2W2NA

Wt pcsk9-deltac bound to egf-a h306y mutant of ldlr
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
294
structure length
273
Chain Sequence
SIPWNLERITPPRLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEDSKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSDCSTCFVSQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAALPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9
publication title Structural and Biochemical Characterization of the Wild Type Pcsk9/Egf-Ab Complex and Natural Fh Mutants.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/receptor
total genus 97
structure length 273
sequence length 294
ec nomenclature ec 3.4.21.-:
pdb deposition date 2008-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2w2nA00
4NE9A 3Q40A 1AQNA 1GNSA 3SQOA 1AV7A 1PEKE 1SUCA 1BJRE 2GKOA 1GNVA 5ARBA 1GA6A 1TM1E 3LPAA 1SCAA 3TI7A 1TM5E 2W2MA 5FFNA 3EDYA 1EGQA 3DE4X 4H6WA 1NDUA 1SVNA 1SIOA 4GI3A 1Q5PA 5AQEA 3AFGA 4OV6B 4ZOQI 1DBIA 1THMA 1ST2A 3GCWA 2G4VA 3QMPA 1PFGA 5SICE 2ZWPA 3CNQS 1KDYA 3DW3X 1C9MA 2PRKA 3VV2A 2E1PA 1SUAA 4DWWA 4I0WB 3AJ9A 3VHQA 3DVQX 3PTLA 2Z56A 1SUDA 1HT3A 1SBNE 1EA7A 1VSBA 1SBTA 1Y3DE 3QTLA 1KDVA 4HX2A 1C9NA 1CSEE 5B1EA 2X8JB 1Y34E 1WMDA 2PWAA 1AF4A 1GCIA 3LXUX 4DZTA 1GTG1 1SUPA 1MEEA 4OMCA 5FAXA 3DW1X 3BGOS 1UBNA 3F7OA 1Y48E 2W2PA 3DVRX 3VSBA 2Z2XA 3LPDA 1YJBA 1AK9A 1YJAA 1R0RE 1SBHA 2ST1A 4WOBA 3QFHA 1TMGE 1TM3E 4MZDA 3EE6A 2SICE 3BPSA 2Z57A 2W2NA 2DUJA 3BX1A 4BWGA 1BE6A 3VYVA 1GA4A 1Y3CE 3I30X 1C3LA 1GTJ1 1SELA 5I9SA 1SCBA 1KE1A 3DE3X 3PRKE 1GTL1 4JP8A 2Z2YA 5FBZA 4RYDA 4OMDA 4CG0A 2DQKA 3AJ8A 1AU9A 4J94A 3DE5X 4K8RB 3HJRA 5CW1A 1LW6E 1BFUA 2W2QA 5B1DA 2SECE 1IC6A 2TECE 3L1KA 3D9QX 4H6VA 1R64A 1SUEA 3DYBA 2PYZA 5K7SA 2WV7A 2PWBA 1Y3FE 1P7VA 3ZXXA 1AVTA 3T41A 1SPBS 2IY9A 2HD4A 1WMEA 1NLUA 1T1EA 4WOCA 3A3OA 3EIFA 3I34X 1IAVA 3VTAA 1SCDA 1Y9ZA 5JXIA 1TO2E 1YJCA 3WQBA 5ARCA 4CFZA 3LPCA 3DE2X 5AMXA 3GCXA 2WWTA 3DVSX 1Y4DE 4Z2AA 4B5LA 5JXHA 2B6NA 3DE0X 3F7MA 3TI9A 3GT3A 1SCNE 4KPGA 1V6CA 2P4EA 3WIVA 1BE8A 5AVJA 1Y3BE 1PJ8A 1KDZA 1WMFA 1ZVKA 1BFKA 4CFYA 4NMXB 1SH7A 2Z58A 3DDZX 1SBCA 2HPZA 3D43A 4AKSA 5ARDA 1OYVA 4KB5A 2WUVA 1C9JA 1R6VA 2ZRQA 1KE2A 2SNIE 1OYOA 1Y33E 3F49S 3P5BA 1TK2A 1OT5A 1S02A 1YU6A 5JXGA 3DWEX 1SN7A 2PKCA 1TO1E 5JMOA 3OSZA 1SBIA 1AH2A 4M1ZA 1A2QA 1ZVJA 1GT91 2ID4A 1SIBE 1TM4E 1ST3A 1DUIA 4YN3A 3A3NA 1NDQA 3TECE 2X8JA 2IXTA 3I2YX 4NE7A 3WHIA 4HVLA 4FONA 1T1GA 1T1IA 1SUBA 1WSDA 4ZARA 3VV3A 1BH6A 1V5IA 2ZWOA 3WIUA 3DE1X 4KG7A 3DE7X 1TM7E 1JEAA 2ID8A 1P8JA 1GA1A 1TECE 4DJ5X 1PTKA 1S01A 3Q5GA 3ZXYA 4C3UA 1SIUA 4C3VA 4LVOA 1XF1A 2PMWB 3SICE 4H6XA 2QTWB 3UNXA 3H42B 2XTJA 2Z2ZA 1Y4AE 2PQ2A 3CO0S 2XRMA 4AKTA 2WUWE 1S2NA 2DP4E 1P7WA 4LVNA 3A3PA 3GT4A 2SBTA 5AVKA 5JXJA 1CNMA 3DE6X 2V8BA 2W2OA 1WVMA 2Z30A 1Y1KE 3I37X 1MPTA 1SCJA
chains in the Genus database with same CATH superfamily
4LYAA 2O2EA 4GIBA 1NMEA 3TQCA 5JFGA 3VVLA 3ZV7A 3TN7A 4WBNA 2AJTA 3Q2OA 4PYNA 5CVEA 5JNVA 4RSGA 3AERB 2OKGA 5H80A 2BGMA 4YRTA 1T6NA 5F35A 4J0JA 3F6EX 4FNMA 1W1IA 3ELDA 4Y2JA 5AI6A 4JBLA 4G23A 1OH6A 1NW4A 1PEKE 3OEED 1NLFA 1BQ3A 2Q29A 3QVKA 3W90A 1EVJA 1LPOA 4WIAA 4UTVA 5L45A 4QREA 3BMCA 3VM6A 1UDAA 4DIUA 2SKDA 4CDMA 5JSUA 3C8HA 1YUBA 3NEAA 3BFXA 2BEVA 4MO2A 1RPAA 2WILA 2CXSA 3QXSA 2BFAA 4CGYA 1N6PA 3BJEA 2YFKA 1QQTA 4D0RA 1M1YB 3DBHB 2MIIA 4M8IA 4D41A 2QLFA 4G65A 1G5QA 3G2IA 3T5GA 3DQPA 2WWWA 4MQFB 5GOZA 1L5GB 2BWJA 4CTKA 2XTMA 1AQIA 4IVRA 3HLYA 2HT6A 4PRLA 2AWOA 1UCFA 4MIYA 3FFWA 1M67A 4M0PA 5DTMA 1A1SA 1JG7A 4JYBA 5DK4A 3PXGA 4YUXA 1I2BA 3COVA 3T9EA 4HQKA 3K92A 4JBNA 5DIFA 3EOAI 1DCFA 1J70A 2Q7OE 3GJXC 5FTKA 2B0CA 2RBGA 3WRYC 3HB4X 1TDJA 1GKIA 1D9ZA 4KDFA 1IL0A 2H07A 2NYVA 3FMOB 3QNWA 4MQLA 4ZT5A 5LQRA 4LOIA 1HYQA 1JKIA 4H60A 4OOFA 3MJDA 5L4LA 4X5OA 2MSKA 1VLHA 2J9YB 2QAGB 2YBEA 4R3UC 3W2TA 3VOSA 4UTPA 4ASUA 3KE8A 3O9MA 2GYWA 4QYSA 4F21A 3L8YA 2IDKA 4L6AA 4B7CA 1HQKA 2XUGA 1XZ8A 5C8ZA 4DV0B 1NKVA 2F59A 3C3YA 4GZ5A 2DHEA 2FCAA 3KL2A 3WJ1A 2IYVA 2HF9A 2PRJA 4HWKA 5KVCA 4QUGA 1M72A 1SVKA 4ITRC 5LOVF 5E7MA 3ST7A 3OSUA 1H8ED 3QYFA 1O9HA 4C0JA 1ZGJA 2O0JA 5LNK1 3TMAA 3K1ZA 5IK2D 3LDFA 2HFKA 1EVZA 3GEIA 1GUYA 2C5HA 1JNXX 3WIDA 1UPBA 1H4SA 3IDOA 2AA3A 3C3JA 4V2UA 2O0HA 5IASA 1GNPA 1E32A 1PEDA 2ANBA 4YMUA 1X1CA 1E2PA 1IXKA 1XZAA 1X8XA 1GARA 4PHCA 1ML3A 1UMKA 3CUEF 4FLFA 4LNUA 4OXYA 4QXOA 1JLLB 5EP2A 1H6CA 3QOFA 1WULS 1TKCA 1KMQA 4JBGA 1C9NA 1MDBA 2CHFA 3F74A 3OZRA 5CK5A 3VMMA 4AJJA 3MB8A 5K20A 4ENWA 3GDWA 3IHKA 5AIBA 2V1UA 3A6GA 3E81A 3GL9A 1ZIOA 1Y34E 3KZMA 4P4LA 4DM4A 2XAAA 3PFNA 5JVDA 1FJGB 3L7MA 3ENQA 4I7EA 3ON5A 2ZWMA 4QBKA 2D2FA 1PX0A 3U6BA 2IHJA 3A6FA 3AHDA 1L4BA 4PO3X 4UHDA 2XVMA 3I9JA 4AJKA 1EFCA 1WP4A 1P5RA 1UBCA 2XNDA 4NBRA 5EMMA 2X9NA 2N1BA 2PVCA 3OOEA 4OOEA 3QLUA 1FNBA 4TSKA 5EIBC 1THGA 4D56A 4OMCA 4C14A 3WIOA 4AURA 3OQ6A 2FMXA 1QYCA 1S8AA 1Z2OX 4C0AC 2XGOA 3WLFA 3BWMA 1PO7A 2JLAA 1IB6A 1XK7A 4Q4LA 2I5PO 4PAMA 4JLWA 3CCFA 4WL0A 2Q1UA 4DWOA 3AIIA 4J7UA 1YT5A 2YL2A 3EPPA 3II6X 5DTJA 3VTZA 2ALJA 2EWMA 4N8DA 1AV6A 2I71A 3WGYA 1N92A 