3FNIA

Crystal structure of a diflavin flavoprotein a3 (all3895) from nostoc sp., northeast structural genomics consortium target nsr431a
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
154
structure length
154
Chain Sequence
b'KAETSIGVFYVSEYGYSDRLAQAIINGITKTGVGVDVVDLGAAVDLQELRELVGRCTGLVIGMSPAASAASIQGALSTILGSVNEKQAVGIFETGGGDDEPIDPLLSKFRNLGLTTAFPAIRIKQTPTENTYKLCEEAGTDLGQWVTRDRLEHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative diflavin flavoprotein A 3
molecule tags Oxidoreductase
source organism Nostoc sp.
publication title Crystal structure of a diflavin flavoprotein A3 (all3895) from Nostoc sp., Northeast Structural Genomics Consortium Target NsR431A
rcsb
total genus 53
structure length 154
sequence length 154
ec nomenclature ec 1.-.-.-:
pdb deposition date 2008-12-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fniA00
4FGLA 3EYWA 2Q9UA 3N39C 4GI5A 1WSWA 2QR2A 2V5VA 3KEGA 4NLLA 4ZVNA 1AKVA 3ZHOA 4QODA 4CF6A 4QOGA 1OBVA 2OHIA 2R97A 3FNIA 1B1CA 2V5UA 2R96A 3LT5A 1CZHA 5BUCA 4LTDA 4U7GA 1XYVA 1ZWLA 3QE2A 4LA4A 4DIKA 2D5IA 4GQIA 1AKTA 2FAXA 4QOEA 4C0WA 1E5DA 3SVLA 1FLNA 1OFVA 4ZVMA 3TE7A 3JSXA 1DX9A 4QOIA 4YAWA 1KBOA 2OHHA 3HR4A 3N3AC 3ESZA 1FLVA 1RLIA 4U7HA 2AMJA 4YAFA 1XI2A 3OJXA 1I1OA 3B6MA 1CZLA 1FTGA 3FVWA 4HS4A 5FX2A 5F12A 3GFQA 1YOBA 2KLBA 3NHYA 3W77A 3S2YA 4YAOA 4C76A 2QX9A 1OBOA 2QMYA 3KLBA 2KQUA 3GFRA 1XYYA 1J9GA 2Z9DA 1VMEA 3ESXA 2XODA 3NHLA 4FGKA 4QOJA 2FZ5A 3HLYA 4BMOB 6NULA 1RLJA 3UXEA 5ULLA 1YCGA 2MOKA 1CZOA 2WC1A 3G5MA 1FUEA 1BU5A 3NHSA 4OXXA 4ZVLA 4H6PA 3F6RA 3B6KA 5LVAA 1BVYF 2MWMA 2X2OA 3FX2A 1X77A 4ESEA 4YALA 2F1OA 1CZUA 1XT6A 3FW1A 3K20A 1WSBA 2Z9BA 1CZRA 1V4BA 3NFRA 3OX3A 4M0CA 4N65A 4PU0A 3TEMA 4HEQA 1YCHA 1AKUA 3ESYA 3F2VA 4NULA 5B3KA 1YDGA 3N3BC 1TIKA 1AHNA 5JROA 1JA1A 4LTMA 4ZVKA 2M6RA 2BN4A 2QMZA 3K1YA 2ZKIA 4DY4A 5A4KA 5B3LA 2W5UA 1CZNA 5EA2A 4DILA 1AZLA 2HNBA 2QWXA 3W78A 4ICIA 1T5BA 3NHRA 5LBTA 3W79A 2QX6A 2FLVA 1D04A 4CETA 1RCFA 2V9CA 5NLLA 5LMCA 2N1MA 3OWHA 5EMNA 3NLLA 1AKQA 4XDHA 5F51A 2OHJA 1FX1A 5NULA 1J9ZA 3B6JA 3U7RA 2B3DA 1QRDA 2MT9A 4N9QA 4Y7CA 2QX4A 1AMOA 1SQSA 4FX2A 3OX2A 3D7NA 4Y9RA 5TGZA 1C7EA 5LLDA 3F90A 1RTTA 1J9EA 1QHEA 2FDXA 3L9WA 3ES9A 3U7IA 4PTYA 1DXOA 2FCRA 3GFSA 3P0RA 1T0IA 3NHFA 1C7FA 1H69A 3EDOA 2HNAA 3NHKA 1DXQA 3L9XA 4FGJA 2XOEA 2FOXA 2BPOA 2MTBA 4YAUA 1J8QA 2Q62A 2QX8A 2FVXA 2A5LA 1CZKA 2RG1A 3NHUA 3FJOA 3F6SA 3O2NA 3KAPA 3QFRA 1QBGA 2BZSA 3RPEA 1KBQA 2GSWA 2FX2A 4U7FA 5LBUA 2ARKA 3KAQA 2Z9CA 4QOHA 1YCFA 4C0XA 3NHJA 3OVMA 4S24A 2HPVA 3QFCA 5FUQA 5F4BA 1YRHA 3HA2A 4F8YA 5EAIA 4R81A 1FVXA 4YQEA 2FZVA 3R6WA 1D03A 1FLDA 4XDGA 2BF4A 4LTNA 5FA6A 3TZBA 1AKRA 1AG9A 5LJLA 1YKGA 1AKWA 1D4AA 1ZWKA 3W7AA 2M6SA 2Z98A 1NNI1 1ZX1A 4Y9UA 3NHWA 3OJWA 4PTZA 1F4PA 3UXHA 4N82A 1H66A 1GG5A 3OWXA 3NHPA 2BMVA 2OYSA 1FLAA 3LCMA 3OX1A 4LAFA 4C14A 4D02A 4GR9A 5LJIA 1SG0A 2X2PA 4QOFA 4J8PA 3GAMA 4H2DA 4BMPB 1TLLA 3O73A 1QR2A 1JA0A 3B6IA
chains in the Genus database with same CATH superfamily
1SELA 2VPXA 4IHJA 3TQFA 1GPKA 2IYWA 5IT0A 4ZQCB 1F2TB 1VKZA 1PFGA 1NR1A 1RJWA 1M1YE 2NZJA 3IELA 3KWLA 2QUZA 5D8DA 4G5SA 2PX5A 2Y1FA 3QKRA 2H1SA 5FL7A 3T8YA 4EY7A 5C5CA 5JBIA 3WDMA 1KAHA 3AL2A 4YRRA 5IKEA 1XPRA 4I3HA 2R7KA 3MAAC 1PG0A 2B69A 2E4AA 4BWYA 4QECA 2I4IA 1H85A 4Q16A 1OXVA 2VRCD 5DBOA 3RVMA 3A9WA 3BTOA 3A4MA 1VLHA 2FKAA 2ZAGA 4TRRA 1P9NA 3ACBA 3WHLA 2GARA 4LJ9A 4DJDC 2YKGA 3O93A 4OG2A 2K2QB 4BP3A 5TT1A 1ZXLA 1SUIA 1GPYA 2PT6A 4WOKA 1SKUA 2YJ6A 1W8IA 2QX7A 4NABA 3EQ6A 3ETLA 3HDGA 4HNHA 5E4TA 2FX5A 4DSUA 1ML3A 1N2SA 4UD6A 4GDFA 3PFNA 3DVLA 3R44A 2JIMA 3KSBC 1SCUB 2DHQA 1W4BA 3BZWA 3D6MA 9LDTA 2JRLA 3TFOA 3NHSA 4H6PA 4W5OA 3NJRA 2X2OA 4UEJA 3ORYA 3KKPA 2R4TA 4KNWA 4CLRA 3I12A 3HH8A 3C15C 3K20A 2YV4A 4LJYA 4AMUA 3Q7PA 4DGSA 3BL8A 1IVSA 4JOSA 4RJIA 1A7JA 1BE1A 4BV3A 1B2LA 4OK6A 2W43A 2AZMA 4TKUB 5M2QA 1JEEA 1JKJA 1EWTA 4EG5A 4MP6A 1VB3A 3KSMA 3O1JC 1N6IA 2X5XA 3GFGA 2H8KA 1TFRA 3B13B 3AQIA 3EXHC 2WU4A 3LPDA 4GL4A 4TL8A 4X93A 1IXSB 1RP7A 2FVYA 3ZDFA 5LBTA 2IXGA 4CG2A 3W9YA 4B0OA 1FMCA 4DKXA 3CKKA 5IF3A 1EB8A 1EVEA 4X8OA 2CFIA 5DBGA 2YXEA 4X5OA 1U9ZA 2B1QA 1A9OA 1LNZA 2ODWA 1WMDA 4HDAA 1NKVA 3OE7D 3OCXA 3TSCA 2V3CC 2NT4A 3ZWYA 4Z6KA 4NMHA 3U17A 5AVVA 4C7OA 3BUSA 1OWNA 3BC1A 5KOHB 2O3UA 2D2XA 2Z83A 3L05A 4TKLA 1KEUA 1LLFA 2GWRA 5EJEA 1YV9A 1K6XA 2DHCA 2PU5A 4INPA 1OWOA 2Q62A 3JZDA 4RQBA 1KFJB 3D6VA 1ISSA 4G4GA 4YLEA 2RHOA 3WWYA 2QXUA 2Q07A 2WWVD 3LRPA 3DC7A 1TECE 4NC9A 5HMLA 4DAEA 2JGRA 4B4DA 2YQ4A 3VR3D 3OQIA 3S5JA 4G2TA 3B1VA 1KP3A 1TB4A 2VQSA 4JGBA 4OJQA 1UEXC 3VZDA 4B6GA 4KQJA 4FT4A 1E3SA 5CB0A 1NVWQ 3CIFA 1EP9A 3A6HA 1OT3A 1I51A 3BD8A 3LUPA 4DZRA 3S7TA 3EVBA 3TZBA 4DR5B 1AKRA 1W75A 1QCZA 3ELWA 1FDUA 2HFJA 4LECA 4COOA 2WTUA 4MUMA 1XMPA 2DRIA 4PV7A 1IU9A 2NZXA 3DPSA 4Q03A 3DTTA 1JEYA 5H3CA 1Y1LA 3PQ8A 4DTIA 4IUBS 1FFDA 3VR2A 3AEQA 3KQQA 4Z7NB 3GJ6A 4KL8S 2ORWA 1Z6YA 2HK6A 2AIRA 2D74A 4IJKA 2ESRA 3I9JA 4QYXA 1XMOB 2KHZA 3LUFA 3TIXB 3TX6A 2GCPA 3LWBA 1N1MA 1NZFA 3PD7A 5EHGA 1N1GA 2O8FA 3CCBA 3VI3B 1NJ8A 4AJJA 3KPUA 4MQEA 3ZV6A 2BFFB 1DWUA 