1U7PA

X-ray crystal structure of the hypothetical phosphotyrosine phosphatase mdp-1 of the haloacid dehalogenase superfamily
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
164
structure length
164
Chain Sequence
b'MTRLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQNIQLYPEVPEVLGRLQSLGVPVAAASRTSEIQGANQLLELFDLGKYFIQREIYPGSKVTHFERLHHKTGVPFSQMVFFDDENRNIIDVGRLGVTCIHIRDGMSLQTLTQGLETFAKAQAGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords magnesium-dependent phosphatase-1
molecule tags Hydrolase
source organism Mus musculus
publication title X-ray Crystal Structure of the Hypothetical Phosphotyrosine Phosphatase MDP-1 of the Haloacid Dehalogenase Superfamily
pubmed doi rcsb
total genus 53
structure length 164
sequence length 164
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2004-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12689 Acid_PPase Acid Phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1u7pA00
2YN4A 4BKMA 3MN1A 4GIBA 5AW8A 2NO4A 3F9RA 3WKAA 2EARA 1L7NA 2MSNA 3QUQA 3OCXA 3W5DA 3MC1A 3VAYA 2FUEA 5ALWA 3ZX4A 2I6XA 4DW8A 3RFUA 4KNWA 4KX5A 5ALJA 3HYCA 1TE2A 2I34A 4F72A 1Z4QA 2B1RA 1EK2A 4IFTA 1QYIA 1X42A 4Y2VA 4EENA 3UM9A 3I1YA 5AIAA 2G07A 3PCTA 4KNVA 1Z4OA 3AR4A 3WK4A 5AKXA 2I33A 2R8YA 3U26A 5ALEA 1LVHA 2OYCA 3ZWKA 5ALPA 3J7TA 4QJBA 3QU4A 4BBJA 4AS3A 3ZWDA 4Y2JA 4CNQA 5AKIA 4C4SA 2OBBA 2WF8A 5ALUA 3L1VA 1O03A 2R8ZA 1L7PA 2W4MA 2AGVA 4YH1A 2MU1A 5AW3A 2P69A 3DV9A 4BNDB 4ZEVA 3QNMA 1Z88A 4Y2XA 3K1ZA 1N9KA 5AK4A 5AESA 3U7EB 2RAVA 3E58A 4FYPA 3AR5A 3L0BA 2NO5A 4UU1A 1U2SA 4MUMA 4H1WA 2GHQA 2PR7A 1RLMA 2YJ6A 2CN1A 4YIKA 1NRWA 1N8NA 3FVVA 4J2TA 1TA0A 5ALZA 2BDEA 3L5KA 3QGMA 2IA5A 1U2TA 1L8OA 3L0YA 4NWIA 4OD0A 5AKHA 3N1UA 4YCMA 4YCNA 4Y2SA 5AKYA 1WVIA 4ZEWA 2HHLA 4KN8A 1K1EA 4UAUA 4EZEA 5AVXA 3OCVA 5AI8A 4C4TA 2B0CA 4UASA 1L7OA 1XP5A 3KOOA 3ZVLA 3CNHA 4UMEA 2BDUA 2PKEA 2ZXEA 3U7GA 2JAWA 3B9BA 3ZVMA 5AM2A 2C8LA 1XPJA 3N5KA 3S6JA 2B1QA 5AKJA 2Q4TA 5AKEA 3SD7A 1Q91A 4Y2YA 1RRCA 5AW4A 3ZI4A 1CQZA 2G0AA 1VJRA 1RKUA 4OCZA 1SU4A 3OCZA 1RMQA 1VFPA 3WK7A 1Z4NA 5AW2A 4BX3A 2FPXA 3N07A 3AR6A 1T5SA 2GHTA 5ALXA 5AW9A 3U7FB 2YMQA 3A3YA 3IRUA 5AHXA 1ZD5A 3QXGA 3NRJA 4XPZA 1QH9A 2IOFA 5T41A 4L57A 1L7MA 1QQ7A 5ALNA 1ZOLA 1RDFA 4Y2PA 1Q92A 3NANA 5AK3A 5E0OA 1Z4IA 1F5SA 5AVUA 4FFDA 1NNLA 4HGRA 3OPXA 2FPSA 4HAIA 1IWOA 3R9KA 1YDFA 3UMGA 3ZU6A 5AI0A 1U7OA 1FEZA 4BX2A 1JUDA 2YFYA 2HI0A 1YV9A 1TJ3A 1RQNA 2RB5A 3OTQA 2I55A 2B82A 3IJ5A 3SF0A 2FEAA 1PW5A 2C88A 3W5CA 2YMLA 2ZG6A 4DWOA 2VKQA 3WK5A 2HOQA 2JARA 5AVYA 2HF2A 3KC2A 1ZD3A 4O8CA 3SMVA 1TJ5A 2C8KA 2HCFA 2RBKA 3FPSA 5A3RA 1SWWA 3QUCA 4FE3A 4CE6A 4OHFA 1ZD2P 2B8EA 2QLTA 3W5BA 3N28A 5IT0A 2OM6A 3ONNA 4HYTA 2WF9A 5ALKA 1J8DA 5AKGA 1RC8A 2FI1A 2BY4A 5FP0A 1U02A 2ZBDA 3ESRA 3L8GA 5AM3A 4EX7A 2HEGA 4CF4A 4UATA 5IS2A 5AI9A 2WF7A 2YMPA 3P96A 5AVQA 4J03A 3WK8A 1Z4PX 1RLTA 1Z5GA 3L8FA 5AKLA 3I6BA 4MWOA 1NF2A 4AP9A 2YJ5A 3BA6A 4HGPA 5AW7A 4BEVA 2G08A 3ZTYA 2ZBFA 3IB6A 4L6CA 2D2VA 1CR6A 2WHEA 4JB3A 3B8EA 1RPZA 4Y2QA 2WFAA 3SHQA 2HSZA 4E88A 5AW1A 1VJ5A 3QU2A 2FUCA 3E8MA 3FZQA 2FPRA 1Z4LA 3ZX5A 4Y2UA 3DAOA 3L0CA 3M1YA 5ALMA 1YNSA 2IOHA 2O2XA 3KDPA 5AVSA 3RF6A 3ESQA 2O9JA 2EATA 2IOFK 5ALHA 3WGUA 2HF7A 3L1UA 2CFRA 3E81A 2IYEA 4B6JA 3WK9A 3SLRA 1T5TA 3R4CA 4YIHA 4IG4A 5AW6A 5ALRA 3ZW7A 1QQ5A 4UMVA 3WK6A 3KZXA 3BWVA 3SKXA 2GO7A 3FGOA 3U13A 4EX6A 3AR8A 1YMQA 5AI4A 5IT4A 3R09A 3QYPA 5AVTA 3PDWA 3L8EA 3DNPA 3EF1A 2YMMA 1WZCA 2HDOA 3A1CA 4RETA 4ZEXA 3ZVNA 2C9MA 4OFZA 2HO4A 3N8GA 3I76A 3QX7A 2WM8A 3MMZA 4UMDA 1QQ6A 2NYVA 4UMFA 4I9FA 5ALIA 4L6AA 1YS9A 4BX0A 5AICA 1WR8A 1ZD4A 3WKCA 3FM9A 3QUTA 5ALTA 3NASA 4JDPA 3W5AA 1TJ4A 4UU0A 4DCCA 4UW9A 3QLEA 2I54A 1RKQA 2B8JA 4UARA 2DQSA 2JAUA 1ZJJA 2AH5A 3AR7A 4UM7A 2EAUA 4PNHA 5AIBA 3M9LA 4KX3A 2G06A 1WPGA 1RMYA 4BYGA 5AM4A 3B9RA 3WGVA 3NALA 1MH9A 4C4RA 3HLTA 2R8XA 3EF0A 3FPBA 5ALFA 2QYHA 5AI6A 1J97A 2JGAA 2RARA 3ZUPA 2ZBEA 3D6JA 2P27A 1Z4JA 5ALQA 3ED5A 3A1EA 4GXTA 4XOUA 4AS2A 2WF5A 5AW0A 2P9JA 1S2OA 2ZBGA 3L8HA 4NAVA 3I28A 2AMYA 5AVWA 4RESA 3GYGA 3QU7A 3WKDA 4KYTA 2W43A 1YJ5A 2ODAA 1KYTA 5AKKA 2R8EA 1LTQA 5ALVA 1L8LA 3A1DA 3OCUA 3PGLA 3E84A 4Y2TA 3AR9A 3QU5A 5AM1A 5ALDA 1XVIA 3OCYA 3ET4A 3UMBA 1SWVA 1O08A 2GFHA 3OCWA 2YBDA 2YY6A 3AR3A 4NV0A 2CFTA 4UAVA 4BNDA 4I9GA 1RQLA 1S8OA 2YJ3A 4BEWA 2X4DA 5AVZA 3NAMA 2FPWA 1ZS9A 5A3QA 4CF3A 3ET5A 5ALGA 4YCLA 4XQ0A 2C4NA 5ALSA 5AI5A 1U7PA 3AR2A 3MPOA 4QQFA 4NFLA 2B30A 2WF6A 4HGQA 1RMTA 3TLMA 3NIWA 3U7HB 2Q5EA 1Z5UA 1Z4MA 5JJBA 1ZRMA 4HGNA 4CF5A 4EELA 1T9ZA 4Y3UA 3SKYA 3WKBA 2ZOSA 3QU9A 4XE5A 2G09A 4F71A 5A3SA 5AM5A 4Y2RA 4UM5A 5AM0A 4EEKA 2P11A 5ALYA 3KBBA 5ALOA 3U19A 2FDRA 3CZ4A 5AK5A 4DFDA 1AQ6A 2W11A 3WKEA 2FPUA 3DDHA 2YJ4A 3UMCA 2G80A 1Y8AA 2G1AA 2HX1A 4NABA 3ZTWA 5AK6A 4YGYA 4G9BA 3PGVA 1Z4KA 2GMWA 3L7YA 2JAOA 2Q4RA 5ALLA 5AVVA 5AW5A 2PQ0A 3QUBA 5AVRA 2I7DA 1RKVA 1EK1A 3EPRA 2OA0A 1L6RA 2AUTA 3NUQA 4G63A 4HGOA 3EWIA 1ZRNA 5AKZA 1RLOA 3KD3A 2CFSA
chains in the Genus database with same CATH superfamily
