1SUAA

Subtilisin bpn'
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
263
structure length
263
Chain Sequence
b'VPYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLNVAGGASFVPSETNPFQDNNSHGTHVAGTVLAVAPSASLYAVKVLGADGSGQYSWIINGIEWAIANNMDVINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGTSGSSSTVGYPGKYPSVIAVGAVDSSNQRASFSSVGPELDVMAPGVSIVSTLPGNKYGAKSGTAMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGDSFYYGKGLINVEAAAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUBTILISIN BPN'
publication title Crystal structure of calcium-independent subtilisin BPN' with restored thermal stability folded without the prodomain.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Complex (hydrolase/peptide)
total genus 92
structure length 263
sequence length 263
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 1997-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1suaA00
3VV3A 1CNMA 2XRMA 3DE0X 5B1EA 3TECE 1Y3DE 3WIUA 3OSZA 3DE5X 3I34X 2ZRQA 1KE2A 3EE6A 1NLUA 2WV7A 1BE8A 1AF4A 1Y3BE 3WQBA 2B6NA 4H6XA 1SIUA 1PFGA 2ZWOA 4LVNA 1WMDA 2HD4A 2W2OA 1DBIA 1GT91 4AKTA 1EA7A 1S2NA 3A3OA 1GTL1 1ZVKA 3F7OA 4KG7A 1V6CA 1AV7A 1VSBA 4NE7A 2WUWE 3Q40A 3SQOA 1OYOA 1XF1A 3VSBA 1SIOA 1Y3CE 1TO2E 4H6VA 5ARCA 1Y48E 5CW1A 1BFKA 2W2NA 1T1IA 1GNVA 3ZXYA 1C9JA 2X8JB 1EGQA 1KDYA 2IXTA 1P7VA 3DE1X 1R0RE 3DWEX 1S01A 3VHQA 1AVTA 1SH7A 1A2QA 2Z30A 1WSDA 1T1GA 2PYZA 1SBHA 5I9SA 1GNSA 1GTG1 2G4VA 3DE3X 1TM5E 1SVNA 2DQKA 1C3LA 1SUCA 3P5BA 4AKSA 3I30X 3I37X 1TM7E 2Z2YA 3QTLA 3SICE 1OT5A 2W2MA 1ST3A 1SUDA 1NDQA 3DVRX 1Y33E 4JP8A 1SCAA 1YJAA 1DUIA 3Q5GA 3CO0S 2HPZA 4M1ZA 1SCJA 3L1KA 5FBZA 3GCXA 3A3PA 4I0WB 2V8BA 1C9NA 1Q5PA 5AVJA 3ZXXA 1AU9A 1PEKE 4GI3A 5AQEA 1SBNE 1SUAA 1SBIA 3GT4A 1SUBA 1SN7A 2PKCA 4J94A 3D43A 1Y1KE 1YU6A 1GTJ1 3DW1X 2W2PA 1Y3FE 1TK2A 2WWTA 2Z56A 4OMDA 4DJ5X 3GCWA 1MEEA 3AJ9A 3LXUX 1PTKA 3LPCA 5JMOA 2Z2XA 1Y9ZA 2ZWPA 3DE4X 1OYVA 1TM1E 3CNQS 4OV6B 4CG0A 1T1EA 5JXIA 1KDVA 1GA1A 1SBCA 3AFGA 1BFUA 4OMCA 1UBNA 1BJRE 1P8JA 1YJBA 1SPBS 4YN3A 1ST2A 4ZARA 1Y34E 3DE2X 3PRKE 4KB5A 4LVOA 1ZVJA 2TECE 1R64A 5JXHA 4DZTA 1PJ8A 1SUEA 3F49S 3EDYA 3UNXA 5AMXA 2QTWB 1BH6A 2X8JA 1JEAA 2DUJA 3EIFA 1Y4AE 4HVLA 3PTLA 3DVSX 1SCNE 3BGOS 5B1DA 3TI7A 3WIVA 1IC6A 2PQ2A 1WMEA 1KDZA 3VV2A 3TI9A 2PRKA 1TECE 1BE6A 1C9MA 5FFNA 1MPTA 3VTAA 3QMPA 1SELA 4WOBA 1AH2A 2SNIE 4H6WA 2PWAA 1AK9A 4K8RB 5ARDA 1IAVA 1GCIA 3D9QX 1SCDA 2PWBA 3LPDA 5JXJA 2ST1A 1AQNA 1SCBA 1GA6A 3DW3X 4FONA 1NDUA 1CSEE 3DYBA 4RYDA 2GKOA 1SBTA 3T41A 4WOCA 3DE7X 1WVMA 4NE9A 4KPGA 4CFZA 2Z58A 5JXGA 3QFHA 4C3UA 4MZDA 1KE1A 3I2YX 4CFYA 1Y4DE 2Z57A 2ID8A 3VYVA 4NMXB 1S02A 4C3VA 3F7MA 2WUVA 5K7SA 1TM3E 5FAXA 3HJRA 3BX1A 2P4EA 1THMA 1GA4A 2XTJA 2Z2ZA 4BWGA 2SICE 2SBTA 3BPSA 1TM4E 4ZOQI 3AJ8A 3DVQX 3WHIA 5AVKA 1P7WA 3DE6X 5SICE 1WMFA 1V5IA 2DP4E 3GT3A 2E1PA 2PMWB 1SUPA 2W2QA 5ARBA 2ID4A 2SECE 3H42B 1YJCA 4HX2A 3A3NA 1R6VA 2IY9A 4Z2AA 1HT3A 1TO1E 4B5LA 1SIBE 3LPAA 3DDZX 4DWWA 1TMGE 1LW6E
chains in the Genus database with same CATH superfamily
2GCOA 3FMPB 1A8HA 4G5XA 1IUOA 3CLKA 3EJ6A 2EP8A 3BZWA 1OIVA 5C8ZA 1FXWF 3HPQA 2AXNA 3V7NA 2NU9B 5F7XA 3V7FA 4IOMA 1Y7TA 2CXRA 5JBQA 4H9GA 3IYLW 3TZKA 2WHQA 2H11A 2J0QA 2XTNA 3FB1A 3HCRA 1Y98A 3C6MA 1IDOA 4AKGA 2B1GA 2ZSDA 5JMPA 4AECA 1LBTA 4BNVA 2WV7A 2F17A 3IXQA 4J0GA 3GH3A 1N2ZA 1HURA 3A58B 5CEFA 4Z99A 3WJ1A 5CX4A 3AM3A 3FWPA 3ANXA 1T43A 1G55A 2GM9A 1V4VA 1MRNA 1B8VA 4F4CA 4WA8A 4ACAA 1HKUA 1JIJA 4R8RA 2MSDB 4PZUA 4NNPA 5AICA 4QOEA 2CFRA 3HLYA 3JQ9C 1HMPA 1UF9A 2YQZA 3LUBA 3RG8A 3RFUA 3WGTA 4AJ1A 4OHZA 4UNPA 4CLRA 3IDZA 1FDOA 1LDYA 5B58T 1MTZA 5F2KA 4HDRB 1I4OA 2W4QA 3L6DA 1YZHA 3OE1A 3OZUA 3EYAA 3S28A 4X6XA 1NKTA 5CVCA 4RJKA 4N6NA 3GVIA 1ZZGA 4ZHQF 1Z8NA 2EKZA 1P1BA 4GOJA 5EHNA 3ZU4A 4UEWA 4Z4HA 1EFAA 4P8RA 1NYQA 4Q1DA 4WKNA 4I6EA 5A9RA 1NN1A 4P7FA 2AB0A 3WB2A 1EMDA 2ZYHA 3OU2A 3PUIA 4LWPA 4TSRA 3UENA 1U5BA 4QUBA 3PEVA 3OEYA 4AY3A 1E2FA 1KS9A 4D0NA 4MYTA 3FPBA 4N54A 1ZGCA 2C95A 1FQWA 2LIPA 3D6MA 4Q16A 3AGQA 1APBA 4QVIA 1VPDA 3T4UA 2GZ1A 1Z3IX 5LQMA 4HC4A 3HR4A 3ANSA 2JI8A 3F46A 2XDWA 1NNLA 1R8SA 2YMMA 3DAHA 5F7ZA 3PA8A 2R87A 3AHIA 1KI7A 3ICOA 1ONSA 2JGIA 1RPTA 1VE6A 2EOAA 1TA9A 1XCGB 2XAAA 2XNHA 1K6XA 2MWMA 2QRGA 3P27A 3NBUA 3P7MA 4HQ0A 4IDGA 4M36A 4UCQA 2D3TA 2GRAA 3W6ZA 1T36A 4H6VA 4YP7A 4J9UE 3OPYB 4BB5A 5CW1A 3S2UA 2IZZA 5L3QA 1EINA 4KBFA 1F38A 1UKBA 4PX3A 4MP8A 1OBHA 1X8JA 4DIBA 2ZUBA 2GT1A 1YRHA 4BCCA 1Z6AA 5J2UA 2NZWA 1C9JA 1U3DA 5HG0A 1KY3A 2GZ3A 1X86B 3K0CA 4HNHA 1LTKA 1SCIA 4JLSA 3HJFA 5DGXA 1EGQA 1EXMA 4I1IA 1B26A 5CYOA 2XWJI 1OE0A 3QUAA 1FC0A 3DZHA 3MTDA 5AXDA 5K0FA 2XUDA 3CLUC 2HWYA 2R1UA 5F76A 3IKVA 4IICA 4PONA 4CVNA 4W5HA 1QCDA 1U2GC 5F4ZA 1L5GB 2ACWA 1IQ0A 2V3VA 2XMQA 3TPZA 3DKRA 2HPVA 4L4ZA 3C98A 2C5LA 2AGVA 1SBHA 4RD0A 3R5FA 4KK3A 4AY5A 1M73E 4Q9AA 3DMYA 3AR5A 3DKIA 1JE1A 4QOHA 1GNSA 3KTOA 3AM5A 1UAAA 2DWPA 4PX5A 3LAWA 5IU6A 3UQYS 2QTTA 4KSYA 3OE5A 1KK1A 3FJOA 4ND3A 2OD7A 4G2NA 4YJGB 1YB4A 4BFWA 3ZU5A 5HJ5A 2L42A 3KLNA 4NF2A 1SB9A 5F5LA 1TM7E 1O08A 2HKIA 1ORHA 2Z2YA 3RC1A 2WJ6A 4OAQA 4MB0A 