3FNIA

Crystal structure of a diflavin flavoprotein a3 (all3895) from nostoc sp., northeast structural genomics consortium target nsr431a
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
154
structure length
154
Chain Sequence
KAETSIGVFYVSEYGYSDRLAQAIINGITKTGVGVDVVDLGAAVDLQELRELVGRCTGLVIGMSPAASAASIQGALSTILGSVNEKQAVGIFETGGGDDEPIDPLLSKFRNLGLTTAFPAIRIKQTPTENTYKLCEEAGTDLGQWVTRDRLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Putative diflavin flavoprotein A 3
publication title Crystal structure of a diflavin flavoprotein A3 (all3895) from Nostoc sp., Northeast Structural Genomics Consortium Target NsR431A
rcsb
source organism Nostoc sp.
total genus 53
structure length 154
sequence length 154
ec nomenclature ec 1.-.-.-:
pdb deposition date 2008-12-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fniA00
2OHHA 4N65A 3ESZA 5TGZA 4QOHA 3FJOA 4YALA 1RTTA 3NFRA 1F4PA 3ESYA 1XT6A 2HNAA 5JROA 1YDGA 3K20A 2FZVA 4OXXA 4NLLA 3U7IA 3SVLA 4XDGA 1CZLA 4FGLA 3EYWA 4FGKA 2Z9DA 3S2YA 4ZVLA 3W7AA 5EMNA 1OBOA 1WSWA 3F6SA 1FTGA 1RLIA 2X2OA 2WC1A 3KAQA 2Z9BA 2MT9A 1AKWA 1D4AA 3ZHOA 4R81A 4FX2A 1XI2A 4YAOA 1JA1A 3KEGA 1YRHA 1WSBA 3ES9A 2FDXA 1QRDA 2Q9UA 3F90A 2BN4A 1C7FA 3OJXA 1FLVA 5LBTA 3ESXA 3FW1A 3B6MA 4U7HA 1QR2A 6NULA 4GI5A 2V5UA 2AMJA 1AKTA 1X77A 1FUEA 1NNI1 2V5VA 4LA4A 3NHFA 4BMOB 4DIKA 2ZKIA 4LTNA 2Q62A 2B3DA 1B1CA 2KLBA 2FAXA 2XODA 1CZNA 1ZWLA 5A4KA 4LAFA 1CZUA 2BMVA 2GSWA 1CZHA 1BVYF 4C0WA 1AKUA 1V4BA 4U7GA 2OHIA 1T5BA 4QOJA 1J9EA 3NHWA 1FLDA 1OBVA 4XDHA 1TIKA 1T0IA 1JA0A 1ZX1A 3FX2A 3NHUA 1ZWKA 2D5IA 2F1OA 2ARKA 5LVAA 2OYSA 1AKVA 3N3BC 1XYVA 4ICIA 1GG5A 4QODA 3D7NA 3NHPA 2M6RA 2Z98A 3OX2A 3F2VA 3FVWA 4ZVKA 5F12A 2Z9CA 4Y9RA 5NLLA 4S24A 4YQEA 4QOEA 4GQIA 1CZKA 1DXQA 3NHKA 1DX9A 3RPEA 4PU0A 2X2PA 3FNIA 1AG9A 5F4BA 3O73A 2N1MA 5B3KA 1FVXA 3EDOA 5FUQA 5NULA 2QMYA 3R6WA 5B3LA 1CZRA 2FZ5A 4YAWA 3L9XA 4C0XA 4NULA 3KAPA 3B6JA 1YOBA 1H66A 2RG1A 4D02A 4ESEA 4BMPB 1XYYA 2FX2A 3QFRA 4DY4A 3GFSA 2QMZA 4GR9A 3GAMA 3N3AC 5F51A 3L9WA 1RCFA 4YAUA 1KBQA 3K1YA 3OX1A 1I1OA 2MOKA 4QOGA 4ZVNA 1E5DA 5BUCA 3W77A 4DILA 4M0CA 1FX1A 2HPVA 3B6KA 3OWXA 3LT5A 3TEMA 3NHRA 1OFVA 1J9GA 4C14A 4CETA 2BPOA 3TZBA 2MWMA 4CF6A 2A5LA 2QX9A 1VMEA 3P0RA 5LLDA 3F6RA 4QOIA 4F8YA 1KBOA 2FOXA 4Y9UA 4U7FA 1TLLA 2QX4A 1DXOA 1SG0A 1YCHA 2V9CA 1YKGA 3JSXA 4H2DA 1SQSA 4YAFA 1BU5A 5LJLA 2W5UA 2R97A 5FA6A 3NHJA 2HNBA 1AKQA 4N82A 3GFRA 1FLNA 3UXEA 3QE2A 2QWXA 3N39C 2QR2A 4HEQA 5EA2A 2BZSA 3NHSA 2MTBA 4FGJA 4QOFA 2BF4A 3NLLA 5ULLA 4LTDA 4H6PA 4ZVMA 1AMOA 3U7RA 2QX8A 1C7EA 2QX6A 1FLAA 3HLYA 3W79A 1D04A 3OJWA 3HR4A 4J8PA 2FVXA 2R96A 1H69A 1J8QA 1QHEA 3OX3A 5FX2A 3HA2A 5LBUA 1CZOA 3O2NA 3GFQA 1AKRA 4Y7CA 2XOEA 3W78A 2FCRA 2OHJA 3TE7A 1AHNA 3OWHA 4LTMA 4N9QA 4C76A 1AZLA 1YCGA 3NHYA 1QBGA 3QFCA 3NHLA 3LCMA 2KQUA 3G5MA 2M6SA 4PTZA 5LJIA 1YCFA 3UXHA 5EAIA 3OVMA 1D03A 4PTYA 4HS4A 5LMCA 3B6IA 1RLJA 2FLVA 3KLBA 1J9ZA
chains in the Genus database with same CATH superfamily
1HQCA 3TKLA 4RTNA 4O4LB 2JIMA 1DOAA 2WB4A 5T41A 3ZWAA 2D62A 4MARA 1TJNA 2CXHA 2VKTA 1X94A 3AETA 2WYOA 3DOUA 2FJ0A 2G1AA 3EMKA 3Q3JB 3R0VA 3KBBA 2ONKA 1L5YA 4TLBA 2R00C 3ZXUB 1XV5A 3AVYA 4LHXA 1RTTA 3N8HA 3NC1C 4FOSA 4KXQA 3RWOA 4BRZA 3ZJUA 4AZVA 1Z74A 4BMCA 3L2OB 2HK7A 4DG9A 3HCPA 4U4AA 1I9CA 1IUNA 3FBGA 3SNHA 1MQSA 1QZZA 3A9TA 1WDWB 3EVTA 4G09A 4G63A 1EX7A 2GAFA 3EIXA 4OAPA 3F3MA 4U3JA 3X43A 4B74A 3L7OA 4EF5A 3PA6A 4YONB 1PX2A 2MMCA 3FH0A 3UB3A 5IDWA 2FZVA 2VDNB 5E2AA 3PTZA 1CUUA 4KX3A 3RV3A 2Q5QA 4WESB 3A6ZA 3U7IA 1S1CA 4WZBE 4DN6A 5HFNA 1CZLA 1DAKA 1EU1A 1JYFA 1PJCA 3TOXA 3IR7A 4G9GA 5H7XA 1QP7A 1G7CA 1H1LA 4DC0A 3EWNA 5CBPA 1RM5A 2XLCA 5ENDA 1Z08A 1JXMA 5SY9A 1M2VA 2YXNA 3CCCA 4HX2A 2MSEB 4N4AA 1OBOA 1WCIB 4C01A 3N86A 2EJCA 3KWFA 1BGWA 2CFOA 4B43A 4DYVA 2IW1A 2HMYB 1R7RA 2QP9X 5J9FA 4YGYA 2B2CA 3A2MA 4PHGA 1A97A 5INTA 2XIQA 3QOFA 4O2AF 4N7RA 4E4RA 1C5KA 2UKDA 4NV0A 1ZUNB 1EM6A 4TXNA 4HDQB 4OHXA 3O95A 1Q22A 4N3AA 4HWPA 2Q3BA 2LW7A 3HU1A 2RKWA 3D7MA 1ESEA 4ZK6A 3SWWA 3MT8A 3QE4A 1UJ6A 3P9YA 4N54A 5DBHX 4YAOA 4CR6A 1TF5A 1AK2A 1C8BA 1PSDA 1JJBA 3DVAB 2OCPA 3H97A 1GG8A 1SO8A 5I9SA 4CNBA 1OC2A 1ZQ1A 1NVVR 1BXZA 3Q9LA 4PLPA 3CEMA 3PGA1 4RADA 1EFVB 3GPBA 5DVZA 1G21E 1FMTA 1I3KA 1I3CA 2QVZX 2WJWA 3GWGA 2ZIZA 4Q34A 1JYSA 4AK9A 3VR4D 1N7HA 3H2SA 5GV8A 1ZSVA 3G1UA 2LKDA 1ZD1A 4R5HA 4W5HA 4DW8A 3A1DA 4MS1B 5KYWB 3NTOA 3GP5A 1EVLA 4OI1A 4H7JA 4ANFA 2PV7A 3RVDA 4Q4JA 3S44A 5G40A 4JSTA 4FI3F 5H3CA 5KTSA 5DGIA 2MSKA 3M5WA 4WCFB 3WWCA 4YGXB 5EKSA 1G5TA 3DL4A 1F7VA 4DR6B 3I4CA 3OG9A 4UQPA 2AE2A 1KO1A 4AWAA 1KR2A 4J9VA 4OL9A 1M6NA 3OTQA 2R6GA 2WR8A 4RVSA 1PJ8A 1NOIA 4M9CA 1K63A 3FROA 5ITZA 1T25A 2RGWA 4L74A 2R1UA 4KYVA 1SB9A 1FUEA 4JZYA 2RD2A 4S3MA 1MB9A 3A37A 1KP2A 4C9BA 4PO3X 2J08A 4M99A 1Y4ZA 1QCCA 2AYZA 2D54A 2HL6A 2IXEA 2C4KA 5A6SB 2C5GA 1XZ8A 4UDYX 4XSGA 3IEMA 2FEPA 2LPMA 1Z5PA 3A1EA 4FR0A 1LS1A 4IWYA 4NYJQ 4OJNA 721PA 1FU4A 1U8EA 2E6UX 2HLNA 2ZKIA 5CUQA 3HVIA 4JBWA 4HRYA 4QBGB 4WLVA 2XADA 5HKKA 3P4XA 3RD5A 3RJTA 2JGDA 2RMKA 2NG1A 5FTLA 4RTSA 3A6PC 2CLFB 5CT6A 1SZDA 2OORC 