3TZKA

Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg)(g92a) from vibrio cholerae
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
247
structure length
247
Chain Sequence
SQFMNLEGKVALVTGASRGIGKAIAELLAERGAKVIGTATSESGAQAISDYLGDNGKGMALNVTNPESIEAVLKAITDEFGGVDILVNNAAITRDNLLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVGSVVGTMGNAGQANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMTKALNDEQRTATLAQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMYMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 3-oxoacyl-[acyl-carrier protein] reductase
publication title Dissecting the Structural Elements for the Activation of beta-Ketoacyl-(Acyl Carrier Protein) Reductase from Vibrio cholerae.
pubmed doi rcsb
source organism Vibrio cholerae
total genus 92
structure length 247
sequence length 247
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2011-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3tzkA00
1DIAA 4F6LA 1Y8RB 3TZHA 1BDBA 3LK7A 5IZCC 2PGDA 5DOVA 1NPTO 3BMNA 4ZQGA 3GC6A 3QSGA 5L51A 5BSGA 4RVHA 3AY6A 5MGBA 3F1LA 3GGGA 1CEQA 3C7DB 5IXYA 4LRTB 3CSDA 2ZYAA 4ND5A 4BKRA 4UVHA 3RSHA 4MVJP 1MG5A 1PZEA 2Y99A 3GDOA 3ZWAA 1EEHA 3VPSA 4ZQHA 2X0IA 3QWBA 1NQ5A 3TJRA 4ZGWA 3Q9NA 1PQPA 4U0JA 1NVMB 5I7EA 1VL6A 4XR9A 1EUDA 4FDAA 4QO7A 4AJHA 1E5LA 1E3WA 2ZKLA 4BL5A 1MGOA 1IOLA 3OA0A 3FBTA 4RQUA 3VH1A 3WFIA 4YYZA 3AU9A 4OKIA 3WLEA 1WDKA 1YGYA 4YAGA 3RFXA 4CMJA 3DZIA 3ZHYA 3N7UA 1YOVB 3RFVA 4WLNA 3VPGA 1SBYA 4DLBA 4YT8A 4M1QA 1DIBA 3KRTA 3OIFA 4L73A 3SC6A 4J0EA 4I9HA 1IPFA 2VTDA 4FFRA 3JQBA 3D5QA 3QV1A 1PX0A 4W9NA 3RIHA 3PLRA 4NMHA 5JY6A 5JXWA 4M54A 1UXJA 3IIEA 1YXMA 4RGBA 1TXGA 4S1VA 1C1DA 1PJ2A 2R6JA 2G1UA 3VKVA 4A26A 1L7DA 3CEAA 3HNPA 4I5GA 4J3FA 5T5QA 2Y68A 1Y8QB 2BFPA 5CG1A 4R1NA 5KWEA 3KUXA 2Y1GA 1IHXA 1HTBA 2J3JA 4Y8VA 4BNKA 5HTOA 3G0OA 1P3DA 2Y1OA 1JU9A 5FYDA 1ZXLA 1HLDA 3ZHZA 1P1KA 4IGFA 3ADOA 3HN7A 1SB8A 1Y9EA 2VHYA 5IDXA 4LVUA 5JYDA 4J4BA 3B1KA 3WGZA 1KC3A 1UUFA 3DWFA 4P38A 5I7SA 4FCCA 2X58A 3NDJA 4XJTA 1HDYA 2ZCVA 3GT0A 3IP1A 3RWBA 2GR9A 2OHXA 3KSUA 1EK5A 3E82A 1L1FA 1GZ4A 2IEBA 4OYRA 3UCEA 3RI3A 1H6DA 4R69A 3P7MA 1HETA 4J16A 4BO2A 4YAIA 1W6UA 3MTJA 1P1HA 4BO0A 2FN7A 4XB1A 3IQDB 4BVAA 3Q3CA 2JD1A 1T1SA 4WCFC 4YRAA 3AU8A 3FTNA 3BMOA 1E3LA 1QV7A 5BNFA 4OH1A 2NV6A 2G17A 4CMEA 1ISJA 5AXDA 3RUIA 1P1FA 1EMDA 1ZIDA 4WLVA 1DJQA 2C82A 4XIYA 1KBZA 3UAGA 5IN5A 4CLHA 3ENKA 2Q2WA 3I4CA 4HFRA 4XRRA 4GH5A 4KDFA 4L0QA 2VCYA 1DC3A 1H6BA 3AUUA 3IUPA 2WYVA 3ZHXA 4ZHSA 2GUGA 3V5NA 5K9ZA 5FF9A 2D2IA 3GFGA 4NDNE 1ZJYA 2EP5A 3C7CB 5AOVA 2W98A 3H2ZA 3KOUA 4Y67A 1VJ0A 4B3JA 1XEAA 3OJ0A 1UAYA 2FMUA 4ND2A 4RF2A 2VT2A 3NGXA 3I4FA 3I9LA 3WQSB 2OP0A 3CUKA 3K30A 3OIDA 1CYDA 1ZCJA 2ET6A 3OFSA 3QIVA 5TC4A 4PGFA 2BGKA 4NI5A 4KP7A 3LU1A 4JBIA 1TT5B 3DZFA 4EW6A 2Y1DA 1E1MA 4HP8A 4R5HA 3I23A 2WTBA 4D43A 2FRDA 1C0KA 4BNLA 5J23A 1M67A 4DIFA 4CV0A 1KIFA 1E3EA 4JJGA 3UVEA 3FCOA 1H94A 3NEPX 2ZJ1A 1HDRA 1E7RA 5H83A 4RZHA 1CWUA 1Q0LA 1LLDA 4YJGB 5L3ZA 4GI2A 2YQ5A 1BTOA 5L4NA 4WECA 4PRKA 3RC7A 1XA0A 3HDHA 2EJVA 2YV2A 5F21A 3E5RA 3ENNA 3V8BA 5KVQA 1RM5A 3EW7A 3T4EA 2NLOA 5ITVA 1PJCA 2PWZA 3HADA 5FFFA 1XLTA 4LMRA 3JQ9C 1UP7A 4FOSA 4P22A 4RVGA 4E31A 4NJMA 2J3IA 4CUZA 4GQAA 4BGIA 1H9BA 4LGVA 1EVJA 2O7QA 1LSOA 2GO1A 1O9BA 5HWSA 3KLMX 1WMBA 5EN4A 1E3SA 1LUAA 3AM5A 3P2YA 3DMTA 3UCXA 3S2EA 4UEJA 5GZ3A 1OC4A 3E1KA 1LRJA 2AHRA 1I30A 3JD1A 4WEQA 4ESOA 2BKAA 3UW3A 1PS8A 1UXHA 3H3FA 1WPQA 1XWFA 1DAPA 1MFZA 3I6IA 4CLXA 1QYXA 3DAFA 3K6JA 5TT0A 3UUWA 2PH3A 2CDAA 3B70A 1ONPA 2V6FA 3DAGA 4LSMA 3VH4A 4NBRA 1NPDA 1YL7A 4N7RA 4CM9D 4UUMA 4MJLA 1G0NA 4X54A 3HFSA 1EQUA 1PJ4A 4OOFA 3KV3O 3V2GA 2W2LA 2O3RA 3DZJA 4GGPA 3IKVA 1X7GA 2HMVA 3IOYA 4PN3A 3GNSA 4PZDA 1P9LA 4JCOA 3PFFA 1GUYA 4GKBA 4EJ0A 1WMAA 1WDLA 2C7VA 3ICPA 1R0KA 3AM3A 3AUSA 3ORFA 4UVDA 2GDZA 1TB4A 3JCZA 4JJIA 2X9NA 1LC0A 1B0AA 1DPGA 2ZJ0A 2AG5A 3O38A 2PKRA 4Q3BA 4XGKA 2EHDA 1LRLA 1NXQA 2WJPA 1X0XA 2RH8A 5L4SA 4HWKA 1F17A 3GVIA 1YH3A 4IINA 2LDXA 3TFOA 3DO5A 1KEVA 3H65A 3WBFA 5B4VA 3C1AA 4U0KA 3WJ7A 3MJEA 5AVOA 1A9ZA 3HHPA 3TF5A 1G1AA 1R4NB 4FSHA 3DOJA 4YR9A 4RORA 2NNLD 2CUKA 4XRGA 4CQLB 3U09A 1AHHA 3HUDA 4QUKA 4BNWA 5JLAA 2O3JA 4YWJA 4G5HA 4WJZA 3HDJA 4RZIA 3HJAA 2VYNA 3NGLA 2AQKA 4Z9YA 5DDIP 4RPHA 4XGNA 5IDQA 5KJ1A 1DOHA 4IMRA 3P2OA 3ST7A 3H9JA 3PQEA 4XQCA 3BTVA 3NYWA 5ICMA 3U4IA 4AJEA 2PD6A 1YB4A 3NDIA 3F46A 5G0WA 1MX3A 3MTGA 1DLIA 1VL8A 3E03A 2EV9A 3DBRA 4BQRA 5IXSA 5T8KA 4CQMB 3NRCA 3RD5A 1U7HA 2QYSA 3GH3A 2W2KA 1LA2A 1HSOA 3LC2O 3AI3A 4INAA 3V1UA 5A06A 4O59O 