5ANRB 5IT9A 2J33A 1TIKA 2R6FA 1G63A 1ECFA 1SQSA 1W1IA 1Z39A 2WU0A 2Y93A 3INGA 4MRPA 4OQZA 4W8HA 4WBSA 3FXAA 3KKEA 3TMAA 4EHJA 3G8CA 1PW7A 1AY0A 1JHAA 1FFCA 1WW8A 1E62A 1G8MA 3FWKA 3PXDA 4ZWNA 2NN3C 1N8NA 2CWWA 3D64A 3ROXA 2LDBA 2RHGB 1K3UB 1J33A 3KC2A 4ZEXA 1C7QA 2Y68A 3P9YA 5EZYF 3C2QA 1U4NA 3GAMA 3OCYA 4MJXA 3IAUA 4FWBA 4H31A 4UDOA 4D81A 3EPJA 4OQLA 1C3VA 1K7CA 5G41A 1SFRA 2P65A 1YNOA 4QD3A 1E4EA 4MVJE 2GESA 2V8BA 4AKIA 1Q5PA 1U0OC 1NUAA 2HX1A 1V7CA 1JR2A 2PUWA 3JQBC 4N47A 3VSAA 5JLAA 5FOVA 2PSDA 2P79A 5FOTA 2ZSIA 4P5EA 5JJIA 3CSDA 1ZFNA 2HA5A 3K6KA 2VRCD 4H4CA 1EIZA 1Z3CA 1U8ZA 5IBPA 3I6ZA 5CIYA 3R5XA 3ROQA 3EEYA 3FUWA 2DH6A 1YE5A 3OECA 3A1CA 2VQDA 3FHCB 4J49A 2KJQA 3B7WA 4HGNA 1QSGA 1PS9A 5F7OA 4J0CA 3NDIA 1DCFA 1Z83A 2F62A 2J5BA 3A2LA 2X41A 3ETLA 3VH4A 4BQIA 2HQSA 3ICCA 3V1NA 5F1OA 4DSNA 1NULA 4HAXA 4QFMA 4IZ6A 5A05A 2XUGA 4B8YA 1DPGA 2H29A 1WHSB 4LK3A 1GEEA 1RQ2A 4FSXA 5F1KA 2VYNA 1SKAA 4KQKA 3WAKA 1V95A 3HVUA 1H65A 4G63A 3CCCA 3MWDA 4HFMA 4HLQB 2I33A 4JYPA 4RABA 4ACBA 1NW3A 4CE6A 1ZINA 1I7DA 1QH1A 4GMDA 1RMYA 3GCWA 3DZGA 3NBKA 3LQ1A 1GAWA 3TZHA 1HC7A 2F1HA 4D8VA 3TZ6A 3HGMA 2HK7A 2ZUEA 2DT5A 4M0FA 4MITA 4AAYA 5ESXA 2RHBA 3RRJA 1NP3A 1UMKA 1WCIB 2IS4A 1KGDA 4KRXA 4Z9FA 3G5LA 2NSLA 1KJJA 3MT0A 4FHCA 2QZPA 1A5AB 4HN9A 3FCAA 2EGHA 4TTTS 1JA9A 4B6FA 4HLUC 3MINA 1ZJWA 2YWDA 1VL8A 3OZVA 2GJAA 3TNJA 2WHXA 3Q9SA 4YCMA 4KBYA 3LWNA 4N0MA 4YQFA 1QJCA 1X7ZB 3IEUA 3W5BA 2YJNA 3SX0A 3FOEC 2PEYA 1VL2A 2CE7A 5CXSA 1FTSA 1QHFA 3K94A 4PPFA 4PNZA 4QJ4A 3ULKA 1GA1A 2OTCA 2JRLA 1SBCA 3FIJA 5B2EA 3EBLA 2JAUA 4L7VA 4FZJA 2HIHA 1GU0A 3RWMB 4BO4A 3QLTA 3V6MA 3W3AH 1MC5A 1F7VA 5AVTA 1E77A 4XRGA 3UIEA 4BNKA 2GFHA 3PC4A 2ANBA 1G7TA 1HDCA 1RWWA 4EPTA 4H3SA 2ROQA 3UMVA 1ZH8A 4DCMA 2NM0A 1JDVA 3HUEA 1C7EA 1W0JD 3P9QA 2E6UX 1TEZA 1UINA 3IR5A 4KWEA 4TWIA 4CMJA 1JJBA 1WWKA 2NXJA 3QPVA 4HVAA 3PRKE 2ZI5A 2NP6A 3ZXSA 4KQCA 1D0SA 5EWJA 2EDCA 3DPUA 4ZHQA 1P77A 4E46A 3HY3A 5ES3A 3FWYA 3A0RB 4MGZR 1BCRA 2Q8QA 3EXAA 3BFJA 4LQCA 4OJQA 2B3DA 2O1WA 1QV7A 3AP1A 2WSMA 4U0JA 3UGKA 2O2EA 3U3MA 3QV2A 5AKLA 2PANA 1DL5A 2C94A 2XB4A 3IT1A 3OPQA 2YUIA 1BH6A 2GN2A 3WWYA 3VYTB 1L4KA 3ZE1B 1SXPA 1CEEA 3EIWA 4K6KA 2CF6A 2DUJA 3C43A 5JC8A 3K0SA 1PG5A 3D5TA 4YEDA 3RS8A 3FPGA 1GAQA 1AZSC 5DYWA 1Z06A 2AWOA 5DRYA 4BFXA 3GRRA 3X1ZA 2M2IA 3Q98A 4HVLA 5DLYA 1Q19A 3G0DA 1GCGA 1SQGA 1T1JA 3FTPA 3L2OB 4LF5B 5AKYA 1G6HA 1AGRA 4EHBA 5HF5A 2WVJA 1JR3D 4LHWA 4O4LB 5I01A 4C4OA 2ZUDA 3P2YA 1V3TA 3TLEA 1U0GA 2QUAA 3NTXA 3SBEA 4RX1A 2FEOA 2P9QA 2ZYWX 4D7AA 4H08A 5BWCA 2AOVA 3D3NA 4G56A 2R1TA 5CD9A 8AT1A 2CNOA 2ADMA 3G0OA 1P39A 4EA6A 2EZUA 4G01B 1NQTA 1RYNA 1ZGAA 2Z5VA 2OQIA 2RGXA 3EY4A 1CUZA 1X14A 2EP7A 3EY9A 2E4XA 4NZ9A 4XCVA 5FFNA 3VPCA 4H7IA 4BJ6A 4LQ4A 3O8OA 1EJ6A 2G88A 1YASA 4KUGA 4TUYF 2QP4A 2V7QD 3PCXA 4E5UA 3URMA 3EGCA 5A6VA 1RYMA 1D2RA 4Q3OA 2MIIA 1DB3A 4ZT5A 5CU7A 5AUQA 4B3TB 2O1XA 2GXSA 2YNMC 1QLJA 1XLUA 2QI9C 4IYRA 4PSCA 2GBCA 3KQHA 3CWCA 2HK9A 2LCIA 3DTNA 3SNHA 5DNUA 1E9CA 1W73A 3E3NA 3FWHA 3KD2A 6YASA 1PT8A 3M5WA 4YLGA 1GTRA 4UQPA 1BWRA 3LTEA 4CM8A 3C3XA 4OJKA 4KGXA 1U8XX 2VDOB 2NSYA 5FRDA 2FOXA 2JFUA 3FDFA 4NESA 2HWXA 4QNMA 2QRJA 2QV7A 3IESA 4QBIA 2NU8A 1HXHA 1WXFA 3A11A 3R9IA 2AN1A 4Q34A 1AQNA 2YQ5A 3LYAA 3OIUA 4Y67A 3UJPA 3WL5A 2Y0BA 3NBZC 2GPTA 1FRQA 2IYRA 3FI9A 3K32A 4H1TA 3WK4A 4ADSG 1HYGA 2ZJBA 3H9UA 1G6OA 1ULAA 1ZWKA 3CVOA 2V4UA 3G02A 1C29B 3WGZA 3QPDA 1BU8A 3H04A 1K3TA 1CJUC 3FZNA 3SMVA 5LD2B 4QNNA 1R4ZA 1RS0A 4JT2A 4ETMA 3FTQA 4DRYA 4E11A 2FWRA 2V6BA 1B3BA 4CKWA 2O0KA 2W70A 3EVDA 3UH1A 3HUTA 4WH0A 2OV1A 5KQMA 3QXXA 3JASA 1JEYA 4I1YA 1J2YA 5EKXA 4ZT2A 4NE9A 3K9LA 1SULA 3RANA 3WRWA 5ILOA 4BAUA 4S3MA 2UYOA 4OBEA 3MCAA 1U80A 2ZWVA 5EP3A 4YUXA 4U9UA 3BE6A 1KWGA 4O2RA 1QPZA 3DDOA 2EW2A 5IMBA 1KDOA 1QQ7A 4QDTA 2ORED 4JENA 4PTYA 2AQIA 1JEYB 1W85A 1Y81A 2AFHB 2B4YA 3Q6MA 5TQ0B 4ND2A 3GT0A 2DBVO 4DDWA 2ICAA 3OHPA 3A6ZA 1PYGA 3E84A 4RD3A 2JFPA 2R8EA 3GRFA 1FFAA 3PSAA 4J0KA 2DTEA 2ISCA 4CCSA 2OHXA 4YAUA 3CVVA 5TF4A 2GBIA 3D4NA 5C52B 3BFPA 2WPDA 3LT5A 2A7QA 1UM9A 5KNCH 2QX7A 4NHOA 2J3MA 1ISHA 3AW8A 3JARA 2AMJA 1CE8A 2FZ4A 1IXZA 3NTRA 4D3YA 3KXKA 4D43A 3I53A 5IKOA 4HNTA 1DEAA 2AZ4A 3WLHA 4YV0A 2IOFK 2FZ5A 2WAMA 2PUJA 1XQXA 4KN9S 1W44A 1CV2A 1M75A 2LTAA 2VCYA 2XXBA 1NJSA 4Q3DA 5FHRA 3S2ZA 8GPBA 5KJCA 2AFVA 4OHMA 2OWDA 4QPJC 3WIDA 2AEEA 2B3TA 5I4CA 2IL1A 2BKUA 4WN9B 2NTJA 3BX1A 3E3LA 5FUWA 4AZWA 1FDSA 4ZI7A 4BTEA 4JIGA 1NWHA 3KZKA 721PA 1GA4A 3GY0A 4B35A 2W7TA 4MPDA 3DEJA 3G6WA 3IP3A 3VTKA 5AVSA 5JZ9A 1TLTA 2F4VB 1LD3A 1FQJA 4R1NA 5LDDC 4ZCRA 2F43B 1QP7A 2K4MA 4BWFB 4KIFA 1D4ZA 1KJYA 1UKAA 5CLIA 5ALGA 5C8YA 4ZOQI 2OWEA 3RDPA 1E2IA 4V2UA 4XQ9A 3GFPA 1PLJA 4BVAA 1OLXB 1Y7LA 1LK0A 3D8UA 2O8DA 1FTYA 4RSHA 2IBMA 1EZ4A 3GJRA 1Q91A 1P4AA 1U1DA 1XOIA 3PYMA 1E9VA 3ESRA 1SKYB 4IWNA 2C5BA 4Z1MD 5KYWB 2XNCA 1F2DA 4XYBA 4IIUA 1SUPA 5TE9A 2YJZA 1H2HA 2GMWA 2OMEA 4INZA 2QAGC 2P2SA 5B4UA 4GSKA 4KMOA 4TTPA 5ALFA 3LT0A 3DNFA 3GQVA 4LDNA 1JAZA 4MS1B 3H6KA 1U4OA 2P2LA 2PUTA 4MWGA 4ARBA 3LIPA 1W87A 5HCIA 3DQZA 3ETDA 5K6RA 4Q4AB 4CCAA 3EHEA 2I2BA 5AXCA 4HOYA 