2W2NA

Wt pcsk9-deltac bound to egf-a h306y mutant of ldlr
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
294
structure length
273
Chain Sequence
SIPWNLERITPPRLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEDSKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSDCSTCFVSQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAALPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/receptor
molecule keywords PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9
publication title Structural and Biochemical Characterization of the Wild Type Pcsk9/Egf-Ab Complex and Natural Fh Mutants.
pubmed doi rcsb
source organism Homo sapiens
total genus 97
structure length 273
sequence length 294
ec nomenclature ec 3.4.21.-:
pdb deposition date 2008-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2w2nA00
1GT91 1WVMA 4DWWA 5AMXA 1V5IA 1MEEA 2DQKA 1SBCA 2ST1A 5JMOA 1BFUA 4ZOQI 5AQEA 5ARCA 1WSDA 1T1GA 1SIUA 4OMDA 1OYVA 4NE7A 3Q40A 2ID4A 1TMGE 3DE4X 1CSEE 1R0RE 3DVRX 1OT5A 1PTKA 3EIFA 3DVQX 3VYVA 1KDZA 1SUBA 1SUAA 1A2QA 1GNVA 1S2NA 2W2PA 3DE7X 1BE8A 3L1KA 3VSBA 4CG0A 2IXTA 1TM5E 5AVJA 3PRKE 1TM1E 1UBNA 2QTWB 1ST3A 3DE3X 3DE6X 3TI9A 3SICE 1YU6A 2TECE 1NLUA 1IAVA 2PQ2A 1PEKE 3TI7A 4KPGA 4MZDA 1TM7E 3I37X 5ARDA 4WOBA 1Y3CE 1ZVJA 4AKSA 4DZTA 2PYZA 5AVKA 3AJ8A 4C3VA 3ZXXA 2WUWE 1SIOA 1NDQA 3ZXYA 3QTLA 2DUJA 2ID8A 1AK9A 3F7OA 4BWGA 1BJRE 2PMWB 4K8RB 1NDUA 1TK2A 4DJ5X 2SECE 1SELA 4B5LA 1TECE 1LW6E 1SPBS 3I30X 3LXUX 3AJ9A 4LVOA 4H6WA 2IY9A 1GTJ1 3QMPA 2GKOA 1GCIA 4YN3A 1Q5PA 4ZARA 1S02A 2PRKA 2XTJA 1WMEA 3GT4A 4LVNA 1BFKA 1GA1A 3T41A 3OSZA 1SH7A 1TM4E 2PKCA 4H6VA 3DVSX 3WIUA 5JXJA 1Y3DE 3DE0X 1Y4DE 4CFYA 4WOCA 1Y34E 3DE1X 1HT3A 2G4VA 4AKTA 3PTLA 4J94A 1Y3FE 4HX2A 3A3NA 1GA6A 2Z56A 1SCNE 3DE5X 4FONA 5K7SA 4HVLA 1Y33E 2Z58A 4OV6B 1SBHA 1C9JA 3HJRA 4NE9A 1GA4A 1R64A 1TO2E 1AH2A 2PWAA 3VTAA 3A3PA 1SCBA 2W2MA 2SBTA 1EA7A 1SUEA 1YJBA 2P4EA 3LPAA 4KG7A 5I9SA 1PJ8A 5FAXA 1SVNA 1GNSA 2V8BA 3AFGA 1AF4A 3D9QX 3DW3X 2Z57A 5B1EA 2PWBA 4I0WB 1ZVKA 2Z30A 1SUDA 1OYOA 1DUIA 3F7MA 4JP8A 3CNQS 1SUCA 1THMA 1BE6A 5B1DA 1GTL1 1TO1E 4RYDA 3DWEX 3CO0S 3I34X 1C9NA 1SBNE 1AVTA 3BPSA 2ZWOA 3TECE 3EDYA 1XF1A 1AV7A 1S01A 1C9MA 5FFNA 1SCAA 1Y1KE 1SIBE 1YJCA 4OMCA 1KDVA 1SCJA 3P5BA 1Y4AE 3GCXA 1KDYA 3EE6A 1SBIA 3I2YX 2E1PA 3WHIA 2WUVA 2X8JA 3Q5GA 2X8JB 3F49S 1EGQA 1P8JA 1SUPA 1AU9A 5FBZA 1SCDA 1P7VA 3LPCA 1Y9ZA 2W2QA 2ZWPA 3GT3A 3WQBA 2B6NA 1BH6A 3SQOA 1T1EA 3VV2A 2DP4E 3DW1X 2WWTA 3QFHA 5SICE 2SICE 1Y3BE 1KE2A 1P7WA 4H6XA 5JXHA 3DE2X 1V6CA 3D43A 1PFGA 2SNIE 3UNXA 1SN7A 3GCWA 2W2OA 1MPTA 1DBIA 1VSBA 5JXIA 2XRMA 1YJAA 1WMFA 4KB5A 2Z2XA 1C3LA 3WIVA 1JEAA 4NMXB 2W2NA 2Z2YA 1CNMA 1KE1A 3A3OA 4GI3A 1GTG1 1TM3E 3VHQA 2Z2ZA 5JXGA 4C3UA 1ST2A 4Z2AA 1WMDA 1T1IA 5ARBA 4M1ZA 2ZRQA 1SBTA 2WV7A 5CW1A 3DDZX 4CFZA 3DYBA 2HPZA 2HD4A 1Y48E 3LPDA 3BX1A 3BGOS 3H42B 1IC6A 1AQNA 3VV3A 1R6VA
chains in the Genus database with same CATH superfamily
1YVUA 1BAPA 3D81A 3EGVA 2I62A 3WGTA 2FW9A 1KZ1A 1V5IA 1T15A 1RXVA 2DPYA 3LU1A 1X1EA 4HWTA 1GFIA 1UODA 2PGXA 4UD6A 1HF3A 2REOA 3GZ4A 4Y1EA 3WGJA 5JMOA 1CHDA 1TAUA 1G8AA 1K7YA 3CURA 3NIFB 3K0EA 2Q62A 2XJ9A 1QO0A 2ZBFA 4JK3A 4LUCA 4ZAWA 1JJIA 5ADHA 5THXA 5CDYA 2C7OA 1L5KA 2GD1O 3BCRA 1WPRA 1FRQA 4OL9A 4PPYA 3RUPA 2JIBA 1GYQA 3LLSA 4QBFA 3SOPA 1E2BA 1D5WA 3ASUA 1F6DA 3L79A 2BI7A 1NYRA 1NQXA 4LC9A 2Q4TA 4EGJA 2NTNA 5EJ8A 2JLUA 1X70A 2WJHA 3PF9A 4F1WA 3PKIA 1U9IA 2OG1A 2PQ0A 2PXCA 1ONNA 2AYZA 1F2UA 4KFTA 4PPGA 5HUJA 2RI0A 1QP0A 1S7GA 5K2MA 4M99A 1XE3A 4NBLA 4HMPA 4HNTA 1GXSA 4FIDA 3MJTA 4KVAA 4MPPA 3DVQX 4NV1A 4QOEA 4RHTA 1KI9A 2IHNA 1T3GA 1TVCA 3WGVA 2JD0A 1ZXXA 1V1JA 4G0UA 1X8KA 4UREA 4XKJA 2FX5A 3ELWA 4DNOA 2GEDA 3JYNA 4D3DA 1SUAA 2BW0A 4GECA 4IYRA 4J07A 3CSDA 4CKCB 3B8EA 2E4VA 4OFWA 1QK5A 1VRVA 3OJXA 1J21A 3F9IA 4WH0A 1WW8A 1HFEL 4QQRA 3HV0A 4HEJA 5I9NA 2AMJA 3UA3A 4WFQA 5IXJA 1DARA 3H1AA 4MIKA 4QU9A 3W9BA 2ADMA 1TM5E 2MT9A 4K9RA 5FOTA 1LKZA 2C7BA 4J9VA 4QOSA 5EJEA 1P2DA 1E94E 5HNKA 2CE2X 1DCFA 2WFLA 1LPPA 1U2RA 2IYSA 3B9RA 3OJOA 5KJEA 1X39A 5GM2A 1Z17A 1MR3F 2EZ9A 2HF7A 2M6LA 1Y82A 1PSDA 3SXUB 1H3NA 2P79A 4B0PA 4NDZA 4XW2A 1ZONA 2BFWA 1R8SA 3UAXA 2DT5A 4OY3A 1S6YA 4G81A 4KN6A 4PLTA 5A3SA 3DTYA 3BN3A 4U4AA 1EVLA 2PSSA 5REQB 3OE1A 1Z22A 2X9GA 2FQQA 5TGDA 3IBTA 5COAA 1FTGA 2P9CA 4FJ1A 3AY3A 3BH6A 1KYYA 3DBOB 2XE7A 1M75A 1T9CA 1GPUA 5HE9A 4BLWA 3SC2A 2ATVA 3CLTC 4NBRA 1DDGA 3M4NA 2EKPA 4L5IA 4C0BA 2FB9A 3NC1C 1XA0A 5C5CA 3H9GA 3NP7A 1J90A 1ORIA 3M2PA 4QDKA 3W6PA 4LECA 2I3DA 3E6AA 4QU0A 5EKSA 4C6SA 5BV7A 1OHHA 2B21A 4R6WA 1BXGB 4IWNA 4Y3UA 2CK3D 4HDKA 3WWOA 3GLHA 9GPBA 1CHNA 3TECE 5C8XA 4OQPA 4LOHA 2RCNA 2IHJA 3DSRA 3JQRA 2FLWA 2GPSA 2H1CA 5LWHA 5DT2A 1UFRA 3TQQA 4REQB 1B42A 1U2ZA 2OORA 1TA4A 3H9BA 3E0QA 1N9GB 4P3XA 2QN6A 3GJ8A 3I05A 5K4AA 1YB7A 4QO7A 4GSKA 4UFPA 2EP7A 1AHPA 1QCZA 1QRTA 3F6YA 3KLPX 2GLUA 3QRWA 2DEUA 4O4IF 3VC1A 3P0RA 4MPJA 3T4EA 1JHQA 1K2VN 2WLTA 2Y68A 4NS1A 2AE2A 3D1JA 3F5QA 3U26A 3PUVA 2NACA 4MUXA 3ETEA 1MXHA 4B3FX 4M49A 3IVRA 3OZEA 2MHCA 1T35A 5HIIA 1A8HA 1U7DA 3QG5A 