1U7PA

X-ray crystal structure of the hypothetical phosphotyrosine phosphatase mdp-1 of the haloacid dehalogenase superfamily
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
164
structure length
164
Chain Sequence
MTRLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQNIQLYPEVPEVLGRLQSLGVPVAAASRTSEIQGANQLLELFDLGKYFIQREIYPGSKVTHFERLHHKTGVPFSQMVFFDDENRNIIDVGRLGVTCIHIRDGMSLQTLTQGLETFAKAQAGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray Crystal Structure of the Hypothetical Phosphotyrosine Phosphatase MDP-1 of the Haloacid Dehalogenase Superfamily
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords magnesium-dependent phosphatase-1
total genus 53
structure length 164
sequence length 164
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2004-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12689 Acid_PPase Acid Phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1u7pA00
5ALYA 2BDEA 4UAUA 4JB3A 4Y2VA 1AQ6A 2C8LA 2G80A 5ALQA 5AW4A 1L7MA 4KNVA 3IJ5A 1ZS9A 4UASA 3WKEA 4HGNA 1S2OA 4YIHA 1WPGA 2I54A 3IB6A 2FPRA 3NRJA 2ODAA 3KOOA 3E81A 5A3QA 2HO4A 4UARA 2W43A 4UW9A 1SU4A 3AR6A 2R8XA 1L8LA 2P9JA 4UMVA 2ZBEA 1Z4PX 2YN4A 4MWOA 1TA0A 1U02A 1XPJA 3UMBA 3CNHA 2O9JA 3UMGA 5AK6A 3N1UA 1RDFA 1CQZA 2HF2A 3FM9A 3QU7A 4UMFA 4YH1A 4YGYA 3WK6A 4J2TA 5AHXA 1J97A 5AKHA 5AM0A 3L1UA 1EK1A 1MH9A 1Z4LA 1ZJJA 1LTQA 5FP0A 1TJ5A 3B8EA 3WGVA 3SLRA 4UM7A 5ALPA 1Z4NA 2RARA 3QU5A 5AK3A 3WKDA 1U7PA 3A3YA 4UAVA 5AI5A 4YCNA 4EELA 1NF2A 2YJ6A 2FUCA 1U2TA 3EF1A 2ZG6A 1L7NA 1ZOLA 5ALNA 2R8ZA 4KYTA 3CZ4A 2YMMA 1PW5A 4OCZA 3WKBA 1N8NA 3L8GA 1Z88A 2B1RA 2G07A 3EWIA 1WZCA 2CFRA 2G06A 2O2XA 4GIBA 3UMCA 4BX0A 2JAWA 3QLEA 5T41A 1YMQA 4AP9A 2GHQA 2CFSA 4OD0A 2G08A 2DQSA 2YMPA 3ZWKA 3RFUA 2FPUA 1RMQA 5ALUA 2JAUA 2PQ0A 5ALLA 3N5KA 3FGOA 3U7EB 1RPZA 4Y2TA 2JAOA 1ZD2P 4HAIA 1ZRMA 2GFHA 3OCZA 2NO4A 2YBDA 4G9BA 5AESA 2HF7A 2Q4RA 2ZXEA 4BEWA 1U7OA 1QYIA 4QJBA 4OFZA 2YJ4A 4C4SA 3OCWA 2FPSA 2HSZA 2CFTA 1Z4OA 4ZEXA 3MMZA 5AKXA 1JUDA 5AW0A 3EPRA 3MN1A 2GHTA 3L7YA 1RLTA 1ZD5A 2FPWA 5ALGA 3QUCA 4BYGA 3NAMA 3B9BA 4Y2YA 3ZU6A 2MSNA 5AKKA 3ZVNA 3FPBA 1WR8A 1O03A 3ED5A 4XQ0A 4CE6A 3ONNA 2IOHA 3I1YA 1ZD3A 4DW8A 3N28A 3TLMA 2P27A 3ESRA 3QYPA 5AVXA 2ZBFA 1T9ZA 5AKEA 2GMWA 1O08A 3ZVLA 2AH5A 3S6JA 2YMLA 3NASA 2RB5A 3L8EA 3QXGA 5ALSA 3SF0A 2G1AA 5AKJA 3KD3A 4UM5A 3PGVA 4L6CA 3I6BA 1L8OA 3NUQA 3AR5A 3R9KA 4DFDA 3U7HB 2B0CA 2GO7A 1CR6A 3SKXA 4HGOA 4IG4A 4Y2JA 4FE3A 5AVSA 4Y2SA 1SWWA 1RKUA 4AS2A 1J8DA 3L0YA 5AKZA 4KX5A 5AI0A 2I33A 5IT4A 4HYTA 4MUMA 5AM4A 2IOFA 5AK4A 2FDRA 2BDUA 4HGRA 3ZTYA 4NWIA 4CNQA 3OCUA 1RLOA 4YCLA 2ZBGA 5AM5A 3ET4A 4BKMA 1RMTA 4ZEWA 2FPXA 1NNLA 3FZQA 4HGPA 4CF5A 3OPXA 1RQLA 1Z4KA 5AKIA 4IFTA 3ZX5A 3L5KA 5ALMA 5ALJA 5AVYA 3OTQA 4QQFA 1KYTA 3AR7A 1RKVA 2I55A 2P69A 1RMYA 5AI8A 5AVZA 3ZTWA 5ALTA 3AR9A 3NALA 1EK2A 2QYHA 4CF4A 3IRUA 2WF5A 3DDHA 4NABA 4XE5A 4PNHA 1XVIA 3VAYA 2IA5A 4NAVA 2WF9A 2B82A 3P96A 4NFLA 4Y3UA 4BX3A 3I28A 2PR7A 5AI6A 3DNPA 2I6XA 3FVVA 3SKYA 1YS9A 3W5BA 2ZBDA 2IYEA 3HYCA 3MPOA 4KX3A 3RF6A 4FFDA 5A3SA 1Y8AA 2CN1A 2YFYA 3A1CA 5ALHA 3AR3A 1Z4MA 5AI4A 2NYVA 4DCCA 4RESA 3WKCA 2B8EA 1RQNA 1VJ5A 3OCXA 4G63A 4UATA 3K1ZA 1X42A 3WK9A 3A1DA 4J03A 1LVHA 3NANA 4EENA 4GXTA 5AVUA 3J7TA 4AS3A 2ZOSA 3U19A 3ZWDA 1QH9A 4C4RA 3QU2A 5AW6A 4I9FA 2FUEA 3WGUA 5E0OA 2B30A 3SHQA 3U13A 4ZEVA 2HEGA 1XP5A 3QU9A 2FEAA 1NRWA 2JARA 4RETA 3L0BA 4Y2PA 5ALKA 3U7FB 3QX7A 5ALOA 3DV9A 2HHLA 1Z4JA 4F71A 3BWVA 2YJ5A 3D6JA 3QUQA 3AR4A 4Y2XA 1QQ6A 2FI1A 3A1EA 2I34A 1RC8A 3QU4A 5AI9A 3PDWA 1QQ5A 2HI0A 5AM3A 2WM8A 4BNDA 1VJRA 2OA0A 2IOFK 5AW3A 3L1VA 2W4MA 3PGLA 5AKLA 2OYCA 3WK4A 2JGAA 5AW9A 1Q92A 4HGQA 3ESQA 4I9GA 3QNMA 5AM1A 1IWOA 4NV0A 3W5AA 4H1WA 4YCMA 4CF3A 2PKEA 2R8EA 2C88A 1YDFA 2W11A 1SWVA 3N07A 2EARA 4UU1A 4BX2A 1K1EA 5ALDA 3QUTA 3F9RA 3L0CA 4Y2QA 2HDOA 3W5DA 2QLTA 5AVQA 3I76A 2HOQA 4EX6A 3M9LA 3U26A 3WK8A 4C4TA 1Z5GA 5AK5A 3AR8A 5AW7A 4JDPA 1F5SA 1T5TA 5ALFA 3R09A 4XPZA 5AW1A 2P11A 3ZVMA 5IT0A 4BBJA 2AMYA 1S8OA 2I7DA 3OCVA 2HX1A 1RKQA 3B9RA 2G0AA 3KBBA 1TE2A 2C9MA 3W5CA 3SMVA 5AKGA 3ZUPA 5JJBA 1YV9A 1TJ4A 4EZEA 1U2SA 2WFAA 3EF0A 2Q4TA 3L8HA 4KNWA 2YJ3A 1YJ5A 2EAUA 3SD7A 5AW5A 4UMEA 2AGVA 5IS2A 5AICA 4E88A 4L57A 3KZXA 2G09A 3GYGA 3QGMA 1RRCA 4UMDA 2WF8A 2Q5EA 3KC2A 4F72A 1Q91A 4KN8A 5ALXA 3OCYA 2BY4A 4Y2RA 5AW8A 3N8GA 1L6RA 3MC1A 5AIAA 4DWOA 2C8KA 3QUBA 5ALIA 2AUTA 1VFPA 2RBKA 5ALRA 3E84A 3UM9A 4FYPA 3ZW7A 3BA6A 3AR2A 5ALVA 1YNSA 1Z4QA 4L6AA 2YY6A 1N9KA 2B1QA 2HCFA 2WF6A 3DAOA 4UU0A 2MU1A 1TJ3A 1RLMA 2OBBA 4BNDB 5AW2A 2R8YA 1WVIA 3NIWA 2OM6A 2C4NA 2EATA 2WF7A 2YMQA 5ALWA 3PCTA 3R4CA 3WKAA 1FEZA 5ALEA 1L7PA 4EEKA 2NO5A 1Z5UA 2X4DA 3E8MA 1ZRNA 1ZD4A 5AVVA 5AVTA 5AVWA 2VKQA 4OHFA 3L8FA 3ET5A 3E58A 5AM2A 3KDPA 5AVRA 2RAVA 4O8CA 5ALZA 3ZX4A 4EX7A 2D2VA 5A3RA 3FPSA 4BEVA 1L7OA 2B8JA 4XOUA 1QQ7A 3WK7A 4B6JA 4Y2UA 2WHEA 5AKYA 3M1YA 4YIKA 3ZI4A 5AIBA 3WK5A 1T5SA 3HLTA 3U7GA 1Z4IA
chains in the Genus database with same CATH superfamily