1TQ8A 2C78A 3PQ8A 3SJCA 1FXUA 1FFDA 5H9WA 1G20E 3WO1A 2ZJ0A 4DQUA 2BFNA 3BHMA 4CM3A 3PI6A 2OENG 4IBOA 3D8HA 3IAS1 1UKZA 2C8VA 3PWZA 3SC3A 1IJKA 3NW9A 6ABPA 2YINC 1VPWA 2O3JA 4WBNA 4ZTBA 2JHFA 2V98A 1DIRA 2G9NA 2QPOA 3WBBA 4DR7B 1JDBB 1LDNA 2O6HA 2Q5CA 2MYTA 3WGYA 3EIHA 5BQXA 2VLBA 2WJAA 4JIMA 4ZFNA 5JRZA 4CWAA 5IKXA 4WNYA 4XEHA 1VCHA 1V11B 1JQLB 3LLSA 1NVFA 4A6XA 1UIRA 1ZN9A 2O2YA 4MTCA 2ZCJA 2VHJA 4URUR 3EQ2A 1OX4A 1VE9A 3RIGA 1O6CA 1JJ7A 2PRIA 4XYMA 3WYGA 3QVVA 4K7JA 4IUCS 4D3XA 3G2HA 1B6TA 1IEXA 4XEUA 4P22A 1THGA 2COEA 1IN5A 1R0LA 4M0DA 2BPOA 3FOWA 4UCFA 4BMDA 3D81A 4D9GA 3LP6A 2EEZA 3G0CA 5KQSA 1PT5A 2H0AA 2NTVA 2VYND 3EZ6A 3LRXA 4C4XA 4BZPA 1GPAA 3VNRA 1FYVA 2B20A 2G17A 3CCFA 4J1QA 2WHPA 3ZZ0A 2ZI9A 1VSVA 2CKMA 3WGMA 2FB9A 1QWSA 2GN1A 4RTOA 2PUGA 3DTYA 2C7VA 1RWMA 1X7GA 3HRIA 4L16A 4P7JA 5U9CA 4N4AA 3NHLA 1ZOPA 3GLFB 1K5GA 5FTWA 2P2CA 2RC5A 2QWXA 2FW1A 4IRUB 1TVMA 2W6PA 4FFDA 3T3MB 3ZQ6A 6PFKA 4MVJH 4K81B 1UXGA 4Z4QA 5E8JA 1UC9A 3BE8A 3VSDA 4WJKB 1KIMA 1Y5NA 4EF6A 2H7CA 2BGJA 4D98A 2IPAB 2HN9A 4BQRA 5T4HA 3GIWA 5T3UA 1XU4A 1N4DA 1M2GA 3EXHA 5E7JA 2BH2A 1GTL1 1Z34A 5HKAA 4D57A 1I4TD 1N5IA 2ZU0C 3MXTA 4R54A 5CXUA 3RVLA 4ZZIA 2H7YA 3G7NA 2WABA 3I05A 4OL0A 2RB4A 4Z0HO 4OXRA 3ZDEA 2AKAB 1I6MA 2AMYA 821PA 3WDMA 1TQ6A 1N2CA 3MCUA 1CB7A 1CDDA 4GRAA 4OK3A 5ECGC 4HGPA 5LQAA 1TPZA 2VDRB 2WE8A 1AQJA 2B7BA 4ZRDA 1MT3A 2ETXA 2PHZA 3Q41A 4X6YA 1Y4SA 2ODQA 4MIYA 4XGRA 4B4DA 4YMHA 2YVKA 4BRWA 8OHMA 4UUAA 2PVSA 4XUGB 1YFJA 1PWYE 2E87A 1JBEA 2IEAA 5HS6A 2OORC 4D5EA 3CV3A 3P94A 1SA0A 4FC7A 4B48A 2W6NA 1QDEA 1BEUB 4D46A 2XB9A 4MAAA 1T4CB 3IHTA 5DJ5A 3L49A 1AKRA 3I2HA 1V7QA 2C5EA 1W88A 4KQ2A 1D9ZA 1LCIA 1IVNA 2CJFA 1WRBA 3ESQA 1VJDA 3JQGB 4HJRA 4RXMA 3R40A 3RGWS 3ORHA 1PGOA 2HIGA 3FYUC 1PJTA 2AMLA 3A3YA 4XKJA 1M1UA 1PZEA 2FF7A 2I4TA 2IKSA 3UXHA 3JZFA 1HF3A 2BHTA 1XTPA 4MKFA 4F0JA 3W5AA 2A4MA 2F4NA 2OSVA 4RHYA 1G17A 2W9XA 2D74A 4B33A 4HDCA 5D1NA 3HUUA 3K6JA 3T3GA 1WSDA 2HJGA 5F35A 3BTSA 2DM6A 3LW8A 3OT4A 3WLOA 5JCXA 3W6OA 3TRIA 1DCMA 2HSJA 4LRSB 2IF2A 3O4JA 3AU8A 3N2LA 1JQAA 3AR7A 5LLDA 4DEXA 3M6IA 1UJ5A 2RBKA 3QUSA 3AIIA 4UHHA 4JBIA 1FFWA 4TS4A 1N6PA 3JD4A 3ZGXA 4CR8A 3QTBA 4JLWA 1PD0A 4ZMSA 5A3QA 1GG9A 1HLGA 4J07A 3KQUA 3K05A 4PXAA 4ZPJA 1SUCA 3STYA 1BW9B 3PQ7A 4RPLA 5IJ0A 3SYLA 2WSLA 3H5AA 3QTLA 2FHPA 4YJ3B 3PFIA 5KNLA 2ZJ7A 2DRIA 1QDUA 2J7PA 3RRMA 4EW1A 5GTDA 5HILA 1CVIA 3WYCA 2BN4A 4FYYA 4GXRA 2AG0A 2A9VA 5AVQA 4URZR 3PPIA 2JS7A 4N7RA 4CM9A 1N7GA 2N1MA 1KO8A 2X58A 2XWPA 4JEHA 5IZCC 4FT4A 1XDBA 2PS9A 5EIBD 2YJ4A 3KXPA 1L8LA 3N8KA 4XA8A 3Q5GA 2QVLA 4HLCA 3ZVRA 2C8LA 1U0BB 3LBIA 1NAHA 2GJSA 2RGEA 2SCUB 3C1TA 5ABPA 1Y82A 4BC1A 1MB3A 4MGKR 4NXMB 3L1KA 2JJYA 3E8SA 4KLRA 4W5OA 2ZPUA 1NRIA 4NBVA 1FX0B 2XRZA 2JAQA 4PNPA 3DO5A 1JXAA 4MW5A 4KQJA 1HRDA 3U7QA 2W2KA 4BKRA 5IC6A 2GSWA 1C7FA 1V1RB 5CPFA 1I3CA 3D3JA 4AURA 4X95A 4R2XA 4A5SA 3DO6A 3QBJA 5ECDA 3U7JA 1ZM2A 3K5WA 1GPNA 2VSOA 3TLAA 1ZJJA 1TT5B 2F3TA 4B40A 1FX1A 4FB4A 1YJQA 1VI5A 2OZVA 3A31A 1EFPA 2CYAA 1EGVB 3SBDA 4D4GA 3BTOA 7REQA 4B9EA 1CC1S 3OKPA 2C3PA 5D01A 5BWMA 4UDYX 1ICIA 4UC0A 1SN7A 2YW2A 1DRWA 3URKA 2NQTA 4AZTA 4DVGA 4J94A 4CV1A 4NZYA 3HACA 4UTOA 1EBFA 3S68A 4P83A 1EGMB 4DS3A 4E6PA 2VYQA 2XRFA 3DW1X 4TKUA 4O1IA 3PXGA 3RJ9A 1GGNA 3NAGA 3W04A 4E32A 1QE5A 5ITVA 5JFGA 3DLHA 2QX4A 2AR9A 1P4JA 2QJRA 2YV5A 4OAPA 3RB8A 4C5AA 5KTPA 3NHJA 4RVOA 1OGIA 4WZAE 1ODJA 3NHAA 2JH8A 4H6PA 2WA1A 3SC6A 3AY0A 2QA5A 2ZRJA 1XT6A 3L0BA 5JJCA 3CZQA 4N3AA 5LQJA 3GCDA 4RK1A 3B82A 2QTBA 2UYCA 4HH3C 2NYUA 4ZO9A 2VDMB 1TU3A 1NYTA 3CNBA 3LXUX 4HRYA 4OY3A 2WPDD 4QPZA 2QF7A 4U7HA 1PS8A 5E3JA 1DWPA 4HSEA 4QJBA 2B8TA 3HKEB 2WZBA 2Z98A 3HXKA 4ECEA 4HAVA 5K0LA 4IOKA 5AKXA 2WKSA 3NVMB 3V1KA 4UVGA 2I99A 2H4JA 2OD9A 1TM1E 3H8JA 1O2DA 2YWHA 1XELA 4GBED 4MDFA 1RHRA 4AQYB 4YMSA 2FPIB 4MPPA 3TEMA 4CBVA 3L7OA 1B8OA 5FWXB 1ULUA 3SN6A 4DNQA 1EVIA 1JXMA 3DZIA 3IULA 4OI4A 4R2LA 4WN3A 3VYUB 2L17A 4PYOA 5CNIA 3UAXA 5K20A 3JVIA 3X1KA 2NYAA 1I1NA 1KOJA 1QVAA 1BKSB 4MW6A 4X6LA 3Q8LA 2ZUFA 3KFLA 1H6BA 1YRAA 2XJ4A 1XXHA 2IP2A 2IDJA 2V58A 5J2TB 2OO5A 3ND6A 4NCAA 1KU6A 3BSYA 2IYOA 3ZE9A 3A1SA 1L7VC 3N2ZB 1QG6A 2I22A 5EA2A 4CN8A 3UT5A 4B6JA 2GD1O 4DBVO 2ZT7A 5L3SA 2PLAA 5K4AA 1HLPA 5KZMB 1U0SY 2DU8A 1QCZA 4GNRA 1YA8A 1VLLA 2ZAGA 3WO0A 4NBSA 1XRMA 1UC5B 3KM0A 1DAPA 3L43A 3OTWA 4AY4A 1UFOA 4DWVA 2JASA 3OOJA 2VTDA 2O0MA 2X9GA 5EXXA 3DF7A 1R5OA 1T2AA 1XVUA 4WNAA 1DPFA 3WLPA 4UCXA 9LDTA 4Q3BA 4NNJA 4R51A 4C5BA 1A9ZA 1H3FA 1VRWA 1E4VA 4WADA 3R76A 4H1WA 1VIDA 3C97A 3FSGD 1L4EA 2XTAA 4PICA 1PFKA 3GEBA 3ET5A 1A27A 4RA9A 3KPUA 1WXGA 4LZOA 4TSKA 4V02A 3UKOA 5KS2A 1Y5MA 5JAQA 3BL6A 4NCIA 3UGJA 4GO1A 3GG2A 4GE0A 4QO7A 2I5PO 3GFQA 3WG9A 4F85A 2UZ0A 5BVGA 4YCBA 2BW0A 1E5DA 1VSTA 3AF5A 1R50A 4C08A 1KIFA 1QIIA 1WMBA 2I6XA 3N8DA 1LRKA 4RO0A 4X1KB 2VQ6A 3JATA 5GM2A 3GJ3A 3W7BA 1JVNA 5J4KA 4K3UA 4BFSA 1QIJA 4B09A 3B12A 1Z12A 5A6SA 4HGZA 5J2UF 3CVUA 4Q00A 4RULA 3R6WA 3R3SA 1I7LA 1ORWA 3U0BA 4HDOB 1FU7A 2ODNA 2Y3IA 1R3DA 4F72A 4PYMA 2EEPA 1HT0A 4JP1A 1HV8A 4I9UA 3VKVA 1S2OA 2J9FB 2JFBA 4DLPA 1J7KA 1H66A 1XTRA 