3QSGA 3DYBA 4J91A 1GKYA 3Q7TA 4RKQA 5DXJA 2HK9A 1TTTA 4EG3A 4KR7A 5AM0A 4KAAA 2C2BA 3J7TA 1Z5WA 3BWCA 4S3MA 3TEFA 3IIKA 1K27A 3P8ZA 2WV9A 2SKEA 1SUAA 1UMBB 4XX0A 5AOAA 2Y0CA 4TQUS 1E7WA 2PCLA 3G13A 1JBQA 1TU3A 1WHSB 3O6VA 1Z8DA 3E05A 4MAAA 1MJNA 5DP1A 2FEMA 2XRYA 4YAOA 2EP8A 2CLSA 3F97A 3PR1A 1UKYA 2QLBA 4GYKA 4MQUA 2ZRAA 3NHLA 4WFQA 3QUAA 4TKVA 3L2OB 1BKSB 1N5RA 3LY5A 4MINA 3RFXA 4C7BA 3OIWA 3ENQA 5A0TA 1RXSA 1B93A 2D5AA 3PFWO 4MS1B 1TTHA 3OHSX 2FFAA 2O57A 1NUHA 5A71A 2PUTA 3NTQA 4BVJA 1TPZA 3OTIA 2SICE 1ENYA 1JLLB 2ISSD 5TPZA 4E2YA 3ER8A 2YOHA 5FHQA 2XMBA 1S8FA 4N7MA 4CUKA 4WN3A 3CG0A 1NR5A 1QO9A 1PJCA 4UAUA 3ZIAD 3JQAD 3AG5A 5TRTA 3IDSA 3NWEA 5FH9A 2IS2A 3RRYA 2ZRFA 2XW6A 1YQWA 3AQ4A 4RPIA 4G1BA 4WJKB 3MA0A 3LF1A 2QM0A 2Q6KA 1Q22A 1HO3A 3O90A 5F2NA 4JWTA 5DJ5A 3IQFA 2D54A 3OQJA 1J21A 1QP0A 3L18A 2FW8A 3BULA 3L8HA 2VZ9A 4HQLA 1JHPA 1EFVB 2GF9A 3GT4A 3LV8A 1CRZA 1L7BA 1PFVA 1JMKC 1QO0A 3GRYA 4OMCA 4RETA 3B85A 3IRUA 4QUJA 1ZVJA 2NZ8A 1NF9A 5K4GA 2IPMA 2YDXA 2ZK7A 5I45A 1E96A 1G8GA 1Z47A 1FYVA 4WNAA 1IUPA 2I1QA 2PMCA 1LCIA 4JA0A 3DKRA 3W34A 4KQKA 1T0IA 3V1KA 3CZ4A 4BO3A 1ZW1A 4MUBA 1WIWA 3W3ZB 3OY2A 1BN7A 5FO1A 3THXB 2PS1A 4KXQA 4ZVOA 4EF6A 1XE3A 4KYVA 5IDWA 4MJLA 4WK4B 2CJPA 3D2LA 1B3BA 5JCZA 4LDQA 3C4JA 2Z5GA 3JQDA 4ASUD 1J39A 2R7MA 3DD1A 4TN5A 4UVGA 3I9KA 4E5PA 3ANSA 4G8JA 4A16A 2Q5QA 3I8XA 1LU9A 3B12A 3TW8A 2I65A 2WFAA 4AO7A 3NHMA 3P9IA 5F73A 1MW9X 1CDOA 4WBXC 1FNCA 1XRRA 2RB4A 5FI0B 4L8GA 3K2EA 1JX6A 2JBHA 4XB6B 2C7QA 3M6AA 3NXSA 2HM7A 3DOOA 3SHWA 3QSYA 1LJUA 1PYGA 4BNKA 4WERA 3VR4H 2FPXA 4GHWA 4HGRA 1CERA 3IV6A 1IBSA 4D3ZA 1QLWA 1E3QA 3KJIA 5KCMA 5E1DA 1PI3A 2A5YB 1Q3HA 4GI2A 1WXFA 3H5NA 1FQOA 2WSLA 1YJXA 5CMLA 1R7RA 2GPTA 1E6WA 1BSVA 1I2BA 1NG1A 3QRWA 4K88A 1SRRA 4LXHA 1XNRB 3E7XA 5BVHA 2IHYA 2GHQA 1M2OA 3C14C 8LDHA 3QOWA 3VR1A 5AVRA 2PSEA 4A15A 4XGIA 2GXQA 1XTIA 2ZWAA 3AZPA 2DTEA 3RBZA 1OXSC 1Z2OX 2JF0A 1KJQA 5K0SA 1YDHA 3D31A 1QIIA 3ZHTA 4EPTA 1Q7TA 1Z9BA 4KJZA 3SSMA 1HYQA 5CIQA 4PLTA 3FDXA 1J2YA 1TC1A 4A6DA 1WXXA 3O95A 2ZYRA 4KBYA 1GPJA 4ND8B 2ATCA 3TF5A 2OESA 4TLCA 4QPPA 2VWHA 4V0NA 2B0JA 5AM1A 5A5EA 1J6UA 1LPPA 2WR8A 3V4FA 3TE7A 3OKAA 3GELA 3FMPB 4YP6A 1A4UA 1ONSA 1ZL0A 3N9IA 3U31A 3IIMA 3ZHCA 2YRFA 4ZCIA 3L1HA 1Q74A 4RA9A 4Z54A 2C54A 4UMEA 2REOA 3OT5A 2I8LA 5FLYA 3QYAA 3KPVA 4U00A 5E0OA 3H1PA 1NRIA 2FRDA 1AXRA 2VYVD 3M4NA 1UH5A 5ALOA 1Y8CA 1CY6A 3EGCA 4P7JA 5ALIA 4C87A 4L4UA 4HX2A 3OPQA 1OC2A 1WPQA 1LQUA 4XCVA 5IC5A 2RH5A 4B7ZA 3BEOA 1XZKA 3BKXA 3P32A 3AT1A 3W0LB 4CRWB 3OJLA 1F7UA 3K0EA 4AVYA 1ML4A 5FULA 1Y3DE 5HQJA 4B09A 2XDYA 4RJLA 3CQ9A 3KDAA 3ETNA 1D0IA 2NSYA 2VZ8A 4V1CB 4I1YA 3MWKA 2P79A 2QE6A 3X1ZA 4B74A 4RNCA 5CFLA 4PAOA 4Q4HA 2EXXA 1Y4AE 3UUGA 2PZFA 3KJXA 3SNKA 4W7SA 2VTBB 4Z4FA 1BOOA 1I0ZA 4YYEA 2JHCA 1ODKA 3H4TA 2H0QA 1CEYA 3ZKWB 1QVVA 4M1OA 1TE2A 4QLBA 5AK3A 4YT8A 1X3SA 5BWBA 4C07A 3NDIA 2QX6A 2ZJ8A 2Q8NA 3AEKB 4CETA 2ZU6A 1DKRA 5F51A 1AF7A 1BOFA 1N36B 4DDVA 5JJ5A 2JLAA 1E89A 4OMUA 1ZZGA 4GUDA 1RT9A 2FEXA 3MQFA 2ZB7A 4KWEA 4WAUA 4UUBA 3PEYA 3VR6D 1OXTA 1P44A 1XVIA 2NUPB 1I14A 2X1MA 2J3MA 3QBJA 4LCBA 1BNCA 3OP1A 4MA0A 5FYDA 5BUQA 2RD2A 3NVDA 3OZXA 4M9UA 1GFIA 2SCUB 3GNTA 4RKEA 1GNLA 1I9CA 3GD7A 4PYJA 2F3RA 3BYZA 2HMSA 4K9MA 1DDGA 1IOZA 5EE3A 3EH1A 5GV7A 1AUQA 1N7GA 2GAAA 1VQ1A 3GJ8A 1IAVA 3FZGA 4HI0E 3UPUA 4ZMBA 3JQ9A 2NPIA 2CGEA 3VHLB 4JHLA 3AF0A 5CH3A 4C6TB 1U0EA 4PZPA 2W11A 2A4MA 1RLUA 2B8NA 3ZDZB 2CV1A 3PQEA 2EBFX 3F6PA 2DUUA 3FNRA 5KX5A 3VOAA 3VPGA 3ISTA 5HILA 1L1FA 3VHRA 4CU5A 1CY8A 3E4DA 3QMMA 3U9SA 2TRSB 3T3MB 5T8KC 3FKSA 4PIPA 5JAHA 3DCNA 1P1RA 1TO2E 1X86B 1ZJJA 1OLSB 1ZD9A 3PU6A 3PKIA 3B36A 1NP3A 2JIDA 3BF8A 2X0EA 2ATVA 2OYCA 3UMJA 3EUFA 1WXGA 2MSWA 4O4IB 5EXTA 1JHQA 1CY7A 4AS2A 1LBIA 1OVGA 5DCYA 3G89A 2G5TA 3H11B 3Q0EA 4L74A 3OP4A 3LLSA 5CDTA 4TMKA 1UPBA 1A27A 2YTZA 3LDUA 4GPIB 3TOXA 1I2CA 4FYYA 2B9VA 3IMKA 4O3MA 3UPDA 4N3NA 2EGGA 2J9FB 5IZ4A 4MDYA 4M1ZA 4PPQA 2CLFB 2HA7A 3UXMA 2BUBA 1PZMA 2AI2A 2N46A 3HJTA 3QOXA 2ZBUA 4JROA 2CB0A 1EDDA 3AI2A 3Q5EA 1OVMA 4PX3A 1U2GC 3M4JA 5LNK1 4K28A 1DX9A 2E4VA 5AI5A 1J0EA 4KFUA 3W7BA 5FI5A 3HP7A 1IB6A 5EN4A 6ADHA 1A77A 1MB0A 1R18A 5K8JB 1H8EA 1RD4A 4KK4A 1QCDA 1JR4A 4MUAA 4RS3A 5C4IA 5JAMA 5CBPB 2PD3A 4GWLA 2ILVA 4UOQA 1TCAA 3SS8A 3N7TA 4QSHA 3V1TC 4BU1A 5ITZA 3V6LA 1D6SA 4C01A 2RSLA 3UMRA 1XZLA 2AKAB 2W37A 3WIDA 2DPGA 3NM4A 3BFPA 2J07A 1X0VA 2Q8PA 4R9SA 3O8LA 3GLFB 2XQKA 2XZOA 1L3CA 3LCCA 1T6BY 3ND8A 3F5SA 1L4BA 3SIXA 1DFHA 4B17A 1H2WA 3C3MA 4QPCA 3EC1A 5ERGB 4QARA 2E6KA 1E7MA 1G60A 2X8LA 1W6UA 5L3SA 1G8YA 2QJFA 3IP6A 5A6SB 4LNUB 1PR3A 1G7TA 2R1VB 2Q9BA 2QQGA 3D7LA 3TLGA 4F92B 3G23A 2F3TA 3LI2A 5L3ZA 5B1YA 4OGFA 3DKIA 3PF9A 1DAGA 1G3RA 3TL6A 7GPBA 2V1UA 2VKQA 4WD3A 4MVJI 1EHYA 5G0WA 2VJBA 2CK3D 2WT8A 3TKYA 4E1VA 2GFIA 2DTXA 4KXLA 2PO7A 5KSPA 5FFMA 2DPYA 3PP8A 5SZKB 2AX3A 3EXIB 3A3YA 2WWGA 2C9MA 2JKVA 4GSLA 3P0RA 1C30A 5LYYA 2N42A 1DAIA 2HNAA 5K0LA 1VJDA 3WRVA 2DBYA 3R0XA 1I2AA 4QFBA 4RW0A 3CN7A 2ECOA 2PM8A 1ZSYA 4LX0A 5EE5B 3ICWA 4KXMA 4ZV7A 1OH5A 1STOA 4TKZA 3RVBA 1E2JA 3HADA 2BLNA 4EPVA 4EP1A 1E4OA 