2JLZA 4X54A 4G8DA 2XE4A 3H05A 4HCJA 2IQIA 4IXDA 4J0GA 4OGGA 4QASA 5D84A 2XYVA 2D5BA 2QT0A 4LJLA 3E9QA 4G1CA 3LCMA 4KYVA 4YDHB 5FO1A 1TA9A 3RW9A 1TW2A 2FUNB 2WINI 3P9PA 1JXAA 3FPHA 4RLQA 4X93A 2O8CA 4YLGA 2Z8ZA 2J45A 1U63A 4AULA 3CLHA 1IWBB 2ID8A 4ZT3A 2RG1A 4OGFA 2BGGA 2EATA 3RUFA 3N8KA 4KC0A 4Q3KA 3R7WA 4XE5A 1XHLA 5TVKA 1YDWA 2PRJA 1NXSA 3UUGA 4CTJA 5CYGA 4G8BA 3LI2A 1PJZA 1W1UA 2HV9A 2RAPA 1CZLA 1Z4PX 2OXRA 2SECE 2V5UA 3TG2A 3TRJA 3D7NA 2PVPA 5AKLA 2HRRA 5IKEA 3AZQA 1SPBS 1JQ3A 4U63A 4D6PA 3LO5A 1W52X 4HTFB 4C5CA 1TCUA 4DLAA 5BV8A 4G84A 2Z6UA 1ZGCA 5JCZA 2H5LA 2Z9DA 4R8RA 1Q7EA 4BP3A 3PX3A 4BAGA 1YS7A 4LA4A 4OB6A 3G17A 4Z4EA 1WD7A 2PLNA 3DLCA 1E98A 4RHFA 4YTEA 2CVPA 5JJ5A 1PJQA 1WULS 2P5UA 3ZLBA 1S02A 5C7YA 2I6FA 3PDCA 3KTAA 1FNBA 4OQDA 1HDXA 3TVYA 4EUEA 3R5XA 1Z2NX 1EFDN 3RIHA 1ISMA 1HZZA 2UZIR 1V6AA 1MFPA 3CZQA 1C80A 1BEEA 4LJKA 5AK3A 4D5GA 3N28A 3MGBA 1G3RA 3JQGA 4D45A 1G8YA 3A1WA 1AX9A 2XADA 5JWHA 2OA0A 1VDMA 4FW8A 3UMSA 4D44A 3EWNA 1J9EA 2B99A 3G89A 3HZRA 3RM3A 3HFSA 4QVKA 1ZH8A 2EW8A 3OFVA 3BBPA 4FIZA 2XMDA 4WY5A 2JFWA 1T8WA 2OM6A 5CJ2A 3MCUA 4B6GA 4J1TA 3B2QA 5A7FA 2LGJA 2D1QA 3BXPA 2HMVA 5EKTA 2W2TA 3SQWA 1P0CA 2XRYA 1QX4A 1V4NA 2ID9A 2FK8A 3ITKA 4Z3DA 4H60A 3OCUA 1M76A 1VECA 4P58A 4XXHA 4ZQBA 4RDIA 2OPBA 2JKVA 3CVXA 3LL7A 2ZRAA 1I94B 3CUYA 3FUTA 3D2AA 3IDQA 3HLKA 4UTRA 1WNTA 4PZ0A 821PA 3WGMA 1C7QA 2C88A 3O9ZA 3WWDA 4RJJA 5CITA 1YCGA 4QPCA 4MICA 2ZAGA 1UT8A 2WD9A 2FFJA 2ESRA 2XE8A 5SY9A 3TLGA 4BP1A 1OH6A 1E2IA 1VZ3A 4FCVA 2QS9A 4ZQHA 5MFPA 4UDYX 2JFPA 3BD7A 1VLHA 2FZCA 3PGXA 4GG1A 3K0SA 3O6VA 1UH5A 3BJZA 2XA1A 1HYBA 3P94A 4RTJA 4RCYA 1OKKA 4OQEA 3LRXA 5TF0A 3X1ZA 1P3Y1 2KI5A 1I2DA 3IIMA 4CUJA 4QJ3A 1N2XA 2HWXA 3P2IA 3RIXA 4CWAA 1TMYA 4DVJA 4M1EA 2GASA 4CMIB 2PBLA 3VGJA 4TPKA 5CHEA 1CJBA 1FFCA 1FRZA 1QH1B 2GQ0A 2OORC 3BVPA 1F3LA 4GXTA 4M22A 2DUUA 4R8MA 1C3XA 4IDOA 5H5JA 3GLGB 3AHDA 4O1MA 2YZKA 5T5QA 4D4JA 3PIRA 5HIAA 4D3YA 3UMMA 2IVZA 4M7RA 1IUOA 4AMZA 1N6KA 4HDNA 2O54A 3ROZA 3M5WA 4H7JA 1WBJB 4QOIA 5HS6A 4CIBA 2VXCA 3NBZC 5CRIA 1GNRA 5BT8A 1NVXQ 2O8DA 4HQLA 1PQ4A 3PPWA 4Q16A 3LH5A 3V4OA 4N1AA 1M1NA 2K87A 2RJOA 4WZBA 1QFZA 4G8CA 3HB5X 1E3SA 4LHEA 5C1PA 2IX3A 3W7BA 1AQUA 1SU8A 1W30A 2PR2A 4KG7A 4LJ7A 5I9SA 1C81A 2O20A 3CC8A 4LY6A 1L3CA 1H1TA 2JI6A 3GRUA 1XPJA 2EL9A 2Y0EA 1G8JA 3KQPA 1UKYA 1W88A 2J67A 4FYWA 4B4VA 1ZM3A 4BFSA 4HG2A 1PK9A 1QQAA 2VUSA 3NC0C 1PEAA 2VTBA 1PV2A 2PWBA 1M2FA 4I0WB 4DNQA 4ZI7F 4MYTA 4MGHA 3WJ1A 4FSHA 4YHHB 3AEUA 1TFRA 3SLGA 1BGXT 1E6KA 3K5PA 2JATA 1G4HA 2A7XA 2ET6A 3R0IA 1CZOA 1TTHA 2B98A 2GZSA 3F7MA 4MS4A 4QWMA 4RJ2A 3ZXUB 1UBMS 4N7RA 5EUQB 7ABPA 1IH8A 2PZMA 1H2BA 2J7KA 1G1AA 4GM4A 2HGSA 1QH8B 1K9SA 1JHOA 1EJBA 1AUOA 1BE6A 3OH8A 4PINA 4TT8A 3W6OA 4XVRA 1ZGZA 2NWQA 3PC2A 4BVAA 6CHYA 3IIEA 2J3DA 2J9FA 2CNLA 4FGWA 3A6LA 4D3ZA 2FZEA 2VSYA 5IJ9B 3WRYC 1CR1A 2UYYA 4C2TA 5I47A 1BRMA 3ZY4A 4EPXA 4CIXA 2XW6A 2DUMA 5EA2A 2UAGA 3P4UA 2XB8A 3BKXA 3JWIA 2CYAA 3VHXB 2HJHA 4F5ZA 1UMCA 2QROA 3COSA 4F06A 3V42A 3UAVA 1KPIA 4ND5A 2ZI5A 4GOND 4EL5A 1V95A 4XTCS 4IRUB 2CFRA 3AVTA 2WPDD 3R23A 3RD5A 2BISA 4PLFA 2PSFA 3SFVA 1U6IA 3I5YA 4C0QC 1QLHA 1W85B 3GRPA 4PHHA 3MW8A 4NC9A 3ZH9B 1UKAA 5A6VA 5IC5A 5AFSA 4A0HA 2OEPA 3OPYB 2BZSA 4URFA 5F12A 1O6ZA 2QPLA 3IQDB 5MFZA 2CE7A 1G19A 2E89A 1ADFA 1J2YA 2N1BA 4J1TC 1KKUA 1XA3A 2EJWA 3ADBA 3W7VA 1A1VA 4FR2A 5J2UB 4GWLA 1DTSA 4E2YA 5JRDS 1D9ZA 4KNYA 2H18A 4MWZA 3H16A 4B17A 5A62A 2H54A 1J8VA 2X8JB 1U9CA 3ULKA 1AXGA 1L9XA 2YMPA 1M1YB 4MQ4A 4C07A 2ORVA 1DC4A 2V6GA 3ES9A 4UU0A 2BI4A 4HYQA 4R7TA 4CL8A 3FN4A 3MIIA 1OPRA 3PPYA 4IMJB 4A2QA 5J2TA 4CR8A 5LDDC 2D06A 1M74A 1G0OA 4HWGA 1HYGA 2FR8C 1T2DA 1UKZA 2DSTA 2JCSA 3RSFA 4PHCA 4DFDA 1CRWG 5BR7A 1A7KA 4MGIR 3H1PA 3KPWA 1HQKA 2EC5A 4OHPA 2GK4A 5AKJA 3UJAA 4FNOA 4WECA 3R7DA 1X7YA 1PE0A 2EJTA 2WWTA 2Y66A 4Y2RA 2A5YB 4AM8A 4E5UA 2ZIXB 1PGOA 4R1MA 4Y6RA 4R83A 3A2LA 2Q4OA 3NNSA 1I5EA 4AURA 3IHKA 2VXBA 4MCAA 5JCPA 4FNAA 1FDOA 4OMFG 2GEUA 1YL6A 3V80A 4NU6A 4EA7A 1PJ2A 2YNMC 3W4IA 1JSXA 1V16B 2DQZA 3QI2A 3UWDA 1A50B 2ODNA 5CLGA 3O8QB 1O94C 4NTZA 3R8CA 1Z28A 1Y42X 2PUAA 1B74A 2NUPB 5ITSA 1NZJA 2FSGA 3GJXC 3UMGA 4DWJA 1M2EA 1V6CA 2HRBA 3HKEB 4LF7B 2D4HA 3EF0A 1OGIA 2G1AA 3KU1A 1LSSA 1SC1A 4E33A 4PYRA 4JBHA 1TEZA 3TB6A 3BK7A 2IP2A 4D8YA 1B0AA 4N8SA 1QKIA 4ZQCB 1K66A 5DDIP 5B7GA 5CFOA 3GCWA 2DERA 1Z25A 1O95D 1QWSA 4OATA 3MYYA 5EE9A 1DBIA 5B64A 1OR8A 1BCSA 3BHMA 4A3SA 2I7VA 2A88A 1ZH4A 1CVLA 4QGBA 4LS3A 1IRIA 4GDFA 1G7CA 2WPNA 2WIBA 1I36A 3B1JA 4J0HA 1KQPA 3QE9Y 5CVVA 2LZ0A 4A8JB 4Q3BA 4RD0A 4HT3B 5FV4A 1O89A 4KV7A 3ZI7A 5A3QA 3KJFA 4MW2A 5K2OA 1E1CA 1H1LB 2LCFA 1RHRA 4TMFA 1Y1SA 3KQSA 4L0DA 2P2NA 2HBZA 1Q2UA 1EZ4A 1TD1A 3AC0A 2BTEA 3BMCA 2C2WA 2W11A 3DTVA 3DZGA 1KDPA 2X2EA 5IDXA 3VR5A 5A06A 2CZCA 1UC5B 3EXFA 1DKOA 1CULC 1FQWA 1VPTA 4XD2A 4YUAA 4IDAA 5EPEA 3ZIAD 3QQPA 3T7IA 3PFHA 4A8TA 3KR1A 1HTBA 1UBHS 1QX3A 1UXJA 1J8MF 3C7TA 4RM2A 2VAMA 1BA3A 4D1YA 1Q1BA 1N2CB 4P3KA 3ANYB 4FWTA 5EWMA 5F1YA 4GO1A 1C5KA 2LTAA 1F8UA 1G21B 3QE0A 1RFLA 4KXVA 4O2AA 4Y30A 4Q7JB 3BA6A 3QG1A 4MV0A 1TO6A 1YAHA 