1PT9A 3T4PA 4Z0TA 1N57A 2WEKA 3QMVA 1G8MA 4YUYA 2AW3A 1MLDA 1I2DA 4I50F 5I51A 1HRKA 1YMUA 2BFPA 5AKIA 2FPIB 3ZK7A 4BMXA 3Q2IA 4Y1RA 4HADA 4JT4A 2AYYA 5F35A 3FKQA 2VBFA 1T9BA 4M9SA 5KIAA 2EHDA 3B20A 1GA6A 4B79A 1P2VA 2ANBA 2GJSA 4BZZA 1ZIDA 4D0LB 5CEFA 5KNDH 1DC3A 5J2TA 2BJHA 2GSWA 4NIMA 3EZNA 4RTKA 1S7GA 3GFFA 3VGJA 4NEQA 1E2GA 3I5AA 3CRNA 4UNIA 2VTEA 4KXXA 4P32A 3CUTA 3CUUA 4C29A 3IEVA 4GWLA 1HYBA 3KUUA 5DDIP 3ZKAA 1U28A 3BMCA 2XUJA 4YMIA 3B1KA 1XWWA 3KD3A 2C9BA 3JYPA 3ASUA 4B45A 4B4KA 3PGVA 3DUFB 2Z56A 1BEEA 1IZ9A 1L5KA 1R18A 1YXMA 2HJGA 4K1XA 4PG8A 1OAKA 2BY4A 5BWMA 5CCBA 1PVVA 1S4MA 2K5UA 2UXBB 2REOA 4JBLA 1UBHS 2WYHA 4X1IB 2B4RO 3ILVA 3OMLA 4LFCB 3KYBA 1TIKA 4CTNA 1V9SA 1CT9A 1TVKA 3G5UA 5EJ7A 3NH6A 4CMIA 5F7ZA 2OFXA 5F4ZA 1KZ9A 4LYGA 3D3EA 2XT6A 3VR2A 4KDRA 1KMIY 1ZG3A 3BFPA 3KOUA 2A84A 4EY4A 4DR1B 1ODSA 1VJRA 2JBWA 2EQBA 2B5OA 4NK5A 4QPDA 3R7SA 2BONA 3ND8A 4QDZA 1FBNA 5CA1A 2G80A 1JNXX 3D6AA 1IZYA 2XMGA 1G5IA 3MS2A 2Q4OA 4KQHA 1BD4A 1W0KD 1GZHB 3A2NA 1DQRA 1JLKA 3PXEA 4KXNA 3D7NA 4ND5A 1T9KA 5DHFA 3TRKA 1GZ4A 1AZWA 2WKSA 1RJ9A 1VG8A 3U13A 4ND7A 3BFJA 4IDEA 4BNVA 2CCJA 1AHIA 1G8KA 4P54A 4NU0A 2AH5A 3LY8A 1FP6A 4I36A 3ZQJA 4ZJPA 1JHDA 2JFNA 3OZSA 3TD9A 1Q6YA 1FJ2A 4S24A 4IIDA 1A5ZA 1PBNA 3MWEB 4UHDA 1QJ4A 4X71A 3N2NA 3VTZA 2D0DA 3CZMA 4KTTE 1AHPA 2WQ6A 4YP5A 1E3EA 1BEUB 2DG2A 5ED4A 2RH5A 1ISIA 3RQSA 1QIKA 3L1IA 4FFBB 4R31A 4RGBA 4C4ZA 4CM9A 1Q0PA 4KUHA 1EI9A 2A1UB 1FNBA 1Q57A 3L8HA 4HLNA 4B3SB 2ZBEA 5LP1A 5JXHA 3R5XA 1EK5A 1KFEB 3EEIA 4Q37A 4B4WA 4D8XA 3WL7A 3EG9A 4K8RB 5CYFA 1P5FA 4TKVA 1NBIA 2YKGA 2AJCA 1U0LA 2N1MA 3R5JA 3ESDA 1DBQA 3IP5A 3NIDB 4RY9A 1Z0FA 5CIWA 1VL8A 3GVHA 2DBQA 1FFCA 3ASYA 3QF4A 4PCUA 2XPCA 4TKMA 5NULA 4HMOA 3RAJA 3PV0A 3RC3A 1OV6A 7ADHA 3ZVRA 1P18A 3CLRC 5DM0A 2V6JA 2GM4A 1GY8A 1PR1A 3M3HA 3NC0C 3H87A 4O25A 4HTFB 4WN9B 3RC7A 1F14A 4ZCIA 1TL7C 1NT4A 2DT5A 2IOYA 4WEQA 2YWFA 3SZLA 3QM1A 1LRKA 3ZW7A 5J1SB 1KMCA 1ZD3A 1UCFA 4C4PA 5E6RA 2JI6A 3SLRA 1E3LA 3KAPA 5JV5A 4AAYA 3PHHA 3K96A 2VYFA 3E0XA 2BF7A 4MGZR 5F64A 7MDHA 5G41A 2REBA 2W2TA 4P92A 2WU4A 3DNMA 2FMKA 2PSSA 1QHHA 2BKAA 2IP1A 4FJ0A 2B7LA 4LE0A 2FPPA 2H0QA 3DYVA 4D25A 2P2ZA 3OQHA 1Y3IA 2BLLA 4ZIRB 1J56A 1HTWA 4UXHA 2YOGA 1GZ6A 2VSOA 4BE9A 4ZAFA 4PIVA 5CVDA 1JJ7A 1WAMA 2IPMA 1BXGA 1V8PA 2Q5CA 2Y8EA 3HO8A 4QUDA 4MUAA 3NBXX 3PHIA 5TS3A 2ZAYA 3KL2A 3WL4A 1L4HA 4FSHA 2NZYA 3P9XA 1POWA 2DTEA 2C8VA 3H2YA 4J2OA 4EHHA 3C1OA 2NVOA 1RKXA 1WMEA 4IIJA 4Z0HO 1NXTA 1IBRA 2GZMA 4AF7A 4TMTA 3UGKA 4ZC1A 2XGGA 4J2HA 1ECPA 3LCUA 4I0WB 5JANA 5BQXA 2JCSA 2YJTD 4BO4A 4URVR 1Z6YA 1R74A 3D8UA 3LCRA 1IAVA 2QQ0A 3CRQA 1G66A 3EGXA 3TB6A 2GRAA 2IUTA 3I01A 1EFCA 3FSJX 4PZLA 3KHUA 5CDUA 3VTAA 1HNNA 3HUDA 3CNHA 3TTUA 4YR9A 4IV0A 1C50A 1I30A 3C87A 4H0CA 3TRHA 2G71A 5AIAA 1ZINA 4Q9AA 5JR3A 3EGCA 3SZOA 5FTNA 1K6IA 1A71A 1MAUA 4E1BA 4LHYA 3Q1KA 4IILA 5HQ3B 3BMOA 5HVNA 4RNDB 5LLTA 4KFSA 4IQFA 1JR3E 1FS4A 4KXLA 4MMZB 1T26A 1KA9H 3C48A 3PNKA 3L6DA 1SBZA 2OXIA 3D0OA 3TEMA 5EQTA 4RCYA 4F38A 4KFCA 3OKFA 2CJXA 3MTAA 4R1TA 1P91A 3TW4A 5AXBA 1Y5IA 1RWOA 2JJ1D 5JVDA 1A4IA 5HQJA 3QBVA 1RPJA 4XUCA 2JDID 2WG2A 4M6WB 1IAQA 4R2MA 4TM7A 5BYKA 4MHOA 2RHGB 3CEPB 3K0BA 4YT4A 4A73A 5FIUA 1QG6A 4H16A 2YXDA 4J3NA 4II2A 3TL6A 3ZCRA 4EA6A 3B1ZA 3UGQA 5TX7A 4NNJA 2QX9A 4RKFA 3WNQA 2OFOA 3MJRA 4X5OA 4D6PA 1TJPB 2J46A 4YT5A 4EFKA 2YZNA 4YPVA 4YX9A 3FBWA 5DNUA 1VE1A 1NBWB 1LVHA 4X00A 2Q0HA 1QS0B 1W1UA 4LUCA 5CM9C 4QUEA 4Z9XA 5LLDA 1UAAA 3HCWA 3VZPA 3GLFA 4DBZA 2UUBB 4OJTA 5KTOA 3B3JA 4GI7A 1J2UA 3R7FA 1GT6A 1Q1GA 2IZOA 2XA9A 1KBOA 4M36A 3X1WA 3ZE2B 4BPRA 4FFOA 1JIVA 2I91A 4OCZA 3IBTA 1XZDA 2ZI6A 4MUIA 3V1TC 4ZV9A 2ZIEA 2KWIA 3GHYA 3TQSA 3I5UA 3CG0A 2IIPA 2P1RA 1S3FA 1FTNA 1PZHA 2PWZA 1TAHA 3DEHA 3NRCA 4DUZB 4BGVA 3A4YA 3IESA 1AS3A 4WNCA 4GT1A 2WF6A 2QAGB 3DZIA 3EXEA 3WQQA 4DSUA 2BSXA 1J5EB 4X92A 4K6KA 5KTKA 1DV1A 2YRXA 3TEJA 4IOJA 2FK8A 4ZOBA 1SD2A 2AF3C 3FI0A 2C5EA 5C34B 5A9RA 1U7XA 2Z6QA 2OYRA 3H8SA 5AJXA 1ORIA 2HNBA 2PBFA 3A3OA 4IHJB 4NJEA 1W5FA 4LXUA 4I99A 5I45A 2WSYB 3CW9A 4RF3A 3PRKE 4RGVA 3O8LA 5AKKA 3TZLA 4ZICA 1FFEA 1I6MA 1ZIPA 4UVHA 4KR9A 3QEOA 1KAMA 2H1SA 3ZTWA 3U4GA 3FTQA 1P80A 4RK0A 3E23A 1UM8A 1XJQA 5T57A 3GVCA 1CEEA 4L0DA 3CF2A 3D3QA 1ISMA 5IMBA 5K9ZA 1U0JA 2NPFA 4B6RA 5K1ZA 3RIMA 1U7OA 3T4UA 1S2MA 1EP2B 5JSHA 4JI0B 1SG9A 2ZJ1A 3GT4A 1RHQA 4B81A 3QHPA 3UAZA 2V6MA 3LY5A 1I4EB 4H6PA 3AUTA 1FYWA 1Y80A 1CLEA 5KVSA 1RKVA 1BFUA 4IZ6A 4UJ3A 8LDHA 1QK4A 1HZZA 3AU8A 5AM0A 1Q3TA 2IEBA 2E4ZA 4BE4A 4Z4CA 3FPFA 5LIRA 1VSTA 1LPMA 5AW3A 1L4EA 3LI2A 4PGFA 1O9BA 3GRRA 3QQPA 6GPBA 1O54A 1KVUA 3RVKA 1JX6A 5DIZA 1EG2A 1X80A 1XEWY 1YDEA 1QZUA 4EMBA 2X4GA 4ZDWA 2HOQA 2PZ8A 1HDZA 1M73E 2V7GA 3PYMA 3ER9A 4UZFA 1GAWA 1U28C 3IEUA 3JU3A 3ICCA 4PAQA 3FUTA 2PHZA 4NCNA 3OWHA 3AR7A 4X54A 1J33A 5FTJA 3R7BA 4D9NA 1Q12A 2QB5A 1GCGA 1UIRA 3ZHZA 2FG6C 3MRXA 4EO9A 4LN1A 1DKMA 4K1LA 5ARBA 2ZIXB 3PEFA 2IZ5A 2G0AA 1YQXA 1BCSB 4DR3B 1A7JA 1W6UA 3L8CA 3ILSA 4WBXC 2NUTB 3SMQA 5B37A 1XPJA 2XWBF 3ENQA 3DTVD 3KJZA 3KT6A 4GE0A 1C8KA 1EZ4A 4YNBA 3WB2A 5CA0B 3MLBA 1WKCA 4LXQA 5B30A 5KYKA 