1Z8HA 1ZESA 3L5OA 5IT4A 3E2PA 3T9CA 2F55A 3WWOA 1N36B 1MH9A 4QUDA 4TYQA 3BE4A 1ZG3A 1AHIA 2HA2A 5BVHB 5IAOA 2EC5A 2VSYA 2AW5A 3MT7A 3GG9A 5AD1A 5KYYA 1J0AA 4PAMA 4Q9HA 3U6KA 1TECE 2V5VA 3HDTA 4D4KA 2QD1A 2BTQB 2QVXX 2M1XA 2MR5A 2M98A 3DFKA 2PNJA 4DDVA 5CTAA 5CXXA 3CZRA 4IVQA 3GNTA 4Q5IA 1HEUA 3GJXC 4QICA 3SIPA 3C15C 3ETHA 1GSIA 1JX6A 4LHYA 4RLFA 4ALLA 4BBPA 4FD3A 3FTCA 3S8EA 4BE9A 1C9YA 1WF3A 2AOTA 2RGDA 3I45A 5HFJA 3QF7A 2X2FA 3MW8A 2CZGA 4M8SA 4B3FX 1P3Y1 1VA5A 4C21A 1VMKA 4DA0A 2BAGA 1U28C 4NJEA 2GPBA 4FWIB 5K01A 3QYAA 1O9HA 5H5JA 4DG9A 1NQXA 1MT0A 1SZDA 2OD2A 2Q6LA 4ZOBA 1I5RA 3T61A 2RK4A 2GJ4A 3OAAA 5EJAA 4AUNA 3R7WB 4R3UC 3E58A 4TS1A 3KXLA 1SU7A 3FYSA 3I6IA 1DX4A 3DL0A 3HL0A 4JL6A 4OI1A 5CBPA 3G2PA 5IDWA 1F20A 3CRMA 1Z0SA 1LLDA 1TJ3A 3QIVA 4QU5A 3TK1A 1N1GA 3FDZA 1D2HA 3IELA 2PN1A 1TKAA 4GOMD 4OJMX 1SBTA 3EBPA 4EB6A 1AO0A 1O0CA 1PBNA 4NIMA 3T41A 3O9MA 4G0PA 3ZTWA 3KJQA 4IF4A 1A7UA 1TW2A 4L0DA 4KQ1A 3X43A 2JIPA 1T13A 3B6KA 4PE5B 3RSZA 2XIJA 3ASYA 3NH6A 3LBHA 5DSZA 3TZQA 5IVIA 3AV3A 3QLUA 1HDRA 3TE7A 3NIBA 3PITA 1O87A 3CTMA 3WL3A 2CXPA 5K0EA 3Q7EA 2X0DA 1GKIA 4G1FA 3IJ5A 3I2GA 3HL4A 2HNKA 3CCBA 3FVWA 3VU1A 4FC6A 3RNOA 3RARA 3TLXA 1GPH1 1X77A 2R8PA 3MMSA 2EBHX 3IBTA 3PP8A 2GBPA 3UJAA 1QS0A 1HQKA 1XDDA 3QWAA 4CMKA 5J4YA 4JFAA 2DUWA 3U7RA 2Z57A 4WNIA 3U1BA 3S3TA 1E9DA 4V0OA 1A04A 1UBCA 4N6GA 5E1DA 3T3HA 1IOVA 3V7WA 2WG0A 3U9SA 1OREA 1ZGZA 2PV7A 4YQZA 4DYDA 4GR5A 1W2WB 1QKKA 1MW8X 2IPXA 1S02A 4KXVA 4HFRA 3WLLA 2WWFA 3QVOA 5IARA 2BMVA 1VJCA 4WLOA 2C0QA 1I6LA 4WW0A 4UMVA 4DOMA 2HV9A 4MQMA 3TRKA 1JMYA 3AEKA 5J63A 1HE1C 1S0UA 2O48X 3DQPA 3B7GA 2AFRA 3BH0A 3FETA 3IEIA 3O95A 4JS0A 3T7KA 2PYDA 1Z18A 2AN4A 2WTNA 2Z5LA 3WISA 5HKKA 4LF6B 1YHNA 2QZSA 3ROZA 1W1UA 1XTTA 4L5CA 3TQQA 5AW8A 5JD4A 1NYRA 2R1VB 2OGSA 3QJ5A 4GR9A 1E7YA 3JPWA 4X66B 4RY8A 4WLNA 3WLJA 1MJGA 4OA5A 1KP3A 3C8DA 4Z7OB 3CRRA 4L9WA 3P19A 2ERXA 1QFSA 1STOA 3EFOA 4QGGA 4IVRA 2JIMA 2OHFA 5FLYA 5K8IA 4UPEA 2HO4A 1P3DA 3KYIB 1H5QA 2VHWA 1QH8B 5AVYA 2WJVA 4R1LA 1QU2A 1YOVB 4C0QC 4EJSC 2VJDA 1EVEA 4MI6A 4DLTA 3L8MA 4TXLA 3U4IA 1BDBA 1K4MA 4JVMA 2FMHA 4ASUD 4B82A 2O14A 3IP9A 3DE6X 4JQCA 5CIQA 3TGLA 1WMFA 2JH9A 3W9SA 2XW6A 2OXCA 4MQEA 2PKEA 5AM1A 5JZSA 4F06A 1EQ2A 3A1EA 3WWZA 1RQPA 1MJGM 1BQ3A 1U0HC 2PX2A 3FSEA 3E82A 3JD1A 3RNLA 3VJMA 3IILA 5DTEA 1V96A 4L2IA 1FVOA 3BMNB 3I2FA 3TZCA 3W5CA 3VHLB 4WE3A 5SY9A 4ZYUA 1KVRA 4QJ5A 2O8BB 1OH5A 2VQ3A 1SQ6A 4UVIA 2J7PD 1ILWA 3C7AA 2XRYA 4XWOA 3EXIB 3WKBA 3C7KA 2BGWA 2Z1NA 4HX2A 3AEUA 2DTDA 2HXSA 4CM9D 3JWGA 4K6GA 1YQUA 4P3KA 5DISB 1R6BX 5HJ2A 4LHXA 5HUJA 2G6TA 5JQGA 3ZD7A 1JILA 4ZVNA 5KBYA 4FD2A 4L0MA 1OQAA 3DHYA 4LJYA 1R6VA 3E5RA 1T0UA 1XGKA 2ZYSA 5TRTA 3WL4A 3D3WA 1SIBE 3HI4A 4RVGA 1TFUA 1H9CA 4OXXA 2VSXA 3IPAA 3ROMA 2IPMA 4HWKA 4P2BA 4O4HB 4A6EA 2EKDA 1OLSB 2OV4A 3PEYA 4MVJP 3WDLA 3TUZC 2EJCA 1KQPA 2NVWA 1SQFA 5IYZA 4GX5A 3B9PA 4J1TC 1ZWLA 4DCCA 3SC2A 4BNIA 1WNTA 4OQFA 1M0TA 1J0CA 2PT6A 4IINA 3M2TA 2BEUB 4YCAA 4OK5A 4XE5A 3WKCA 1RAIA 1AB6A 2ZI7A 4K9RA 1SCQA 3RWBA 3SNKA 3MJSA 2EIXA 5BN4A 4CCWA 5FOQA 4OYHA 1J39A 5FP0A 2DPLA 3M82A 2Y1KA 4IGEA 4QGHA 5A7FA 1JHOA 4WXPA 4I4NA 5HEKA 3UWPA 4LQDA 1JL3A 3OMXA 5FI1B 2B83A 3QOXA 1TAQA 4ZCMA 2VDQB 2QRKA 1O96B 4JLKA 2HOQA 2JL1A 2ATCA 1TCUA 1ICEA 2ZSHA 1UK9A 4LYEA 1DOHA 2WOJA 1EUCA 1NE7A 1NMZA 2CHVA 3O83A 4FW9A 1GPJA 2G4CA 2VL7A 3STWA 4JI7B 3CBGA 4HHEA 5D3MA 4MKRA 3R3WA 3SKYA 2J59A 1Y6RA 2D2IA 2FN9A 1Z38A 4PX9A 1CNEA 3GVCA 5MDHA 2NGRA 1Y5LA 2XYQA 1TZMA 4LVNA 3KTDA 3EFHA 2J9RA 1DE0A 5M5BA 1Q0UA 2GK7A 3FPJA 4JYCA 4IIHA 5ALYA 4S24A 4IILA 5KNDA 1LPBB 1P4HA 5JTTA 4DR3B 5LOVA 2H8KA 4C7XA 5AHWA 3WDKA 4C6RA 1IG3A 1MORA 2XUZA 2XZDA 3CE9A 1ZR2A 2PZMA 5KREA 3OJWA 4RZ2A 1CR2A 4TRNA 1ZXBA 4DF3A 4GS5A 1S1CA 3AB7A 3PDHA 2G9QA 5EGSA 4D3SA 1GUZA 2G7ZA 4N5DA 1QJ4A 1KA9H 1Q57A 1HDGO 3EQZA 3GJZA 1GV0A 3F9RA 4PFJA 4YCJA 4B79A 4V1CB 1DEKA 2VJOA 3HVKA 1JHMA 2D0OB 2I8LA 5A5VA 2E55A 2JIDA 2ZI6A 1VXOA 1EX6A 4XUCA 4GYJA 2Q1YA 4RKRA 4HLNA 4NE7A 4LSMA 4NY1A 2BUBA 3OFSA 1NNI1 3Q40A 3R41A 4N8SA 3QFCA 1RABA 3MT9A 3UT0A 1T9GR 4LJ9A 5DW3A 4A82A 2Q3HA 4TLCA 4X1YA 2R7AA 4E2XA 3RLIA 3BXEA 1ADCA 1Q11A 4MB6A 1D03A 1LBSA 5I5GA 4EPXA 1T0IA 4HGRA 1EK0A 4KR6A 3FGNA 1TO2E 4UZSA 4YC7A 3PDIA 4Z5XA 5B3JC 2XBMA 2JBHA 4C4SA 2FSVC 1QQTA 2DPYA 2IW3A 4PZAA 4XRRA 2NU6B 4XXHA 2WJ4A 3L0CA 4GHWA 2JGRA 1T1IA 3A9VA 2CF5A 1FDRA 2GRUA 1LVHA 3DZDA 4WZBB 5JNTA 3CY6A 1H1LB 2IPNA 3F6YA 5BW8A 1UBEA 3U3KA 3AU9A 4B2LA 5DSTA 4DC9A 2JLZA 3JAKA 1CFZA 2BBTA 1U0EA 4JUFA 1SVUA 1JHPA 2BFAA 3GX1A 4CF7A 1HZJA 4UHDA 1C9KA 4QQKA 4IFBA 1A1VA 3I6YA 2MMCA 4TV8B 4HK4A 4CEJA 5FUQA 4UOQA 4DLXA 1G98A 3NWBA 4N3NA 3W4JA 1PTJA 2E5FA 3N74A 1FNBA 1AKUA 2P5UA 4N01A 4ZPXA 4UOZA 4ZQGA 2B6HA 5HHTA 2PQMA 4QDXA 4TYPA 5CAEB 2JJ8A 3FOFC 4I3FA 2YXNA 1A9RA 1RC0A 5JC1A 2Z2JA 4CLDA 2NADA 3ZWXA 1K5PA 4FQ5A 4AMGA 2PLWA 1VJ1A 2VJLA 2VUTA 4RY2A 2DQ4A 2BONA 3QX8A 4ODIA 4S35A 3K73O 2XKKA 4U2KA 1HH4A 1D9XA 2Y6VA 2PSJA 5C8YF 1KYTA 3OCVA 4UPDA 1BVRA 5C0OE 3RVKA 1D4OA 4I3GA 1FJ2A 5FJJA 2OXFA 3EQ9A 2BLLA 4FCWA 4DIUA 4EHKA 4L6AA 1J21A 5D2CA 5DCUA 1H0KA 3LM8A 5TMBA 