4IIVA 1LDEA 4LK3A 1DAOA 3JD3A 4PLPA 3NTQA 5TX7A 4BB5A 3PZRA 4D41A 1HE3A 1KS9A 3TZKA 2FY8A 1V3UA 5A9RA 1I3NA 1IB6A 3PIIA 3ADPA 3M1LA 3CXRA 4IPTA 2Q2QA 2TMDA 1DB3A 1I8TA 3WYCA 4A27A 5BSHA 2DM6A 1UZLA 3HSKA 3K2BA 3ZV5A 3H3JA 3CMMA 3BTOA 3ABIA 4NBVA 5L7YA 4BO3A 3VZSA 3W4KA 4XGIA 4E5MA 2R2GA 3CMCO 1DRWA 6LDHA 3JQAD 4JNKA 4OQZA 4BB6A 1BRMA 1TA4A 1ZK0A 4CLOA 4GX5A 2X1HA 3EZLA 3H4VA 3JQAA 4O1MA 2EGGA 5I8ZA 3UCFA 2Y0DA 5A5FA 5F1PA 1HLPA 3QE3A 5I9MA 5KKCA 4XB2A 4YRBA 1M2WA 1WXDA 3DFUA 2A94A 1BXGA 4L4RA 1XSEA 4TVBA 4CM3A 1ORRA 3HQ4O 3L6DA 2UYYA 2BH9A 2QRJA 3R3JA 3S55A 4XZ3A 4MVJF 1U4SA 1ZFNA 2HK8A 1R4MA 1LU9A 1SOWA 2O23A 1YONA 3KYBA 3ONDA 3HDQA 4NFSA 3RROA 1ZH8A 4XYGA 4NG5A 4EEZA 4YXFA 5BSFA 5DCUA 1YB1A 4XCVA 4Z0PA 1ADBA 3DEYX 1BW9B 3BTSA 2YHUA 4GWKA 4DQXA 3GZNB 1AGNA 4PVCA 2Y66A 4XQEA 5B37A 1U5CA 4CPDA 1A5ZA 5CDUA 3MJCA 1DFHA 4IDBA 4MIYA 4R5MA 2HRBA 4NFYA 1VLLA 3IMFA 3U9LA 4DMLA 4IDCA 2X9VA 4DPMA 3C7AA 5F3RA 2PGLA 3JQFA 4BNXA 2CMDA 3I52A 2VHZA 3BIOA 4Z0HO 2EKLA 1UR5A 1TI7A 4IJWA 1LBEA 2BD0A 3FN4A 2Q2VA 1Z73A 4R01A 4Z9FA 1U4OA 2VT3A 3TFQA 4RF3A 4PG4A 4EJMA 3PP8A 2ZTLA 4ZN6A 5A02A 1A4IA 2D5AA 1XYGA 4DUPA 4R9RA 5ENVA 4WLFA 1A71A 1ISGA 1KEUA 5CPFA 2O3QA 4L9RA 1O5IA 1Q0QA 2JHGA 1PJBA 3VC7A 1PWXA 4Q39A 5CEFA 2BF7A 1E3JA 4UEOA 2QQ5A 3WTBA 4GKVA 4FFMA 1A9YA 1PL7A 5AXCA 3VOSA 1I01A 1DXYA 2WD7A 3I5MA 1JDJA 1UDCA 3T4XA 1U8XX 1B3RA 1PGNA 1T4BA 3OA2A 4JBGA 1R66A 1FMCA 4FJ0A 4CR8A 1ZK3A 4Q3CA 3C1TA 2NU9A 2NVUA 1JVSA 3DZKA 2BFMA 2IODA 2ZIZA 5BQFA 3DHNA 5CDYA 3C1OA 4E32A 2UV8A 2B4RO 2GNAA 3FI9A 3JD0A 1HE2A 1NP3A 1W8DA 2EEZA 1HSZA 5I7VA 4MP6A 1I10A 1KY5A 1CQJA 1R6DA 1NHGA 3NX4A 2QZZA 3H5NA 1Z6ZA 2XOXA 1V6AA 2DC1A 3DMTC 5B4TA 1Y7TA 3Q11A 3L6EA 2IYOA 2O3SA 2EW2A 1P1RA 1LRKA 4XEHA 1IL0A 1DHRA 5FI3A 1U28A 3GAZA 4OGWA 2E37A 3VDQA 1HT0A 1NFQA 2Y1CA 2ZB8A 4C7KA 5B1YA 4MVJI 3BZUA 1NQOA 2ILTA 5A9SA 3F1KA 4ZU3A 3M2TA 1P45A 5KVCA 2RIRA 2HAEA 1LDBA 3PYLA 4D44A 4DQVA 4YQYA 4D45A 4M86A 3TRIA 3CZRA 3PYXA 1WVGA 5IF3A 3ZW8A 4UVEA 2W2LD 4OAQA 4RPJA 4CM8A 1MA0A 3JSAA 1B26A 1P1JA 2GD1O 3NV9A 3UICA 3MJSA 4ALLA 3TZ6A 1NVTA 4BNJA 3ZU4A 4EJ6A 5L9AA 1Y8RA 1HDXA 3W6ZA 3OICA 3EDMA 4M8SA 3LT0A 2I66A 1PS0A 3JQEA 3PEFA 3GEDA 5IJZA 3CKYA 2WD8A 5U9CA 2NU8A 3ETGA 4G2NA 1GZ3A 2EGHA 4DYVA 5DBFA 3SXPA 1DFGA 1DO8A 2VQ3A 1BMDA 3HZZA 3JQGA 4XWYA 3A4VA 1T2EA 4PLFA 3WGOA 1QYCA 1KERA 1W4ZA 2C0CA 3GR6A 4IS3A 4URFA 1JKJA 4R41A 2GASA 4BV8A 4DC1A 5C3MA 5CP8A 1U1IA 2D1YA 1Z7EA 2DFDA 3DTYA 3PHHA 1PSDA 2G76A 1X0VA 3UHAA 2V6MA 3IKTA 2X8LA 3E18A 3L4SO 5DZSA 4P4NA 1Q0HA 4MVJM 4WNIA 2EW8A 2POQX 4A0SA 1ENYA 1GQQA 1Q2XA 1EZ4A 4HFJA 3PJFA 3ZGYA 4JN6B 3GDGA 3OH8A 1YOVA 4TROA 1EDZA 1BVUA 4O6VA 2O4CA 2PV7A 3WICA 3WIDA 2B0JA 2ZB3A 4GGOA 5COAA 3PHIA 5IFLA 2VZ8A 2GZ1A 3GK3A 4ZQFA 2QRKA 2C20A 2LDBA 4OKNA 1NFRA 2C5EA 2Q3EA 3FF4A 5T8KC 2CNBA 4NZ9A 1L7EA 1N2SA 2FPIA 4IZIA 4BNMA 1Y81A 5G4KB 4AJOA 2GZ3A 1BDMA 1HRDA 3ZNNA 1P74A 4BS9A 1A7KA 3WSVA 3GPDG 1GU7A 5DBGA 1PGPA 3VZRA 3PWSA 4L8VA 2AEJA 1U5AA 1N1GA 1TT7A 4UULA 3PJGA 5JBIA 3ANMA 3I83A 2FHSA 1PS9A 2QZ9A 5A03A 5G0SA 2GLXA 3RVDA 5I7FA 4ZRMA 2ZQZA 5CDSA 3LF1A 4CM1A 4WOKA 4ZQBA 3DOCA 2FOIA 4HV4A 1WDMA 2W90A 3V2UA 4F46A 3E8XA 5DOZA 4CM9A 4BNYA 1H6CA 3GQVA 3JYPA 4Y6RA 2ZTMA 4GL4A 1I3LA 2P9EA 3LLVA 1TLTA 3BTUA 1K6IA 2AG8A 4JXKA 4JROA 1N7GA 2PZJA 1CJCA 3HFGA 3PRJA 1J0XO 4ONEA 5BR7A 1ADFA 2FWMX 3DBHB 4DLLA 3QWHA 2NQ8A 1ZNQO 3OMLA 3A1NA 1VC2A 1E1LA 1CRWG 4HY3A 1NR1A 2WEKA 4KMSA 1D4FA 1VKNA 3GF4A 4ZD6A 3GOHA 1Z7BA 5ILOA 5TSDA 5GMOA 3FNHA 2AE2A 3U0BA 2R00A 3GEGA 4CMCA 5FWNA 3WJAA 4DWVA 1EVIA 2OBYA 4E30A 1F12A 2PY6A 2QHXA 4GVLA 1SPXA 3KSDO 3OJLA 4QT0A 3PGXA 2I99A 5LDHA 4FJ1A 4XA8A 3U62A 4TKMA 3U49A 1GEEA 1X7DA 4YJHB 2D8AA 5IZ4A 4CV1A 3GMSA 4QQRA 1NTOA 3ITDA 3LSYA 2BI8A 5IDWA 2QYTA 3O8QB 5CEEA 1CIVA 1I36A 4GLOA 2AMFA 3E6AA 3BMCB 4I8XA 2PKQO 5CEJA 1AXEA 1UH5A 2BRUA 4ALNA 1E0DA 4NQZA 1V3VA 4DTIA 3D5TA 4BMVA 3LDHA 3QLJA 4KUEA 4K28A 1X7HA 2UUOA 5AXBA 1SZJG 3GRPA 9LDBA 4RL6A 4RVFA 3L0DA 1G6KA 4I9UA 3ZU5A 4BO9A 2IZ1A 3JQFC 3DDNA 2WYWA 1UXKA 1C0LA 4CMIB 2DBVO 1QP8A 4GX2A 3C24A 4CMAA 2Q1UA 1LJ8A 4AVYA 2IDZA 3WWZA 1ZEJA 3RC9A 4D3FA 3KSZO 3MWEB 2O2YA 3D4OA 1TT5A 4FC7A 2VYVD 3WXBA 3JQ7B 5ENDA 4WKGA 2RHCA 5EPOA 4YAJA 4KUHA 2OL4A 3AI2A 1GPJA 4BGEA 4RLSA 3ZWNA 4TKLA 2J5KA 2RHRA 3CTMA 4J4TA 3LT2A 4TZTA 1PGJA 1R16A 3C85A 3IL2A 1PZGA 3D4NA 4J91A 1D1TA 4PFJA 2Q99A 3E9NA 2CD9A 4GVXA 1QYWA 2Y93A 2G0TA 1JTVA 2YY7A 4YJGA 2YW9A 4KOAA 3S2IA 1ENPA 2SCUA 5EESA 4IDDA 4W4TA 1QMGA 2CVZA 5TGDA 2OORA 1C1XB 5B12A 1MXFA 2VNAA 1YQXA 2JAHA 3S1LA 4CL3A 4P4GA 4EGFA 4MVJH 