3E03A 3GUYA 5EEHA 4QHYA 4CFZA 2DXIA 2Z8YA 2AI1A 4RVHA 2WD7A 1P62B 5A5GA 1ZINA 2C54A 1P5FA 3L7AA 5DHAA 1SAYA 4XX0B 2P3SA 1UWLA 5T3UA 4Z7QB 1NVTA 5LP1A 2QV7A 4YVFA 3ET4A 3LPDA 2YDXA 2V6FA 4P4UA 2P8JA 4AUNA 3OIDA 3K6JA 1E5LA 2F1OA 2AWNA 4D4IA 3EZGA 4MQEA 1XMSA 1TUIA 2E85A 5F77A 4KMOA 3U4AA 2WIAA 5DV9A 4HDAA 3QVJA 2SHKA 3P0HA 2GDJA 3UV3A 5KNBH 4HGRA 3RUCA 1JN0A 5EZYF 3WLKX 2DG2A 4N3NA 3W1WA 2OQRA 2D4AA 2QVXX 1C8LA 3MTAA 1DXYA 3EXHA 4XJXA 5F9FA 4FFDA 4WI1A 4GWKA 1KK1A 4EF6A 2HCFA 1N2GA 2J3JA 1WSDA 5LZ7A 4K8OA 4S0ZA 4EJFA 1M2OA 2GAAA 1QQBA 2FG6C 2E7ZA 4UM9B 4HDSA 2H1HA 2R11A 3KDSE 3HKCB 4WK6A 5SYAA 2GH1A 5GJCA 5JAHA 3AHFA 4QYTA 5CVDA 5AK6A 5DOVA 1R6TA 1KARA 1JKFA 3P9NA 3DVRX 3ESCA 1PTKA 1Z9BA 2BDTA 1VZ2A 4DAEA 1GUZA 2ZUVA 4DLYA 1UP4A 2BFEB 5IDVA 3RB8A 4YLYA 5ITZA 1VE3A 2P68A 5BNFA 1QZUA 3LD9A 2ZETA 2WIDA 3SHQA 5BQ3A 1PEDA 5E6RB 4BIMA 3X2SA 2NVBA 3I9FA 3ER6A 3K9FC 4Q66C 4FSXA 3VNRA 3WLAA 1JHXA 5CVEA 2W6ID 3FZNA 2I6SA 3WJ7A 3UB4A 1QIHA 2HUNA 3NR2A 5DK4A 1GM5A 4ZYWA 1T25A 4CLRA 4EM6A 2E5LB 3RUAA 1GU7A 3MMNA 3P8ZA 3QA9A 3TBFA 1U2EA 1OZHA 5IKMA 2OGUA 5CCXA 2VF7A 2HRZA 2EFYA 2QKYA 1CF2O 3DQPA 1DL5A 2VHJA 4KXMA 3AFOA 2IHTA 4S0XA 4B3SB 1Q17A 2E21A 1WEHA 3K70D 3CLRC 4MUFA 2DWCA 4NJMA 3PRKE 5AVJA 2CLFB 3P4XA 3WVNA 2XSZA 4JYBA 2NO1A 1X42A 4WZAE 4ZPXA 4RTMA 1ZUNA 5FNVF 3BZBA 4RF5A 5T3YA 3AF4A 1X1QA 2NIPA 1JVBA 2O4CA 3EVGA 4UQPA 1ETHA 1WTCA 2QYOA 3R76A 4ZKDA 2JKYA 4OF4A 2ZJ5A 2RGYA 3D31A 3HHEA 2CDBA 3K1TA 4K3VA 3R9XB 4CIVA 1EAYA 3KJIA 2OGZA 1JDBC 1KBOA 2X7HA 1HE4A 1S96A 2OCXA 1HXHA 3LCUA 1Z8NA 1G18A 5EP2A 1Z38A 1E5DA 2Q49A 2RHBA 4IGFA 1GL6A 1D6SA 1FZTA 1YU9A 4I4TB 1G6Q1 1K2WA 2EFJA 3C14C 5KYYA 3BRWD 4YCNA 2AC7A 1I2AA 1N0HA 2GCIA 1Y81A 4U3JB 3VBCA 1NLUA 1QAMA 3FYDA 5KWEA 3KRTA 1QRUA 3I1FA 1P0FA 5TSDA 2I34A 2OXIA 3RTAA 3E9ZA 4QUDA 3FNEA 1IK6A 2Z95A 3OZDA 2DFVA 4U7GA 1DJOA 4ZOCA 5FBKA 5H3CA 4BEBA 4JJAA 3DMDA 3ZHCA 3ZIDA 4E1AA 3EZ7A 1TZMA 3I23A 3KT0A 3FDJA 3KXDA 4FYIA 2IKQA 4MKHA 4O2BF 2IHYA 4EG0A 2DWPA 1PG5A 2A1UA 5HXAA 1AB6A 4UAUA 3C3WA 4P31A 1X6VA 1YL7A 1IZZA 1KJ9A 3HDHA 1YI8A 4R51A 4ZT6A 4RV5A 1ISRA 3EQ9A 3KVYA 5ECGC 4K6GA 2J6HA 3GHHA 5AYVA 3ZNOA 2AKEA 3ANSA 3WWPA 1XRNA 4XDHA 5SZIA 3SF8A 1M1ZA 4YX9A 5ITWA 4C2UA 1CR4A 2QMQA 3SVLA 4II2A 4AXBA 4P2BA 4Y6OA 5LZ4A 3OF3A 1L7RA 1QO0D 5KOJB 2B8EA 2ZQYA 4FYVA 3QE4A 2EERA 2NZXA 4ZO8A 3ZE7A 4MW0A 1LC3A 1ZAKA 4HNSA 3RF7A 4A9AA 4E3WA 5JRZA 4I3FA 5M7EA 2YICA 1QHIA 2H92A 4GBJA 4MINA 5DI9A 5L3QA 3TDKA 2HK7A 1FLNA 5IC6A 4LF4B 2X0KA 1HTWA 2Q5EA 2Z5LA 2JBWA 1R16A 5EJ7A 2BBSA 4G3XA 4BIIA 3QU5A 2N46A 1TJYA 1Z15A 3NTUA 4MVJA 5HKLA 1S0UA 2XUPA 3OY2A 2JD2A 3C48A 1KO7A 3L8EA 4GPTA 3UGKA 4DUZB 2CV2A 2FRDC 3CEHA 1U3CA 1AK2A 3ZE9A 4CYMA 2ATCA 2R1VB 4IH9A 3A32A 3TKYA 5HX7A 1W2WB 3FUWA 1IN1A 1R3UA 3AKCA 1OILA 1KI8A 2ZFUA 1DQPA 2RHOA 2BONA 4OBBA 1RYBA 1WAMA 1W93A 1TECE 1ID8A 3Q6NA 5E3HA 1HT2E 4RX1A 2A5DA 2Q4DA 1Y9EA 4Q4HA 4LVOA 3QH4A 2CWDA 3OAAA 4Q7KA 4D8WA 3S27A 4LXIA 2HDNB 1EFVA 1KH3A 4HLUC 2EKBA 4XR9A 4D8VA 4QUAA 2W2VA 4M8LA 4DBLC 4ZHQA 1TF2A 1U3DA 2AL7A 1Q83A 2OECA 2VPPA 3MRVA 3NHRA 3PNYA 4FOOA 1ZG3A 1TNDA 4IKOA 2OCDA 2X13A 3KSZO 3T3PB 1BGVA 1D9XA 2I4LA 1ONBA 5CD9A 4CRWB 3WFZA 1KTVA 3G0BA 5AJXA 4CVNA 4Q4CA 4YRFA 1SUFA 4LVNA 4OLFA 3FROA 5FWYB 1CQZA 2VNAA 3BA1A 4P1ZA 4U2GA 1BWRA 3UXYA 1XNHA 4RF4A 3QPAA 4BJ5A 3X2EA 2VEOA 3O31A 2BF7A 3JASA 4J0DA 6LDHA 2E4XA 2IDZA 1AGXA 2OCKA 4G2NA 4TZ0A 3C5WP 1D4FA 4YMWA 4J9UE 3DEAA 3OURA 2JLWA 4NYJR 4YB8A 1CLUA 1WA5A 4GEKA 5FR2A 4D25A 2H1SA 1VMIA 2ILTA 3C45A 4DCTA 4F4JA 3IE1A 4LRXA 2FZ4A 1OI7A 4CFYA 2D0PB 3L0BA 2HEGA 2QSJA 2JAXA 4L5CA 3BF8A 3EUWA 4YCLA 3OHPA 3E35A 1CF9A 1F6BA 2H5EA 3SSMA 3EA4A 2IS4A 1U8XX 1UQRA 2TMGA 3TB4A 1O58A 3IBCA 5T7BA 3GAAA 3NETA 2DB3A 3QW4B 1DIRA 3ACBA 3L7IA 3NAZA 3H9JA 3AHCA 3GDFA 3OLCX 1Y3FE 3TS1A 4B0OA 3UH1A 5C5IA 3B60A 5TQ0B 2Z56A 5EWLB 1POWA 2N3ZA 3M6AA 1VIVA 2O8EA 3V32A 5JD3A 2DECA 3ZJYA 3C3AA 4PF1A 4I5GA 3QEOA 5IAJA 3C43A 1T3HA 3E4CA 5CPFA 2QMUA 2GEKA 2VH1A 3BFKA 3KZ1E 5K0GA 2VRCA 3KQVA 4OQXA 2YWGA 3OJ0A 5TXGA 1YBVA 2ICAA 2ZR9A 4AKHA 1A9YA 1PTJA 1ZXLA 2QUJA 3LLVA 1SJ9A 2Z6VA 4HXYA 3NWJA 4JJIA 3Q8LA 1WSBA 4UEWA 2J3IA 3CLUD 4MI9A 4Y2GA 3VH4A 1IN5A 3VO2A 2HWYA 2OG2A 1D6NA 4WFKA 1R74A 3TRHA 4QJBA 3B9BA 4EGQA 1NNSA 1RFGE 1RM3A 2JB9A 4DDMA 2BEJA 2W2MA 2HCBA 2JCXA 3F9CA 3ZWBA 7REQA 4DMKA 2WWYA 2WF5A 3DLBA 1JAXA 5TX7A 4NAUA 3TSCA 3WQQA 1KRWA 1QUEA 5EJFA 4N5IX 4BJHB 3DV0B 5BN4A 4Y7DA 3G8BA 3R3HA 4M1KA 2PBFA 3D0KA 2OUIA 2HRDA 3L02A 4I1RA 3LWBA 3KWLA 5A71A 3QIAA 3AX6A 1GNSA 3NTOA 2YC2C 1DEHA 2QG6A 3AU8A 4CM6A 4RMNA 4X60A 4RVDA 1C1XA 3UATA 2O2SA 4Y1RA 1XC7A 1MC4A 4RVOA 1VYVA 4TS9A 3VC7A 1MQSA 4JYCA 1Z82A 1CCWA 2J3KA 2WFAA 3UKDA 4HQNA 2C82A 1MOQA 3AESA 5NLLA 4AZ0B 3L4JA 3TL2A 3LF2A 2CVOA 4GYYA 2EDCA 1YR8A 1FJXA 1RLUA 3O3CA 3GDWA 2XMCA 2JANA 2QRPA 3ETJA 1A96A 2ZSHA 3MA0A 4LW8A 4UE3S 3KLMX 2J5BA 4BGVA 3PDIB 2FFRA 1X9GA 1HETA 3IIIA 3ODPA 4JT2A 1TRKA 2POQX 4OP2A 3JQDA 3DOHA 2G6BA 3NAGA 3OPVA 5HJEA 3P4YA 5ALRA 1QQTA 1GTL1 4HQ6A 2EBWA 5DW0A 5JDIC 1JSLA 3ZU3A 5ICSA 3ZQJA 2GAFA 4MUBA 2DY1A 3IBGA 4FBLA 3CONA 5JAOA 