3N1UA 4BE4A 2XWQA 2I6GA 5ESXA 3OTHA 1YK0A 3R74A 3QRWA 5LQUA 1IN1A 1LRLA 1DQSA 4E5UA 3FKQA 3NM4A 1GSAA 5PNTA 4R3NA 1D2NA 1TQ4A 5KQSA 1E0DA 3NBMA 3YASA 1DWOA 1RLJA 3UPTA 2NYRA 4ZYLA 3EDCA 3RFXA 1PTJC 5ALSA 5K5EA 2AMJA 5JJKA 4I4TA 4UBNA 4CKBB 2UVPB 3HA2A 3MBOA 1ZVMA 4GXQA 5IULC 3SEAA 3OPYB 1W76A 2BR5A 3EVDA 3FWKA 2WTBA 2UUOA 1Y5MA 3D1VA 4EYGA 4K46A 4TXMA 1JHVA 1TF2A 4PPFA 3RS8A 2QPAA 1WL8A 1TMGE 3NANA 4P31A 3RIGA 1C4XA 1AGNA 4BVBA 2E5FA 2EERA 3QPAA 2GD0A 4QEKA 4RWZA 3DEIA 1W5TA 3VX3A 3EE6A 3T4EA 5D85A 2ES4A 3REOA 1E1DA 5AKLA 5HMLA 5GZ3A 5JUWA 2WG2A 3UN1A 2Q3EA 3G2LA 3LIIA 2ZYSA 3KQLA 4TUYB 5G4KA 3RUAA 3C4QA 4MUHA 4C43A 2XGJA 1QFXA 5BT9A 2W8BB 2WFLA 1QF9A 2YV5A 1KO5A 2B1QA 3OE7A 1DKPA 1GA4A 3KCNA 5EMLA 4DR6B 2HA6A 3A05A 4MCJA 1SELA 1WCYA 2OZVA 3DR3A 5BYAA 3MGBA 1I3LA 2PT7A 3OIWA 1J20A 3RIHA 3FPBA 2QRZA 1XZMA 4O4LB 2BFBA 1XRPA 2A4MA 1BU5A 3IV9A 4LSWA 4E07A 4PNZA 4IVNA 4Q4JB 1YS9A 1DX9A 1RI2A 1XCMA 3Q9SA 3S1AA 3U3KA 4YMGA 3B13B 4FDTA 3OOSA 3OPNA 5D5PA 3AB7A 1JIJA 3UUFA 5LLTA 4ZVKA 3UB3A 2VF7A 4IIUA 2BGTA 3WK4A 3IEMA 3AKCA 2CFSA 2AD1A 3TG2A 4G1VA 3EA4A 3LT5A 4COOA 3WTCA 3SS7X 4DCOA 1K75A 3AQ4A 4FB5A 1Z73A 4BNYA 1BDIA 1QMGA 1CZRA 3ZUPA 5KWSA 3EEOA 2JLQA 4JCCA 5T3YA 5FPQA 1A7KA 3CUWA 4JYAB 2JB9A 3R3HA 1ZNWA 5IN5A 4JP1A 4D57A 4WLVA 1L2TA 2Z1MA 4MOWA 4XOUA 1WJGA 2G0NA 5U4QA 2IOYA 2N75A 2G28A 7YASA 4AJOA 3OLCX 4PS0A 3QVOA 1XZQA 1HWYA 1YB7A 3DYIA 5FTMA 4UOQA 3MMPA 3EXFA 1BN6A 1W48A 2Y8EA 4MPRA 3C43A 4EUHA 4ZK2A 4RVNA 2C2BA 3TH5A 4WGGA 3L18A 1ID1A 3C3XA 2IZ1A 3IL2A 3ZQJA 1AXEA 1OQAA 2QD1A 4QJ4A 2JJMA 4B09A 4BNLA 1DO2A 1WLYA 3AXSA 5IZCA 2BDEA 1Y6RA 2PM8A 2QPLA 2IP4A 2L82A 3MJRA 3THOA 1R4ZA 1SIWA 4QDTA 5FA5A 3USCS 4NZOA 5L4SA 1M6EX 1Z17A 5AI4A 3ACDA 3ONEA 2W90A 4GU5A 5A4DA 1WUKS 3OQIA 1DAOA 4NEGA 2NUBA 5M5BA 3QY9A 4UM7A 1R6BX 1Y8QB 1IWBB 3O3MB 3ETGA 1W94A 3MTAA 1JH9A 1ZRHA 1CYEA 2BR3A 2W6JA 1G98A 5JRDS 1FFWA 5K0BA 3NJ4A 1NZFA 4JC0A 1EWQA 3SOPA 1LF5A 4ID3A 4D9NA 3DDCA 3CZRA 1LS1A 4PXSA 3LE8A 1OLUA 2DEUA 1W6RA 2AT1A 2UXCB 4MP3A 2OM2A 3AHFA 3X0DA 1OXXK 1T9BA 1Z6XA 3QUBA 3DKRA 4WNYA 3RVQA 1Z7EA 3BCHA 1UC9A 4XYBA 2GM4A 1UBHS 1M8PA 4NCHA 4A8JC 2PSFA 2C07A 4Q24A 3BDAA 1JXAA 3SYTA 2OO5C 4Q4AB 3ZH2A 3TW4A 4LNHA 2ZOSA 3L49A 5T8KA 2W6PA 3HYCA 3ACBA 1ORIA 2GBCA 4GRIA 3FNFA 2FZWA 2DOKA 2N42A 3FYHA 2EKBA 1L4HA 1NJ5A 1ZM9A 2VSYA 3HB5X 2D0DA 1DC4A 3EVEA 3IKLA 3KTDA 3WL4A 1HE5A 5JYCA 2P6RA 3JCZA 3TK1A 1KXZA 3BXHA 3LPMA 4E4RA 3F97A 1G7SA 4MV0A 3BXFA 2W2VA 5EIFA 1NT2A 3V32A 4GVXA 1NZDA 1XRQA 3L43A 4F8EA 1LV7A 2VYND 1P80A 3SKXA 2AQKA 1RIFA 3NMUF 4WMLA 1GY8A 4MAFA 5EFOA 5F21A 3ILHA 1F2TA 1RFLA 2DY1A 2FCRA 3L0ZA 4XQ0A 4W63A 2G77B 5HBGA 1EBBA 2Z6UA 4LC0A 3D4PA 4L0MA 3U3MA 1CB0A 4OX9Y 2BY4A 4EPYA 1W5AA 1FUIA 2HL6A 4RELA 5DHUA 2ZJ2A 1OU4A 3FB4A 3Q8XB 3LO5A 1E3TA 1KJIA 4FPXA 1FTYA 3EQZA 3IP5A 3P26A 4REOA 2KSQA 1RXIA 3GMTA 1YS7A 1P77A 3FLEA 2ZSHA 4V38A 3ZE1B 4IX9A 5CITA 2VF4X 2C42A 3VDXA 3HR7A 2P1ZA 2X58A 4RH3A 4NMXB 1BQ4A 1O58A 1SH7A 4GR4A 4REMA 1VE1A 2VYFA 1VKHA 2AD5A 2DLDA 4AB1A 4MJXA 3NT4A 1E0KA 1SZJG 1VDMA 3EGXB 3DKVA 2V97A 2D1FA 3ISVA 4N5HX 4Y2QA 3RK4A 4B5KA 721PA 1JFSA 2O05A 4U02A 2JKVA 3T5TA 2V7BA 3G2QA 1FPMA 1P0PA 1YRYE 2DWCA 2DFTA 3OF3A 2HWUA 2ZBVA 3EVBA 5TB5A 2NVUB 1J2RA 1LJUA 4BKOA 2PO5A 1Y37A 4DSNA 3LY9A 5A62A 4PPGA 4ZWNA 4DREA 1KOFA 2W42A 2RB4A 4BU1A 2E3JA 4E5KA 3QW4B 2FR0A 3GH1A 1UFKA 2GNOA 1ZI6A 1YQ9A 5FJJA 4UC0A 4YRKA 4EY5A 5AM5A 4ILKA 1UZMA 4HNAB 4NARA 4LSGA 3GLHB 4KVFA 4WA7A 4D79A 2EKZA 2NP6A 1YZGA 2IYFA 2MR6A 2QL6A 1UFRA 3PF8A 4HS9A 1UMCA 3PNQA 3LC2O 1PI3A 1QHXA 3Q2KA 2GZ3A 4XPZA 1WDKA 3WICA 1V2HE 3L8HA 2C9MA 2QYHA 4BU0A 4DW8A 2DTXA 4HQOA 3MHPA 4L9AA 3GDOA 5KTRA 4KAFA 1R5BA 4IM7A 3I6IA 3EZGA 4NMHA 4MTCA 3HKDA 1D9XA 5HA5A 3RUDA 4FILA 3KZ1E 1BIFA 2ZM6B 1G1MA 2XVXA 4AJEA 5CA0F 1Q83A 2ID4A 4B45A 2H4YA 3GEGA 3PXAA 2O7NA 2FI1A 3VC3A 5BNIA 4IKPA 5BQFA 1YQTA 2PLAA 5K0ZA 2Z3WA 3T52A 2ZYVX 2Q5CA 2ZJAA 2WB4A 5IM4A 5T67A 1YR2A 1QC5B 4ZYUA 1CEEA 4IHAA 1HX7A 3LA8A 4DIKA 1Z4LA 1DS6A 4BY9E 3G85A 4J0FA 3VISA 2GEFA 1M7HA 4K87A 3RUEA 2BSAA 1YCFA 1RXEA 5A2QA 1SC1A 4AKEA 4F4CA 4MPTA 1AMOA 1JIIA 3A4VA 3DCYA 3HZRA 2VYVD 4WBXC 4ZODA 3NORA 5GM2A 1ZOIA 5SZJA 1GGMA 2FETA 1KP2A 4MUBA 4N8EA 4OIMA 4OXXA 4Y2TA 4DNOA 4ZYZA 4TVOA 4YRQA 2IS6A 1V41E 1XWIA 1W44A 3LUDA 2J8ZA 4LYGA 1CQIA 1PZEA 5M3BA 2VNAA 2GRJA 2Q27A 3CYFA 4ZV9A 3WKBA 4Z4EA 2HT1A 4RF5A 1XD8A 3FRIA 4P3NA 1JEAA 3G5MA 1QCYA 3QUSA 4JKIA 2QLNA 4UDNA 5HX7A 3G5UA 3HABA 1U2GA 3HNOA 4R0MA 2QW0X 1E0AA 4OU5A 1TU0A 1H65A 2J4DA 4LXXA 2JVIA 1LK5A 4CVNA 4J8PA 1BMTA 1K5DA 2IEYA 3K3PA 1UKEA 4J7XA 3BE6A 4ER6A 4F11A 4WEQA 1HXHA 2DT8A 4HRVA 3ZXYA 3JASA 2C5GA 3H75A 3IVCA 3KSUA 4WOJA 5E95A 2WWHA 2HREA 3ZXIA 2GZSA 1QRTA 3D3JA 3H11B 5G1NA 1J5EB 1ZN8A 5K8VA 4H6XA 5AKYA 2FLKA 4ALLA 1FQOA 1KK0A 3NBQA 1PS8A 2F9LA 3WGQA 3ZYZA 4F6CA 1N0HA 1YOBA 2ECQA 3KZNA 4MP6A 1PNVA 4H7DA 2Y66A 2XTJA 4K9DA 2AG0A 1K98A 4MMXB 4HBGA 4F45A 1Z0FA 1YDEA 2IU4A 4R9SA 4JP5A 4Q3LA 4QAJA 3DLAA 3TD2A 3H1FA 1RAFA 1P7ZA 5FUVA 4FFBB 4K6OA 4MS1B 4HAYA 3L1VA 3VFDA 2F3PA 2BBOA 2Y1XA 4G36A 4RHUA 1JFRA 4TRJA 5DYIA 