5T67A 1MXHA 3ZU3A 5JS6A 4JP2A 3LT4A 1ARZA 1PL8A 3GAFA 3WSWA 1R12A 3BA1A 1DIGA 4BNZA 2C59A 1IPEA 2O7SA 3O26A 4AJ2A 1YBVA 3I3OA 5HA5A 4PLZA 1KEPA 3A14A 2IEDA 3PI7A 4WNCA 3EUWA 1I3MA 4PLTA 1ZSVA 2AQHA 3D7LA 2C2YA 5JAIA 1Z74A 3K96A 1Q7GA 2AE1A 1Q1NA 4IDGA 1NBOA 3ASVA 4J0FA 1U8FO 4PZEA 3FNFA 1DJNA 1NNUA 1ONOA 3E9MA 3WMXA 4CMHA 4Q3EA 4PRLA 3LC1O 2I9PA 4ND3A 5KJEA 3ULKA 2DPGA 3G3EA 4OOEA 2VOEA 1RPNA 3X2EA 3INGA 3LC7O 4FW8A 4YAEA 3AUAA 4AJKA 4BKUA 1FF9A 1ISHA 3NAQA 4FN4A 1GYPA 2C29D 4N18A 5IG2A 3UN1A 5JO0A 2VNSA 3WGTA 3F47A 4EI2A 3QWFA 1XELA 1EE9A 2BGMA 4A7PA 3VZQA 3BYZA 4D7AA 3DZBA 3AFMA 1OC2A 1ZK4A 3GFBA 5JO9A 4BNVA 3VHRA 4IIUA 4OIMA 3WNVA 5JMPA 3ONFA 4XDZA 2NTJA 2PNFA 4I5EA 4KTTE 3WR5A 3OBBA 1C0IA 1ADGA 3OQ1A 3DOOA 1E6UA 4BNTA 1MB4A 1TVEA 3TOZA 1R4NA 1WNTA 4GWGA 1XR3A 1LC3A 1NPYA 2C5AA 4CQLA 4TRMA 2Q1WA 4HXYA 3I1JA 3IP3A 3EVNA 1ZO8A 3ROPA 2D3TA 3EGOA 1GEGA 2GN8A 3S2FA 4QFDA 1BXZA 2P5UA 1AE1A 2BLLA 1E1NA 4QTZA 3ICCA 1J4AA 2DTEA 4FFLA 4AG3A 1M6WA 3EYWA 1YJ8A 5L53A 1WP4A 1PZHA 3GPIA 1LDNA 2AXQA 2JL1A 3CZMA 4Q3AA 1I5RA 3HB4X 4R4JA 3H9QA 2VHXA 2FZWA 2V6GA 5C7IO 2HQ1A 4AJLA 1OMOA 4B4UA 4DIBA 3HWRA 4U8GA 1EFLA 1O89A 4ALJA 5CFZA 2WDZA 4IY1A 1YDEA 2JCYA 4BKOA 4DBZA 3ZV3A 4EYEA 4YCAA 2CY0A 1QLHA 1SEVA 1ULUA 1HYHA 1N8KA 3W8EA 1IYZA 4E2ZA 2Q1TA 2VN8A 1DRUA 4U6SA 2B83A 2Z1MA 3ZV6A 4LRSB 2HRZA 3Q1LA 1K5HA 1U9JA 1XIVA 3QWIA 4EUEA 2P9CA 2QG4A 2HO5A 2B4TO 1F14A 3RKRA 1NHWA 2ZB7A 3NJ4A 2IZ0A 3A06A 4D79A 1JWAB 2P2SA 4GBJA 4PG6A 1V35A 3BXXA 2NVWA 4J7CA 3T7CA 4M87A 1R0SA 3VKUA 4C4OA 2JCXA 1KVUA 2R00C 4AJJA 4BGUA 1K6JA 3WX0A 4CM4B 4A2CA 3SVTA 2P5YA 4RPGA 3TQHA 4MVJA 8LDHA 2ZTVA 1V3TA 4I08A 4MIOA 2P91A 5ICSA 3QA9A 3FNGA 1JN0A 5CHEA 2OUIA 3GLQA 4XKJA 1I0ZA 4BNUA 1IUKA 4IJVA 1RWBA 3DONA 1T24A 2DTXA 3ZWOA 2X23A 2G82A 3H6KA 1R15A 4RO0A 4AICA 4AJNA 1NWCA 1F8GA 3FR8A 4RVUA 1BW9A 4BNGA 2QW8A 3ZZNA 2JD2A 3PWZA 2RH4A 3VVCA 1EBUA 1MFPA 1VPDA 1HE4A 2BI7A 2VWPA 4QECA 3GY0A 4KTVE 4K26A 2EKPA 1U3TA 3VZPA 3DHYA 4PVDA 3AUTA 2B69A 3G49A 3MOGA 4MO2A 4CM5A 1IZ0A 1N9GA 3W4IA 1Z75A 3N74A 2RBEA 2PFGA 5BNTA 1QKIA 3VPXA 1VE9A 2ZB4A 3R3SA 3QVSA 4J1NA 1ADCA 2NUAA 4BO4A 1MV8A 4D42A 1GFSA 1P0CA 4K6FA 1Z82A 2EKQA 1GV1A 4NR0A 1QR6A 4WOJA 2GPTA 2Z5LA 4II2A 4BNFA 5L4LA 4EITA 4J2OA 3AY3A 4G65A 5DP1A 2OGUA 2H1SA 1DRVA 4BO7A 1M66A 3GVXA 3VH3A 2VWGA 3PLNA 2HMTA 4ZVVA 5I9LA 1HWYA 3GNTA 4GPD1 4MP3A 2Y0CA 3VTFA 2PD4A 1RYEA 3HDYA 4BOYA 3BMQB 1BVRA 2FR1A 2HCTA 1IZ9A 5U4QA 1FDUA 4ILKA 1E7MA 4DA9A 1YRLA 2O3TA 3D1LA 5DBIA 2B35A 4B7CA 4TRNA 4FGSA 1EE2A 3KYCB 1GL3A 3ONEA 3AW9A 1U7TA 1P33A 3RJ5A 4L4XA 4W7HA 4RCVA 5JC1A 3GRKA 1IHYA 2J3HA 1X1TA 3O9ZA 1JWBB 3IC5A 3D3WB 4A73A 4PLCA 2HKIA 4OXNA 1FK8A 4KWIA 2C54A 3WQRA 5TF4A 4PZCA 2B36A 3PIDA 4XD2A 2HDHA 1KC1A 5EINA 2DUWA 3WNQA 3OM9A 3EZYA 4JQCA 4GMGA 4CLEA 4GX0A 3DZHA 3JQ8B 1F06A 1ZUD1 5A4DA 4B3IA 4YJFB 3MJ4A 1GTMA 5JSFA 2NU6A 2GF2A 1NASA 1JW9B 5TJHA 1HYEA 1BGVA 4ZA2A 1R0LA 1M6HA 3VPFA 3TWOA 3JQCA 3GG9A 3WG9A 4IGEA 5JNLA 1EFKA 2CFCA 1B8UA 3FR7A 1CERA 3QHAA 4D0RA 2CDCA 4JIGA 5JAQA 3RJ9A 2Y67A 3GVCA 4O0LA 2DAPA 1KY4A 1FDSA 1PGQA 2DBQA 1O94A 4J43A 2I65A 3JQ6A 3NTOA 3ROQA 3SC4A 3DBVO 4LISA 1FDVA 4HX5A 1JAYA 4C7JA 2Z95A 1WW8A 1F8FA 1EUCA 4E5NA 3R6DA 1XG5A 3TSCA 4UVIA 4DRYA 3PXXA 2P68A 2IXBA 1M75A 3TNLA 5TRTA 1BG6A 1N5DA 1RM0A 2JCVA 2JHFA 4HUJA 3N58A 1G0OA 2WSBA 1U2GA 2DFVA 4QX6A 3B1FA 2X0NA 2BMAA 3GVPA 3L4BA 4E6PA 4ROSA 3IUSA 2VYVA 1A27A 5JCXA 1E7QA 1I2CA 1JVBA 3ETEA 4WEOA 1RM4A 2XXBA 4TQGA 2X4GA 4K6CA 5DF1A 1LX6A 3NTRA 1UXIA 2YHIA 3DHEA 2NTNA 4DLAA 3QY9A 4BNNA 2X6TA 4PIVA 4B4OA 1S7CA 4E21A 3OHSX 3K73O 5FI5A 1SC6A 3ROMA 4A03A 3I6QA 4F6CA 4FJ2A 2WYUA 4HADA 3RQSA 2VZ9A 1PU2A 1MC5A 3I9OA 1VM6A 2VWHA 3SJ7A 3WDSA 1U3WA 1DBVO 1JLLA 4FD3A 3RBXA 2HMWA 1ZMOA 3PHLA 3GUYA 4YAKA 4PLWA 4CM6A 4IBOA 1Y1PA 1LDMA 3WWYA 4XYBA 1MUUA 4DPLA 4UUOA 5G0VA 4CQMD 2A4KA 1TEHA 5LCXA 2HUNA 4R1UA 3SX2A 2HJRA 4U6QA 1XHLA 4GAEA 3LQFA 3FNEA 3UKOA 5G0UA 1H0KA 4NJOA 1DEHA 1T4DA 5A5EA 2E49A 3WB9A 1SO8A 4N5LA 4E5YA 1HZJA 2OOSA 5EQDA 4RVSA 3O4RA 4ZQEA 1C14A 2OO5A 3QVTA 3JD2A 4DL9A 2NACA 4BO1A 3L9WA 3OP4A 1HDGO 3K5PA 3RC2A 3GZ4A 1OAAA 5LC1A 1VSVA 1Z45A 3GN1A 4LCEA 4TMFA 1R4MB 3ZDFA 2GZ2A 3DBLB 3ZNPA 4W6ZA 5EMHA 4FBGA 1J5PA 3DBHA 4QEDA 4RDIA 2BFOA 1LLCA 2X0RA 5EJ2A 4IDAA 4BO5A 3MJVA 1UAGA 2PD3A 5KJFA 2FSVA 2HU2A 3PFWO 1LDYA 4R68A 2VOJA 3F4LA 4M49A 4A5OA 5JDCA 3PWKA 1WAMA 1OZAA 3IS3A 3SJUA 3ON5A 4A10A 2JFHA 5EQFA 1B15A 1ZBQA 2Y05A 4B4WA 2I5PO 4QXMA 3MEQA 3DQPA 1ZXBA 1DC5A 3K9QO 4FS3A 4MVJD 2EJWA 4FQ8A 3Q6IA 5ILGA 2BHLA 3E48A 4DGSA 1GYRA 3GGOA 4ND4A 1B3BA 