2VPZA 1U6KA 4EENA 2FPGB 3NHKA 1AVTA 3BPSA 4QA9A 3K0KA 3SVZA 2ZUSA 4OHOA 5COBA 1GTZA 2QJOA 4IJQA 1UOQA 4K9NA 4RV4A 5BV1A 2IRWA 2A1TR 3II6X 3NM6B 1DFHA 3H2GA 1XROA 3W5IA 3MWYW 1U1EA 2AG1A 2NG1A 3AT1A 1OVMA 4GQAA 2FVXA 1UADA 2QRKA 3ANNA 1CQIA 1RP7A 1Z4OA 4NG5A 1E92A 1Z7BA 2PMFA 2YR0A 3KAJA 1J00A 4K1LA 5JAPA 1FW6A 2AJ8A 3EXG2 4GMGA 3LYAA 1U8FO 2UUCB 3RU9A 1SVLA 1RAHA 4I8IA 5IJWA 2J0EA 3GJZA 3NB0A 1G1MA 3ZHTA 3PNQA 1F2TA 1GDHA 2I2BA 3AL0C 1HDYA 1LX6A 4R2MA 1E4EA 1KIAA 1QK3A 3D0RA 4UTOA 3REGA 5K3OA 1Q0RA 2W2KA 3QKWA 4V24A 4G07A 4BBJA 4OB7A 4BUJA 1HDEA 5ETJA 1W29A 5IYZB 3A05A 5KNLA 4FZJA 1JIQA 1DQYA 3DP7A 4JBLA 4YJ3B 3HVJA 1GQFA 3R5KA 1RHMA 1OKKD 4CKBB 1Q7BA 4FS8A 1LJLA 2YY7A 3W8DA 2WJ3A 5B58T 2NO6A 3GO4A 4NDNE 3ILSA 2D74A 1TJNA 2IF2A 2WUDA 2VKQA 4JJZA 2A1IA 2ZE6A 4RHYA 5HS4A 3LNCA 3PLRA 4CM9A 3TM5A 2BY4A 1PGQA 4R0NA 3T9AA 1SNYA 4Y2PA 2P91A 2ENUA 1IU9A 3BG5A 1RRGA 3TTWA 2XMPA 1JR3A 3P5SA 2QUHA 3NANA 1S1MA 4XCVA 5IVIA 1RQPA 3IIKA 4RPGA 2QTBA 2FP4B 3R7FA 3U81A 3VV2A 1RCUA 1DKRA 1W5TA 2JFOA 4IIHA 4DLKA 2CWWA 2Q1WA 4OAPA 1W19A 3W4JA 2PV7A 2R6DA 3A6EA 3ZWOA 1GKYA 4LV6A 3SS9X 5IFLA 1NONA 5SICE 4B3MB 2ZBRA 3A3YA 3D4LA 3WK8A 4MJXA 2FW7A 5AQ1A 5DIZA 1I30A 4YQEA 2BWJA 3HKDB 4M60A 3NHPA 3LX6A 3K9WA 1EG2A 4ICIA 2DHRA 3C3EA 1SZCA 1PTJC 1ZEMA 2QTGA 1OREA 4FN5A 1EJ6A 2ZSDA 4NP6A 4P81A 1UMDA 2H0RA 5E9WA 2KHZA 1JFSA 5C3MA 1N0UA 4GU5A 3C5VA 1LW7A 2J5QA 3AOEC 3MGAA 1A3CA 2YV4A 3EHDA 4RANA 4YCBA 3OT1B 1IHOA 1GRQA 4KQFA 5IKPA 1U2SA 1PJ3A 1C8KA 1Z4JA 1AD2A 3CNNA 3HYCA 3DMTC 4NOMA 1U9YA 1UKVY 1ZU5A 4N6NA 4P7FA 4UULA 4Q1CA 1NQTA 4Q3NA 1Y6RA 4R1OA 2BHNA 5D3QA 2PHZA 3VR6H 3L8MA 1J2JA 5GM1A 2GK6A 2BEWA 3MBKA 1QMGA 2V5VA 4WVLA 1LF5A 1L4FA 2R8PA 3HP7A 2YZMA 3HPRA 2EZUA 3CGGA 5D87A 3RAGA 4AO6A 2CXOA 2UZ1A 4BY9E 4ZZ2A 5FUQA 5JARA 1B2RA 3QENA 4RVGA 3ROEA 2BMJA 2IDKA 4JT9A 2JFGA 2ZK7A 1A9RA 3L40A 3OZUA 1KXJA 2DCUA 2IYFA 2BFDB 2L2QA 5ESXA 4V0QA 3TJRA 3TFOA 1WQ4A 2XUDA 3K09C 1Z2EA 2BGKA 3M1AA 1E8MA 4WZ6A 3TQHA 1IIBA 2E48A 2GZRA 4I55B 4UEKA 1J0AA 3NAMA 4DHWA 1JKIA 2VDVE 2IIVA 3GOQA 2QMZA 2Y1GA 1IVYA 2JGDA 1J24A 1YRBA 4MP6A 1H2RS 1E9SA 3I1IA 4EQZA 2Z1MA 2CHQA 3ZDXB 5HTOA 3IRUA 1SC9A 1YOVA 1S2GA 2VDRB 3LP6A 1CFZA 1X7XA 1F8GA 3FIUA 3L7DA 3PJFA 4V02A 5J58A 4KR6A 1XRJA 4NYMQ 1YQXA 2KBFA 1KEUA 2XI4A 4ARAA 1K7EB 1Q1EA 2Z9CA 2P78A 4PZ9A 1ZXBA 3UGQA 2PLFA 1OFUX 4LSZA 4U8HA 2JAWA 3T4XA 5AKYA 4BQPA 4OOFA 2Z2ZA 4EI8A 4CLOB 2B94A 4L27A 5DGHA 1JBQA 3QLEA 4G1BA 1RC0A 4Y2JA 1EWVA 1E77A 1MJNA 1GGJA 5FLEX 3NDBB 4ENWA 3RAEC 1GQOA 1IG0A 2C2KA 4L4ZA 4A2PA 3LLUA 1Q20A 3NZEA 4IXTA 5CVTA 2YXBA 3LUJA 3U3RA 4U02A 3FYHA 4N6GA 4DPLA 3AERA 5DXJA 4MWSA 1ODKA 4LXGA 4LKOA 5JSZB 5LOVA 1OH5A 4QOFA 3PQ7A 3ISJA 4TWZA 2NUTB 4XIGS 4EHFA 4RTLA 2JIQA 3ZHVA 5HVNA 5LZ9A 4TTRA 3N53A 2IX9A 1LRKA 5AW5A 4MQFB 3WLHA 4N4AA 1XDZA 1J8YF 3U61B 1X94A 4L4UA 1QDLB 1CZNA 10MHA 2DUNA 3QKTA 1XMIA 1DIGA 1NVWQ 2QZ4A 3ZWQA 4IWYA 3KQKA 1QHNA 4A36A 1MF7A 1V3QE 2ZIWB 4O5OA 4QULA 5D86A 1E69A 5KWVA 3CNBA 2EYQA 3HN2A 1IBCA 4L5JA 3CCFA 5B53A 5EC8A 3L0DA 5BN5B 1NI4A 4XLLA 2O8BB 2YVLA 4YGYA 3EHEA 4Z1OA 2ZYTX 1DWOA 1XQ1A 2AFHE 1I4DD 2FKNA 2QY6A 4CDMA 2GM4A 4Y2TA 3PNLA 3MRSA 3QPUA 2NZYA 5PNTA 2P9JA 4MYSA 4L4RA 4PZAA 3RG8A 3RAPR 1I01A 1QYDA 2PD3A 3Q40A 4LEIA 1J5PA 4AP9A 1AKEA 1DAGA 5KC8A 1AOXA 3NUZA 5BMVB 2DLCX 3H75A 5BN3A 3QJGA 1TMKA 4E5SA 2Q5IA 4Q15A 2NVOA 1A9XA 3K71B 4X41A 2CNOA 4RO0A 1MT0A 1QFMA 2C57A 2ODWA 1OFIA 2VQSA 3GEEA 3L7OA 5LQNA 4O2RA 2Q4RA 3AV0B 2OFOA 2GNOA 4KNWA 4GPIB 1MDBA 2FOIA 5JI2E 5CH8A 1SG9A 3IERA 3UFXB 5CVJA 1ZHHA 1XEAA 1CJUC 1E60A 3K0FA 2ZRHA 4EF5A 1Y5LA 1PK8A 2NXNA 4Z9FA 4YRSA 3DV9A 3V4RA 3JD4A 2JLQA 2Q8NA 3P2YA 2Z2JA 2HQ1A 2GXSA 3IELA 4JLJA 4YI3A 5ALLA 3DE7X 3N59A 3O3NB 5GJBA 3ON5A 3VSBA 2ZAIA 1ZUHA 2FFHA 3AINA 1QFYA 2GVZC 2P2DA 1YGYA 3V7YA 1Q0LA 4FZRA 2AJDA 5I7FA 2CL6X 4V0RA 4Z49A 4D6XA 2XVYA 4ND3A 2BJVA 2H4WA 2JHPA 4I9HA 4RL6A 1X9IA 3U6BA 3C5EA 3NRCA 1CZRA 2GYWA 5ADVA 5A1TA 2WJIA 4AY3A 4JNCA 5EHZA 1XNJA 3NKLA 2CXHA 2MYUA 4HWPA 1CETA 2EQAA 1MG5A 2XQJA 3A4IA 3IOEA 4JP1A 4NS4A 3VR5D 4BLTA 4HWOA 5JS6A 3IEMA 3T95A 4J16A 3LUDA 5DTRA 4JXJA 1SC3A 2C94A 3QITA 2G70A 1QVZA 2Q4BA 3RS9A 1Z83A 4BVJA 3GPLA 3UWOA 2D54A 3DNPA 4KQMA 1UZUA 3A6DA 2JZCA 3H87A 2GWRA 1ZESA 3KPYA 2AKYA 1FTQA 1WUIS 3BQNB 3GCGA 4ZP1A 1UAYA 1C4XA 3TLKA 4DF3A 4R9VA 3D6HA 5DYTA 3OEEA 3ZJ4A 2GF0A 1V3TA 3LY7A 2NGRA 1U5AA 3OKFA 1GILA 1R0CA 4PG6A 1TZJA 4XUEA 1B76A 2A2ZA 3DYIA 2HDOA 3IB3A 2B3TA 4OXKA 1K4KA 2ECFA 3NCTA 2BFFB 3LNTA 4L08A 4ZALA 2UZ4A 1KY4A 2VJQA 1D2MA 1XZPA 3OKAA 1WCIA 3H5TA 5J4LA 4LQLA 4WOBA 1ZVJA 4Q39A 1XWWA 1WXXA 3CF6R 4O4IA 3SDZA 2A14A 3GLFA 3T7SA 4DL9A 1PT8A 3CUKA 4MQUA 4OBXA 1G8PA 3O91A 4RVNA 5AIAA 4ZPJA 3RNOA 4FLFA 4YRJA 5CBKA 1EUQA 2XXAB 5AVKA 2X7JA 4CM8B 4NMLA 3I1JA 3E7PA 3WL5A 1KZYC 5JXWA 1TOAA 5HFAA 4L8VA 3BIFA 3TPFA 1L5WA 4TKZA 4C4XA 3TTVA 2FEKA 2R8OA 4KUEA 1EDZA 5MHTA 5EQDA 3G9UA 4QDXA 4F2HA 5BUSA 2IEBA 2XUKA 1B7GO 1E1QD 4P5EA 1C9EA 5KU7A 1X86B 3L8ZA 1MAVA 3D1VA 4B3XA 4YAEA 2D1RA 5BVHB 1QHEA 4OI4A 521PA 1D6JA 3EODA 4JASB 4M2LA 1NW6A 3HU2A 4H18A 2DPXA 1H3EA 4LBYA 4AL4A 2YX1A 