4C2BA 3EDMA 3DMGA 4Y9SA 5CNMA 4C5CA 1P7WA 3RLIA 2EATA 1F2DA 4ADSG 5FV4A 4D97A 2J87A 2D2EA 3QBVA 2A5YB 1VBMA 3CB2A 5A1TA 2OCDA 4MI9A 3BULA 4K9KA 1BD3A 3GVCA 3I5XA 3PX3A 5J2TB 4MUMA 4H16A 1WMSA 5LA6A 1TLLA 2P4HX 1TVKB 5CXUA 3UK1A 1Z0IA 1PR0A 5CD1A 1SXJC 2YDYA 3KB2A 3TM4A 1ZUHA 3M3HA 3Q8LA 2C5BA 4P54A 4YAJA 5E7QA 1J7KA 1SXGA 4RV5A 4A9AA 4B83A 5LZ2A 1GCUA 2ZRJA 1JR2A 2Q0HA 3WWZA 2DH6A 2YV1A 1EJ0A 2ZAYA 3SJBA 3SIPA 2P11A 2NXJA 4B76A 2FR8C 4WKOA 3RAEC 3V3KA 4XDZA 2C57A 5AKXA 3IAXA 4Z8YA 3PUWA 3ONVA 4RJJA 1XMSA 1NQVA 2GTPA 3D2BA 1DT3A 4M1KA 3AFIA 3CWZA 1W4LA 1ICIA 4HDKB 3VA7A 4YMWA 4E2FA 3OT5A 3W4IA 4RTMA 5HJ5A 5C34B 2QMYA 4B8ZA 1LVHA 2QN3A 2ZB2A 4DOMA 2NUAA 2XOKA 4L16A 5DI9A 3BGIA 2O8CA 1F2UA 2JKYA 4PGAA 5SV2A 2V8OA 4MCIA 1RAHA 4RK5A 4MLZA 2AFHA 1OPRA 1WY5A 2VK1A 3HBMA 3ZBQA 1NBWB 1NPYA 1SCQA 1B3RA 3EDYA 2ZIEA 4CFSA 4KQ9A 1J25A 1O97D 5FORA 1GRVA 4ZHSA 3HO1A 1EAYA 1C4WA 2JHFA 1QH9A 3THSA 3ETHA 1T10A 2HKIA 5KHAA 1N34B 2V58A 4JDUA 3SGLA 3TRKA 4HWTA 3CT4A 4MQBA 3D4LA 5SY9A 4IDDA 4PLZA 3NIDB 3S6JA 3LLVA 4LJKA 4G0YA 4L4XA 1GZ7A 3OZWA 1FFDA 1WDTA 4RK4A 1P2GA 1IDOA 5TNXA 5HKBA 4W9NC 3Q1LA 2Y92A 1ZOPA 4D0LB 1GTVA 3FX2A 1CP2A 2AIRA 1PNTA 4Z4CA 5HZGA 4ZOQI 2A5LA 2UXDB 1ICEA 4JJFA 4O0LA 3WQQA 5EMJA 3L8ZA 3WHPA 2K87A 1Q84A 1UOQA 2QPOA 1S3IA 3WYNA 4L4YA 1DC6A 3GDGA 1XPUA 3WKDA 5SICE 4KVGA 3UTDA 4GWLA 2FGJA 2ZJ4A 4BWYA 1L7OA 1ZIXA 4TS1A 1RZRA 3DAPA 3K0HA 5EQJB 3UPDA 1GV0A 1KDYA 3WWYA 5A4KA 1ZJ5A 3E3MA 4K05A 3PNLA 2BGJA 4C1NA 1JMYA 1P2UA 1INLA 1Q14A 4GOXA 4IY1A 5IXYA 2EQAA 5G02A 3U3RA 3AV3A 4M1EA 3W2IA 3BB4A 3W4KA 4W5QA 1FNSA 4RA6A 4RXUA 4B17A 1WB6A 5IVPA 4NU5A 2V7XA 4P8RA 3EEYA 1JEEA 4AMYA 1JU9A 5IT5A 1U0FA 4RTRA 1PYOA 5K3OA 5H70A 2GEJA 1NW7A 1XCPA 2D2IA 3CZ4A 1ISHA 3QX9A 1CTQA 4B40A 1VSBA 3DMYA 4JU8A 1SBTA 1DKRA 3QTLA 3QXHA 4ZPJA 1PWXA 2JCYA 2G07A 1IIBA 3ODGA 4KO1S 4ZU1X 4WNCA 4B34A 3MELA 2FN3A 1MX1A 1VSTA 2IUTA 1BCRB 5AJUA 5DHRA 5LBIA 3ZN2A 1UAAA 2MSCB 3IVRA 4BRZA 1QM5A 2J9GA 2JGDB 2E89A 5JMTA 1OXKB 2QE6A 4E15A 4M54A 4D74A 2K7FA 2YJ4A 1VGQA 2WW8A 2I34A 2QSJA 4NONA 1R50A 4HDAA 4KXMA 1ONNA 1TC2A 2YXBA 2FKAA 1Z5OA 5COQA 5DNAA 1X7ZB 1GCIA 3AKDA 1A9SA 2ODTX 4NS4A 5I9MA 2JA1A 5I47A 2LDXA 3F7TA 3ITEA 3FZNA 2KLBA 4JP2A 4HUJA 4QJ5A 3LX6A 4XM0A 4ARVA 1SXJB 3R4CA 1BMFA 1MC5A 1UADA 4IHJB 4A2WA 2VKTA 1BN7A 1ZINA 3C1OA 2I7CA 4MKRA 1V35A 1B23P 1OR8A 2WAAA 4K1LA 1RYZA 2MINA 4KEAA 2DUWA 5A1JA 4DCTA 5L7WA 2X2FA 4I81A 1X1EA 3KAKA 3BWBA 5ESWA 3BM5A 2Z0MA 4BC1A 2C2OA 5C52B 2Y1LA 1YL7A 1UFQA 1GQFA 2RG1A 4P2GA 3QVMA 3KEFA 1RXCA 2ZSAA 1K7YA 3UJAA 1APBA 3PEWA 5J58A 2QBYB 1DAKA 1VJTA 1PX2A 1U0GA 3UMCA 1CEXA 4AJ2A 1Y3IA 1MB3A 3HCAA 1B76A 3AHEA 4RADA 2WJVA 5F4ZA 2WKSA 3VYSB 4TYNA 2RGRA 4WZAB 1U8UA 3EZNA 1E9DA 2WD7A 5ERXA 2J0UA 4UM9D 3W8NA 1ONBA 2WAXA 1EK2A 1WEHA 2AYXA 2GK4A 1NJFA 4FGZA 1V7ZA 2BP7A 4F5YA 1KMNA 4L2IB 3KVNA 4Y2HA 3ZS9A 1GKLA 2A14A 2COKA 3QE3A 1XC7A 1CF2O 1Z3IX 1L5YA 3Q9NA 2B5WA 1E6LA 4FFDA 4X95A 4KQFA 2IZ0A 1DX4A 3W6NA 4KWIA 4X8OA 2GBLC 3HBJA 1ZUD1 2QVBA 2ZRDA 1KO7A 4M9RA 2R6JA 2OZEA 3FI9A 3P9RA 4ZOAA 1DOAA 2P4SA 3AUUA 4PSDA 1G2PA 2GAIA 5FCDA 2FWAA 4E03A 3T9AA 4GXTA 2Z57A 1XTZA 4IKEA 3V4RA 3NRJA 4GI1A 2I6FA 4JLDA 1GQSA 1TKBA 4PSCA 4J6EA 4YT5A 1EWTA 2A57A 2W58A 1GG2A 1T1RA 4BWGA 3A0UA 5EZSA 4BO3A 3U60B 1X3LA 3DGEC 1UMDB 3L84A 4W6QA 5K3AA 4YR9A 3R7SA 3HM9A 4L85A 1NATA 5H59A 1DKQA 4RMGA 4R5MA 1S2DA 2UVQA 4TTSA 4GZ3A 2AN1A 4FSXA 1B41A 3B7PA 4HX5A 3E5NA 5B1YA 3WBFA 1OWNA 1XQYA 1A5TA 4O4HA 3UANA 2EDAA 4D26A 4B6EA 5BV0A 1WDLA 4PZEA 1P9WA 2O4UX 1R12A 3T1TA 4U9HS 1T4GA 1U04A 2QORA 4D7AA 2P2CA 2FW9A 3KB1A 2VA8A 4HWOA 4AN0A 3EN0A 3HCDA 3FLAA 2D8AA 4TKUA 3DB1A 3T3DA 5AUOB 1PWHA 5CFLA 1K08A 4KX5A 1RP7A 3F46A 3SBOA 3TL3A 2ZIFA 3I4FA 3S5UA 5IJ0A 1G59A 3SIRA 1MIOA 5TIIA 3D1JA 4FYKA 1XTTA 3FUVA 4AS1A 3FNEA 5LQSA 2A88A 3VUEA 1RXWA 3GNSA 2C82A 4NCKA 2CL7X 3RVDA 3SC4A 4NBVA 4FBMA 3O5AA 1GADO 1NBMD 2HRCA 2L69A 5AJTA 2IOFK 1ZNZA 3SCZA 4UEKA 4I1UA 2HDWA 1FMCA 2WJJA 2I3BA 5LZ4A 3BORA 2UZ1B 1STOA 2YHIB 1RWNA 4IO1A 4V2IA 1SG9A 5EJ7A 1KMHA 1RC1A 2D00A 2GM9A 3A10A 2BZSA 3AEUA 3R77A 3VSCA 2WF9A 3WL5A 2XOEA 2A5DA 1UK9A 2HWXA 2OAQ1 2XNDD 1KZ7B 3GYGA 2OQ2A 3OLWA 4IP0A 4U2BA 4M49A 3VR5H 4HXGA 2ZSUA 4YI5A 4BQNA 3LDAA 3LOPA 5JZOA 2TYSB 3BL8A 1XAJA 2QN9A 2MYPA 2XUDA 1Z2CA 4Q9KA 3WNVA 5IN4A 5M29A 1SKBA 1P1KA 2G70A 1U2EA 1BEEA 1N2CE 4BN0A 1PEYA 1VXOA 2AOVA 1WMBA 2IYEA 4P53A 4M53A 1AVTA 1L7PA 5HKKA 5J4LA 2C4TA 2XB4A 4CQMB 3GLFA 4REQB 2ILTA 1L5KA 4TSFD 3I04M 3CG4A 5DI3A 1GZ5A 2ERYA 1NLUA 4FE3A 5JZVA 2VAXA 2H11A 3JVIA 3DOJA 2E4WA 3KT0A 4CGZA 4DDVA 2G1JA 3BXEA 4XWTA 4B84A 5FWDA 5I7FA 4DIBA 1DG3A 2ONJA 2CSXA 5ALZA 1Z18A 1TE2A 1Y9ZA 3A7DA 4PICA 3V4VB 4DNQA 2O8EA 2BFDB 2XWSA 4BEWA 1M5RA 4BX0A 2X6QA 4GFDA 1AN0A 3HVUA 3M1IA 1DE0A 2JJ1A 1QIIA 4GOKA 4Z0NA 1C1DB 4HPWA 2HAEA 3FZEA 2I1WA 4D3SA 4FEYA 2C84A 1PR2A 3QGMA 4HQ0A 5FOVA 5EIEA 5K0JA 2HJ9A 3HO6A 4WBNF 2C59A 5JPIA 1SWWA 4KBGA 2BJVA 3CVXA 3ZBUA 1K6EA 3EOZA 4W9RA 4QGFA 2XTNA 3FVTA 1Y4DE 3K4QA 3VZQA 3A06A 3T3MB 5FDFA 5UKDA 5KHLB 5MN5A 4IGFA 4L7VA 5B1IA 1G3MA 3CPEA 1QHYA 1UL1X 4P4UA 