2CF5A 4PLYA 3LLSA 5F5NA 4OSPA 1E7WA 1GAEO 3EC7A 4QFCA 3I9NA 4YJHA 1EQ2A 3RUDA 3QVWA 4NIMA 3OETA 4M55A 4TRJA 3O8QA 2UAGA 2CSUA 1YS4A 5DP2A 3HB5X 3TZQA 5A04A 2E82A 3BMCA 4IZHA 2YFQA 3ZNQA 1IULA 2JFGA 1D1SA 1ENOA 2Q46A 3Q2IA 1NX6A 3EVTA 3QQPA 1UZMA 3PJEA 3DC2A 3AWDA 5EIOA 3DZGA 2ZQYA 1GADO 2BELA 4ID9A 3H2SA 3QVOA 3WGIA 4WGGA 2FZEA 2O3UA 1RKXA 4XR4A 4YQZA 1MC4A 4II3A 5EERA 3GG2A 4LN1A 5KCZA 2B5WA 4FB5A 2D59A 3PJDA 4L76A 3PHGA 3FPLA 1UJMA 3PQFA 3U4HA 2OMEA 5TNXA 4D46A 4IMPA 1IE3A 4Q9NA 1OI7A 1EDOA 1NFFA 3RUEA 1GD1O 2Q1SA 2WD7B 3P5SA 4DVJA 2RAFA 2XXJA 2OFPA 3DTTA 5JCJD 1PJTA 1Y8QA 4GLLA 3DXFA 4Z3KA 3UXYA 1VRWA 4UREA 3U4DA 3UGKA 2X7HA 4DIOA 2DQ4A 3AY7A 1NWHA 1GZ6A 5C37A 3EAGA 2J3KA 4NK4A 3AJRA 1NVGA 2DTDA 1OFGA 4OQYA 4AJ1A 1LSJA 1V0JA 4CMBA 2YFHA 2E6UX 5T6BA 2OZPA 1YVEI 5BSEA 2DT5A 4F45A 1UP4A 1FXSA 1EVYA 3NT4A 1O6ZA 4PLGA 1EK6A 4WCFB 1NM5A 2W4QA 4XQ9A 4CLRB 4J7UA 1E92A 4HFMA 3RCBA 5KTKA 1MP0A 1C1XA 1X1EA 4B8WA 4YRDA 1QSGA 4D0SA 1B8PA 1HL3A 1QYDA 4W99A 1UXGA 5GZ6A 2ZCUA 1K89A 2J8ZA 3A28A 4OMUA 4R54A 2GRAA 1I32A 3WGYA 4JX8A 3T7EA 1HZZA 3WGGA 1NR7A 4D3SA 3WMWA 2NU7A 3IJPA 3GN2A 4J9UE 2O2SA 1YL5A 2GYYA 3GUCA 1V9LA 1SMKA 3GMDA 4YTEA 1HF3A 1T2FA 2EP7A 8ADHA 3QW2A 3ZU2A 4DREA 2B37A 4IQ8A 2OP1A 4L75A 5JFOA 1D3AA 4MPDA 3B20A 4RQTA 3KYDB 1PJQA 1T2DA 1RJWA 3NDRA 4Z0TA 5CAEA 4Y6SA 4IQGA 1XDWA 4WK6A 2TMGA 4JJFA 4R9SA 2D0IA 1P1IA 5JAZA 1X14A 2VHWA 5TS3A 4MDHA 4YBZA 4MVJG 3UOGA 3JQGB 3VAZA 4AJ4A 1ZEMA 2UDPA 3VPHA 2IZZA 1AUPA 4WLOA 4RF4A 1IY8A 4E4YA 5A1TA 2UVDA 5IAAA 3LVFO 4JP3A 5C5IA 3PPIA 1GQ2A 2QX7A 1HKUA 3E5MA 4LSWA 4YEDA 3INRA 2B5VA 3DFZA 3MCVA 3VH2A 1Q7BA 3ZWWA 4DPKA 4EUFA 5ITWA 5ER6A 3F5SA 3UF0A 5FEUA 3L4BC 3RUFA 3ZNOA 1XCBA 2JAPA 3DAPA 1YDWA 3QWAA 2X9GA 1LI4A 4J6FA 2AEFA 3CE6A 3G1UA 4B79A 5L7WA 3C8MA 1DC6A 4P4LA 4OHUA 4O63O 3SLKA 5TQVA 1DIRA 1AN9A 3G79A 1YBAA 2I76A 4M89A 4Z3DA 4IXTA 1K2WA 3RBVA 5ADHA 3W8DA 3K2EA 5GY7A 4NNJA 4MINA 1OOEA 1E5QA 4XYMA 3WOHA 1SCUA 2X86A 2GERA 1JAXA 1ZK1A 3F4BA 2FP4A 4RLHA 3WYEA 4YJDA 1PGOA 3BHJA 1HEUA 3V2HA 3TN7A 2DPHA 3AOEA 4JLWA 1R37A 4B7UA 1ZJZA 4R1TA 3RUHA 2D4AA 2JJYA 5G4LA 1DLJA 3L9XA 3SBOA 2J5RA 1VJ1A 5COBA 4JGBA 3UFXA 4D3DA 4TVOA 1P77A 3R1IA 2NQTA 3PGJA 2ZK7A 5F5LA 3GVHA 1XQ6A 2XPCA 4WPGA 3ZW9A 1YQGA 1GQYA 1O8CA 1U3VA 3JYQA 2Z1NA 2X5KO 3H5AA 4J4HA 4OXKA 4H15A 2AEMA 5L45A 2EIHA 2P9GA 4YT2A 4E5KA 3NT5A 2HK9A 1ISFA 5C7LO 1LDGA 2YV1A 1YWGO 2HMSA 1DFIA 2J5QA 1CF2O 2WE7A 3TZCA 5KVSA 3H7AA 3CH6A 1ZVMA 1ONNA 3GDFA 3I9MA 1EUZA 3X2FA 3WBBA 3BMNB 4EBFA 1HDOA 4E2WA 3O03A 3L6OO 3L77A 1P0FA 1P44A 4AFNA 5U1PA 4Q3DA 2VUUA 4QSMA 2AA3A 2VUTA 2RCYA 2JFFA 3QVXA 4ALMA 4EZBA 3PYMA 9LDTA 1KVTA 1KVQA 2A35A 2NADA 5DT9A 2C7GA 3JQDA 5JDCC 2DKNA 3PZBA 1SB9A 4G81A 3WS7A 4CM4A 3ZWMA 2CZCA 3FWNA 3KHUA 1E3WB 3NJ8A 3AFNA 4I9NA 3W8FA 4BIIA 1PQUA 4IJUA 5H82A 4ALKA 2Q4BA 1KVRA 3ZH2A 2H6EA 4E13A 2CDBA 3BAZA 1F0YA 1T2CA 3DB2A 4Y9DA 2DBZA 5TT1A 1T26A 1ZZEA 1S6YA 2F1KA 3UH1A 2H5LA 2P4HX 3D0OA 1GPDG 3ANLA 3C3XA 3HE3A 3RU7A 1PEDA 1SAYA 1ISIA 1E77A 3A9WA 4OSOA 2VUSA 2IRWA 3STHA 4YDRA 5IN4A 3RUCA 1VL0A 2H9IA 4U7WA 1GY8A 1C1DB 1DHTA 2HK7A 2V6BA 5KVVA 4XDYA 1H2HA 5COQA 4LW8A 5THQA 4NK5A 2EF1A 5F1OA 1WLYA 4IXWA 4B7XA 3OECA 3KTDA 4E3ZA 3ZI0A 1QLJA 3H9UA 1K0UA 3BHMA 4DC0A 3KO8A 4CQMA 3MWDB 2UUPA 2VRCD 4DQUA 5KIAA 5K6AC 4I5FA 2HMUA 1VSUA 2Q4EA 1CQIA 3U3XA 5JC8A 1QRRA 3Q9UA 1CETA 2C2XA 4NBWA 5MDHA 2AQIA 1NAIA 3JYLA 1O0SA 3V1YA 4HFNA 1PJSA 2Q45A 2YQ4A 4Z9XA 2YDYA 4PLVA 4YT4A 4KQWA 1I2BA 4XYEA 1JKFA 5A3JA 3GA0A 3FSRA 1U3UA 5KKAA 1ZSNA 2YDXA 4BO6A 1LLQA 3BMQA 3F9IA 4WCDA 3ZN2A 2V65A 2OBNA 5I9NA 1JA9A 4DBVO 2YYYA 3ZHBA 3KYCA 4Q3NA 4QO8A 2FPPA 2Q49A 3BMOB 4R16A 4FPXA 5ES3A 3JD4A 5AYVA 4KWHA 3KETA 4FR5A 2NSDA 3MOIA 3Q0EA 2IE0A 3S2GA 2PZMA 4RDHA 3D3WA 2ZATA 4WUVA 2NTVA 1B7GO 1KYQA 3D4PA 2BGLA 3INTA 2W8ZA 3NT2A 3OJOA 5B4UA 5LDGA 4J9VA 5F1KA 5K0ZA 1PL6A 1FJHA 2WWRA 3K92A 1LQUA 4W82A 1U2DA 6ADHA 1YE3A 1P31A 4E12A 2E48A 3H8VA 1GV0A 3KBOA 4HBGA 4R1SA 1I33A 3JQ8A 2CVQA 1QV6A 4OJNA 2NM0A 1B8VA 5JDIC 4YJFA 1X13A 2VTEA 3KM0A 3QJ5A 1D7OA 1DDOA 3OIGA 5KJ6A 1Y9AA 4EDFA 4N5NA 1B2LA 1H9AA 4YACA 1ZK2A 1M76A 3OJEA 4BKQA 4UUPA 4WASA 3D3EA 5JW6A 3GZNA 3FD8A 1XKQA 3COSA 2JKVA 1KOLA 1WZIA 3ZCXA 7MDHA 3JTMA 3MJTA 1OBFO 2EERA 3FPCA 2G5CA 3OF2A 4JK3A 4KDEA 4E5PA 1GR0A 4IQ0A 3VDRA 1SOVA 5DN9A 1LSUA 2PA3A 4NHEA 4WLUA 3JV7A 3KEQA 3RASA 4CV2A 3FTPA 3LZ6A 5JAMA 2PR2A 4J1TA 3PDJA 3WLFA 3G17A 3SEFA 3ETDA 4MIEA 2XAAA 4CUKA 4O5OA 3U5TA 1GUFA 3U4CA 1QG6A 3V1TC 4Y6PA 1MLDA 4I5DA 2O50A 2Y1FA 1A72A 5JCJA 2EG9A 3NUGA 1XGKA 4UVGA 4KQXA 4KUGA 4EUHA 