2VUIB 4CF7A 4YCLA 3PEFA 1FXWA 4MOWA 5EMNA 4YP1A 2OZPA 3AKCA 4IXMA 5DULA 1M1XB 3GPIA 5BR4A 1P4AA 3EIEA 2WJVA 3BFJA 3MERA 1EJ0A 3PC8A 1REQA 2VP0A 1OFVA 1BEUB 3P2OA 4HD8A 4YGXB 1KC3A 3RU2A 4MS4A 1IPFA 4D8TA 4HXGA 3EEQA 2O06A 4JUBA 5E2BA 5ES3A 2IYLD 4GLLA 4MP3A 5E6UB 4MJXA 1Y1SA 4PC3A 2PXXA 4F3YA 3M6MD 4V0QA 1BN6A 1GA1A 5AOBA 1NYTA 2V5VA 2YXPX 1VKJA 5CVTA 1JPJA 1H2BA 4LHVA 1VJGA 4GRDA 1Z13A 2R00A 3OM0A 3PX2A 5JRZA 3RE1A 1J5EB 3T52A 1DSSG 1NUTA 2YZKA 3GXOA 3RFFA 3ZV3A 1O0CA 4O2AA 1BOFA 1JSZA 1LWNA 4NP6A 3ZWWA 2KHZA 5TQ0A 1ZC3A 3IKLA 4WY5A 5IK2A 4KL8S 5F9FA 1VKZA 4CKBB 1IJBA 4ROSA 1HE8B 2FFRA 4DMHA 4C78A 3T1NA 2Q9UA 1LU9A 1XA4A 2XNDA 3FCUB 3H2KA 4OI1A 1XQ9A 4DMUB 4JJ6A 4DR2B 2JLWA 3M70A 2ZBDA 1ZDMA 3HBNA 1RC8A 1TEXA 1NXQA 4HWOA 2W2LA 3GVPA 3THYA 2D1TA 1SB9A 3PVSA 1NMYA 2EFDB 2JAPA 3QSGA 2ZSAA 1FX0B 1ZYUA 1TTTA 3PHBE 3FGOA 5BSVA 3N8KA 3LDFA 2HA2A 1EX9A 2VZ0A 3FFWA 3VC1A 4QUAA 3GJSA 3ZBPA 3GBPA 2QTAA 2B8WA 5JD6A 1JG6A 3W3AH 3TL2A 3K35A 3MF4A 4CL8A 2X8BA