2HUPA 2ERYA 1AHIA 3GK3A 1PT5A 1N4DA 2GB4A 3DMPA 4YAWA 3QFFA 5JZBA 2X5JO 1JILA 3QUAA 3REFA 3VOAA 1IYZA 2PYZA 2PX3A 2VDQB 1IZ7A 4MWEA 5ALWA 1XRSB 2ID9A 1RAAA 2WNIA 2H7XA 1VM6A 2DR3A 5ALJA 4YUXA 5HUJA 1HE8B 2ZANA 1EESA 4GM1A 3QIAA 4QAQA 2G9UA 3ISJA 2KYRA 4DDHA 1QR6A 2ZTUA 5CT8A 3S55A 4F4JA 4Y2VA 4NCIA 1Q77A 3UM9A 3CKKA 4COOA 3CRZA 2QQ5A 1AUOA 3FDXA 3ON5A 1OSNA 3PYMA 1G20B 1PJ4A 1G2PA 1IQUA 1EKXA 3C6YA 1MX1A 1OWNA 3WK4A 1YUMA 3SF8B 1Z8DA 1H05A 1BDBA 2A5JA 3UHFA 2UZ1A 4Z8YA 2CF6A 1KS9A 3UO8B 4QPCA 4QOEA 3FCUB 3U4CA 3UYKA 1K6JA 4WK4B 2WYHA 1QTQA 1B8NA 3GT0A 1GGMA 4RFVA 3BIJA 1TM5E 1E3IA 4Y2JA 1OA0A 1Q6YA 1P1RA 1W0CA 4BO4A 1C4KA 2FSIA 2ZATA 5F77A 3UAWA 4CKWB 5FWXB 1NBMA 3U39A 1L5KA 1G8AA 3Q3JB 3R74A 4RO0A 3HU5A 2PH3A 3ERCA 3RC3A 3K2QA 2RMKA 4NMWA 4RXMA 4DSAA 1ILEA 5JHGB 3MB8A 1G7RA 1JKJB 1XNGA 2HRQA 2OPBA 3N0TA 4PW0A 1FBTA 3ZUGA 2PT7A 5AOCA 3O4RA 3FSRA 2DUJA 3DV9A 4IKOA 5EG5A 4OLAA 3QF4A 2QROA 1NRJB 3CRQA 4JYZA 3HP1A 5JQGA 1ZL2A 4KQCA 4FYMA 4C1BA 3AKDA 1C50A 4Q7LA 3VDXA 4BNFA 4WZ6A 4WUVA 4C2TA 1Y9ZA 3CVWA 1B42A 5EGNA 2XBUA 3O47A 3UBTA 3L92A 3HYSA 2CLCX 4AMBA 3IO5A 1JLLA 2G0TA 2HJWA 3OG9A 1SBCA 3RUCA 1VLMA 2NO5A 2PUEA 1WXHA 2HJGA 4G2TA 1U8YA 4QAJA 4UU1A 1ZVMA 3ANTA 4MUMA 4MUBA 1ZR2A 3RCBA 3ROXA 1QE3A 2VF5X 1WQ1R 1KFKB 2I1WA 2VYQA 2FQQA 2WFLB 2ZKLA 3R0IA 4I1IA 4Q3LA 4YGXB 5H1YA 3WWDA 2HMAA 3B1ZA 1UIRA 1PW7A 3KLOA 4FFLA 1ZM9A 3MWEB 4ZHQB 1DBQA 1VYUA 4UVHA 2QLFA 4Q7JB 4V3CA 1F7VA 3E22A 4Q02A 1J2RA 1ZCFA 2OBNA 4QASA 3UK1A 3CVJA 1KY2A 3PVCA 3Q8KA 3G2OA 3PGXA 1ZR4A 1SU6A 1BKSB 2X8WA 3TW6A 1W52X 4ZCQA 4K9DA 4UAGA 2JB9A 3DZKA 5DK4A 3W1WA 4TKMA 2IUTA 3NRCA 3KOOA 3P2IA 3PE6A 4DA4A 1KFBB 2VYVD 3H99A 3CNHA 2HPHA 5G41A 1C7ZA 5D00A 3PWTA 3PFKA 1I3LA 2G1JA 3IPAA 3DAYA 3VKHA 4JP8A 4Z1OA 3JVUA 1DHRA 1B73A 2Q1UA 3BE5A 1CD5A 5DJ5A 4A8HA 3MJFA 2P2ZA 3Q88A 4QYXA 4WL0A 5IEBA 3MJTA 4PXSA 3UAXA 5JAMA 2ZROA 3LWNA 5B1DA 2XEDA 2B1QA 3T1TA 4D26A 4I81A 2Q4TA 4IFIA 4QXRA 1XAIA 2DCUA 2V7EA 4WGFA 4ZIRA 1KRWA 1J1IA 3QX8A 3HVRA 2B3TA 2BCJQ 2G0AA 3LVFO 4DIFA 1VJRA 1EVEA 3AKYA 1SU4A 1Y7HA 2EEPA 1Z4NA 1I13A 4B73A 2V0NA 3BZBA 5CURA 1DARA 1VA4A 4H7EA 3AR6A 2Z3VA 4UUOA 2X0FA 2QMEA 4X94A 3CKLA 4X7PA 5ALXA 5K05A 2JBAA 2VPWA 1AY0A 3ZI7A 5IAEA 5JG7A 1KZGB 1S2IA 2QRPA 3TYXA 1ADCA 1DCKA 4HN2A 3ZWAA 1A7KA 3HY6A 5A2QA 4XWYA 1UT8A 2OD7A 4DUPA 5C8DA 1JU4A 1OX4A 1OBCA 2TMYA 5KVSA 2ZM6B 4U2FA 5JH7B 3MQ2A 2NIPA 4E4YA 2AZXA 1DINA 4MGZR 4FP9A 3PI7A 1B7GO 4DDKA 3T4EA 5CHEA 4J2OA 3WLNA 4ZJUA 4JYAB 4BS9A 4BQSA 3VA7A 4E08A 3BWEA 2Q0HA 3OOWA 1KJZA 1RI2A 2JLUA 2XCRB 3CT4A 3PWSA 1F5SA 3LP6A 4IJQA 4LBWA 1N1DA 2GAIA 4Y9RA 2B94A 1CB0A 2G9RA 4CF7A 2DE0X 3N53A 4CT5A 1V39A 2ZFUA 2C4MA 2AHOA 5CUQA 2VQFB 1AXEA 1GUZA 3KUDA 5TJ9A 4EI8A 2IYPA 4YO7A 1S4QA 5F21A 2H9YA 3WLPA 4RKRA 5JVDB 1QYWA 2CNOA 3CNNA 4BJ1A 4PPFA 7ADHA 5JE8A 1XRMA 4DABA 5GIPE 4NG5A 5FUQA 3C3PA 2R2AA 2OAGA 5BVGB 2D0OB 1NBME 3JQAB 4MIKA 4FYXA 3U09A 3SIPA 4IV5A 3GDWA 5IMBA 1PO7A 1XZNA 3IJ5A 3SF0A 1X74A 3H87A 4J0KA 1RACA 1D09A 2GF0A 5DRYA 5FUBA 2CLMB 1P73A 1PLKA 3IMFA 3KBOA 2OFFA 1NY6A 2ZG6A 3FWKA 2X2EA 2BI4A 3LHKA 1NBWB 1RTTA 5F2NA 5J2UF 2QAGA 2BGKA 2SECE 5L9AA 3DEJA 3CRMA 2P2SA 3LY9A 4J1SA 2JGIA 4AUEA 1PZEA 1PHRA 3N8HA 1GCIA 2PSSA 3CLSD 4LV6A 4WCDA 3ZIDA 5JQWA 2E87A 1G66A 2BR4A 4CDRA 4GEKA 5IBRA 3VZQA 2DLCX 3BGDA 1XU4A 4B35A 3K20A 4IHJA 4BQFA 3EXFA 3MBIA 3QELB 1EIZA 5H81A 3RVRA 4XYLA 3M82A 3LUHA 3VX3A 2BWJA 4HDRB 3TR5A 5MFPA 3VRHA 1U8CB 2HU2A 1T43A 3CMCO 4WACA 1Z68A 3OI7A 2REOA 2CUNA 1WEHA 4HEA1 2JBWA 2E2WA 4BO9A 1RXIA 1HFEL 3CH7A 4C0HA 4J03A 1IUKA 1XTRA 2HA4A 3Q98A 1I01A 4IX1A 2VNJA 4RNDB 4C4YA 4IIBA 2BSQA 2BFPA 1U1FA 5A9SB 3CCBA 1EU1A 4MWOA 1NF2A 5B58T 2VI5A 4AP9A 5ICMA 2EJTA 3DBHB 1OLUA 1LBQA 2EG5A 2J9ZB 4DS3A 1PEDA 4DGQA 2PXCA 3I5AA 2IHNA 4M1OA 1OV6A 3AP2A 3HBAA 2BKLA 2D2VA 4ZAYA 5FPHA 1SUSA 4JB3A 2YNMD 1RAFA 4AKEA 1B3RA 1REQA 3OH8A 5JNRA 3C41J 4AZ3B 4LXYA 2QUAA 2XSZA 5INTA 2QQGA 2ECQA 3BAZA 3HU1A 1KQOA 4UNSA 1E66A 2Y99A 1TUBB 1R0LA 1ZJ5A 4II2A 4OATA 3RS9A 3ZX5A 3L7MA 3E9YA 3KEOA 3GLHB 4D6XA 4HXFB 4QEKA 4Z9YA 1OTXA 4R6XA 1U0NA 3SX2A 4MRPA 4OGWA 3FWHA 1AXGA 1KI2A 4O4LF 3KJHA 2R1TA 4IIEA 3AL0C 2J48A 3MWDA 3MF4A 5TPWB 1KVSA 5ALHA 4DLAA 4KBYA 1HT1E 2BISA 3ZLBA 2QT9A 4J76A 1FFCA 1WPXA 3NOQA 1HSOA 3QA9A 4ZAGA 4N0EA 1FTWA 1E9SA 1KAHA 3LC2O 1EGVB 4JUBA 1AOXA 2ZXFA 5FA5A 5J5VA 2XE4A 3UY4A 4FZVA 3AVQA 3TLKA 4IH1A 1JLKA 3GCWA 4FW9A 1RYHA 4CF6A 1EHIA 4PWYA 1PD0A 3HK2A 4D79A 1B1AA 1NW7A 2XWPA 4HYQA 2HZBA 1M6EX 3HQ4O 2O14A 3L1KA 4H31A 5EWLB 1LDYA 3LQKA 3Q9SA 1EDEA 5A2GA 4B85A 2CEAA 4BBZA 4ZCRA 3JZMA 2V3WA 2DUUA 1AF4A 1Z13A 3EC2A 1AKTA 4UHCA 4RETA 1M0SA 5HRUA 3LT2A 3DS8A 4DYVA 4YRJA 1T9KA 3JARB 1X8XA 3BXZA 3N8GA 3FRJA 4QEZA 1T34A 3NHLA 5FNVA 2V7WA 3DUFA 3EG5A 1RJEA 5HP4A 5AHRA 1WMSA 2HKIA 4YT5A 5IM5A 3L1HA 1L5RA 3ORSA 1C1YA 3CGWA 1T5IA 4R6WA 3L0PA 3UT5B 3V2GA 3RIMA 1SVLA 4RFLA 1J9EA 5DIZA 3LKBA 2RHDA 3I05A 2XVXA 4V39A 2C42A 4JC0A 1AO0A 3MUNA 4FEYA 1VLQA 2A9JA 3EGDB 3SMQA 3OZ7A 1NI3A 5J2UB 3MS4A 2CY0A 3W3AD 1OPRA 1ZHOA 2Q2WA 3CSSA 4BU0A 3D3QA 4EA6A 5LL6P 2HWUA 1YFLA 3HRIA 1L5HA 1BXRB 3PB3A 5D1HA 3BYZA 3UMFA 2ZWIA 1L5OA 3LWBA 5DRTA 3GA7A 2CXSA 4DA6A 5JANA 1B8VA 