1ZUNA 2XW6A 3HVIA 3KYIB 4FX2A 4WY2A 1LDEA 2ZJ3A 3CYFA 3MGKA 1OYYA 4E70A 4G1CA 5FTMA 1JAIA 1XD2A 2JI6A 3AKEA 3R5KA 3EJ6A 2Z5LA 3VPSA 3R75A 4Z53A 3NM5A 3TO5A 3M82A 3USES 2G83A 5FRDA 3R3SA 3QKIA 5DNAA 3SIXA 2X5XA 4LJLA 4A0GA 3OPYA 5DULA 3C3BA 3TLCA 4BVAA 4B4DA 1E9SA 3GT4A 1E2EA 2GNAA 3QBVA 1YZHA 4ZYUA 4IX1A 1W4ZA 1F3LA 2W6OA 1XROA 3OIYA 4GX2A 3R6WA 4HGYA 4ER6A 2HLNA 1JR6A 4OBXA 2GYUA 2RJOA 2VPPA 1YQWA 2WUGA 1A9XB 1FL9A 1QFMA 4UW9A 4BVGA 4FFWA 3AQ4A 3OOEA 3HR8A 2Y2VA 1X8LA 3SSAA 1VQ1A 3H99A 3ZGLA 2BMDA 1EE9A 4LDPA 4IUDS 4DMLA 3H2ZA 4IHJB 1PP4A 2HMWA 4I2NA 2QMOA 1RWWA 5HTOA 1PJCA 1BRTA 2BFMA 5C8VA 2A5LA 3HEBA 4D9MA 2VNSA 1W5FA 3CR3C 4MWOA 3MRXA 1PN3A 1QLWA 4LHZA 5JMTA 2JFXA 2NZYA 4K9MA 1IVSA 3ETDA 1FU8A 3UMGA 1OXMA 4QYWA 1E0AA 3PC6A 3NX4A 1PZGA 4N5NA 1XTRA 2WPDD 3LU1A 4RTNA 4K8RB 1R6TA 4Y6RA 1YDGA 2D5CA 4B6FA 2Q6OA 4NCKA 1E4YA 5AHXA 3PL1A 1VE1A 2I3ZA 4QU0A 3UAZA 3B7GA 3PUVA 1YBHA 5AUQA 3OD1A 2R4UA 4M4SA 5IPFA 1I13A 2I4RA 2H5LA 2B3TA 4XEUA 3OY7A 3UCXA 4GKKB 1GDDA 3MQFA 1MFPA 1RFGE 2GM3A 3WLEA 1JBQA 2ZVJA 4QOIA 3T4PA 3HJUA 2REQA 4LOLA 2PSFA 2HT1A 1JLSA 1V5FA 1U7PA 4GOKA 1EFLA 1EVKA 4Q03A 4EYKA 5HKBA 2LKDA 4KOAA 1VIMA 1N5DA 2GRJA 3WLLA 1RLIA 1KH3A 1C9MA 1L7NA 4JP3A 3G5MA 5ALNA 3KU1A 1BEEA 1C9JA 1YA4A 1SULA 3CCFA 2AMJA 3HO8A 3LIIA 4RHCA 4RM3A 2GZMA 3P2YA 1T2DA 1EVQA 4MZXA 2P2YA 1K6EA 4XWWA 2WWTA 4DBLC 1OA0A 2CFRA 3CRNA 4CT5A 4PCUA 2WTNA 1KU6A 1OTYA 1JQAA 4MB0A 4PGHA 1R50A 4BNTA 3ANTA 3IDOA 2G08A 2XCRB 3RS4A 1KO1A 4M46A 1R5NA 4M0UA 2ZRPA 4XWTA 1KQNA 2LIPA 1PR0A 1KE2A 1K3TA 4DR5B 4KPYA 2WMNB 3IBFA 3SY8A 4NYMR 2VK8A 1M2EA 1TOAA 1Q6YA 3IJEB 1HUQA 3KQOA 4L07A 2FPIA 3JQCA 3QM1A 5BXYA 5CA1B 3GBPA 4RHFA 1ZXXA 4QL3A 4K9NA 4ZC1A 2QX9A 1Y7PA 2JLRA 3QA3E 1NOKA 4FU0A 4XM0A 2QA5A 1F5NA 4XJXA 2R65A 3C43A 2H0AA 4XCVA 3RTCA 2X1MA 1A9PA 2OGWA 1A9QA 3VO2A 3ESYA 4WXYB 3QVVA 4QARA 1VCMA 1L5YA 3QTBA 1SQ0A 1TEHA 5FOWA 3SSMA 3H3FA 4YJHB 1Z4OA 5KYNA 5BV2P 4E2XA 1GQOA 1R9NA 1TU4A 1WBDA 3EZYA 2W8BA 5J2TB 2J0EA 4L85A 5FR1A 3LC7O 4QT4A 2MSDB 1RHMA 3OF5A 3RVQA 2YV5A 3BILA 4UTZA 3RD5A 3TFOA 1PVOA 1MC8A 4BYGA 1GDTA 1LI5A 1RYZA 3WLRA 2FFHA 2OR3A 1C30B 1L1RA 3VJLA 2HA0A 3DSRA 3NKVA 2WIGA 4BMZA 2YKGA 3W9UA 1DAMA 4Z54A 3IEXA 3E82A 5A4AA 4JENA 5CYOA 1SBIA 1WR8A 3ED5A 1SG9A 4DLTA 1C9KA 2CL7X 3GLHE 2HRCA 5K09A 4TRNA 1OZGA 5EWMB 3GCDA 3TKAA 2IT1A 3BE5A 1BH2A 3BRCA 1GCUA 3AZPA 1B2RA 2EFEB 3BSFA 2OGUA 4GXQA 3QYPA 2ZRCA 3KELA 3DOJA 4X7RA 2WK1A 4I55A 1QHSA 4II3A 3DE6X 1C3JA 4HLCA 4HC4A 4HZIA 3B1ZA 2QL5A 3GELA 1N92A 5HZKA 3KKMA 5KHOC 2J0SA 1Z0SA 1WXHA 3PXCX 3O31A 1QGUB 1DBPA 2GETA 2QUKA 3O0DA 4HLQB 4KQGA 1T36A 5B53A 4X93A 2DH5A 1U31A 4A5SA 4TKVA 4WXPA 5CB0A 4EAQA 1ZM9A 2C97A 3GLHA 1XE3A 3JCZA 3KKOA 3TAUA 4F4DA 5JJCA 1T2FA 4B3XA 2B0CA 5SY4A 3L6CA 4JBNA 3PDIB 2GXQA 4HH0A 2TRSB 4RKEA 4MVWA 2VF2A 4JVMA 3ZY5A 3H6HA 2LE0A 5A2GA 1W85A 5IT4A 2YZ7A 4Y9UA 4UTVA 2K7FA 2YZMA 4MUMA 1RJEA 3C5CA 4LKRA 5DLPA 2FUG1 4S0XA 1N5OX 3F6SA 2QP3A 2QN2A 4MS4A 4J7AA 3RRYA 3TAXA 3QHQA 2LDXA 3OJXA 3UHAA 3IODA 2VJCA 2Y1CA 1NI3A 2FRXA 3B1YA 1FTYA 4J16A 3BL8A 3KRTA 1B42A 1KK3A 3BDIA 4M37A 1ADBA 1QIIA 3GNLA 2ZUTA 5EHXA 3DR5A 3GJQA 4OI2A 2C82A 1Z4KA 4JSRA 1O57A 4AZ3B 1XTKA 3FNHA 1TQ4A 3ELWA 3L5KA 4O4LA 4J91A 1VCIA 2PO5A 2JNWA 3FPLA 3PJEA 4K03A 4MW0A 4QQFA 2CDAA 2V3WA 2YXDA 1D7OA 4OH1A 2VDWA 3DFFA 1EGVB 1Q44A 3Q9NA 4MINA 3GDOA 2ABWA 4HFRA 5AI8A 5DT2A 3CHYA 1I36A 4UU7A 2WYHA 3NHJA 1SC4A 4PZZA 1YOVB 3DA8A 2HWYA 3AMVA 4BO4A 3B3FA 1VPTA 1Q83A 1XFDA 2PPVA 3HN6A 4MRAA 3B7WA 4D0LB 3E9QA 2JGMA 1E9BA 4PNHA 5EP2A 3DFIA 3UJBA 4F91B 3DMPA 3N2IA 1QYXA 5IBPA 4PZCA 3WHIA 3IUEA 3F7OA 5GMOA 2VXOA 2BEKA 2A9PA 2O8CA 5D5HA 3S7ZA 1E2LA 3L4KA 3A4TA 1DDOA 2ZB3A 2ZSKA 3L41A 3QVKA 1MVLA 3ZYZA 2X3UA 3LM8A 3L7BA 4WNYA 3EYWA 2X9LA 5LOVF 2MSKA 1RC1A 1NHWA 1Z0JA 2I65A 1UL1X 1AIPA 2IU0A 3F6BX 1I4OA 3LSYA 5IDVA 2QYSA 3FNBA 5DP1A 1C4KA 1PUIA 4L15A 4YNBA 5LBTA 2VF8A 4Q37A 3KVOA 2ZUUA 3BC1A 1FQKA 2IH5A 4YRSA 1I0IA 2CGEA 1Z4MA 2X0NA 2NYVA 4LQDA 4Y6QA 4PHHA 4CLHA 4URVR 4KRYA 1TYZA 4Q0MA 4KQCA 4FONA 3RRXA 3JSAA 1ZITA 3KUKA 4ZHQA 4LYAA 4QQRA 3WK9A 4IXNA 1EM6A 4NYIR 3OOHA 3C0KA 3I8XA 2IHJA 5AMXA 4X92A 4EENA 1YS1X 3A04A 1Q0UA 1D6SA 4AS1A 3G8DA 1GZ5A 2HEIA 1KJ8A 4ERXA 3CISA 5KYUB 1ZR2A 5HE9A 1M5RA 1LPPA 2FRDA 1QF7A 1XZFA 4M1TA 2R87A 4K2HA 1VL5A 4DCSA 1GILA 3IYLW 4AJPA 4Z1MD 3SHOA 3N2EA 1MA3A 5LP1A 2LCIA 3S8MA 2WLTA 3LCUA 1Y80A 1SVMA 1BVUA 3WGUA 1JQBA 4EKGA 4KTTE 3N8IA 2FZCA 1XP5A 2V7QA 4H1TA 3AVUA 3ECAA 4HTFA 4PO9A 1D5CA 4B83A 3ENZA 3HU5A 2XQVA 2WPDA 3LPCA 3H65A 5CT8A 3H87A 4LI3X 1AZLA 3THXA 1JQLB 4TQGA 1NXQA 4A73A 4KFCA 5HCNA 3AF3A 3GLTA 2DPYA 1ZA2A 4RORA 2YJ5A 5HR5A 4X20A 1I5OA 1JT9A 5HSGA 3CLTD 1T2UA 4RD1A 5LZ2A 2JANA 4X91A 5HUHA 3ZBTA 4POOA 1SQ5A 4MLPA 2VAWA 1Z83A 4R51A 2VP3A 1QQ5A 2HI0A 1L5NA 3FAKA 4Q93A 3ENQA 4OHCA 2ATIA 4BLUA 4BNDA 1VJRA 8GPBA 1Z2AA 2PUHA 1SKAA 3SG0A 3EWNA 3AUYA 4R71A 1QIMA 5DYTA 2I78A 4RIHA 3TSAA 2WM9B 1TT5A 4CLRB 5JNLA 2NNLD 2IZ5A 1ODKA 5BQFA 3HN7A 3L6EA 4O6VA 1E60A 3O4FA 2ODTX 4FMCB 4RS4A 2GTPA 4C30A 4CF3A 4ER7A 1Q7GA 1YDFA 3WTCA 2A9RA 3L7LA 2X0JA 1SWVA 5KCZA 5KSYA 4ESVA 3G8YA 1NJ5A 4E31A 1OWNA 2HDOA 2O8FB 4HADA 5AVQA 4G0PA 3NETA 4RK6A 1BFKA 4B6QA 3CLTC 2G8LA 