1OYOA 2AEEA 3I9MA 4G4JA 4WI1A 2JRCA 4H7EA 4DA4A 4OBEA 4HZUA 3LK6A 3A2KA 1Z4MA 2A78A 4TWAA 2WSMA 4TM8A 2OPBA 4OXQA 2D2FA 3L1IA 4G89A 3L40A 5JALA 3UMVA 6LDHA 5C8YA 5AK6A 5DFAA 5SYAA 1R6VA 1Z4LA 2BMAA 4RF5A 1ZOLA 4TLEA 4QQRA 3D3WB 2F3QA 3DO5A 3RVNA 3KX2A 4HQKA 5KBYA 1YONA 3LFTA 4AY5A 7ADHA 2DF8A 1YNSA 4X24A 4XQ9A 2Z4TA 2IS4A 1KDRA 3H83A 1KAQA 4TMYA 1PR5A 1Y80A 2NXEA 2JGLA 4UNRA 4S12A 2HL6A 3G2LA 3JQ8B 2BFBA 2J48A 3O73A 3DE0X 3B6IA 3PFIA 3UJ6A 1N3LA 2C04A 2FQXA 4GI5A 2GM5A 4I66A 3RVRA 3UF0A 2CFTA 3ZTYA 3T3OA 1I5OA 2XWBF 1QG2A 3EGVA 1C4OA 1DQRA 4FNOA 4HUQA 2DB3A 1H1LB 3VPFA 3GL9A 1AZTA 4UXHA 4HF7A 3SR4A 3QE0A 3FF4A 1DARA 2CK3A 3ZGYA 2OG2A 1MB3A 4M2LA 3S1LA 4EB6A 4WRRA 4QUKA 3OLWA 3KQLA 1PP4A 3TW0A 4YAWA 2VDWA 5B12A 1YUMA 2IIBA 1KO8A 2L42A 4HCJA 1OC4A 4H6XA 1KY4A 1ZLXA 2QMEA 3SR3A 3WIOA 4DANA 2FPRA 2ZDQA 1I8TA 3BXHA 3W5IA 9ATCA 1D4ZA 4FBMA 1P3JA 4FR2A 1A71A 1J9GA 1Y3CE 1AD2A 1MGOA 1MMFB 2VJYA 2Y8EA 1MJGA 4KDEA 3G9QA 5CH8A 1K97A 1MFZA 1NKTA 1XXHA 2DT8A 2HC9A 4I4IA 3CO5A 4O59O 2G1AA 3EGXB 1RYMA 3F1KA 1C7ZA 4EEKA 2XYHA 2GF0A 1Z5GA 2REBA 1V4VA 3HB9A 3R6GA 1CQWA 1KH3A 1HT3A 1N5IA 1RCUA 1V26A 1FYDA 1HI9A 3AP1A 4I4LA 3JAKA 1ZK0A 3EQ9A 3PWKA 2WV7A 3K73O 3DHEA 5J1TB 5JG7A 3T7DA 4AI6A 1JYSA 2QTAA 3JWHA 2Y1KA 4ALIA 4CDMA 1GL3A 1ZP6A 4HNUA 2GEUA 5JSZB 5JJKA 2YINC 4ABTA 2QTWB 4LJKA 1EG7A 2QMZA 3NT2A 5F3DA 1L4FA 3V55A 1W36C 4CQMD 3VDMA 2VDMB 1U1IA 3MS7A 2PRYA 2P35A 3MD9A 3NHRA 3PENA 4Q21A 3JZIA 1ATZA 2ZYHA 3LJKA 4P38A 3WSVA 3ZY4A 4G9EA 5NULA 3FXAA 2ZVDA 4M9CA 4RFVA 1P33A 5JSYA 4ZC1A 4Y2GA 4WJZA 4AG5A 5K09A 1H6DA 3Q87B 1BWRA 4ZYVA 5KOIA 1AA9A 2J3JA 2X0JA 2VNHA 5D5PA 5A5GA 1VJ1A 2HBQA 1J20A 3IDZA 1WUIS 1XLWA 2XVXA 3WGUA 3AWIA 3RIHA 4BASA 3WWDA 2FOIA 4FGJA 3TTTA 4DUGD 3COYA 3JQRA 1OHHD 3M6LA 1P4JA 2ANBA 3HVUA 3FUCA 3IQWA 3O0TA 4IOLA 2QPAA 1K3FA 1LK7A 3FJYA 1CF9A 3M6XA 2QM7A 3O3MB 3T7RA 4BQSA 1GZDA 1SXPA 2JI4A 2BJWA 5FBLB 2ZFUA 1JALA 3KU1A 1ADFA 1MN6A 2IEDA 3AEKA 3A4TA 4YJFA 3ND7A 2HCBA 1R4MB 3GLVA 3GYBA 3LYLA 4K3VA 3EVGA 2QGNA 1KZ7B 3E1GA 4OVKA 4RDHA 2ERXA 3AH8A 3KSZO 1U9CA 3IAXA 5JADA 2H2IA 3UKJA 1T5DX 1EIWA 3PVZA 4OJYA 3MGBA 1QQAA 5T3UA 2DC1A 3CGGA 4PO9A 1AKWA 4BGUA 1E9CA 1C9MA 3HY6A 1G41A 1NQVA 2GXUA 4MQEB 3S4YA 4AYXA 2J3DA 1NQ5A 3DVQX 2RHBA 5KX5F 3CPSA 3IPAA 2P3OA 3PA8A 2O06A 4CMHA 4DC0A 2CJWB 3G2MA 3KPWA 2GK4A 2OPHA 5JW6A 3ENNA 5DGHA 4QELA 1ZVQA 5CB6A 3DVAA 4EWLA 3AUJB 1CS0B 2VDPB 4ZREA 2BFCB 2ZUBA 3OM1A 1GILA 3CEJA 3H5LA 3HYLA 4GH5A 4E3WA 1J0AA 4BVLA 3QLEA 3AC0A 4ZICA 2WSBA 1FYEA 2O0HA 1YS9A 2JGFA 2QR2A 1X74A 1E32A 2RI6A 2W2QA 1AKVA 1JQDA 3KEGA 3LH5A 3NM5A 4LRYA 4OI2A 2XB8A 4X44A 3T0FA 1PJZA 3VPHA 4LQDA 5HIKA 4KV7A 3MYYA 3KETA 3UAWA 5IBCA 4DNPA 2WWIA 2ZJFA 2QXTA 4U7WA 1Q0UA 2VUUA 1CKEA 1GPUA 1I2ZA 2JD2A 2QVLA 2J5XA 3H17A 1PN3A 3IT1A 1UJ5A 4O2LA 5HEKA 1DAMA 5B55A 2BP7A 4MI3A 4U7PB 4D4MA 2RGBA 3STHA 3P20A 3MW8A 1P0MA 1QGAA 2CHFA 4EF5A 2I67A 4BMDA 3M1YA 5D3QA 5EY5B 5FRDA 4LMRA 1XMVA 3P97A 3TR5A 4S05A 4GKVA 3RJ5A 3DBVO 5GGXA 3KV3O 3KXPA 1Q7RA 4X97A 3ENVA 1A98A 2O3QA 5JD6A 2W6ZA 4UBMA 2ETVA 4DVGA 3KKOA 2DMRA 1UBNA 1XAGA 4M6WA 2EERA 2V59A 4RMGA 3WLNA 4NAUA 1UADA 3TYXA 1Z2NX 1F0KA 4I1UA 4OX9B 4ESEA 1HFWA 3W8RA 3SAJA 4TGLA 1U99A 1JVNA 1Q1ZA 3DZ8A 3B82A 4FYKA 4CN8A 4CIWA 2HLPA 4E2XA 5I8WA 2E5FA 4C4SA 3KE9A 3KHSA 4GXNA 1DAHA 4N9WA 4PY2A 1NI3A 4ZOQI 3VR0A 3OY7A 5BV8A 1F20A 1FTQA 2WHRA 1FY2A 1K0FA 3HBLA 1GRRA 3QJ5A 4TL9A 2IYPA 3NMUF 1B43A 3OCUA 3DW1X 3H9GA 2FWAA 1PJ3A 4OUDB 4Z9XA 3FHCB 3SMQA 1NF3A 1W96A 2O9JA 5HX7A 4L16A 1XF9A 4B46A 2P9EA 1EXDA 2H51A 2VJCA 2XTAA 2BCJQ 3TL2A 3MT9A 1F14A 5DPMA 4QO7A 5CYFA 3EQ8A 4ARAA 3F6EX 2OFPA 1BVHA 4G23A 1Q6YA 1SC9A 4PLYA 4E94A 4B44A 5C1DA 2IUTA 4U7DA 4Y0VA 3PSAA 3FMOB 4FIZA 3P9PA 2WK1A 1NP7A 3UICA 5M04A 1U98A 2V7XA 1XCMA 2ZT5A 3DFMA 4F85A 3IT2A 3OKCA 4UE2A 1PWEA 2RHWA 2VK4A 1UMKA 2IZZA 5TQVA 3FCCA 4EG4A 4FHZA 1QQ6A 5M3BA 4RZXA 3GQVA 1ODJA 3MBIA 4PLCA 3K2IA 5COBA 5DHPA 3RC7A 1FX0B 2PX3A 3QV2A 5IBPA 2IW1A 2ZYGA 3GPIA 1OFGA 1ADCA 2NXNA 4F6RA 1JWLA 3GC6A 4L51A 4LF9B 3L84A 3Q9NA 1F8UA 2JLZA 5IJ0A 5J2TF 5BOSA 2ON6A 3P9RA 4PC7A 4I8DA 4MK4A 1QTQA 2Q3HA 2F8LA 3O91A 1L4LA 2O50A 3IVGA 4NZZA 3T1QA 1JXOA 1TMKA 2FYTA 2WZBA 2YYSA 4V1CI 1ULTA 4IMPA 2AQKA 2GJ8A 5DSZA 3G2NA 5FYQA 5ALXA 2B30A 3HJAA 3SHFA 4B3DA 3U6KA 4HR7A 1PV2A 4NBNA 1N4AA 4MKIA 4MV0A 4JL5A 4E5NA 1U2EA 1MJGM 4PPGA 2CD9A 2AYXA 2ZYIA 1K9SA 4IHJF 3WLJA 4CGYA 2ZJZA 2O3JA 2JANA 1TEHA 1J56A 2CHQA 3LLMA 3OQMA 4Q4AB 1GCIA 2YYYA 2HJ9A 3THYB 1W88A 2R6HA 3ZN2A 3MJRA 1IQUA 1GPBA 3DGFC 4LV8B 1GXSA 3TQRA 3G6WA 3TXYA 1WMFA 3DTVB 4H3KB 6CHYA 3BMOA 4KPUB 4B1FA 4ZV9A 3L7NA 4EHJA 5CDSA 4LI0A 2C0PA 1EQ2A 1DX4A 1LTQA 1VI6A 5EPOA 4LXTA 3OLXA 1JLLA 4H18A 2OZPA 4RELA 3ZGOA 1AK9A 1R6XA 3EBLA 2AZXA 1OIWA 2H1RA 2Z43A 1IL0A 1QXSA 1Y7HA 2VG8A 1OTXA 1QH0A 1UKCA 1BJTA 1B41A 2BONA 3P5SA 4KWIA 2UZ4A 2CF5A 3N7AA 2V7GA 2J45A 4KE8A 1W59A 3H6KA 4LWQA 1E1YA 3KT8A 2GEDA 2W2KA 1B0AA 5TMBA 1YA6A 1M74A 2F1RA 5GJVC 5FWNA 5JI2E 1EWYA 4DQLA 3WBJA 2C4TA 2Y9PB 1RABA 2P2LA 4QLAA 1NQAO 4HLNA 3QE4A 4N0PA 1F5SA 1OR8A 2XEXA 3WK6A 2E9SA 1QIJA 2JK1A 4GRIA 2QVXX 1NI4A 3CZRA 