4PHGA 1DL5A 4E70A 3C2QA 4GGOA 3W7AA 5BQPA 1V16B 4EHNA 4U8GA 3RKSA 4EARA 5IN4A 4V0KA 3BFXA 2Q4EA 3H8SA 1ZITA 4MCJA 5TX7A 3R7SA 3IQWA 3UENA 3V8NA 3JQFA 2QYSA 4GICA 4RENA 4YP1A 2GK3A 5C8YA 3U7RA 1J8QA 1K0FA 1UMDA 2CCJA 4YRGA 1YHZA 1RM0A 3LX4A 1FNCA 2EZ9A 3FHOA 4BE7B 4QT4A 1DJMA 1M0WA 4BNTA 2YHIA 3RC2A 5JAZA 2AOVA 4LWOA 1M1YB 3I9V1 3Q7SA 2HY7A 3BQNB 2R48A 3AUUA 3G17A 3ZUPA 1JI0A 13PKA 2PD3A 3GMTA 2P27A 3RVMA 2GF2A 1HQKA 3I52A 1YR1A 1ZL0A 3M9WA 1GQQA 1G18A 4F3YA 1Q0RA 5FUMA 1HMYA 3OMLA 421PA 3AVPA 2H1RA 3L8HA 2B69A 3L1JA 1CR0A 2RHJA 1DO2A 1SIWA 2Q3LA 5GINE 1V4VA 3FFTA 3GOHA 5COBA 5B1HA 4DDWA 2BFCA 5LDGA 1J0XO 4V0SA 1F8YA 4M1WA 1II8B 4OU4A 4BWVA 3CRVA 5CGQB 4BRUA 4JYMA 3B6MA 4EPWA 1LK7A 1XMOB 2O0HA 4YJ2A 4LE2A 3E3LA 1MB2A 2XTMA 4URFA 3ZC3A 2ODNA 1T0UA 1XQ6A 4KAXA 5AM1A 2FN3A 2ZB7A 1AHPA 1BROA 2DM6A 1ACMA 2HT6A 3NM6B 5DCLA 2JH8A 1LS6A 5ALDA 4YV2A 5LYJF 1VKOA 1N75A 2UV8A 5HFAA 2QXUA 4FIDA 3MJRA 1XZPA 3BFJA 2V3CC 3UAVA 2BTEA 3AVTA 3HB0A 3FD8A 5DCWA 3LCRA 2R66A 1W88A 4G9EA 4I9GA 2YWJA 2ZYDA 1CT9A 1T24A 5B7NA 6LDHA 3QVJA 4OQPA 3RNLA 1A2QA 1J1ZA 2BHLA 3G1UA 2SKEA 1CB7A 3ANNA 1GZ4A 4E5KA 3NVDA 5EIFA 5K2OA 5DKFA 2BUAA 2CVFA 1T8PA 4UOEA 1WCYA 1XWFA 3A6JA 3EGXB 3WLLA 4BVHA 3E15A 4GSKA 4XEUA 3G6WA 3JQGA 4TLAA 3H3XA 3KKLA 3ICWA 3GLQA 5AO9A 1PFKA 2JPDA 4GHWA 4WKGA 3TSWA 3R6WA 3HKCA 4GMKA 3ZXIA 3ILSA 5ALSA 4IYRA 4BN0A 1PRYA 2HQRA 4GU5A 2DWQA 2HT1A 5TQ0A 1JIXA 3OQIB 5FPYA 1H6BA 3O3OB 3GCXA 2QN6A 3CCFA 1ESNA 3MTBA 4I66A 2PIDA 4NJMB 1QOPB 1QTNA 3M1LA 1VB5A 2F4VB 1BMTA 2O0LA 4FJ2A 1QB7A 3DE0X 4YECA 2I7XA 4H08A 4F91B 2V65A 3B70A 1QR2A 4LDPA 1E3WB 2QRNA 5JC8A 4V2IA 4CLXA 5FA6A 4M9ZA 4CM4B 1ORDA 1CR4A 4IDOA 2COUA 3ZYCA 4XJTA 1MTZA 5D85A 1NYLA 1VSBA 3OEYA 3W8EA 2VTBA 1EXNA 2AT1A 3FSGA 1QIDA 3ELWA 3CZ4A 3EVEA 4MQFB 1OBOA 4IH4A 1PTJC 4K6GA 3N2NA 4Z0TA 1YDEA 1Z39A 4CL0A 3C6BA 4CM1A 1Z2DA 2I4MA 5EI5A 1K7EB 3VYRB 3KJIA 2R11A 1UJ2A 4N18A 3WIBA 1SXJA 5DEIA 3TOVA 3I6YA 1O96B 5CEJA 3KIPA 3G7UA 2OD2A 1E5TA 4TTIA 4DCGA 2YR0A 1TXGA 1QHHB 4KOAA 1OI2A 1XLTC 1I4EB 4TV8F 4RK5A 4CDNA 2ZYWX 3D7SA 4NNOA 4IMIB 5TEWA 2RB4A 3FMFA 2H0AA 4HH1A 3H65A 1QJCA 4X91A 1TCBA 2GYWA 3NDPA 1NN0A 1UWCA 2ZR7A 1EYZA 3NT2A 3UMYA 4LXIA 5DLYA 5EZQA 2A9OA 3CWQA 4OKSA 3KAPA 4JKOA 2CE7A 4ZALA 5TQ2A 1I2AA 3W8DA 3PEUA 2J4CA 2GPWA 3IEIA 2P5UA 4FN4A 4Q15A 3V00A 5AOAA 3P52A 5DHPA 1KI1A 3U61B 4KMMA 1E6LA 2AJCA 4NDAA 2PTHA 4P3XA 2CDRA 3EAQA 1H94A 2ZEJA 1N1EA 1JEDA 4XYGA 1ODKA 3OCXA 4FZ3A 1LTKA 2ON6A 1ZX1A 3JS5A 4J1TC 1YQXA 3R6LA 4LNUB 1VIAA 2YWDA 4CLHA 3GROA 5EUCA 3ZX4A 1Z25A 5KWEA 1KP3A 3KEQA 4NYMR 2QTGA 2Y71A 3D0KA 3G7NA 3LHFA 1NVXQ 1OXMA 3CLRC 4I1RA 4O29A 5CM9C 3VSCA 3WWEA 4BMZA 1XWIA 1P19A 2I34A 2XMPA 5BQ3A 5KTMA 4E1AA 1RZRD 4TZ6A 3BD8A 2W6NA 1Q22A 4Y98A 1ZKMA 2Q9BA 1OGIA 1Z4QA 4JENA 4QRIA 4UHKA 4BLOA 1YQEA 3I8SA 4G1BA 1FS5A 1M1NA 3K2BA 2YTZA 1RI3A 4ETWA 5HKKD 4BPBA 1UC8A 5F76A 2H9AA 3LNTA 2OG2A 4YT4A 4RIFA 1ESZA 2HK8A 2VHQA 4MLCA 4CL3A 4YAUA 2UUCB 4ZVLA 3ZBQA 2ECKA 1ZMRA 3BD6A 3CIFA 4I0WB 4TXMA 4ZYTA 1UBHS 2FOLA 2NSYA 3KYCB 1C8VB 1PS0A 3C43A 4OI1A 3C16C 3C3MA 5FYDA 2ZLBA 3ZY5A 4AS3A 1BXKA 5AKIA 4C4SA 4OYLA 5C31A 2G25A 4Q3OA 3DGEC 4PIVA 1YKGA 4Z0NA 3T7CA 5ADUS 5KU1A 1YBMA 4XW2A 5LQCA 3TUJC 3TLYA 4N41A 2EFYA 3K70D 2D06A 5K01A 1ID8A 3AUAA 4DEXA 3KWJA 2W4MA 1EUDA 2NSLA 4PZEA 4KO3S 1EFVA 1Y0BA 1DAPA 3T15A 3H6HA 3OZSA 4Y0VA 3ZHSA 1J56A 4ZGBA 4JC5A 4W9NC 5TARA 2B5OA 5K7SA 2WMNB 5ENDA 2FSVC 3AOEA 4C5AA 3IIMA 4HJXA 1GILA 1JQLB 2G70A 2V4UA 3K1ZA 1UPTA 3N8DA 4RX1A 5DT9A 5ECWA 1CNMA 2DPLA 2AK3A 1X15A 1Z0AA 3NI2A 4RVOA 3EFHA 4E2FA 4ZYLA 4PYNA 1E98A 2RHCA 3PF8A 1VE7A 4PS1A 1BC5A 3VQTA 4EYOA 3RYCA 2WYWA 4TLEA 4JLJA 5CVVA 1FP2A 5EIEA 1TKRA 4X20A 4KPFC 4N7BA 4UTRA 5LSAA 4H1WA 4RANA 4WOPA 2J0QA 2VDLB 2Y1FA 3AK4A 1V3QE 2YJ6A 4I6EA 3MCAA 1MGPA 1N8NA 3HWWA 2VYCA 7MHTA 3CVOA 1KPIA 2IHTA 2XMBA 2BKXA 3ESZA 4XFDA 4ZZ2A 4HLDA 4UM9B 1L4NA 3BFPA 3KWLA 5IAGA 2O2CA 3I34X 3ETCA 4CETA 1PL8A 1LLDA 3PC8C 4CU5A 3D4NA 3DXYA 5ETJA 3MHTA 1DGQA 4KN8A 3T3NA 4QQNA 1OB2A 3ZJVA 4D46A 4PC1A 4FEAA 5H16A 2CDNA 5ITVA 3FMGA 3GUHA 3M2PA 4HH4A 5SYNA 2Y1KA 1JQKA 3N8NA 2JI4A 2BV3A 4EMSA 2GQ0A 3QVLA 4HEQA 4DB4A 1Z33A 3D02A 3VHXA 1TZCA 5F3RA 3VZDA 3L7DA 4YEDA 3DPUA 2O2JA 4BECA 1SR8A 4U2GA 4J6FA 4OXNA 1VPDA 3UJ9A 2P77A 1BD4A 1BXZA 4WECA 4QDUA 4LSWA 4BGVA 4DBLE 3LVQE 1GPUA 1YJCA 2GGSA 3O2QB 4J0JA 3U3JA 4AW9A 4EVIA 5FTJA 2WJ3A 1A9PA 2IEAA 3FW1A 1ECCA 1DZ3A 1NBIA 4W7IA 2WT8A 1YQ9A 1LPPA 1K8YB 3I9KA 4LDJA 3ZWWA 2O8FB 5D84A 1D07A 1RKUA 3K9CA 4CWAA 3HY3A 2XUHA 2W8BA 5ELLA 4LBYA 4WDQA 4WN9A 2FEWB 5EIOA 3ICVA 4DPMA 1LV7A 1KR2A 2ZYTX 1AKNA 1EM8A 2GFQA 2Y0BA 4N6OA 4PZLA 5HOQA 5DHUA 4LF9B 4NXMB 3O94A 3SYMA 2QXTA 1OXSC 1ZJ4A 2Q6IA 2Q5QA 2ZYRA 4ML3A 4TS4A 3HVIA 5E9QA 4HB2A 3T1QA 1OZFA 3C70A 5I9MA 5BT9A 3KPJA 2PR2A 3IQEA 3KO8A 2WSSA 1FSGA 2RH8A 2E6KA 2VQSA 5JPIA 2QR2A 1EFUA 4KQJA 4RDXA 4I50B 5FBVB 3D0OA 3TKLA 5DE3A 3F3MA 3WA6A 1H8HD 1OVMA 4A5OA 4G0PA 5M7EA 1VCIA 4A16A 3BQ9A 1ZH8A 4B45A 4F04A 1QF7A 3CNBA 3P2KA 4MRAA 4QJIA 4KR9A 2L0XA 2NG1A 4PGAA 3F7TA 4NPCA 3FFWA 4PLGA 1NTRA 1I2DA 2CJFA 5ITSA 2PL1A 5M29A 1UJ5A 1GPWB 