3WK8A 3BREA 1V8ZA 4GR5A 4F2WA 7MDHA 4PC1A 5KTSA 2WHQA 1OYVA 5C8YB 3IQEA 1RJ9A 5JI2E 4M1KA 1TQ2A 3B3GA 1RR6A 3T0IA 4PPQA 3P32A 4HY3A 4M1QA 4X95A 5TEVA 4FHEA 2Q5LA 3KUXA 3IULA 1P8AA 2HX1A 4DDVA 4FC7A 4GDMA 1NJ1A 1V3UA 1TKRA 5IN5A 1NY6A 5A7FA 4MKRA 5FOQA 5FD8A 1CG6A 2VSNA 2HMVA 3R5FA 4FJ2A 1WUTA 3LBAA 4RH1A 3IQGX 4W9RA 3Q3JB 4GKAA 4JN6B 3MILA 4K9KA 4P0TA 4MUFA 3PTAA 3WMRA 4IO0A 4HDOB 3ZUPA 3OUUA 4ANFA 1FUKA 3RIGA 1P0PA 4D42A 4UTOA 1GR0A 4OGKA 4JYZA 4DB2A 4KHPB 3SX2A 1UK9A 3OPNA 1NAIA 4NBUA 2CXHA 2QVBA 5IKEA 5BURA 3N87A 2EFHB 2OP0A 4HT3B 3TG8A 1JAHA 1JYFA 3B5JA 4XFJA 1ZEMA 2P77A 4LTMA 1GV0A 2UXBB 1JR3A 4NU6A 4ZJYA 4ZV7A 1YAJA 3WDLA 5AOBA 4C7OA 4MH0R 3G2LA 1NULA 4G36A 4OKSA 2X76A 1C1DA 3BSSA 4G0OA 5TQVA 2GK3A 1W0KD 2XYVA 1TQ8A 3WOHA 1WW8A 1UPXA 2V5VA 4JEUA 3WICA 1E9FA 3PP8A 2H4HA 1N7HA 4HUQA 2XWBF 3THYB 5ERXA 3QF7A 5U9CA 3TOVA 3EA0A 1LLCA 3IP3A 3LTEA 3WOVA 4FKBA 4K7JA 4EITA 1RYFA 2HU2A 4PZYA 5AIAA 3V4FA 3FCOA 4DWOA 5JNTA 2Y0PA 4WADA 5IBRA 4B8WA 1J39A 1UADA 1PL8A 4DJEC 2W70A 1AG9A 2O1XA 2QRHA 2HCJB 3RKSA 1JMYA 3P26A 1HDXA 4NE2A 4A26A 4MWCA 5BVHB 4W5HA 2NVBA 2FQQA 1CQWA 4HZUB 4OB8A 2ZYSA 1EK6A 1BE6A 4N8EA 2IHKA 3TOCA 1LJLA 1UT6A 2VJMB 3K35A 1XLTC 2YY6A 1UC5B 4ZZIA 2JC3A 3B78A 3B8HA 4OL0A 2PRJA 2X9NA 1OREA 3RRZA 1PFWA 4N0MA 1L8QA 3VAAA 5FI1B 2C4NA 1Z7YA 1FP1D 1DJMA 3LKVA 1P6UA 4NL4H 4RJKA 1C8LA 1RPJA 1XOIA 4GOOD 2QLFA 4DGSA 2J9GA 2O57A 1EQAA 2IYTA 4ZVSA 5HBRA 3ENKA 3ILYA 5EPEA 4J0DA 4EW6A 2Q1WA 4UVGA 1PUJA 5EVJA 1ZD4A 2CEAA 2ZYWX 1Z5OA 3IB3A 2LV8A 4PR0A 3MGAA 4QUIA 1J70A 2ZATA 5AVTA 5AM2A 3LT1A 3E58A 2G5GX 3W3AH 3P97A 4BFLA 2NADA 3PQ4A 2AK3A 2DAPA 5BYKA 2V1UA 3EGOA 4NCNA 4Q3BA 2JHPA 1T4DA 2GJSA 2V1XA 4HNRA 1WXXA 1YJ8A 5J2TF 4KYVA 4YJFA 4PG8A 1I4DD 1RSZA 1VG9B 2BIFA 2RGUA 2X2FA 2C77A 1FFHA 1AM4D 4HYYA 3RYFB 1S01A 4LY9A 3OLZA 3LP6A 3AW8A 2HCRA 1A8IA 2FW6A 3W78A 3DEJA 5EMJA 3VNSA 3MMNA 2NYAA 3C3MA 2V8BA 3LK7A 2FOIA 5GJVC 5ICMA 1EFUA 3PNMA 5DKFA 4QTXA 3T06B 2WOOA 1SK9A 4DCGA 4E13A 2DLNA 5JS1A 2NU6B 3ZU3A 1IM5A 5IAJA 3DF7A 4DDHA 4HNSA 4F46A 5FOUA 1RXYA 521PA 1X3LA 5DGIA 1RBMA 2IC5A 2JJ1A 2P3OA 4AX4A 1DRVA 3R6LA 1E2PA 4IYJA 4JB3A 1JDBB 2A3NA 2JIQA 4MCAA 3WE7A 4JGBA 1ZK4A 1GKKA 1BQEA 3HRHA 4LDZA 3E7DA 3I64A 5ILQA 3PU6A 4OQLA 4QZVA 5KNLA 3NXKA 1UDBA 3CONA 2OAP1 2YNMD 4UASA 4JKOA 1Q0RA 2O5CA 2YHAA 2FMTA 4ZOLF 2G72A 1PZHA 1S5PA 1E6CA 2XKBA 4NOLA 4BN0A 1W2HA 3FUVA 3INGA 2COKA 3I3SR 3IAAA 5CA0A 3UAVA 1ENYA 2NTEA 2Q0QA 4J0IA 1A9ZA 4C2UA 1YZGA 3G9TA 1M6WA 3STUA 4WFJA 1M6NA 4WCFC 3Q8XB 3L5OA 2C2MA 4RD4A 4TTTS 3HADA 3PXGA 1GL9B 5E3IA 3LPDA 2BGIA 4NK5A 1NF8A 1QZZA 2AJLI 2QLJA 1HZJA 4ZI7B 4O4JA 3MZ0A 1KY2A 4ZJUA 1IEXA 1SIUA 1M74A 1RJDA 1U6IA 4RPLA 2H54A 3QPBA 2QG4A 3O47A 3U3ZA 1D9XA 2O9JA 2QW0X 1Q2UA 3P2IA 4B9EA 5F23A 1HR0B 2QYTA 3V34A 1OSNA 2P1ZA 2HMAA 4YP6A 4P3XA 4I99A 3LC1O 4LZNA 2RGXA 4PYIA 2FSUA 3H6KA 3JQ6A 1XPRA 2Q2VA 5DNVA 5I8WA 2FPIB 5E9WA 1Y37A 1BOOA 3R5JA 5EMLA 3ER8A 2I6QA 1ULBA 1D2MA 2ATVA 4UXHA 1QS0A 3DWIA 3ZUGA 3KHSA 3LRPA 1XZJA 2EP7A 1MOQA 2FN4A 2EJVA 2GCPA 1FPQA 2QUIA 3H4IA 3RU9A 5BY2A 3ZBQA 1ZMOA 5IDXA 3CVJA 5IYZF 1P45A 1Y8ZA 4MVJA 2VFAA 2W2KA 5FFFA 2NV2B 3VYSB 4DGQA 3THWA 5ILOA 5EWJB 2R8ZA 1PK9A 1IXRC 2FX3A 2YMMA 3WWDA 3GLSA 1RXCA 1OIXA 2Z30A 4MGZR 4QA9A 4DWJA 5IYZB 4P2GA 2DBQA 1YDEA 2GCNA 1YACA 4G85A 4HWPA 4N3BA 4XIYA 3UHFA 4ER5A 5K05A 1BCSA 1AUVA 1GG2A 1XQYA 2ACWA 4IIVA 1M2VB 1KO8A 4GIBA 4Q6BA 2PLAA 5EKDA 3UMCA 2EKLA 5JARA 4OQMA 4EQ6A 4MWGA 3LC0A 4KU4A 4RX1A 1VA5A 3O73A 1KEVA 3B6MA 4I36A 4PVCA 2UZ4A 3CUWA 4YP7A 3OJOA 3P5SA 4HTAA 1DJPA 2Q4BA 1RMQA 2H07A 2R5NA 1V6SA 3OETA 5HMLA 2D13A 4C88A 3I1JA 5DTEA 2DBVO 4MQLA 4YCAA 5KNBA 2NTYC 1D2NA 1VMDA 1ZGJA 4R84A 5CJJA 1AQJA 4UZSA 1IHUA 1LA2A 1LF5A 3NVAA 2XCQA 1KYQA 2YCLA 4AY6A 1ZUIA 3T3HA 2YFHA 1QK3A 4JNCA 5DM2A 4F2PA 4DYHA 1V35A 1A27A 2YJ4A 1Z0KA 4JOQA 5C46F 4RMGA 4J2OA 1CERA 2O6HA 4MXDA 1JEJA 1VKOA 1P1CA 4TXNA 1EWQA 2C95A 1E8DA 1QKIA 2J31A 2VK2A 2IF0A 3D1VA 1LDMA 4NBWA 3VYRB 5FTNA 3G5TA 5ARCA 1EVYA 5CH3A 5A4DA 1BVRA 2WAYA 1Z3IX 5I7WA 5JC1A 2P75A 3G9QA 3R7WB 1O4WA 3INRA 8OHMA 1DIHA 4N3CA 5FI0B 4YJ2A 1D2AA 4GVXA 1JL3A 3KAKA 3ZVNA 1POXA 5REQB 3ETJA 2Q6LA 3RM3A 1Q0ZA 4D8UA 3SF8A 1H0SA 3ZWAA 2X2PA 3O4IA 2LUOA 4C7BA 3R0JA 4X8MA 5K0SA 3U2QA 2PPLA 1D09A 2ZIXA 3NIBA 3EVEA 3C3JA 1QYVA 3AVQA 3KK0A 1KKLA 1KORA 1UH5A 2PG3A 2VSYA 1H93A 1QO0A 4IHKA 1D03A 5TR9A 3RS2A 1WY7A 1U2GC 1DT3A 2XKAA 5JMWA 5AKEA 1T5IA 2WWYA 3BSWA 4Q24A 4HDNB 3PUHA 5EOVA 3TZCA 2OCXA 4U6SA 2XT9A 4FKMA 2JIRA 1T1RA 2I67A 1ZP6A 3OM9A 1WXWA 2W6ZA 1A71A 1HDZA 3NASA 2ZWIA 4CMIB 1XZEA 4J9VA 2CCJA 1LC3A 5T4FA 5F2EA 4DA9A 5K0GA 4O4IA 1QH1A 3R6GA 1V16B 1HTTA 1LB1B 4CKZA 4ZU1X 3L4JA 5AKJA 3UWKA 1Z5VA 2W8ZA 2HPAA 4RGYA 2V5AA 4O2BA 4FEEA 4YRKA 4OXRA 5FB3A 1GZUA 2TMKA 5BW8A 3SKXA 1G0NA 2W6PA 4HTFB 3N5CA 4YAOA 4E5UA 5B2FA 2VDVE 1IRXA 5CRIA 1TECE 1JLHA 3DP9A 1DL5A 1RKUA 5K3SA 4AS2A 3EIHA 3QE3A 3K71B 1XK7A 3LL7A 3LZDA 4L73A 4B31A 4HYTA 1N8KA 1WWKA 5BYAA 3OO0A 3HDVA 1IAQA 1P5HA 5IJWA 1NF3A 2FMIA 1TA9A 2WMYA 1G8FA 1N36B 3WYAA 1EB8A 1YKGA 3T3GA 4BV2A 2HWUA 3CRZA 1G4HA 4QUHA 4BRUA 2WJAA 3SZLA 1LZKA 3HA7A 