1P6UA 2HZBA 1L4NA 5CXQA 1LDYA 5B7NA 4ZT5A 4MRMB 4BWGA 2CUNA 3LDFA 4OFZA 3OLQA 3NASA 5LBUA 2ODQA 3X0DA 4QYMA 4CNQA 3Q2KA 4CMKA 3LDAA 1HYQA 5H59A 2VP9A 3O82A 4O29A 2JLAA 4YJFA 2PX0A 3UC5A 3D4PA 4FFMA 3A2MA 3JY6A 4FXOA 3KKQA 1M7HA 5F52A 3K0AA 4MQ5A 5CP8A 1M67A 2XNSA 2YINC 3LPLA 3ZV6A 1YVDA 1ZR2A 2VT6A 2VJDA 1YZGA 3GLSA 2OCYC 3EGDB 4D3SA 2CXRA 1T1RA 1DV2A 4B44A 3PQEA 1Q1GA 3AJ9A 2CCGA 4XM1A 4DR4B 4HQ0A 3U7QA 1II0A 1VE6A 3WL4A 4INZA 5LJLA 5ECYA 1ZJWA 1P9RA 2OR3A 2J6BA 3N8HA 3Q7PA 3PU6A 2BE7A 3BFJA 3DH0A 2OBNA 2H2IA 4YAJA 4I50F 1RPNA 2XSZD 3PUIA 4LJAA 3ILXA 4AY5A 2BTQB 4EABA 1IHUA 1E4VA 1OPXA 1ZRMA 3D8NA 4FP9A 4NX2A 5KAPA 3P97A 5IXYA 3UGJA 3C7CB 1WMEA 3LSYA 3TUIC 1XEWY 2FN8A 4AO7A 4GX2A 1M5TA 3WE7A 5FTJA 3WA6A 4D4HA 1IHXA 1KKMA 3MUOA 1MNQA 1SULA 1C14A 2P75A 3H2YA 2R0QC 2NW6A 1S2DA 1XQYA 2VH2A 4H1UA 4MWGA 4UVGA 5BSHA 1OLXB 2PKCA 1T2FA 3EVCA 2FZKA 4JMLA 2PIDA 1AXEA 1D04A 1EG7A 4HZGA 2FEWB 1TVEA 4RMHA 1AKYA 4BB5A 4C14A 4FB4A 1FJGB 3KE9A 1QC5A 2I71A 4N5NA 2VP4A 3M3DA 3BJMA 3FSGA 3Q7RA 4BO9A 5JJCA 1YZHA 1SPXA 4NZNA 2XCRB 4QT0A 1SEPA 1CEXA 3C7KA 4JP5A 3LCCA 3COVA 5DGIA 3CLSC 4LHSA 1GZSA 4EPRA 1NC3A 4F9EA 4OXQA 2P40A 3LBFA 3DPIA 4JBNA 1O54A 4CQMB 4UOQA 4HL6A 3R5SA 3A3NA 5IBQA 2XTNA 4C7OA 4E14A 3CFYA 2Q7OE 2XIQA 2JLXA 1E2JA 3T8YA 1L7VC 4PYLA 4HXEB 1E8NA 4G6ZA 4D9HA 2WSLA 4YCJA 3DS8A 3WTBA 4HVLA 5JWOA 1IPHA 1CTQA 2ZRIA 4UQOA 2PV0A 3DZJA 1V25A 3NNDA 5ALYA 1CJVC 2IF0A 2WABA 2RARA 3LG2A 4JUCA 1RACA 4G5GA 4J1NA 4X64B 4DXAA 1X9HA 1D09A 1VLJA 3HJRA 2VDUE 4U2CA 3VNQA 5J40A 2D2XA 3PUYA 1R64A 3IQXA 2X0DA 4JGBA 5A02A 5DFAA 4ZU6X 1IXRC 1TK3A 4KQ2A 3R7AA 3QYPA 5CDTA 1XVLA 4WFIA 4FMBB 2B6HA 4ARSA 4E6PA 2PWAA 3ETCA 4J4HA 2NU6B 3LS2A 2Y93A 5AOAA 3PD0A 2HXYA 5EESA 3K5WA 4LZOA 5EQTA 2BFCA 1D8TA 1I9GA 2AOUB 3MLAA 3MM4A 4MVJD 5CHYA 4ADSG 2ZSFA 5CM9C 2N0SA 4FQ8A 3O2SB 1JHVA 1QE0A 3AHHA 2D1TA 3O4IA 4HS4A 5DGXA 4CF3A 5L3VA 2QRNA 2H4JA 3KELA 1JECA 4KFCA 2HLHA 3RYCB 1WPXA 2I9PA 4F04A 3E22A 4U9UA 4MH0R 3REOA 5C7IO 4PW0A 3CSUA 4CV3A 1FVFA 1LBTA 4DIUA 1MKYA 1T5IA 4PSVA 4Q37A 5HKKD 5BR4A 1OI3A 4HR7A 3UF0A 1BN7A 1LLUA 3ETLA 4L8GA 1QIMA 4ZI7A 4RD3A 4PV7A 3KBBA 1DCKA 4OM8A 2FYTA 2OZLB 1P2VA 1Y1QA 3OAAD 3AFHA 3T3DA 3TZLA 3SLRA 1QG4A 2FAXA 3REFA 1GP2A 1G2OA 3IBSA 4BKUA 1Z63A 2R2GA 2XUAA 5TPZD 2MR6A 1IL0A 2H16A 2D7JA 3B5EA 3IUEA 2BC9A 3KJXA 2X77A 2A5LA 1CUUA 3QMWA 3FCUB 4DLBA 5K6AA 4YRKA 1E3MA 5ENZA 5IEJA 3OT5A 2VF4X 1S5PA 1NULA 4B6SA 5GZ3A 5J4HA 3BWEA 3UMYA 4OTZA 4RAQA 4FMCF 3OX4A 1ZIPA 3SZMA 5CUQA 4F46A 2BH2A 1KBQA 2ZR0A 3U09A 1JTEA 4YMSA 1S8NA 3DM9B 5CLJA 1OBCA 3G9ZA 1SBNE 4G26A 4EI2A 2C58A 1L7OA 1GJRA 4HWSA 1T10A 1DRJA 2H85A 4NPHA 2HMSA 4S05A 4PYKA 3TMYA 1Y7LA 1QVRA 2NXEA 3RQSA 2FPSA 4BVLA 1DC7A 2EEPA 4O4JB 3KWMA 4FINA 2QD5A 4QTUB 5NULA 2PUDA 2Z2IA 4N39A 2P5SA 4A6PA 2WVHA 1VJGA 5J1TB 5AHXA 1AMUA 3E81A 3Q1KA 1W46A 4NBUA 3ND8A 2EFGA 3P27A 2OPHA 4IL5A 3RHZA 3BWDD 1BG6A 2YWRA 3BD6A 4EELA 1E6WA 4QDZA 2VQ6A 1FMJA 2J4DA 5GPBA 1EYZA 1RC1A 1SUIA 1XNGA 2I4TA 5AO9A 1DPGA 2D62A 2JW5A 5AKZA 2OAGA 1JHUA 5KOHB 1HNXB 3BERA 3ORYA 4PLPA 2YV5A 2MINB 1T8YA 4W8HA 1Y7HA 3KD3A 3S2IA 1T5HX 4CF6A 1TRHA 3I2YX 3NDRA 5T67A 1RHJA 4ZD6A 3R3UA 1JSZA 2ZUCA 2YFHA 3N39C 5IKOA 3IAHA 1MIHA 1N5JA 3LT1A 4R16A 4GGOA 4RLHA 4TMKA 5D7BA 1SC6A 3HEMA 2HJSA 5IMSA 1H4QA 3CX7A 3T15A 4MUNA 1KOJA 4Z99A 2VRCD 3GLRA 2OK7A 2P69A 4EFKA 3CVJA 5HMMA 4N41A 1YH3A 5HFNA 2OLKA 2Q07A 1H2EA 2KM1A 2DFTA 4PRYA 3TNLA 4M0EA 2HCRA 3HO8A 1SQFA 1U5BB 2OB1A 4KBGA 4D9FA 3WAJA 2RD2A 3K05A 4QPJC 3KXPA 1IAQA 5FUBA 2IP1A 1N33B 1EVEA 2JD1A 5LIRA 1MB9A 5C8YA 3EXEA 3HL4A 3LT0A 4WFJA 1JLLB 4DR2B 5DNUA 3SHOA 2JCYA 5FOWA 1K27A 2VBCA 5JSHA 2QUBA 1NUHA 1PK7A 2F1JA 4BXOB 4PVDA 1NM5A 2L42A 3E27A 4J6FA 1YULA 1E59A 1ZC4A 2ARKA 1CIJA 1DRVA 3DKKA 2C1ZA 1VXRA 3HGMA 3QHQA 4FPXA 5D5QA 2RKWA 4ZVUA 1Y3BE 3OX3A 5KNBA 3AYZB 2Y2VA 3PFIA 2FG5A 3AZOA 2ZGVA 4M88A 3WV4A 5HPYB 2B3DA 4RACA 5HIMA 3IESA 5CLFA 3L4KA 4NENB 1Q0HA 4U00A 2OP1A 2EKZA 2VO1A 3FGNA 3JQEA 5ALNA 4EW6A 3BXFA 4PR0A 2GJKA 4RMJA 5EHQA 3WB2A 4DM4A 4OU4A 3L6EA 5BORA 4BKOA 2I7TA 4KN5A 5YASA 5JVDF 3VU8A 1ISHA 3AKDA 4N76A 2N75A 5DX1A 2QVYX 4CDNA 2ZLBA 1A9TA 1EB9A 1JNYA 4TXNA 4GBGA 3V34A 5BPFA 3TQSA 3O83A 5FO0A 1GAEO 4M3NA 1EDBA 3D0OA 4IIFA 3S4YA 1A8IA 2VF2A 3OEHD 2AW5A 4MRSA 3WYAA 1FCJA 2ZUDA 4YS6A 2VOJA 3WIEA 2JK0A 2PTHA 2Q41A 4GOMD 4L75A 1AKNA 4MXDA 3SIPA 2AEEA 1ZNQO 3DUFA 2I6TA 2RHTA 2BYTA 3AY7A 1N8SA 4GRAA 1A76A 3JZFA 3MWEB 2IUYA 3T7KA 2DJIA 4YPOA 5AK0A 5BWNA 4RKQA 2BGIA 3EFBA 1A98A 3WFJA 2P6NA 4E6EA 2HI0A 2OHXA 3K31A 3RJ9A 4EA6A 1YA6A 3QBVA 1U2DA 5K6AC 1Q3HA 3DD1A 4BO7A 1G98A 3NVAA 3AEUB 3ZTYA 2ZRDA 4DEVA 4Y9RA 4TTAA 1I3OA 2FSFA 1M6WA 2JBAA 3C87A 3KEOA 4RGQA 4ROTA 2IXEA 4DWVA 3IAEA 1PV4A 1C4KA 4GMXA 3NP9A 1JI0A 1UJ4A 3JD1A 3BMNB 4FW9A 3A37A 1ST2A 4C3UA 2IKSA 5JXGA 3PIIA 2EBFX 5H82A 4ZEWA 3PEWA 5CM2Z 1QGUB 5FYQA 4RZQA 5FF9A 4MX8A 1M1YE 1T13A 3GP5A 1MO5A 4YMUA 2WAMA 4TV8B 3KSUA 2YWEA 2JHCA 5ERGB 1QP4A 1E2KA 5DGCA 2K6GA 1OYWA 3FYSA 3S1AB 3TM4A 1BXZA 3DYBA 5T4EA 4MQBA 5C7LO 3F6CA 1S2MA 2JGFA 2X0NA 4EUNA 4Z1MA 1R0WA 4CR6A 1TDJA 4HVCA 5M2QA 1GTRA 