4RTJA 2D8MA 2P91A 2AIRA 2B99A 3A6GA 3LU1A 4Y1GA 3VR2A 3OEED 1H8HA 1A8QA 5CPBA 4O4JF 1FZTA 4Y6SA 4US2R 1V5IA 1N5KA 3LHSA 1MB0A 5T7BA 1Y8RA 2P6PA 5A71A 4PSVA 1E1QD 1YU6A 1TJ3A 1QHSA 4KQFA 3T3EA 5HF6A 1VIDA 2YNMA 1F0YA 1LTHR 2QN2A 4KBFA 4KPUB 1A71A 3ITEA 4CODB 2HGSA 1Y8CA 1GL7A 2H3EA 3O31A 3GQVA 2ZSAA 3SXUB 5CXXA 3MTJA 2G28A 2C2XA 4LY9A 2IZ6A 4JLBA 4IDBA 1FOEB 2WMDA 5EESA 2C97A 4C7XA 2XCUA 3C15C 3QVTA 1ZMTA 4NYJQ 3OKAA 2AW3A 2FJPA 4L4UA 4HAVA 1NULA 3W90A 4D1YA 1NQAO 3P71T 3VU9B 1BU8A 2C8KA 1E1DA 5TJHA 4UEWA 1L5HB 3I45A 5EHZA 3VVLA 2OO5C 1QHHA 1D9XA 3HBMA 3V1UA 4UDNA 2EKLA 3ZD9A 2XYRA 2WC1A 5IT0A 1DIAA 1TKCA 3C3KA 3FNQA 5CYGA 2GH1A 2WF9A 3KKZA 2PMDA 2JATA 4F9GA 1RXCA 1F51E 1FFHA 2R1VA 5IXSA 2ZBDA 2X86A 2HYDA 1U3VA 1V7ZA 1TJNA 2B4KA 4QUHA 2QZJA 1YRYE 2ZYVX 4A0RA 3V48A 5LIRA 3BXFA 1R64A 3ZWMA 2BP7B 3I2YX 3G8AA 2UYYA 4HRVA 1Z4PX 2I6QA 5BSKA 2DBYA 1EVIA 3I6BA 4M1ZA 1L7VC 4LF7B 3TZBA 3TPCA 3GDOA 5JDIC 3RV4A 1C7QA 1YE3A 2QGZA 5KX5A 2AJLI 3PNQA 3RUAA 3QLUC 1M10A 1P9OA 4YAGA 1ZK3A 1JW9B 1HLGA 2GOYA 4P4LA 2XE8A 1PEAA 1P0IA 3LT4A 2AUNA 4E14A 1OZGA 2WYOA 2A33A 3LVBA 4QUDA 3YASA 3R3WA 3X1XA 2CHFA 3FKSA 1M2OA 1K86A 3L43A 2FPRA 1FJ2A 2XXJA 1OYVA 4O8ZA 5TQ0B 5JPCA 4ERNA 3GGDA 4KU4A 2QMZA 3WISA 4DMUB 2I1QA 4HP8A 4AO7A 2JGLA 1AKWA 1WMFA 1I4LD 1EFDN 3F7MA 4FPXA 3IPLA 1RYZA 4NU8X 4QJ5A 4EJMA 1GGVA 2EX1A 1PK8A 3QG1A 4ITRC 1ZCAA 3WGUA 2HRZA 3I12A 4XM0A 1Y6ZA 3T5BA 3EMDA 4MYHA 4B6JA 1IN5A 1CY4A 3OLYA 4FOOA 1JHVA 1RBYA 2JJ2A 4MW2A 4P7JA 3UV3A 1JFTA 5DM1A 4PG5A 2Q50A 5DOZA 4IG4A 5IANA 3FUUA 1E5LA 2O7QA 3CF0A 2GCPA 3SK0A 3T1VA 2HHAA 3QBDA 4HDNB 4JXXA 3OKPA 2JRLA 4UXHA 3UEOA 3C45A 2JLSA 1E7SA 1MAVA 1USVA 2GN6A 1IULA 4R9UC 5JD5A 4RTSA 1KIMA 1I6WA 1MOPA 2C7VA 3SVLA 4CKWA 2JHPA 2OE2A 4P84A 4D81A 1QH8A 4ER5A 5IT4A 2OXIA 4C2AA 2A5GA 3G3EA 3QYPA 3I6QA 2QM3A 4HB4A 4LE0A 2YKGA 5EIBD 4LY6A 2HMWA 1GNTA 1CUXA 3LG2A 4XTRA 3RFXA 1ECPA 4LQLA 2VAXA 3SC3A 5FWXA 1ZGZA 4GQBA 1BAPA 1C3OA 5IAJA 2AMVA 3IAS1 3BD9A 4FDAA 1H2FA 1RQPA 1IVSA 2OGTA 4TKZA 4B3GA 5K0NA 3QVMA 5AMXA 3V4PB 5DLEA 5J1TB 3MMZA 3IFSA 4RTLA 2BC9A 3KG2A 5DWQA 4JX9A 4YAJA 5HF9A 4DIDA 3JSAA 1AM4D 4R1QA 1KMHB 1HE3A 3NETA 4HLUC 3MT0A 2I7CA 3VR1A 4BB5A 1JBEA 3O1HB 1D6NA 1LJUA 1PVVA 3CYFA 3F74A 4YRKA 2B36A 5E0KB 3MTQA 1IZZA 4I1YA 1OASA 1MEOA 1ORHA 3JV7A 1G1MA 3P9CA 1RJ9B 2GK7A 5DHTA 4OQZA 4KSYA 1TM4E 4EM6A 2GYUA 2VDMB 3EGWA 3DDOA 4KXFB 1E64A 1W6RA 3K32A 3OPQA 3ZWQA 1FP1D 1Y1PA 1NXOA 1SUEA 1EUYA 2VCEA 3OCCA 3OTHA 3JY6A 5FO1A 4HPWA 1DJPA 3UJDA 2BFFA 1SIOA 1WZEA 2YFKA 4ZAVA 3MOSA 4EHBA 3A6HA 3V6LA 4AXBA 4LFBB 4B87A 2VHWA 4BTLA 3DMRA 1YDGA 3SHFA 4YWJA 4C4RA 4D8XA 1JDNA 4AJIA 1JIVA 1X7HA 3BGSA 3E53A 3EY4A 5KYKA 2NTVA 3QOXA 1X1DA 1RNLA 3A70A 3BN3A 2KS6A 4BKRA 1E8NA 3HXLA 1YR7A 1B1CA 3S8YA 3RQSA 2QE6A 4WI1A 4O5OA 4PC7A 4ED9A 1TKBA 4M0LA 5A7HA 4OFXA 3R0VA 1GLGA 5G53C 4JV5B 2O7RA 5GJWC 5FOVA 3V7FA 4DHEA 1W48A 1ZESA 3LH5A 3Q6MA 5AVWA 1O4WA 5B2ZA 3RJMA 1NVUQ 2FUKA 3LD9A 1S3GA 4R8LA 1BFUA 3UMRA 4DY6A 2UZ0A 7GPBA 2LPMA 1FDOA 1BE1A 4GLBA 5DI9A 1X0VA 4OMCA 4AUKA 4E33A 3C3BA 3DF9A 1P2DA 1SKQA 2CYAA 1G9XA 2EKDA 2IBMA 1L8LA 3HG7A 7YASA 5KVQA 1KBOA 4M0FA 3HM2A 3TZHA 3ZWPA 2R6ZA 3WG9A 4R8VA 2Y1LA 1NONA 2B3DA 3U1TA 3AR9A 4D97A 3BCRA 3IPYA 1OKKA 1TEHA 2CLLB 4P86A 3TIFA 3FA2A 4CCYB 2JVIA 4DR6B 1Q7GA 1CSEE 3AERA 3B7PA 2BKUA 2IGBA 3GG2A 1OFUA 1XMPA 4ZEMA 1ZH4A 2Q07A 1Y8ZA 2PWAA 2ZJZA 1OH5A 1NJ1A 2W6ID 3NHKA 4AIRA 3OJWA 5I01A 4EP1A 3BMQB 2CW5A 1KEUA 1LA2A 1O5IA 2TMGA 1AGRA 1XDDA 4NH4A 3MS2A 5EJ2A 4FJ0A 1QV7A 5ERXA 4CLOA 2BYTA 3MFYA 3IT3A 4WSOA 4MVJG 3GLSA 4KVFA 4QXAA 1JR6A 5ILOA 1Z28A 4LXHA 2AN3A 3OEWA 2WWYA 1Z7EA 3VO2A 1CVIA 4QBTA 4WLOA 4DV7B 5AQEA 2GSWA 3G59A 1GITA 4QNRA 4FGWA 2C7OA 5IBCA 3T3IA 3NCHA 5REQA 3ZE8A 1TRHA 4ZKDA 4HSEA 4CG1A 4YK7A 1B8UA 2I76A 4MB6A 2QLMA 4TWAA 5HJ2A 3EYWA 2C1EA 3FLBA 4TVOA 4N3CA 4PC3A 4CF5A 5K5EA 1E3DA 2VPIA 4BV9A 5JWRA 2RKBA 2Q1XA 2GZ3A 1XQVA 4P4TA 5I7RA 4OHYA 4QVGA 2WE7A 3OMWA 4Q4DA 1DXQA 2YN0A 2G09A 3R6DA 4BAZA 5FNVF 3ZH9B 4B31A 1XDZA 1Q0TA 3NTUA 1D7AA 4UM5A 3IVRA 1Y63A 1O94D 4RMGA 1MLDA 2AI1A 2CJWB 2W2MA 1X8KA 2B1IA 3DOHA 2P11A 3ND8A 5EHGA 4OH1A 4KPEC 5ALOA 2RI1A 1ONBA 1TQDA 2ZQ5A 1Z26A 5JYCA 5CLGA 3RUPA 1WIWA 1CS0B 4KGDA 5E6UA 3UJ8A 5KU7A 2FPUA 3FZEA 3CQ9A 4B6QA 3BCHA 2FN7A 5CD9A 4IGAA 2VJBA 2X8JA 2G1AA 4ISCA 1XTZA 1BGWA 2ZVPX 3F4BA 2BFEA 3TI7A 4ZOLA 2XF2A 4YGYA 4RK0A 1TAGA 3HL4A 2VK8A 1M2HA 1RE1A 4F3CA 3QMMA 2P0EA 1GA6A 4OFWA 4BO3A 4L3VA 4RQBA 3LLMA 3GJ0A 4TTSA 1XZBA 1AK9A 3KE9A 5CDSA 1HO3A 1K66A 4GRDA 5BW4A 2EHDA 4KTTE 4LQ4A 4C7KA 2EXXA 3A9CA 4CBVA 1JHMA 2ZBQA 4ZT3A 3BF7A 1KOGA 1VRWA 4WNAA 4HKTA 3GARA 4LGCA 2IEZA 4OSPA 3E2MA 1QH1B 2CWDA 3Q11A 4NY1A 3EZ9A 3ILVA 3RDPA 5JS7A 3ZD6A 1II0A 1RLOA 1TVEA 1U6KA 3HJUA 4IIJB 1NSYA 3TFOA 4K9NA 1ZD1A 2YN4A 1KOJA 4Z54A 5SY4A 4P1ZA 3IP9A 4N6NA 4B8ZA 3K1JA 4GIBA 2DFVA 4DBZA 2A2ZA 3WGMA 3OMXA 2HU8A 2XUZA 1RTKA 3WKAA 2NUTB 3WLOA 1DPGA 1K7FB 2FRDC 3SLKA 1PLJA 3U4AA 2Q5LA 3KLNA 2FUEA 2Q99A 3BMNA 3HFJA 1QGUB 4R1PA 4Q16A 1HT3A 1U0FA 1U81A 4RH3A 4CG3A 4AJNA 3IURA 3NDIA 3O21A 1XXHA 2GAOA 1WRBA 3U7QB 1LXCA 3WIDA 2ZI9A 5IJ0B 1XDBA 