2FOLA 2LXNA 4AUEA 1UZLA 1YNSA 4GMHA 4F21A 2WNIA 1FRVA 4RV5A 2ZIUB 3SF0A 4CKEB 3SR0A 3CO0S 1RI4A 3H18A 1DX4A 4LF7B 3B51X 3GP3A 3ERCA 1HDRA 1JH8A 2H48A 3OHPA 2AQ8A 5GP1A 5L3RA 3LDFA 5CIYA 1JB9A 3OMWA 1H8HD 3AVQA 4J0DA 1JFVA 3THYB 2AJ8A 3T1HB 1JECA 1WHTB 2IIVA 2QY6A 2ZYSA 3LX4A 3P9QA 4GHWA 4LJ4A 4OXIA 5LB2A 4KWIA 5AW2A 1A77A 2HUPA 1OPXA 1FVOA 3R0JA 3W2HA 3GPLA 3QTBA 1F1BA 4PX3A 5BNIA 1QNFA 1V16B 4GECA 2PS3A 4I8XA 1JMVA 3ORRA 4XWTA 3EXHB 4ZA2A 5KYXB 2A0FA 1HYHA 1PWEA 1THGA 2HNAA 2PGXA 5B1IA 2QPTA 4B87A 2IGTA 1NG1A 3RVQA 3UXMA 2FJUA 4ZCRA 2OB2A 3L7CA 4WLOA 1AXEA 3WTBA 1NUTA 3FZQA 5F7JA 2PLAA 5JFOA 4H6XA 1D2MA 4GOND 1P45A 1T3HA 2YNMD 4E3ZA 3G89A 4N5NA 1D6SA 3L41A 1SB8A 3H42B 4XARA 1RVDA 1Z7WA 5K20A 2A3NA 3ZV7A 4OM7A 2GI4A 4EY5A 4ZOEA 1U9CA 1DUIA 1EESA 1HK7A 2R2AA 4BXOB 4AUKA 5A4AA 3O7WA 2KI5A 3WP1B 4OI0A 1Q0QA 4HDAA 2NXEA 3UKJA 5H16A 4NESA 4E22A 5EMNA 2XZOA 1RYBA 3GK3A 1K0FA 5TVGA 2GR9A 3COSA 1WSWA 3PNLA 3PZRA 2ZQ5A 3R2JA 2BUAA 2PPVA 3DEZA 621PA 5A3JA 2FMFA 1P6UA 2NO5A 3TCKA 2P0YA 4C08A 3PX2A 4YJ2F 5FP0A 1FNMA 3FB4A 1H4VB 4M0LA 4MRVA 3KAQA 3W6PA 2H54A 5C4GB 4MUMA 5J47A 2HZBA 3A32A 2YASA 3GOHA 1MP0A 3S28A 3W2EA 3B5IA 1N2CA 5HGXA 2XWJI 4TXLA 1YASA 3OTIA 5FPSA 5LBIA 4EB6B 2O5CA 3W4KA 4B3TB 4GVXA 4LGCA 4RY0A 1TB4A 4IJQA 1U6IA 4KWEA 1IUKA 1TCBA 4TTJA 4AF8A 4UFPA 4AY2A 2GJ9A 1WKBA 1CJUC 1YRHA 3EQZA 1WW8A 5CFMA 3BRWA 3VBEA 3E7FA 2KPOA 4LJLA 1HX7A 3MLAA 1YC5A 3TQIA 4NC9A 3PEUA 2YXBA 3P5BA 4OB6A 2IDMA 2ZJ8A 2AN4A 1HH4A 2OBNA 3AB7A 3HADA 3IT2A 1IIBA 4UREA 4ZT3A 5HK9A 3R0IA 5IUKC 1K8YB 4N8SA 5FB3A 3LUBA 3MB8A 1CUGA 1KL7A 1XRPA 4QYMA 3OFND 3RS9A 1Q95A 2VHZA 3S4YA 1DQSA 2NSHA 3SN6A 2HXSA 3C7DB 4G8BA 5IC6A 6PFKA 4PRLA 4GKJB 2ALJA 2LRHA 2ZRPA 4HAWA 4IFIA 4OREX 4QECA 1NM5A 1LW7A 5JXIA 2HSDA 2X4LA 4JEIA 2YY7A 1J00A 4FOTA 4QGBA 3Q41A 3EPKA 2IXFA 4O5OA 3G6WA 3GLUA 2QZSA 2M1XA 4LNUA 2VUSA 1PU2A 3IBYA 4M1MA 3TF5A 3NGMA 2PQMA 2RGNC 5A0VA 3LO5A 1C7RA 3UANA 1B23P 1JHVA 4JUIA 4DLBA 4RH3A 1RAEA 9MHTA 1U3TA 4BTEA 3DCJA 1PFQA 3HKBA 4JLKA 4IHAA 2GCGA 4AU1A 4R51A 1P2FA 4QQKA 2IZ0A 4KVZA 1MIHA 1R6UA 4ND8B 4B7XA 4BKQA 3PNOA 4GPAA 2ZBQA 2IQIA 1E79A 1VCMA 1CY6A 2IVFA 3JVUA 5FH9A 3S0JA 3UCXA 4YMTA 4V02A 1L7RA 4CM4B 3RFFA 5JD6A 4R6XA 1EZZA 5SZJA 1RKQA 4QEKA 1G21B 1N2SA 4UU1A 1DXHA 1VSUA 1YBHA 2ZB3A 3PQ8A 4FU0A 4IF6A 1GR0A 1WXIA 4ZYUA 2NTJA 4CMJA 3SVTA 2VT2A 3KLOA 2EATA 4GRIA 4IHJF 4LYAA 4HRVA 4WK4B 2I6FA 4GP9A 2W2OA 1OMOA 2AFRA 4GLOA 3BB1A 3K35A 5D3QA 3IO5A 1KKMA 2QJTA 5FT9A 2PSEA 1LCIA 2F64A 1L6IA 5EIWA 4AJ9A 3HPRA 2RHTA 4DMCA 1LS6A 1URPA 1ESNA 3CLHA 4N76A 4IIUA 4J0GA 1G9SA 5B7NA 3TLMA 1A95A 1B26A 3A1UA 4V0NA 3T3MB 4NTZA 3UCFA 3I6BA 3SSMA 5H59A 2J3QA 1KAGA 4EAAA 4PAMA 3RT9A 5JDIC 1MW8X 3FTCA 3K3PA 5K3FB 5C4IA 3ULKA 4D5GA 4DLAA 5H4GA 2GARA 3I58A 3R7WA 4KBYA 1J7KA 1AURA 1R0CA 2Z4RA 2ECQA 1ORVA 4MCHA 3U56A 2IBSA 3BSWA 5HRUA 3MBKA 1M9NA 3V9AA 1V3TA 3CKLA 4LK2A 4DNPA 3OLYA 3RASA 4C7XA 1GFSA 3EPLA 3B1WA 1TO2E 4Z86A 4CFSA 3NDBB 2QN9A 3LIIA 3MWGA 3WIBA 4AT1A 1PNQA 2V54A 4HQOA 1ZNWA 1T3SA 3HFGA 2SKCA 3CNEA 4KB5A 3C4JA 4MR8B 1L4NA 4RD1A 1E7WA 1JG4A 1FRZA 5BUZA 1XRRA 4QT0A 4X1OA 1DRUA 4WCDA 4KBGA 3KT8A 4PHCA 3UZUA 2H9AA 2M32A 4AKIA 4Q1EA 4ZVKA 5F12A 2MR6A 2Z9CA 3U9TA 1VE6A 2QF7A 5IJXA 5A5VA 3W5BA 4Y9RA 4JCCA 4ACAA 1T5LA 2FP3A 3KIPA 3M6UA 4GG1A 1T1IA 3PEEA 4Q7JB 3TI7A 4I1SA 4AVYA 3DVLA 1FDTA 4F4JA 1G9TA 3I6YA 4E6PA 5B7GA 1XMVA 2UVQA 1RC8A 4HGQA 1SAYA 3UCEA 1ISPA 1EXWA 1Z18A 2QOEA 4HQRA 3VPCA 1FYVA 4KE7A 1KVQA 1YB2A 5CA0F 4OKIA 3ZKWB 1NQUA 4UHHA 5LIPA 1DJMA 1FPQA 1EFKA 3PNSA 4R4JA 4PQEA 4UULA 1OZFA 2IL1A 1U9IC 5FYQA 1JIUA 2F8SA 1JB1A 2OWEA 3D8BA 3O6VA 2VDQB 3HNRA 1ECBA 5D84A 2ORWA 5B1YA 2C59A 4ODIA 1HYGA 1V6SA 2NYUA 4Y1GA 3IMGA 4S05A 1BC5A 1YBAA 4S1PA 2P3LA 1L8LA 4JV5B 4O2LA 4Y2QA 4H35A 1U7PA 1L4GA 3F7NA 4MVJE 3Q8KA 4P81A 2EL9A 4XGIA 1M0WA 4DUGD 3QIAA 3R7LA 1NRXA 3MCAA 4YQZA 4QELA 2DQ4A 2PA0A 1L5HA 4BFTA 1TJYA 4M9XA 3K09A 4RTLA 2WVGA 1G4AE 4QZVA 1RZRA 4XQ9A 1YOBA 1E3DA 3M9XA 3OIDA 4ESEA 1GV0A 2HAEA 3QV1A 2BLNA 2LZ0A 1E94E 5D00A 3JZIA 2PKEA 1R0SA 4LRWA 4DCMA 1MJGA 3WGYA 4NVRA 3RWMB 1HGXA 3IALA 4JMPA 3P7MA 2IT1A 4P7BA 1NFQA 1RT9A 1ZU4A 2IU0A 4LMRA 1OU4A 1H2AS 1N92A 1LPNA 2FV8A 2BR5A 3OZTA 3G23A 3FOCA 3SCZA 3CF0A 2DR0A 4DPKA 2O0KA 2M6LA 3TEFA 1D1QA 4L02A 4K9LA 5JNWA 4H27A 4S12A 1P0CA 1ST2A 4O08A 4UE3S 3OLCX 5THXA 3MG9A 3VAAA 4YQYA 1YMVA 3PPVA 3VR6H 4FPXA 4K9MA 1VPLA 4TWJA 5EYPA 4YUVA 3W8RA 3WGOA 2X0NA 4HEA6 5TV2A 4C4AA 1H5QA 4D9BA 3EUWA 4J43A 3WTCA 1SWWA 2X5KO 3VKWA 1NLZA 1KDTA 3Q98A 1XQWA 3PXBA 1P8AA 4OOEA 4YUXA 4D6YA 1CKEA 1MC1A 1CJCA 1DKNA 2FW9A 2AOTB 3ABZA 1UFOA 1A4XA 2Z1DA 3E9YA 3FFWA 3KZOA 4IEFB 2GN6A 3KB6A 4JIGA 4PNPA 4CKBB 3TGLA 2C29D 4F7WA 2IJGX 4Z3DA 1MMFB 1N2OA 1P6XA 1VIVA 4EX7A 3UMVA 1M2GA 1J1IA 3AR4A 3SE7A 2VHUA 3D6MA 3DAHA 1EHYA 3AFHA 1CJSA 3O74A 4MUKA 5CLJA 5F5XA 1CJMA 5ES3A 1NQ5A 1GKYA 3FDZA 4QUBA 1RJGA 3LQKA 4RAOA 1A7KA 4ESOA 2EP7A 3U4CA 5I7FA 1TYDE 3AWDA 1J25A 3W0LB 3ZBUA 5F2NA 5A02A 1OOEA 1KP9A 3BMQA 4HATA 4A0HA 4FWBA 3V1UA 4EMUA 1SXJE 2XVXA 4UM9B 4P7JA 2OCDA 4RZUA 5IM4A 2MWMA 2W2LA 4CF6A 3AV0B 3N7AA 2R7NA 