3VDXA 1NI3A 2HQBA 2P0YA 2GYUA 1KPGA 2BFEB 3TSYA 2WLSA 1RPAA 2QLMA 4DEYA 4DWJA 2HU7A 2WM3A 1AQIA 1OLUA 4UAUA 3U61B 1G0OA 1KMQA 1UPBA 3A04A 1U1GA 1GUBA 2C1EA 4G24A 4GZLA 4K1LA 4ND8A 2YOHA 4Y6QA 4ZAVA 2FEXA 4BTVA 4O3MA 1ZUNA 2EU8A 1QZZA 3BJZA 4MKIA 3WB9A 4GG1A 2C7QA 1EIWA 1KZ7B 2GD2A 3PKZA 4HGQA 1YBHA 2GM5A 1GGEA 4KN8A 5CX1A 1T8PA 2NZVG 2ZJFA 4KRGA 2BFWA 3VO1A 3WLKX 1LBQA 5IC4A 1BVYF 3OAAD 1M34B 4C7KA 3D2AA 1LVUA 2R2AA 3EGOA 5GGXA 5F5NA 5I9TA 1U2EA 4I08A 2HJVA 2J0UA 1FFBA 2PJZA 3OC6A 5B57C 4O29A 2JIOA 3UBTA 1YD7A 2OZLA 1CTQA 1I9GA 1FUEA 1X1BA 4M0PA 4M8IA 3FCOA 1CBUA 2B92A 2Q5OA 3DBLB 4RF5A 3T06B 3R3VA 4UEOA 4WBNF 3A2KA 3BWYA 5JAPA 9MHTA 4F93B 3SS9X 4QJIA 4R9VA 1J22A 1JLLA 1K63A 3O91A 4ETNA 2HY7A 4ED9A 4EQZA 3UXMA 2XE6A 4L07A 4D97A 1FMCA 3BA1A 3D8NA 4FGZA 1NU6A 3VMMA 4P4NA 4CU2A 3WLAA 2D0DA 3A9WA 2W2PA 1O95C 3R23A 4MYSA 1NW4A 2C9YA 5JY1A 3NDJA 1NR7A 4ZI2A 1ZR4A 4YI3A 1B23P 3MWKA 1LZLA 4WUVA 4DM4A 5CGQB 3ZH2A 4LE1A 4GVLA 2AIRA 1JSZA 2EZ9A 1JI3A 2WF6A 3QLJA 4C7OB 4EB3A 3K5HA 5AW3A 4TOIA 5DXJA 4GZ5A 4NHEA 4NLLA 3UJ9A 1KIAA 1IEVA 1O94A 2MTBA 4ITVA 4WHMA 4C7BA 2IGTA 3TW6A 1BHSA 2FPGA 5CJJA 3B20A 3DE4X 2LKDA 3K8ZA 1RTTA 3CG0A 2YFKA 4NU8X 3IA2A 1I3LA 1JU9A 1L5ZA 3RJMA 1YR7A 3VBEA 4PGMA 4W6ZA 5B4VA 5LQDA 4EL5A 2IV7A 2UXBB 3M8KA 3V7YA 4C0KA 4Q15A 4NZNA 3SBOA 3TO5A 1XO1A 2Q6IA 5HKKD 3HB0A 5KJ6A 3L7NA 2ZIXB 3L8CA 4KK4A 1MVNA 4NQRA 4D9JA 4QE3A 2W2VA 2VPIA 1R7RA 4E2ZA 1JTFA 2VDPB 4IXDA 2P9BA 1RI4A 2VG8A 2IYYA 1JQBA 5HK9A 3NB0A 3PR2B 1CRZA 3I2JA 4MDYA 3THSA 1EUDA 1GTZA 2OGUA 4EJ2A 2IXBA 2FFAA 3L0YA 1QAOA 3FUTA 4IDCA 4YN3A 4V0QA 3R09A 4ZYTA 5IUNC 2CFIA 2IODA 1WVIA 2KWIA 4AJEA 3QBDA 4EENA 4BEBA 4OMUA 2QXYA 3OT1B 1ZN8A 3H1FA 1YAJA 4RIFA 2R6HA 4J3NA 1EFDN 1K08A 2PX0A 2QYHA 3DE2X 3K8YA 3OJLA 1Y1PA 5HDBB 4DANA 3JAKB 3TQFA 1U90A 1UZUA 2WHEA 2REBA 4A1OA 1W36B 4PAGA 2GZSA 3JZAA 3CKLA 4AO8A 2UYHA 4RJIA 4Y2XA 5EL0A 2EATA 4CR7A 3WK5A 1O54A 3M4JA 4EG3A 3LE8A 4WERA 1EWVA 1EP9A 1TU4A 4QSMA 5E6SB 1WSBA 2A88A 4ZA2A 4ZU6X 4XR9A 1USUA 2HM7A 4IJQA 1T25A 1U2SA 1UANA 1TQDA 2AXPA 2NO6A 4G67A 1LGYA 1ZQ9A 4F3CA 4QBTA 1G21E 5LQRA 3RV4A 1IOZA 4EAAA 5J4LA 1PWEA 2H92A 3B53X 3W34A 3QU9A 2INGX 2X6QA 3M6UA 5D3QA 1JRLA 2C2YA 1GVNB 3C4VA 3FPFA 3KSRA 3GR6A 4URWR 1PUIA 4ZOCA 1WETA 3GBPA 1WZ2A 5AHKA 3TDNA 1JPNA 1QH9A 1WZUA 1Z62A 1QOPB 5J2TF 3GDFA 4WUTA 4ID3A 1EFLA 3ZG6A 5BPFA 1TYDE 3L18A 1XP8A 4Y9UA 5CT4A 2XZOA 4HV4A 1RKBA 2PGXA 3B1JA 4R1PA 4ZIRA 2XXAA 3VPBA 2I76A 1OGJA 3KUDA 3Q4GA 2P62A 4MVJI 2G0TA 2E82A 3FDJA 1IXYA 1J49A 3SG0A 4CI9A 3OZXA 4G65A 4F3NA 2ZKLA 4QRDA 5T6MA 1M0SA 1Z2EA 2QDXA 3K1YA 1XI2A 4OTZA 1RI3A 1PQYA 2XT0A 3K53A 4BX0A 2ZYAA 1KXZA 1QZ3A 2H3EA 3TRDA 1U2QA 1YJ8A 1T8UA 5AVXA 3EPKA 2I4RA 4I9NA 2NZXA 3ETCA 2HA3A 3VV2A 4DLWA 2ZDHA 3BDIA 4J43A 4JJZA 1KVSA 1MX3A 2B2XA 5CJ2A 1RRGA 5JCOC 1UFQA 1NM5C 3HMKA 1KDRA 3MGAA 2P90A 4J6FA 1UADA 4NV3A 3S2IA 2DPHA 1U98A 1LWNA 2Q5EA 2WFZA 2QUIA 3AXSA 3C8ZA 3IMCA 1UBKS 4C14A 3V1YA 1SBQA 5J3JA 3LKBA 2YC4C 3EWNA 3GPDG 2CHEA 4ZVPA 4E2WA 3L6OO 3PICA 2JJ2A 1GR0A 4IDFA 1KEKA 2ILTA 1LWOA 4HDSA 1EQAA 1QHXA 1LPPA 2OGZA 3FH0A 1YVEI 1OZAA 2I1WA 3HUFA 2IDKA 2A1UB 3AC0A 1HDYA 2F8LA 3ET4A 2A1IA 1I1HA 1USGA 3KP1A 4DLLA 1UPAA 5LFAA 3L4KA 4UBMA 1Z0DA 5E7MA 1JDNA 1IZ7A 1QRRA 1YS2X 4QARA 1E2UA 2ECOA 5FO0A 5DWVA 4YCCA 4QUKA 2W48A 2RHTA 3WDSA 3O4RA 3NATA 5FWAA 1GA6A 3P52A 3KOXA 5HKOA 1T9ZA 2Q1UA 1NXOA 3GOHA 2CV2A 1JB9A 4YJFB 1MX9A 1Q0QA 2LP4Y 3H1TA 1H0RA 1V8ZA 3L6RA 4GR4A 3IVXA 3ROEA 3DFFA 1W75A 3OQHA 5GOZA 1P1FA 1VB5A 2DPXA 3QLVC 1UT8A 2JF0A 4XQ0A 5H3LA 1T34A 4MVCA 4PLZA 1NVAA 5CCBA 5AKJA 2IYVA 3WLFA 2DERA 4TV9A 3JQDA 4DCVA 1ONPA 2IHUA 1KEPA 1ZOOA 5ADVA 2PGJA 4KQHA 5LXTA 1KC3A 5KYXA 3BYZA 4CL8A 1IPEA 4EZBA 2B99A 1RFGE 1M83A 3DAPA 1F2UA 4OUDB 5LDGA 1BWQA 3D6VA 3DVLA 3ESZA 4WAUA 4ZZ1A 5K0GA 2BZSA 4YJ2B 3TQSA 2P91A 3AZPA 1K3FA 3A70A 3BMOA 3L7DA 4MR9A 1C0LA 2EKBA 2XADA 4I14A 4LTNA 1I0IA 1MRZA 1SOAA 1CD5A 1SM4A 1SC1A 4RF2A 3WNVA 4FI3C 1OC4A 1E3WA 2G28A 1B93A 1TZKA 3BB4A 3DMPA 1SUSA 2GN8A 3E9QA 3WNCA 5BWBA 5CTJA 2ZUSA 3E70C 1V47A 7AT1A 1AKWA 3S44A 1J8MF 4OGKA 5EKTA 2QTVB 2ZWAA 4DMGA 2A5FA 1QZTA 1FIUA 4XB6B 5F98A 2P30A 3RS7A 4ZK2A 2C7BA 1GZ7A 3UKDA 2GCGA 3HJTA 4R16A 2C2MA 2XVXA 1DAKA 4C3VA 1ADBA 2FSFA 4IQ4A 4DNXA 5IJXA 3G5AA 5K7SA 1DMSA 1G8PA 3BSSA 1BOFA 3W1EA 3VR4H 3OZRA 3DV2A 2IS1A 2CXHA 3AFOA 3U3JA 5FNVA 3LI2A 5UKDA 2VC2B 2ETVA 4OIFA 4LPKA 3JQ8A 2RAPA 5DU2A 3RUEA 5JS7A 2K5UA 4I1VA 2EZ8A 5G0UA 1W36D 3I58A 1D1QA 4D0LB 5B53A 3MUEA 1FVFA 2X19A 4FMPA 1ISRA 1D6NA 1FE8A 1ORTA 2A7XA 1XZGA 5JDCC 3ODPA 2YWBA 3OFNA 1EXDA 2P41A 1DC4A 1J07A 4NI5A 5BMVB 4CKYA 3GDWA 5IC5A 4U7JA 3HN2A 5ENDA 1M2FA 5BP7A 1FSPA 1XAGA 2UUBB 4KH0A 4IP0A 5A0VA 2EKPA 1C0PA 4GWKA 2QNBA 1UMDB 4BE7B 2OV6A 3HY4A 2FU5C 3ZGOA 4RTKA 5AIBA 3RS5A 2ISQA 2GJKA 2D8MA 2DFPA 4YO8A 3IEVA 2WD8A 4FMDB 1CJMA 4R2WA 1Z16A 3X1JA 1YRWA 2BC9A 2R79A 4FEAA 4NH4A 3JAWB 4MR8B 2A9KA 2I4NA 2C4MA 2PMWB 2QM8A 3DWIA 1U8EA 5BNTA 4OLHA 4B4WA 2UVPA 4PNEA 3ZOZA 1ORVA 3S8YA 3ZJYA 1KZHA 4Y6LA 5JCJD 2AYXA 3BSWA 2QGFA 5C4GB 2OL4A 4YT4A 1S3SA 1UT5A 2P11A 3PFCA 3H4IA 4RZHA 1U4SA 3ZWAA 