3FWZA 1ZW1A 1ZMTA 3RUAA 1PTJA 4HNHA 4AJIA 2PZLA 4H7PA 1VKOA 5TIIA 2PKQP 2DU8A 3ITKA 1A4UA 3JQBC 3QRWA 4WLEA 2FR8A 3WGQA 2FPGA 4W9NC 4K9DA 1Q7CA 4NJMB 1BWSA 5JMWA 2I3AA 3CPSA 3RFTA 4BO8A 3WQQA 4UEKA 1N92A 1AXGA 3F6YA 3AOEC 4BKPA 4FIZA 1YBMA 3LYLA 2P4QA 2ZYGA 3ZV4A 2NVBA 4PLHA 1PZFA 3FRJA 1W0CA 4H16A 4MKRA 4XX0A 3M6IA 4ND1A 1NYTA 1LSSA 4KZPA 4ITUA 5DULA 1NQTA 4TZKA 1QYVA 4GX1A 1LNQA 1JQBA 1PR9A 3EK2A 3H5RA 1LXCA 3WTCA 4BHTA 4BMSA 5TLSA 1YB5A 4ZRNA 2VWQA 4B3HA 1T1RA 4MKXA 1YJQA 2D5CA 3EHEA 4Y98A 4CLDA 2DBRA 1ZSYA 5TJ9A 2YV3A 1KEWA 4L74A 4P8RA 1DSSG 5A9TA 2X5OA 4MOWA 1H5QA 3AOGA 1DC4A 4RPLA 2YZ7A 1I3KA 4NBUA 2GN6A 1PQWA 2HSDA 1DIHA 3L07A 3M2PA 3IJRA 2PK3A 5CG2A 1XU7A 2XF8A 1SNYA 4LVCA 5IZCA 1I24A 1KVSA 2GN4A 2AW5A 2E4AA 3KLPX 4TSKA 2PZKA 3DR3A 5CDTA 2O48X 3W1VA 4OM8A 1SEPA 1K3TA 3KXDA 1JKIA 3DBLA 4PG5A 1PR3A 4FOOA 4NH4A 5DCYA 3ZWCA 1Y5MA 4EEXA 2QRLA 3G1TA 4J1QA 4CMEC 3E9QA 5JYEA 4AJPA 2GN9A 4XIJA 3PK0A 1KETA 1H93A 1EBFA 3EMKA 5L7TA 4GSLA 3Q2KA 5HS6A 4CMGA 1ID1A 4CR7A 4NPCA 5HRUA 1LEHA 3F3SA 4YB8A 4CMKA 4GSKA 1YO6A 2FSSA 2JD0A 3ROKA 1E7YA 2EXXA 3OQ6A 4IDFA 2C07A 1HDZA 2DVMA 4HKTA 1N9GB 2X5JO 1XU9A 4FC6A 4YPOA 2HJSA 5L40A 2OXIA 4FFPA 2V7PA 3ZWXA 2DLDA 4RVDA 1PIWA 3DBRB 4H3VA 4IDEA 3TDKA 4IS2A 4MVJE 5A05A 4XJSA 2W2KB 3ANNA 4F3YA 4BMNA 4ZICA 2Q50A 3JYOA 2VRBA 4DMMA 3K31A 3P19A 4CV3A 4NFHA 2Y1EA 1J6UA 3RAJA 3VTZA 4J90A 2HLPA 5BT9A 2A9FA 2IYPA 5DNAA 1VJTA 1EVZA 3HN2A 3OSUA 3CINA 1GCOA 1ISMA 5G4KA 5THKA 1BXKA 3VVBA 5CPBA 3WYBA 1C3VA 4ZJUA 4B4VA 4CLOB 5EL0A 2GSDA 1FDTA 3B1JA 5HS4A 4HNGA 4OL9A 2AQ8A 3JQAB 3S8MA 1RYDA 3I9JA 1LQTA 5H81A 4FFNA 3OEYA 4YA6A 2GCGA 3QP9A 3D64A 2ZTUA 4J2HA 5DCWA 4RV9A 1O95A 4R3NA 1BXGB 1B14A 2WM3A 3H9GA 1PWZA 4GMFA 5BNIA 3HG7A 1ZKMA 1N1EA 5T57A 4PG8A 1GUZA 4W7IA 3KEOA 5CDGA 1X15A 3LF2A 4DXHA 3PTZA 2IXAA 3WFJA 4WCFA 1AHIA 3GHHA 1ENZA 4IJKA 4DYDA 4CLRA 3W4JA 5I8WA 1GCUA 3AK4A 2X0JA 4UAGA 1N7HA 1ML3A 3AM4A 5T64A 1ULSA 3MZ0A 1WZEA 2I6TA 2VZ0A 3ASUA 4BUCA 5G0TA 5C7OO 1T2AA 4NU5A 2DUUA 2F00A 3EY4A 2PTGA 4L4SA 4BNIA 1VI2A 1HYGA 2X22A 3PQDA 1I2ZA 4NU6A 3RBZA 3OEWA 2O4UX 1CDOA 3GNQA 1HDCA 4IM7A 3PHJA 4OO3A 2H63A 1C0PA 2YUTA 4R3WA 3RC1A 2NWQA 4BGVA 4IUYA 3KVOA 4CL8A 1A7AA 3FHLA 3ZWPA 1Y6JA 4OXYA 5ER9A 1FDWA 3NKLA 2QIOA 4ALIA 4BQPA 3KYDA 3KZVA 3RU9A 4J49A 1E7SA 2PLAA 4TWRA 4E0BA 1YKFA 3IDSA 4MKZA 1Y5RA 1W73A 3M1AA 3WIEA 4CUJA 3K8ZA 1HXHA 1GYQA 5L95A 2CF6A 3H9EO 3B6ZA 3GHYA 4RJTA 3KB6A 5JE8A 1YL6A 2BFAA 3WGHA 5GZ1A 1GDHA 3CIFA 4CJXA 3PDUA 4N5MA 1QXSA 2PH5A 2YHIB 4J1SA 4CMIA 2VRCA 1PJLA 2EWMA 4B8ZA 4BV9A 2VHVA 3BHIA 1UZNA 4J7XA 3DMYA 1BSVA 4RF5A 3TL2A 1PJ3A 2VYND 5K6AA 1NQAO 4NBTA 1J49A 5AXAA 2ZYDA 4I1IA 5KOIA 5IDYA 4CODB 2CVOA 4YT5A 1E3IA 3IAHA 4N54A 4R51A 2WMDA 1K6XA 3RKUA 4K1LA 1UDAA 5G2OA 2I67A 1XQ1A 1BHSA 5A3VA 1UDBA 2FR0A 3LT1A 2NVUB 4U5QA 4XYLA 4RPKA 3JQ7A 5KJCA 3TPCA 5JPIA 3OJFA 2B4QA 3F5QA 5AQ1A 4PG7A 2WE8A 1E6WA 4AL4A 3JQ9A 3TOXA 1LTHR 2J6IA 3ZWVA 4PCVA 1B16A 4E2YA 2GGSA 4JBHA 3I9KA 7ADHA 1V8BA 4LCJA 3ZWBA 1UP6A 3GGPA 4CM7A 3DL2A 4YVFA 1LLUA 4E33A 4FGWA 2Y0EA 4FFOA 3PVZA 5HM8A 1E1KA 1MG0A 3ZWYA 5A9SB 3R0IA 3W6UA 4CR6A 4WE3A 3OQBA 2YJZA 1HE5A 4Z6KA 2I3GA 1T25A 5KNLA 3AI1A 1H6AA 3FBGA 2A92A 1NAHA 4UUNA 4MP8A 3SLGA 4LMPA 4BNHA 3JYNA 5JY1A 3TL3A 3GEMA 1D8AA 1QORA 4TRRA 4S3MA 1WWKA 4XQGA 5HBRA 4CM8B 5JDIA 1RM3A 2PGJA 1YQDA 1H2BA 1E6EA 4E2XA
chains in the Genus database with same CATH superfamily
4TMKA 2PL5A 1XXHE 4TL6A 1KSGA 2TRSB 1BDBA 2ZIAA 3ZH9B 4NCKA 4B6GA 5DOVA 1D2HA 4ILEA 1KYIA 3BMNA 3PE4A 5EHGA 2OC9A 3AXSA 3E0XA 3AP2A 3IMEA 2YV5A 4N5IX 4EY8A 1OX5A 2QA5A 3CJQA 1XLVA 1CEQA 5DGDA 4PCLA 3EZ2A 3ESZA 3FSGD 4EA7A 3RSHA 4IGAA 4X3CA 3B6MA 2HGZA 5UKDA 2YYZA 1XU4A 5DVZA 3EY9A 2X0IA 3QVVA 1Q15A 1LF0A 3AKDA 1NQ5A 3CTPA 4I6GA 1CTQA 4MQFA 1TMYA 4K6GA 5E0KB 1X7YA 4MRPA 3TAHA 1NVMB 3NC0C 3M6XA 1WSAA 4QO7A 4FDAA 3T1TA 3ND8A 4UAUA 5BMVA 2EFCB 2GPNA 3KUKA 3VSCA 4EYGA 1D4ZA 2D2EA 3LTNC 121PA 2AG1A 4GOKA 4RQUA 3VH1A 1JSLA 2E4WA 3V7NA 5K01A 4YYZA 3AU9A 3NYRA 1VG0B 3C6XA 4ZI5A 3ZY6A 4RETA 1NDHA 1T8SA 1YZVA 4D96A 1UJ4A 2YW2A 3CZAA 3NZEA 5J63A 1T3HA 3N7UA 3UJCA 3AL3A 3KQSA 3NQ41 4XSVA 3SQNA 1OBCA 1JJFA 4OGGA 2PKCA 5C32A 1S4MA 3KB1A 1GRCA 1Z0DA 4AY2A 2QI9C 3BC1A 1DTWB 3OIFA 2C77A 2ZRMA 4KAJA 1IPFA 2VTDA 4LGYA 1J0CA 3L6RA 3AC0A 3QZUA 5KOHB 5HF8A 1KRWA 5JALA 1JEDA 1G4AE 2NYAA 4FT2A 2ZRFA 4WY8A 3RIHA 1AQNA 1YV9A 3IVRA 3N2ZB 3PLRA 4G23A 4NMHA 4RH1A 1BVHA 3IIEA 4S1VA 1TZBA 2BJVA 1O97C 1K97A 3HEMA 2MJLA 1A9QA 1RE0A 1ZOPA 2ICAA 3OZAA 4MYTA 4PZUA 5HILA 5JPDA 4A26A 1NW6A 2IX3A 2O5CA 3GBPA 3PXCX 2R6DA 4N6GA 