5AK6A 3A2KA 1YQUA 1EEHA 4H7EA 3NKVA 3BHJA 5KQSA 3C6QA 3OU6A 2PUTA 1TKRA 4Z1MD 4MPDA 3NAMA 2V3WA 1FF9A 5ELXA 1KBZA 2CDCA 2OPBA 2PY6A 4BVLA 3GI1A 3UICA 3RVBA 1RR6A 4RK5A 2P3SA 4XJSA 1Y42X 4L22A 4QOIA 2IYSA 4W6ZA 3FYSA 4DQ0A 1EE9A 3DE6X 1GU7A 1KZ7B 1XWFA 2JL1A 3OEHA 1HTBA 1KMQA 1XD8A 2EWMA 4HDSB 3A4VA 5FOWA 3RTAA 3ZQKA 2VTBB 5AM5A 3U4AA 1KZ4A 3OT4A 2WKWA 4N41A 1YWGO 1GU0A 1P2GA 3GEIA 3GGJA 4EITA 5BSVA 1Y8ZA 3RH0A 3MCTA 3NNNA 1T5HX 1P4AA 1ILWA 4IHKA 3LPDA 1LSUA 2VJQA 1PDVA 5I7SA 1O5OA 1WOYA 4H0FA 2VIIA 2GM3A 2OHVA 1T2FA 1SUBA 1NSFA 2XYPA 3S2UA 2ZWVA 4CIWA 1C1XB 1KYWA 3PHGA 2IOFA 2F43A 2NTNA 1NM5C 1C3JA 1SQSA 1TQ6A 3PIDA 1MOQA 1PLLA 2DECA 3C6KA 2E87A 3NZEA 1ZM3A 2VNSA 2XDQB 3ADDA 2XQKA 4TV8B 5B6JA 5JYBA 3RYCB 5LUBA 5C0OE 4ILKA 3KJNA 3U4QB 1GTSA 3BJEA 4KPYA 1F5SA 2IY8A 3ACBA 1N2GA 3KZXA 4R9RA 1Z62A 3E9DA 5BN5A 3A6FA 1V8BA 3NP7A 3AVOA 2A92A 3C3PA 3FVTA 2VZ9A 5FL7D 3PQFA 3HDJA 1OBHA 3I2JA 3OQVA 2J9FB 3CN7A 1MZVA 1E3IA 1PN3A 3FETA 2CNDA 1SQ0A 3B2NA 2OOKA 1XTIA 4ILEA 3F73A 2ODQA 3IQXA 4GR5A 2BKUA 4EW1A 1KXZA 3IQHX 3PFNA 1CUVA 4QOFA 4G0QA 5DP1A 5BT8A 1Z7EA 2RIPA 3NVDA 2O3QA 3ZTTA 3TGPA 4KAXA 1KS9A 3AOEC 3MA0A 3FOBA 1W93A 4E21A 4TVSA 1IB0A 1NC1A 1BHSA 4M3NA 3AIMA 3AP1A 3OCVA 1BDBA 2GQ0A 3DTVB 1RLMA 3VV2A 3PDWA 4N7JA 4DQDA 3W79A 3MTGA 3DZ8A 1RRPA 2DFVA 1UF9A 1NVVQ 2IU4A 3EOAI 3EUFA 4FFRA 3O8RA 3OAAA 2MYNA 3N59A 4ND3A 4NENB 4PICA 4YWJA 2QRMA 2HSZA 2XITA 1BXRA 2FPSA 2OKGA 3TVDA 3V2GA 5SYNA 3ROGA 1OFTA 1AMUA 1KDRA 1GRCA 1ZK3A 1VXRA 3GMSA 3EJ6A 2Q3CA 4JEUA 3AEQB 2W71A 4BFUA 2C04A 1N0VC 3ZWBA 2M1ZA 3FTNA 1YZLA 3JAWA 4YJ3A 521PA 3K9QO 1U3FA 4L3VA 3E2PA 4R83A 4MWCA 5JZ9A 4W5QA 2R8XA 1XKLA 1XU7A 3FUWA 4BWFB 1CVLA 2OB1A 1X38A 2IDJA 2GEJA 4FONA 3N2KB 3WSTA 4XAQA 2FEWB 3K5HA 3QVOA 4NQZA 1EKXA 2EZUA 3HBNA 2AOXA 1QORA 4FXPA 2Q7DA 3SKYA 3WLQA 4BNYA 4EPWA 1BEZA 1A72A 1WP9A 2XRYA 3HKDA 2AE1A 2Y0BA 2YHAA 3IHKA 1YGYA 4H31A 3T06B 2QMQA 3TECE 3EC1A 1SURA 1B8NA 3ZWYA 2WDZA 5LJIA 3KEQA 3TINA 2Q1SA 2WFLA 2AMLA 5FUBA 3IQGX 5TMDA 4QTZA 3V9PA 5EEGA 5AK3A 1M74A 2XAUA 1L4KA 5AICA 4NARA 3H6KA 1GZSA 3ZDRA 5HW0A 2AOUB 2VPPA 4OLFA 4PFJA 3QYJA 1U31A 2BBSA 5IS2A 1UMKA 4JC0A 4AQYB 3DZGA 2PRKA 3MQ2A 4M0DA 4D80A 5KS2A 2QRVB 5ALDA 1GSOA 3QKRB 1UKZA 2H1FA 5ALZA 1ZUWA 2PKRA 1NL3A 3LJKA 4C7VA 4F6CA 4IIBA 2DPMA 4UBIA 1Q2UA 1SIUA 2PXHA 3LHKA 4JSYA 4KIUA 4QJIA 3UJAA 2WT9A 5F7OA 1TLFA 4RORA 3OZEA 4QOHA 4RQBA 3FJOA 1VP3A 5JJCA 3FA2A 1C8VB 3B8EA 4ZI7A 4MA4A 4TXMA 1SOVA 2B4KA 3NOXA 1D2EA 1FJHA 3E9QA 4G1MB 4Q47A 5DH9A 1P62B 4TL7A 5EIXA 1VBNA 3I6IA 4JXKA 5DNAA 3KR9A 3QYFA 3UUEA 6ADHA 3PEWA 4C5CA 2HJSA 1KEKA 3RTEA 2V5AA 1Q1BA 1RXIA 3Q3VA 2R5WA 5AWFC 2O05A 5DTQA 3KKPA 1QYVA 1KE2A 3JQFA 3LRTA 4RTRA 5ALGA 3DJYA 4L5AA 1HDYA 3SQOA 3OF3A 5F5NA 4AMUA 2QNBA 2VT7A 3RUPA 5IWAB 5K8VA 1E9BA 2XA2A 7REQB 2WJ6A 5AVRA 1HQYE 5FV4A 4BNUA 4MR7A 5T4HA 2DQKA 3CLUC 4IGAA 4CU2A 2UUCB 4KQMA 3FPHA 1TADA 4FYPA 4QNMA 5DW0A 4IDPA 2I80A 2PVPA 2BVNA 4UQLA 4PYKA 3OKAA 2WKPA 3PDIA 1P9RA 4DFDA 1PWHA 4II3A 3ZZUA 2HN9A 2CL0X 4LV6A 1RXCA 1WDMA 2W7TA 5JO9A 4EELA 5CVUA 5TQ2B 1STOA 3PQ7A 1T4DA 2GAAA 1M1YB 1Q19A 2WWIA 3HV2A 5KTPA 2P2NA 2QN7A 2VXYA 3TQTA 2WMDA 2G4CA 1TM2A 3U17A 1GT91 2VEDA 3D6VA 4BWYA 4KWTA 1ZVVA 1J39A 1Z4KA 2ZSKA 2D0IA 3MRVA 1QDEA 3PEVA 3CEHA 1NJ6A 1UJ4A 3CSSA 1CB0A 2MSLA 3A28A 3ELBA 3SSNA 3WC4A 3MFQA 2AJBA 4BFLA 4EUNA 1BS2A 1UBSB 2NU8A 4H4EA 1BNCA 4UFNA 1WWKA 4J9UE 4G0UA 2XHZA 1H9BA 2OCIA 1XLVA 4HUQA 1JLMA 1RRFA 5KNBD 2HQOA 1I33A 3TCNA 5DRYA 1CQIB 3T5TA 1TFUA 3FBTA 3BJMA 2GN0A 3Q12A 1U9JA 2GZSA 2VF4X 2B36A 3DC2A 3DBHA 4TTAA 2X22A 3TBFA 1LFDB 5KPDA 1VL2A 3GCXA 2C0QA 1XEAA 2SECE 1N2HA 3FW1A 3RYTC 4LF5B 3JZAA 1H2HA 3X2SA 1OFIA 4YBRA 1QR2A 3WRVA 3BZWA 4KQWA 1C9KA 5ECWA 2C3YA 1RXYA 1NG9A 3KDSE 3N76A 1XC7A 1C1DB 2XOKD 4HH3C 1ZCZA 1RMTA 1QFJA 4MVJH 5BURA 5KQLA 3ZOKA 1KY5A 4CV2A 1Z4QA 2KHZA 2W42A 3THWB 4GBGA 5FBRB 3A7EA 4ZREA 3HZOA 1SU6A 1SC3A 1ZH2A 5JE8A 2EDAA 2X5OA 3JSAA 3NT5A 3OQ1A 1N8NA 3SEAA 3TIIA 4EY3A 4Q1FA 3SGLA 3HB7A 4R1PA 4KK3A 4MKHA 3KFVA 4BLRA 4GC5A 2GD6A 4DIKA 4AMYA 3T7IA 4UEQA 2D0OB 3TOVA 2I4OA 2AXEA 4MUJA 1D8TA 4F6LA 4XGNA 1C7JA 5KO2A 2IYLD 3O7MA 5I9IA 4JJIA 4E2XA 2H00A 4HDNA 4OI4A 1OILA 2NT4A 3H6GA 3JTEA 3RSOA 2FP4A 3KJQA 4KQGA 2IUEA 4P7GA 4TV8F 1U63A 2DGDA 2A5FA 1DQNA 2G9ZA 2CDRA 4GPD1 3H16A 4B3RB 1KQFA 4HLUA 1UEXC 1X74A 3W7VA 2BM9A 2ACEA 4OYHA 3VKHA 4UU8A 2O4CA 3U3ZA 3I37X 5B1HA 5DFAA 1N0HA 3ICEA 2UZ4A 4CHTA 1QU3A 1O97C 2BHTA 1RM0A 2D59A 3DMPA 2CUZA 3P94A 2ZJ6A 4E5VA 1X19A 2CFCA 4NZOA 2PN1A 1LH0A 1QGOA 4ON9A 1PFVA 2WFAA 5BQOA 5BVHA 1P0MA 2XMPA 3EGIA 3RF6A 2BTQA 1ARZA 4B71A 3BL6A 2Q27A 3MGBA 3QUTA 3QGMA 4URWR 1U7TA 3RRJA 4GZLA 5B3AA 3D3WB 3E4DA 3RC9A 1IBLB 16PKA 1J9EA 2O0HA 4UUQA 2CUTA 1BWSA 3BTOA 2F8MA 3FRIA 1U94A 3R3UA 4TRJA 4X3CA 4DIUA 2F8TA 3CQ9A 4KI7A 1OREA 1T0IA 1VJTA 2C1ZA 4RE5A 4EG3A 5KMGA 5H8WA 1ZWKA 1DJQA 3EZFA 1U8ZA 1JZQA 1UPTA 4W9MC 3IERA 3SSAA 3NAZA 2QJFA 2CMHA 4E3WA 3IJRA 1MO3A 2CV1A 1EK1A 1A4UA 1V7CA 3BGVA 1KGSA 1XDBA 4YO7A 3THXA 1II8B 1IY8A 3D5EA 5EIAA 2OYSA 4R8MA 1FW6A 4EMTA 5JAPA 1EWTA 1GNRA 3E3OA 4GKVA 4RZIA 7MHTA 1ZCBA 4FC6A 