4MP8A 4Y6PA 4C0QC 5ITZB 1L4HA 5LOVA 4YUWA 2I7CA 1Q5PA 5EKUA 4XWAA 2HUNA 2PIDA 4B35A 2R4TA 1RYBA 1X1CA 4FWBA 4RHXA 5LZ7A 1DHRA 1E5QA 2GR9A 4EG8A 4A5OA 2QU7A 3EVGA 3ANXA 1KYTA 4YCCA 3GEPA 4WWHA 1MIOB 1Q17A 3A4IA 2V7TA 2GX6A 2QN6A 2XTMA 4FD2A 4BNXA 5K45A 1GTL1 1VJCA 5CB4B 3VU1A 5AVZA 5GZ1A 4HQLA 4J90A 3CKYA 4KWEA 2FHSA 3M6WA 4LECA 4NMMA 3WAKA 4DZTA 4K0KB 3LX5A 4H0NA 3M6VA 4JJ6A 4Q1VA 3EK2A 5DHAA 3IIKA 3GFOA 5IARA 2UYOA 1BHJA 5ULLA 4AWXA 4BBAA 3MWEA 4P1ZA 5T3UA 2GBFA 2XTZA 1E1YA 4EY3A 3AHFA 2FV8A 1G9XA 3VTFA 1NW7A 3OU2A 3OZFA 1EJ2A 5B58C 3H19A 1M6HA 3JQAD 3R23A 1FUEA 1FVXA 4J6FA 1OGJA 1QVAA 3DMGA 1R4MB 3L6BA 2IHUA 2FPGB 3HB1A 3W6NA 3MLAA 2LVBA 4YRJA 2BEVA 2QP4A 2C9ZA 4N5MA 1LNSA 3HTXA 5DHFA 2JFZA 1U9CA 5KOHB 3N3AC 3HCOA 1UXIA 4ZXPA 3KPWA 1TM5E 3CF4G 2QE6A 4RVDA 3OA2A 4IUYA 1ORHA 4N3NA 4DV4B 4I6JA 3FTEA 3RU7A 2QPTA 4G5OA 4W5WA 2BGNA 2PGNA 4JL8A 1PX2A 1G55A 1J9ZA 1Y9EA 2F1RA 2Q9UA 3COPA 2ZRIA 3QW4B 2DHDA 1HQKA 3P5BA 5DEIA 1FK8A 4AG3A 2FY8A 3ENVA 2IS4A 2IHZA 3BN3A 2C2BA 4MJLA 1DLIA 4DQKA 1U7TA 4X8LA 4ZDKA 1YJCA 3MGCA 5D85A 5CYGA 4V02A 4GMKA 3NBXX 1L9KA 2EBUA 1VPEA 2UUPA 4J1NA 5TQ2A 4XQ9A 2XBLA 1UZNA 4GECA 4ZOEA 5C35A 1DKRA 1SCJA 3DZFA 3UUGA 4MUBA 5D01A 5AVUA 3EPHA 1S1MA 4P8RA 4RV5A 3T9DA 3U7QA 2ZOSA 2B5OA 3PLAE 1CIVA 3P4YA 1GAXA 3B85A 3LV8A 4RBNA 3WDKA 4YO8A 5FUBA 2WJIA 3CSSA 4D8XA 1I6LA 2MHCA 4ZVOA 4KEAA 1KDPA 4FDUA 4GH5A 1DOAA 3H8VA 4TTQA 5SZKB 4J3FA 4FUTA 3R3YA 2CLIB 3VDMA 3JYLA 3TLGA 3H2IA 1GG5A 4LX0A 2ORWA 1A4UA 2Y1FA 5E0OA 1I7QB 2B30A 1QONA 2HWXA 4L4YA 4XUEA 5ITSA 4YQFA 3LCVB 2WT4A 3M8KA 1DBIA 3BMCA 3AFOA 3HFSA 1GVNB 1R0BA 1R9GA 4CLOA 3QX7A 4QGBA 2G4CA 4QRIA 3G9ZA 1VJDA 4MDHA 2RKBA 4U2BA 3OZAA 1INLA 3C4JA 3RKRA 2KSQA 4Z0PA 4U7GA 4JUAA 4KITB 4Q00A 4AJ9A 4EPTA 2HPZA 2XOKA 4NRDA 3TX2A 2VJMA 5H3LA 4CHGA 1N2ZA 1RC8A 5AI9A 4RGBA 3A3KA 3PEVA 4RZIA 1X80A 5AM3A 1P4RA 1YJQA 4Q7KA 1JDVA 2IWRA 1Y7TA 3WLOA 2Z58A 1QGYA 2Q2QA 2R6R1 1PDWA 1LWNA 1E5TA 1NLFA 3H8JA 1CU1A 4IIEA 4BWFB 4URWR 3CPHA 1GFSA 2W4MA 3JYPA 3RS7A 1JSCA 1R6AA 1JTEA 1JIJA 3VI4B 1VDMA 1QORA 1CDOA 1WMDA 2GN0A 3HJTA 3M49A 1RHUA 4FK8A 4MROA 4S1NA 4ZO6A 4OUDB 4X00A 4DCVA 4ETNA 2PKWA 3FHOA 3ZGXA 1W34A 1YVUA 2O50A 2QSYA 4O4HF 1P3JA 1R0RE 4BCDA 2O8BB 3ZE8A 3O4VA 5KU7A 1FSSA 3ZZNA 4ZVTA 3AONB 3GPIA 5EIFA 3N0TA 4QFMA 4C0LA 4HVAA 4HP8A 4UZFA 5EHGA 1XVVA 2I6UA 3ON5A 4V1CB 3OIVA 4R9NA 5THKA 4EX6A 3N6RA 1CZKA 3V6LA 2FE4A 1T9BA 2GPAA 3PUIA 2CYBA 2IYNA 1O1YA 3HU1A 1DXQA 4CV1A 1U63A 3IXMA 3DOIA 1Z5WA 3GRCA 3WLNA 5JO0A 5K3FB 4LC1A 4IGKA 1KHTA 3EGEA 1MAVA 3B3QA 3U4MA 2VATA 3EEQA 4DCJA 1RJGA 5KTRA 4QSHA 3VR2D 1U0SY 4EB8A 2VPQA 1BD3A 2P9ZA 2G0AA 1EWTA 3CC8A 4UAGA 3VO9A 5DASA 4PGAA 4E7OA 5DV9A 1X9HA 2HWWA 1WG8A 4WK4B 4O2AA 4Z6KA 1T9KA 2GZRA 4KVFA 2CHEA 3JXEA 4NJEA 1S2LA 2NTVA 1KVRA 3VHQA 3HMQA 3I62A 4TMXA 3A4LA 1H3EA 4LZLA 1LV7A 2QG9A 3G5AA 1CB0A 3CNNA 5GV7A 1J49A 1URPA 1Q0LA 2QE7A 3SD7A 1JPVA 3UV6A 1HDIA 3V3TA 4F8JA 2WV7A 3I5YA 2BTOA 2QUAA 2Q3BA 2DULA 2JHCA 4HWGA 3K0CA 5F1PA 1NW6A 3AEKB 3CPSA 1YO6A 1JLLB 5KTOA 2WP8J 1PK8A 5HNKA 3Q2KA 5JISA 5GOTA 5MFPA 3KEQA 4XX1A 3EDQA 5L40A 2I29A 2BLLA 3U7IA 4F2GA 3OIUA 1Y33E 2Y99A 1Y9AA 3EIUA 4MQMA 3R76A 1YE8A 4N48A 1M6VA 1R4NB 1M2KA 1I3CA 3K70D 5D3MA 2GM4A 1ST3A 2Q46A 1R6XA 3AFGA 5D7BA 4RZ2A 2WWVD 3UAXA 4F72A 2I6SA 2IBTA 4FR0A 1E4OA 4TT3A 4TYQA 4WIAA 2D8AA 1WY5A 4GI5A 3QHAA 4IJ6A 1QJ4A 4MR7A 5TPWA 1KSGA 2EFCB 1OF1A 1NHGA 3OCYA 2BY4A 3E3AA 1IATA 5JALA 1K7EB 1LW7A 3SU8A 2YVQA 4BVKA 1SD5A 2DZDA 4URZR 1PEKE 4G67A 3H2SA 4Y6SA 3TTSA 3SC2A 4NBRA 4WFKA 5CH5A 2XPCA 1I7SB 2R6FA 1VJ0A 3WRXA 2ZJ6A 4A0SA 2ZT5A 4GBMA 5FCDA 1LY1A 4ND1A 2ST1A 1MQAA 1COZA 4OOEA 2G76A 2ZULA 4MGEA 3SMQA 1NG1A 5E6UB 2QT1A 3CG4A 1UDXA 5EFOA 3RU2A 2ZB8A 2B1QA 1RHJA 1LQUA 3LJKA 3OZCA 3QLJA 4I19A 1F2UB 2ESRA 5K4HA 4JS0A 3JYQA 3ZOKA 4TWIA 1SXJA 5L95A 1G3MA 1EYZA 3E3NA 1K9SA 1PIWA 3NIWA 3HKBA 1DBWA 1D6MA 1DIGA 1THGA 2EATA 3D3NA 3OWXA 3VGJA 4ZYTA 1C1XB 4R9SA 1UDCA 3OX4A 5DHTA 1BA2A 1SBYA 1Z5UA 4MV1A 4YMIA 3VHLB 2HB6A 2QAGA 1QG6A 1DS6A 3I52A 4HNVA 1WDTA 4PGFA 5KDLA 3OOJA 5TGZA 4AG5A 2ZIGA 2IW3A 3TKLA 3L8DA 3TL3A 1TM3E 1RYHA 2JB9A 3K6KA 5COQA 3U44B 1C7ZA 1E4VA 1AQUA 1KZ6A 1G20B 1L4NA 4C29A 1ULZA 1XRSB 1ID1A 4Y9RA 1DOZA 1LSJA 3MD0A 1G8SA 1Z22A 2XHEA 3NBAA 3ZD9A 2OXEA 3TQCA 4Q3CA 5HS4A 3GT7A 5GGXA 2W2MA 4IMJB 2ZZNA 2LP4Y 2YFQA 4O33A 4XWKA 3WIVA 2HV8A 1L7OA 4OP2A 2ANBA 4C6HA 4EF5A 2NPOA 4MA4A 1SB8A 5KKCA 2VBIA 1ZBDA 5HZMA 2HBYA 1NWCA 2QRLA 3RTEA 1X2EA 4XQCA 1ZN2A 3OQPA 3ZGZA 4PANA 2AJBA 4G4SP 1B4DA 3M3DA 1ZK0A 3WRYC 3U7GA 1XZLA 1Z4IA 5ESDA 4TLMB 2W2LA 1LJUA 1Z2NX 3C3YA 3GZJA 3CRW1 4QLBA 2VJDA 3I6YA 3EYAA 3JYNA 2C8LA 1TKBA 4G1MB 5F21A 4YREA 1MJ5A 5WRFA 2H5JA 1N4AA 1E1LA 1W0CA 4U9HS 1ABEA 4JP8A 2P8JA 1GTVA 4I8IA 3QVTA 5EXEA 4YO7A 3WMWA 3ZCQA 4ZKDA 3QEKA 1BS9A 1YR7A 3NBFA 4XDYA 4F12A 3AHHA 5BVGA 4JNKA 5DXFA 2X9GA 1NNEA 2FGJA 4GKJB 3GDWA 2Q5HA 3IBCA 4YMGA 1BFDA 1R15A 2BW0A 1F1BA 2JJ2D 2C96A 3HBFA 3D6TB 4LTNA 3B13B 3GA5A 4FI3F 5JAIA 1P81A 1M73E 3AJ9A 4KI0A 5IVDA 1N5IA 3V4ZA 4EB6A 1W35A 1ZVJA 3R9XA 3LFTA 5B6IA 4P53A 3T7TA 1WUYA 3ZHQA 1PT6A 5BPFA 3NOOA 1BE1A 