3EEFA 2F1OA 2ZTUA 1RWNA 2J3JA 3KPVA 4YQEA 1XZHA 3UC9A 3RYFA 2EFGA 1Z6PA 4D8TA 3ZDAA 5CVEA 4DQLA 2WVGA 4EG1A 1AK1A 4O4IB 4OYYA 4C0HA 2OXTA 1WZNA 1W5AA 4L3VA 1RYHA 3F96A 5FBQB 4W5QA 4QDUA 3RT1A 1NVXQ 1E61A 2P2DA 2IHYA 3M2PA 4YJKA 4UHFA 1D6JA 1Y3IA 4AJOA 4B4VA 3A1VA 4ESHA 4EYGA 4P82A 4UDNA 4FE7A 1T91A 5TXGA 1QKIA 2GGSA 2WI8A 2Y9PB 4A8JC 4DW8A 2ONCA 3EG9B 1B41A 1WPGA 4XTRA 1J1UA 3VOSA 3LCVB 1N2JA 1ZEJA 5DK6A 3OSZA 5I45A 1KOFA 1MDBA 4EH1A 1PK7A 2AOUA 2GXUA 3F3MA 5I47A 2D4AA 2FPSA 5F9FA 4ZVVA 4WBXC 4D92A 5ICSA 4GPTA 1HGXA 2FWIA 3N1UA 5E2IA 5DNWA 3PGLA 3OOHA 3EDRA 1UJ4A 1T9AA 2ZETA 3FOZA 2FR8C 3LF2A 4FEGA 4O4HF 2G1UA 4UMEA 3SSOA 3ZDDA 3VZQA 3AL0C 2H2IA 3GJTA 2D4HA 5FLEX 2IHJA 1T6BY 4BMSA 2VF7A 3K31A 3E4DA 4RDIA 4DUZB 3UWDA 1UKYA 1R0YA 5AP9A 5T4BA 4Z9YA 3TB6A 3BS4A 1YZKA 5SY4A 1FBTA 1J5PA 2HWWA 1U9IC 1XVAA 2P1DA 2Z3VA 2ZTMA 3B36A 3PXAA 4M89A 4MICA 4RTQA 1YL5A 2WT8A 3WIEA 2FQXA 5K3EA 4EGAA 4A0GA 1YZGA 1U2GA 2BBWA 3PNSA 5AUPB 4MS4B 5F4BA 3QKRB 2J30A 4ZCSA 3RRFA 3J80A 1V37A 2D1SA 3GDHA 4JQYA 4FHGA 3NQ41 4QEKA 1E3WB 2PE5A 2OG2A 2R6DA 5DV9A 5GOTA 4JJGA 1CUHA 3T12A 4DAEA 1JR3E 3TJZA 3U4AA 3KETA 1MZVA 3GWZA 3RHZA 5DNDA 1FU4A 2PKQO 3L1UA 3DAYA 2PSEA 1PNRA 3H9JA 3BMXA 3WA7A 4O33A 4Q47A 4R4JA 2I4MA 1WUHS 1AV7A 3Q8XB 3VUFA 3GELA 4WKPA 3PZBA 4QULA 1Z5WA 3KWFA 2R2GA 3AI3A 2OCLA 4WNCA 1CUGA 1P0MA 3QVUA 3SQOA 1AXGA 1CDOA 1VBKA 1PP4A 2VZEA 2XMDA 1UWKA 1X6VA 2JI4A 3RC2A 3TKLA 4A2WA 1NRWA 4DARA 3VZPA 4ENTA 4O0MA 4UTRA 2Q4BA 3IO3A 2RGNC 3TD2A 3QKSB 1I7NA 4KQWA 5DVZA 5G02A 5IDYA 4YR9A 5FQOA 1H0SA 3VDRA 1RZRA 2I2XB 3B13B 2Y2VA 2DY1A 3D0RA 5DH9A 4JI6B 2HUPA 4CM5A 5F12A 4A6DA 3CM0A 1L7EA 1U2PA 1G3QA 1KQ3A 2O4CA 4LWQA 5E0KB 3U3XA 3W79A 3BB3A 3RM3A 4DKXA 5B4TA 4MV7A 4JDPA 4ZZ2A 3TG8A 1POXA 1WULS 4TWZA 2XR1A 5SZHB 3GMSA 5DASA 2W00A 4Y2VA 4DQDA 5GQSA 5A1JA 4F3TA 1ADFA 1JB1A 1OFUA 2P78A 3FCXA 4MX8A 3QE0A 3UOAB 2VJBA 2EBFX 3MGGA 4PVCA 3WGLA 2I2DA 3G59A 3N8GA 3ZV5A 4KAFA 4AMZA 2V7UA 4W1QA 1UDAA 3I0NA 4D8YA 4AKHA 2A57A 4R9RA 3HXLA 3HJBA 1AVTA 1O58A 4BMCA 3L82B 4OX9Y 3AVWA 3DGEC 2D1RA 3LQKA 1WTAA 2O3UA 3JYPA 3RT9A 4EP1A 2N46A 3DQQA 5JJLA 3C70A 4D79A 4LA4A 5GV8A 1WB4A 4ZYVA 2HF7A 2BEVA 3AVUA 3GYGA 3JWHA 4RUKA 1YAHA 1VG8A 5FIUA 3GGJA 4NZZA 3O4IA 4PPQA 2G4VA 2QLBA 4N3GA 3RKRA 3JTEA 2AVDA 3H9GA 2ZLBA 4QUIA 1GQFA 1H2FA 1U11A 2ONKA 2QL7A 4LSZA 1COWA 4MPTA 4AQDA 4BX3A 3W3AA 2ZJOA 3W8NA 3DLAA 5IW8A 3LKDA 4EPWA 1H4SA 3KV3O 1L5VA 1L4MA 1OFHA 2XHZA 3QBVA 3SICE 3BJMA 4M98A 4RACA 1RR6A 1M10A 1ST3A 3FJYA 3BKXA 4NFLA 4YRSA 2JJ2D 1EWYA 3D7SA 4FHDA 4NU6A 4PLFA 4NV1A 2J1LA 1X7YA 4PY2A 3FPCA 3X3HA 1I4WA 4CUJA 2F3QA 2FUG1 4I55A 3RYCB 2OG1A 2PBFA 4HLUA 3WLEA 4Z3KA 1XE3A 5F3RA 3LYLA 3NT2A 3E18A 3V2UA 1CP2A 5CITA 1QB8A 4FDAA 5JZVA 4KHZA 2WNHA 2O3SA 2XSZD 4MS3B 1PYDA 1WXQA 2C59A 1XYGA 2I6UA 3PLRA 2H48A 4X3OA 1CQIA 2VP3A 3GCXA 5BSRA 1Z6TA 4EYKA 4MKHA 4BXOA 3FWNA 2VR1A 5ITZA 2QN6A 2ZJ5A 5HIMA 3B5IA 1F0PA 4Y6SA 4DYHA 3AUAA 4IJ6A 5EYPA 3ENVA 5JQGF 2ODEA 2O0JA 4JT9A 4PPGA 3U26A 4MKXA 3F4LA 4Q66C 3ZXXA 4EA9A 3VU3A 3GEIA 1BWPA 1CKEA 1J8VA 3OIGA 3IPXA 2GFQA 5BN5A 3DONA 2YICA 5TEWA 3TLBA 3O7MA 3KYJB 1KEUA 4X20B 3CJRA 5BR8B 5A0TA 3COVA 2AUTA 3S99A 1H0HA 1GNLA 2A86A 1DRJA 2OFWA 4PTLA 4BNFA 4C0LA 3MRXA 4C03A 4ZAGA 4QFDA 3SGLA 4RFVA 1CF2O 5CCEA 1KMMA 2GBLA 2R4QA 2VNHA 3MEQA 2RG1A 3MCVA 4G4IA 5C8DA 1NBMD 1FP6A 1G5HA 2PXAA 1J8FA 4ZVRA 5C53B 1K0FA 1UOQA 3EGDB 1OBOA 1ZO8A 4G9BA 1YTUA 4QVKA 2GWHA 4M9ZA 3VOAA 1X8XA 3F0TA 2AEFA 4BKMA 4CKEA 4DZRA 4CEHB 4EVRA 3ANLA 4EFLA 2Y0DA 4P4TA 1I5OA 4B6OA 4MVYA 3EUEA 1M0WA 2V55B 3LFTA 1U8FO 1EVKA 2ZDGA 5A03A 4NZMA 3WS7A 3Q9LA 3NALA 4KACA 3COWA 4OQ4A 1ZHOA 3KBBA 5E38A 3DBRB 1DTEA 3L84A 2A1TR 1XK6A 3BTUA 1VJ0A 3PUVA 2Y27A 4PYQA 4QOIA 4TM7A 1KSHA 3OIDA 4ZV4A 3R7SA 1DCTA 3HVIA 4GC9A 2PRSA 4U63A 4G8BA 3ZDFA 4MNTA 2GF2A 1IZZA 1JU3A 4US0R 4NC9A 5CFZA 4FFRA 3NYRA 2C1XA 2Q2NA 3GD7A 2ZVPX 1R4NB 1VHDA 3MTEA 4HQLA 4KDEA 5EIFA 1RT9A 2Q6OA 2A9PA 2PZKA 3EUFA 3QELA 1V9SA 1YQWA 4E4YA 1A97A 1NI4A 1OASA 3RUPA 1KY5A 4JYBA 1Q1BA 4ZN6A 5AW4A 2DFTA 4C1NA 3PXCX 2CMDA 4OJTA 1OAOC 3WLTA 3O8NA 5KOJB 2ZRNA 3ZLTA 5LOVF 3K71B 2NSDA 3TKAA 1RC1A 4LSWA 2Z8XA 4QRHA 5HE9A 5AESA 1N3BA 4C1BA 3B2QA 5CCXA 5ICCA 3OFND 2VRWA 2BKVA 2WFMA 3F47A 3X44A 2Q3FA 4EJ0A 3DBHB 1Y34E 1KKLA 4RZ3A 2BP7A 2JLSA 3AR4A 4C4ZA 3JWJA 4FLEA 3SS8A 3K09C 5HJEA 2IE0A 2TSYB 4G1MB 3PJRA 1L7BA 1XFDA 3H2SA 1T3HA 1SXJB 3NHBA 3VHRA 3QVWA 4PCUA 1BGVA 1W35A 1RYFA 2IU4A 4EVIA 5B5SA 1BU5A 4RVUA 3UWOA 1ZCFA 5JNLA 1XCJA 2FAXA 2QR2A 3L7MA 3WJAA 2Q3DA 4RCVA 2QT0A 2FNAA 4M99A 2CSXA 3QSGA 3QUCA 2LW7A 3G9UA 2X8JA 5DOZA 4ZCQA 1Z4OA 4E88A 3GQBA 4RESA 2Q9BA 1VCNA 2X5XA 2WWYA 5JH7A 5TLSA 3D6NB 4YO7A 4BNTA 4CEIB 3KEQA 5KX5B 5GADl 1LPNA 5DNEA 3NDPA 4HGYA 1Y4AE 5HJ7A 3L6EA 1YVRA 4B3SB 1FUUA 1QC5B 5M34A 2IZ0A 5JISA 4FEYA 4FINA 4DA9A 2I2FA 1S8OA 1VTKA 5KNCA 5LBTA 4IDBA 4RHCA 3D7KA 3KQQA 1DLIA 3DT8A 4EQ6B 3QE2A 1FMFA 1P2GA 4HUTA 1GUAA 3MK31 4P3NA 1CRLA 1IBKB 4XX0A 2ENWA 1KMHA 3DMDA 5BV7A 1A0OA 3N0XA 3PFHA 4IX1A 3TGWA 2CL0X 5DHUA 2C07A 2HDWA 5DZSA 3TRFA 4NE2A 1WXXA 2HBQA 5G0TA 5KQLA 5L7TA 2WQ7A 3CMCO 4E5PA 