2ZBUA 4XD7D 1Q0LA 2E4AA 1E3WB 3K30A 4RMGA 2DLNA 2G40A 2O7VA 4H1VA 4DYDA 1O57A 3CFYA 4O4IF 4TT8A 4HNHA 3FB1A 1MV5A 4M37A 5FOQA 1CS0B 1UADA 1NV8A 4HVAA 2YFYA 5KVQA 3B3AA 3GLHE 3URKA 4B2LA 1PZFA 1UOEA 1YR3A 2VHTA 4D9JA 4DZTA 2JFUA 3CRZA 1XNRB 2NO1A 3O1HB 3MEQA 5MN4A 3W6ZA 1Q83A 1SVNA 3M5PA 3VZQA 3VO8A 4F5WA 4QG3A 2GTPA 2FF5A 1B73A 3OU2A 3Q7QA 4LHWA 4ZOAA 4WA7A 4D92A 2AG8A 2B6NA 3LQ1A 1DAMA 3EVFA 2RB5A 1KOGA 3AVTA 4BVFA 3GNQA 2R60A 3A6JA 9GPBA 5FAKA 1X7XA 1YZ3A 1G17A 4S1NA 4YRLA 1TCCA 3O91A 2D7JA 3CJRA 4EPRA 4J0JA 4CLRB 3C14C 5HCNA 5BOSA 5A71A 4OBBA 5ICGA 2WF7A 3X1YA 4NS1A 4LDPA 1HF3A 3BQMB 4KDFA 3VR1A 1DBWA 5JXWA 3I4FA 2R8EA 2RHMA 5BMOA 3HE3A 5IF9A 3EDOA 2PQ0A 4GP6A 3UK0A 4CL2A 1CD5A 3WIOA 5HIAA 2ZITA 2C07A 4PV7A 2HIGA 1L3IA 1P31A 2VQ6A 4MINA 3PIRA 4QASA 3OOHA 4KR7A 1E1CA 1CY2A 2VHQA 5JY1A 3N0TA 5AHRA 3BTUA 3F9CA 2W2XA 5CGQB 4KPUA 5AXDA 2GK6A 1U9YA 3H2JA 3RDPA 4NULA 3VZDA 2W93A 4D3YA 2KLHA 1NVWQ 4CIYA 1EGQA 4YLGA 2WAXA 4V03A 2JARA 3RR2A 3R3WA 4CIBA 1AQLA 4M1TA 3HZHA 4F1WA 1P3Y1 2RG1A 3IT3A 2YIJA 4C6TB 2C2MA 2V7PA 5E9AA 1H1TA 3LYAA 4L5CA 5ED0A 3AR5A 3T3EA 1DJPA 1XYYA 3KPUA 4X97A 5JZOA 3DL0A 4CQJA 1RQRA 4PSCA 4IMPA 4UVGA 5AQEA 3KSRA 3FTEA 2DQSA 1UDXA 4MW5A 3L0CA 4KQEA 4HDKA 3SY8A 1VI6A 5EXTA 2BZGA 2JB9A 2Q5LA 4NX2A 3V2IA 1O6GA 5JQGF 1NPYA 2CNKA 3QLEA 4MICA 3TKYA 4U2BA 4ZQBA 5B36A 1I14A 5KJ6A 4GR9A 3DDZX 2YZ2A 4XGKA 3AB8A 1ZUIA 2ZCVA 4LF9B 3PUWA 2JLXA 2DFTA 1YRQA 4UTVA 4EFNA 3HKEB 2M9MA 3H13A 2P7HA 1MV8A 3DP9A 3MYYA 5HMLA 4DWVA 1U8TA 4LHEA 1KQNA 4LZJA 4G5HA 3H1TA 2PT6A 3DH0A 3P26A 1G20A 2FGJA 2IODA 4NE7A 4KXYA 1RPAA 2O2IA 3V3KA 3Q0EA 2Q2VA 3T5AA 1K6XA 4QQ8A 5D3MB 2HQ1A 4BQSA 2HHHB 1DG9A 3FNBA 4DKJA 1MZPA 4CRWB 1MO2A 3HACA 4WXMA 1Z4MA 1DWOA 1P3DA 1E5TA 2QM7A 3KEFA 3KOWA 5JRZA 1KFJB 3HJRA 5CTAA 3EFOA 3A06A 3CUVA 5FWAA 3WL3A 5JJBA 3RSLA 4W7HA 1I5OA 1R0YA 3B1FA 3MWDA 5DYGA 1O4WA 1PG0A 3OA2A 3L1UA 5DU2A 1PR9A 1XROA 2W70A 2ID4A 4RTJA 2FPRA 5J4HA 1MU0A 3MRSA 4FYVA 1VGQA 4WK0B 4MS3A 1R6XA 5CDYA 3MF4A 2H4YA 1JDUA 3KCNA 2QTWB 2W6JA 3DLAA 4KGDA 5CW2A 3H7IA 4AM8A 3GQBA 4UM8B 4HDMA 4TVOA 3K16A 2FXVA 1THMA 2VNAA 1XD2A 3Q8WA 3T5BA 4PR0A 3G79A 1PVOA 1V8OA 3LOUA 2NUAB 4C7KA 4IIHA 4I6JA 3CVXA 5I5GA 1CUYA 5ERYA 1B8VA 2BI8A 2WJGA 4NOJA 2NTYC 5AW4A 4M0MA 3L6BA 1JR6A 2BHRA 1TD9A 1OLUA 1PZGA 3MMZA 5AFSA 4KYUA 2GFIA 1ENOA 4PCAA 5HPYB 3S99A 5LC1A 4MRMA 1OZGA 3FFXA 1E6CA 2ZRDA 4I1IA 3TLXA 2WMOB 4LS3A 3RC8A 2DPHA 4RPGA 4UEKA 1GTG1 4EFMA 5HKBA 3UWSA 4BZQA 4HUJA 2V8OA 4UTXA 1U1FA 1EFHA 1LBSA 1PEAA 2NO4A 2O3JA 1N9KA 3GH1A 4I5EA 2PGIA 3M4ZA 2PPLA 3BF8A 2XAAA 2AZTA 4CM3A 4URYR 4CGYA 5CDFE 1YCDA 1JIXA 3N74A 5ISMA 4ZGWA 2GYVA 1VB3A 2PQ2A 4JWKA 3DV2A 4GSLA 5GONA 5I7AA 4OQYA 2G9QA 2IHTA 1KY4A 3OC0A 4OUDB 4CW7A 4JJFA 3AHCA 1EX1A 1YKGA 1HL3A 4I5GA 1MW9X 2HR1A 4LMBA 3JSXA 1VG1A 3QEMB 5B4UA 3SJCA 1EBBA 2Q1UA 1NC3A 2OV4A 3S3TA 1OXVA 2WAYA 1FTSA 4HG2A 1SQ6A 1UK7A 1E1RD 3WX0A 4X8OA 4EG5A 1GN8A 5CFNA 1BDIA 2HY7A 4EPTA 2HHAA 3KHKA 4QGAA 2VBCA 4W7IA 3ZEIA 4H1WA 5JSKA 3L8ZA 3CY6A 1YB5A 1J8YF 4ZKEA 3VVLA 1SXJB 7ABPA 1BE1A 8AT1A 1RQPA 2IWRA 1UWVA 3GFRA 3PVZA 3PXDA 4QICA 5HRAA 3QTLA 3UXEA 2CZGA 2B5VA 1V6CA 4DCOA 5E4FA 1GXSB 3B8HA 1G1MA 3EAGA 3QVGA 4AY5A 1U8UA 3NNSA 4WZAB 4X8HA 5CX4A 1UBFA 5BMVF 5IAKA 4HAUA 1SCIA 4YA6A 5A7HA 4HJXA 4JOCA 1QO7A 1CSEE 1MAAA 1GGKA 1PP4A 2C97A 3E84A 1J2EA 2PKQO 1L1FA 1SBHA 3RG8A 1PLKA 1VHQA 3EQ7A 3A6HA 1NNUA 3MOSA 2ORVA 4XLTA 1DKUA 3NXKA 3P5SA 4WX2B 2I7DA 4DAEA 3OIFA 4L27A 1U1IA 3ESQA 3TLZA 1FX0B 2HC9A 3NUGA 1C0KA 3U44A 3TQRA 5C9ZA 1WU8A 1QIMA 4GRAA 3L05A 3HHPA 3MTJA 4AMVA 5T64A 3EZXA 3WLSA 3KZ1E 4MDFA 1THTA 4HLUC 4ZU3A 8ABPA 1O8CA 1ZITA 4G5SA 2QL6A 1J8QA 2C5FA 2PH1A 3H11B 3KKEA 4L8FA 1ZJZA 2ZUSA 3SX0A 5IDXA 3A05A 3PDCA 1ZH8A 1I4LD 4Q7KA 2G9RA 3E9MA 2V9PA 2XYVA 1P8JA 4GWKA 2AN3A 2PIDA 2F62A 1UQTA 2X4DA 1UANA 3G02A 3KEOA 3TE7A 4YT8A 1JBKA 1B00A 4C0QC 3NETA 3WZ2A 1KU0A 3BD8A 5F1YA 5IPFA 2QNRA 3GLIA 4IWNA 2G5CA 1CVIA 1VJ1A 3DCYA 2FE4A 3ZBQA 3RADC 5FBKA 3GJ3A 2QVCA 4ECAA 5EZ5A 4I5DA 4WFQA 4EEXA 4ZDKA 4KSYA 4IG9A 4WQMA 5EE9A 4JBHA 1TUBB 1HE8B 2EFEB 3H9CA 1QCDA 3LCMA 1HFJA 1RQNA 4ZO9A 1TPZA 4JYZA 3DM9B 1XKTA 3U4HA 1SC9A 2ST1A 1LI5A 1LV8A 2VF7A 3IE1A 3M6IA 4FDMA 1AKEA 3H65A 3MINB 5ADUS 5L53A 1T36A 3LPMA 1P0PA 2CHQA 3HLKA 2ZJOA 3UXHA 4BNZA 4JI5B 1JKJA 2G28A 4EB8A 2GXSA 2IHUA 3IVRA 3FDIA 4L2IB 2G1JA 1B4DA 2GBLC 1NX9A 2W6ZA 1B3BA 3JWJA 4QPNA 3WK4A 2PUEA 4BGIA 3BJIC 1W5SA 2GHQA 3Q3HA 1DBSA 2RCNA 4IDCA 4OUKX 2X6RA 4DNQA 2EIXA 3P9KA 2VYNA 1P1KA 3O94A 3QA3E 3I09A 3VPGA 1UEJA 5CG1A 2PUFA 3ANLA 3H2ZA 3BDIA 1C7IA 4Y2GA 2BKXA 3IB3A 1GSAA 3HJAA 4RSGA 3LTNC 2PZLA 3JRXA 4TUYF 2NUPB 3GGDA 1H05A 1W0JD 3EQ6A 4QHTA 2OWDA 4Y2SA 4RS3A 3R0ZA 2DUUA 1E8NA 5K0CA 3IV6A 1XZPA 4PZZA 1UMBA 4DXHA 3ASVA 4MWTA 4IKPA 3W4IA 5LD2B 5JCOC 1N34B 1UPAA 2WG1A 2E4YA 4YRSA 4RH1A 5CX1B 2PV0A 2OK8A 4H7HA 3IURA 1IXSB 3OI7A 2RKBA 4FUTA 4D0NA 1H9CA 1W9HA 3TNLA 2FVYA 1F06A 1JIKA 4H7FA 1U6JA 1IZZA 5C18A 5AW1A 4I4NA 2J32A 4KI0A 3K20A 2WVHA 1LQ2A 6CHYA 2FA9A 3T7CA 4ZYXA 1MTOA 1UXGA 3HR8A 5CXSA 4TWIA 1NGSA 1EEXB 1LBIA 3AYZB 4C0SA 1T5IA 1DLJA 3EBOA 