5HCNA 3FTPA 5JNTA 3COJA 1Q50A 3DE0X 4NLLA 2D7DA 4F86A 2K2QB 4HSEA 2ZT7A 3K09A 1VL8A 3HKBA 3ZHCA 4PY2A 1I4WA 3OE7D 2A1UA 1UINA 2E82A 2QZ4A 2VTDA 1Y7TA 2NU7B 3WR5A 4NFHA 2JGLA 1M2NA 3IE2A 1SNYA 4E1AA 4A6PA 5THXA 1I3NA 1H3NA 5AK0A 4E6EA 4ZCIA 1B7GO 3UYLA 4BCCA 3WMFA 4J4HA 2I6XA 1G7RA 3SYRA 4BCDA 4C4RA 3N6RA 1N25A 2FFJA 2AZXA 2ZQZA 1CJVC 2I65A 3REQB 1M5TA 4BMSA 3U6KA 1B8VA 4TYQA 2KBEA 4HDNB 1DCTA 3T99A 3JAMA 1QE3A 3GZ4A 3PCXA 1TCBA 1MPXA 1IN4A 2QRKA 3I6ZA 5I4BA 1YI0A 3M70A 1T43A 1K86A 1GQYA 2BF4A 2HMWA 2JGFA 4TL7A 3IOYA 3LUKA 1BMQA 1R6VA 5J5AA 3E9RA 2JIOA 5KPJA 4JGGA 4M1TA 4D9KA 3HCPA 1ZICA 3M1YA 4OK6A 2E37A 3GXOA 4R1SA 4JL6A 4ROSA 5L6LB 5GONF 1OTYA 1LPNA 3LK7A 3NOVA 1CLUA 1UBTS 1B3BA 2IYSA 2VDRB 4Z6KA 2OP0A 4OAQA 4ODIA 1VYTA 4A0HA 2OQIA 4JJGA 2B98A 3GB9A 4D4GA 1C3OB 2JCSA 4IF4A 3UT0A 2GAOA 4AO7A 4IIXA 1Y7IA 3CZ5A 1GDHA 3A4MA 4JHXA 1SCUA 1OT5A 5KSZA 1PLLA 2VH1A 2N47A 5JC8A 1I5RA 1OV4A 1E3SA 2FEAA 4MWEA 3LXMA 1HO3A 3IP6A 4GVPA 221PA 4FDMA 4RMNA 1VMIA 3TW8A 4C6TB 2OB1A 3DOOA 3BQ9A 4DRYA 5KWVA 1LY1A 3BXXA 2W4IA 4QHTA 2FLWA 2A9PA 4YUWA 2QT1A 1RRCA 1EUDA 1RCUA 4ZOLA 3PPVA 3SDZA 2J3EA 1E3JA 1S3SA 1SG6A 1UXOA 2FPIB 3LTEA 3QYPA 3TGPA 2DBZA 2OUKA 4JZYA 4TV8F 3HWX1 5A9SB 3H1AA 1F60A 4KZKA 1I3MA 3TXAA 2V59A 3AZOA 4J0EA 3E84A 1BKSB 2VPYA 3DNFA 5JEDA 4O2AB 1LDNA 2PMKA 2Y0DA 1AQLA 2Y0BA 3OOWA 1JDNA 1T9GS 1H0SA 4Q7KA 3VGJA 4CT0A 1XU9A 3SBEA 5I6DA 1UWCA 2W6JD 2Y0EA 3LF1A 3WMXA 3SU8A 1PF7E 2VOJA 4H7HA 5TQ0B 3NIFB 2IX3A 3UPUA 1KZHA 1R4NB 1OPXA 4BLWA 3PE4A 1ONOA 3BD9A 5KC9A 3QK7A 1UT8A 2CWWA 1EHYA 3RRMA 4HVLA 1TZKA 1IG3A 3MSXA 3RRNA 3JD1A 1MVLA 1W34A 3PUHA 4FI3F 4B44A 3GLIE 4IUCS 2V7VA 3O03A 1MW8X 1JEYA 3SIWA 3LP6A 4JI8B 3IV6A 1VZ2A 2BEKA 1A9XB 4F1JA 4NK5A 1G4AE 1QHHA 2JGNA 2VAWA 1POWA 3DE7X 4LCJA 1OHHA 3KE9A 2BGRA 3Q12A 3K53A 4X00A 4Y0VA 1O4WA 2IPMA 4WNIA 3MJHA 1QGED 4RZIA 3ZX5A 2G82A 3MRVA 2UUCB 1FVHA 1TECE 2O2IA 2BKXA 2CBZA 2CE7A 1J8QA 3TNLA 1WUIS 3M83A 5C7YA 1QGUA 2NO0A 2WU1A 3RRYA 1V3VA 3S5JA 1X38A 1NOJA 2P5SA 2OLKA 2W71A 3Q5GA 1Y7HA 4UBLA 4XWGA 5BUZA 1IU9A 1ZCAA 1HLGA 1NVVR 2HBQA 4HYEA 3S99A 4DLWA 1S4QA 3HACA 4HYQA 1TJ3A 3DVAA 1UFOA 4NPCA 3VKFA 4MLPA 3C2QA 4MJ3A 1JVNA 1Z56C 1A98A 2JGMA 3IJRA 3GP3A 1YRLA 4K9LA 1JIXA 1WU8A 1CUIA 2QTWB 5HFAA 4WOPA 3N0WA 3QHPA 3M9LA 2GPTA 3C3EA 3MT9A 2IF0A 4YDHB 3DBOB 1Z4JA 2BFOA 2XW6A 3MN1A 4PYMA 5JDCA 4HB2A 2YW2A 2BTQA 3AY7A 4I4TF 4Q39A 4W1QA 1XYYA 4A6XA 1LLQA 4EUKA 3CO0S 1NXOA 3CVJA 3KD2A 3QQPA 3I28A 4AZ0A 5LL6P 3VBEA 1EGMB 2V5VA 5HF5A 5TF0A 1RC0A 1M1XB 3IEIA 3V4OA 3MINB 2VCEA 2WPNA 3VDMA 3L8MA 4LVNA 2PIAA 4QGGA 5F2KA 2DR2A 2GCGA 2Y9PB 1N3IA 1OGJA 1NTRA 4HDRA 3HU3A 4MV8A 5JSKA 4P2BA 4JEMA 2R00C 2D0IA 4K7JA 4MR9B 1X80B 4PONA 4BYMA 2Z3ZA 1DCKA 1OXSC 2HQBA 2W2OA 1LLFA 3GUUA 4HZUA 5EL0A 3AWIA 1KEEA 3UENA 1XNHA 4LZWA 3K8OE 3PITA 4NMLA 2VT7A 4XX0B 4PX2A 4JV5B 1QRRA 4FYJA 1FF9A 2VK2A 4J0IA 1FLAA 1GLGA 1G291 1MU0A 4OP1A 5K3FB 4W5NA 3LRXA 4EG7A 3P9XA 8ADHA 3ETNA 1VBKA 4S12A 3T9FA 4RNCA 4HSGA 1DHRA 4IGEA 1SHZA 3NHAA 2GF9A 5K0SA 6YASA 4C7OA 1VMAA 4CQJA 1YULA 3HBAA 1GNVA 2G7ZA 2WLSA 4ZVPA 4PNPA 4LXGA 1JLMA 3VOAA 3FPLA 3IPLA 4A4DA 2H2GA 4ARAA 1GA6A 4BGEA 1Y6FA 4PANA 1E6KA 2Q5FA 2PH1A 1C8KA 4CLEA 3F3YA 3Q7TA 1RQNA 3BH6A 3E18A 5DGHA 1EU1A 3LCCA 1GGFA 2VDPB 4BGDA 1FSFA 1MXHA 3GGPA 5IAKA 3UHPA 5JHGB 3H4MA 3HI4A 4NDZA 2HWWA 4WCDA 1IEQA 1LNQA 4BNTA 3ADKA 1WOYA 4DAEA 1K7FB 4QXAA 5DNEA 2CV2A 2WM8A 2OKCA 3O94A 4AWXA 5D51S 2OXIA 5FD8A 1W85A 1PJ4A 1DO0A 1HORA 2PX8A 3BIOA 3BWEA 4KXXA 1LF0A 3DE4X 1YZKA 4L28A 5DXJA 1GZSA 5JS2A 4DCPA 2JLWA 2F3QA 4OI2A 1VJ1A 3H17A 1SQFA 1H2AS 1PFUA 3GCGA 2PUFA 1YQDA 5AD1A 1S2IA 1Q5PA 4BQRA 4DIFA 4RTOA 2WE8A 3KPUA 5AHWA 3FFBA 2PG3A 4Z2YA 3KQKA 1OI2A 1FNCA 1H5UA 3IDQA 1XB2A 3Q98A 1L7NA 3CX7A 1Z88A 3DZHA 3ORRA 2GBFA 2Q9CA 3GLUA 4PGMA 4DT1A 1YJ8A 2PWZA 1IONA 2FNAA 2PX0A 2QJWA 1M54A 2P3LA 1ANKA 4YRMA 1Y6QA 2XT0A 3ZJUA 3VHXA 3QMPA 3EA0A 4OX9B 4MWGA 1CRPA 3G7UA 4FOPA 2B21A 3BF7A 2V6GA 1SA0A 1ZMXA 1CZHA 1CZNA 4YCJA 1P81A 3DW3X 4P5EA 3QH4A 3OLVA 3VDQA 2GXAA 2GZHA 3AOGA 4L8YA 1SUFA 4I0WB 3KCQA 5FBHA 3FMFA 1EFRD 3G2OA 2CJFA 3V2GA 3K70D 2FWIA 4GR5A 2NACA 1VKOA 3T4XA 2CXPA 4DUYB 4Z4GA 1QZTA 3PLAE 2FVXA 3M82A 4C6RA 3IURA 1EK6A 2VUSA 3JZIA 4LBYA 1NWCA 3EZXA 3FLBA 4UKDA 3R9KA 4L0DA 2B7CA 4CV1A 2QTVA 4PSUA 5H5JA 3QEBZ 1EKXA 1P0QA 1SCIA 3QXJA 2I2BA 4V03A 5TS3A 3TB6A 1GPUA 4FMCF 5FR1A 2ZUEA 2X8JB 3I12A 1ECJA 2ZZNA 5IDYA 4O4IA 2PS1A 1N2BA 2PWAA 1RQ7A 2CJWB 3HYRA 3TR5A 1O6FA 1E92A 2Z2KA 1YDHA 4RAQA 3WKCA 1JEDA 3G8BA 1DDGA 2WKPA 4XLZA 5LOVB 1T0HB 4B6JA 4B2YA 4EW3A 1EI9A 2ZIUB 2JLYA 4GYWA 3ZWMA 3WXMA 1UK8A 3ZPXA 1S9HA 3GGSA 1M2HA 2CJPA 5K6RA 1T9GR 3WLKX 4EGQA 1K88A 1XMJA 2E4AA 3T5CA 3FIUA 4WVLA 3VZSA 1FS4A 5TEVA 2QEQA 1PUJA 4JI6B 4F3NA 1P4JA 1X70A 4JLAA 3TAXA 2V4UA 3M6WA 5EKDA 3STVA 5BR7A 4CL3A 2C4WA 2I9PA 1Y48E 2QL7A 2QTTA 1HURA 3B51X 1M33A 5ALNA 3SZRA 4LF8B 4J9VA 2O59A 1EVQA 1KSFX 4P6VF 3DOEA 4Q66C 3NBKA 1Q0SA 2V0NA 2JEZA 2I78A 4G0ZA 3DFZA 1N78A 2WTNA 3DGFC 2QN6A 1TO6A 2DXIA 2J3HA 4DCSA 5JATA 1S2MA 3LPDA 1T2AA 4Y1EA 2AR9A 3SVLA 4Y3UA 4B6PA 2FJPA 3LQKA 3M6FA 