3ZDBA 1VDZA 1GG2A 1OGJA 2OHGA 1CRZA 3WHPA 1EAMA 5AICA 4V0ME 4CM9D 4MMZB 4F1KA 3CUEF 3SHFA 1A2BA 1E5XA 4EI7A 1NWHA 2CSUA 4IDNA 1ZDMA 3BYZA 3L04A 1II8B 1NRXA 1JR3D 3IPRA 1R6VA 2VPWA 2ZM5A 1PZHA 3OOYA 4ZQIA 5EZYA 4DWWA 4E2XA 1H23A 4DV5B 1BW9A 4F6LA 1M7GA 1TAHA 1VIMA 4ER3A 3AR6A 4IOKA 2FA9A 2R87A 1ODJA 4CU2A 1OWLA 2VCEA 3FNFA 4RESA 2ST1A 4R0MA 2J6IA 3C3BA 4L76A 4QUJA 4LJRA 4WHMA 5B3KA 1GNTA 2V97A 4RH1A 1JH8A 1CEQA 2ZYIA 1Z5VA 2G5PA 3MLEA 3QM1A 2H1LA 4NYMR 3EQ7A 4URYR 5CAEB 2R6JA 4C7BA 5KWJA 2J9ZB 3PIDA 4N5DA 5TQ2B 4M1TA 3WMXA 1QDUA 3OP1A 4DR1B 2UVPA 2FCAA 3GWGA 2QX9A 3FDIA 3LVQE 4NE7A 2GBLC 3COWA 4ZKEA 2V0NA 4ZZ0A 2ZIZA 3AXTA 4HZUB 3HNOA 1R0RE 2W58A 3HWX1 1B8UA 4R84A 1D4OA 1LV8A 2RAVA 3VI4B 4TKMA 4A0FA 2YWJA 1DAFA 3DNMA 2CXUA 3LO8A 1W4LA 5K9ZA 4L6CA 5BY2A 1REQA 1E2NA 1F14A 3WXBA 1JJAA 2VPIA 5FA5A 4BLOA 2FZLA 3VSAA 1JZQA 2MSDB 1HLFA 3CH7A 4IFEA 3WLLA 4R71A 2H00A 1FC0A 2PMDA 3JQAB 3H1EA 3KX2A 4FYJA 3IE2A 3WLMA 4DNFA 1YZQA 3R7NA 4PAWA 3P9XA 1CW2B 4YRTA 5U1PA 4QDUA 2EV9A 4JLOA 1HDCA 3B6JA 5IWAB 2D1YA 1PJ4A 1AQIA 2XKKA 2DTXA 2H29A 4KAXA 3ZUPA 2IIBA 2P3QA 5KQGA 3EWIA 3H5WA 2IGBA 4H7HA 1DWPA 1JQEA 2COKA 3GCDA 3OWHA 5FNVA 1A9OA 2NU7A 4RZXA 1E96A 4I6EA 4KH0A 2BDEA 4BMSA 3NOVA 1PBTA 2MSWA 5IPFA 2Q29A 1ZD9A 2P7IA 5E4TA 4JN6B 1I0LA 1A82A 5CNJA 2VQDA 2ZBPA 3WYFA 1VG8A 1P3JA 2JH9A 2YJ3A 3GT7A 5JPDA 3MWFA 2VHTA 3PYMA 1N2CE 1U4SA 5ELLA 4MV7A 4BNKA 2BM1A 2X7XA 5BWBA 1T43A 4O33A 3VVCA 8OHMA 1KZHA 3D4IA 3B38A 1KJIA 2O2GA 4G8JA 1QP7A 1G21E 2GK3A 4M0DA 4MR7B 4ZEOA 1RRFA 2IV7A 2YVQA 1E62A 4MW5A 3TKLA 3GH1A 3KZCA 3UTCA 3NHBA 4KMSA 4HVTA 1JDBB 3WNCA 3QYJA 2YW2A 1NXXA 4IPTA 3VNUA 2WSBA 4PYQA 4UNNA 1M54A 4F6CA 3H5NA 4IQ4A 4RD6A 2AXQA 3FLEA 5BSRA 2B9EA 4YCDA 4BWFB 3NHAA 1VSQA 1PDWA 2JFYA 4O2BA 4DC9A 5E9QA 4EHAA 1WP9A 3AP2A 2AYYA 3HA7A 1JEYA 2NSYA 2DX7A 4KR2A 2GI4A 1FLVA 2RK4A 5IDYA 3PE4A 4N0EA 3TQCA 3K5IA 3JVUA 3LQYA 4OJKA 1DMRA 4H9GA 1C3OA 4FOPA 3W5SA 1E7WA 4CHTA 4F9FA 1NVDA 1U94A 2HC9A 2X40A 3AM5A 4B4KA 1F8XA 3G7NA 1MU0A 3ZGOA 4EGCB 4ZYYA 3EX7C 5K6TA 3FSJX 1H8HA 1YA8A 5F3WB 1IHPA 2ANCA 4GNRA 4DCPA 1LRJA 1MB2A 3LCJA 2EOAA 2J32A 4NICA 3FNGA 3GELA 1DEAA 1B4DA 3KAKA 1SD1A 5D3KA 4BZWA 4CPDA 3OC6A 3E84A 5ER6A 4EB0A 4DV1B 5EZSA 1IEQA 2L17A 4FE4A 4WOPA 5EG5A 3W9YA 2VJCA 2WOJA 4IEEA 3PJRA 4Y2XA 2WUWE 4MYRA 1H2FA 3ZU4A 1R9MA 1U0TA 4X1YA 3LKVA 4JT4A 4UASA 1ECGA 4U7PB 3BS4A 4BQQA 2IH5A 4DJAA 1N2IA 3H99A 1RQNA 2J30A 2QX8A 5EPUA 3UVEA 3KQUA 1YZNA 4Q05A 1GPBA 8ATCA 3BJIC 2WHXA 3HN7A 2FPPB 1ZM7A 5LQDA 3WICA 3E5NA 1C9YA 1YGPA 3LXXA 5AUQA 1XHEA 3HR4A 3KKLA 4LRWA 2R00A 4MWCA 4NOJA 3KEMA 4PCLA 1NG9A 1XNRB 4RS3A 2MYTA 4R3UC 4DG5A 3ZTWA 4IKPA 1QBGA 1JQBA 2YQZA 3KQQA 5LA6B 3AEXA 2QGZA 3F3KA 3VSEA 2QEQA 4TS4A 5AW2A 4OKSA 4C7VA 1JDZA 1Z5ZA 1JYFA 3OM9A 3IQGX 4JZKA 1Z2OX 4LTMA 1HQDA 1M6YA 3TZEA 4RWZA 4DJ5X 3B89A 4P4GA 4YRPA 4PYIA 1EX1A 3RCBA 3QEMA 4PN7A 3TYXA 5FOSA 3OPQA 4UHDA 2ISQA 1HM5A 3BF7A 3ZE8A 2WYOA 3L0SA 5K3FA 3CRW1 1KMNA 4WACA 1Z7EA 5D3MB 4LBZA 2IK8A 4N0MA 1RS0A 3E1SA 3QMPA 4ZT4A 5BSUA 2VAWA 4L28A 1KMQA 1LQ2A 5DP2A 5JSFA 1IBSA 3JQ7A 1O9HA 3KJGA 4LCEA 4YYZA 4P3OA 1VTKA 2QLNA 2LVBA 2X1VA 4RIGA 1XX6A 5FBHA 4YN3A 3U62A 3PQCA 2XEXA 4DDVA 4HNGA 3G0IA 3RG2A 4C29A 1G63A 4MKRA 4XVHA 2YJ5A 3MGGA 2ZYAA 5FL7D 3F5FA 4G0ZA 3KPUA 3AEZA 4XOUA 4ACAA 2QIPA 1EKXA 4GZ5A 4DLZA 4M76B 4TWIA 4S04A 3MINB 1FRVA 4BQRA 2AEFA 1YCHA 4AX4A 1JFLA 2AYXA 5DTIA 3T5MA 4A0RA 1QGAA 4CMEA 3AUXA 2WQZA 1YKSA 1EXMA 4R7GA 4DM7A 1DQRA 3DE0X 4YT8A 3ZE1B 4R4JA 3P96A 2I29A 1A69A 3FFAA 4ZDKA 2YW9A 4OKNA 3C2QA 1VIYA 3AKYA 2CLOB 2QSUA 2X41A 2KJQA 3OEED 3KE8A 3RRYA 5KYWA 2WHPB 4PHTA 1VBNA 4MPTA 2KYRA 3RRFA 2IA5A 3A9VA 4HBGA 2QMHA 2BKXA 3EGXB 3PTLA 1QR2A 3RC7A 4XWGA 2QGNA 4CMAA 1W35A 3GXOA 1RC8A 1QGDA 2PN1A 4HRXA 2I2CA 5DNVA 1DUSA 1NJ2A 1ULTA 3UMCA 3K0CC 1UMBB 3LV8A 1Y7IA 4I2NA 1H5NA 3TGPA 5I7EA 2KB0A 2PKQO 1OAAA 4LGCA 5TPWB 2Q0QA 1XEWX 4R98A 4ZIRA 2CY0A 3BL5A 1NQOA 2Z58A 4I4IA 1AM4D 2H5IA 4KLZA 3DEZA 1APBA 4CTKA 5TMBA 1G2IA 3OD5A 4PC1A 4OV6B 4QGAA 4JR2A 4DDTA 4JJ7A 1ZD1A 1N7IA 1R4MA 1HTTA 1XD9A 2W6JD 3DFIA 1YAJA 2R6HA 3GQBA 4MV3A 1EBFA 1G5PA 5HZKA 2VT7A 4RD2A 4R1PA 1RNLA 3LT2A 2XECA 4MVJG 4C0KA 3Q0TA 4RD4A 2HSWA 5HZGA 1WVGA 1TT5A 3FCCA 1PIWA 5T41A 1Y1TA 4ZVQA 1LTKA 3UENA 4QG3A 2A4MA 4DLWA 1KR2A 3KU4A 1ZNWA 3B3FA 4KGDA 1J33A 4ND8B 2W4QA 2FE4A 3LQFA 1ZGGA 2HQSA 4OUDA 2QVGA 1U28C 3FY4A 5F2OA 3TK1A 3WYBA 4ZK2A 1SWWA 3RSSA 4ZYLA 5JZMA 4YRDA 1ZJYA 2Y27A 3UWPA 1OXVA 2XQIA 5A4AA 3D4BA 1XD2A 2DU8A 1CY7A 3H4TA 4HYTA 5IVDA 3KVOA 3TX2A 3VSDA 4TWRA 3YASA 2ROQA 1FRNA 5HHTA 4ZVMA 2QM0A 5DW3A 3T7EA 3EQ6A 2YWDA 2FPMA 3LFHA 1WHTA 4UXIA 1YI1A 4DEYA 5JQGB 2YIVX 1W48A 9MHTA 3ZV4A 3C4QA 3SDSA 4OK3A 1YR7A 3VH1A 4FKMA 1N9KA 3LECA 2Z30A 2XD4A 1EFPA 1W9HA 1Z0ZA 1E79A 1ETUA 2W6OA 2HRCA 4PLGA 4RSRA 2BVNA 3PD7A 3U7EB 2QYTA 1YRLA 4JCOA 3U3OA 1SCUA 5E7IA 2O2ZA 3JYQA 3RS3A 1DG3A 2ZRNA 2OFXA 1UL1X 4HFRA 3VR6A 2R5WA 5GIOE 4HC4A 1S4QA 4PEVA 3RV3A 3TIVA 1F0YA 1ZQ9A 2FMFA 2WAAA 3OIGA 4C4OA 3KKKA 4TVBA 5U4XA 2ZTSA 2VSFA 2CLCX 3C4JA 5FULA 4W7SA 4C3OB 3M34A 1XQ9A 1RBYA 2DFNA 2J46A 3DZCA 5JZ9A 3SEAA 