4WACA 3Q8WA 3UYLA 3CE6A 4MW5A 1R4ZA 4WNIA 3VBCA 3WBKA 2O54A 2B4AA 4MKGA 1JJAA 2Q2VA 1VZ3A 4D56A 1SVOA 5CK5A 4RH3A 1UMDA 4YCCA 1W73A 1V2GA 1TUEA 3Q9LA 2ZUFA 4FWBA 2B2XA 2XMPA 3LSTA 4U2EA 1ADYA 3ZHVA 1ESCA 3L4SO 1CEQA 3BH7A 4UATA 4J2HA 1Y6RA 4TT3A 3M6UA 3I4FA 4CM8B 3U3OA 3WLOA 1QFZA 2WQZA 3I8SA 5K3OA 5HW0A 2P6PA 2VJNA 4IZHA 4UBNA 3AYZB 3DUFA 3OLYA 4IXWA 2CDCA 4M1YA 4ZI7B 1EA5A 1OMOA 3IOYA 4JT8A 5K2MA 4ZP1A 4Y2UA 1YRQA 3AVPA 1DIAA 4JEIA 1QUEA 1H2RS 1EX1A 3RYFB 2BM8A 1BJKA 4KGXA 5CNJA 4R1SA 2CXRA 2QD1A 4DN6A 1G59A 1L4EA 2A5LA 2RCYA 3ZDEA 1G5IA 1OFHA 4HADA 3MRXA 3ZDCA 1OI7A 4KPYA 2DWUA 4WZAE 4C29A 3PE6A 2XWPA 4Y2RA 3Q72A 2DM6A 1VL5A 3E70C 3A1WA 4IYRA 3IUYA 5LP6F 4YDHB 3H84A 2VT7A 4FOOA 4B6SA 2LV8A 3T7JA 4IH4A 5G0TA 1U0GA 2G36A 4O4LF 4MYTA 2HSEA 3MVEA 1WUHS 2Z98A 2AN3A 3ICEA 2BEVA 1JDUA 3RJMA 3GPDG 3PHCA 4MS4A 3WVNA 1XRLA 5KVAA 3DUWA 1ZN7A 3OX1A 4OXIA 2YWJA 3C87A 5EQFA 5JXGA 3MJFA 3ADKA 3MWDA 4GW3A 1W0CA 4H2DA 5L7YA 2JW5A 3RRNA 3UV7A 1X9IA 4DQDA 5DTJA 1P8JA 4MCJA 4RF3A 5ENVA 3KSRA 5SZIA 2JFXA 3NIWA 3O2SB 2H2FA 2VJMB 2OO3A 4H1UA 1Y1QA 1BVRA 3WBBA 5L9AA 1JFSA 4R7ZA 4QASA 1IBMB 3BXOA 4G0NA 4OFBA 4AJLA 1SCNE 4PW0A 1N8NA 1Z7BA 2A35A 3KU4A 3PDIA 3Q4GA 1WQ1R 2AN4A 2O7VA 1CQZA 1DBVO 1EVJA 3MMSA 4L6AA 4B33A 4D6XA 4EVIA 1IJKA 2AWNA 3FGZA 3L3BA 4WXHA 1E0KA 3VGPA 1YVDA 3AF2A 1E2DA 1U0NA 3DAOA 1KJ8A 4L9AA 3Q3EA 2WIAA 3MB8A 3FE2A 3UHFA 3BGWA 3KLNA 3GLFA 4YMUA 2FMKA 1OFUA 2V0GA 2A84A 4RQAA 4HDSA 5TDHA 2IHVA 4OM7A 2EKZA 4PZZA 1W29A 4NENA 4YUXA 1T9ZA 2OD7A 5JWRA 4XW2A 1H2AS 1I2MA 2C2HA 2Q4DA 4BNHA 1F1JA 5KSWB 2EG9A 3EAFA 3QVWA 3H2GA 4PWZA 3SYNA 5AW3A 1YCGA 4QT4A 2HHLA 1U0RA 1K88A 4K46A 1SUWA 4HYYA 4DAOA 1UZUA 3V1YA 3HWX1 2QV0A 3R09A 4IEEA 3VXKA 2MSNA 4DB2A 4BXOB 1FP7A 3AJ9A 1YK0A 2RMKA 4XDYA 2LBPA 3D81A 3EFHA 4PZ9A 1CZUA 1PTKA 2KYRA 2YIDA 1R3UA 2VF5X 5FTLA 3WLIA 1NW4A 5KWJA 2I5PO 1AKUA 2WWRA 1EFHA 3P9CA 1KR5A 1ZOPA 4BOYA 1E18A 1ZVVA 2NUTB 3I1IA 4CL8A 3CTPA 2QRQA 5JZVA 1O08A 4FYPA 3HN2A 3IEUA 4BRSA 4F56A 5C8YB 1X1SA 3AILA 3SOPA 1SHUX 2EQ5A 4D3XA 5C1PA 4FX5A 1L5RA 3LKZA 3QLJA 2XJ4A 4GVLA 5LPNA 2AC2A 1B8UA 4EDFA 3P9QA 2HIMA 2OHFA 2Z1DA 4JVMA 4QUHA 3W9BA 5LYJB 3EOBI 4HGZA 1ZIOA 2ONKA 5FPYA 4MULA 3RWBA 3MGAA 5TGZA 1J90A 1MT0A 1G20B 3AEZA 1QWSA 4NPCA 1TKCA 4R51A 4HNVA 1J2RA 4DV2B 1SXJD 1J9EA 2CY0A 3JSAA 4Q1AA 4M87A 4QPZA 2FWBA 2WB4A 3DE3X 3H16A 5E7QA 2D5LA 4CI9A 1MA3A 3EARA 3L0OA 1XV5A 3Q98A 1WBDA 4DCMA 4D0NA 3C1OA 2XZPA 1WCV1 2Y6UA 5C52B 3ONFA 1UQTA 1BFDA 1FXSA 1WB9A 3VPSA 3L1UA 4ETMA 3QEBZ 2CXTA 2PS0A 2W6QA 4D9HA 5KNDA 2GYWA 4JSRA 4OA8A 1CQIA 3TZLA 2DVMA 3WGQA 1M6VB 2O7RA 3FSRA 4PEVA 5J23A 4QYMA 5A5DA 2PKEA 3CKYA 2C3MA 4EG8A 4N49A 3L04A 3NBYC 3OZDA 3DH0A 5EXSA 1E2EA 1T5SA 1VL6A 2FZVA 2PSDA 4HWRA 1AKYA 3BE5A 2C98A 2NU8B 3T9EA 1UBMS 2JJQA 5I8PA 3VDNB 2ZYDA 1VFPA 4JXJA 3K4PA 5GJCA 1TAGA 3SX2A 3WS7A 1WVGA 3UXHA 4BNGA 5TXGA 2P9ZA 3Q41A 1REQB 3HWRA 2B83A 4JJ6A 1LBSA 3JD1A 5COQA 1KYZA 5FPHA 2DJ5A 4KMRA 4OQEA 2QAGC 4RK0A 5E4FA 4ZCQA 3IJ5A 1QV6A 1XDSA 1C9KA 2PKQO 4M1SA 4Q1FA 5SICE 5GJBA 4PCVA 4RJKA 2PXXA 1T2CA 2QN8A 4GBED 3KJHA 4IEIA 3OZSA 5B58C 1Y4UA 3CLSC 3GRUA 4DWOA 3FDZB 4DXAA 1JDBB 1TM7E 3N2ZB 2AVDA 3BA6A 1BE6A 2BHNA 4PHGA 3I1JA 1TRKA 4QUBA 3ZTTA 4HWTA 4KBGA 2Q1SA 1UEIA 2HCRA 1K89A 2IELA 4HQRA 5KNCD 3KLMX 1MZPA 1LH0A 1N4DA 1PJAA 1WJGA 3C3PA 3EDQA 1JIIA 5JJCA 3B1JA 5CDGA 3GIDA 2GYUA 2RONA 5HIAA 3FCYA 4F9TA 2R62A 1EVKA 1XDBA 1XU9A 3KR1A 5KVSA 4X62B 2EZ8A 1XTRA 1D2AA 1BEEA 1Z22A 3JPWA 5DV9A 3V8NA 3IBSA 2EYQA 3TLEA 2H1IA 3R3UA 5F5NA 3SKYA 2H54A 5JSZA 1H5NA 3DUFB 4RM2A 3N8DA 3MJDA 3U3XA 1I94B 2R25B 1SKAA 2O8DA 4FXOA 1HKUA 5K3BA 3I2KA 3WK7A 4CI0B 1CRQA 1BRMA 1L5VA 1RJ9B 4AJ2A 3NDPA 2AOTA 5IT9A 3U4DA 1NSYA 4MMZB 2BFEA 5K8UA 5L3QB 4L27A 5KNLA 4UNNA 2D0OB 1JMYA 1ODIA 2IP2A 3RQIA 4PN3A 3KOUA 4X45A 1PWXA 4JFAA 3NDRA 2PZGA 2HLDA 1OAKA 2NU7A 1A2BA 2VRBA 2YHUA 3DZBA 4X60A 2GKOA 4UHCA 5EYPB 3VVMA 3ZUGA 2XUIA 1RWVA 1P4RA 3FHOA 5C80A 1ZK1A 4Z1MA 4FNAA 1NY5A 4A8HA 1BH6A 1QLJA 2Z8XA 3CSUA 1DADA 4HLDA 3FPCA 1GTRA 3AUSA 2VQFB 3QEMA 2B8EA 3V1NA 4EKEA 4XYEA 4C3ZA 5EEHA 5JT1A 1G8AA 4NG4A 2C0QA 3VZPA 4AY3A 1R5JA 1SXJE 2Y77A 3CT4A 3EDMA 1BX1A 1XKTA 3DB1A 2FUKA 1MOZA 4KMOA 4MDEA 2AFHE 3DEKA 3V8QA 2O6HA 1FPMA 1YRBA 3WRXA 1VHLA 5K0BA 3INGA 2WU0A 1U7OA 2YJTD 3CRQA 1DJQA 1PV1A 2A9KA 4M98A 1YD7A 1HM5A 2DCMA 5FD8A 3M1IA 2RAUA 3AESB 1KZ4A 4QTYA 4TMXA 5HVNA 3VNAA 4P7GA 2W2VA 2XYVA 3H2BA 4O3FA 3D5TA 2VT2A 3D6NB 4RD2A 4XOIA 1N2CE 1OSNA 4JDPA 2CUNA 4LBYA 4F5ZA 5ELXA 3QXCA 3K0AB 1I1HA 4YN3A 5IXJA 1G3IA 2HIHA 5JVDB 1ZG3A 4QRIA 5T4BA 4BMSA 3BMCA 4MCHA 1PLLA 1X87A 1P2SA 3L7CA 3PK0A 4N54A 1AZSC 1PEDA 3CLHA 4MW1A 4PHTA 4WQMA 3U4GA 4HNSA 1EESA 1RM0A 4OQQA 4W8HA 2WRZA 1YGYA 2HZ7A 4RNDB 3AFIA 5HZKA 3ZCUA 3G49A 1E2IA 2E48A 2NADA 1KYVA 3NATA 2YW2A 4IFIA 1SG9A 5KI6A 1HZZA 3D64A 3CUKA 2EW1A 4GZLA 4UQPA 1KAEA 4LXQA 5BT8A 1HK7A 2GX6A 2XYPA 5BV1A 1AT1A 1AC5A 2BFWA 3NEYA 3C3AA 5KQPA 4INAA 1ISGA 1OBFO 1R5BA 5CT9A 5B7PA 1PQUA 5IUKC 3IQDB 2P9TA 1VFNA 1RP1A 2VDVE 4GECA 2ZE5A 3JWEA 1R9GA 4I3GA 1DLIA 1IVNA 4ALLA 1EDZA 1XNGA 3AB8A 4J1NA 3ZU3A 3N39C 4RVCA 4KRXA 