4GPD1 3EXEA 3LU1A 3TLGA 5FWYA 3S2SA 4ZI7A 4QDKA 2XEDA 4CM3A 4OPMA 3D8NA 2DJIA 1NJ2A 1T2EA 2MOKA 3E22A 1BVHA 3ZHXA 3N7UA 3QJ5A 5CJJA 2BI7A 3OCWA 1IK6A 3KNZA 4BFYA 2XNSA 1ZGCA 2CNLA 3FVVA 4ZVOA 3C3AA 3TTWA 1JI0A 2Y4OA 1C7EA 1EH5A 3C7CB 4QPDA 5ALKA 1NJGA 3AFOA 2GFHA 1J2YA 3A6HA 4FHEA 2A0XA 3OCCA 3GMIA 4HX9A 5KAMA 3COWA 3EYWA 1G8PA 4NMWA 1OZHA 1JAIA 3K35A 3H5WA 1WCIB 1DOHA 4XD7D 1O5IA 2I3AA 5FBLB 4BNUA 5FAKA 5KX5A 1NSFA 2Z8XA 2XWBF 3NWOA 4HDSB 2VSOA 2QTAA 1NBHA 3BX1A 2F2TA 2G5GX 2UZ4A 3FR7A 1E63A 3EFHA 1RD4A 3QKSA 4ZCSA 4OEHA 2DETA 4EP1A 1PUIA 1YDFA 1V1MB 3OEHA 4B33A 2FDCA 2VN8A 4J4TA 2IHUA 2AR7A 2VPPA 3TZQA 1PDWA 1E3LA 3FKJA 2IW3A 1SG0A 3JQAB 1KE1A 5JSQA 4EMUA 3HFJA 5ALJA 1EQ2A 4N3CA 1RZRD 4JI7B 2V7PA 1U2DA 1T3SA 3HUDA 5IM4F 1NT4A 4TL9A 2EP5A 1KJWA 1NU6A 4Z0HO 3A25A 4IIGA 4LSMA 3PTZA 4M1WA 1AY0A 5B30A 3MHTA 3KWLA 3ZBPA 4Z4IA 2ODNA 3ECCA 4DCNA 1WXXA 4BLOA 1K4YA 4WSOA 3OIDA 4AUMA 2FPGA 4R0VA 4PLGA 5FUMA 4BNKA 2DQKA 3BGDA 3F6PA 4GSKA 3LQQA 3AJ8A 2I76A 5TQJA 4RQTA 5CNIA 2PU5A 5J47A 2CL0X 4ZT4A 3JAKB 3GRUA 1VB3A 4MYUA 1V45E 1O96A 2DPMA 1GVNB 1C8VB 1ZM4A 2I54A 3ZV6A 2YZNA 5KZMB 2Z9BA 4B3XA 1VKJA 4WN3A 3CBGA 4IKOA 4E14A 2MSEB 3C39A 1T6XA 3L7BA 1VC2A 4GZLA 2RK6A 3RJZA 1MCZA 2QIOA 2OYRA 4BYGA 2VT3A 1FY2A 2EC5A 1RLIA 2IHTA 3NTOA 2CSUA 1ISSA 3OZVA 4FSDA 4LQLA 4RDIA 5CB6A 1Z5VA 1M8KA 4MUAA 1EFPB 2O8DA 1MJNA 4ZI3A 2HSJA 4RABA 4AD8A 5B7PA 3HVKA 4WCFC 4DIEA 4GLJA 4YR7A 2GK6A 1H85A 1KMMA 1G5PA 2ZUDA 1KFEB 4J91A 3U4GA 2R6GA 4WN9A 2I87A 2PS9A 3A6EA 5JCOA 5KYXB 5SYAA 4FVTA 1RPZA 1PL0A 3HB7A 5LZ5A 4BQFA 1T0PA 1VSUA 5GAJA 1VYVA 4DR4B 2XLBA 3PQ8A 2XDQB 5EUMA 2WHPB 4GP6A 3FOCA 4IIFA 1R9GA 4AX8A 1R4AA 4HN2A 3AEZA 4OSPA 1OMOA 1P29A 4O5AA 1KERA 3AYZB 5EA2A 3RTDA 3PBKA 1DFHA 4A0SA 2LXNA 1UANA 1P75A 1QKIA 2OHXA 3PGMA 4M9QA 2AFRA 5F23A 3IT1A 2CXTA 2XBLA 5B2FA 4MI3A 1KI4A 7REQB 2DPGA 1GSHA 2HF8A 3BSSA 3OM9A 1U2TA 2IV3A 3LCVB 4X20B 4I99A 4Z9XA 4H1TA 4V0OA 5LQNA 1PSDA 5ELLA 5J5CA 5AVYA 1BWRA 3B52X 1FP1D 2ZTVA 1NR1A 3I6YA 3OCJA 2QRVA 4N0PA 3MF4A 5CX1A 2R1ZA 4MA0A 1DQYA 2F64A 2II6A 1E9FA 1OAOC 5LA6F 2J6BA 1B74A 1Z29A 3DAYA 3O47A 2DX7A 1MENA 3DTTA 3LIPA 4N6NA 4PZZA 4R98A 1E6MA 1JVSA 5AMXA 1DIRA 2EW2A 4NV3A 4M1SA 2P9FA 2R68A 3D6MA 5KCMA 2COEA 4LY6A 4P86A 4PTZA 5LSAA 3BKXA 2C9ZA 3GUYA 3DVSX 3M89A 2O2HA 4JL5A 5AVTA 3GJRA 2HHHB 4RENA 4H6PA 3K6RA 1ENPA 5JAQA 3UJNA 2W2LD 1AQJA 4KQ1A 1R8QA 2O2ZA 3BIJA 4B2PA 4RQBA 3SJAA 4EF6A 4PQYA 4ZYYA 3EBPA 3V1YA 1IXYA 1SU8A 3HXKA 1JE1A 3KXLA 5CCBA 1CQJA 3GAZA 3ZWAA 1TU3A 3KQTA 4EJSB 2P75A 1QCZA 3O8CA 3FDJA 4QGAA 1PQWA 3H84A 4UXIA 1CZOA 2BHTA 5DGCA 1KDZA 4ZGGA 4L5YA 3AJDA 2XSZA 1UIRA 3HGQA 2B4KA 1ZFNA 3B8HA 1JJFA 4ZKDA 1RQPA 4GLLA 4JWTA 1P0MA 5HIKA 1I6KA 3X2FA 3K4PA 2BONA 2G6TA 2OCLA 3GGCA 2IQ5A 2R6ZA 4OB8A 5BUCA 3L0OA 4A8PA 3JQEA 4D9JA 3R3XA 4M7OA 3IUBA 4OK3A 2DSNA 3L77A 3PI7A 5HG0A 4CPDA 4R7TA 2JLBA 4I1SA 1VI6A 3IERA 4JJZA 4X92A 5ES3A 1X86B 2GKGA 4KB5A 5L3VA 1SU6A 3X44A 4DVGA 3A6JA 5JD5A 1NVDA 2VRCA 5AVWA 3DUFA 5JYEA 1J0CA 4HH0A 4M98A 3FA2A 4KBYA 4FQ7A 3IO3A 1PJBA 5IC5A 3E3AA 4A5OA 1EB8A 2JFFA 2IVFA 5ITWA 5LBUA 1O94A 3RW9A 3KEOA 1R8JA 2HV8A 3EC1A 2AC4A 2B37A 4KRGA 1QK5A 3ADCA 2A4KA 3PUKA 3QVUA 4KR7A 1NXPA 2BGGA 2OBMA 4RS4A 2C9BA 1F4LA 3UKOA 2Z4TA 3BFPA 2QWXA 3G5LA 2GF0A 3MCZA 4FT2A 3HI6A 4H31A 1V11B 4ND8A 4GSYA 4OY3A 4QRHA 1TZCA 5JO0A 1QX3A 1MDFA 1SUWA 1K9SA 2GT1A 2TMYA 3AGQA 1EE1A 1ZU5A 1YB1A 4L6IA 2L0XA 3HSSA 4Q82A 5HUQA 5CT4A 2OVBA 3FN4A 3MYRA 1QR2A 3SZUA 4BP3A 2AVNA 4F4IA 1JZQA 1DL5A 1O8CA 3BD7A 4MAAA 1SVWA 3EXHA 4FN4A 2OHOA 1P5FA 3GYBA 3FB1A 3LP8A 1PS0A 2V9CA 3RSSA 3DFKA 4QASA 4DQDA 3DJFA 1GT91 2VAPA 5HM8A 4JB0A 3B2NA 3GNQA 3IODA 5IARA 1I1OA 1EG2A 3RYCB 1W52X 2A86A 4CQLA 2WU4A 2BMVA 3AG5A 3B12A 2Z43A 2GEVA 2YVAA 4FT4A 3H5TA 3VSAA 3Q15C 1P1BA 1B1AA 2VJCA 4II7A 4RF3A 3S2YA 3DZ8A 1KO8A 3E82A 1XNJA 2DAPA 4E09A 1R5JA 2X3YA 2QENA 1VI5A 1DUSA 5HYVA 2FK7A 2UUAB 2J31A 3LD9A 9ATCA 4WH0A 2A9QA 4YT4A 3I2IA 3GAMA 4CIAA 4OU4A 2I03A 4GQIA 3U3XA 3VC2A 2DH5A 1C7RA 4Z7JA 3NJRA 3OPVA 2OENG 1T1IA 1JJIA 1JR3A 3BN3A 3CZCA 3DT9A 2ZI4A 4P7GA 3RRBA 3TIFA 3TR0A 1VGVA 2JJ1D 2NN3C 3VV3A 2X41A 4TT3D 4E4YA 2VZ9A 2WAYA 4D8UA 1TA4A 1QTIA 1G60A 3S3TA 3B9BA 3H9CA 2PKYX 3AETB 4QOIA 4WLFA 3QE2A 2W22A 3ZU4A 2JCXA 1PK7A 3N0RA 4LGVA 1W2WB 4OJNA 1AGRA 5CA0B 3C7AA 1P61B 2BGLA 1W9HA 4NAUA 4WZ6A 4YMIA 3B6MA 2NNLD 3EBOA 5IJXA 1KI9A 1WXGA 3ZE7A 2EG5A 1NXTA 2RFLA 4HAUA 4PZAA 2HXGA 3MAGA 3MVEA 2YY6A 2E4VA 1BHQ1 3OBIA 4QIHA 2UUBB 3O75A 2EW8A 1G4UR 2DE0X 3GPCA 4Z4QA 3CSSA 3BC1A 4GGMX 1WSWA 2Y77A 3JQ7B 3ZDAA 4AMUA 2FKNA 4RNDB 1HQDA 1H2XA 2GQ0A 1OZAA 3M4NA 3TBKA 2VDUE 3LNCA 3LLUA 4XVQA 4HO1X 1D2CA 2O0LA 4BCBA 2OG1A 4UTZA 2GEKA 2HA7A 3CONA 3D2AA 3OIYA 4KX3A 5CYPA 1LQUA 2YQZA 3KALA 3UATA 3SZGA 3R44A 4BX2A 5JRJA 4HJXA 1PYGA 4MV9A 4NHEA 1Q7EA 1RYDA 1Y5NA 3V8EA 5GOTA 2FZLA 2G7MC 2VWHA 3FSEA 2ONZA 3MTQA 3P2YA 3Q88A 4F12A 2MWMA 1A7AA 1BXRA 5AK4A 3OP4A 4TKLA 1MZVA 3DE6X 2O0KA 4RGVA 4V0SA 4BMNA 4EFKA 1JLRA 4AG3A 1O5TA 4R2LA 1B8PA 2R7NA 1T5DX 3UUEA 3D7MA 1EGAA 2AJLI 4PG7A 2JI7A 1XLUA 5LZ8A 1RJFA 1SK8A 1B6GA 3PZRA 