4YAKA 3MINA 1W5TA 4LMPA 4NFHA 4EB8A 2PX2A 1BW9B 3G5AA 4EENA 1LS1A 3SU8A 4JYBA 3RE1A 1X39A 1OFGA 1TTPB 1T4DA 3M6WA 5LYJA 5FNZA 4TPKA 1XYYA 4K6MA 4RF3A 1DFGA 3DONA 4PTYA 5CYFA 4DV3B 1ODLA 2EBHX 2YV4A 5J5CA 3ZWKA 2VAVA 1FFXB 1TVKA 5A7FA 2YDXA 3C1OA 5D3MB 1LX6A 5F35A 2Q1WA 3SYRA 1XL0A 1W34A 1F5NA 2DWCA 2QRHA 4FHFA 4JXJA 4D96A 1PKEA 5KPJA 3NYIA 5HZMA 2PFGA 4G84A 3KUUA 4X7RA 4Y6OA 3FOZA 4IV8A 4MB0A 1IL0A 3PITA 1RVV1 2EJCA 4KQWA 1R88A 3DXZA 3TQFA 5AHWA 4E7PA 2EOAA 2HHHB 3ONFA 4M46A 1I4DD 3L6BA 3LX8A 3DNMA 5C5DA 3TOSA 1EFAA 2OOSA 2GUWA 5T6BA 2AL7A 2B1JA 1FRFS 1ORVA 2PCLA 4HF7A 2PUFA 4N5HX 2DUWA 3C5CA 4UZSA 1N9KA 4CCWA 1IUOA 1M54A 2D8AA 4ECEA 5I4BA 4B3TB 4JI1B 2DQ4A 4IIHA 2XPCA 5AVJA 5C7LO 3P9PA 3ZBUA 3TZEA 1UINA 1GU7A 1SVMA 1U0OC 3NOVA 4URHA 4AF7A 3L7AA 4N4AA 3T61A 1I7DA 4DR4B 1USUA 2EWMA 1GTVA 2WABA 1U2SA 3DCYA 3AFGA 1C9JA 3EZYA 2GA8A 3LUKA 2H08A 4WOCA 5DP2A 2I99A 5C4GB 1DADA 3WYDA 5ED0A 3LWZA 2NZJA 4RK4A 4ZYUA 4CEIA 4G5SA 1JEJA 1MW8X 1B0AA 1ZM3A 2XR1A 4AM8A 2CYCA 4IRUB 2UAGA 3AOGA 4H6WA 4J0GA 4CMEA 1NE2A 5AJTA 3RU9A 1NUPA 2LKDA 1RM5A 4ZDJA 1U3UA 2Q5HA 1FRNA 4PSCA 1Z8NA 2R9VA 3FLAA 4UEOA 4ZO4A 3N0RA 2GJ8A 3TCXB 4BFYA 2QIOA 4PIMA 2BZ0A 2FG6C 2F43A 2ZXEA 3EQ9A 4BFXA 1B6SA 1U2ZA 2ZYGA 2ZUUA 3AESA 1RXVA 4S04A 4W5JA 5SYAA 5JY1A 4GW3A 5B1YA 5IVKA 5IDWA 2QV7A 1YR9A 3VYWA 2WZCA 3AV0B 3A1UA 5B7PA 4LVUA 1MORA 2AV6A 3ER8A 1G8HA 4D4JA 5F2EA 3CINA 3CTMA 1VCNA 4MIOA 4RD6A 3LL4A 3S2SA 4WD3A 4B33A 2BMWA 3Q3IA 3FYUA 2Y4NA 3SQOA 5LOVA 4JQCA 1VPEA 3EIWA 2UYOA 1UP6A 2PM8A 3SZRA 3FPAA 3UCFA 1EGAA 4IIYA 1T9GR 4HZGA 3K9WA 4KXLA 2YV1A 1T4CA 5CK5A 4PGMA 3WJ1A 2ZT5A 2GI4A 2GHTA 2YBEA 1PGJA 1VPTA 3R5JA 4U7JA 5E8JA 2AQ8A 3TPZA 2DTEA 3VR4H 4BASA 4MV1A 3IRUA 2VF8A 2IHBA 2J45A 3NRJA 4DDUA 2X8AA 1GCGA 1Y82A 3HC7A 5CH3A 2R1ZA 3GLUA 3L6DA 4MAFA 4F3TA 3AF5A 3KXLA 3WSVA 1IPEA 2D0IA 3PPWA 4NOLA 4KXWA 3NIBA 5KCMA 1IN4A 1Q74A 5LQUA 3LKZA 2PSEA 4Q4HA 4XDZA 1KJQA 3W0LB 1WV0A 3LX5A 3AFMA 1RVDA 3ZHQA 2XCSB 1XAJA 2AW5A 3W5HA 4F56A 1G59A 3PL5A 1ZLXA 3H1EA 1C8KA 4PSAA 4DV0B 4RNCA 2ZBUA 2A35A 1RCTE 5DN9A 2YVUA 1NP3A 1J07A 2PEYA 1E3SA 3JD4A 2Z3ZA 4P38A 1U0RA 3A4LA 4D4GA 3I5YA 1Y3DE 2ZJFA 4Q9HA 4M8NE 1KO8A 3DF7A 2EF1A 2YVAA 1I10A 3EMVA 5FBRB 1GSIA 1JJVA 2QSJA 4LZZA 3F8TA 1Q2XA 4QVKA 3JU3A 2AFIB 1NZFA 4YAOA 1JUDA 1A1SA 1XA4A 1C3OB 4H27A 2FRVA 4A0SA 3RADC 4MW7A 5SY9A 2Q0QA 1QLJA 2NMVA 4MDFA 5HCNA 3HABA 4E3ZA 4WVFA 3RRBA 3LDHA 4PFSA 4H59A 3TSCA 4RV5A 1RPJA 1JPVA 1Q2UA 2Z4SA 1JMKC 5ANRB 2A58A 4Q7EA 2ENWA 4PXYA 2P4SA 4C7MA 2YFQA 1ONPA 2ID7A 3WGLA 1JFLA 3RS8A 1SCJA 3B1WA 1Y8QB 2GX6A 2PGJA 2XGMA 3CV3A 5FWDA 4ZV4A 3DW1X 3NNNA 5JWHA 4MDYA 2FU5C 4F0JA 3VPAA 821PA 4F3NA 2GYVA 3RVJA 1GNQA 1SU8A 2J7PA 3M6UA 4BNIA 4QG3A 3ZGNA 2C7RA 3R76A 1VMEA 5IZ4A 1VDZA 4A8JA 4U7FA 4ZC8A 5BQXA 5C53B 1AF7A 1VYHA 3RTGA 3HA3A 5LUBA 1Q0PA 2C2HA 1G8FA 1JT2A 2XUFA 4HYTA 1KY4A 3NM4A 1ZIPA 3CSDA 4UXIA 3QA3E 3H0EA 1UDCA 1RC8A 3ZHTA 2EP7A 2IYZA 2BPOA 4K28A 2X8LA 3L1IA 3LW7A 1JSCA 5KYVA 3EUWA 5H9VA 4QOSA 1Z3IX 3A1FA 1D5WA 3FVQA 2G5CA 1S01A 2Q29A 2EIHA 4X90A 2AR0A 1QV6A 5DIFA 1GEGA 3HWSA 3OE4A 2YV3A 4JHXA 4MQMA 1JIKA 2RHLA 3IHKA 2QUIA 3OIUA 1EFCA 1QYXA 3NIFB 1N6HA 4HH3C 3WLKX 4PLHA 1AK1A 3HP4A 3QRWA 4BO0A 2OM2A 2W2QA 1OF1A 4G25A 1G3RA 4JUCA 4BMSA 2BUBA 1C7FA 3WNDA 1UBEA 4H16A 1OLXB 2I6GA 4KLCA 4BKQA 1IXSB 1CIPA 3H3JA 1IZ8A 4WLUA 4N01A 4DSUA 1U1GA 1X7YA 3TSYA 2GLUA 4MMXB 2PPLA 2RBGA 2V96A 1ZUWA 2UUOA 4KVAA 3IX7A 4OQNA 4PVCA 5TS3A 1YIAA 4RYDA 2C95A 3HR4A 3TOZA 4QC2A 4PN3A 1LVUA 2FJ0A 3B7WA 1A04A 3FZQA 3I01A 1TQ4A 3HDQA 5LIPA 3ADDA 2O8CB 3ZZUA 3SS8A 5BWMA 4EOGA 1HPLA 2XGSA 3EVCA 1AN0A 5KJ1A 2B61A 1Z7WA 2LW7A 3OQJA 3RVPA 3QX3A 2FGJA 5E4JA 1NKVA 2KWIA 3KDPA 4F7WA 2VNKA 4RPKA 5LLDA 1VSQA 4ZO6A 2WKQA 2SNIE 4WK0B 3O82A 3QSGA 1SVOA 2AG5A 4UCFA 2J3EA 3NHMA 3ESCA 4MRSA 4URWR 1SKMA 1NPDA 1ZY2A 3K0BA 3PENA 5CG1A 2GN9A 3V33A 2B0JA 1UKCA 5EWMB 3SLRA 3X44A 2PLAA 1MB9A 4KUGA 5L8VA 1A8PA 2NUAB 3KLBA 4O02B 4HGYA 1SKYE 2VAMA 4MB2A 5H8WA 2XWQA 3BTSA 1Z5PA 2XMRA 3EZNA 3OOSA 4RZ3A 1MZPA 1KDOA 1LQUA 3KAJA 2CXTA 1JHYA 4DV4B 3DFFA 3P32A 4JU9A 5EWLA 1S0UA 1Z2NX 2IIBA 3E18A 3E2PA 5TC4A 1UJ6A 1YMQA 1I51A 4GYJA 5K3FB 4BLSA 2PKRA 2IHZA 2GHRA 3H84A 1J21A 4OGFA 1EJ0A 3Q8MA 3RH0A 3H1FA 4P7BA 4UDXX 4DLLA 2OCDA 3TX6A 4RA6B 4M1YA 5KNCD 4L0QA 5T3YA 1MB4A 3KVOA 1T3ZA 4MR9B 1TQ2A 1VL2A 2HO4A 2LV8A 3A6ZA 1NMEA 4IIFA 3PLAE 3SS9X 3R7WB 4DXHA 2NYVA 4JGIA 4L51A 1NNSA 3BM5A 1MC5A 1TYAE 4BX0A 2GBPA 1QFMA 4E94A 1WTCA 4L07A 1EA7A 1R2QA 2JEYA 2VNAA 3MWDB 1M7HA 1X7WB 2WKRA 4LQDA 5TPWA 5IJ9A 1QO0A 1UZNA 3H97A 4QFBA 1JI3A 2FCRA 2JNWA 2VHVA 4LOIA 4UW9A 3ASVA 7AT1A 4H4DA 1OZAA 2BD0A 1O77A 2QLNA 3KJEA 3T06B 1NT2A 1T0JB 2FR8C 3DV0A 3IEXA 5NULA 1QVWA 2YHUA 5FFFA 3T5AA 3NUGA 3JQEA 3EISA 3NV7A 1EFKA 5G0TA 4C7VA 1MAHA 1ZKDA 3X3HA 4M83A 1OAOC 1XMIA 4ZI7A 4AFNA 4MQ5A 2VOEA 4FHCA 4B3RB 3QPWA 3WS7A 5I45A 3KTOA 3U6KA 3EXG1 1G21A 4YACA 3T7DA 3D81A 1J4AA 3FB4A 2ZE5A 4DG8A 2PUDA 3GVIA 1TQHA 3JQDA 4DR1B 1BD3A 2MR6A 3OIGA 1VCHA 1UDAA 4Z7OB 2HWYA 4J9UE 3GP3A 1WZUA 2NTJA 4JP3A 2CF5A 3DBRB 2LKCA 3OD5A 3C7DB 3OZAA 3I4FA 3GEHA 4K9MA 2R97A 1MXFA 