1WSWA 4HMQA 2YCLA 1Q92A 2IDJA 2WLSA 2XNKA 3OJOA 5I9SA 4URXR 1TGYA 2DHDA 5LYJF 4HD8A 1JHRA 5IYZA 3RTCA 1H3FA 1LS6A 1PO7A 5JCPA 2E1RA 4JLAA 1UJMA 1MC5A 1DX6A 1RPTA 2XCTB 1E0JA 3GZ4A 5H70A 2CL7X 5AM2A 4RUKA 4OBBA 2NU9B 3KLPX 4UOZA 1CSEE 2PX4A 1YOVB 2QZJA 3TE6A 2GO1A 2O7SA 1NQTA 1XO1A 1NRXA 2WWWA 4J0KA 2ZSUA 4I1SA 3KALA 5D6OA 3ROMA 3PTLA 2ZJAA 3TOVA 4YYZA 2I4MA 2G04A 4V0QA 3CX7A 1WF3A 1ZM9A 3H7AA 2Q49A 2GR9A 1Y8QB 3NKLA 3DDHA 4OLJA 3SU8A 2HSDA 4GRDA 2AJBA 2QTVB 1B73A 4PNZA 3AO0B 2HRDA 1YJAA 3EODA 5JPIA 3RHFA 1JKXA 1MB9A 2VUSA 3WTCA 1SCKA 2GLXA 1C7JA 5DNYB 4A0SA 1VMDA 1Z2AA 2P40A 4YEDA 3TN7A 4S1WA 2B4KA 4YALA 2H7YA 1YAHA 4DJEC 4DJTA 1JAXA 5B3KA 1NV9A 2P2GA 1PFUA 2BFAA 2X4GA 2O2IA 5FL7D 4BX0A 2IUEA 4CEJB 1YR6A 2EIXA 2IK8A 3ZG6A 4RFLA 1BHQ1 4R8KA 3K09C 3ZYCA 4IBOA 4JLNA 4DIOA 1M1NA 1ZIPA 3I0ZA 3W78A 3DPIA 3WKCA 4HGQA 3H2SA 4YT4A 1PNOA 2QU8A 2OXEA 1TJYA 3OI7A 3AIMA 4UTXA 4Z2YA 5IANA 1UUFA 3FRJA 1T4CA 2PWBA 1GU1A 1ZUD1 1RMTA 3GXOA 4MS4B 1N1EA 3E84A 3PX2A 3TLXA 3VR6H 3AR5A 3UK0A 5H83A 4FNMA 2I2BA 1L5WA 2NYAA 4W63A 4M9SA 1TYAE 4ZT4A 1DXQA 3FPHA 2BPOA 3JR3A 4TUYA 4EPRA 5CPFA 1KZHA 3RT7A 5IH7A 2ZZMA 1BMDA 1ZVMA 2VAMA 1SEPA 1PWYE 2WZCA 3A37A 3LBAA 4JL8A 1KO5A 2IJGX 4ZAFA 4BQQA 4B40A 3U4QB 1KBQA 3BXGA 4CEIB 2B8TA 1HQCA 2IITA 4ZQFA 1T3HA 4AJ1A 2LD4A 3PZBA 1O0CA 1YDMA 5CR9A 5GIPE 2J6BA 4GBMA 5KVVA 1KQFA 2ODBA 2H2WA 3GLSA 1WCIA 5K4AA 3ZWQA 2DH6A 2F59A 3IHLA 2W6MA 4MUGA 2UDPA 2I4LA 1E1DA 1R88A 3NR2A 2FEPA 1ZMTA 2ZXEA 4CF7A 1LLQA 4EB8A 4NDZA 2G1UA 3EF1A 1KI6A 4RLFA 4X3CA 3DTVA 2P5SA 5B1EA 1CRWG 4MLPA 3AUYA 4ZYTA 5IMSA 1DELA 2OCAA 2WW8A 1R0BA 3QTTA 1TVKB 5H8WA 1SIOA 2PSJA 3HXTA 2XB9A 2A9FA 2DR3A 4I55F 4A8JC 2Y27A 3CVUA 3LCMA 4RL4A 1LJ8A 3GROA 3VC1A 4Q1CA 3BFXA 3KFVA 3DZIA 2OL4A 2H5EA 1CUUA 5IWCA 3SHVA 4V38A 1HQDA 1QRRA 1Q0RA 1QE3A 1XZIA 1V9LA 2HJVA 2NVUA 3MXTA 4GX0A 3BIJA 3RKSA 3ND5A 1NMZA 3I2YX 2C4VA 3T1OA 3M34A 2BT4A 4HP8A 3N76A 2R751 1DKNA 3UWSA 4KYUA 3LTNC 1NW8A 3H2YA 3P9XA 3N8IA 3ZDYB 4HNQA 5A7HA 2H6EA 1KEVA 4NENB 1JGTA 2ZIEA 4DCVA 1VCNA 3NX4A 2RHGB 2OD2A 3M6WA 1XQ6A 1Y3FE 1TL7C 4XCXA 4X71A 1A9ZA 1GU0A 1FLVA 3IDAA 4JBIA 4WXPA 3W6OA 4ME6A 2HTEA 4DPMA 3GT7A 2DWQA 4UCWA 5AWFC 3W6NA 1HQKA 3I42A 3QH4A 4RMJA 2PAFA 2AX4A 1RWPA 1F7VA 3MT7A 3P2JA 4ZN6A 2A3NA 1WWKA 3DCYA 5BSUA 3TW4A 1W30A 2DXIA 3AVUA 1RBQA 1OBOA 1ZDMA 2KWIA 1F3LA 3T7AA 2GJKA 2P67A 3VYTB 1E2HA 2HA5A 2WF5A 2VPPA 5DXFA 2ZJ5A 2IYNA 4C0QC 4OKNA 3ER6A 2FPIB 3EULA 1VKOA 3QU4A 1N0WA 1Q0QA 5BNWA 4JASB 5JBNA 5JH7B 3SY8A 4P7BA 1PL0A 2YUTA 5LC1A 3Q3JB 1X7WA 5JSKA 3VR4D 4EMBA 4QAQA 1KAOA 1A5SB 3QPUA 1LZLA 3P0IA 5DWDA 1O0BA 1PDWA 2PV0A 4PYLA 1DJMA 1K2VN 1N8SA 2X9QA 2ZI4A 3O8BA 5FP0A 4A91A 4IIDA 2P6UA 2C59A 3A6GA 4GBGA 1XLTA 1BC5A 2C5GA 1TUBA 3ZWDA 3W1WA 1X7WB 2QSZA 2GILA 2PX8A 1ZIDA 1JFRA 1YJ8A 2QWXA 2XLBA 3TSYA 4C9BA 3DO8A 4JYPA 2ONYA 2YVQA 2BUCA 1D04A 4RX1A 1UJCA 3B8EA 3KB1A 4GWKA 2VK2A 3PUZA 1ZESA 2Q5LA 4K7JA 4KQIA 2Y9MB 4R4JA 4RYDA 4DCJA 4NXMB 3K2QA 1OX4B 3NHAA 5CA0F 3CZ5A 3UQYS 1E4YA 4H7KA 1YJCA 1IC6A 1CYDA 1XMSA 4KC0A 2WJGA 1QORA 3UAYA 2OK7A 1NTOA 5IVIA 2FMTA 2K5UA 4IHJB 2G76A 2GD1O 1XVAA 3LXMA 3DMNA 2QX8A 4R9UC 3WMFA 1FE8A 1PBNA 4XYBA 2DUMA 3RNOA 3S40A 3S0JA 4ND3A 1QBGA 2JB9A 3PQCA 1DFGA 3R75A 4QJ4A 2KMLA 1K75A 2HSJA 3KZ1E 4JBGA 5HOQA 3VTKA 1HNZB 1TZ2A 3K0CC 1YACA 3ZWVA 2FETA 3K8QA 5AKLA 5A4IS 4YQEA 5D84A 1INLA 1CUEA 1XZJA 2WD7A 4QPDA 1ARZA 3BOSA 2ZRQA 1VI5A 5AUNB 1AQJA 1E3WB 2VJMA 4CM9D 2HDWA 2R8RA 4I4TB 4EY4A 3ZCPA 4OLFA 3I61A 1GG8A 1ZN2A 2R6R1 3RHSA 3NHWA 4ZHQF 4LDJA 5HZGA 5KMGB 3JRWA 2VDUE 1HDIA 2CXOA 2I2FA 1Z7YA 3DLAA 4PRZA 1ZM7A 4XI9A 3N28A 5LOVF 1VP3A 2L0XA 2KLHA 3R7WB 2VQEB 3P9KA 1JP7A 3MPOA 4OHKA 4P3KA 5CGZA 4EHHA 4RCYA 3AGQA 1HTWA 4FGLA 2XNHA 3FZNA 4LDPA 4AN4A 1SG6A 3A9RA 2C3PA 4MWTA 5G4KA 1H6CA 4UHFA 4ZI7F 1QHSA 2OGTA 1A95A 3JZMA 4HLUA 5AICA 4A4DA 2P9GA 3SFTA 3F4LA 5EWJB 4ZMRA 4FEYA 1C8BA 1XG5A 3E9YA 3JQBC 4P54A 5ERXA 5I7UA 3WLPA 3O2QB 5CYGA 4BMVA 3BXXA 1USVA 4OHVA 3OCYA 1KBOA 5FQNA 2EBWA 4AKSA 2C42A 2WUGA 3UFBA 2G4VA 2O8DB 1H2YA 2ZUCA 4BKMA 4JC0A 4ESVA 1IONA 3PXEA 3JTMA 4IWNA 4K6OA 1P2GA 1XXLA 3VZQA 1JVBA 3BBLA 3GFQA 4CFSA 3BJEA 3DKPA 3UWOA 2EKBA 2ZQYA 3PRJA 1FMFA 3L6CA 3PS9A 4EIWA 1ZIYA 3WXBA 2BKLA 2MMCA 5LUBA 1NSTA 2L18A 4FDVA 3UXEA 3CH4B 2P7IA 2GN0A 2OQRA 2F1JA 3D8UA 3A28A 5DSXA 2C2OA 1WPRA 1H5QA 2MWMA 3EA5A 10MHA 1VLJA 2EW8A 3K9BA 2UZAA 5P8WA 2F43B 3ZLUA 1BGVA 2O52A 3NU1A 1YI1A 3G2JA 1U8CB 4BLPA 1JDBC 5HKKA 1XTKA 1AX9A 2GQ0A 2WIFA 4EPYA 2WFLA 3HY4A 3EXG2 3NTUA 4M49A 5BURA 2VH2A 5HUHA 1F2VA 1Y1TA 2RE8A 1O57A 4K6CA 5G3ZA 1I4DD 3KDPA 1FMLA 4DSAA 2ZUWA 4B47A 3NQ41 1FMTA 1AQNA 1LQ2A 2CN1A 4QEDA 1WCIB 5BOSB 4FB4A 3OPXA 4JYZA 3WMRA 4UMFA 4AJNA 1N25A 3I52A 4WW0A 1SD5A 2ODPA 2VSQA 3U7RA 4CDGA 2H07A 3HL0A 4UM7A 1NFFA 5E2BA 2A1IA 4KWHA 3L4KA 4ZEVA 5GPBA 1DC4A 2CT8A 3PXXA 1D9XA 3QKUA 3RRFA 2I54A 3SQXA 2Q21A 1T5LA 3OWOA 3WIUA 2A1TR 1GFWA 2A30A 2R2AA 3L7BA 3HWWA 5ALUA 1SUSA 1C1DA 1SUDA 1U8YA 1VGRA 4J6EA 4L2IA 2EJVA 3ETEA 1RPAA 1ZRNA 4GYJA 4L6CA 3N8GA 4KVAA 1XVTA 5MN5A 2GZSA 2AF4C 1G4UR 3MAJA 1Z62A 3RI3A 3VVLA 1E58A 3MEQA 1R3DA 4DHEA 3A14A 