3AVVA 1KTVA 2B78A 1FNDA 4NE9A 3U4IA 3G23A 1JJAA 3JQCA 3O9VA 1ZHFA 3VPCA 4LJYA 3G9TA 4JASB 1LPMA 3RSZA 3M1LA 4YMVA 1AQNA 3NB0A 1UDCA 3VHRA 4DLXA 1T36B 2VIIA 3QWIA 3AOEC 3WB0A 3S2IA 4B3IA 3L0BA 4KN9S 4DAOA 2HIHA 5DM0A 3KWMA 2P41A 4O4HF 4AT1A 3AONB 2UU9B 1Q7TA 4AZWA 3G0GA 3OLXA 3OZTA 4KFSA 3I9OA 2HRRA 3R4VA 2W2XA 4B9EA 3U4MA 3OE4A 2GAJA 1XAHA 4GSLA 2PUTA 4FGUA 1XDZA 1QHIA 1ONPA 3BILA 1VGRA 5BV2P 1H4QA 1GNRA 3FTFA 2JLSA 5IAGA 1SBQA 4CEIB 1US8A 4PG8A 2OR3A 1YRWA 5F76A 3VOTA 3ZD9A 1LSUA 3TFQA 4N03A 2BV3A 4LWQA 3L79A 2AUTA 2VBIA 5F98A 1K8RA 3A1UA 3LLSA 1ISGA 2JIPA 2BI8A 2YASA 4MKHA 2W00A 4DG8A 2OGUA 4MJLA 3DNPA 3IT0A 1L5FA 1ZM7A 3R5KA 1YONA 1DOZA 4IHKA 5B4VA 4QICA 3PWZA 1S2GA 1UZLA 2NP7A 2IDJA 1PV4A 5K09A 2NNWB 4Q7JB 4UCFA 2GOYA 1OB5A 1ODKA 5E4TA 4ENQA 3FFXA 2FN9A 4KMRA 1OBOA 3OESA 5ALTA 1TK9A 1TLFA 4XIYA 1X0VA 4B8WA 4ECAA 4YDRA 1T8SA 2JI9A 2X8WA 1VG0B 3KPVA 3QVXA 4D5GA 2GHRA 2HQSA 3NEYA 3O74A 4C0XA 4BLQA 1J5PA 1GZ3A 2WG1A 3DZCA 1BOFA 1ZHOA 4RKWA 4HUQA 2IH2A 2WJYA 2OCAA 3IVMA 2FJ0A 3VKGA 1I33A 4AJLA 4AY4A 1RAIA 4HVAA 1RHRA 3G6KA 1E4VA 1KKMA 2ZB8A 3R8XA 1C0LA 1H4VB 2RBEA 1JQAA 1A97A 1E7RA 2WY2D 1O77A 2B25A 5TPZA 1MEJA 1MH9A 1RLOA 3CGWA 1N6HA 3EMVA 2ACKA 3IXQA 3PUXA 3VO9A 3K0FA 4D4KA 3K0SA 1GPH1 5KTNA 4QKQA 5TT0A 2Q6IA 1W8DA 2WF5A 1KFBB 2VHYA 2ZT5A 4RIFA 2ZR7A 4K1XA 5HFNA 2ZT6A 3DVQX 2VQSA 2A0YA 3JATA 3TDNA 2Y99A 3PFGA 2VQDA 4EO9A 4Z1MD 4DBLC 3TKAA 3GUCA 9LDTA 3CTMA 3KOMA 3OZBA 1KI8A 4G01B 4E11A 5TJ9A 1ES9A 5ADWA 5LZ9A 3KV1A 1MR3F 2W2KB 4R7GA 3NALA 2AKAB 1JAZA 1U2ZA 1F20A 1I4TD 5ALIA 3MXOA 2RGEA 1N2ZA 1ECBA 2I6QA 5EP3A 4CTOA 5C81A 3DHVA 4YFYA 2ETVA 4IEIA 1YDWA 1R8XA 3P9QA 1T9CA 3A6KA 4DYHA 2JI4A 1AD2A 2GXUA 3ESQA 1U0JA 3KT3A 2QX4A 5AM4A 1GD1O 4B46A 5TGZA 1QQAA 4OI4A 1O08A 4E2XA 2ACVA 2CZQA 1PJLA 2C0CA 5DM2A 5HQTA 5KINB 1RM5A 2RHLA 4YC7A 3M49A 3IVAA 3GCDA 3N3BC 3QSGA 4RCZA 1NSYA 2ZFUA 4MINA 1O54A 1XWWA 2ZI5A 2FP4B 2BFNA 4JP3A 4E4TA 1P2TA 1N5OX 1Q7RA 3G9UA 3QM1A 5BNZA 3GOQA 3PNOA 2G9VA 4HNTA 3BZUA 2AOUA 4OBXA 4YHBA 4EHJA 4ZICA 4MDYA 2OYSA 3A4LA 3INRA 3SC2B 2ZAOA 3PDWA 4GT1A 1KIFA 1KH3A 5BV1A 1A95A 1Z5NA 2ZSEA 4IW3B 3TQSA 3S29A 1MW9X 2B8WA 4NRDA 2FF5A 1Q3HA 2DR3A 4H59A 5AH0A 5DCUA 5C8XA 3TQOA 3SWWA 3UAZA 4KAJA 3E48A 4OXNA 3FYUB 4IZ6A 4Y67A 5EWMA 2W6ID 5I7WA 5EIWA 2C1XA 4TXLA 5FNVA 4M0KA 1Z39A 4E7PA 3N07A 3IBFA 4WFKA 5ICMA 2PKQP 2AEJA 2I4OA 2W0SA 4XIGS 4ZPXA 3EMKA 3HNPA 2WIAA 1GPJA 3QWAA 5JROA 2GCEA 4XWYA 3HO8A 3BMQB 4DLAA 2IPLA 2GLTA 2JIQA 4GDMA 2AR0A 4R2HA 5DX8A 3JARB 1EM6A 2FG7C 3ZH9B 3CPHA 1A69A 1GWNA 2AF4C 3I6BA 4HC4A 4WOBA 3T38A 3ANTA 4D9HA 1PBNA 4A2PA 1QU2A 2D06A 3JRXA 2H92A 1WQ1R 4KUEA 5EZYF 3RRFA 1PL6A 4MGYR 1E5TA 2PRSA 4EQ6A 2YN0A 3ZGVA 3I52A 4Z9AA 1HDZA 4C0HA 3KOOA 2ZETA 4PLYA 1J0EA 3RUFA 1OD6A 2Q6OA 5I7AA 4TS9A 4F93B 5CTJA 4JJ7A 2GZAA 5BSMA 4YECA 3FHLA 2OHIA 3SFVA 3EIQA 1LCIA 2R5FA 4KK4A 4XFJA 4QQ8A 2QGNA 3GBPA 1F12A 2IU6A 3SZLA 4ANFA 4F91B 5CH3A 2J0SA 3ITNA 4ZOLF 3VYVA 1MC8A 2NO5A 2WTAA 1GGJA 1J2TA 5D86A 2QN7A 2I1LA 2XMBA 2Q07A 4PX9A 5JSYA 2PRZA 3C98A 4L8GA 4V3CA 3RIYA 1AZLA 3UKDA 4KRFA 1CG6A 2R60A 5I01A 2GTHA 1R0YA 4MS3A 2YYSA 3FM9A 5B36A 3HWRA 2FEOA 4KQ2A 3OBBA 1T3GA 2B36A 4DNPA 5IH7A 1SURA 3ZWXA 4DTCA 1F17A 3QLTA 2I6UA 1ZOOA 1IHPA 2ZPTX 2BF7A 1X7WA 4NFLA 1DBVO 3GOHA 4OMDA 4RYDA 5C1IA 2IS1A 3MUFA 4R9VA 3GRKA 3HDVA 5ER6A 5JBQA 4LRSB 3FNRA 4IXWA 1C0EA 1O95A 2NW6A 3EMDA 3K2BA 3CR7A 4IGIA 4MS4A 5M7EA 3HP7A 1ODCA 3F90A 3I64A 3PDIB 1UDRA 3BICA 1K97A 2A9RA 5IX8A 2KW5A 3MWEA 5EJMA 1BFDA 5KVSA 5KVQA 3WDMA 1ZOLA 1G3QA 4MTLA 1NF9A 2XBMA 4PV7A 3E7PA 4LMBA 1B16A 3C48A 1X9HA 3S28A 2PVPA 2H4XA 4BFZA 2FU5C 2VNHA 3AVYA 5BORA 1VJCA 2WJZB 3CEMA 2XMQA 3E4DA 4L78A 1V16A 2OM6A 2WM2A 5EAIA 5CFOA 3UBTA 4ME6A 1W7AA 1ULTA 2QYTA 1YNOA 1TTPB 1E5XA 4H0NA 4IS2A 4MCHA 3L1KA 5L95A 3MS7A 3NIBA 3Q10A 3ZLBA 3D9QX 2UV8A 1V1RA 1VLVA 1XV5A 2ZJFA 1UEIA 2CLLB 5DB4A 5EZ5A 1UPTA 3GZNB 3T06B 4R71A 3E5MA 2H00A 2H1RA 5J59A 3IKVA 4HKTA 2PSDA 4EF5A 4LMRA 4HZIA 2PYIA 3HG7A 4IWNA 1QZZA 5BSEA 2HRDA 5EIAA 3E8MA 4DLVA 5K7SA 5GJCA 3M6AA 1JHQA 3JALA 1NMXA 3VXKA 3BXGA 5TVGA 1Z33A 1RBZA 2B7LA 5B6IA 3U7RA 1FW6A 3IQIX 1Z2EA 2XQJA 2XT6A 3S1LA 1Q3TA 2INGX 1B8NA 1CUYA 4NI5A 1PJRA 4EHNA 4PM4A 1G5HA 2C7OA 3BHNA 3A3OA 5BW6B 1N5RA 2AFIB 2RHCA 3OP1A 4IG4A 2OC9A 2YV4A 1V48A 3TRFA 3VTAA 1B6RA 3EWSA 3GU3A 3V48A 2REQB 1B2LA 3B3FA 1WTAA 2GK7A 4BVEA 3LGSA 3DEZA 2ATXA 3A36A 4Y2SA 3I2KA 3GPBA 4OYLA 1P0IA 2WSSA 3PNPA 3ICPA 3VI4B 1R4MA 2UYOA 7ADHA 1G8KA 2BEWB 3FVRA 3MGKA 4MQUA 2XIJA 3AUKA 1VZ3A 4OQXA 1GHTA 4XCQA 5CT6A 4P4SA 3SZ3A 1YVPA 2DFNA 3TQHA 4ZTUB 3SNKA 4I1YA 4H08A 4BP8A 3KSAC 2GR9A 2IZ6A 2PMDA 3RI3A 1YB6A 3W1EA 2IZOA 5IBQA 4LZNA 3G68A 4TKVB 1A9YA 1DJLA 1ZSNA 1DTWB 2ORED 3OU7A 4PO9A 1P9RA 4BO8A 1XZBA 4ZOBA 5AOVA 5HRCA 3PCRB 2R8XA 3QVTA 3ECAA 2HJVA 1RCFA 3CF4A 1Z26A 4WASA 3WLJA 3F47A 5KTTA 2NXWA 1EMDA 1Q0HA 4FKMA 3OQPA 3UV6A 1BA3A 1T6YA 3B7WA 1DAGA 2J9FA 2Y1WA 1MC1A 2Z95A 3CU5A 3MOIA 3KLNA 3FNHA 2GN0A 2A2ZA 3OEHD 2V6FA 2JDIA 1P1CA 4OQLA 5HILA 2ZCVA 3STYA 3P9KA 1OW3B 1TJYA 1EVEA 2CB0A 3IFSA 4ZGBA 3KKMA 4QHYA 2PKXA 4QUJA 2QN8A 