4N65A 4ZYVA 2QYHA 4M1MA 1EWRA 2JGAA 2OBYA 4KFRA 4OU5A 4EYEA 1BCRA 2YV5A 3KOUA 4G07A 4D25A 2ZTHA 2DJIA 5ALQA 1GN8A 1SVWA 4MQLA 3PC7A 3MGCA 3QEOA 1Z36A 2YXBA 3A1VA 1YA4A 3LPMA 4GRIA 4HGZA 2HR1A 4BNHA 4HDOB 1J0AA 1EB9A 1E2FA 2VRWA 1YRBA 2IV7A 1Z2OX 2ZT8A 3ISVA 4V0MA 2ZUWA 4B7AA 1HETA 3BF8A 5CMLA 3NORA 2FMTA 4UQOA 2Q4OA 3DDSA 3ANLA 1U3FA 1F9EA 2IITA 5KOHA 4YROA 3NGXA 4JXKA 4I8IA 1QG2A 5DNYB 2GPBA 3NXKA 2YJGA 3FWZA 1GPDG 2PWBA 2Q6KA 3PUZA 3QMVA 4NI5A 1F8FA 2EX4A 2H0QA 1COWD 2R6HA 2L2QA 4U7TB 3ZQJA 4EB3A 3INGA 4FYIA 1OROA 4K8OA 3DO6A 2XUAA 1XVIA 3OCYA 4OB8A 3ROMA 2IH5A 3LBYA 2X0NA 1N2CB 4AX4A 5FWAA 3T4PA 1BJKA 1JG4A 2Q3CA 3IP7A 4NV0A 1XR3A 3WSTA 4BNZA 2Q1SA 2JLYA 3S2UA 3ZHXA 1S2DA 2J3QA 2M98A 2Q45A 2H8KA 3HB1A 1YE5A 4ENVA 2HTEA 2ZWOA 3OURA 1XI2A 3UH0A 5DHSA 1TIPA 4TV9F 2HK9A 4KAFA 1TYEB 1OBFO 2C9OA 3O9ZA 2ZI6A 1PNQA 4AMGA 2WUEA 1QV9A 4B3FX 4EO7A 3IQXA 1KGSA 4QD3A 3V1LA 5HTOA 3BKXA 4X63A 5BN5A 1CUYA 1PFQA 3IQGX 5JMPA 1U0SY 1VE1A 3ASUA 3NHAA 5FOXA 1L3IA 5DM4A 1N3BA 3LC7O 4V03A 1DRJA 5LM3A 2CNBA 3Q40A 1NW4A 1RC1A 3FVTA 5E95A 1VLHA 2Q5EA 1Z4MA 1FS6A 1ZXXA 4K9QA 5GONA 2DWPA 5IDYA 3QEKA 2VQ6A 1EVZA 4N47A 621PA 4JBXA 1JTFA 3ZZTA 3K53A 1XRJA 4XE5A 1JDBC 2RAPA 5LYYA 4H1TA 5A3SA 3TTVA 1C0IA 4Y2RA 4F4IA 2G7MC 3SQMA 3EOBI 2H9IA 2JFBA 3EIEA 4AIIA 5I9TA 4ESOA 4GNRA 4EEKA 4WFIA 3GV0A 2W2LA 1J06A 4JUDX 3R9IA 4G1UC 4R7ZA 2PZBA 3UJ6A 4B1FA 2F43B 2IF2A 4M9UA 4N9WA 4EQ6B 4F92B 4DUZB 2UYCA 5CDFA 1RYYA 3BKWA 3IUMA 4H60A 1D8TA 1T26A 1K5DA 4UHFA 4BQRA 5HUQA 3OM0A 3O4VA 2I4LA 2ZYIA 3QVOA 4TVSA 4YRDA 2VH1A 4LGYA 2QX4A 1Z82A 3CY6A 1NVBA 2ZRBA 4FHGA 3DR5A 1JDSA 3DB1A 3EEBA 4X1OA 4HWTA 3USES 3RFVA 4O6VA 1GZHB 2HPZA 1SXGA 1GY8A 3KQSA 1M67A 2PG3A 1S8NA 4HCJA 2IDJA 1JV2B 2X40A 3K31A 4HO1X 3RVBA 4C4PA 4IXWA 5CFLA 3EGEA 4D6PA 1KZ1A 5EQFA 4B6FA 1KK2A 5FL7A 4BXOA 2OCAA 2NQTA 3JD2A 4ENUA 2FEXA 4KQ9A 3VR6H 3NWOA 2WSIA 3LK7A 4CEJA 1F48A 3ZBPA 2E6UX 4K9SA 4KAJA 3A3OA 5KNDA 3H19A 1Q5PA 3DFIA 1OFIA 3AH8A 4HWGA 1K63A 2RGCA 3JW8A 2CZQA 4M21A 4ND1A 3GMDA 1NI4A 2FN4A 3KD3A 1N7GA 5K09A 4XWKA 2GN0A 3DCIA 5GQSA 4BKMA 4TMXA 5DI3B 3SX4A 2BM9A 3HVHA 4BZWA 1T6NA 5LWHA 2IS1A 3G5MA 4Y6RA 1B41A 3L93A 2E1RA 1V8OA 5E9JA 4TZ0A 1OYOA 2Q0SA 4J07A 3SJCA 3FNHA 4YP5A 2ZS8A 1P9LA 5GP1A 1XHLA 3VKGA 1CUFA 4L5IA 4CL2A 4EHKA 3I23A 2JRCA 4TWBA 1CY0A 2GRUA 1G8JA 2A5YB 5TSDA 4NLLA 4M0KA 1KNXA 2QLJA 2YW9A 2WTMA 3CUEF 3JALA 2WFLA 4KDEA 3D8UA 4OSEA 3HKEB 5DH9A 1WSAA 5F78A 3T9DA 4A7PA 1E5QA 3DC2A 3N9IA 1NF3A 4L9AA 3VU1A 4AJ9A 1X9GA 2H4HA 2R44A 3TZCA 3CX4A 5ISMA 1C3VA 1WMBA 1ZUNA 1Q0LA 2K5UA 4IZIA 4EW6A 5KOJB 1NUUA 1ZMBA 2ZPTX 4YJ3F 2PGAA 5B64A 4PAOA 2BFBA 2J9RA 4N39A 5DMHA 2IWRA 3HEAA 3FTFA 1DTWB 3E3NA 5LMNB 3CPSA 4G0YA 4W7SA 2J5KA 1B15A 3WDMA 2I78A 3BBPA 4D3SA 2BJHA 2YRFA 1N6IA 4ON9A 3ZDXB 5CB4F 1GRRA 4YJGA 3UHOA 1XJQA 3V9AA 2ZB8A 3B89A 1ENOA 2GJKA 3NHZA 1PQWA 4AP6A 1I94B 4ES6A 2D5LA 1A77A 1W5AA 3HKBB 3T7RA 3TQSA 4BNDB 5KTOA 4UOQA 3ML1A 1Z88A 1NBOA 1NBMD 1F4VA 1WV1A 1R0SA 2GJSA 3F96A 3SDBA 4KWTA 3VFDA 2I91A 1SZCA 4YNBA 1YQTA 4O08A 2H8GA 3UJHA 3PHBE 3R0XA 5KYUA 4RV4A 3P9YA 2WA2A 1HQDA 1PG5A 1YIOA 1BVUA 4IW3B 7REQB 4JI8B 4N3GA 3L4JA 4AJ1A 2D1QA 2WJZB 1NRIA 3QKRB 1RBMA 5B2FA 1XALA 4EUNA 2XUIA 1QOQB 2PR7A 4GS5A 1YBHA 3GEMA 1XNHA 4KV7A 2C4UA 5DCYA 1FFDA 1E6UA 1IXZA 1JLSA 4G4SO 1N5RA 1P1BA 3GT3A 2BBWA 3AHHA 4FZJA 1JJIA 1KY5A 2F1HA 1BH2A 2OXEA 4LF6B 1JAYA 1EE1A 2HIAA 1Z17A 3A2NA 1U2TA 4P3NA 1G3QA 3AEQA 2R5NA 5B30A 3R3JA 5AKHA 1ISFA 4MYSA 2ODEA 3ROGA 1FW6A 4O0LA 2OGWA 1WVIA 2IX9A 1JLMA 5G02A 4DM7A 2YUIA 1X3SA 4EGCB 5P8WA 3PX3A 1L4LA 2AYZA 3IUPA 3OCVA 4A6DA 1BMFD 2PBRA 2WJYA 3EVBA 3TOXA 2ODWA 3TQRA 3RKRA 3G82C 2AUMA 4PNPA 3NHRA 3AP3A 5KYWA 2P3QA 2IZ5A 1DO8A 2VATA 3SZLA 4EVSA 3RLFA 4UTOA 2XYVA 5K0BA 1K89A 5BNIA 3IH5A 2LIPA 2OCYC 5BWCA 5SZJA 4XCVA 2GWHA 6ADHA 3KQNA 5HCUA 4JP5A 1TMKA 1ZGAA 2NO1A 5GZ1A 2C0QA 3HADA 4K6FA 4UBOA 4Y1EA 3SG0A 3TS1A 3SYKA 1GQ2A 1DKPA 1WDKA 2DY1A 3JQAA 4U5XA 2XB4A 8ATCA 3SFZA 4H4CA 2IIQA 3DXFA 4MUXA 4URVR 2V6IA 1ML4A 3ZLJA 1SGWA 3EXAA 2QTMA 3EDOA 4HL6A 2BJVA 2IQIA 4ZHSA 2E4UA 2AJBA 3F4KA 5B6JA 2RI0A 4BJ5A 1DIRA 1RM4A 2WJWA 3F5SA 1GTG1 1UXOA 3KJFA 2W70A 4D9KA 4K5QA 3S7ZA 4JI7B 2BHTA 3IDAA 1SC4A 3WHPA 1DOAA 1TB4A 4GKBA 4HR7A 1KMQA 1Z6AA 3EZ2A 4KB5A 4KPUA 5DSXA 2Q9AA 2FSFA 2VA9A 4Q4JA 5H82A 5EQDA 4NBNA 4TLLB 1QMPA 1ZSVA 1N2SA 2PXHA 3GRAA 1NXVA 2YXNA 3HBNA 2J5BA 2WTUA 2FWJA 1XZHA 3NANA 3WB1A 2VEOA 2IYRA 3H9GA 4MYCA 1HT0A 4RORA 4ZCLA 1HWYA 2JIRA 5ENZA 1L4GA 3CEAA 3RAJA 3RASA 3BMCA 1NNLA 2C9YA 2J5QA 4W99A 2YS7A 1QRAA 2KX7A 1W2WB 1ZFNA 1NV9A 4DG9A 1ST3A 1GRCA 1QH0A 1ISSA 3P9KA 1IQRA 1Q7TA 1QHNA 4IG9A 2IYSA 4WAUA 3DTTA 4Q6WA 3IAUA 3VPSA 5JJIA 3R5TA 2JFWA 4G0ZA 4TTJA 3M8KA 1PG2A 3CHYA 2CNNA 3K96A 3GLFB 1FTNA 1Y9JA 3KPYA 1LPMA 4U2KA 1YV9A 4ISBA 3WICA 1Y4AE 1R4NB 3FRHA 3R7NA 4DILA 1NMSA 1Z75A 3SFVA 1J33A 1Z38A 2I1LA 3F6BX 4DIBA 5KS2A 2JGRA 2CHGA 4EG1A 2XCOA 3B3AA 3HACA 3MT7A 2PUBA 2P67A 2FE4A 3DE1X 4AKHA 4K6CA 2VYND 3D8RA 2J08A 4KUEA 3LUDA 3H9JA 1EUZA 3L7OA 4OP1A 2IXTA 1XRQA 2O2EA 3LI2A 2PDAA 3ZCRA 1U11A 2ANCA 2WZBA 1I3NA 1EXVA 4BBPA 4NV3A 4RU1A 2R5FA 