4G1EB 4FHEA 3G0CA 1E20A 4TKUB 3U5TA 2G76A 4YCJA 1HC7A 2QZ9A 3RAEC 1CRPA 4BV2A 5IG2A 2OE2A 2P1DA 4HN2A 5ITSA 4BS9A 4WNYA 3W7BA 3S8MA 4RK1A 4BEBA 2NACA 1T2NA 4Y98A 4F96A 1X1AA 3E5NA 2WJYA 1WCXA 4E4TA 1DDGA 3C74A 3LBNA 4OJYA 5C8ZA 3K7EA 4BECA 2GUGA 8GPBA 3ZH9B 4QBIA 4MVJF 4Y0VA 4ZEWA 1Z2DA 4Y9TA 6REQB 3TRFA 4Q4AB 3T54A 2WC1A 1T8RA 2HRRA 3B3GA 3TW0A 3VDNB 2ZBVA 3G8YA 3WK6A 4N5HX 3JQEA 3I5XA 3DDHA 1LD3A 3V8NA 1DIGA 4RKYA 2AMYA 2IF2A 3I2IA 2CNNA 5EQFA 3TSYA 3UEOA 2O0MA 2GAOA 1RLOA 4WI1A 5DN6D 1QTNA 4BJ5A 1ACLA 1XGKA 3AI7A 5KNCA 5IYZF 4YDHB 1GWNA 4Q02A 2II6A 1XAIA 1Q17A 3AHGA 3DGFC 3M6VA 1Y9EA 1NASA 3DAFA 3LLCA 4UD2A 3JQGA 3NIBA 5AW5A 2QQ5A 5FWYA 3C15C 2P6PA 1W36C 2TMDA 4OLBA 3V46A 4COKA 3KXDA 3WLNA 1F8GA 3ECAA 1YR7A 5D1HA 4CYMA 4LJ6A 2WW8A 2ZTLA 3P45A 5A6VA 2CVOA 2FG7C 2YMQA 1ZCAA 2IP4A 4L95C 3HNPA 4PYOA 3UF0A 3EH2A 1MX5A 4KE8A 3WDMA 4FYXA 1M83A 2HMUA 4KG7A 3FMIA 2AFIA 3A9UA 4OV6B 1DP4A 4YJKA 5H80A 4QATA 5DPMA 3CEJA 1T10A 1REQA 3R5HA 4ZQGA 3OHSX 4PY2A 3KQLA 1OFHA 3JYNA 1Y4AE 5JRDS 2JLVA 2B98A 3KLNA 1IN1A 2OZKA 2EGGA 1XEXB 1XDUA 1WPXA 2JHGA 5ER6A 1FC0A 2HFKA 2YYYA 5CDSA 4AZ0A 5LMUB 3OQOA 1E3SA 1VHWA 5KTNA 4WOKA 4ZYYA 4FZJA 1WPQA 3KU1A 3SC3A 1A27A 3PR2B 3THSA 4F86A 1K8QA 1QP8A 5JWRA 3UYLA 5CB8A 4FC7A 1SULA 4X62B 1I7QB 4PLWA 2NZ2A 1RM4A 1SJ9A 2WUWE 10MHA 3MWJA 3Q6MA 1G8HA 4MJ7A 1R3DA 5H82A 3TZEA 2PVSA 5IU6A 4M86A 1JEJA 3I64A 5FBLB 2V4UA 2KLBA 2YQZA 1L4YA 1T2AA 1U7WA 1RD4A 2FAXA 1RBQA 1PT5A 1NUAA 1E92A 3B9QA 4GOJA 4LJAA 2K2QB 2QLFA 3ITEA 1YFKA 3GGPA 5CNKA 1QAQA 2HU2A 2B4AA 1BE8A 3BK2A 3ZLVA 1L8AA 2B9EA 1PUXA 3DE2X 5E1BA 3MJEA 1UJCA 1PE0A 3JQQA 1ICEA 1K7EB 1O96A 3EF1A 4G4SP 3VU9A 2KW5A 3QUSA 5KOHA 3RFCA 2EBUA 1N2JA 2IKQA 2QRPA 4JB3A 3UPTA 4D8VA 1IE3A 3M70A 5IZ4A 1XHFA 3KG2A 5CRIA 4REQB 4WLEA 3SIPA 4PAWA 2E2WA 1O9HA 4XQEA 3EPHA 1IOZA 2RFLA 2J6IA 1F48A 3ZJYA 1XXHA 2BH9A 3ZCVA 1E1QA 5C8VA 1Z5ZA 2R4QA 4ALIA 4B8ZA 4RIFA 2UXDB 3I45A 3IIIA 4H0NA 1Q14A 2FRDA 1QHFA 3PJRA 1L4FA 4D82A 1LY1A 1W34A 4QOJA 3TLKA 3PVSA 2P78A 2MSWA 5KQMA 3SLGA 4BQFA 4DZZA 5LQRA 3IVMA 2ZS9A 4NBNA 2X9LA 1XTZA 1WU7A 4DNXA 1X0VA 3WL5A 2Z8YM 3HS3A 1YZHA 1NULA 3EIUA 1Z33A 3MILA 4CI9A 2PIAA 3IIEA 5KWJA 3N8IA 3PGJA 4D3FA 1YJQA 4BBPA 1JJIA 1WUJS 3AGQA 5IHPA 3K9BA 2QR5A 5D3KA 5LA6F 3AY7A 1L7EA 2OCLA 2VAXA 1GITA 1VLJA 1FDIA 1YVRA 1GZ3A 1T8UA 2UZ1B 3OX2A 3U81A 1HDEA 2BFCB 5DCWA 5KJEA 3SNKA 3ENNA 5HKKD 5ALOA 2YYSA 1E3MA 1K7FB 4RTMA 3HYNA 4HAYA 1CUBA 1Y1PA 2N1BA 3K5IA 4EYQA 4C88A 1R9JA 4RXUA 4F6RB 1Z5NA 3K8ZA 2XUZA 1I3MA 2O57A 1Y5NA 4FEAA 4GQIA 4C05A 3K53A 2SCUA 3K9NA 5T7BA 3UUWA 4R0MA 2IXTA 2YRFA 3CNLA 1JIJA 2Y2UA 3H5LA 1C9NA 3G88A 3QLVA 4MK4A 1XRJA 2MR5A 3OMXA 2ZSDA 1GPNA 4NHOA 2QRKA 1XTPA 3WJ2A 4GXQA 2LE0A 3PZBA 4EVQA 4QAJA 2PZJA 1N1GA 5J43A 5JQWA 4F8JA 1QYCA 5AKXA 2YMLA 1U9ZA 3KXLA 4R71A 2MYUA 5B3KA 1N5DA 3A1FA 2P9FA 3QRWA 3V8BA 4B32A 2OC4A 4UUPA 1SKAA 2A58A 2UYQA 3V6LA 5EJEA 3N0RA 2I0FA 2P5TB 1DQZA 1II0A 4M0PA 4R8SA 2V8BA 5EJ8A 4TTPA 1QYIA 5F1PA 1V1MA 3ASZA 3NIFB 3R6WA 2Y76A 4U39A 3WGJA 4EECA 3SC2A 4YCLA 2CLLB 1P1IA 1QGUB 1GG2A 3F6EX 2ZRLA 3V8VA 1CJBA 2GOYA 1SXQA 1YI8A 1NP7A 2REXB 1LQUA 2YV4A 3H0KA 4MR9A 4W4TA 4YRJA 3HK2A 5D5QA 1O94A 2WTXA 1WY5A 4KQFA 3AR9A 4FMPA 3CGGA 1V7QA 2YHSA 3PRHA 4XPIB 3Q15C 3EGDA 3P2JA 3VR2D 4WBNF 2CNWA 4MUXA 2V7XA 4CMGA 2IH4A 2QE7A 2YYAA 3OP4A 3IQDB 4JXXA 1Y5MA 3DBLA 3TVYA 1ADFA 2R6HA 2VYCA 2Y1FA 5EPOA 3FDJA 1JZTA 2ON6A 3CB4A 2XEDA 4BEWA 3QEAZ 1QPBA 2OVBA 2C83A 2Q6VA 4HMPA 4EJSB 2IGBA 1X3SA 3GGCA 4OMDA 3ZDCA 5K4HA 2I3GA 2FSFA 3VYWA 4GFDA 5AHXA 4EI2A 2O8FA 1X7ZB 2VHVA 3JVEA 3N6RA 3PCXA 4JLNA 4MIYA 4QU9A 1A8IA 5HMMA 4UHEA 1ML3A 1U8AA 5TQ0A 4NRDA 2ZB2A 3AKYA 3E22A 4H7DA 1Q7TA 3DOCA 4PRKA 4CDRA 1GUZA 4JQOA 4QPPA 4CM9D 5HJEA 2O8BA 1E99A 3AGPA 1FMCA 3CJTA 1AQYA 2I78A 5FEMA 3TSZA 3V32A 4FFPA 4QJ5A 4RFSB 2Z04A 3I53A 1DKPA 3ODPA 4BLTA 5FJIA 3OX1A 4AJ2A 4RMNA 2IYRA 1NP6A 2VP9A 2G8LA 1XVLA 5BP7A 4MQFA 3AERA 5LWHA 1QQBA 3GRVA 1E9VA 1I6WA 4LV8B 4XYBA 5CMLA 3LFUA 1NZJA 5CYPA 4ZOLB 3CR8A 2OQVA 3CZCA 3KTDA 5HXAA 3I0NA 1SPBS 4GXRA 3IP8A 2OTCA 2XE7A 1QIIA 4AN4A 3W5DA 2W8BA 1O6ZA 1I2MA 5MGNA 2KX7A 2ZULA 1UKCA 1FUUA 1E3TA 3MT0A 2OAGA 1O0SA 3JATA 5FI0B 2ADOA 1MNAA 1KWGA 3ZD6A 4XUDA 1G6HA 1OFUX 3DDCA 4NU6A 2F3QA 4M0CA 4OSEA 5ALUA 4RETA 3SG0A 3P2YA 3LUFA 2RIRA 4BLSA 4GU5A 3JW8A 4YV1A 3F8WA 3CZRA 3RS8A 2WWVD 4FCTA 4C14A 2I7CA 2CFRA 5GGXA 4CETA 1NURA 3OFVA 5AUOB 1P73A 1EWVA 3R9IA 2NVUA 2QRGA 3IVAA 5KYYB 3M4NA 4PYNA 2JFOA 2Q29A 1E7QA 3AWIA 4YPOA 5TDHA 5KQPA 1TYBE 4JGBA 1SD5A 1E5VA 3IKTA 3FWKA 4KLAA 4A2QA 3IS3A 3OTOB 1OD6A 1S7CA 5EESA 3G2QA 3WGZA 4WAUA 3UYKA 3GLRA 1P9NA 1OXXK 1PFWA 4FMCB 4BMYA 5K45A 1DUVG 2BM8A 1WMSA 4A23A 1NVTA 3VR4A 5IXYA 4UAGA 3H3JA 4MV7A 3RRNA 1TK2A 4N01A 1TMOA 5CVVA 3NRJA 3BX1A 3HYCA 3TLGB 4EIWA 2YN0A 1K3TA 2Z8ZA 2HUNA 1R4ZA 4B46A 4EB0A 5E9WA 3H83A 4CQLB 3JS5A 2BSQA 2HQBA 2WJ3A 3BKXA 4NCKA 3N28A 4BZWA 1DELA 3HGMA 3LQ2A 3DQZA 4G4GA 4PGMA 4R7GA 3C3DA 1ONNA 2FFRA 2QW8A 3COYA 3ZQUA 4BMVA 5DIFA 2V7VA 1Z29A 1DKQA 2PRJA 4O2BB 3I5YA 3UT5A 5JAZA 5AKGA 2YHIA 3KPJA 1G8YA 5JYDA 3TG8A 1PTKA 1T24A 3R5TA 1A8PA 1KJIA 