4P32A 1W4AA 4I1VA 3D6UA 1BTOA 2CFTA 4LZLA 3OJCA 1UJCA 2BDUA 1QDLB 3NYRA 4AJIA 4YQZA 2Z58A 5JAPA 4XUCA 1WPGA 4I5FA 4L7QA 3L7KA 1HDXA 4H4EA 2KE5A 3QLUC 5ARDA 4CE6A 3Q85A 1D6NA 3MM4A 1Q0ZA 3V4LA 4AKIA 1CUGA 2P9QA 3CXRA 4WBNB 3LX4A 1O57A 3DKIA 4RTQA 1WUHS 5FT9A 3THRA 4D6YA 5HP4A 4JQCA 3PHIA 5I7EA 1BX3A 3P9ZA 3E1KA 1ELOA 5U4XA 3RSQA 3TZEA 3PHGA 2FPRA 4UNPA 1NNI1 2FSIA 3FCUB 3HFRA 3U1TA 3HRHA 2BTEA 2WNHA 4RHFA 4PZUA 4WZBE 5KNDA 2A30A 2RGNA 3BMCB 2G5PA 4I4LA 3ZU3A 4DXAA 4G0UA 3AVTA 2NT3A 4KN6A 4PAGA 2RKWA 2BEVB 3K9HA 4KP7A 5EYPA 5KNBD 2XHZA 3QU7A 5D7BA 1X94A 3I8OA 4B47A 2HCRA 2Q8NA 4QNMA 4UM9B 2O8NA 4AMGA 2HADA 3FPAA 5A7FA 3T1YB 4RLQA 2FPLA 2F1OA 2AXPA 1YU6A 2IYAA 1PAUA 3V7WA 2OBLA 4CETA 3IOBA 3L6RA 3IR7A 2RAVA 3L8FA 1WZCA 4DC1A 1SBIA 4RDCA 1AXGA 3PEEA 3HTXA 4EW6A 3V7YA 4YRFA 2AKEA 4FC7A 1HOTA 4CG1A 2P2GA 2C5EA 1OWPA 3OWHA 3RBZA 1SIBE 3LFTA 2BM9A 3FDFA 1W59A 4E21A 3AU8A 3NFRA 4KR0A 3QVVA 1L0BA 1E61A 1V25A 4QDJA 2GEUA 1FFEA 3BIWA 2AK2A 3HJAA 3O8QB 1WR8A 3HB1A 3MC1A 1ZA2A 3U7EB 1FZTA 1ILEA 3A3NA 5GONB 1CY7A 3RS3A 2EJVA 3RU2A 1JIVA 5JAIA 2HA0A 3AR4A 3C3KA 4BKQA 3ZJVA 4O4IF 4YRAA 2VEDA 2ZRCA 5TRTA 2QMZA 2EJBA 1TFUA 1SO8A 4JC4A 4XI9A 5HQJA 1T5LA 3MEQA 4JYCA 4YP6A 3R7NA 4KFCA 2ZIVB 3TJZA 2RGXA 3DBLA 2YHBA 1NBAA 2AF3C 3MCVA 4WTOA 3GJSA 1BSVA 1HG1A 2VDJA 1WXFA 1UAGA 5L6MB 2HR1A 1KKLA 4QPJC 2XYRA 4OHMA 4L27A 2Y1EA 4AIIA 1CUUA 3UMSA 1E3QA 2IP1A 2YWEA 5DGTA 2OLJA 2B4AA 1GG9A 1P8JA 4LZOA 4YAKA 2YV2A 4D2IA 2J85A 2JFPA 3ZIDA 1VG1A 1K1EA 2Z6QA 3S8EA 4TV8B 1L3BA 3C3MA 4BO1A 3ZJYA 2DHCA 2PUVA 2H2IA 3PT5A 3VOBA 4JQSA 3KP1A 4FSHA 4LNUB 1QANA 2YN2A 4RMHA 5KYYA 1CT9A 3PFWO 2BLLA 3QVSA 4U39A 3B36A 5FBKA 3S7TA 4JUAA 4LNAA 4EEXA 5KOHB 2J3LA 1RM3A 1WQ4A 3E1SA 4OB7A 2MSLA 2FR1A 2PGOA 3V1UA 1K8XB 3EVTA 3LC0A 5EE1A 1Q21A 5I8ZA 4B74A 4ZQFA 5JVDB 2BOVA 1MHPA 2XI4A 3EZ7A 3N05A 4IRXA 3IP1A 3VH4A 5K0EA 5HJ2A 3TG8A 3PGXA 2CBGA 2XSZD 1UH5A 1QXSA 2I2CA 4G5QA 1N8NA 4TXJA 5T4HA 1DAIA 3DV9A 3RT1A 3HXOA 2OPBA 4GOMD 1P4GA 3O8NA 1HYBA 2ZPUA 4XEUA 5FL7A 2ODBA 1NUSA 4UBKA 3ZQ6A 1XMVA 1XTPA 2H2AA 4I8IA 3I1JA 5DBOA 5KPDA 4BNGA 2ZBQA 1EZ1A 1UC4B 2V74B 3NV7A 3NBXX 3R3VA 1NF8A 3A3PA 3LS2A 3NYQA 5F64A 3N8KA 4HGRA 1G6KA 2H1FA 1ZPDA 4YROA 4PF1A 1D0SA 5G40A 2ADOA 1BVUA 3ND9A 3NRBA 5LU8A 4LE1A 2EKLA 1Y1KE 2CKMA 3LH5A 1ZI9A 3MT7A 1M3SA 4ALNA 1NW3A 1TT7A 4JLKA 4RL4A 5EHQA 3HXPA 2PSEA 2XVYA 3FD8A 3EXG1 1PFYA 3H18A 4C2AA 1E1YA 4LG1A 3VSEA 4ZYXA 3HCNA 3E7XA 2NV0A 2WHXA 3I61A 4QUDA 4H35A 3E9EA 1FSPA 3PYLA 3PJEA 4MYHA 2RAFA 2VBFA 3R0XA 1HUQA 3KKZA 4B4WA 3AHCA 2C95A 2H2HA 2R2AA 4I4TB 5ENZA 3RUHA 2CFOA 2QR2A 3R0QA 1M0TA 1LU9A 4P83A 1G8HA 2G09A 2F1JA 2WIJA 3VR6A 3FPSA 3P9NA 2VLBA 3LUJA 5T8KC 3LVBA 2ZJOA 3FHCB 4D80A 1ZMBA 1X9GA 2VJAA 3EIOA 4KXVA 5JNWA 2I0FA 3R40A 1DQRA 1JDTA 2VRNA 1ZWLA 2AEFA 4DG9A 3U19A 3K0BA 3QI2A 5DCWA 5KEIA 2AOWA 3KM0A 2YMMA 1TM5E 2HCFA 2ZXFA 2E21A 4U2DA 2MHCA 5FFNA 5TF4A 1W0CA 1YZYA 2VF5X 1CUVA 4OGWA 3BERA 5JCJA 3V00A 1YBAA 2JFQA 3FE2A 1Y81A 4X7MA 1FUKA 3ROZA 4ZMSA 4OGKA 1LBHA 1YJQA 1RMQA 3AI1A 2Q2OA 1FYFA 2BEJA 1RYFA 4LAFA 4JI3B 3B6EA 3K2IA 121PA 3IHWA 3KJGA 4NULA 5AW9A 2AJDA 5F78A 3ZZNA 3LHSA 3GLVA 4BL5A 1S1CA 1CW2B 1SHJA 2RHBA 1TW2A 1YCDA 1PVVA 2BFBB 4QOGA 1QOPB 2QR3A 3MUOA 5DLEA 3U61B 4JXJA 5F9FA 1IDN1 2MCFA 1TZMA 4ZTBA 2NSYA 4DLZA 4DHWA 1RQ2A 1N6KA 3QP9A 3RU7A 3S1AB 1EXDA 2J41A 1JR3D 3PB3A 4DDUA 3BDIA 8GPBA 1KI7A 1VI2A 3LRTA 3DL7A 4TTAA 3ZE9A 2J7KA 2X0NA 5F73A 4CIYA 5ESDA 4Q16A 2OAEA 2P78A 2O48X 1Y0BA 1WTCA 1ZBQA 5F52A 5BRAA 3KKLA 3DNMA 4QELA 4QOJA 3DB2A 1SC6A 1M34E 3CX8A 4KQWA 3SQMA 2RGBA 1BHJA 3TGLA 1ZZEA 4QA9A 4RHYA 4W1SA 3BIXA 1H42A 1MTOA 3ZD8A 3N9IA 4AUEA 5I4IA 1AKEA 3AJ9A 1C29B 2X2OA 4AN4A 1AHHA 3WGNA 1P2VA 1XX6A 5FPHA 4G8BA 4DRZA 3MGGA 5CYGA 5BYBA 3C14C 5KTKA 4NU6A 2O54A 2PQ6A 1E1RD 3CT6A 4XQCA 1HT3A 3LC7O 4NU8X 3ONNA 4MMZB 4P98A 1M1NA 1B0AA 1Y8CA 2XWPA 2X8AA 4AJPA 2HDNB 3EXFB 4R16A 1RW4A 1Z6AA 2YWFA 2Z5GA 3GPIA 4H15A 5CG1A 2UYHA 3U7GA 3WIBA 3D7NA 4QYIA 1K4KA 3CF6R 2MYNA 1G41A 1ZH0A 3J7TA 5CPBA 2C78A 1E4OA 3OJXA 1XJ0A 1EE9A 1KC1A 1DPGA 1EEHA 5FUQA 5ECYA 3RAFC 3RE1A 4IWYA 3LT4A 1G9TA 5E9WA 1Z6YA 3CJTA 5BMVA 5HUJA 1ZQ9A 4OBBA 4LRYA 3P5SA 3KUKA 1FPQA 3AT1A 4NBLA 4PAOA 2IYTA 3H7AA 5AOCA 2QSYA 1AF4A 2GCNA 1YL5A 3N7AA 3OQIB 1C2TA 4CQNA 1UXIA 3M6UA 3OQHA 2HZBA 4UUAA 3G0DA 4EVQA 2VAMA 4X6UA 1FSSA 1M6HA 1F9AA 2QPTA 3L3BA 4BPRA 3OFKA 3PLNA 3I76A 4XUGB 4J0QA 1I2DA 1X2BA 3BXPA 1X8JA 3JQ6A 1JX6A 3IBTA 1T5HX 3CX4A 4RXMA 1JUDA 1ZMTA 4EX7A 1L8LA 5C18A 4YRDA 1O87A 4S1OA 1WB9A 1O0CA 1Y98A 1TQ6A 4YJGA 2RH4A 3V80A 3ZWKA 4ZZIA 2PL1A 4XUDA 3FCYA 4LJ7A 5IAOA 4TMWA 1HE3A 4LJRA 1EVLA 1ZU4A 2W9XA 3U26A 4LW8A 3BF8A 4ZQEA 1Q1ZA 3JQFA 2ZR8A 4LTNA 1JXMA 3EAGA 4P93A 4LWPA 3T1OA 4AX4A 4D0NA 1XL1A 2F8TA 1W36C 4Q37A 5HRUA 4QUBA 4WXHA 1SOVA 2P91A 3QE0A 1FU7A 2JI8A 2VHQA 2A0FA 5EHZA 4B6RA 4EG3A 3LHFA 3VJKA 3BQMB 5BQXA 2P2LA 1UIMA 5CT9A 2HIAA 2HMVA 4WLOA 3EJ6A 3CEPB 1HT2E 4EIWA 1U7TA 4FYPA 2HCTA 3T1NA 2ZIGA 3CLUD 1FXWF 4Y9TA 5ALDA 2JZCA 3ZOZA 4KIFA 5D5HA 3CKYA 3HY4A 4DR1B 4MUXA 5KSPA 3GJQA 1AB5A 3QBEA 3RSHA 1MGPA 1WHTA 4X93A 