3BRWD 4FMCF 1PX0A 4K9LA 4N8SA 2QTNA 4OB6A 1DWOA 3AHCA 5F9MA 2YWFA 1E1MA 1UFRA 2PS0A 3DVAA 5DHAA 1AQLA 2HHCA 1CRPA 3CEJA 4HX5A 5DGXA 5FHQA 3S44A 1VKZA 2W6PA 3PQ3A 4HLCA 2PO7A 3N28A 4EKIA 1QMGA 5AKGA 2R62A 3DT6A 4OLBA 4MS4B 4HDQB 2LCIA 1JKIA 1YJ8A 1PUXA 2XD9A 4HRYA 2JCBA 2OAEA 1OXKB 2HD4A 1CRWG 2GS9A 4YMHA 1DBRA 2IE8A 2JF0A 1VLVA 4BN5A 5M2QA 4KTVE 3VMFA 1IQPA 4L8FA 2DBZA 4J0IA 5LJIA 1OI4A 1YGYA 4G0NA 3HM9A 1RFGE 2X9QA 3HKBA 4FKBA 3OWXA 4O1HA 5FTNA 3WDSA 5AW7A 1X1TA 3S4YA 5H9WA 2PXXA 3BT7A 1WDWB 4L6CA 4XIIA 1CZUA 2AS0A 2NU9A 2PX4A 2IYLD 1CLUA 2JFXA 5KDLA 5HVNA 4XGIA 3DEHA 4FZRA 4M3NA 5FTKA 4B3MB 4A6EA 3DWIA 1ODJA 2X0RA 1V8ZA 1UPCA 2MYTA 4WA7A 3NAGA 4XB2A 4ZK6A 1Q84A 1VJ5A 3FNEA 1H5NA 3TW0A 1QO9A 1MA0A 1M1UA 4DZZA 4PBSA 4DDVA 5K8LA 4C2UA 3HYLA 3OIYA 4FCVA 5BYAA 1F6DA 4PSDA 3M1YA 4QULA 2KM1A 4B48A 1NC3A 2O2XA 3DEIA 3DEAA 3QPCA 5TGDA 3ZY4A 5EJ9A 2FP4B 3PF9A 4D0GA 3VU0A 3DZBA 3E5MA 2W83A 3V1NA 4BDSA 1UKBA 1Z0UA 2QX7A 1ENPA 2Z1NA 5I48A 3EIUA 3ADKA 4KQIA 3LRPA 4AMYA 2ZAOA 1K4MA 1KMHA 1SXJE 3IOMA 3L6EA 3RIEA 2QI9C 5JASA 1VHWA 4G67A 4BZXA 1YA6A 2FPPA 1F4LA 1H0KA 2RONA 1T35A 4HMOA 4NR0A 5ALRA 4CJXA 4E6PA 3PUHA 1P18A 1XELA 3E9CA 3E9NA 3LCUA 2B78A 1U9IA 2EHJA 3BRCA 3JQCA 4Q9IA 3AXTA 2GVZC 1B76A 4M1EA 2ZYSA 3C6QA 4Y1RA 3ZR4B 4FNAA 3HR8A 4LRTB 3NHUA 4KO2S 2GPAA 3ZLVA 1OE0A 3GJ7A 4GPIB 3CRNA 4OPMA 1UJMA 4QNMA 5GGYA 1P1HA 5AVTA 5LP6A 3UGJA 1QH8B 1N0UA 3K0HA 5EGSA 1ID1A 4MW9A 2P9CA 1X94A 1F8UA 2W90A 3HDGA 3NJ8A 3O3NB 1U2QA 4AKGA 2VIIA 4YJ3A 1HDOA 4OQXA 4EL5A 4IQGA 3OLCX 2IU3A 2Q6TA 2O20A 1LPBB 5BSEA 5FPQA 4ME6A 3UUFA 3UOWA 5B3KA 2WT9A 1LDBA 2G82A 4ASUD 2A3NA 6PFKA 1YS9A 3E9ZA 2WWWA 3T1NA 1QKKA 1WR8A 1PF7E 4A82A 4D0SA 2AVDA 2WNHA 3PNYA 3OLQA 3CR8A 3F9CA 5KC9A 1LUAA 4G1EB 4U02A 2DU8A 3U40A 1NR7A 3ZNNA 1HNXB 4MA5A 4LJRA 3ZHZA 4M53A 4H3HB 4CHGA 3DDWA 2GZRA 2XB9A 3RYHB 4KITB 2V9ZA 4NSNA 3E5HA 1C81A 4P31A 5FOSA 3STHA 1H8EA 2FWMX 1SUIA 4B3JA 1YXMA 5GM1A 4E03A 2E4XA 4DBVO 3SLGA 3MMNA 2FKNA 3TTXA 4YQFA 1LPNA 5BSMA 2ZIXB 3TXYA 1V7PC 4HNQA 1ULHA 2DRIA 3MLBA 4CU2A 2C0CA 4PAMA 2W6IA 2UZAA 5GZ3A 1GAXA 1FNMA 1RWPA 3LK6A 2P6OA 2DUMA 3O1JC 3RK4A 4AD8A 1JA0A 1VRVA 5D3QA 1E79D 3C6ZA 5AM4A 2QZ9A 5FOWA 3DBIA 4QOHA 4QGSA 1QP0A 3WGVA 2QI9F 3FMVA 1MH9A 2WOJA 4NAUA 1XPRA 4MUGA 2R4QA 1D2NA 2W2NA 1H2AS 1M2NA 1MBZA 2CHUA 2Q8PA 4M8IA 2OO3A 4O2AA 3OIVA 1B74A 3U17A 2ZBEA 1ZCBA 1TM7E 1PIWA 1R9NA 2XQGA 3A1EA 3W2TA 8ABPA 1QU3A 2P9JA 3B9PA 1U3CA 2OEPA 2YWHA 3K4PA 4E4TA 3PCXA 1TA9A 2OBLA 4IDHA 4JASB 3IV6A 1MT0A 3H16A 3UOAB 2JGFA 3OFND 1ATIA 3A6KA 3OESA 3AYXB 1SCBA 2JJ2D 3QU7A 3RS2A 1XEAA 3LHDA 1TTHA 1XCOA 2VDWB 1NVWQ 4TWZA 2JS7A 4M0MA 4I36A 3PFCA 5DWVA 2AFVA 2QM7A 2X76A 5C1OA 3MOGA 1FJGB 3VJKA 4Y6GB 3DMHA 4HOYA 2JAHA 4AYWA 5BN1A 3LT1A 4PZDA 1LBEA 1WW2A 2BFFB 3DL0A 2BL4A 2QTFA 3RJZA 3TQHA 1QHEA 1P7YA 2OK8A 3GVHA 2A86A 1UKEA 1LWOA 4ZTZB 1CIVA 3OOYA 2CBZA 1QOZA 1QH1A 3UMBA 1GADO 1IJEA 1OC2A 3FHLA 2QZSA 2RCYA 3OQ6A 4TL8A 4RFSA 3KSAC 3EH1A 2OBFA 2FW1A 1AXRA 3BK7A 3ED1A 1AB6A 3GJ6A 3EDRA 2WPDA 2Q46A 1U7HA 1R4MA 2F6RA 3NG1A 1B8PA 1G6KA 1JHOA 2ZIAA 5EN4A 3SHTA 6GPBA 5KDOA 4FXOA 3WMGA 4QPNA 2YJ3A 1G64A 2NO7A 1OH8A 1R6XA 2F3RA 3H5IA 1QIJA 3BJZA 3BXHA 5EZSA 1VI5A 1ZNQO 3MEQA 1ZS9A 3RYIA 3DZGA 4O1IA 4GOMD 1TKAA 2PUTA 1G9TA 1DEKA 1H6CA 1MZVA 2Y9PB 4UUQA 4RPHA 4ZCPA 3RIGA 1YSCA 4EPVA 2FFJA 5IM4A 4A27A 5KAMA 2C7PA 1CRLA 2ZJBA 4JEUA 1GQOA 3R41A 2QPTA 1VXOA 4G56A 4I4TF 4DMHA 3NHSA 4Q1FA 1F2TB 2ZJAA 3D7RA 3MRXA 4FOLA 3ONDA 1NOIA 2VJCA 3VI4B 1N2XA 2VLIA 2F55A 1HEUA 4NG4A 3TD6A 1W88B 2FWBA 3PSHA 1JH9A 4KMRA 1M1ZA 1IFXA 3VU3A 1K4YA 1GUFA 1OGJA 1XF9A 2I87A 3T9EA 4YY3B 1T0HB 1KFCB 5MF6A 3D8NA 1V6CA 1NIJA 1T1EA 1Y1QA 5ELMA 5C18A 2EFCB 3DLIA 4FWIB 2H2HA 3WQSB 3GPBA 5A0FA 4H77A 3SY8A 1X2BA 4EKGA 3BMNB 3F0TA 1AQ6A 1SVSA 2ZUDA 1FVFA 3BJEA 1NBHA 4W9NA 3TB4A 4XVCA 4HX9A 1OTYA 2YJ4A 3ZJ5A 2G80A 3TNLA 2CUTA 1JEEA 3EWSA 2HX1A 2X9GA 2J3KA 2YY5A 3PFWO 3PVZA 2C54A 3BIFA 1J0DA 3KTAA 2J46A 5BSHA 2I7TA 2OY0A 2VDJA 4EY7A 2Y1XA 5KSWB 3MTGA 1Y33E 2ORED 5ABPA 4ZDKA 3HUFA 4QSMA 1NATA 1EBFA 1SUPA 2O5VA 3TG8A 4C22A 1N2HA 1F06A 3O1IC 3HXMA 4OXKA 1T6BY 3RU3A 5HQ3A 2Y76A 1A9OA 4O4IA 3WL5A 1GGKA 4MCHA 2RH5A 4OAOA 1S1MA 1DAFA 2XIJA 4W1PA 1FP7A 2Y27A 5HDQA 2HJRA 3WOVA 2QG6A 3LUGA 2PH5A 4HDCA 1ZRNA 4TS9A 1UODA 5AKZA 1NW3A 2MMCA 3OUZA 3KQWA 2HH9A 5JLAA 4Z3OA 3ZS8A 3TDNA 1CP3A 1QZ3A 2ENUA 5HOEA 4KGZA 4KLAA 1TYCA 3UV6A 2CJWA 4H7JA 1AK2A 1GNPA 3ELDA 5C1IA 5LQJA 4OVKA 1FRZA 3U3MA 3VAYA 1WB9A 2UUAB 3QE2A 2G40A 1LH0A 2PANA 4IMPA 4XGKA 2JZOA 1Z18A 1AIPA 3LUBA 3UJBA 1H8ED 4EF4A 4IIDA 3MUFA 4IDEA 4BVFA 1KS2A 1NMQA 1T5LA 4PFKA 2X42A 2P5YA 4D44A 4JA2A 1Y7IA 3LSTA 3A3PA 1CXZA 2VLBA 4GECA 4IFTA 3K6SA 4WNIA 3JTMA 3I6IA 3U3KA 3AXSA 4YYZA 3E5NA 5DLQC 3RABA 3QHQA 4O2RA 2HLNA 2PMEA 1N0WA 2FV8A 3NW9A 2MSKA 4A8TA 4IVRA 4RDIA 2HWKA 3DT8A 1L9KA 4D56A 2NZ8A 4QFDA 6REQA 3EAFA 3JZFA 2GZ1A 2O8CA 1G3IA 1LVHA 3LQ4A 1QHIA 1WMAA 1YHNA 4RH0A 5JSYA 3QU4A 4LYAA 2DP4E 5E7IA 2BGWA 1G17A 1E1KA 3PTAA 2IWHA 4JYCA 4BGIA 4G01B 1HORA 4XRRA 1G3UA 3ESYA 2KBEA 4M55A 5BSGA 4NF2A 5K9ZA 3KZMA 3ZLUA 4N3AA 4HJRA 1NA5A 4RYLA 5U1PA 2IRWA 