1G5FA 4RANA 1Y8QB 3DH0A 3GEIA 5T5QA 4JYZA 4YJ3F 4R1NA 1QRSA 1ODFA 3SJAA 3KD2A 3LCMA 3W3AA 3KUXA 4ZZ1A 2IP2A 2DRIA 2QLBA 4TL7A 3KPYA 3FRHA 3T1QA 1JU9A 5EG5A 3D3JA 5JI2E 1RIFA 1P1KA 4P3KA 4IGFA 3KPWA 1EQAA 4IIHA 3KDSE 2A5YB 3WA7A 1BKDR 2VHYA 1E79D 1P2FA 2QVLA 3L18A 4LVUA 3UAWA 5IDXA 1PR0A 1J8QA 1KC3A 1UUFA 2DECA 1Y4SA 3JY6A 5IH7A 2NUPA 2PLWA 4ARIA 3NDJA 3DVRX 2RK3A 4YMWA 3JRWA 1FMJA 2PRKA 4TOIA 4NABA 1HDYA 5DHUA 3K2QA 5DTRA 4IILA 2ZRJA 1RZVA 1MU0A 1EK5A 1RSZA 4RKFA 2AMVA 3RB8A 2FUG1 3UCEA 3TGLA 4R69A 3DNPA 2AXNA 2HV8A 1HETA 5ALJA 4H77A 2MMGA 3OZDA 4IL5A 1IN8A 4WHMA 4YAIA 2J48A 4JU9A 1ZD4A 1DKRA 1VJCA 2FOLA 2XADA 5CFPA 1SR8A 4F91B 3VHLB 2QVCA 3TTXA 4BO0A 3EH2A 1G2PA 2J41A 3QGMA 4LK2A 1OU4A 3TLMA 3BRSA 4KACA 5DI3B 4BFUA 5TPZA 1AHNA 3QELB 4F2PA 5FO0A 5HQ3A 3IP7A 2GJAA 2QJTA 3DC7A 3AU8A 1OTXA 2MWMA 1M72A 2R62A 2C9YA 3N39C 1QH9A 1QV7A 4LX8A 3TCKA 2O0KA 1IY1A 4LOHA 4CMEA 2JFBA 2V58A 4EMTA 5AXDA 3RUIA 8ATCA 1U3DA 5C5CA 1JHAA 4GRAA 1NG9A 4MTCA 1ODTC 5JC1A 1CX9B 3HKDA 4JASB 4KQ6A 1F4LA 1KBZA 5AM0A 4AZ3A 3KKOA 5IN5A 2CXTA 4CLHA 3ENKA 4L8YA 3LFTA 4XRRA 3DKVA 1FU8A 4GH5A 3L8EA 5A0FA 3BFPA 2QAJA 4ZO6A 2WYVA 3R24A 3FPAA 1JDBC 2GUGA 3M9LA 2IBMA 2HYDA 3HACA 2J6CA 4M2LA 1JSXA 3GFGA 1ZJYA 3EFOA 4LYDA 5T4EA 1YS9A 3OPYB 5J40A 4P3YA 3N87A 1PJZA 1LPSA 3A1WA 4GDFA 1UAYA 3PUWA 4XJVA 3SC3A 3AVTA 5C8YB 3VC3A 1J1UA 2WICA 3NGXA 3I4FA 3I9LA 2H4ZA 1UBLS 1YJAA 4RHXA 4JLUA 1QV9A 4NATA 2WA1A 5C8YF 2ZSBA 1V5IA 2EFYA 5CM9C 3ZE8A 4A15A 3OIDA 3KT3A 5TC4A 4PGFA 2Z2JA 4IDOA 2BGKA 4RZ3A 2FLKA 3B7GA 4KP7A 4Z7NB 2W70A 3DZFA 3PUIA 4BQOA 4FZJA 4R5HA 4KWTA 1I51A 4Y3UA 4ENPA 1N2CE 3D5EA 4B82A 1C0KA 4BNLA 4N3CA 4PGGA 5GJVC 2G5GX 1OH6A 3EASA 3Q12A 5FORA 1LBSA 4JLNA 2AOTB 1TF2A 3D4BA 2WVJA 2XB4A 4NE7A 4IHJB 3FCOA 2W0SA 3IB3A 1GA1A 1E7RA 1NJFA 1A98A 2ZJAA 2PH1A 4MQ5A 2BZ1A 4YJGB 4U8HA 4IHJF 4J2TA 4FMPA 4WECA 5DN6A 3UT6A 3RC7A 1XA0A 4OKSA 3HDHA 3MIZA 5F21A 4NPAA 3ENNA 4R2MA 2ZYUX 1RM5A 4CU5A 5DYTA 1HV8A 2KWIA 2X1VA 1JS1X 5JFGA 3V1LA 3CWZA 5FFFA 3DBIA 2ZT5A 4LMRA 1U9CA 2OAQ1 1YU9A 4FOSA 2H4JA 3L0YA 4RVGA 1RXVA 2J3IA 4DV5B 4R81A 4TT3D 4BGIA 4ZQCB 3WMGA 2EQ5A 5CVEA 4X8LA 1LSOA 1O9BA 2QTFA 5HWSA 2NO6A 2IYEA 1YR8A 4FIDA 5EN4A 1LUAA 1ZWLA 3P2YA 3ZHUA 2IZ6A 4LPKA 1OC4A 2OCIA 1NXOA 3GX1A 3QFHA 2CVPA 2XT9A 2QF7A 4RK0A 3G0GA 3GRZA 2BKAA 4Y6QA 1NF3A 4ZREA 1XWFA 2Z4SA 4U3JB 1XV5A 3UUWA 3NOXA 2HBYA 7ABPA 3F3MA 5HJ2A 4FFVA 4QEZA 4LJYA 4HNRA 2QSJA 3VOAA 2VXYA 1NPDA 2QENA 3Q85A 4N7RA 4ZT5A 4EQ6A 4W5RA 3P0FA 4H31A 4CM9D 2COKA 3QX3A 4W1RA 3IPLA 4UE3S 1HLGA 1PJ4A 2NO7A 1RHJA 3KV3O 1IY2A 3OAAD 4YJ2A 2W2LA 4OYLA 4XWAA 4ESEA 1NVKA 2JLCA 3WHKA 4GGPA 4Q4LA 5F52A 2QJOA 2A7QA 2DKFA 2HMVA 4MGZR 4RA6A 2IW3A 1P9LA 1XFDA 3KV1A 3PFFA 2GQ0A 1WMAA 4MR8B 4MRVA 2GTPA 3Q6NA 4ID3A 1YDMA 1Y42X 2KBEA 4K87A 4PWZA 1PYDA 2A67A 2H1RA 2JIPA 2VA8A 3DPIA 5JAUA 3ORFA 2WAOA 4JT9A 2FWJA 1NC1A 2OCGA 2IUEA 5T3UA 5BQ5A 1XALA 2X9NA 2ZAGA 1G3MA 1LC0A 4YDSA 1E2GA 4NCBA 1GG2A 4YP5A 2GCOA 2GCPA 5DISB 2AG5A 1XT6A 3R6WA 5J9FA 3G9ZA 2C2BA 2YWRA 2DXIA 1D8TA 1X0XA 1T13A 1U0SY 3TKAA 1PFQA 1N2EA 2JVIA 2Q1XA 4UD2A 1F17A 4QODA 5CB8A 2LDXA 4RZXA 1N2JA 3DO5A 1EGHA 1V1MB 1VSBA 3C1AA 4U0KA 4E1AA 3SYKA 1BVYF 3BDVA 5FWDA 3HHPA 1GR1A 1ULTA 3A6ZA 4JJ4A 3HO1A 1G1AA 1G7RA 3NFRA 3LPLA 1Z4NA 3P2MA 4FSHA 4O4IB 4CF7A 4YROA 2NNLD 3DGFC 3U09A 4TLCA 2Q3LA 1TM7E 2XMDA 4BNWA 1L1RA 4D5GA 4RTPA 3LC0A 4FDUA 4WJZA 2Q6OA 4Q5IA 2WJ4A 4WRRA 1ZM4A 2VYNA 1Z35A 4LQDA 5B58T 2GHRA 5DDIP 2PUVA 3AKCA 5IDQA 4I3HA 1QS0A 3VPCA 1WUIS 1HMPA 3K9BA 4C30A 1UK7A 2W6CX 4A8TA 2P2GA 3BTVA 4HWTA 4V39A 4EAAA 1WEHA 1BWPA 2BGNA 3U4IA 2PD6A 1CS4C 1YB4A 4NFLA 1KBQA 4S0XA 1QX3A 4XWTA 2WFZA 1TADA 2XE8A 1ELOA 4BQRA 1CVLA 2BFCA 2EV9A 2JVKA 5IW8A 3T8YA 9ATCA 5T8KA 5CFMA 3OM8A 3PPXA 4LZAA 3NRCA 3ED1A 1U7HA 2QYSA 3GH3A 4MLCA 3W1WA 2A1UA 1DXQA 3FMVA 2K7FA 4M7PA 5A06A 1YHZA 4ZVLA 1ZM3A 2DT8A 2O0LA 1L8QA 4JJKA 1DAGA 4OU4A 4BEVA 3PEVA 3U7FB 4BB5A 3PZRA 4YCNA 3B12A 3KZMA 1KS9A 3TZKA 2FY8A 4OK6A 4D41A 3MM4A 2IV7A 1TU4A 4W1QA 5K1ZA 4TMVA 5AKYA 3ADPA 1R27A 3M1LA 1OY1A 3C4JA 1DB3A 1I8TA 1YE8A 2HC9A 4M0DA 2DM6A 1UZLA 4BXOA 3K2BA 3PL5A 1IH8A 2WHEA 1QYRA 3ZV5A 5LUAA 2H85A 3BORA 1E1QA 1Q77A 3LKZA 5C0OE 1VBKA 4FEGA 3ABIA 4DJAA 5L7YA 2DYKA 1CT9A 2X77A 5IK2A 1PKEA 2FFQA 3EDOA 5E4TA 1YRHA 1HI9A 2W6MA 3O6VA 3UEOA 4Q18A 4N7JA 3TRDA 2WC1A 4BB6A 1TA4A 2FRXA 2TMYA 4UJ3A 5P21A 3T7JA 3EZFA 3UV7A 1PK8A 3EZLA 1HBJA 3H4VA 1LCIA 4DLRA 4O1MA 1KQPA 1PNOA 3WWDA 4AP5A 3N0XA 3KE8A 2CV0A 3G0DA 2B4YA 3AR2A 3UCFA 2Y0DA 3EXG1 3LPMA 2C8JA 3I9V6 3QE9Y 1QGUA 3QE3A 4XB2A 4YRBA 2J3MA 2VK8A 5FPKA 