1E9DA 1D2CA 2QX8A 2V6JA 2WG0A 2WJZB 3K9LA 3B9PA 4I4NA 2YN4A 3TF5A 1H3NA 4AJ4A 1HETA 4Z9XA 4RFLA 1QC5B 1KI2A 1ENZA 4HAWA 3IUMA 2RDMA 2ZIWB 3PNOA 3UW1A 1LDNA 3H5OA 3N6VA 4J3NA 3RQIA 4Q4DA 1ILWA 3P0IA 3WFJA 1CEYA 1QHEA 2C2YA 2HF2A 3K1YA 1Q57A 2XUAA 3OOSA 4JU8A 1BYUA 1OKKA 3GROA 1N5JA 3OEHD 4NXMB 1ADCA 1RTTA 1UPFA 5DLEA 1NVMB 4HXYA 4I2VA 1JJFA 1NFFA 5H0IA 1I5RA 4O4LB 2MT9A 3FCEA 4NMXB 1TJ5A 1L5HA 3P9YA 3LT5A 4DQLA 5EIBD 4O4IB 3FSGD 3ZCRA 1Z4NA 2QY9A 1CD5A 4ZOBA 4JUBA 3VOBA 2QAGC 4IOMA 1XWIA 1V8DA 4M7OA 5I7HA 1RBYA 1ZGAA 1QUFA 4W6QA 1EESA 1Y8CA 1HI9A 5K8TA 1H2ZA 2QM0A 3FF1A 3DYBA 3MWFA 1AUQA 3AOGA 4NPAA 1M7GA 1H2BA 1CFZA 2FW8A 1MC1A 2FH5B 3E3MA 1QPZA 1RACA 2C57A 2FWPA 3SHWA 3VKWA 3FROA 2XGGA 3JVDA 4E4TA 5IVPA 2A33A 4F3RA 5DNWA 1BJKA 3B60A 1U04A 2WVGA 3QSYA 3IT1A 4M7WA 3C3DA 1CRPA 3DKKA 2R7MA 3M6IA 3D31A 5HW0A 4Q7MB 2VUUA 4BUZA 1MEOA 5T8KA 1E0DA 3I39X 2PT9A 1ZOIA 3PXDA 4JQSA 3OT1A 2CMGA 1I24A 3NG1A 3HJHA 2X42A 3RRJA 2IHTA 1A2OA 1BW9A 1NDUA 4IVRA 5FKJA 2GNOA 4QBFA 1VL0A 2EXXA 2YXLA 4Q1BA 4RQAA 4ZI2A 2Z9CA 3Q3VA 2HJSA 3LGAA 1E1RA 2BHRA 2EBHX 2JAUA 1QYWA 2D5IA 4IDHA 2CFCA 2H7XA 3EG9B 4JJ4A 2AG8A 3HBMA 5AO9A 1M2OA 4R0MA 4OY3A 1BXRB 1CUDA 1ZRMA 1NVUQ 4HX5A 1UQRA 2DP4E 1VPVA 2PZJA 5ANRB 4MA0A 1AZWA 1GYRA 2EZ4A 2ZT8A 2PV0A 5JSKA 3FVQA 1FDOA 3JQPA 3M6LA 2O23A 2FMKA 3PWSA 4UEOA 4C01A 4FZ5A 3DL0A 2O8NA 2JF0A 3W1WA 2VQ3A 1MO2A 2O5VA 2AW5A 1QH1B 4MOWA 1O0CA 1RAAA 1UJ5A 1Z7GA 5FOSA 1P4GA 4EA6A 1W7AA 5HJ7A 3JRXA 1R8SA 1X1TA 3PJDA 3IL2A 2BTEA 5CLJA 2WM2A 4M9ZA 4AO7A 1ADYA 1ORDA 1SD1A 2YJNA 3H9UA 2XQJA 3AVVA 1WIWA 4G5HA 3D7LA 3RVMA 1IULA 5F9FA 1CLEA 2HIAA 1OFVA 3CRMA 2W6QA 2COUA 2H48A 3UB4A 1EFKA 5HCUA 3GY0A 4R2MA 1Q6ZA 3PGXA 2DFVA 3FVRA 3W34A 4NJMB 5CDHA 3S2FA 1WSWA 4CE6A 3HVRA 4QUKA 5GINE 4F7DA 4LDJA 1N3YA 2BONA 2IPAB 3FNGA 1K92A 4HB3A 3RIXA 2FPKA 4C08A 4PN3A 1JDJA 2OWEA 1KGDA 1DINA 2ZIUB 2FW7A 4X64B 2AN1A 2CJFA 5K6RA 4PU0A 4NU5A 4BFSA 1PEDA 2QBYB 2BGJA 2J5BA 4S0ZA 4NYJR 1C0EA 1JFFB 3DT8A 2QXTA 4JFRA 3PEUA 1GOTA 4PLWA 1NKVA 2P4UA 1J0BA 4Q9JA 5D3QA 4HN2A 1FFXB 1W48A 5J1SB 2A4KA 1FOEB 2Q41A 3GZTB 4V0QA 3UA4A 1KAMA 1CUIA 3SFVA 1SPXA 4D8TA 4ZAVA 1SCBA 1Z74A 1M83A 4RL6A 1PJRA 3KAJA 2CUKA 3FPHA 1MDFA 4D41A 2X0IA 4ENWA 5JPDA 4QFBA 1YR9A 1UJNA 2O20A 1SVSA 4YFYA 2IOQA 3CH6A 1J8DA 3L0YA 4MKFA 1PTKA 4OLBA 4B2LA 1HT0A 2BPOA 2IDMA 5AVOA 5KYXA 3H84A 2NN3C 1LRLA 1TXGA 2C29D 4RLFA 3ZTYA 4D3YA 3CT4A 3E22A 1Q1BA 2ID8A 3KSBC 3B51X 3R7AA 3A9TA 2CKDA 3TXXA 5C18A 1SY7A 2CK3D 3DUWA 3ET4A 2O05A 4JODA 3MMPA 3AJEA 2VT2A 3LSTA 5K3AA 1NZDA 4FR2A 1LLDA 1OX4B 1I3NA 3BCHA 3IELA 3QG5A 4Q02A 3RVKA 4CLOB 5LJIA 8MHTA 1M72A 3OPXA 2LKCA 5EYPB 4H59A 3DHEA 1FA9A 3I2KA 4M99A 4M98A 5AKIA 3BWEA 3CVUA 1PV4A 4WKOA 4CYMA 2OHFA 3I0ZA 4HZUA 3Q0IA 4I5FA 1Y9JA 5JC8A 3HCFA 3AR7A 4ZOLA 1ESEA 2F55A 4KAFA 2ADOA 1EFVB 2PMFA 2I55A 3PQ5A 2BLNA 1T6BY 1Z2OX 3AF1A 3HDQA 3HJGA 5AOVA 1IK4A 3O2SB 4FOSA 3GBSA 3GAZA 2DQYA 1GWNA 1NT4A 2ZITA 1KYWA 2JIMA 3R41A 4CL2A 1DRKA 2ORED 1GTJ1 1SCNE 5E9JA 1RHKA 2IUUA 1EK2A 1RWNA 4LG1A 3S99A 4EATA 4F92B 1ATZA 2ECOA 1A9YA 2DJ5A 3L4BA 2AFRA 4ZQEA 3ZIAA 2LW7A 4B84A 1DC5A 4OGWA 2HXSA 1I0ZA 3ZPXA 5GOZA 1YUNA 2XA9A 3F78A 1E1MA 5JU6A 4ZQGA 4DSTA 5JJKA 3X1DA 1MZVA 4GM0A 1D2EA 1LNZA 3AETA 3ZWWA 1OI4A 3FX2A 3VISA 3DEIA 4IH4A 3ADDA 4O4HB 1KYVA 5HJEA 1A5BB 2YXEA 421PA 3HWX1 1DKLA 1P7VA 3V8VA 1XA0A 3BE8A 3ILSA 3KTDA 2IYEA 2LTAA 4BV3A 2XE6A 3LRXA 4JT8A 1SKYE 1ZQ9A 4PFJA 2V0GA 4XRRA 3ZLVA 2IX9A 4B3TB 4D80A 3GRYA 3DXXA 1Y8AA 1IXZA 1QLHA 2GN1A 3OWHA 4LI0A 4HUJA 3ZI7A 1NUSA 1QVWA 3N0VA 10MHA 4FC6A 1F8XA 2ILTA 5EJEA 1JFSA 1NBIA 3D64A 3PJGA 2ZCUA 4GX1A 4MWSA 3BMQB 3VR6H 1TVKB 4TS9A 1VJ5A 4AY2A 2AXPA 3FR8A 1QRAA 1TVMA 2GXUA 2RAUA 2RIPA 2VJQA 3FMOB 4PS0A 4X61A 3RRMA 3TQSA 1FJXA 4JSTA 1P8JA 5JNSA 3U3JA 1QKKA 1O94D 1JLLA 2LNDA 5JRZA 1ESDA 3AL0C 4J0EA 4S35A 2CDCA 1YIOA 2PT5A 2Z2KA 1AB5A 3GRAA 4MQBA 9ABPA 5LM3A 3IXLA 4OK5A 4RF2A 4DEVA 4PRYA 4E5KA 3E0QA 1YRAA 5DCUA 4BAGA 1YC2A 1UPCA 3T5GA 1TFUA 1TJYA 2HK9A 1EGQA 3JQBA 3EBPA 1IBSA 4QBKA 2KMLA 1K6IA 1QG4A 1SBTA 4Q6WA 4V0OA 2PAFA 3PFGA 1C3LA 4G5RA 2V4MA 3PFNA 2G9VA 3RBXA 4L3WA 1QGDA 2FMHA 3K1AB 4YJ3A 4CQJA 4MRPA 4ALKA 4L5BA 3L93A 2OCKA 2EKZA 3UEOA 1RZVA 3K30A 3LI2A 4GP7A 2IDKA 1P80A 5IC6A 2E0IA 3BWVA 3KLMX 4HI0E 5HQJA 2ZE5A 9MHTA 4R01A 1D2HA 2APJA 1V48A 4U02A 3RC2A 4LF6B 2QRZA 4I8DA 1FMCA 3ETLA 4D56A 3BZBA 1Z45A 4HAOA 4CKYA 1GPH1 1ZKDA 2K7ZA 3WX0A 5DB4A 3KJXA 3LX4A 4AJEA 1ULTA 3H5IA 4BDSA 1SBZA 2F1JA 2W0SA 3CEHA 3M6UA 4JGGA 2Z5VA 3AY3A 3QFSA 1BCRB 4KAAA 4LXTA 3N0XA 5CVCA 2DTDA 5FYQA 1XRLA 5P8WA 5ENVA 3A7EA 4PSCA 5FR2A 4RPIA 2JVJA 3OY2A 3OLYA 3C5VA 3LY5A 1I3LA 2LCQA 3ZNPA 2BCGY 4YCJA 1T9GS 4HV4A 4ZJZA 1BE8A 1QR2A 3ND8A 4IIHA 3PEWA 4N3AA 2VP0A 2ZI7A 5HM8A 2AJTA 4JLNA 1PQ4A 2AL7A 3MCUA 1IJFA 1VLMA 2PKEA 5A9TA 2C88A 5KB3A 1T9DA 5K3EA 1A5SB 3OJ0A 4UHCA 5AQ1A 5EKXA 1QE0A 1H2YA 2V59A 1JLRA 2RC6A 4JLAA 5CVEA 3DDWA 4UNQA 3V46A 2D7DA 1F06A 3VOSA 5AW7A 3SBXA 1CY6A 1H4QA 4JC8A 1SZDA 2VXYA 2BFFA 1CJBA 2WTXA 2EF0A 4KHZA 3V2HA 3WLFA 5KCMA 3BQNB 1AY0A 2AFHE 5AXAA 2XUPA 2NVUA 4K86A 1O77A 3PGMA 1Y3CE 2WKPA 3IQXA 5IT0A 