1R4MA 3AVYA 1OWOA 1YB5A 2I1QA 2RJOA 4BVHA 1DBWA 4D9HA 1JECA 3OPVA 4GRDA 3ZQUA 2D5CA 5IBRA 4URFA 3WRYA 1J2RA 1K8QA 3G8BA 4AZ3A 1YZQA 1ZK4A 1KKUA 1NR1A 4B3RB 1K6JA 3KOUA 3PHBE 1MPTA 3ZWWA 4K0RA 5LMUB 5TT0A 3VTAA 1MGPA 2C4WA 2CJWA 1MFPA 3SOPA 1P1JA 2FFJA 3PK0A 4UTVA 5HGXA 3TFOA 2DPGA 2YKGA 1WQ4A 1JT9A 1GEGA 1J2EA 2OAEA 2TYSB 3CH4B 4CETA 2I9PA 1KSFX 3E03A 2XBUA 4C2BA 4Z3OA 2IK8A 3O2QB 1AQUA 5L3ZA 4DLKA 5JD5A 1CZLA 3C1UA 5E9WA 1V39A 5KYNA 2RIPA 2OM2A 4WIAA 2F9FA 1C2TA 2B5OA 2C99A 2X14A 7GPBA 4I1SA 1ZKMA 1XMSA 3IAXA 2R8XA 4UREA 4DSZA 3IBFA 2VP4A 5K4GA 3II6X 1RACA 2PQ0A 5EKDA 3IX7A 5ALTA 3CLUD 3RK4A 3WYBA 3U60B 3AWDA 3FUXA 4L7QA 4RJTA 1II8A 4JFRA 2BF4A 3T5DA 3ZBPA 3X1WA 4UXHA 4RYDA 2WKWA 4EA7A 2GKOA 1SKYE 3ICWA 4X45A 4X92A 4Y1RA 4F2DA 5KDOA 3ZGNA 4MSUA 5GVRA 3BE5A 3U7HB 3VC3A 3EIQA 3MJTA 5HW0A 7MHTA 1N3LA 3ISTA 4B8WA 1WLSA 4BNYA 2A14A 4JB8A 2ODAA 3LHFA 1P7CA 5AOCA 4I50A 3QEMB 4KPEC 4EARA 1YDMA 1JFRA 1XMJA 3QF4B 3AOEA 1GDTA 2J3LA 2XGSA 1FTGA 4OQQA 4PFSA 4YV7A 3DD5A 4EKDA 5TT1A 4C3UA 5TPWB 3LL4A 4II7A 2UZIR 4R7GA 3EBOA 1PKEA 2QAGA 1N4AA 1V1MA 1XLWA 4YP1A 4J0FA 2OCKA 4MI9A 2C88A 5EE3A 4KQMA 3Q3HA 2Y76A 2NXNA 2XITA 4JVSB 4RJ2A 4A26A 3L0DA 4MPJA 3NRJA 1N3YA 3K0FA 2ALJA 5B7QA 3W8EA 2RCNA 2DGDA 3KQOA 1XWIA 4NMXB 3G8DA 4CLEA 2WTUA 2B2NA 1OTXA 3S5JA 3W8FA 3OEHA 3PPXA 4OMFG 1RTKA 2IOFA 3CURA 2WU1A 3EGXA 1RZRD 1LRJA 3ADDA 3DPSA 4EBBA 2DKNA 1GRQA 3M1LA 2K87A 3N0VA 3T1OA 1LSSA 2OOSA 4JI0B 2ECQA 2GKGA 2IYLD 3LKVA 2I7VA 2B35A 3F8TA 1MQSA 5C8VA 4GLBA 1DI0A 4AN1A 2BDUA 2Q4RA 4OD0A 5D00A 2QRHA 3ESCA 2AE2A 3AETA 5K0JA 1PQ4A 2RHCA 1XL1A 2K2QB 2E4AA 4HDQB 9GPBA 4IDHA 1UAYA 4WI1A 1KR5A 4GYYA 2VTBB 1XYVA 1U9ZA 1RRKA 2ZRGA 4FZVA 4F9TA 5BV8A 4MVJA 1NF2A 2KLHA 1DAFA 4OGWA 5DW0A 3WHIA 4AZ0A 3O8LA 4ZCIA 4ZYLA 2YWEA 4P80A 4AIIA 1WV1A 3VO2A 4EPYA 2OBYA 1F51E 5IUJC 3IGFA 1PJ2A 1RQGA 3R7AA 3S4YA 3UFXA 1P4GA 4RC9A 2XCTB 1C1XA 1CRWG 1UPUA 2Y1DA 1P6QA 2NU7B 4GI1A 5FWYB 4ZI5A 4ZEMA 1G5RA 3ED5A 5F7JA 3IUNA 3GLFE 2E1PA 2FFHA 2NSHA 2QXUA 2C9CA 1XJWA 3W3AD 1OV6A 4EHLA 1MIHA 1PK9A 5KB3A 1Z33A 3IUBA 1P0FA 3IVRA 2P6PA 2IT1A 1W5TA 4MVJM 4UVEA 3IERA 3T52A 4XX0B 3FZGA 5BMVF 3EGEA 4F4IA 1C3OB 3WKEA 1MHTA 4TZ0A 3ZNOA 4MGYR 3WQHA 4II3A 3T3OA 1BDHA 4ER7A 3DZFA 1PDVA 1O0SA 2FN8A 2V5UA 4UVDA 1LFDB 5ULLA 1EXNA 4K6OA 5HRUA 2UYGA 1NW7A 2BEJA 1JFLA 1H94A 2BFFA 3HRKA 2XB8A 3J7TA 4JP2A 1C2YA 2UUAB 2F3PA 3LNTA 1L4UA 4BEWA 4KE6A 4WQMA 1YFKA 1XDSA 8ABPA 2R8ZA 4C3ZA 2WJYA 4DDTA 3ELDA 5E1OA 6Q21A 5CH3A 1ABBA 2JCBA 2GO7A 5EWLB 4YCSA 2XLBA 4LXQA 2H54A 1H2ZA 3RQIA 4F7DA 3JQFC 3LC2O 3Q7RA 4IWYA 3REQA 3RVNA 1U9YA 2X9QA 4XQGA 4ENUA 3A27A 4KYTA 5FEMA 1QF6A 3C3YA 3IAAA 4QREA 1CNMA 3IQIX 4JASB 4WSOA 4M9XA 1KRHA 4BO6A 1OX5A 3T1NA 4LYHA 2IH4A 1T8TA 2XD9A 2ZT6A 2QRZA 3FD8A 4ZOLA 2PUCA 2W90A 3I34X 2PG3A 2VHCA 4O1HA 1JDUA 2WHYA 2BKEA 3U40A 4GLLA 4KR3A 4ARCA 4O2BA 2ZRQA 2PZLA 1FPQA 1Y6ZA 3KVYA 3L7JA 1ZSVA 3TIFA 2PDAA 2EFDB 2L18A 2X1LA 3PUHA 1G8AA 4HNSA 2VIIA 2WJJA 4L27A 3CH6A 3USZA 1RXUA 3JD3A 4BZWA 3MZ0A 4M7PA 4B84A 1NZDA 4PIVA 3SEZA 2ZREA 5AJTA 2FMTA 1M66A 4LRQA 4G97A 4BATA 1DBPA 4RMIA 4BZXA 2WJHA 3PJFA 4WV3A 3HJUA 3OQJA 3SIRA 2BYTA 2TMGA 1W2GA 3RO7A 3R44A 1P9LA 4E3WA 2O8CB 2QW1A 1YIOA 4KO1S 3R7FA 3QEKA 2PH1A 4D8UA 2JIZA 3KZ1E 4ZC8A 3E22A 5THQA 3GD5A 3EZ7A 1PVDA 2VDWA 3QU2A 4LGMA 4MJ7A 3I8SA 1EPUA 4RAQA 3WSWA 3PBKA 1M9NA 4KGDA 1OD6A 5BR7A 4ME6A 4DRXA 1L4YA 2BM9A 5GIPE 4QASA 5FJIA 2HTFA 3KLMX 5GPBA 5IDQA 3RYHA 4HAWA 2W83A 1TZBA 1XQ1A 3CH7A 1PZFA 3F7OA 3JU3A 4OA8A 4TV9F 5AJYA 1NTRA 2DLNA 5ED4A 5LXTF 1N1EA 1V26A 2I78A 1DNPA 4BQFA 3LA6A 1G8FA 3U48A 3DMNA 2WUWE 1V9LA 2RE8A 1IB6A 2YNMD 3HGTA 4XCQA 4BZZA 3DL7A 1OB5A 2ES4A 2P6OA 1OFTA 4X91A 4IHJB 1Q1ZA 5IZCA 1L4FA 1SIOA 3F5DA 3E0QA 4QGSA 5DI3B 4F2GA 1S5PA 1U2ZA 4FSHA 1LNSA 3FNQA 3S40A 2OO3A 3LBFA 3CRZA 3M3PA 1E1CB 4L4RA 1SKMA 3N2KB 4H0FA 2ZBFA 1Q6YA 1N6OA 3BFXA 4L5IA 1SCUA 2JFGA 1BC5A 2PKWA 2WA2A 4GMKA 4HXYA 4IG4A 5TVKA 3WWEA 5AJWA 4C06A 4FHEA 4TMXA 2IVZA 1XMOB 1ISJA 1TTTA 5F1YA 1E6WA 1L6RA 5BOVA 4LFCB 4E6EA 1T1SA 4GPD1 4PO8A 4G81A 4U00A 5CT5A 3WK8A 1NMYA 2CNWA 3DE1X 1R0RE 4L95C 4E4TA 1XZAA 4DMKA 3H7IA 3D4BA 1E1MA 1XTQA 4JT8A 3HB4X 2IGBA 1NJ6A 2Q1WA 2Z5FA 2VAVA 2DQYA 5FNVF 3HKCA 5KNCD 1E79A 2W8BA 3C8HA 1M6WA 1NMQA 3OJEA 4RORA 5LD2C 1N57A 2Z30A 3IXMA 4Q37A 2PX8A 3FDIA 4R0NA 1S7CA 2EHDA 3DC7A 5K3FB 1YR9A 3Q3EA 1D4AA 2ONZA 2PYZA 4O02B 2V3WA 5B12A 1H2BA 2D1YA 1JHZA 5DM4A 3RLFA 3IOMA 1ID1A 3LUCA 1JHDA 2YJ3A 2RAVA 4X5OA 4L72A 4B44A 2GBGA 2Z1DA 5EZSA 4YMVA 2H16A 1JHVA 4C9BA 1QVWA 1P2UA 3BZBA 2OHIA 2XHEA 2DQKA 2XUKA 3K4HA 2DE0X 3P5BA 4OPMA 3EMBA 1EHYA 3BXGA 2CD7A 4MQ5A 1CK4A 1VJGA 4UU1A 4CCYB 4TZ6A 3OJOA 4O0LA 2NTNA 5FO1A 1OFVA 221PA 4HRAA 1X7DA 1NQVA 3NWOA 4EGQA 3EJWA 2YV4A 4L50A 4HWRA 3R0ZA 3R9XB 1FSGA 1TIBA 1Z7GA 4R3NA 2IHKA 3K9CA 3U81A 2G06A 1WZIA 2JBWA 1ZVVA 1XNRB 3B1XA 2VXBA 1UZAA 3P71T 1E7SA 3AF1A 2ABWA 1NXPA 3A28A 2DETA 1ES9A 4NENA 5LB2A 1SRRA 5AK0A 1CCWA 1D2GA 2MSWA 3AY6A 4JLBA 3AUJB 1WUIS 1KF0A 4TL9A 1C7JA 3DFZA 4BQOA 2RMKA 2YY5A 4MI3A 3IE2A 4NZOA 3UHFA 3BWMA 1R0BA 1QO7A 3PD0A 2IEGA 4CIWA 1GFSA 1WNFA 3SXUB 1Q3KA 