3UA3A 1F2TB 4F1KA 4IIBA 4KGDA 1OB2A 2BDTA 3LC1O 5J4KA 2QP3A 5AVRA 2H0QA 3KQNA 4DLSA 2G72A 1KVTA 4GGPA 1MABA 4GX2A 4U2CA 1G8SA 1W49A 4GLBA 4D82A 3GWGA 1C14A 5AJWA 4EG8A 3DDHA 3K70C 4ZCPA 1KJNA 1J0AA 1ZC4A 2C77A 3B9QA 4DJFC 2B2CA 2GJSA 5HIJA 4RFSA 1HG0A 3GJYA 3VNRA 2IYYA 2ONYA 2DUJA 1HTTA 2W37A 1Z83A 3SSMA 1NVAA 2BMDA 3H5VA 4HDCA 3KELA 3DQZA 5E6SA 5JWOA 4IQFA 3R7FA 2Q1SA 1U65A 1P17A 1IEWA 4JJKA 1VE7A 5J3JA 4L5AA 4KRYA 4IDFA 5B7NA 4KFUA 3OU2A 3JAWB 5EHIA 1GQRA 2DM6A 3H3JA 1XJQA 2OC4A 3SEZA 4BO2A 1ZR4A 4BNDA 4R7ZA 1USUA 1SZCA 3AZQA 4PSVA 4PYOA 3KHTA 5U9CA 3PL5A 1YMQA 2HU7A 4OQYA 1UBMS 1FYWA 4AYXA 4M0DA 4GKBA 4LRTB 3Q72A 3OX3A 4DSZA 1VJGA 3SQWA 3H97A 1FBTA 2QG4A 1C9YA 3W2HA 4B6OA 1MJHA 3K94A 1CR0A 4L75A 3A26A 4LI3X 4L72A 1K3FA 1I3OA 1WHSA 1YQWA 3QHQA 1YOVA 3O4GA 4O5OA 2B69A 5KWJA 3QX3A 1FFXA 1XDSA 3K1YA 2V45A 3E53A 3OJLA 5JSHA 3FW1A 3N58A 3GRAA 1QH0A 1T2UA 3WG9A 1VL1A 1UMCB 5JAZA 3RGGA 4K8RB 4I3GA 3CH7A 3HB0A 3CO5A 1WDMA 4Q34A 4TKZA 1FP6A 2RDMA 3DC7A 5LQMA 1C30A 3V6MA 1NXVA 4Z3DA 3DD1A 4CYMA 4UTNA 1V4NA 1WSBA 3QZUA 5ALHA 4DS3A 2YVKA 1E3WA 2GNPA 3TTUA 1N36B 1WVIA 2ZAIA 1DKUA 2R62A 4LC9A 3GY0A 1KDPA 3HKDB 4YV7A 4PINA 2BW0A 2EZUA 1XHFA 5REQA 4Q00A 3U4QA 2Q5HA 4B3CA 1RAAA 2C97A 3E2PA 3ROMA 2HF7A 1S8FA 2WT9A 3LI2A 2B9EA 2EYUA 1UPXA 4Q9LA 2CT8A 2EHDA 2VCHA 2WD9A 4I46A 2VHUA 3IX7A 1BXGA 1R3UA 2GAAA 2B8TA 1GL9B 1LBIA 4NHOA 4UCWA 4N7MA 4BIIA 3KQUA 3L1JA 4EF4A 2HU2A 3RU3A 1G21A 1X1TA 2P3OA 2R6R1 3ICWA 1A9TA 4IZHA 5SZKB 3EH1A 2YWGA 3E27A 2PZEA 4P9NA 4X66B 4NCBA 3FJYA 2VZ8A 4KO2S 1I2MA 5AVQA 1ESCA 1Z28A 3KUUA 1AHIA 1BX0A 2JA2A 3AUAA 3V4SA 5JWRA 2WTMA 4ZEMA 4FGSA 2QMHA 3IKMB 3GRVA 2HGZA 2FGKA 1FMLA 4QEDA 5LP1A 2CYAA 1CQIB 5DCLA 1YZQA 2NZUG 4DZRA 3R3YA 5B53A 1Z25A 1E66A 1RI4A 1C9DB 1XN1A 3QF4A 2YMLA 1QPGA 4FUTA 4ZT3A 5AJYA 2F4NA 4EARA 1CZUA 1W29A 4UE2A 5JFTA 4MWBA 2CNBA 2PH7A 3QU4A 1DX6A 1KEPA 1C5KA 5BSUA 2PLWA 1UJ6A 3K0AA 2A84A 3RAJA 5GIOE 3W5AA 2EJUA 1DAEA 5HTKA 4EA9A 4FR0A 4I4NA 5BSHA 2CHEA 1UT5A 1KI1A 3HJCA 1XDDA 3JASB 3M4XA 2BM8A 3SF0A 4A6DA 3E1GA 3QEMA 4CHGA 1P45A 1R9JA 1BO6A 2LE0A 2VJLA 3O92A 3ORFA 3OWXA 3QMMA 5DEIA 3U80A 1KH1A 4RF2A 2W70A 3K70B 2GAFA 2NAPA 1HFEL 3CJRA 1DKNA 2RBKA 4C20A 1SBZA 4CBVA 2C99A 3EOBI 3GLSA 3B3GA 3JQRA 1E64A 4BJ1A 4KWHA 3DHYA 2NU8B 4B5LA 5K6AA 1B4DA 3BK7A 4Y2RA 1TB4A 4RESA 4BN5A 3UT5A 1BDMA 4RPIA 1JBQA 4IUYA 1PZFA 1SCNE 1WSAA 1YZ3A 4YT2A 3IQEA 2ZK7A 3BCRA 3WIVA 2I3ZA 2J3KA 4DM3A 5JU6A 3N70A 5D3KA 3PUVA 3ZLVA 2PNFA 1E1QA 2OGWA 3EZ6A 4C4PA 5SYNA 4H7PA 16PKA 3GF4A 2XUOA 2BGWA 1T4CB 3OX2A 2HDHA 3G02A 2AWNA 4FNGA 1T2NA 4KQGA 4EI2A 2D0PB 2ZANA 4ZYWA 3AUYA 4IPTA 1QP7A 4TSRA 1MB0A 1GVHA 2R1TA 1BZYA 2QYOA 3WB9A 4AJ9A 2GFQA 3W78A 5LA6B 4DL9A 1YI8A 4TMTA 4EY3A 5KJCA 3GLGE 1E2MA 1F48A 5LUAA 3TLMA 4OFZA 3K30A 5DV9A 1SU7A 2KWIA 1B93A 3W3ZB 1QH8A 1YIOA 4XAQA 5BPHA 4MWZA 4YONB 1AZTA 4BX3A 4D43A 3DTNA 3BWYA 2DYKA 3EFEA 4E2WA 3V8BA 2Q6KA 5DX1A 1Z38A 3TB4A 3NU1A 3PUYA 3K15A 1AK2A 1I80A 5DN9A 2PV0A 3HCWA 4NZ9A 3GLIA 3E58A 1IOLA 4KOAA 9ABPA 5SZHB 2EP7A 1P62B 4JS0A 1LPBB 2NUAB 3NEPX 1VP3A 4JI1B 3CMMA 4G86A 2QTMA 3EARA 3G2PA 1F2UB 1GXSA 2F55A 1WETA 4MW5A 5J4VA 3UJCA 2ZRPA 1YS1X 5HHTA 2AFHB 2O3TA 4PWYA 4HFRA 5CVCA 3HCCA 1J42A 1NXXA 1DFIA 3W5SA 1GP2A 3TLCA 5KJEA 3UHOA 5BURA 2W4QA 4ERNA 1NI4B 1V8OA 3QMVA 4FIZA 3ZWDA 5E6RA 5C3UA 4WADA 3RT7A 1JHAA 1U3WA 1OXVA 3RNOA 2B1RA 4LJ4A 1HH4A 3OPMA 1PL7A 3I42A 3LK6A 2P6PA 1LJLA 3IS3A 3R7DA 5BVGA 4OJMX 3GHYA 1CDDA 1U8TA 1SXPA 4U0KA 5AUPB 3N3AC 2WYOA 4U9IS 4AZ3A 1T0JB 1DUIA 2OY0A 1AK1A 1G17A 3HV0A 4GPEA 4CLOA 4NL4H 2WHRA 3HGTA 5DNWA 1WMAA 1MO4A 1U0OC 2HNAA 1BQEA 3MQ2A 4XVRA 1RWVA 4GKVA 1QVAA 2ZULA 4PIVA 3SLRA 3H8SA 1OREA 3TCKA 3CUVA 4BDTA 2X7JA 1NP3A 4EA8A 4KSCA 3D3NA 4YP9A 3ZCPA 3B1VA 4LRQA 4H27A 4ZP1A 3Q9LA 2FZEA 1NBOA 3GJ3A 2OCPA 3B5EA 3H19A 4XM2A 3DDWA 4AQ7A 2PD6A 2RH9B 5K0CA 2P6UA 4R8KA 4YREA 2RC6A 1EJ6A 3FH0A 4BAGA 4JIGA 5K4AA 5HS6A 5FTLA 1P1RA 3LYHA 4G63A 4YYEA 4EKDA 5AW6A 3HCOA 4E2YA 3GFTA 2Z09A 1ZXLA 5KDLA 3JQ8A 3AILA 5CB0A 4U7PB 4Q0MA 4XE5A 3MILA 2ISSD 3MS4A 4R01A 5JJBA 1GR0A 3DAFA 4MVJI 2XCSB 3RTBA 4QYWA 4WFQA 2VDLB 2OXEA 1WDWB 2B30A 1A2KC 3KJQA 2WUGA 1VE6A 4NJOA 4QTTB 4ZMRA 1SD5A 1ZZGA 1AXRA 1MX9A 1E3DA 3C5VA 1N7JA 1M8GA 3IMCA 3LJKA 3OI7A 2FWJA 1N5JA 3NT5A 2GHQA 1GQ2A 5JD4A 5EE0A 1XP5A 5FOQA 2DBQA 1PJTA 4X63A 2SHKA 3GC6A 4QLAA 3SR3A 2JDID 1H9CA 3H9UA 1VIYA 4JCOA 3ELWA 5AHRA 5DOZA 3CKMA 1DTEA 1U9CA 5BWCA 4EZBA 1FJ2A 3MLEA 1HT0A 3PD7A 5K8JB 4J0DA 2ZUUA 1Y80A 3X1YA 3OF2A 4URFA 4OAPA 4BFSA 5SY6A 3FAZA 1FYVA 3VO1A 1DXQA 2DGDA 3OC6A 2YHUA 1T4MA 3H1TA 3DFMA 4K6MA 5LMCA 3H5OA 4MDHA 4O02B 4HGPA 3AL3A 3PSAA 1KJQA 3KOUA 5KDOA 3STWA 4TUYF 1W5BA 1Y1TA 5K45A 3IDFA 2GLXA 3MSCA 4UEWA 1DNPA 1VB5A 4HH3C 3EFBA 4C2TA 4DA0A 5KOYA 2FG6C 3KHSA 1L5ZA 3KLMX 2G71A 4YWJA 2VL7A 2Z30A 1UBJS 2KS6A 1LXCA 3I37X 1KPGA 3IC5A 3P0FA 2QS9A 4UNSA 1XRLA 2GD1O 5DWQA 3L8EA 4WVFA 3JTEA 2AZ4A 3FNBA 3TCXB 1QUEA 1I7QB 1K4MA 3RRJA 5FI3A 4EPWA 1KDOA 4EYSA 4GZMA 1K27A 5GWXA 2PS3A 4X91A 1U5BB 3FPGA 5BR1A 4F4DA 4D4JA 8LDHA 2WK1A 5C35A 4XKJA 1J6UA 5JMPA 2K7ZA 3L04A 1WUTA