3RVJA 4CETA 3IIJA 3VNVA 1MPTA 4EG3A 5FO1A 1IH8A 1P72A 1ZBQA 3ZLUA 2XADA 5JYEA 1XYVA 1THTA 5B2ZA 2EW2A 4AM8A 3NBMA 2ZJ0A 2QN1A 5F77A 2BEJA 4DEYA 1IBRA 1BU5A 3VH4A 4F9EA 1Q77A 2J0UA 4NCJA 4BFZA 3CVVA 1QSGA 1PS0A 5T5QA 3LFHA 3E8SA 5AKGA 3KUCA 2J07A 4KSBA 5KO2A 5CT6A 2OBYA 2JBWA 5E38A 1PWXA 3H1GA 4KNWA 3WL4A 1M1YE 2JHAA 4N18A 1IUKA 1G5HA 5CAEB 4YMUA 3BH0A 1QDEA 2QTGA 2RHBA 4HWRA 1HYHA 1XZHA 4WLUA 5TXGA 1KK2A 4QWWA 3AVTA 2BZSA 4QBGB 5CXXA 3CNOA 3AF6A 2QG6A 4Q3EA 5A7HA 4YAKA 3DYIA 4FILA 2YIJA 4RSMA 5NLLA 1GQYA 3VC7A 5I9IA 2UUBB 4QJ3A 3BFXA 4I9UA 3EZ2A 3QVXA 2OCGA 4OQQA 4ZQIA 3H1BA 4O5OA 2G1UA 2I62A 4URXR 4HQNA 3SYRA 5EZYA 2JLQA 3LKDA 2XA2A 3D3QA 3O7WA 4PPNA 4QGFA 3R7WA 3IPYA 1U3CA 2ZZKA 3B6EA 4TLDA 2DHEA 1KNQA 1ISJA 2G5TA 1X70A 2NSHA 2Y77A 3B7PA 3LZ6A 2A0UA 1DU4A 1E5DA 3CBQA 3PXAA 5H83A 3V48A 3OU7A 1IBLB 2YWBA 2R7NA 1NGSA 4MLCA 5EXDA 2PO7A 5EERA 5TY0A 2FFQA 4DDTA 3WBBA 1EPUA 2VCYA 2UYQA 2NXNA 2VI5A 3B2QA 3ZE6A 1J0XO 1F2VA 3QYAA 2AOUB 3HZRA 1YVDA 3BA6A 1NPYA 3KTFA 2FMUA 2DPGA 2BUAA 4L2IB 2YZNA 4WJKB 2A0KA 1DAGA 1OGIA 1VRCA 3V7WA 4CPDA 5IAGA 4EFKA 1BAPA 2J3HA 3PX3A 2NPIA 3PC7A 1G60A 1VL1A 1KZ4A 2A9JA 3IUQA 4M9RA 4LRYA 3HXOA 1BFUA 4DLUA 4CEIA 1L7EA 1YR6A 2CYAA 1UOOA 1XJCA 3F49S 5C1IA 2DUJA 4URFA 1XXLA 4BFVA 3KU4A 4D9HA 2O3RA 1R00A 4BFUA 5AQEA 2HQBA 3C7CB 3LUJA 1P7ZA 1NF9A 2NQ2C 4YRBA 1GNSA 2NV0A 4RZUA 1XRPA 2X4IA 3CUTA 5JLAA 5AYVA 4B47A 1ACMA 4FMDF 3DQQA 3QV1A 1Z18A 2ZUDA 3L1JA 5ADUS 2C58A 4GGMX 2X0DA 5HQTA 3LWZA 2O5RA 1N2CE 1ODCA 4OA8A 4BQNA 5AVVA 3OBBA 4YPVA 1Y1SA 3OJFA 2Z08A 1YU6A 4JLBA 1FNDA 2GTIA 4RZ3A 5BRJA 1J33A 1KFBB 1ORTA 1ACJA 4M22A 2W2TA 3K53A 1K08A 2G04A 1PZFA 3TMAA 4CG2A 3IQZA 3ZJUA 5ITZA 4FNGA 5FHQA 2IIBA 4EVRA 2GBLA 3TRFA 2FK7A 4EB6B 4BWGA 3ZX4A 5K8IA 4I3FA 1WHTA 1WRBA 3GVPA 4BEVA 4YS6A 1RWMA 4I0WB 1Z06A 3G2PA 4IDDA 2DUUA 1UMCA 2WU1A 4FHGA 1JEYA 1W93A 2ZFUA 1V41E 1SUCA 1UMBA 1K5PA 1C2YA 4B6JA 1DKOA 3LY7A 2WHEA 4XR4A 4D96A 2NTNA 4WESA 4HR7A 4Q47A 6ABPA 2O48X 4F7WA 2O8VA 3DBLB 2ZREA 3C6XA 3UAWA 2EFYA 5EJ5A 1CR4A 2FLVA 1EG2A 1UJ6A 3ZI4A 1MAWA 3JZAA 4DPMA 3JQQA 4F4JA 4S1PA 721PA 2Q3LA 4BO0A 2EGGA 1QOQB 5TB5A 1P7PA 3WGOA 1EU1A 2VDQB 5ALYA 2DR3A 4TKMA 4RFVA 3HZZA 4R68A 1RXWA 5E4JA 2EQBA 2IV2X 3MWYW 3BH7A 4Y2VA 5HBGA 1AQ6A 5DIZA 4AIIA 2VQSA 1LFDB 3DPSA 2VYVD 5ALQA 5JROA 2ECFA 2DF8A 3ZJVA 4JOSA 3ZHCA 3WKEA 3U40A 1KVTA 2B4AA 1THZA 4WECA 1SOMA 4QO8A 3RHZA 4CMIA 3NJRA 4TQ9A 3VPXA 2OBNA 4HVLA 3CTPA 4UD2A 1CUGA 2FPRA 1LKZA 3SEFA 4GYKA 1PU2A 2HO4A 2VPXA 4KR2A 2W43A 1UAYA 3SEQA 1RYNA 2IE8A 5J4HA 1A50B 3I9JA 3PV0A 3ITKA 3ZXIA 5BN3B 1W4CA 1PV2A 5AHOA 4KVGA 1S6YA 4Z0TA 1MW8X 4GC9A 1KH1A 1NN1A 2OHGA 4WGGA 2BEWA 3ECSA 3AP3A 5GPBA 3GUCA 1FXSA 3O74A 1Y4UA 1J42A 4H2DA 2WJHA 5DXAA 5EJ2A 5HEKA 2P2SA 1Y5RA 4QDZA 1XPJA 4BNZA 1ZMBA 1EHCA 1NY5A 1XLWA 5HDQA 3TLXA 3KYCA 3PI7A 5AK6A 4NHEA 4A91A 4C5CA 3FWYA 3K2QA 1M54A 4OSPA 1NVWQ 1P2GA 1PWZA 3DPUA 3STYA 1MT0A 4B5LA 1GZDA 3ADOA 4JELA 3MJHA 1WXQA 1MX5A 2R6ZA 4Q4JB 4TLBA 3E5NA 1YCGA 3MD9A 1VBKA 4L4UA 4RV4A 1X92A 3SOPA 4IEEA 5IXYA 1K89A 1ZJJA 3TNDA 5EIBC 3TW4A 2ZSFA 1RADA 4M89A 3SKVA 4OYHA 3NEYA 3KTAA 5B30A 2CFIA 1FX0A 1CZNA 2I87A 3ELBA 3HB0A 3OIGA 4XJSA 2QQEA 5JS2A 3W4IA 1UC9A 3ZBUA 4D79A 4LMBA 2ZUSA 1QU3A 4G4SO 4C2TA 1N6OA 3JWGA 3RJZA 3H0CA 4GYWA 3EF1A 2XTNA 1E3EA 2PM8A 2POQX 4KC0A 3V1KA 2P9QA 2WYUA 5JAQA 1DXOA 4CEJA 1C0KA 4MMXB 5FUVA 1T8WA 1C4XA 5DJ5A 3VNAA 3T1OA 4DKXA 2VHXA 1MJNA 2YY7A 3P7MA 1NNI1 1T29A 3H9JA 3PS9A 4TV8B 5D1NA 1YH3A 2G07A 2ZROA 5L53A 2CMKA 3FLAA 5FF9A 3SIRA 3DL7A 1JJAA 5JAUA 2P4EA 1F2TB 2Y9MB 3KQPA 1KSFX 1KYZA 3OT4A 4B73A 2D5BA 2GUGA 1XKXA 5E6SB 1GV1A 3J81A 3JQ7B 3BB4A 3HI4A 1U90A 2R84A 1EP2B 2BMVA 3GDGA 3KSMA 3L0PA 3JQGA 2C3YA 3NWBA 1QF9A 4GOXA 3KJQA 3BERA 5TV2A 4N9WA 4AMBA 3DZGA 3HVJA 3N5KA 3KFVA 1BC5A 2F4VB 1L7AA 1UPUA 1LCIA 4R7ZA 4Y2TA 3QEJA 4Y0NA 1V5IA 1M67A 3QOWA 4MVJF 4BFCA 1KBOA 4FGJA 4FGSA 5AESA 4Q1CA 3MOIA 3AEZA 5DSZA 4BJ6A 5KEIA 1ELOA 1NW9B 1QHHB 2AIRA 1U7OA 2JRCA 3R0XA 3LD9A 1Z7EA 5TRTA 1RE1A 1TM1E 3Q8MA 5CTAA 2WDZA 2EVWX 1Q95A 4JLUA 3GFSA 5TLSA 4D8WA 1J8FA 4QG3A 2XCUA 3AJ8A 2G17A 1PNQA 2KM1A 1A8PA 2GM5A 4UFNA 5IK2A 3BAFA 4ERNA 3F5SA 1U0BB 5HE8A 3DG9A 4BU0A 5JNUA 2FLWA 4PS1A 3ZWYA 2GHTA 1JPNA 5HHTA 5JSQA 4CV0A 4UNIA 3PR3A 4HRAA 2AXEA 2D2IA 3FTPA 1DCTA 4PAMA 1DWPA 2QY6A 4HLNA 4JVNA 4ND4A 4QPDA 3RJTA 3KNZA 2I1QA 1RYEA 3B1JA 1JFVA 4WEQA 3JATB 3FPBA 2IYSA 5C8ZA 2NU6A 2C5LA 3K4QA 1PJSA 1T35A 1PR5A 2Q6KA 3JATA 4M9SA 4KXFB 1V4VA 5JVDB 3WZ2A 1CQPA 1FFSA 1K06A 1SC1A 4MB6A 4EM6A 3K8YA 1G5FA 3P2OA 4FQ5A 1WDWB 1X14A 1NIPA 4RYDA 3THRA 1ZVVA 4UTXA 3C1AA 3E53A 2MINB 2QKYA 1BMQA 3GFRA 3F8SA 1XZQA 4JCOA 1CVRA 3URMA 1AUPA 3LPMA 3T0GA 5HZHA 5JSUA 2WU4A 1G9TA 1TJPB 1WF3A 1BKSB 2AR0A 3K05A 3KB1A 2JL1A 3MS4A 4H1HA 1U8AA 4H7HA 4IJVA 5IZCA 1VE9A 2HQ1A 4KBFA 3MEQA 4F4FA 1M1UA 2VUIB 4H16A 4QEDA 2QTWB 1H0KA 3L7NA 4B3FX 5BQ3A 2IS6A 3ETCA 3M2TA 3SAJA 4DM3A 4MQEA 4KN6A 2ZJ5A 3ICWA 2RMKA 4U2GA 4IIUA 2VLBA 3VOAA 4H3KB 1NW8A 4B75A 1ECJA 1SBCA 1KMCA 3OFVA 4PFQA 3GD5A 2CXQA 3AJRA 3S2YA 2VAMA 4Y2SA 3KR1A 4IIJA 5LZ8A 1N6RA 5D3MB 1HQYE 1M2NA 1SWWA 5F7JA 