3EUAA 3PNQA 2PEZA 4IIXA 1M8FA 2ZE7A 3UG6A 2DHRA 4DA9A 4PG6A 5K8LA 4OY3A 3HM9A 4BX9A 2J6BA 3Q88A 1JWLA 3ZLUA 1NBAA 1I10A 5B57C 2B8JA 2R6CA 4P82A 5FD8A 5KDOA 3VX4A 1HE2A 5C3UA 4NICA 5CB6A 3AL0C 3GRPA 1M1NA 3LKBA 1FFDA 1PK8A 3AUUA 2QR3A 2X13A 3DEYX 5BVGB 1XVUA 5C1BA 1EVQA 4OFBA 2QTZA 4TYQA 4DG8A 4B3GA 2V7WA 5COBA 5FWXB 5IVHA 1XFDA 3S1AB 1SIBE 1SHLA 4RK7A 4F3KA 3HGQA 4L76A 1LZLA 1MAVA 3ELDA 4MVCA 1K9VF 2IXBA 3ILHA 3ML1A 4MVWA 4ZOQI 1AQJA 4BNXA 2GTHA 4LDZA 1W94A 2PU5A 4H77A 5DISB 5ECGC 5E7MA 1DE0A 1EWRA 3N9IA 4JNCA 1QHYA 3TZQA 4CT4B 1UBJS 2X0KA 3OPYI 3R5FA 4CT5A 2A94A 1M2JA 5EMKA 3IMFA 2GK3A 3EMVA 4EHIA 4ER5A 1ZHFA 1HLPA 2OHFA 4AP5A 4QXAA 4KO1S 4Y7DA 1J7JA 1H3NA 2XNKA 4MPPA 4QYIB 4B6PA 2H5JA 3QH4A 1VLVA 2ZGVA 3BOSA 3SBXA 2F48A 2GCNA 1RJEA 1LNQA 3ZI7A 1M75A 2ZCUA 3K6KA 4NAVA 5CU7A 2A14A 4ARAA 1XPUA 1PDOA 5J2UB 1RCTE 1T4MA 4U2EA 3D2CA 1G3IA 3U1BA 2R8YA 3I1YA 1KY3A 5G0VA 3B7GA 1M6YA 3WGVA 3K6SB 2WU1A 2XYHA 2DJ5A 2YJ6A 1RWMA 1V1RB 2JLBA 3OCCA 2O7SA 3LC1O 1N2BA 2FFJA 4FZ3A 3O3NB 4PLGA 4TLEA 1FRFS 4LZWA 2BGRA 3VNAA 4FKMA 5BSGA 3ZIDA 1G6Q1 5D3ZA 2I99A 1I9GA 1DG1G 4LTMA 3WRXA 4ETWA 1QH8A 2AV6A 3M6XA 4EKGA 1JQBA 1U0GA 3DBRB 3GRZA 2C2KA 3DF9A 3QOYA 4GPEA 5REQA 2RI0A 3QJGA 3UMBA 5TF4A 4ZYLA 3PBKA 1W73A 5IZCA 1GO2A 1MPTA 2CNBA 5DMXA 2V7TA 1UXOA 2CBZA 2WA1A 4JODA 4MV5A 1F2VA 3W9UA 1AN0A 4Q1AA 5TE9A 2Q4BA 3SR4A 4FDVA 2C4UA 1XHLA 2O7RA 2ZRJA 1NU8A 4A0SA 3L4KA 2VN8A 3MUNA 4QVKA 1EUDB 1Z17A 3PFFA 4TTIA 2A9QA 1SHTX 1U0NA 2BRUA 3G82C 2ZANA 1NMQA 3T34A 1T1GA 4DDKA 2P2LA 2M6SA 3LVRE 4JVNA 3UHAA 3KR2A 3DAYA 1PYDA 4W5OA 3ZCPA 1T2CA 3JQBC 4LNHA 4A1FA 2QAGC 4MUYA 1ZUHA 4MKGA 1ZAYA 3VKVA 3NVKI 1FQKA 1TMYA 2XCUA 4JB0A 1M2FA 2GERA 4CUKA 2B83A 2OGZA 4IJVA 1V45E 3LKZA 1W8IA 3S2EA 1JU9A 1HSZA 3IH5A 4EGSA 1P2UA 3FMFA 1OTHA 4XQCA 1UAYA 1Q3KA 2XQFA 2ZSHA 4N65A 2DP4E 1R88A 2Y1LA 3BREA 1Z88A 3B2EA 2HCJB 5MFZA 3HCBA 3MGKA 3P0JA 1ZSNA 3EGWA 4D9MA 5C4MA 5BR4A 1JHXA 3OJLA 2FEXA 2YBDA 3UG7A 1Q7BA 3OESA 3G17A 4JNKA 1HZJA 1P3JA 1MF7A 1Q77A 1ZMOA 4HX5A 3UHPA 4DBLC 3G68A 1I7SB 1YZYA 2AKAB 1G291 1R0BA 4KH1A 3UJ9A 3H5IA 3DAOA 3WIDA 5DYIA 2QTTA 1U5BB 1T34A 3AEUA 1NUQA 3D5QA 5I7RA 4GDFA 1Q74A 5EIBC 4K8OA 4F9TA 2LVBA 4M8KA 3KSAC 2WD8A 1Z4IA 2JAQA 3M5DA 3BXGA 5K0LA 1GKIA 3KVRA 1PJBA 5H3HA 1YHYA 3B7PA 3ZY6A 4D46A 5HSGA 2BJVA 4XOUA 4NV3A 4CM1A 4MUFA 1VZ3A 1WZ2A 1Z0DA 4A8JA 2FR1A 4BNTA 3DLPX 4C4XA 3RWBA 1EXMA 4ZCMA 2QLMA 4GP7A 4EJMA 1XAHA 4WWHA 4LMAA 4WRRA 3P0IA 1LWOA 2W11A 2K4MA 2ZG6A 4OQFA 4FSXA 1C3EA 2PMEA 1SVWA 1O94C 3LVFO 1JG7A 1PG2A 1DCTA 3U39A 2Q9AA 4D96A 1BFDA 3K6JA 5CBKA 1M6VA 3CSDA 1TF2A 4YMHA 2HPZA 2NTVA 2X3UA 3I42A 1IDN1 5JASA 1E96A 1M8JA 1RE1A 1TJ4A 3G8CA 1N9GB 4M0EA 4U3JB 4X63A 4ZOLF 2RBGA 2F55A 4YTEA 5IUJC 4AG5A 3LPNA 3F7OA 1Y6QA 5AJYA 1AKWA 4EM6A 5C31A 3BEOA 3RU9A 1CG6A 2GEVA 1R0LA 1XTTA 1ZBQA 3PC8A 4ZV7A 5DNDA 4OK6A 1GYQA 3GNLA 2J0QA 1PZNA 1E9FA 1TQDA 2P91A 3AU9A 2EW1A 2K2WA 3KSMA 3MSXA 3U49A 5CBPB 4NCBA 1NE2A 1GTRA 2CXOA 1Q84A 2EP5A 4F84A 3KC2A 4ZYVA 1Q3HA 3IIKA 4HUTA 3AC0A 3UAWA 2ZSAA 4BWGA 2W58A 2TSYB 3H0EA 2Q8QA 1I5RA 1G0OA 2ZB8A 3WIEA 4E09A 1ZLXA 4PYQA 2Y1DA 3DMTC 3N0XA 4G37A 4GMDA 5LZ9A 3FYCA 1E4OA 3KQNA 3EXIA 2QORA 5HBRA 2Q9UA 4BTLA 3HCRA 1MB4A 2ILTA 3PPWA 5BYAA 5KNCH 3P2IA 3NBYC 5BSHA 2BP7A 4LDJA 1XJ5A 2J6HA 3DKIA 1V7ZA 5HUHA 2QEQA 3CX3A 2FWJA 3M1YA 3OCXA 2ZM5A 1M0SA 4N6OA 2BDTA 4BIIA 4E15A 1Z13A 3Q6IA 2ERCA 3GXOA 1QMPA 2KSQA 2ZREA 4GX5A 3ADPA 4YP1A 5IRCD 3MTEA 1VLLA 4FMCF 1P7VA 4MKRA 4UBKA 4MUHA 4KO2S 4BO3A 1OX4A 3V33A 4YI5A 2JDIA 2A1IA 1Z2NX 3K1AA 3PNYA 4HVTA 2ZT6A 4J75A 3ZOZA 1RHUA 1F8UA 3I9JA 3DMYA 5HNKA 2FR8A 4ENUA 5EP2A 1CEXA 1J0XO 1U7HA 3OKCA 1G6OA 3H5RA 1M34A 5K8UA 3ETDA 5JZSA 3UHJA 1DBRA 5T4FA 1FTQA 2Q2QA 3SZGA 5L3VA 3WL8A 3H17A 4MQ6A 2XKAA 2DPGA 4Q4JB 4O2BF 1KFBB 4TXJA 3SBDA 4RTPA 2WQ7A 2I4IA 4LXIA 1HKUA 4D42A 2I6TA 3NHFA 4BMOB 3T12A 3GUHA 3DB2A 4C3UA 1QO0A 1U2EA 1EGVB 2IYVA 4NHEA 5CW1A 2QTVA 5FEUA 1P7CA 1IVNA 3CE6A 3I8SA 2DHCA 4M1KA 1CR1A 1WMBA 4XASA 5THKA 2F67A 4LRXA 1CB7A 1GARA 4I55A 4TS3A 4FDTA 1KAOA 2OVFA 4PYJA 3AIOA 4UCQA 1H4SA 1H2BA 2FSIA 5TB5A 3HVUA 3SQLA 4NNPA 3O38A 1Z5GA 4Z4HA 1CHDA 2YH2A 1ZWLA 2H7XA 1ZVKA 2QW1A 4L4SA 4JI1B 3OQ6A 2GASA 2FWPA 4HAOA 3BRWD 5K3BA 3CBGA 4WDQA 2H4XA 1VRWA 2X76A 3O82A 4NOKA 3BE5A 2XGJA 4FDAA 2R5FA 5LNK6 1YR6A 2P4EA 2VZ8A 4MB0A 4CM8A 1VMDA 2GBFA 4QFMA 1OHHA 4GM4A 4KQ6A 5DV9A 3GNTA 2JGDB 5A62A 3OZRA 1IQPA 2MU1A 4V39A 2X0DA 3S8YA 3W5AA 1JUDA 2BFAA 1Y63A 2JIDA 1Y5RA 1QFMA 1E2MA 3ZCXA 1K6MA 4DR2B 6ABPA 1Q7GA 2PLWA 4WXYB 1KVTA 2I6QA 3JZFA 4L6IA 4U7WA 4INPA 4XPZA 4Y1RB 4ZKDA 5I4KA 5J4KA 3T9DA 4YLEA 4YS6A 1V41E 1OBVA 2G9NA 2OV1A 4CV1A 1TCVA 5J2TB 2VDVE 3HP7A 1UBUS 5EZYA 1ZBDA 4TMFA 3ESAA 3ZG6A 2I7VA 2GCIA 3T5CA 3UQYS 2WT8A 4KV7A 5AM3A 2H4WA 4X95A 3L1KA 2IZZA 1GPLA 2E85A 1IHUA 2ISSD 3IA7A 3BMCB 3WGMA 1QQTA 2HX1A 3W04A 1JW9B 3KSDO 2DFLA 1GVHA 2OY0A 5A7GA 3PF8A 2ONJA 1SA0A 4WGFA 5LQMA 4F9FA 4KXVA 2N9UA 2O2HA 1EXVA 3NKLA 3O4HA 4ICIA 1EGAA 3NBMA 4KVGA 4NBSA 4WASA 4L07A 3V80A 3E27A 3IR5A 1Z5OA 1E79D 4AQDA 5AVKA 3P9SA 4DA0A 2ZB7A 3BFXA 3FTDA 3KETA 2FMTA 5AOBA 1ZMRA 4B3CA 