1RZVA 2YIVX 1AMUA 4W5QA 3I6IA 4RH0A 5FTMA 4GE3A 5HTOA 1FRZA 3A32A 1SHJA 4FYJA 1KJIA 3FAKA 3QKRB 4QU0A 3KBBA 3GZNB 4H15A 2ZQZA 1UK8A 2N75A 3KSAC 1D4AA 2BDTA 1V47A 2IHZA 2J0UA 2JGEA 4TVKA 1IJBA 3D02A 3GYGA 5JYCA 2WWYA 2JLUA 3FTFA 2FTKE 2IE0A 1U7TA 3H1EA 1RYNA 4X1KB 3NDJA 5ER6A 2J30A 1TD1A 4BGEA 1Y1PA 4BBAA 1JN0A 4YMIA 4RM3A 4J16C 1RQNA 1V11B 5A05A 1P8AA 1KEPA 3CCFA 2NU6B 1NN3A 4Q9AA 2BFDB 2FW1A 4V3CA 3UB4A 5A9RA 2Z30A 2VLIA 5AVTA 1KKUA 2PWZA 2PZ8A 4D4KA 4EABA 4OH1A 2HX1A 5DO9A 1APBA 1W0KA 4J4BA 3ZE7A 3GEMA 4PYMA 3DF7A 1PUXA 1A7KA 1AN0A 1RHUA 1BMQA 1YWGO 3DNPA 3CA8A 3VM6A 5EJ8A 2ADMA 2LR0A 3AM4A 1CJSA 1I80A 1V71A 2Q5CA 1KYQA 3ED1A 3COSA 2ZWIA 3DT6A 3EXHB 3ODGA 5DHUA 3UFXB 4FMPA 1PJRA 3T7IA 4YAIA 1H0RA 4L57A 1P19A 2FFQA 1YQQA 2VXOA 5DISB 3QLUC 5LZ5A 1UT5A 3R7LA 1RU3A 2NV2B 4F1JA 2RHHA 5F1OA 5AW0A 3CJRA 4X1YB 5EWLB 2B35A 1T8YA 2XODA 4QX6A 3CC8A 1KSJA 4ENVA 2NQ2C 2G9RA 3ABRB 3GFVA 3MC1A 4MPDA 3N7UA 1RAIA 1NZJA 2P75A 4BIIA 3OQHA 3I73A 3W8FA 1JKIA 5TX7A 4DQVA 3IL2A 3V3TA 2VF7A 2CJYA 2A9PA 4M9ZA 4EKYA 3OE5A 4L9RA 2IEZA 3IUPA 5CLIA 1WTCA 2YQ5A 1W1WA 4IDEA 4KO3S 5K3EA 2HADA 4RTPA 2VHCA 1ZUNA 2O2YA 1H9AA 4MIYA 3U62A 1S2OA 4TV9F 1SXHA 1TCCA 1NUPA 5I4BA 5EJIA 1VLLA 3P52A 1SXGA 3VNVA 5ENZA 5SYMA 4N1AA 3QFHA 3WP1B 1B7GO 1MAAA 1P6UA 1XMJA 3CB2A 3CLSD 4J16A 4GP7A 2OORC 5IHPA 2FG7C 3QUQA 4YJFB 4PS0A 3OECA 2WYHA 4BGDA 3L7IA 3IR7A 2BEVB 5HIMA 3SBDA 2XH8A 5FTKA 1ODSA 2QIOA 5KPDA 3E9ZA 3SWWA 1NG9A 1H22A 1KP9A 2OQIA 5BR7A 4GVXA 2PEYA 3D3WA 3DT9A 4RVOA 3H4IA 3Q3VA 3RABA 3HJHA 5AHWA 4KEAA 5E9QA 3E48A 5E2IA 2VF8A 4ZT5A 3WQRA 4CW7A 5I7EA 1L1EA 2YFHA 4QNNA 1KSFX 3HU1A 4LDRA 3QE9Y 1VG1A 2J4DA 2AXQA 2FVXA 3IAUA 1DSSG 1H42A 1NYLA 1SIBE 4MKRA 1NMEA 2BZSA 3SQMA 5AD1A 5ANRB 3RVKA 4NNJA 4ABYA 1H2ZA 3VX3A 2QRVB 1Y81A 4UZFA 3BCRA 1AU9A 4JBWA 2F00A 4XWAA 5G0SA 2W2PA 1ZKMA 3IUNA 4BWGA 3BGDA 4JLUA 1N9ZA 3FR7A 4CM9A 2QL9A 1NV8A 4QGGA 4KXYA 1KMIY 4ENSA 1RPZA 4ZT7A 1OTYA 2BISA 4MR8B 4YGYA 3WFIA 1ZCJA 3C85A 2IYTA 1DTEA 2AI1A 1Q7BA 4QVKA 3UJHA 1H0KA 1SHTX 4AJIA 1P9RA 3AFHA 4NCIA 5AKKA 3UV6A 4EFMA 1H66A 1PZFA 5AJZA 1DEAA 5F3RA 2EV9A 1GSIA 3K6KA 2AZDA 1TLFA 2A1TS 5JCOC 4FP9A 4GQAA 4Y6SA 3SF0A 1QR6A 4B76A 4P35A 2GAJA 4H77A 3SGLA 1Z4KA 4PN7A 5CCBA 1MJ5A 1KFKB 3NJ4A 5BT9A 4DLAA 1M1XB 3RKRA 3AEUB 1UPFA 3EISA 1EEXB 4H7FA 1EQUA 1O0SA 1OREA 2HHCA 4HFJA 4ENQA 2RGEA 1CWUA 1ISHA 2P5TB 4L72A 3ZZMA 3OG9A 4HC4A 2JGMA 2TMDA 5GVSA 1Z82A 4YRNA 4W1SA 4XWYA 1P75A 1OZ0A 4V2UA 3EEIA 2RIRA 3HNOA 1N5JA 3G0HA 4H7HA 3VTZA 2FN9A 4OGKA 3OE7A 3QI7A 3GHHA 3IURA 3DEHA 1OZGA 5IKOA 2JBAB 3J80A 3CVYA 3EPPA 5J40A 4I1PA 3AEXA 5HRAA 1P31A 3T0GA 2HB6A 1WB5A 2RH4A 4W5TA 3K9WA 1GSHA 3D7SA 1XWFA 4G9BA 2PN1A 4MWSA 4BO9A 4G5FA 1Q95A 3BRSA 2ZS8A 4JEUA 4XIYA 3IR6A 3FTDA 3PEVA 2E4ZA 5DRYA 3SQLA 1OBHA 1GR1A 4J1QA 2B20A 1NVKA 1V95A 3IQIX 2QPLA 1Z25A 3WJ2A 3IKJA 1Z4NA 3CE9A 3NKVA 3F6YA 3KVYA 3PJGA 1FUIA 4J9VA 2FJUA 1L5SA 1ULBA 5L4NA 1IIBA 2G4CA 3DZCA 1PW5A 2OGZA 4U5QA 3UAXA 3TEJA 1NUTA 1JIXA 4TSFD 4AJOA 4DA8A 3K9LA 2BM1A 1BKDR 3TLCA 3F98A 4BKOA 3VTFA 1EWKA 2QW8A 3RJTA 1T43A 3AY3A 3TVDA 3L8FA 2RKOA 1KRXA 1SUBA 3Q3IA 5EC8A 3WWOA 2X14A 1V7QA 4YBRA 3RU2A 4UPDA 2BMFA 4LEIA 3QXXA 1UZNA 2XUQA 1R37A 4AMYA 4CL0A 5KQMA 3KTAA 1VBKA 4BP8A 2HU2A 2FPPB 1KXJA 3NBUA 1AKQA 4URYR 1KI3A 2IFTA 1SKMA 4DV0B 4CLOB 5TR9A 1AO3A 1WEHA 1XZEA 3V1UA 3P0HA 5J47A 3GXBA 1QHFA 4LRWA 1D2EA 2XOXA 4L8FA 4PTYA 3C8ZA 2HHAA 2OBXA 4UUMA 4XIGS 2XTNA 4WLVA 5HRUA 3PNPA 2E89A 2YJ3A 3FGOA 4GVPA 4YUVA 1R8QA 2YL2A 3DZJA 4P4NA 4TT8A 1S8OA 2LWIA 1E66A 4AROA 1KI4A 4MZDA 2EX1A 3P27A 3FM9A 2OV2A 4YRLA 3ZHZA 1K2WA 4QU5A 2EGUA 4DLUA 1D5CA 2Q1UA 2X58A 3D3KA 3L4BA 1J22A 1E2UA 2H06A 3LKBA 4KI0A 4RIGA 5F35A 1VE5A 4E4RA 2JFFA 5IDXA 4TZ0A 3G82C 4Q3NA 3GVHA 1CFZA 1F38A 4IKPA 1N7HA 1V45E 1FVXA 2PVPA 2WSYB 1X8XA 3A6DA 2ZUUA 2AOWA 1EJBA 3G0IA 3H1GA 4HEJA 4MS3B 4HX9A 3CLTD 3ZHBA 5HJ7A 3AUUA 4FCTA 3VO2A 5M5BA 4JJEA 1Z38A 4OFZA 4UUOA 3ZX5A 4B87A 1IM5A 2BDEA 1QOPB 2XVYA 1RR6A 1YQEA 3N5CA 4RE6A 1JLKA 2IHJA 2NAFA 2H63A 3C2QA 3ET5A 2Z04A 1WKBA 6PFKA 2OYSA 5MN4A 4QNMA 4ETIA 4DCGA 3QUSA 3ANLA 4G5QA 4PVDA 4DBVO 1PUJA 5FV4A 4ZTUB 4BXOA 1IN7A 3DJFA 1KFEB 2CLIB 1KO1A 1JF8A 1OHHA 3NOXA 4FGWA 5HS6A 2A1UA 1LSOA 3G5UA 3B6ZA 4N48A 1IN4A 1MX5A 2YS6A 1QZUA 4TKVB 3SN6A 2AVNA 1JAIA 3TKLA 5HKKD 2CLEB 5TVKA 3WYFA 5AJYA 5A3QA 1MTZA 4AF6A 1KQPA 2CMHA 1JT9A 1OD6A 2IOFA 3OZFA 4X1KA 5KNBH 4Q19A 1GGEA 1JG1A 3PNYA 2FSGA 5FWYA 3OJXA 1QC5B 3QEMB 2WF7A 1EINA 4QXRA 4JB2A 5AXBA 3VC2A 2N1BA 3SF8A 2FJPA 2G80A 1U0OC 2EF0A 2DSNA 3HGMA 3CW2A 2NYUA 3UGTA 4LHWA 4EJMA 4ZMSA 2LKCA 5CH5A 4O2BA 2GBLC 1F9EA 4REQB 4CKEB 1EFPA 4RDXA 5IS2A 5EHZA 2XMSA 2JFWA 2EJBA 4XM2A 1G20A 5DX0A 4K6HA 5FUYA 1PT5A 4ZK6A 4QHSA 2VLBA 2ZAIA 4MP8A 1EJ0A 4AYWA 4F4FA 1UP6A 2X3UA 3CF4A 3D2CA 2ZR0A 4PZ0A 3DE5X 4R1QA 3ZY3A 4AURA 1EJ2A 2Q9AA 3IPYA 4RL6A 4WDQA 3ME5A 2EAUA 1AB6A 1UXGA 3M2TA 4XQGA 3H7IA 5BNZA 5LWHA 2H8GA 4JL6A 4YR7A 3TECE 4F11A 2YVAA 3A10A 1F06A 3IBGA 4Z4CA 4PS1A 1DG3A 1M6VA 1VKRA 2FN4A 3QG5A 1NSFA 1V9CA 5C32A 3TB4A 5A3JA 4EY5A 1P9OA 1ILEA 3AVYA 3WLEA 3U4AA 2GASA 3HV2A 3E5NA 4KE6A 1C3EA 