2G63A 3MRSA 4GAEA 4KX5A 1M6VB 3MW8A 4DQVA 1WB9A 2I33A 3R6DA 3PD0A 3ZHXA 2IOFA 5AK4A 1M0WA 1IY1A 1R74A 3KVVA 5HFNA 3W7BA 1TPZA 5F76A 5L51A 1U0RA 1TK9A 1UKAA 3NHFA 4L5JA 2NQ8A 3GX1A 5BSTA 3TVYA 5EWMA 4CMEC 2P5YA 4BFTA 1UBJS 4ZVUA 2OG1A 2EX1A 1XQ9A 3FZQA 5C7OO 1U3FA 1B8OA 1SQGA 1ZUD1 2R25B 3INYA 4WL0A 3D6FA 2MTBA 4EBBA 5KUTA 1XZPA 4PSKA 2BMJA 3FHLA 1QPBA 2YVKA 3WLKX 3ZWMA 3G89A 1O97D 4O1IA 3DZBA 4QBHA 1XTQA 2EG9A 3MUEA 1QYCA 1GAQA 2J3QA 3A0RB 1QR6A 4R2KA 2EQAA 4FMCF 4V0MA 4B46A 2YL2A 5L9AA 2PRKA 3EXFA 1H1LB 1WLYA 2WAXA 1ZPDA 4RMIA 3VX4A 4KO2S 4C4YA 3TSWA 4H0FA 4OIMA 2CLSA 4EVQA 1UIMA 1Y81A 4NCAA 4OL9A 1VGVA 3I12A 4LJ7A 4MGIR 3F3YA 4MIEA 2WSYB 3TVTA 1OR8A 4JA2A 1RPAA 3U3DA 3B53X 2HFKA 2IA5A 2DRIA 3IQDB 3SM3A 4PSDA 4ZMBA 3AYXB 4LSMA 1GADO 2BFDB 1Y3IA 5FXMA 3MT8A 3U49A 3ENNA 4IOJA 1HK7A 3AI2A 1RI3A 3E5HA 4BQSA 1M2GA 4KLAA 2Y1WA 2GBPA 2IEGA 2PFGA 4LV8B 3SJUA 3DVLA 5JD6A 2YW9A 3M3PA 2TS1A 1DAHA 2VAVA 1E94E 4LCEA 4IF4A 3WGLA 3L77A 1S0UA 3B70A 4B85A 2AX4A 4QGGA 2JLXA 2I2WA 3DAYA 3LCMA 1HKHA 3OMWA 4KX3A 5DH9A 3RF6A 1M3SA 3BG5A 1C8BA 3KQWA 2O14A 4DLZA 1A88A 4B2PA 1DJQA 1DCFA 4GRIA 3SVLA 3NAQA 2QRJA 4JUDX 3OSUA 4IGFA 1P61B 2HJ9A 3JS5A 1HOXA 1HLFA 3AUXA 1E3QA 3VI3B 1RIIA 2D00A 2BMFA 4NICA 3WMFA 3LP5A 4WCFA 2P67A 3I9KA 3CSDA 1LU9A 4UUBA 2SKEA 4BN4A 5E7QA 1D2RA 3TZ6A 3T9BA 2XVAA 121PA 2XWPA 1LPAB 2BGWA 1CY1A 2X15A 2BKUA 4JLWA 1M8KA 4B3BA 3ULKA 4I1VA 2Y1DA 4G5SA 4H31A 4WCVA 5CNKA 4UUNA 5K4GA 3U19A 1QH9A 2VNJA 4IUBS 1E66A 3HUDA 4HAXA 4C03A 1QHYA 4DB4A 1MV5A 4N1AA 4GQBA 2P35A 4BZXA 3D3WA 1TUEA 4X6YA 3SDZA 5DP2A 1KZ7B 1GPYA 4WNAB 4PTLA 1XRJA 4AJHA 1JHVA 1B8PA 2LBPA 1OTXA 1U3UA 1TVEA 1BDJA 3A4YA 2QEQA 3KXIA 4RDIA 3EULA 4DQUA 5JYDA 1DMRA 3UYKA 2AF4C 2EW1A 2F1OA 4R5HA 2Z5FA 3GUVA 2F1IA 5EIWA 5C53B 5D5PA 4G01B 4YRMA 3F3SA 1FTSA 2IHYA 1B8VA 3E5MA 2GFQA 1P9LA 1QC5A 4O59O 4EHKA 5CDYA 1XQWA 1W88A 3QUQA 1XZNA 5HM6A 2A8YA 3UWMA 5CXSA 4P84A 3UJ7A 3ZCTA 5IU6A 2Q1XA 5IUKC 4IQFA 4JQZA 1I9CA 4BMVA 1OI7A 1NI4A 2WM8A 1ZSVA 5AVKA 5ILGA 2EKQA 2Z2XA 3UOAB 3P9PA 1NR1A 1KEPA 2VDNB 1U7DA 4JDUA 4I4CA 4LNUA 1CEEA 5DTJA 3KSUA 4GOLD 5AHRA 1QXSA 1E63A 3KV1A 1N34B 5AW9A 1CR2A 4PZAA 4W8HA 4E5DA 1K0FA 1YQDA 3H2YA 3QFFA 3A14A 3TAHA 1LEHA 4PONA 4NENB 4Q66C 1SCAA 2WYVA 3IERA 1YQXA 2LGJA 4B76A 3G0HA 4M6WB 2YV4A 3FYCA 4RE6A 4UOEA 5L4NA 3ELYA 3S1AB 3IBGA 4IXMA 2HV9A 5D7NA 5ELLA 5LA6A 2KYRA 3Q2IA 3ROXA 5C3UA 4LRUA 1YT5A 4LYDA 2Y67A 4YUVA 5TMEA 5LZ9A 1C1HA 3FIUA 1Z36A 4HJXA 3T9AA 2HLDA 2HOQA 4RVUA 1BS1A 1PF7E 3IE2A 2H2HA 4Q3DA 1MN6A 4QPPA 3LDGA 2PBFA 4JLMA 1RRPA 2FSVC 1UMCB 4I81A 3CB4A 2Y8EA 5IEJA 2IZ1A 2Z6UA 4IQGA 3R09A 4QT0A 5CDFA 2Y6VA 1MO3A 5GQSA 2V03A 5KWIA 4FPXA 3KR9A 1JB9A 4B4VA 3ESDA 1KMHB 4G1FA 5I9TA 4ECAA 1PZMA 3FKQA 3GN2A 1KIFA 3A9CA 3WGTA 1GGVA 3R0QA 1H65A 2IXDA 2G40A 1NM5A 4L3VA 3Q5DA 3O75A 4N9QA 4JI1B 5HMMA 4EVIA 5HRCA 1E1KA 1V5WA 3A3NA 5IJZA 3R9IA 4EECA 3W5CA 1XPOA 1YFJA 3LH5A 2J6BA 2QZ9A 1BD4A 3W6UA 1IZZA 4BZPA 3MLBA 2HBRA 3LBIA 3SVZA 3U9SA 4AC9A 3RFCA 3DKVA 1TM4E 4GR4A 5I9NA 3SSOA 3TRHA 4BPRA 1NC3A 3Q40A 2B4YA 2Y6UA 3H2KA 1N2GA 3P19A 1AUOA 1UXJA 3OKCA 1OBOA 3ISVA 2C4UA 2O8FA 1JH8A 1F0NA 2BJVA 3AJDA 2O2EA 4K28A 4CCAA 4EABA 1ZIXA 1XGKA 4L8LA 1J21A 4B6EA 5KNCA 2NT4A 3BXFA 3GVHA 2WKRA 4YJKA 4JP2A 1QWSA 2EU8A 5GADl 1DTWB 1G19A 2H4ZA 5GJWC 1N1GA 2RI6A 5EKSA 3E61A 2PU7A 4MGKR 2WIAA 4PLZA 4U3JA 5ALXA 4YBZA 3RS9A 2C0CA 2HA6A 4JKIA 5B6PA 2OD9A 3U3OA 1ZZEA 3VC1A 3G2IA 3AWDA 4F96A 1GNTA 5JZVA 3LHIA 4FIDA 1ZDMA 1YZNA 3FPEA 2J9XB 5DHPA 5E4YA 3FMIA 3Q9SA 1PQYA 3AEQB 1HT1E 3PRYA 4IF6A 1U3TA 1ZJ4A 1Y4AE 5I7FA 4RTJA 3L8YA 3U7QB 1B0UA 3M83A 4RJJA 4U9IS 1XELA 1XWFA 4B17A 1A9OA 1Z47A 1M1NB 2XUJA 2EFJA 3AEXA 3AM5A 3PX2A 3WQSB 4ZRMA 2QBYA 2E4WA 2XH8A 4L4SA 3MJVA 4RHUA 1UKVY 4BRSA 2MR6A 4XUGB 4L95C 4UU0A 2QZ4A 3GHYA 2IELA 4IDAA 4BNDB 1U1IA 2H9AA 4RZXA 3B1VA 5LQKA 2UXDB 3U48A 5CCEA 1LLFA 2QVGA 5EXSA 3WNDA 4N76A 1XRRA 1M2OB 2OFWA 1S9DA 2WD8A 1QQBA 2MDTA 3ETNA 4EEKA 2B94A 1JIVA 1NFQA 2AFIA 4Z2AA 3E8XA 1R88A 3AI1A 2JFFA 3KOUA 4WZAA 3RVNA 3UJCA 1M7HA 4YJGB 4E5MA 1N8TA 4LJSA 2PVSA 2QRQA 2VKQA 2E2WA 3AKYA 4G0MA 4ZZ2A 5AVWA 3L8FA 2X5OA 5C8YA 1G8GA 4KXMA 3UGJA 2PUFA 1BGXT 1E7SA 2F4NA 2FPGA 2FQYA 3IO5A 4FDMA 5FFNA 3SK0A 2BGTA 4XIIA 3UAGA 1Z6AA 1NQVA 3VC2A 5L7TA 2PUDA 2B1JA 3DE1X 2E1PA 4LVUA 3B6IA 3PK0A 2CMHA 2UUOA 2WJJA 5ALZA 4YV1A 4TKUA 2BH9A 2WAMA 3WYDA 2RHRA 1E0KA 1NM5C 3K9WA 4WY5A 3UATA 5A03A 1BXGA 1ECGA 5KNBD 4RK4A 1WUKS 1PR6A 1MVNA 1QQ7A 1RWOA 1KPIA 2WUVA 4J4TA 3RTDA 3HVUA 2X7HA 3GLQA 1FP4A 4W9NC 3NW9A 3L7MA 3RJ5A 1XZCA 3C97A 3IP5A 4MV4A 1BOFA 4XB6B 2R0QC 2JGNA 1Z0FA 4R83A 3A25A 2WUDA 3DD1A 3S5JA 1WP4A 1OU4A 4HNHA 5BRNA 3L7DA 3QWFA 4DRXA 3SEZA 3EQZA 4DIDA 3RNLA 4WBNB 1ETHA 2NO0A 4RNCA 5FA6A 5HF6A 3V8EA 3BD8A 1YFKA 3OF3A 1KJZA 2DBYA 3H4MA 5CYPA 4YT8A 3A31A 1BN6A 1G66A 1JW9B 1WCIA 1MX1A 4AUEA 1A97A 1QVVA 1XKLA 4MTCA 3TZHA 3CNEA 5EZQA 3TW0A 2AD5A 2ODWA 3MUFA 1MU0A 3IAXA 1W2GA 2VJKA 1FVHA 1PNRA 3I58A 3BZUA 3PC4A 1L7RA 4DC9A 1FUYB 1E77A 2H4YA 3KAQA 4BP1A 5B3KA 3WL5A 1NJ2A 2EERA 1BHO1 4YRAA 1E7WA 4LXHA 2DHQA 1F12A 1G5TA 3FTNA 4AZ0B 4JH0A 4H35A 