1FFYA 3T3OA 1MX1A 2LCIA 3IX7A 2D00A 2A94A 3G0HA 4CKXA 2MSDB 2ZUVA 1NUQA 1EXNA 1CPYA 1PFWA 1YZKA 4QXOA 3NNDA 4Y6GB 5CA1A 5FDFA 2W6IA 3CURA 2V7BA 5DM4A 2BH9A 2QRJA 2Z8XA 3R3JA 5H4GA 5K3FB 3WKEA 1U4SA 2IYVA 1L3IA 3KYBA 1LU9A 3PUXA 4Q03A 3VC1A 4P7KA 1FVXA 4B7ZA 4FYXA 2C2MA 1BMTA 2Q2NA 3DWGA 4K7JA 5E0OA 1EK0A 3B1WA 2CJPA 2GAOA 3C6QA 4X63A 1QIEA 3VYTB 8GPBA 1Z33A 1PWEA 4ARZA 3UPTA 1QWSA 3CEJA 3EIQA 3RCBA 3TIFA 5D7NA 1ADBA 3JVIA 4FNOA 3VU1A 4DEYA 1Y9DA 3MGGA 2C2GA 4D92A 5LWHA 3RVLA 3GZNB 1AGNA 3AEXA 5GONB 4PVCA 1LS6A 2Y66A 1A5ZA 4C2AA 5CDUA 4MGKR 4J75A 1IBSA 5GONF 3VFDA 4JLKA 5KPJA 1QFYA 2XVYA 3WY9A 4R5MA 3PCRB 2HRBA 2Q9CA 3B8EA 3KKZA 3N8IA 4NFYA 5AIBA 4OQMA 2QE6A 4IFEA 4IDCA 4BQIA 1F0KA 3RS0A 5ALZA 5MHTA 1YDGA 2PGLA 4QRDA 4CKCB 2GEJA 1MO4A 4O3FA 2EJTA 2RH9B 4Z0HO 4XPZA 2EKLA 3BH6A 2YHSA 4IXDA 4JLOA 1TI7A 4DB4A 3P52A 4IJWA 1OZFA 1IK6A 1CS0B 3A1CA 3I0MA 4C6SA 1Z73A 4R01A 1U4OA 2VT3A 3ORYA 3R9XA 4PG4A 2Z2IA 3BWXA 4EJMA 3PP8A 3OPNA 2D5AA 4JI7B 4MNTA 1XYGA 3EEBA 4DLUA 4OY3A 3TSOA 2R4UA 5AHXA 4D56A 4DUPA 3CR7A 3PGMA 4NS4A 5BSUA 1A5SB 2AX4A 3PD7A 2EGUA 2IEZA 3EBPA 1DT3A 4KFCA 2YHAA 3C39A 3SZOA 4UHCA 3EPKA 5FPTA 1S3SA 1UFQA 4G0PA 4TKVA 4E09A 2C03A 3MJRA 4P3PA 2OK8A 5B58C 3ZYZA 2BF7A 2QLJA 4UEOA 2Q5OA 2M6KA 1OFUA 1QGED 4GKVA 1NURA 1ZD9A 1J00A 2XEDA 3H42B 5IVPA 1PV2A 1V37A 2O06A 5AXCA 3M5PA 4CW7A 3IMGA 3JRNA 4MW7A 1I01A 1DXYA 2W5UA 2WD7A 3C14C 1LJUA 3I5MA 4KBYA 1JDJA 1VKZA 2O5VA 1UDWA 2QTRA 1PGNA 3H17A 3RK0A 3UK0A 1KHTA 4XX0B 2WZQA 1Z88A 4CR8A 4PW0A 2NVUA 4YAOA 2C4VA 4AC9A 3U44A 1DAFA 1WU7A 2IODA 1I4LD 2WKSA 2ZIZA 3NHRA 4Q4AA 3DHNA 2XR1A 1EGVB 4CG3A 2IV2X 1G21E 2B4RO 3QU2A 1RRPA 5HFNA 1YB6A 3I53A 1HE2A 2EEZA 1HSZA 2WDPA 2C1ZA 4MP6A 1I10A 4WJKB 1LW7A 2FQXA 2RGAA 1R6DA 2QRQA 3NX4A 4L28A 4QU9A 5CFRA 5IKEA 1V6AA 2DC1A 3DMTC 1Z18A 2G1PA 2PUFA 3CG0A 2IYOA 2J33A 2PZ8A 2WTUA 1D0SA 1L4FA 2EW2A 4S1OA 1TM4E 1LRKA 2NU6B 1IL0A 5FI3A 4D2IA 3GAZA 2FX3A 2POCA 3ZLVA 2A7XA 2OCKA 5CNMA 3IXQA 4JSTA 4KAAA 1OKKD 1LV8A 5B1YA 3MG9A 2R1VB 2ILTA 1IBCA 3DOIA 5L3QB 1XZNA 5EQTA 4AJIA 2HD4A 3Q72A 5JYCA 5KVCA 3MERA 3D6JA 2PAAA 5I9BA 1YRBA 3KJGA 3ISJA 2X42A 2XQFA 4M86A 2XZTA 3W3ZB 3V3TA 2XNSA 3OZBA 1H85A 1W47A 1C3LA 5CCEA 2YN2A 4BYMA 3ZUPA 5J1SB 3QEAZ 1NXVA 5IWCA 3OCYA 4RPJA 5ALXA 4HLUA 1P1JA 4ALLA 5JSZB 4BNJA 2W2NA 4B4KA 3ZU4A 5ARBA 1ZJWA 4EJ6A 3IHTA 4IH1A 1HDXA 4B3RB 3IAXA 3IAFA 4IKEA 4LYFA 3I4LA 3LT0A 4D9GA 1T3LA 1HT3A 1IPHA 2I66A 3R5SA 2JBAB 2IHBA 4Q1AA 3UJDA 5AW0A 2WD8A 3LCRA 4HLCA 5IJZA 2ZUEA 3O9VA 1T4CB 4N7BA 4G2NA 1NV9A 1UZAA 4FXPA 4M9XA 5LB2A 2P3OA 4KE7A 1U7WA 1DO8A 1BMDA 1GZUA 3GPCA 3JQGA 3ROXA 4F56A 1HYBA 1QOZA 4XVHA 1AKTA 3I2HA 1JJVA 1QYCA 3GWZA 1U1CA 4Q16A 4R41A 4Y0AA 1UMCB 3HXOA 2J85A 1OILA 2W6JD 4Y2XA 3JX9A 2D1YA 4B3FX 2QKYA 1OB5A 3FOCA 4PSUA 2AW3A 1PSDA 3IVGA 4HATA 4MTLA 4EGQA 4C21A 3HWWA 4N7MA 4AP6A 1FUKA 3L4SO 4M37A 5DZSA 3IHKA 4P4NA 5FTMA 1L7OA 3NCTA 2YWEA 5FB3A 3EVBA 2C88A 2EW8A 3QBVA 1QJ4A 1EFVA 4QEKA 2DCUA 3O2QB 1VHTA 4J3NA 3G02A 4RUKA 4HFJA 4A0SA 4JR0A 4AECA 3ZGYA 4JN6B 4G8CA 4HZIA 1JYFA 1JR3E 1M2EA 3AYZB 4G5XA 4Y2PA 4GR9A 4X7MA 3GFPA 1EJ0A 4O6VA 1RKUA 3QXHA 1QG0A 5HZGA 3B1YA 1E9CA 2BZGA 4MV0A 3WIDA 1WXQA 4OLBA 5IFLA 2BBTA 2ECKA 3ENZA 2QV7A 1TTHA 2QRKA 4P98A 1INLA 2LDBA 3QKRB 5GGYA 1DTWA 1C81A 4AS3A 1Q1GA 1MRSA 3A7DA 4UBMA 1PE0A 1N2SA 4MLZA 4O4HB 5KOHA 1HQYE 2BW0A 3QLEA 4C87A 2OEPA 4UUBA 1R3UA 4CIVA 4KIGA 3CNOA 2OXEA 5C4IA 4KN6A 4C7OB 4GKAA 4LY3A 4O4HF 4BS9A 3WSVA 2PTHA 3GPDG 4BPRA 2YKGA 5DBGA 2ZYIA 1PGPA 3VZRA 4L8VA 4ZOAA 1OXMA 2AEJA 4X8MA 4JP1A 4EKEA 3PJGA 5JBIA 3WMEA 2JGKA 2FHSA 2J0VA 1SGWA 1M6VB 5A03A 3TAUA 1O54A 1K6EA 3P4XA 2QRZA 3V55A 5C5EA 1RPZA 4ZRMA 1RMYA 3ZVRA 5CDSA 4I99A 2PS3A 2QMEA 4WOKA 1XX6A 1N2IA 2WAXA 2W90A 1NI4A 3ZHSA 1H6CA 4GP6A 3STWA 1SC4A 2ZTMA 4Y6RA 5H9WA 2HF9A 2I6UA 4TS9A 3L40A 1QHXA 1I3LA 2FPXA 3ZHCA 3LLVA 1TLTA 3WV5A 5LM3A 1XVTA 2PRJA 4JROA 4BX2A 1G5HA 4ONEA 4ZEVA 3DBHB 1OXUA 3Q0IA 3SJZA 3LJKA 4DLLA 3GUHA 2ODQA 3DKRA 4HWSA 4CL2A 1JQAA 1L4KA 1TD9A 2OQRA 2WEKA 1VKNA 2HY7A 2FQ1A 4KMSA 2OLKA 5CDFE 1NVFA 2YZKA 5ERYA 2VJLA 1R9JA 7REQB 2G77B 2K2QB 3WBJA 4AXBA 3GRFA 4BTLA 3WJAA 1XTBA 1FRFS 2XV1A 4DWVA 3K0CA 3UJPA 3OZIA 3V1MA 1KL7A 4C4XA 4PC7A 4FFWA 1F6WA 3AHHA 4C01A 5DI3A 3CNHA 2PYZA 3CVJA 4ZTBA 2IGBA 2Z0MA 3L7JA 4QUGA 1ZMBA 4OG2A 2OT3B 1XD2B 2VO1A 3A4TA 1SPXA 3KSDO 1A04A 3WWCA 1FRQA 3PGXA 1B41A 2I99A 4IIDA 5IBPA 2O7VA 5JWRA 4FJ1A 2J4CA 1A8PA 2CB9A 3NRJA 1Z39A 1WD5A 4KYVA 3U62A 2GK6A 1JHOA 4KN8A 3SSAA 3U49A 3S8YA 4KPEC 3TD6A 3W2TA 1I1QB 1OLSA 2D8AA 4RQAA 3GMSA 4CVNA 1L8OA 2YXLA 3LSYA 