4EHLA 4MYTA 1NPTO 3DL7A 2CFCA 4LKRA 2NXCA 1EB8A 5C1PA 2CC2A 3EUAA 2WU4A 3UFBA 1U0GA 1YK0A 2I0FA 2C59A 3FNBA 3VOTA 4DVGA 1J2EA 2NZ2A 1GM5A 2QUZA 4GR9A 1C7EA 4QWWA 4B71A 3WAGA 5AK4A 2Z57A 5E6RA 2B4AA 3VYTB 1ZNXA 4M7RA 5KNDH 1PYGA 3HNPA 2ID8A 3PJRA 4GKKB 5GVRA 4F1KA 1BTOA 5KMGB 1QG6A 3VKUA 1J0CA 3IL2A 2ADMA 5G0VA 3TRKA 5LU9A 3IBCA 1MAWA 2OGZA 2QMOA 4CIXA 1XZAA 3OQ1A 1FNBA 3GEDA 1AQNA 4HEA6 5EVJA 5LNK6 4PCLA 1UF9A 1K3UB 2LD4A 4HUJA 2Q5CA 3KT6A 4LDQA 2UU9B 4IHQA 1DQPA 1NGSA 3Q10A 2ZJ5A 1W19A 1QO0D 1KARA 4AQ7A 2K2QB 5FBWB 4B09A 1L5GB 5L6LB 4Q1AA 4QUBA 3WQBA 3IDQA 1LW6E 1VPVA 2R2GA 4GPBA 3DMDA 1ZM2A 4OUKX 1PYDA 3AZOA 1SA0B 1ONOA 4EGAA 3EDCA 3UFXB 1OILA 4IEIA 2PKQP 4R81A 4A0QA 2FG7C 4EFKA 3DEZA 5I7AA 2VUUA 4WE3A 4PQFA 5FV4A 4TROA 2O48X 3R24A 4ZZIA 3QW4B 1CULC 1YDHA 1IHPA 2XMDA 4LCBA 2GEFA 4NU5A 3ENKA 4R83A 4X97A 2NTYC 1QG0A 2V5UA 4FILA 2IH4A 1RI4A 2JCSA 5FPKA 2IZ0A 1D1PA 1WUTA 3HCAA 3TVDA 2OFWA 3U3XA 3N2YA 5JZVA 4BLTA 2IE0A 4CKYA 3N8KA 3D1LA 5CXUA 1C80A 1ZQ1A 3QVUA 1S8AA 1NQ5A 4P4SA 1LBHA 1KRHA 3QH4A 4PG4A 4PYLA 5FR2A 4B4UA 5C7OO 4FFNA 4HD8A 3G13A 2Z0MA 5IUNC 1XNRB 4QTTB 2Y4OA 3VNBA 3I09A 4HTFB 4ZU6X 4KACA 4RQAA 3W3ZB 2O5RA 5AW2A 3VNVA 1IWBB 3K9NA 3PTLA 3M7IA 1J23A 2FSHA 1JKFA 1K75A 1UADA 2R8PA 1SPXA 1XRRA 3LLVA 3M3PA 4IH9A 2VDPB 2QVCA 1CJVC 1GZ5A 1KJYA 3ZV4A 3GLTA 1JR3A 3KSBC 2Q4DA 3KD2A 3EHEA 5JDCC 3QLUA 5IN5A 1SQ0A 2R87A 3VR5H 1EP3B 3ZHBA 1WNTA 3VGPA 1LSUA 4HLQB 3V46A 4BUJA 2Y67A 3VR6A 3GVCA 5CDGA 1QIIA 3BXGA 5DBEX 1GKUB 5JSKA 4ZI2A 5JXHA 2XTJA 2WDZA 3PJFA 4L57A 4C9BA 1YKSA 4M9QA 3VOBA 3UC5A 1JFSA 1WVMA 4EKYA 4NHOA 3PLNA 3QXHA 1J90A 3F67A 3TR0A 3QKTA 5LZ9A 1N7HA 4FDVA 1RRGA 1BYUA 2XADA 2YCLA 4U6SA 3RHTA 4A2QA 1Z8FA 4L28A 2MR5A 4E7OA 9ATCA 1QAQA 1DKRA 3GT4A 4YJ2F 4LJKA 1DAOA 3STWA 1CG6A 1F2TA 3H5OA 4NNPA 4ZDIA 5BR4A 3EPJA 4NE2A 2G1KA 1MX9A 4JOSA 4NE9A 5KWVA 4YJHA 2C9CA 2H07A 4MR9A 5EP1A 1PK9A 1TC2A 1T2FA 2JD1A 4KHZA 4WJLA 5KNBA 1O9GA 5DVZA 2PX8A 3O84A 5LPNA 1O0CA 3ZDQA 1HFJA 2ECFA 4RZ2A 1RCFA 3JXEA 4CQJA 4KIWA 1WHTB 3R7AA 3E7WA 3WXBA 3NXSA 1XEWY 3W06A 4R1SA 4YMLA 5J58A 3FVRA 1RZRA 3OZFA 4PINA 1CZHA 1PW5A 3IA2A 4F60A 2IK8A 1CBUA 1HLDA 2GK6A 4MWBA 4DWOA 3PCRB 2FHPA 4MV0A 2HAEA 3H3FA 2YYYA 4CIDA 3LL7A 3H13A 1ESEA 2DR0A 1V2GA 2E4VA 1U4OA 2FA9A 3DMGA 1IXKA 2FVYA 3GZ4A 2VAPA 3GH3A 3Q5GA 1R0RE 4W5HA 1ULBA 4RHYA 1P0FA 3TD2A 1XQ1A 4ZTBA 3RSLA 1YBVA 3IOCA 4X1YB 1YJBA 2Z4RA 4CQNA 4S1VA 1YFZA 5CNKA 4WVLA 1VB3A 3NPAA 4ARSA 4EI2A 3PYLA 1RHQA 3E9EA 5HR5A 2RK4A 3KQHA 3VKWA 4RVHA 4IP0A 4Y9DA 3GUZA 1EZ4A 2P30A 2NNLD 4FYKA 5IYZB 1KNQA 4DV5B 2VCHA 5AJYA 4F85A 2X9NA 4MSUA 4XPIB 3ZE1B 1DAHA 1DC4A 1RLJA 1XMXA 2ATEA 3AHGA 3AHJA 3QLVC 3DL2A 2H57A 1YS2X 2H06A 2C4TA 1O58A 1E3EA 2OV3A 1P6XA 4RIEA 5JSHA 1XZMA 1ZIYA 2C4WA 2QUJA 1QGOA 5AH0A 1GTMA 2Q8NA 4RF2A 5IJZA 3OEHD 2W71A 3O91A 4IOMA 2XCIA 2D5BA 3SEZA 3VH2A 2NSJA 4ZI5A 3BA6A 1BOOA 1QIFA 5EPOA 4OGKA 3VVBA 5J2TB 3GJYA 1HZZA 1UMKA 4BEBA 2UUPA 4X92A 3CZPA 3HVKA 2VBCA 4B3DA 2MSCB 2H1IA 2KQUA 3PE4A 4AKTA 1K97A 5FLEX 5BRJA 1GUAA 2HADA 4TV8B 4CM7A 3PEEA 1O4VA 2HSZA 3EW7A 3JRXA 4MS3B 4C0QC 1IPHA 2P4HX 3I2KA 4YPFA 2PSHA 2ZS7A 4O4IF 2DVMA 4MP8A 3BWYA 3WRYC 2ZAGA 3V4VB 3CZMA 1AC5A 1LNQA 2X2OA 4G8DA 4M88A 1GSOA 4D3ZA 4ID9A 3C1UA 1HZZC 2EZ4A 2N75A 3KKPA 3SXUA 1I2CA 5DTEA 3SC4A 3A9RA 2R1TB 4Y8VA 5BRNA 5K0TA 1MA3A 5A9RA 1CDOA 1G8YA 1OLSA 2ODPA 2YICA 2VT2A 3I2JA 4Q48A 5CITA 2X3UA 4DLUA 2QAIA 1CC1S 3IERA 3SBEA 4BX2A 2XGJA 2XKJE 1JAIA 2YX1A 1IDN1 1X92A 4MV6A 4XTCS 5D3ZA 3BHJA 1KQNA 1ZVQA 4H3VA 3IAM6 1VE5A 3ZDFA 3EPKA 3UG6A 2RGYA 1XMVA 3NKLA 5IC6A 3CUUA 1G8KA 3DYBA 1DJQA 1KAQA 1Y1RA 1ULSA 4EY6A 2ATVA 2RFLA 3UQYS 4QSHA 1P9NA 3CX3A 1BOFA 1KI7A 8AT1A 3K71B 3GFOA 3L06A 4I9HA 4EJFA 3UJNA 5E9WA 5AI4A 2VJLA 1D2HA 2HSWA 3ENVA 3GY0A 4TYYA 3PR3A 2ORWA 2JJ1D 1NHWA 2XTNA 2E5FA 1H1LB 3H75A 1LPAB 2TYSB 4U00A 1DPFA 4XD2A 1CEYA 3H2IA 2HUNA 3B2EA 1JG6A 3KQQA 4ZEXA 3TUZC 3ANSA 1HR0B 2W0SA 2CXOA 3V8RA 1W85A 3BILA 3MQ4A 3WBKA 3F7NA 4CR7A 2J59A 3R7FA 3V4OA 2VA8A 4DA8A 1KAMA 5JNSA 3E1GA 3FROA 2PE5A 1J1UA 1DHTA 4L6AA 4AZSA 1DUVG 3GPCA 1N6OA 1UOPA 3EDQA 4NZOA 5DM0A 4D3FA 1ADBA 2GVDC 2AG6A 2GK4A 4H6VA 3FTQA 4DCCA 2QTVA 3DTYA 2PA0A 1QM5A 2Y6UA 1YOBA 2QG4A 4UEQA 4PZCA 1R12A 2VSYA 1PV1A 3Q15C 4LOAA 5B4VA 2UZ4A 1L1EA 4BNKA 4ZVSA 2IXGA 1VBNA 4YCJA 3E9RA 3TUIC 4C4AA 5I9NA 1JJFA 3A06A 3SIRA 2FWPA 5IZCA 2A5LA 1Y5IA 1UBMS 4KK3A 1N5LA 3T7TA 3ESXA 3AVYA 3QBVA 1SCQA 1V95A 1VJGA 2FMIA 3FKJA 3BAFA 2VBIA 1H2WA 2IYFA 3NNSA 1XAHA 3JCZA 1NV8A 1SUAA 3QXXA 4KKXB 1XSEA 2VZEA 3PXAA 1MQ8B 4REMA 4W1SA 1VLLA 5IF3A 2PT6A 4ER7A 3WLAA 2C5GA 2HSDA 1N2CA 2AC4A 2OO7A 4FGSA 1AKEA 4UPEA 1FX0B 1SOVA 3EF0A 1ZN8A 3CF2A 3IP8A 2I3ZA 5AI6A 4JKIA 4BVGA 1J97A 2O2YA 2UZ1B 3IQZA 1ZGJA 1P75A 4NOMA 2FMUA 4B6GA 3JAWB 4YR7A 1OB5A 1FA9A 1VG0B 3Q87B 2ALJA 2WILA 3R7WA 3UPDA 4GXTA 2UVPB 2XMGA 2WF5A 2XUPA 4JK3A 2X13A 4L8VA 3UQZA 5J40A 4DCNA 5HZGA 5LQDA 4OTZA 3U4GA 1GUYA 3L2OB 2XQIA 1EP2B 4RCYA 1XT6A 2JA1A 1A8SA 2ZUSA 3H2YA 2I5PO 4RXUA 5DBOA 1QQAA 3UWMA 4DIMA 3H5WA 4OKNA 1L5FA 1YS1X 4KQGA 3CVVA 4DLPA 2PO5A 1C9NA 3PP8A 4NEHB 2R7NA 1DUIA 3HKEA 3L8YA 4PX9A