4U2KA 2NUPB 2BGMA 2O4UX 5DYWA 3CF0A 3O6VA 1YE3A 3A6LA 4UBKA 3DAPA 5KX5F 1CXZA 1EWVA 3HY6A 1AVTA 2WD9A 4FSHA 5EXXA 4AKIA 3C14C 3KD2A 3DMTA 3S55A 2X8WA 3TLYA 2ZSJA 2I7XA 1B7GO 2CLHB 2BMAA 3OLCX 4C7KA 1KEKA 3DE7X 4HWTA 1HL3A 1Y4ZA 4US2R 1S3SA 6ADHA 3WGNA 3T9FA 2CT8A 1B0AA 4TL8A 4KSYA 3EDMA 4ZALA 3U1VA 3W04A 3TECE 4DQ0A 1N2OA 2JLUA 4CN8A 2AOXA 3Q7PA 1AKQA 3KUUA 3VV2A 1T8YA 2GFIA 3PFIA 1KI8A 4NZ9A 3VH1A 1ZISA 1KRWA 5FLEX 5HIKA 1MO6A 1D1QA 3B82A 1Q1QA 3VSDA 3TL6A 4DJJA 3SE7A 1H2AS 3FOCA 3RSGA 5LQNA 4D43A 4UBJA 1W0JD 2H11A 2P4HX 1T26A 3ZJTA 2D7JA 1IVYA 2O3SA 5LR6A 4GI7A 1L7QA 3Q7QA 3E2MA 1I30A 3T5MA 1QMGA 1RLJA 3KSAC 4WGFA 2VCEA 5TPWB 3H9EO 3WKDA 1H2WA 1OYOA 2JCXA 2WJYA 1P91A 4GL2A 1JYSA 1FYWA 5KMGB 3ESAA 3KVNA 3DBHB 3EGXB 4MWEA 3UWOA 2RCNA 3QE9Y 5IBQA 3JD0A 3SC2B 5C9ZA 1R8YA 4JZYA 5HIAA 2C31A 4QUBA 3W9BA 2GA8A 4I55B 4EI2A 1M34A 4MIOA 5F3RA 4M76B 3PX7A 1GU0A 1QCCA 3SXUA 1ISSA 1E2MA 1XEWY 4ALJA 1R6UA 2O2DA 3DR3A 1DCKA 4ZCQA 2D3WA 1TTHA 5F1YA 1RRGA 2GBIA 3K9NA 2IV7A 4DHEA 2JG3A 5E8JA 5T41A 2RONA 3GNTA 2VQFB 1E6KA 3G88A 1M2JA 1V96A 3LX8A 1XAGA 3G0OA 3RFUA 1ZJZA 3QVWA 3L6RA 5ALUA 4HX2A 1RT9A 4EQZA 2V7QD 3A2LA 3B38A 3FUCA 3ZNQA 4D82A 1UWVA 4O2AB 3TLZA 1OXKB 1Z6GA 1BU8A 4HRVA 1P77A 2HDHA 1E62A 2FG6C 2OXRA 1I3MA 4HNAA 4ZO4A 1DX4A 2X23A 2ORVA 3BQ9A 3QOXA 2ZRGA 4G09A 5FULA 3QNWA 2Q4RA 5FLKA 4AJ1A 1W76A 4R31A 3UPTA 2H59A 2D1YA 5EZYF 4ZT7A 5HXAA 2VNHA 4U7PB 2ZSUA 3IXQA 3LA6A 2O1WA 4E2FA 5JDIC 4EYGA 3SXJA 1KI4A 1GFIA 3H7IA 3V6MA 2IPNA 2QUBA 4P3YA 4LWOA 4FNAA 2R1TA 4OOFA 3TOSA 3DP7A 2I4NA 4O2LA 1ZJWA 4YN3A 1T9GR 5H5JA 2X7XA 2PGXA 2HSJA 4PVDA 2BGLA 2PUEA 3PR1A 1YBVA 3OHMA 4Y1RA 4EDFA 5JY6A 3CJQA 4UVEA 2WJVA 3OZBA 1MA0A 1GRVA 1O03A 4UE3S 5AJWA 3D8UA 1XZGA 3F9IA 1IVNA 1UBFA 4Q1FA 4Q5IA 3VO8A 1YL6A 1RYMA 3BXZA 5ECDA 3RB8A 1GY8A 1NU8A 1NX9A 5D1HA 5SICE 3ESRA 1P62B 4BLPA 2ZBFA 5IK2D 2JI8A 1JXAA 3P8ZA 5IWAB 4JLVA 3X0DA 3CKKA 1XVAA 3NDPA 3GP8A 3W2TA 3TRDA 1Q84A 3FUXA 1V43A 2DUNA 3OC6A 4WFQA 3WZLA 3ZY3A 3GVIA 1KDZA 4DSOA 2ZIFA 3ZHZA 4A0FA 5LYJF 4A2PA 1CJVC 1XYYA 2PX8A 4TWJA 3HKDB 4CLRA 4RLHA 2NUAB 4Q9AA 4X7MA 4M1YA 1N5MA 4QQ8A 4Y9TA 2H2AA 4NDNE 2HNAA 3E2PA 3INTA 3ICOA 1KZYC 2V4ZA 6PFKA 1JN0A 4X6UA 3GLHB 3P4UA 3CZ9A 1ML4A 2IHBA 4XRGA 3KB2A 2YUIA 4WKGA 3RCBA 2ALJA 2FGKA 3I5UA 4J1QA 1UBHS 4AMYA 2ET6A 2GILA 3PLNA 5CXQA 5BWBA 4KL8S 4KO1S 1XCGB 1P4JA 4I3GA 3LF2A 2MSLA 3PYXA 2NU7B 2RHHA 1CX9B 3LQ2A 4G41A 3N53A 5I4KA 1PVVA 3MS2A 4MHOA 1BTOA 1KJNA 1D1PA 5EJ8A 1XMQB 2ISCA 1JZTA 2A35A 2AZ4A 1OW3B 2FXIA 1OE0A 2R11A 1W5TA 3D54D 1Z75A 3NCTA 5EQJB 1KDRA 4CMBA 4P31A 1J1ZA 1UKYA 2CLLB 2WLSA 5IM4F 1T0PA 2A0FA 2V55B 3LT2A 3H17A 1RCTE 3BTSA 4S2UA 4U2EA 5J2TA 4PO8A 4MYTA 3AVYA 5F1OA 4H7PA 3O94A 1T3ZA 3SC4A 2HMYB 3I6QA 3W5JA 5SY6A 2FPLA 3OTQA 2YHIB 1O5OA 5BUCA 4PQYA 1HBJA 4IZIA 1V6CA 4GWLA 3GXOA 2IHVA 3HR4A 5TS2A 1G4AE 2YJTD 3WRYA 3K0SA 1OBVA 4MI9A 3O93A 3FSEA 4WCFB 4ATNA 5CBPA 1QRTA 1GTSA 1IY0A 3F6CA 3GEEA 1WNTA 3F3KA 4OMCA 3S1AA 3UMFA 4C0BA 3EARA 2FLKA 4K3UA 2WF5A 4M38A 1TQHA 2JZOA 4W63A 4Z8XA 5JCJD 3EX7C 3NVKI 3EGWA 3KEMA 2NU9B 3D7RA 1DAIA 4DR4B 4KMOA 1GXSA 7YASA 2O0KA 4YRCA 3W2EA 1BEZA 3Q7RA 3R24A 2IV3A 4ZPJA 1USIA 3LG2A 5B3AA 1E64A 3LLVA 5B1DA 3R44A 1KR2A 3O8QB 1J2RA 4ZP1A 1AXEA 1BS2A 2OL4A 1ND6A 3UAOA 1J4AA 1YJXA 2R79A 4DV0B 3H8WA 3PC3A 4TMYA 1Q7EA 4JJKA 3GRRA 4REQA 3U7JA 1L2TA 3BK1A 5REQA 4A1FA 4LYJA 4V2IA 1E3JA 3ONFA 1PG2A 3R77A 4MUXA 9GPBA 4O2AF 3U60B 1H3FA 2ZE8A 3R1IA 4D9IA 1UEXC 2WT8A 3HYCA 1BG6A 3CT6A 3DXYA 1XLUA 4TL7A 3JQDA 4ZYWA 2JLBA 4AMZA 4DABA 2BUBA 1IM2A 1MCZA 1WULS 4EHIA 5K2OA 1ZGCA 1CW2B 4AN4A 2I7TA 2QPLA 1CV2A 2AN9A 3JWEA 1UR5A 3AEUA 3P20A 4P2BA 3WKCA 2B8EA 1QZTA 1OZAA 4V0KA 2WSSA 4MS3A 2XDWA 5FBVB 2PRZA 4DLKA 4R2IA 3L4SO 5F98A 1YZUA 3W6OA 4RULA 2W90A 3OD5A 2NLOA 3IAFA 4MW9A 3ZD6A 1T6NA 2MCFA 4J4HA 5C32A 2VHCA 2VJNA 3NAGA 1OLUA 3BFVA 3ASUA 4D8YA 1KIMA 5CP8A 5A5VA 4GSKA 1B23P 4A8JC 3ZK8A 2L69A 1UBCA 3GFBA 4ZKEA 1BX3A 2JKVA 1U7HA 3ROQA 1JHYA 4AX8A 1WJGA 3WG9A 5DMHA 1X7WA 2QLLA 3KCQA 2J08A 4WERA 1BMFA 2Y1GA 5LWHA 5MDHA 1CUJA 2JGDA 4ETIA 5IJ9A 2Z9BA 3BH6A 3QUAA 3GL9A 1L4LA 3EC1A 3NJ8A 1D7AA 4INPA 3T4UA 4EF6A 4EHHA 3V55A 1FRQA 3KQKA 3AVOA 3F2VA 1GLGA 3D3EA 4GGPA 4LHVA 3DZCA 3C41J 1CYEA 5FO0A 2JARA 3L0BA 2D2XA 3P0HA 3IAS6 1F2DA 5ALKA 4MRSA 3LVBA 2ODPA 5KDOA 4OHZA 1FNCA 1XAHA 4HAZA 1H5UA 1IIRA 2LIVA 4Q4LA 4Q9IA 4WN9A 4MLZA 4EGQA 4IJMA 1ZL0A 3ZDCA 1DO0A 1J6UA 2ZKIA 1K27A 3D6JA 4M9UA 5DWVA 2R2AA 1I2DA 3GB9A 1IN4A 1EH5A 4WRRA 1WU8A 4F6RA 4ZAWA 1YZVA 4JLOA 2JCBA 3MTIA 4EYOA 3IKVA 3UO8B 3LT0A 2ZRKA 3K92A 3PNPA 1W4LA 5TQ2B 7MHTA 5KINB 1K5DA 1P18A 3LHKA 3EC2A 1OOEA 3OC0A 5CLHA 5D5QA 5TIIA 2QTNA 3NKLA 3K8QA 4UPDA 1IONA 2A67A 1T8PA 1VMEA 2NZVG 3I6IA 3ID6C 1IBCA 3Q72A 1YU9A 1TYBE 1G21A 1XX6A 3NT4A 5GAJA 3HYRA 2CLEB 5T67A 4BGVA 4CL0A 1U6JA 3DBLA 4I9GA 4BE7B 4DIBA 3HU2A 1M66A 3GK3A 5A0TA 1KMQA 1NBWB 1D0VA 1K6XA 1NFRA 3FTQA 1ZCFA 2OHOA 1OFIA 2W11A 3W8FA 3DTVB 5DYNA 5I4CA 3HYNA 5D00A 1VE6A 1PBTA 3UJPA 3NTXA 4AWBA 4UU1A 2VSXA 5JHGB 3RUAA 4Y2QA 4GD3Q 3W5DA 1BX1A 3I09A 3P52A 1GNVA 1I4EB 1VSUA 1O7JA 2OAQ1 1PZXA 2OXCA 4PRLA 1U8UA