5FOVA 2OFFA 3MJDA 5CFLA 3Q6NA 5LQJA 5BR8B 3KCQA 4LV5B 4M89A 4R8RA 1TVKB 5DF1A 5DLDA 1VE9A 4ID3A 1J6UA 4AYWA 4UHJA 2KB0A 3QLTA 5JPIA 4CMIB 3I2YX 1X8XA 1IWPB 2IYYA 3B38A 1HOTA 1OYVA 2BFFA 3F71A 1A9YA 3S6JA 2BM0A 4HTAA 2KBFA 1VHTA 3EQ8A 4PXSA 1HQDA 3NHKA 4XR4A 1UWCA 1KDYA 2VSFA 1TRKA 1YRLA 2X1LA 1UKEA 4AMZA 2J31A 4PU0A 3KKMA 4F93B 2ISQA 3GAZA 4KNYA 2VJMA 2P4QA 4LECA 5JS1A 1T1EA 2GPAA 1SKUA 2JFVA 2GEDA 2WWTA 2GZDA 3CUWA 5L4LA 1XZFA 1KKUA 2PX6A 1YBMA 3W1EA 2H63A 1CEYA 3KXKA 1R4AA 1U6KA 3LLVA 1JPVA 2VZ0A 2REQA 3ANNA 3EVGA 3VNVA 2C2BA 3QKUA 4NI5A 4QGFA 3KQHA 3AVVA 3B5EA 3WLIA 2C9ZA 3OTWA 2H2WA 2ZI3A 1MUUA 4I1RA 3MGCA 3KYCA 2P9YA 4ZODA 1E59A 4G0YA 5I9TA 3MSCA 2C1EA 2CJWA 4YAWA 3GX1A 4W1PA 1E4VA 3M83A 4IO1A 3L82B 3L9XA 1TM4E 4LJ7A 4M7WA 4PYMA 1B1AA 3DMFA 4B4DA 1WTAA 1OXUA 2F2TA 3EG9B 3NVAA 3HA5A 3P32A 4TKVB 2FN4A 1SVUA 4EKDA 3NBKA 4CM6A 3G8BA 4CG0A 1SVKA 5FPYA 2H1VA 1Z0KA 2YWGA 4ZO6A 3RROA 4WZZA 2R4UA 1P0FA 2EHJA 3EXG1 4B8WA 1F0NA 3IO3A 3QF4B 3T7AA 1H8HA 1VYTA 3RJ9A 5D5HA 5KTYA 4I5FA 4EPYA 1B6RA 2XVZA 2YCBA 4OAOA 1YR1A 2IIBA 3RHSA 5IT0A 1KOFA 4MO2A 2GXUA 4DLSA 5CK4A 4RK6A 3LQRA 5TXGA 5A2GA 4PZCA 3JQ8A 1F9EA 5T67A 3MXOA 1WUTA 4IMIB 3U5ZB 1XEWX 2QU8A 4GGPA 2OZPA 1FDSA 1L3BA 3DDOA 3GAMA 4R1MA 3G9TA 3MXTA 5BQ5A 4CL3A 5E6RB 1DEOA 1QVZA 2VH1A 1KEPA 4LX0A 5JSZB 5DTRA 2A30A 3AEKA 5JI2E 3G0IA 3HYTA 4E5KA 2P2GA 1H22A 2Q49A 1K6JA 5K03A 2HU8A 3MW8A 1OWPA 3UK2A 1KSFX 3TG2A 1NVUQ 1KMMA 1W85A 1FXWA 1PR2A 1QHHB 5LP6A 2YNMA 2CN1A 2FPPB 4LZZA 1ZD9A 1I1OA 1K88A 1NYTA 1PRYA 3EGVA 3G7SA 4Q3KA 2D1SA 3OPXA 5HEKA 5KINB 4QEZA 1WW2A 1MVNA 2VAPA 2E0IA 2NZJA 1BXGB 1P7YA 3I8XA 3I9FA 1DIOB 3D7KA 3OX4A 4LDNA 4UU7A 2XT9A 3RUDA 4UUOA 4UFOA 4B4OA 2JLWA 1VYVA 1XVVA 2I2XB 2XUOA 4IIJB 3JTMA 4BNIA 1IBMB 2VCYA 1X7YA 1SQGA 2RH4A 4PNEA 5CURA 3EIFA 1LTHR 4CUJA 1IN6A 2VNKA 4A8JC 2F4VB 3CR3C 1PDWA 3WHLA 4PINA 1LK0A 3FRJA 1WUKS 3DQPA 3IUMA 3N8GA 3OZCA 4MI3A 4EUFA 1U99A 2ZI5A 1XCBA 2B8WA 1NFFA 1FUKA 2Y67A 4OU5A 2AN1A 3E9EA 1RZRD 1BDJA 1H6BA 1OA0A 1QCYA 3DBIA 4Y1FA 4XWKA 4KGXA 4ZZ1A 3AVUA 2ZTUA 3I8OA 3M6WA 2Q5IA 3FHLA 2IS2A 4G0XA 5EXSA 3WNVA 2XUFA 3K0EA 2H07A 3L7JA 1QQAA 3LOPA 1RYZA 3ZY5A 4CKYA 1KMHB 3OPMA 4Z8XA 3H84A 2YS7A 3KB8A 5CLGA 3TQHA 6LDHA 1UJNA 3BMOB 1JEYB 2UZ3A 4JLUA 3M6FA 2BEUA 4Q5IA 4REOA 3AVPA 2QY9A 3TTWA 3N1UA 3TS1A 3PLAE 1L9KA 2NUBA 3TXAA 3PC8C 4RHCA 2I9KA 3T0GA 4WLFA 1FFXA 1N2ZA 1UOQA 4LPKA 3RSHA 3KTFA 3HRIA 1VLZA 4U0JA 2P67A 4MAAA 3C1TA 1RJFA 5JVDB 4BNDB 3VO9A 3GB9A 2C31A 4DMGA 1A9TA 1GYRA 4LSMA 3OFNA 2O8EA 5C32A 5LZ7A 2GDZA 4KQCA 1LLQA 1F12A 3TOCA 1UP4A 2JNWA 4JUBA 2JGJA 1MD9A 1B76A 1CVRA 1MB2A 4L78A 4O2RA 1Z6AA 5T4BA 5B12A 1GLGA 2BTOA 4LWQA 4D44A 3RO7A 2FG5A 2R8ZA 1WNTA 2W6QA 3H1GA 4RHEA 5DB4A 1YRAA 2QPAA 3LUKA 1QG2A 4MPRA 1JKXA 5KYUA 1C9MA 3K2EA 2CCGA 3H04A 4NCXA 2VJBA 1YMQA 3C2QA 4UNPA 4AG6A 2GCOA 4FE4A 2HM7A 2QBYA 2CVPA 3UFXA 3GLFB 4DCJA 5T5QA 3DSRA 3VTFA 1QGED 3PHJA 3L93A 1HA3A 4ZAYA 2BL4A 3VR5A 3ZE7A 4J2TA 3MTIA 2EKPA 3WAKA 1JDJA 1U2DC 2RHJA 3LCCA 5AKEA 4N48A 1SMKA 4HOYA 5JS2A 1FLNA 2IOFK 2OO7A 3MVEA 1WXQA 2QWXA 1SUSA 5JOQA 3TZHA 5KWSA 2IBMA 3QZUA 1OX5A 5G0TA 3QUCA 2JIZA 1KC3A 3MTBA 4JP8A 2UZ0A 3KYJB 1DTWA 2WM2A 4NXNB 1L8XA 2W2LD 3EXEB 2C7QA 2XYQA 1L5FA 3IAM1 4NBRA 4R2XA 4NEGA 4JL6A 2BDUA 3K6RA 1PK7A 4G0MA 5GQSA 2EGHA 1YQTA 2ORED 3PD1A 3HEMA 3GRFA 4M1YA 2PBLA 1JGTA 1ABBA 1EUCA 1PHRA 3EHDA 4Y2VA 3SM9A 4NJEB 3LC2O 4MA5A 3P9CA 1IOLA 2IHKA 3F3YA 2IVZA 2VKQA 4HQNA 1NJ8A 1WEHA 4GLFA 3RYIB 1GQYA 3WWYA 1FLAA 1JQJC 3OEHD 3PL5A 4GPIB 1A0OA 1CTQA 1UBRS 1UK9A 4RZ3A 3VU1A 1JIQA 2QSYA 4J8PA 3RAFC 2P2YA 2JK0A 5LOVB 1ZCJA 4FE3A 1U0EA 1YULA 2E3JA 2XBUA 3GMIA 3N2IA 1RYDA 3U3XA 4B7UA 4J7XA 3ZWMA 2IBTA 2D6FA 3EW7A 3O21A 1TECE 1C0IA 5GGYA 2GX6A 1TTQB 1P5ZB 1YTLA 2J7KA 4NE9A 3UIEA 4GRDA 1BKYA 3IOMA 3DF7A 4HAZA 2XY4A 4KMSA 1PQWA 4D79A 2OHJA 2IPLA 3F5MA 4GUAA 1Y9AA 3EOZA 4DC1A 4C76A 5EQJB 1E32A 2GZAA 2ZJ4A 3W3AA 4B34A 1M1UA 3U1TA 1CQWA 1EJ0A 4CF3A 1QRTA 1KEZA 2P2CA 4YH1A 1USKA 4K9KA 5I4CA 5IKMA 1AGXA 4JROA 3AJ8A 5MDHA 5IJ9A 1BO6A 4CEIA 1EUZA 4IYJA 4K26A 3KV1A 2HBQA 5E1DA 2Q07A 2AUMA 3FWPA 1N5JA 2PGJA 1NR5A 4GBMA 3OLXA 2X9GA 3KPYA 3T9BA 3JQRA 2KQUA 1GQ2A 4QUAA 3CIFA 1Z35A 2GH1A 2RB4A 3E4CA 4YJHA 4C7MA 1YCFA 4QSHA 4E7PA 4K81B 1G0NA 5CLIA 3TUZC 3G1TA 1JS1X 4DV0B 3JD4A 2PUGA 3M4JA 3CCBA 2D3TA 4PTYA 4G5OA 4AP9A 4JEMA 1ZI9A 4RHYA 2W0MA 2O1WA 3EGEA 3FMGA 3SM3A 3GBPA 3EIQA 1TI7A 3B6IA 4G9BA 4UOZA 4GICA 2WHXA 3MJTA 1NPTO 2QUKA 3ZZ1A 3IV9A 3NC4A 3STWA 3AHJA 5HE9A 1NJ5A 2H52A 2R6R1 1RBMA 3O5AA 4ZYWA 3U16A 1YS9A 5JSQA 2OCAA 3AOGA 2CL7X 3W2IA 5K99A 2PZEA 3OAAD 3G8DA 1WXFA 3QF7A 5EL0A 1W88A 3STVA 4O4JF 4UCWA 2V59A 1H0SA 2BEWA 3NFRA 4KBFA 1XT6A 4XX1A 3MJCA 4AJEA 3UBTA 4G0PA 4G5YA 3C5HA 1XQ9A 5LYYA 2PD6A 3RRXA 3TWOA 4I50A 5E95A 4BLPA 1M0TA 4DUGA 3MIIA 3T7EA 1JLLA 4JP2A 2ZBPA 4RDXA 3STHA 1XZHA 4OL0A 3HDGA 2JGKA 5KX5B 1YZGA 1UODA 3QXCA 4AS2A 3NAGA 2AFHA 1TFRA 4KXMA 5JNRA 1OXBB 2QXTA 3OZVA 4CG1A 4FGLA 4Z3KA 2GA9A 4TQUS 1AGYA 3AFOA 3UMCA 4AUMA 3SEFA 3DXFA 3A26A 1VTKA 4LSWA 1CUFA 3B82A 4D4JA 1BWPA 3W7AA 1FFAA 2CF6A 3QWBA 1ZGCA 2EQ5A 4ARCA 3ZY2A