5FLKA 5H4GA 4YCDA 1ZJZA 2PRJA 3CWQA 2PSHA 1AU9A 1M2OA 2H2WA 4E94A 5ILGA 2NWQA 6CHYA 3UUEA 2O50A 2TMYA 3EUWA 4M7WA 1RAFA 3AGPA 3ZEAA 2Z4TA 3I73A 4FFBA 3DH0A 3QI7A 5GONB 2FR1A 1JA0A 3K0AB 2AK2A 4DDKA 1NXTA 1KI9A 1ARZA 2FUKA 2WEKA 4DV5B 3FYUB 4Q4JB 4YREA 3ST7A 2YHIA 1DWQA 1QUEA 4K9DA 1W1WA 4REQA 2HRBA 1ZMBA 1F5NA 3M1YA 1A5BB 1CYEA 4OLAA 2CJXA 3TSWA 3EK2A 4IPTA 2QMUA 4ZAWA 2H1RA 1VYUA 2QYSA 5F64A 3R8FA 1JDTA 3GA0A 4RIIA 1XNJA 3WNBA 2JGAA 3HZZA 3INYA 4OU4A 1MZPA 4YRPA 4JNCA 1PQPA 3HM9A 3FVVA 1ZZEA 5JW6A 5K51A 3HBJA 1JWAB 2IWHA 4D3DA 3IPCA 3EEBA 1RBMA 2G1JA 5E9QA 4JJIA 2PXHA 2W2LA 4Z7NB 1N5JA 2R1ZA 4RPCA 4QBHA 2M6LA 3BIFA 4HN2A 2ATIA 1GNRA 3GLUA 1PFUA 4NAHA 1YQEA 2BFBA 3DVAA 3NI2A 3L4SO 4RXUA 5CLQA 5HK8A 3U7IA 5ALUA 2PZJA 4F3KA 3ZWBA 4R3WA 1P2BA 1HZZC 5DYYA 3RW9A 3LK7A 4GXTA 1P1CA 4PSUA 5A3RA 2FTKE 1DARA 5AK5A 5ELXA 4KIJA 4MLZA 3KUXA 2RGRA 4D80A 3LUHA 1IN8A 4TMKA 4D9KA 3JVEA 1XJCA 1M3SA 5IFLA 3K70C 4IDNA 4MQ6A 2JHAA 4MWEA 2C3OA 3PS9A 1D2AA 4R0VA 1EEXB 3HO1A 1GKLA 3B3JA 2BFCA 1RHJA 5BSKA 2E2WA 4OV6B 2YYAA 3N6XA 1NATA 2J6IA 3UFBA 5JRJA 4B4UA 2VWGA 3PNBA 2RKBA 5JXIA 2B4KA 1TCAA 4WXEA 2NT4A 3N28A 1ZGGA 4RGBA 4X54A 3HLTA 3U19A 1JSCA 1WIWA 2IYZA 2OPBA 2ZU6A 4EJMA 5IJ9B 1SQ5A 3Q2IA 1Q1QA 1G20A 3BGSA 4ND6A 5T5QA 3TQTA 4BLRA 1IZ9A 4A16A 2OB1A 1ML4A 4TM8A 2VWQA 4LXIA 3NBQA 4V3CA 5E9AA 3PUZA 4RVDA 5U1PA 4P0TA 3T7RA 3H5VA 1LQTA 3MCTA 4WA7A 1JBKA 2ACKA 4MVJD 3WQQA 1ZN2A 4K6MA 5I7UA 3FI0A 4LY9A 3VH1A 4L8WB 2BWJA 1I2ZA 1YNSA 2PIAA 1BDIA 3H4TA 4IJ5A 2QVCA 1UUFA 3JRWA 1U28A 3DHWC 3PNVA 4RSRA 5DLQC 4IDEA 1N33B 3RSGA 3NUZA 3QPCA 1E63A 3K0HA 4RU1A 5IF3A 2UZ1B 3ZY2A 2CJPA 4Q1EA 1H2XA 1PJ8A 3JQEA 1E20A 4DZTA 1M8FA 2IUSA 4O8CA 5ALOA 4URXR 4GBJA 3KT6A 1RPNA 3UANA 3HKCB 3HY6A 3OCJA 2C5SA 2O3TA 4FR5A 5CVVA 3SSMA 1UFRA 3PNPA 1VBMA 3E5HA 4M4SA 2MCFA 1YS4A 3PX7A 4BCBA 2L0XA 1Q0TA 2CEAA 3PT9A 4ZQCB 1NE2A 3JYQA 4OI0A 1WXDA 3L93A 5H7XA 1PNOA 2PRYA 3HDHA 4MROA 3QKUA 3P2MA 2GVZC 2R00C 5TIIA 1JKJA 3T6KA 1U65A 1U3GA 3CR8A 3IP6A 4AULA 3PQ4A 3DA8A 2P9HA 1FVHA 3CS3A 5DO9A 5F2EA 5LQUA 1WXWA 1Q77A 2FRXA 3QU7A 2A0FA 5EVJA 4CTKA 4J4TA 3I0ZA 4HMQA 2NOAA 5A1TA 2Q1XA 1Q92A 1BVUA 4GGMX 5D85A 4LZJA 5FCDA 4IIFA 2DB3A 2A84A 2AZDA 3B3FA 3W9YA 4FE4A 2BEWA 4XWAA 4ID9A 1UDWA 3GFTA 5CR9A 5H81A 5B6PA 3WMFA 1JQKA 3CPHA 1R9NA 4YIKA 3IP1A 5E7QA 2CN1A 3IE1A 4PGGA 1ZRMA 1UKVY 5KX5F 1IIRA 4NP6A 2BKXA 3MOGA 1FLDA 2I87A 2EWMA 3O9ZA 5B30A 5KIAA 1Y8AA 1T8RA 1OSNA 3UHOA 1JG3A 3BCSA 2FWBA 4LWOA 4MQUA 3RAPR 1ZUD1 1PE0A 4EUHA 4Z51A 3QNWA 2XCRB 5H8WA 3CPJB 2QVGA 3GIDA 4LGCA 4YRQA 1S2GA 4W5NA 4EBFA 2XOXA 4FJ1A 3TXAA 1BCSA 2HREA 2JK1A 3ECSA 4QBFA 3RAJA 1LI7A 4B6QA 2UUOA 1GCIA 5BQ5A 2IXEA 3TIIA 5CLFA 3DLCA 5HP4A 3D9QX 3NJRA 2CUNA 4MV9A 5DKFA 4R1TA 4DQ0A 2CXOA 1B15A 3CWZA 2VYCA 3A14A 3P8ZA 4GLOA 4FWTA 3COPA 1SCBA 2BZ1A 2UZAA 4ND4A 1CZOA 2H31A 4LJLA 1WA5A 3H8WA 2D1TA 4I55F 4JYMA 4IGFA 4RVHA 3N9IA 5TGDA 4M49A 2GI4A 3V4OA 4MV8A 1KBZA 2P0AA 2OHVA 2ZAIA 3GV0A 1T9DA 3IMEA 3OLWA 4IDOA 4AXXA 2JIZD 2R9VA 2DLDA 4HPWA 3ZGVA 3UJNA 5JIBA 3VJKA 5JSQA 2ONYA 3KT3A 4X60A 5EINA 4AXBA 2R47A 4ENPA 1NSTA 5BOSB 3O2SB 3QXSA 3RIEA 1MABA 3N86A 1MXFA 4BKOA 1L7PA 4NBUA 1W46A 3ZWNA 4Y7CA 4I2VA 4OF4A 5E3IA 4JB3A 4MRRA 2CXQA 5LB4A 5BYJA 1IM5A 2NT3A 4K46A 4KPGA 1II9A 3R0XA 4Y3UA 3MTJA 1EB8A 3ANTA 3A6GA 1LSJA 2G82A 3OH8A 3ILHA 4URVR 1N77A 2GDZA 1AZWA 2YASA 5JJKA 4AUKA 1ZONA 4ER0A 3NV9A 5TPZA 5FOSA 1M6VA 1ISIA 1K4YA 2FMIA 2QN9A 3ONEA 4MWTA 2WWXA 4MA4A 3WNDA 1PG0A 2HA6A 1OU0A 1TQHA 1YVUA 2C9OA 2VBGA 1R18A 3DR5A 3L5KA 4FGUA 1KE1A 3WA6A 2OP0A 4BJ1A 3ME5A 1AB5A 4QFBA 4DA7A 3CUEF 3A05A 1UWVA 1IZ0A 3CB2A 3BICA 2ID8A 3OOWA 4Q02A 4YI5A 2H5IA 2AQ8A 3D0KA 1GSHA 3HKBB 4TT3A 4OHYA 2NV0A 2AW3A 2L82A 2PWZA 4BLWA 1WW2A 2C77A 2ASVA 1Z7EA 1JNYA 2C92A 1JAHA 5IF9A 4MUXA 4EHAA 4QM7A 2J6CA 2RK6A 3ADOA 3NHKA 3OA0A 3VR6D 3L7YA 4A0SA 3HP4A 5B1SA 5ITSA 1RHKA 2IZ5A 4PWYA 3P4XA 4R2KA 2Q5FA 2Q5LA 3NJ8A 3PWKA 5HM8A 4Q1BA 3MYYA 4RKYA 2ZYUX 3D59A 4L57A 4W99A 4YRTA 1YSCA 2WP0A 4X6UA 4IKOA 5KCMA 4EZIA 4AO6A 4K28A 1L5NA 5ENVA 2CNWD 3L06A 1GUYA 5CURA 1V41E 3TXYA 2QRVA 1AXRA 1J8YF 2XQGA 3KTFA 1X38A 3CO5A 1YBVA 1NT4A 3P9RA 2GUWA 1DQSA 4KQ9A 4P5DA 3RYIB 3TX2A 2G72A 3VR1A 4D25A 1X7WB 3ACBA 4DJDC 5TR9A 2R6AA 2DECA 4V0NA 1RWVA 3H2GA 4FGSA 2PR2A 1S8NA 3FMVA 3UA4A 1M5UA 4WCFB 3RS4A 1E6CA 4DB4A 4B5KA 4XOIA 4BNLA 2WPNA 2VZ8A 2VCEA 3PGVA 3Q0TA 2R60A 4LG1A 1YK0A 1Z4KA 2ZIUB 1A98A 2JKVA 1CIJA 2HEGA 3KB6A 4M6WB 3T4EA 3WRXA 3E8MA 4E5SA 1OXMA 4UBJA 4WJLA 1SUFA 3HB1A 2W2QA 2XUOA 2ZE6A 5C2JB 3K0KA 2WQZA 1YS1X 3KSAC 1XHEA 1XMXA 3NUQA 3ZWKA 4JMPA 5HYVA 4A8TA 1XLTC 1QG0A 4AROA 1WKBA 3BG5A 3LYHA 4K6HA 3W2TA 3D4LA 2PLRA 1C0IA 4J1NA 3IUPA 2ERCA 3ZWQA 3BCUA 5JNWA 4N3CA 4WLUA 5JATA 3A3NA 2QR5A 2R85A 4JP3A 4XASA 4C6HA 3MTAA 4L73A 3ZVKA 3M4ZA 4KE7A 1Y8RB 2VHXA 2EKQA 3HZOA 3DCYA 4JT4A 5A04A 4WZAA 1TNDA 1O89A 1P5ZB 2WAXA 4A0RA 1ZMTA 3MOSA 5JH7F 1GNQA 1Q50A 1GFWA 2QBYB 1XQ9A 5TGZA 3CVJA 4NJMB 4Z7JA 1XALA 4QX6A 5CNMA 4KRFA 1RJEA 1FNDA 2FPRA 4MUEA 4BO2A 1ONOA 4Y2UA 3TNFA 1N6LA 3RH0A 3SFZA 1NI5A 3RC7A 5CA0B 1TEVA 2DAPA 3AJRA 3CIOA 2IYQA 3F6RA 2X23A </