2WMOB 4GZ3A 2HQRA 1MX9A 3VSDA 2IZ0A 3DB2A 1I1NA 2QR5A 3CF2A 3GFOA 4CM7A 2P27A 3KV1A 4IXTA 2ZCUA 3TCXB 2P69A 3KQYA 1L5NA 1C2YA 2WJIA 3OSZA 2ZTVA 3X1YA 1Z4QA 3KEQA 4YV7A 5EIXA 3S2IA 5KOJB 3C1UA 4C7MA 1RTTA 1XP8A 2ORED 5DRTA 3W6PA 5A7FA 1E1LA 5BSWA 1PJSA 4QTTB 1BQEA 1FTWA 3EOZA 4V0ME 3T5BA 4P86A 4H7DA 1X9HA 2IYYA 4X64B 3V97A 5A0FA 5JEDA 3TFWA 1L5HA 4LBZA 1WBJB 3GDFA 3DYVA 4XUDA 1KIAA 1PLJA 5AW5A 5A3RA 5I7AA 1FSFA 3T5DA 4F45A 3ZVKA 2BR5A 4QLOA 3THWA 3BL5A 1Y34E 1M8GA 2BZ1A 1FSZA 2GZ1A 1NU6A 2Q1WA 1NMXA 1ZH0A 2RBKA 4EEXA 3QX7A 4XGQA 1W7AA 5A2QA 1SXIA 1PJ4A 3DDZX 1D1PA 1NBIA 4FFMA 1T8TA 3KM0A 4LSZA 4XDGA 5I4CA 3W06A 4LC9A 1KGSA 2WPNA 4LPKA 4L0DA 1U80A 1CB0A 1KI7A 1Z6GA 2DJIA 2YZ7A 4CCSA 3USZA 4ZI5A 4YIHA 1U7ZA 2BGKA 1UEJA 4LOIA 1YOVA 2RKBA 1AK2A 5JYEA 2NG1A 4P0QB 2ATEA 1GYQA 1B8OA 1BCSB 3X3HA 1PQ4A 1JFFB 2AOTB 3DSRA 2AH5A 3C98A 3IPRA 3DKVA 5EIWA 4AJKA 4R2HA 2C78A 3PCXA 5K0NA 4KQHA 1PSDA 1S3IA 1XQ9A 3M3HA 1P2FA 2CL5A 3N70A 4FOPA 4KACA 1U7PA 1VPEA 2UXDB 3A7DA 3TTXA 4X91A 5C5EA 2X1LA 1H2XA 4IKOA 4NBWA 1BWQA 3JYPA 4IINA 2VEDA 1BJRE 2P91A 3OQVA 1R12A 4MYCA 2ZRHA 4NAHA 1D5WA 3ZXSA 3TBHA 4DMHA 3SIWA 4Z2AA 2BBSA 3I01A 4PRKA 2XKBA 4UFNA 3CH6A 2H16A 4BLTA 3KQMA 4MQ6A 1O94C 2UUCB 1GADO 3KKEA 1XXHB 2C3OA 1OLSA 5AIAA 1TK9A 1EFVA 5L95A 5BUZA 4CLEA 3V46A 1DB3A 2OAGA 3GFFA 2OAP1 3FZEA 2NX2A 4RFSA 3IIIA 2Q7DA 1RAGA 3BGVA 1EX7A 1XJ5A 3OPYA 1DEXA 1O7JA 1ZMRA 2GPBA 2QLMA 2H65A 2H5LA 4G84A 4XLTA 5HF6A 3UJ8A 4XQEA 4J0EA 1JEDA 1ULHA 1MC4A 3ZGVA 5J4LA 2RHTA 1VA4A 1E4VA 3JASA 1T6YA 4TL7A 4TMVA 4E7PA 4ZXFA 2D6FA 2F3PA 4HDNA 2PKWA 3CXRA 4YDQA 3WGTA 1EGQA 2IIQA 3DZDA 4OH7A 4URFA 2ODTX 3MWYW 1OF1A 3UT0A 4B43A 4DCPA 2R00A 5JISA 1TYEB 3R41A 3RHTA 4R3WA 3GJRA 1GPMA 4PANA 1I7SB 1N34B 3DZGA 1U2TA 5E95A 1TF7A 2BBTA 3EGDB 1EUZA 1DO2A 3W2HA 4HB3A 3D3NA 4IXMA 4XD7A 3STTA 3T1NA 3K31A 3BWXA 1NX6A 3IEIA 5DDIP 1OOEA 1D1SA 1QPBA 2COUA 1WOMA 3GP3A 3NWJA 1IAQA 2B4TO 4TLDA 3TRFA 4CFYA 3LUJA 4PHCA 5HZHA 3U19A 1N33B 3E5MA 1JSXA 1TM4E 3NLLA 1D8AA 1Q83A 4IVNA 2GOYA 1QK3A 5DWVA 3OEYA 5DHAA 1XCPA 1SQSA 2DQYA 5DNDA 3L7KA 1JKFA 1PK9A 4MICA 4G0QA 1TKAA 3JD4A 2ZWVA 4EPXA 4KIJA 1FXUA 3Q8MA 2F1HA 2JLQA 1KTVA 2BFFA 4W6QA 4ZXPA 4TRNA 3UO8B 2QRGA 2XMQA 3WDLA 1M75A 4GI1A 4PE5B 4BVGA 1E9EA 2DKNA 3AINA 5EVJA 4N5MA 3UJ7A 2RGNC 1JR3E 1BHJA 2I6XA 1FFYA 2JZCA 3F3KA 1KNXA 2RGCA 5H16A 4DM7A 3ZZTA 4UNPA 1BX0A 1LUAA 2C8VA 4YRKA 1V8DA 3RV4A 1TMOA 5GADl 1BFUA 1LDYA 4KR9A 2OC4A 4KQMA 3WDKA 4CNBA 2FRDC 2MMGA 1L7MA 3UJ9A 3FWHA 3O74A 4FGUA 2Z6AA 1KAGA 3O3CA 3AETA 4MEAA 6NULA 3GJQA 2E5WA 3G0DA 2BHRA 5FJJA 1NW7A 3O1HB 2NYVA 4IIUA 4A10A 2R8XA 1NA5A 3PCTA 5AKJA 3VSCA 3Q7QA 2ZRJA 3JYOA 1RHKA 1NBME 1IXRC 2ZJYA 4GMKA 3WQQA 1SC4A 2WG0A 5CLHA 2H5JA 5DM1A 3V7YA 3BK1A 1U1GA 2X6TA 3NCTA 4TMWA 4PYNA 1IXKA 1DBPA 2ZWMA 1Y1SA 2KSQA 4MW9A 4UAJA 2E4UA 2QUJA 3E7PA 4UDNA 3DV2A 1YBFA 3TZEA 1F4LA 4WK2B 1QAQA 5HPYB 4A82A 3RUEA 1X7YB 2VO1A 1OAOA 2PDAA 2O0JA 4NBTA 1Y3HA 3CNBA 4ARBA 4BB6A 2FF5A 4TOIA 2BEKA 3TIVA 1QZZA 2OHIA 3TZKA 2JBAA 2KB0A 1Z6ZA 4QUAA 5GM2A 1IG0A 5FI3A 4G0WA 4KXFB 4FWIB 1PX2A 1ODTC 4NDAA 3FYUA 5D51S 1O6FA 1EM6A 1G7RA 2PQ0A 3QG1A 1IZ7A 2QTLA 2Y1DA 1IEQA 2MYTA 5F33A 1NMQA 3RYCB 3RTDA 3LECA 1AHHA 4CKBA 1QH8B 2RH9B 2VDOB 4EW1A 4CN9A 2ZBQA 4GO1A 1L9KA 4W99A 5E9AA 3R3YA 1ACLA 1NY6A 1WXHA 3A36A 3FCSB 2IV7A 2C07A 2HT6A 1B6GA 2AXEA 1WDLA 2HQ1A 1XYYA 3GN2A 1RWKA 5ENDA 1YQXA 2EZUA 5BYAA 4ZZIA 1HFKA 3HU2A 5EOVA 3A4NA 4O0LA 3WJ1A 2C8JA 3TOCA 5DNUA 4ZVLA 3MJVA 1Z8FA 1LZKA 1CJTC 4WESB 2HF7A 1C4KA 3NV9A 3ZC3A 1PJQA 3CZ9A 4RMHA 2PR7A 2B25A 2EWWA 3AFNA 4I9NA 2A0WA 4P6VF 4BKPA 1XXHE 2IEGA 2XMZA 3FPFA 4I1VA 4YDSA 3RAEC 2ZCJA 2R84A 1EBFA 3HXPA 3A05A 3ZY6A 4JR1A 3WE7A 3L02A 3P2MA 2FN8A 2NP7A 3RS7A 3E22A 5JXWA 2PVSA 1PZXA 4RY8A 2WD7B 1QYIA 1MJFA 2JH9A 4G0OA 3B1ZA 4YUAA 4CKCB 3GY0A 4EG1A 3GDGA 2ZIFA 4PSDA 5C7IO 4Z0PA 3IJPA 5BN4B 1JZQA 2A9RA 4J4HA 4V0LA 2Y05A 1XTZA 4ZQIA 1W6RA 2B5VA 3L0CA 4ONEA 4QDKA 3ETGA 3OEHD 3QPWA 4LJSA 1H4TA 1TKBA 5EMHA 2MSCB 2DLCX 4C03A 1XZAA 2PMDA 1EQAA 1L4NA 5CEJA 3CXUA 4ED9A 2C8LA 1ZI6A 1KAMA 5JLJA 4TL6A 2WD9A 3V7FA 4LFCB 2UVDA 1BCRA 3REFA 3WQBA 1FSGA 4Z9BA 2XQVA 2XYGA 1JU3A 4G37A 4CR7A 1X13A 2C7GA 3N0WA 2IH4A 2XCQA 4OXYA 5TMDA 4OP2A 4S1PA 4E32A 3WHIA 3AJRA 3I01M 1IDOA 1NIPA 4RTOA 5TMPA 3VO9A 4MB2A 3ILVA 2ACWA 2FXVA 2OSVA 1QIEA 2C3YA 3DW3X 2ZTUA 3PFBA 5D3MB 4A2PA 2L69A 2QT1A 4WKNA 5BW6B 2BF7A 2FR8C 3Q5GA 2XMGA 5FPTA 4PC1A 2HPHA 1IN5A 4BO6A 2X6QA 3WGYA 4D92A 9GPBA 2R87A 3GLIB 1A9XB 3OHPA 3UMBA 1F8FA 1P0CA 2WFZA 1XZNA 5E6RA 3TLZA 3RNLA 4LJRA 1CUWA 1DEHA 4MUEA 4N4AA 2QN7A 1R6DA 5T4EA 3SOZA 2R68A 5K0TA 2F8SA 1TDJA 3EPRA 1IB0A 3H6HA 4XJXA 5AHXA 3OTQA 3WRYC 2OAQ1 1QOQB 2R6DA 3WB2A 3O38A 1UJ2A 1DAFA 5E6RB 1TCVA 3QKIA 2DFVA 2QW0X 3LT1A 4I9HA 2OZLA 1UC5B 3OKFA 4KOAA 4WA8A 5JZBA 3V34A 3PPWA 2IZOA 1JDVA 4KAFA 2WAOA 3UUEA 4AJHA 3DZKA 4OHWA 4Q3EA 2CYBA 1V1MB 1EUYA 4GWGA 4QGHA 4LIPD 1M8KA 4WN9B 5G41A 1U0TA 2LKDA 3RUDA 3WMEA 3MG9A 4JZYA 2Y3IA 2HW8A 2FWMX 3U81A 1E3JA 2GUGA 3HDJA 1WCWA 5BSRA 1V25A 4XTRA 4UDOA 1RC8A 3TO5A 5H5JA 1MFPA 3I9V6 2ZB3A 2AUNA 4PX5A 1N5MA 1GRQA 1XTVA 