1R9NA 4OD0A 3EPPA 2H52A 1CUEA 3CBQA 3FZQA 4IUYA 1OAKA 3AGQA 2OCBA 4Q9HA 3OQHA 3DB2A 4KDCA 4XWKA 4XGQA 3T4PA 4CW7A 4BQIA 3N0TA 3UW3A 3MIZA 1B3RA 2OYRA 5IKXA 1UDWA 3FSGD 5FH9A 2YHAA 1X7ZB 4UEJA 4DLTA 4EG4A 1J70A 1Z37A 3GEDA 3KV1A 5LFAA 3ZR4B 1TF7A 3HRIA 1UKEA 3LT4A 3V8EA 5DX0A 4M4SA 1SGWA 3GFOA 2CHFA 1SKAA 3P5BA 4U9HS 4QTZA 4TLLB 5D7NA 1AHNA 4R68A 2IEDA 3KDPA 4Y2YA 2Z6AA 3N8GA 3SJZA 4G0WA 4FCCA 2PWZA 3GD7A 3IULA 2QVCA 4ZVPA 1GDTA 1UUFA 2I6XA 4MB2A 5HJ5A 1D2GA 1IE3A 1UJ6A 3BSFA 5HQ3A 2FTKE 1VP3A 2W8ZA 1ZISA 1RR6A 1R0ZA 3ZBPA 5E4YA 1KI2A 2BH9A 1GRRA 1T8PA 1EQUA 2JJ8A 5ALXA 1U2GC 1U81A 1SVUA 1U0EA 1J1UA 2ZE8A 4QBIA 2QVLA 1L4MA 1E2PA 1XCOA 2YJZA 2B8WA 1HFJA 1O6BA 3D3EA 3EASA 5IJZA 1FMCA 1RLOA 1GO2A 3NDIA 2Q2OA 1XKLA 2FQYA 4DIEA 5I7VA 5JJKA 2ZIUB 4W9NA 2ES4A 3A1UA 1PR9A 1QZXA 3HU1A 3AILA 2RI1A 3MTQA 4AIIA 1I4EB 1DI0A 4ZANA 2GBFA 5L8VA 5I9BA 1JT2A 2Q3CA 2GILA 4IOJA 2HIGA 3ETHA 3AEYA 4TZKA 5I3ZA 3CO5A 3IOMA 4I4CA 5BWMA 1RCTE 1IOLA 3AF5A 3DOEA 3ECSA 3JWJA 2CHEA 1KHTA 2OV6A 3L84A 2R7MA 3PD1A 3SR3A 1NOKA 1KK2A 2JGIA 4DG8A 2WWRA 4EARA 1C9DB 4GM0A 1OFUA 1Z07A 1H3FA 1C7IA 4KJXA 1MO3A 1Y8QA 2E4ZA 3JRNA 2HKIA 4MA5A 5JIBA 5KKNB 4E5KA 4AG6A 1J1IA 1K92A 3QF4A 3GWZA 3FB1A 3T5CA 3U9SA 3RPEA 1HUQA 1QJ4A 2JI4A 2Q4EA 4GLOA 4RV9A 4EKDA 1NUPA 3FI9A 2NYAA 4CEHA 1T9DA 1WW2A 4PLHA 5G4KA 3ONVA 3E18A 3DE2X 1FVXA 1VM6A 4KXNA 1TE2A 1ZU4A 5K3SA 4EJSC 1MZPA 1OSNA 1KU6A 3WKAA 1GUAA 2B7LA 3LQQA 4EG7A 1V39A 4F71A 4FEGA 2C4HA 1GZVA 1SCKA 2XYHA 3LDUA 1YQWA 2GKSA 4U9IS 5H16A 1LV7A 5AM4A 3PGA1 2ZTVA 2OCPA 5EVCA 1OBFO 1ZNXA 1SN7A 4FYMA 5EXTA 3ADPA 2ISSD 1PWYE 2OSBA 4G4SO 1GSIA 4L5YA 3X44A 1U3UA 2UZ0A 2VKTA 3RBZA 1IOZA 2OZKA 4CTMA 2PUEA 3ICEA 3SR4A 3QQ5A 3KZVA 4Q9DA 1NBEA 2UUPA 3Q3CA 1AZWA 3IV9A 4R2IA 4HAYA 2YIMA 4JC4A 1X1DA 5KQSA 3W6NA 3LF1A 4MDYA 4GW3A 3Q87B 1GEEA 1QIJA 5E7JA 1L5ZA 1PSWA 3AVPA 4QREA 2V7TA 3K2IA 5FNZA 5TLSA 2QUIA 2UUBB 4H3KB 2QIOA 1VYUA 2VYNA 1S7CA 2WKRA 4Q4DA 1XZQA 4MWDA 1U2TA 1KQFA 1I6KA 1QQ7A 2YVKA 4PFJA 4ODIA 2PLWA 1FL9A 4KO8A 4HQFA 3O74A 1VL6A 1VE1A 3H2ZA 1WXFA 2WU8A 3HJUA 4WLVA 3DOIA 3ISTA 3LOPA 3NGLA 3MSCA 4P4LA 4OQNA 3K96A 2PUCA 4ENUA 2C7QA 4MGKR 1TJ4A 5TIIA 1ZOOA 4GPD1 1SY7A 1E7QA 1VKNA 1XU4A 2B1RA 4US1R 5ERXA 3RWBA 5A04A 4DSTA 4YA6A 5LR6A 5AVSA 3KQNA 2NOAA 2FXIA 3OP4A 2UUOA 4XJVA 6PFKA 5ICGA 1K1EA 1T36A 3A06A 3DL2A 2PXAA 4M7WA 4TMTA 4US2R 2ZRQA 2JGNA 5GIPE 3PT9A 1SBTA 4GKKB 4B7AA 2X3UA 1PJAA 1PS9A 5HQTA 3OQBA 1I7PA 3F78A 1P9NA 2XX3A 4EJ0A 4DKJA 2EAUA 4RHEA 2J4CA 4LC1A 3SXJA 3CN7A 3WXMA 2P2SA 1YQDA 2PKEA 4M9UA 1NY6A 1M6NA 2GA9A 1FP1D 5EIFA 2HPZA 1BD3A 3CLKA 1RJFA 3BX1A 1DWUA 2A67A 4K9MA 5A0FA 3SX2A 4CUKA 4K5QA 5FUMA 2V98A 2OILA 3BH7A 4Q9NA 2O7QA 2AS0A 1O6CA 2IYRA 1ULZA 4DREA 2O23A 4JQCA 3T0IA 4FNGA 1JEDA 1P7YA 4U2KA 1OX4B 4L8FA 3T5TA 3ADDA 2BP7A 2OXFA 1IVNA 4BDSA 2FWNA 1DHRA 1HDOA 2EJUA 4EYGA 1ARZA 1JL3A 3OQIB 4K9OA 3BGSA 1XDUA 4ZOLF 1IQ0A 1T1GA 5CA0F 3DZDA 1QF6A 3LL4A 5LVAA 4IJ5A 2I22A 3V4SA 1FS4A 1TJPB 1OJ7A 1YUBA 5TNXA 5C1DA 3OPYI 1IG3A 2J8ZA 3QXXA 4JP3A 1N1MA 2YRWA 1PGPA 4MUGA 3PX7A 1Z2DA 3JX9A 4BKRA 4CLDA 2WSIA 3R8FA 4QTYA 4NV3A 1ZZGA 1OV4A 3EEFA 3T52A 5IAAA 4GRIA 2GUWA 4D0RA 1GZ3A 2P9EA 3Q9SA 2J0SA 1E1KA 4FYXA 2CL0X 3A8TA 4ZGBA 3R3SA 4WKCA 4DCNA 3A2KA 2XQFA 3TCKA 2VOEA 3IPCA 4GOXA 3U9LA 4F3YA 1LQTA 5K8CA 4B8WA 3VOAA 4F8YA 2IYNA 3EDMA 4F9GA 4DJJA 3AFNA 4OJTA 3GBVA 4MWOA 3DMPA 4ZQGA 5EMNA 3ZKWA 1VLLA 4GL4A 3WDMA 2A92A 1LPSA 5BUQA 2J08A 3TOCA 4WUVA 2WBLC 4C43A 2F8LA 1KHHA 5JFGA 2W2PA 2O2XA 3C5CA 3M70A 2ZANA 4O4HF 1M6VB 1I1OA 1VGRA 4OXXA 3VU0A 3ZX4A 3RC1A 1PHRA 4M0CA 2O48X 1K3TA 2AVNA 1V5FA 5JMPA 2E5WA 3RUEA 2I5PO 3AHIA 4OSPA 1UBNA 2EZTA 1H93A 3OLVA 1ZNZA 3B12A 2FX2A 3HI6A 3QGMA 3ZBQA 3FMIA 5TY0A 4YYEA 1MOPA 4AKEA 1TLFA 1XF9A 1UKBA 3L7LA 3PEUA 3WLTA 1EK5A 4TRRA 3MILA 3KQWA 3MUNA 1D7AA 2WTBA 4CCWA 3T3IA 1EVQA 4JI3B 5DN9A 5IN4A 5U9CA 3SBEA 16PKA 1Z4LA 4J2HA 4ALJA 4FFSA 2YQ5A 4AJJA 2HGZA 5JZOA 2WVGA 4LTNA 2OHFA 3DG9A 5AI0A 5KYVA 1FB5A 2VDNB 2VSOA 3IYLW 4O6VA 2L0XA 4IJMA 1PW7A 4L51A 4E21A 1CQXA 3EIXA 2V3WA 1XWFA 4Y67A 3S44A 5ELXA 1Z33A 2FDXA 4HLNA 2A6PA 3WGHA 4RD1A 3HKBA 3N2YA 3NTRA 5AXDA 4D43A 1I3LA 2I55A 1KZ4A 2IYAA 1GL7A 1L5HB 2OQIA 3ZEIA 2QXYA 2X1MA 1XQVA 2G7ZA 3HYLA 4Q6WA 1GPWB 2WWIA 4LJ5A 4PSAA 2JGDB 4E3ZA 3RHFA 1ZOSA 1F60A 1L5OA 2JFQA 1V1RB 2RGNA 3HVHA 3AFMA 1ABBA 3WA7A 1I4LD 4NL4H 3B7GA 1Y1RA 3DPSA 3K53A 4YROA 3A4MA 2C9BA 1ICIA 5JH7F 3HXTA 3IPXA 1SXJC 4WNCA 1SC4A 2MR5A 3ABRB 1N6PA 4UBOA 4BB0A 5I48A 1U0FA 2ZSUA 3UQYS 1YZ3A 2D8AA 2CXQA 4W8OA 2OAQ1 3K9LA 3IVCA 3FA2A 4Q9LA 2PYZA 4EW3A 1CU1A 2EFHB 5KYXB 4RM3A 1GN8A 3R0XA 4Z9AA 4HUTA 2C5GA 2W0MA 2PS0A 1WJGA 5EFZA 3CYFA 3KBOA 4GZ3A 4EY8A 5B58C 4BNHA 5KX5B 1HL7A 1N7JA 3TAUA 2FEXA 2HOQA 3FOFC 1YS1X 2XOKA 1A72A 3SZRA 2PKRA 4PN3A 4IRMA 2EG9A 2ODPA 4A8PA 3BWCA 3FCYA 5FD8A 1OXUA 2G5GX 3ROFA 4DCGA 3OJWA 2QN1A 1H2HA 1RM4A 3NGMA 1LJ8A 4JYMA 1NNLA 4RY8A 3SS8A 2C20A 3BE4A 3I04M 1Y63A 2PAAA 2DFPA 3IPAA 2GAJA 3AJEA 3CU5A 4MR9B 3SIWA 4AJNA 5DM60 2HXGA 2AC2A 2Z8YM 4EMSA 4AUEA 1RQGA 3AUJB 4PYOA 5GTDA 5K0SA 2RONA 3V7UA 1ZP6A 2EP5A 1AK9A 1J2EA 1KFCB 