1YFKA 2PLFA 3TRJA 2X1VA 5JRZA 1IMJA 1IZ9A 2IW3A 1HYEA 4HQ6A 4EHFA 2QMUA 1B15A 1G8SA 1LA2A 1R16A 1HA3A 3O4IA 2NSJA 4FHFA 4ZCTA 4I8IA 4QU8A 1PJLA 3CYFA 1RQPA 2ET6A 3TIGA 1BQ4A 5CBKA 4CR6A 5DH9A 1ENZA 1ZKDA 3BQ9A 2O8NA 2D59A 3ITDA 3HK2A 4B3RB 3R3ZA 4D8YA 2LNDA 4G0YA 1QV7A 1H2EA 1ZM4A 2JNWA 2O19A 4KAJA 4KPFC 2XVAA 3CPJB 4YJ3A 4J0GA 3N6VA 1DIOB 2Q0QA 4WTOA 5FOTA 1XTUA 5F5XA 3NHBA 2OUKA 4HNAA 4D1YA 4IUCS 2K7ZA 3H13A 5DI3B 2Q3DA 4TTAA 4OQDA 1OFIA 5IJ0B 4ROSA 3KYIB 3O8OB 4MCAA 2X0KA 4UNIA 1FX0A 3F7MA 3HV0A 3FTCA 4FC7A 1ATIA 4KX3A 3SYMA 3WLLA 3HVRA 4BS9A 2F4VB 5I9BA 5EFZA 2Y1CA 3SX4A 4E70A 1MIHA 3L7AA 4YP1A 2XBLA 3WBFA 4UE3S 4WADA 1DAEA 3Q2OA 4D4HA 2XGMA 1NLFA 1IY2A 2PNFA 3ZV5A 4RTQA 3CURA 1XD2B 2XOEA 2A9JA 2Z5FA 3CINA 1V39A 2R4QA 3CJQA 4WY2A 5JDIA 1LBQA 1SU4A 2RG1A 1XBTA 2XNSA 1G7CA 3BORA 4TV9B 1Y98A 1JHMA 1YRYE 3DXXA 4A92A 2ZIXB 4E30A 4XWOA 5IEJA 1RNLA 3U49A 1YTLA 3KE8A 4OTZA 2RHCA 1DIGA 3HCNA 3KD3A 3DHWC 1QZXA 3LY8A 5B57C 4IUDS 3RUPA 1RWMA 1QF6A 3H9JA 3Q1KA 4A0HA 2HGSA 1CNEA 3SF8B 4Q0MA 2VBIA 4CR8A 2WYOA 4M38A 4G5OA 1XCJA 2DU8A 1IIRA 3MERA 3NGXA 3CONA 2TMYA 1Z34A 1DHTA 4D2IA 3PWZA 3BSSA 4K6KA 4LOLA 1LNSA 1HYGA 1XJCA 5HFAA 4MARA 2BSQA 4YQZA 4CXMA 4DWWA 4IOMA 1SUPA 3AZQA 1PNQA 1DV2A 2UYGA 5A7GA 1AS2A 1QYXA 3IVMA 4FFVA 2H1WA 3A6LA 1VZ2A 4A0QA 1QR2A 1ISIA 1JAHA 5KAPA 1CUXA 2WJYA 4NBUA 1JLRA 2XCLA 4Q48A 4R2IA 4RKYA 1NOKA 3FYTA 2SKDA 4LMPA 1NDUA 3GRZA 4KSBA 2EW2A 2I3GA 5LJLA 1Z7WA 2FY8A 4O29A 1JXAA 3I28A 1CZHA 4IX1A 3HO1A 1UDAA 2EU8A 2JFVA 4MTCA 2W0SA 1JZTA 1ZWLA 4II3A 3FLEA 1AH2A 2PUEA 1VIYA 3HY3A 4F5WA 1QIHA 1W5AA 4MDHA 4QICA 1B8VA 2QRNA 4UE6A 4YJGA 3PWSA 4KH0A 2FHPA 2ZJ1A 3K6SB 1LC3A 2O8EA 1CY2A 2K4MA 3RTAA 2J87A 4EX7A 3ZDXB 4P2BA 4GOMD 4N0MA 1JFLA 1C3VA 1TJ4A 1C1XB 1XRNA 2OCBA 4C08A 5IG2A 4C4XA 3PLRA 1R4NA 2VJDA 2RGXA 2RAFA 1B6TA 1DIRA 1MC8A 1V8PA 2Q2QA 3NTVA 4JZKA 2VNJA 1B0ZA 4LS3A 3A1NA 4DMCA 4UW9A 5HK8A 3K96A 4MVJG 1CNFA 1FP4A 2WYIA 2IA5A 4MWEA 1J99A 3R77A 2RARA 5GZ3A 4N7BA 3T52A 3IERA 3GLQA 3OQBA 4J07A 3QITA 2AFVA 3BHNA 5B1DA 3R0JA 4ND6A 2HCTA 2YZ2A 2ID4A 1ICIA 2JCGA 3C4VA 3ZQ4A 4NARA 4YQYA 2CL6X 1WSBA 4DLRA 5CA1A 5CVDA 1U8TA 1LDMA 1NW3A 1URPA 5D1HA 2CYAA 2FGJA 2X9NA 5JVDA 2CVFA 1W8DA 2PG3A 3RSQA 2R7NA 3GEIA 3QM1A 1K6JA 4LRSB 4RHFA 3NUZA 1QFXA 3HABA 5K6AC 1HC7A 5IXYA 3R6LA 3GGSA 1PVVA 3R5KA 4BFTA 2WB2A 3QWIA 4R2XA 4IV0A 5DWQA 3EIXA 2BOVA 5JDCC 4YMGA 4R98A 5TPZD 1BO6A 5REQA 3JD3A 3WWEA 4KX5A 4QODA 2O7NA 3FPGA 3PA6A 1EWQA 1N92A 4AO6A 1SVIA 1HLFA 3THWB 4YACA 1REQA 4BC0A 3DOJA 4LBVA 2LIVA 4B6QA 4MWCA 2OGUA 2P2YA 4AJEA 1A9PA 4FQ5A 1GKUB 4YRTA 4JBYA 4YAJA 1XFDA 2X5NA 4E4YA 3VZRA 3WZ2A 4EGAA 1M66A 2FE1A 2C9OA 3H8VA 1DDOA 1I9GA 2C9CA 4HJXA 3U3DA 5CDHA 4YCLA 3MCZA 1VG0B 3W4KA 5DNEA 4QGFA 5I7WA 4ZAYA 3CZAA 3DLTA 4MAMA 4INJA 4LYAA 1YI0A 1QTRA 1T0UA 3IEXA 3CSDA 3K92A 2ZATA 4CODB 4GKAA 2FDRA 3IOCA 4MRAA 2O14A 3GVCA 4CIXA 4CKCA 2VSOA 2BBOA 1JPVA 5TS3A 4ZCLA 3F3MA 1JDZA 1UIRA 1FDVA 1SY7A 2E49A 3DV0A 4OXKA 1ABEA 4LXUA 5AHOA 1MXHA 1Q1GA 3NP9A 3FPAA 5EMKA 3LPNA 5ILOA 3OIVA 5J2UB 2HYIC 1DUIA 5ABPA 1H0SA 4MHOA 4D80A 1GOTA 3CUSA 4G1FA 1KEZA 4X90A 4ASUA 4L02A 5IASA 3I62A 2PS9A 1VMAA 4C2BA 3G9XA 1T5IA 1O5IA 2NLOA 2FFJA 2WKSA 4RVSA 3WFZA 4BUJA 2GJ9A 3PD0A 2Z8YM 3PV0A 2ZM6B 2UUBB 1LPBB 4UTPA 1F8YA 1NAHA 2FCAA 1R6UA 1CCWA 5BP7A 2G70A 3A9UA 3FUVA 4KQWA 5G40A 1FNMA 2NYRA 1P5JA 3NWOA 3R7NA 3MLEA 2WJ3A 2VPIA 1G8JA 4EGJA 2JIZA 1MRZA 4I9UA 2HEGA 3A04A 4O2BB 3HCFA 3CWCA 1K0UA 1I7LA 2C96A 2W4QA 2Z6VA 4RPLA 4REQA 4ZVUA 1QKJA 5TGTA 5JECA 5E38A 1Z0UA 2HJWA 5JQGA 5ELMA 1N8KA 2I33A 4WVFA 2WAMA 1SRQA 3PKZA 1U31A 2DQSA 4CCWA 3FWYA 4RK7A 3TLJA 1LPMA 3NAQA 1KI1A 3FSGA 3QNUA 4OV6B 2FSFA 4NE9A 5CTAA 2AMJA 1WBBA 4H6WA 3RU7A 4R8VA 3SC6A 4DF3A 1X1QA 2IXAA 1P39A 4PVCA 4U63A 1Y9DA 2XZTA 2JJ8A 4WSOA 3KD2A 3CEPB 2BSXA 1BRTA 3GFRA 2OG1A 3B51X 3LPCA 3RRMA 3ESXA 4W5WA 3OEHA 3T95A 3KKKA 4ZHQB 2EJTA 1AIPA 1XKQA 3N53A 2WI8A 4RZHA 4BQFA 6AT1A 3WK5A 1T1IA 2W6PA 4DCSA 5HRCA 2FPPA 3L6EA 2ZXFA 2D3TA 4IX9A 1WUKS 4GP9A 4OGLA 4N41A 2B37A 3IP3A 1NAIA 1UJBA 4EATA 2SNIE 5HKBA 3AG6A 1CU1A 1S9DA 4L9SA 4TKMA 4F21A 1W4ZA 3VAYA 2QRPA 2WJAA 3OFSA 5FUMA 5AJXA 2O2ZA 2Q3BA 5FA5A 1OTHA 1BXRB 3FTNA 3V4PB 1QH9A 4JSYA 2PXCA 2QY6A 4G1MB 3DTYA 2YASA 2ZETA 3PPYA 4KGZA 2GBLA 2WHPA 4D42A 1U9IC 1QHHB 2WJPA 3KT3A 1QGZA 4ZVKA 5ICGA 4OYYA 3NZEA 1NBWB 5ITZB 1K1EA 3CF4G 3RANA 2XGOA 4ZHSA 2VWGA 1P5RA 1BW9B 1Y3BE 1N78A 4E5KA 4JJ7A 1KVUA 4D0GA 1QYCA 4Q7EA 4BEJA 1WMSA 3I04A 3HJUA 1J9ZA 3DMTC 1XHEA 3S3TA 1XKLA 3WNBA 4OYLA 2DAPA 4MO2A 4OHFA 3TJRA 4YP0A 2UV8A 5B7NA 4EYEA 4W7HA 1P5ZB 2XWJI 3TPZA 2V74B 5AVWA 5EHXA 2C7OA 3PUKA 4N8EA 5FOVA 5CA1B 3HXMA 4BO7A 2XXBA 1AXEA 1PEYA 1H3EA 2X15A 3SM3A 4MUNA 2ECQA 1EXWA 4FHDA 3F7NA 5E3HA 3T5CA 5L40A 3NHUA 2R6CA 1L5LA 3JQFA 4DEVA 1RDFA 4HVLA 5FL3A 3TNYA 2V7PA 1ZSVA 4PQYA 4BNVA 2BZGA 2FZEA 1P77A 2YC4C 1E2FA 3A27A 4L5BA 5F7ZA 1YDEA 4DJ5X 4DJAA 5DIZA 2YWHA 3E3NA 1YT5A 4PNPA 3FZYA 3ZD8A 2CDAA 1N2GA 3HP1A 3IAHA 1H9CA 1AN9A 1LVGA 2Z5VA 3SC2B 2O8EB 1JHDA 4QYTA 1NPDA 1HDYA 4QOSA 2IU0A 3MPUA 4AIRA 1T4BA 1GVNB 4FYWA 1HDOA 4WLNA 2P4SA 4ID3A 4YO7A 3AP3A