1H66A 1U65A 1ZQ1A 2GS9A 2PRSA 3CF4A 3KSRA 5B2FA 1BJRE 1AXRA 3TLMA 5IUNC 1SIWA 5FQOA 2O3QA 3N5KA 5HF9A 1EUYA 5AWFC 2RGUA 4G09A 1KQNA 2R66A 1FX1A 1A5SB 1VXOA 3OICA 4HNAA 4URXR 3E3OA 5LJIA 1PNQA 4OQYA 2GXQA 3NLLA 2ZT7A 1QSGA 1NKTA 3P9KA 2PL5A 3G82C 4S12A 3GJ3A 4YMLA 3MQ4A 1LW6E 3B2NA 3RC2A 3OM8A 3IP7A 1NI4B 3LIIA 1U04A 3LXUX 3WGKA 3TMKA 3SP1A 1JMKC 4RTPA 1XVIA 1YCFA 3DKVA 3ZHOA 3LZDA 4RGBA 3L7JA 4EHKA 1NLYA 4I50A 5GZ1A 1W34A 1IUKA 5DNWA 2DPGA 3SZ3A 1N8KA 1U31A 3O21A 1UK9A 2O2CA 1X7HA 4X97A 3VQTA 4EVRA 7AT1A 3S8YA 4QLAA 3THYB 3TW4A 1QYWA 3NV7A 2XTJA 3OQPA 3RK1A 2HK9A 5DCYA 3PP8A 3GRVA 3R40A 4JEIA 4K3UA 3RJZA 4R40A 2Q3BA 5DNEA 3WLIA 3H2KA 4XPIB 3QEBZ 2VFAA 1PFKA 4NVRA 4KZKA 5ESDA 3F6EX 5K3BA 1WV0A 3RWOA 2FR0A 3C3KA 1RYHA 1UBLS 5CIWA 1BHQ1 2NU9B 4EP1A 2KLBA 5KNDA 3BBLA 3UIEA 3I09A 4BBPA 2VR1A 4QEKA 4H1WA 2JCVA 5HG0A 3WIUA 3FOEC 4RCZA 5GJVC 3LBIA 1QQ5A 3QTTA 4GVPA 1OZ0A 2L18A 1E4OA 3KOYA 3MS4A 1ZCFA 4ZQFA 3UMBA 2R8ZA 4A2WA 2I1WA 3QU7A 3LHSA 1USIA 5B6PA 3AVUA 3M4ZA 5BO5A 5I5EA 3HVUA 2Q6OA 3G49A 4W82A 1CYEA 4NI5A 4K0RA 3NRJA 1Q0ZA 1QKKA 1HT3A 2PK3A 2V7QA 3HBJA 1KC3A 1R0SA 3I6MA 5HUQA 1ADJA 3ZVRA 4DY6A 2P1DA 2WJWA 4KMMA 1KI4A 5FHQA 3ILHA 2K5UA 4P33A 2YWHA 2RBEA 3NEYA 4M8IA 4QBGB 4W5WA 1H8HD 3OMWA 4A10A 1ZGAA 1TCBA 2C2OA 4UBIA 4UOEA 1IYZA 3W5HA 7YASA 5K7SA 1NF9A 4OHRA 1CJCA 5LLTA 4JI4B 2W42A 2WM3A 4CV0A 1DKMA 3V5NA 5D51S 3REQA 1SD5A 2HNAA 4LDZA 3T5AA 3T1QA 2OTCA 4DMUB 3VKUA 1S2LA 1JIVA 1KNXA 2EX1A 2QJWA 3P2EA 1Q77A 5TC4A 3V9AA 2VEDA 3PS9A 1RZ3A 5E3JA 5EMKA 1X77A 2BHRA 4BKPA 1XTSA 1DQZA 3ED1A 5T4FA 3E9MA 1NW5A 3K6RA 1ZKMA 2HXSA 2NNWB 2O0JA 1GSHA 1Z68A 1RYYA 1JJVA 3JZMA 3T35A 3T9BA 5F7OA 1ISGA 1FP4A 1VHJA 2GSWA 2OY0A 3P0JA 1KC1A 4J0JA 3A9TA 3I01A 1M34A 3DXZA 4FM9A 3G0HA 4OSOA 2XV1A 5T4BA 4XIIA 5AKHA 3BGWA 1SR8A 3DZIA 1UDRA 2J9RA 1UZLA 2R79A 1TXGA 3K32A 5FWXA 5LDHA 1H4SA 2WB2A 1XZFA 1MO2A 2MSKA 3PWKA 3H2HA 1TTQB 1ACMA 1QG0A 2ONZA 4D9EA 3FPCA 3KOWA 3OQ6A 4EK9A 1IBKB 1XTTA 1G8GA 2WHEA 4A2CA 4B09A 4F2PA 3DLTA 1D0VA 3UG6A 4AXXA 5K6RA 3ZK9A 3NC4A 1VSTA 3NTXA 3OZTA 3ME5A 2HK6A 5E38A 5EERA 1PFYA 5CB0A 2PRYA 3R9IA 5K09A 4IX1A 4Z4QA 4W5NA 3EZXA 3PC3A 2VNIA 1DIHA 2ZUBA 4PC2A 3BMOB 4B3DA 4TMZA 2R6R1 4OH7A 3EMKA 4OHVA 4QXMA 4D02A 4ETWA 5CCEA 1E64A 3UT5B 1XZHA 2BEVA 1PD0A 2J7PA 1BX0A 1L5MA 3CTPA 2W4MA 1YBFA 3QFTA 4L3VA 2PUJA 2AFIA 2IWHA 1LA2A 3IB6A 1O4VA 5M5BA 1CWUA 4C4PA 2Q2VA 4MVJM 1JNXX 3WRXA 4C7MA 5KVCA 5KTSA 1Z12A 4FGKA 1X2EA 2CNKA 5ALZA 4E2FA 2HSGA 2HF9A 2IYEA 3EFOA 3CUVA 2FSVC 1FNDA 1NY5A 2NPFA 4ZAXA 3K3PA 2ATIA 4IGAA 4NCJA 1FX0B 4BNXA 1ZVMA 3TLXA 2H7CA 3BSSA 4DXDA 2Q0HA 3JAWA 4TS1A 5JMWA 4UUOA 2UYQA 5HKOA 1YCDA 2GD2A 4G1EB 1NN5A 2P90A 4RLFA 2AT1A 4C76A 5L3SA 5HF6A 2CB9A 3PYXA 4W5QA 1T6ZA 2C4MA 1IDOA 2ZIGA 3EEIA 3OA0A 4X1KB 4DYDA 5F98A 1T2EA 3V55A 3M6LA 2VATA 3GDGA 4PX3A 2HA0A 4HAUA 4GI5A 5CDHA 1GKUB 2CDNA 1KIFA 4KU4A 4N47A 4CQJA 3QKSA 4GQIA 1B15A 1I3KA 1LPNA 1M8FA 4ENPA 5HUHA 2XTAA 1Y4AE 3FTDA 2HMTA 3FI0A 4MHSA 3ESZA 5A4JA 5JU6A 1YB5A 4K9PA 2PNJA 3ZE2B 2PTGA 3E1KA 3MRXA 1G42A 3DDOA 5AHRA 5E3IA 2PZBA 1GWNA 2WF9A 1IB0A 1PCXA 2JI8A 1W0JA 4OXYA 4DN6A 1B93A 3JQ8B 5CJJA 4EHNA 1IFXA 3IEUA 3NM5A 2P4HX 1A5TA 1EIZA 2D0IA 2E4AA 3DEFA 4IEIA 2JFZA 1CY8A 2DYKA 4HD8A 1Q6YA 1EPUA 3ESQA 5HP4A 1B8VA 1PS8A 1ZA1A 4P7KA 4RDCA 1N4AA 1YF3A 4WKNA 2RI6A 3LLCA 2G76A 2OE2A 4GBED 4QJ4A 2XNHA 1K6JA 1TU4A 3S2ZA 2C03A 5IAKA 1E3WA 1DVRA 3ZY5A 4Y9UA 1QE5A 4TMYA 4UBMA 2MWMA 1PUXA 3GT3A 2UKDA 2X5KO 2ZCUA 2BJHA 2ODTX 2YVAA 4GYJA 4MULA 4MI3A 3RT1A 1NMQA 1XSEA 3WK6A 1RXSA 1KOLA 3X2FA 1Q22A 1YC2A 3S2GA 4IDDA 3PL1A 3QUQA 3ZZ1A 3OPXA 3VKHA 2QX4A 1Z6QA 2WWFA 4RULA 5LMUB 4OG2A 3O47A 3QFFA 3TQRA 2HK8A 4DADA 4HX9A 2HCTA 3DBRA 3KWJA 2X8LA 1B00A 2XMQA 3MT9A 1E58A 3OZSA 4F9TA 5AM0A 2ZUFA 1BMQA 1A2OA 1C8BA 1OIVA 4W7HA 5THQA 4R05A 3PNKA 5KWIA 3SD7A 1B26A 2TYSB 4L0CA 4M0UA 5CVUA 2OM2A 3QELB 5JXHA 2IS6A 4C2AA 2VJNA 3UAGA 4BNUA 5E2BA 1GKKA 1JXMA 4N48A 1TZCA 4JB0A 4X6UA 5JNWA 4MSUA 2P9QA 3D43A 2QTVB 1BU8A 2AHRA 4B84A 3VAAA 2WR8A 3AVXA 4IKEA 1DT5A 5DN6A 1Z6GA 3IP1A 5HF5A 1S2IA 3ZQ6A 3I3OA 3CRMA 1P2FA 3NOOA 2PT9A 1A7JA 1DJLA 4FOLA 1V5GA 1Y5IA 5MGBA 4YK7A 4TN1A 5EGNA 3TE6A 4PS0A 3IEVA 3GUHA 4PM4A 3FCEA 4KQ9A 3ZD8A 3BWMA 4YJHB 1CNEA 3D0QA 1YV9A 2KE5A 1P80A 1NVKA 2PPVA 4P7BA 4R2KA 1BMFA 4IF4A 3TL3A 4Q48A 5JAMA 1WD5A 2PUBA 3OCYA 4K28A 4TYPA 3LT5A 3Q7EA 3TZ6A 2CVQA 2KPOA 4DYVA 3H65A 4YR9A 2R6ZA 3P26A 5E7QA 4O3MA 2IPAB 2P9TA 3AUFA 4MVXA 1CT9A 4FWBA 1S3FA 1N6LA 1ZUIA 3QLTA 1XP8A 4GZ6A 4KX3A 1QF9A 3ZLTA 3IL2A 3THXB 1VL8A 1OFVA 3I42A 2P9GA 1CNMA 4Z3KA 3EIHA 3I4FA 2QAGB 5FPQA 1XTVA 2PMCA 3IRVA 2JLSA 4CU5A 2DTEA 1NXPA 1KEEB 2IOFK 4K9KA 4MKXA 1TB4A 3H2JA 5EJGA 4AAYA 5LYJA 4DQUA 4JELA 3DDNA 4IAOA 2CDAA 3ZPXA 1NFRA 3K2QA 4CMHA 4TQAA 1BMDA 4L02A 3RC8A 3QXJA 1NHGA 5JBQA 2B34A 4Z3OA 4NBNA 2OBXA 1YONA 1TGVA 1SVMA 4RQTA 3VYTB 2Y0PA 5DYIA 3BMQA 4UHEA 4LZZA 1KQ3A 2JFHA 5BOSB 3Q9NA 3LAWA 2MYNA 2C04A 3EUEA 1BRTA 1NVFA 2QZ9A 1IOVA 3L77A 3NHWA 3P2MA 1JFFB 4TGLA 4Y0VA 5H9VA 3TN7A 1N6HA 3PNVA 5B4VA 3A6FA 1COWA 1MX9A 1YHZA 1E3QA 2ZITA 3MTIA 5E6SB 2WLSA 2ADOA 3PUHA