5HIAA 1OXKB 1CLEA 1NXWA 3NM5A 1JG4A 1WB4A 2QYTA 3O8QB 1C7RA 4JEMA 2JLAA 3BXGA 2WTXA 1RLMA 4GLOA 5CEJA 3BMCB 1AXEA 3QMWA 3RRYA 1V3VA 3HCRA 4FHEA 3LCCA 1QGYA 4I81A 4G25A 4WFKA 3O95A 3CVVA 3BF8A 3LDHA 3QLJA 3IR6A 1K8QA 1X7HA 4G85A 4KUEA 4RM2A 4X1OA 5BQPA 2KSQA 2EL7A 1R5BA 1II8A 3TD9A 3DMGA 4W5NA 2IY7A 4RL6A 4Q9DA 4RVFA 3EG9B 3V4SA 3LUGA 1P7CA 1CBUA 2GBFA 2WYHA 3L0DA 4BO9A 2CJFA 2MYUA 3IP6A 5EFOA 1DOZA 2FZ5A 2WYWA 3P9PA 3OPYA 4GYWA 4PFSA 5JCZA 4PYNA 2VRNA 2WTNA 4LWPA 5C8YA 4RD2A 2RGNC 3FIUA 2B6HA 1RP7A 1QIKA 3WAKA 4RK7A 2CNWA 2Q1UA 1L5NA 1USUA 2L2QA 4MV8A 3OZFA 1DADA 4D3FA 1N6NA 5EZYB 3KSZO 5C81A 1RAAA 4YREA 1VMEA 3GZJA 1WL8A 1NA5A 4OHVA 1F60A 5EZYF 2QQGA 3OLVA 3JQ7B 4WKGA 2RHCA 5EPOA 3CVWA 1ZS9A 1N2XA 3UUGA 2PYDA 3JVUA 3G2NA 4DNXA 1JKMA 3VSBA 3ZWNA 2DHQA 4IUCS 2RHRA 3NM4A 1R16A 4X95A 1J2YA 1IQRA 3I1IA 2VATA 2ABWA 2XYPA 2H4HA 3D4NA 4IHJA 2PZGA 4GVXA 1Y6RA 3C8ZA 4DWJA 2OCAA 3EGDB 1XZIA 1T29A 2CZGA 2D62A 4MR9B 2YW9A 3C5EA 1XK6A 1G41A 2PZAA 3EZNA 4YJGA 3Q9LA 1QIHA 4IDDA 5M3BA 1HG0A 3SHQA 5TGDA 5JZ9A 1ZESA 1C1XB 3IP9A 2C9MA 2YWFA 4DABA 2O59A 1R0RE 1IC6A 2JAHA 4UW9A 4HUTA 1EXMA 2I1VB 4MVJH 4AWAA 1MXHA 5LB4A 3W2IA 3ND7A 2GAIA 4EGFA 4EENA 3L7LA 3FYHA 4OHCA 3LT4A 1JHXA 4MHTA 4RIGA 3JS5A 1N1MA 2FEPA 3NNNA 2MOKA 1MTZA 2O7SA 3O26A 1YBVA 2CMGA 3I3OA 1IVSA 4I5IA 2NU7B 4XCXA 5C1PA 1V47A 5DM60 1DXOA 2JAOA 3RRNA 1OAKA 3PI7A 1G8YA 4WNCA 1UBEA 4XVQA 3WRYC 3ZWDA 4ZZ2A 4BB0A 3GARA 4B3SB 2QU7A 3WBKA 4PLTA 1OPRA 4NBNA 3VVLA 2QD1A 3LVBA 5JAIA 3CKMA 2F1RA 3MAAC 2AE1A 2RBKA 2N1BA 4NOKA 1Q1NA 4WZAA 4Y2VA 1LPOA 2GWHA 3ZQKA 1ZMXA 3OTIA 5CAEB 1WM1A 3FNFA 2XUPA 1TK3A 1JG7A 1DJOA 3AIMA 3E3AA 3E9MA 1ONOA 4XSGA 3WMXA 1LK5A 1HKHA 1Z7YA 4Q3EA 4X6XA 3C3DA 5FUVA 4CMHA 5FPQA 1GNTA 3NR2A 2I9PA 4M0EA 3AKZA 3RF7A 4D1YA 3HP7A 4OOEA 3WHLA 2NP6A 5EUQB 2VOEA 1C9MA 3A11A 3INYA 2OVFA 3INGA 2Z57A 3V7YA 1GFIA 2G25A 3RC8A 4WKOA 1E6MA 1EVKA 1LVGA 3AUAA 4HLNA 4FHZA 5DSZA 3VNAA 4B81A 4FN4A 3IHWA 3PNSA 1SRRA 4K8OA 1YFZA 4EECA 5I9IA 4MR8A 1QOQB 1A9OA 3WGTA 3INNA 3LE8A 4FINA 3EIUA 1MB0A 1QHSA 2I03A 2WSIA 1P60A 1A4XA 1BGXT 2RKOA 3VZQA 4HGRA 1PK7A 4WESB 5EIXA 3S99A 1KI7A 2H2DA 1URPA 3GFBA 4QWWA 2IHUA 4PICA 5KYWA 3WNVA 5JMPA 3ONFA 4CZ2A 4KTTE 4X9XA 2ADMA 1QONA 4P83A 2AMLA 1ESNA 2FGJA 3P32A 4JVNA 3TMAA 1W96A 3BVPA 4BNTA 3SS8A 1MB4A 2V1XA 4KRFA 1LPNA 1V6CA 4O4IA 1ZIPA 4YP9A 1AUQA 2ZUCA 1BHJA 1LC3A 1RWQA 2LPMA 4JLVA 4TS4A 4TRMA 5JRDS 4LQCA 4CF5A 4F4HA 5HVNA 1UANA 5F3DA 4HXYA 3BGWA 3D81A 3I1JA 1N0WA 4KIUA 3FKJA 1HC7A 3RTDA 1PV1A 2ORYA 2ZJOA 3EGOA 4C0AC 1N78A 2H2AA 4JI4B 2ESRA 2GN8A 1WO8A 3FDZA 2H1IA 4AF6A 4HVTA 2O05A 4QFDA 1ZUWA 1Z9BA 4GPIB 4BMCA 4C3OB 3VRHA 1XCMA 2DTEA 4C4TA 1YJ8A 2WOJA 2HJ9A 1LI5A 5KYGA 3GPIA 5ED4A 2AXQA 3CPJB 4UHBA 1Z17A 2CNKA 4F2DA 3VNRA 2FMXA 3IMKA 4EFDA 1VYHA 2IOFK 2BCEA 4LJ7A 4PO9A 1OLUB 2JIRA 2FI1A 2H18A 4Q7KA 1IXRC 1OMOA 2H11A 4AN4A 1WTCA 4HX9A 4UHEA 3L43A 4NV3A 3LNTA 3BRQA 2J7PD 2YCBA 5CFZA 4IY1A 1YDEA 3NASA 4O4JF 4A8HA 4LHEA 5E3JA 5CLHA 2RKWA 4EYEA 1RXWA 1VE1A 2CY0A 4RM3A 1AZLA 2REXB 1HY3A 1QLHA 4QTXA 3RVKA 5BORA 5DBEX 3W8EA 5BO5A 2XVMA 3WGKA 1SBHA 2H9AA 1IYZA 4CGYA 4E2ZA 2VN8A 3NPAA 3RYHB 4U6SA 1GO2A 1JDZA 2YYSA 4LRSB 1KYWA 2QZJA 2HRZA 3WIVA 4YMIA 1U9JA 2C9DA 2OV6A 4POAA 1YK0A 4DB2A 3DUFA 4FE7A 2JA2A 1R8SA 2J08A 4X6YA 1PLLA 4O4LF 4F97A 2B4TO 5CD1A 5EAIA 4OEHA 1CEXA 1FSSA 1GG5A 3D7SA 3MYRA 3NJ4A 1NF8A 3UK6A 4H9GA 4C03A 3GEBA 3NC4A 1JWAB 2P2SA 4OFZA 3BAFA 4GBJA 1E2UA 4FKBA 4PX5A 4K03A 2NVWA 4J7CA 3VKUA 4HEQA 2JFWA 5I7WA 2AYZA 1ZIYA 5EJIA 4YAUA 2G63A 2WNSA 4TLDA 4YLGA 1TF7A 3LWBA 3OF5A 3ZW7A 3ECSA 2CLEB 2FA9A 2BEVB 2C98A 3ASZA 5K3SA 3ZS9A 1QG2A 1E2NA 4LNHA 4UZEA 2IHKA 4P2BA 1FVFA 1K6JA 2XLCA 4BGUA 4CM4B 2ZCJA 3JWGA 2P5YA 4ER7A 3LQ1A 5LBTA 7YASA 4MRNA 3K70D 1V3TA 2JLZA 3H4IA 4D97A 4OVKA 3TXAA 4AZVA 3QA9A 5K3FA 2RSLA 2VAPA 4KJZA 1U0TA 4LV8B 3OZVA 2I7XA 2YH2A 3PUVA 3GCGA 3MAGA 3P1JA 4FQ7A 3FETA 3LBFA 3ZTYA 1VCNA 5C8ZA 1TL7C 4FWTA 3MC1A 3NUZA 3RE1A 4HDSA 2DTXA 4DSAA 1JR2A 4JVSB 3EZGA 3ZWOA 2Q07A 2G82A 4RO0A 2CFOA 4QGGA 3OIWA 4AICA 5BWOA 4ZZ0A 1F8GA 4GICA 4RVUA 3RSFA 1PSZA 2BRUC 2QW8A 4WADA 4AT1A 3CXUA 4ZKDA 1SCNE 1MTOA 4S2UA 1ORTA 2GAJA 3OE7D 3M9XA 4BJ3A 2QL5A 4LQ4A 2YZMA 1QK4A 2ON6A 1X1QA 3U56A 3ASYA 1MEOA 4NP6A 3Q5GA 4P7FA 5TEWA 1BJKA 3A10A 3AUTA 4GI3A 5AKIA 1IZ0A 2FUG6 1CJTC 1N9GA 5CLFA 3N74A 4REQB 3HU5A 1AO3A 2AMJA 1QKIA 4FWIB 4UZSA 1ZH2A 5BNTA 1UC8A 4FW9A 4BZWA 4CKCA 2RGBA 1BE6A 4X7RA 5K3EA 1K08A 2AFHE 2XUOA 1EX7A 1D1QA 1T1IA 2JH9A 1SC9A 3ITNA 3KK0A 4L57A 4M8NE 1FMLA 3PCTA 1MV8A 4B34A 4D42A 2YX1A 4K6FA 2EKQA 2NO5A 3F8WA 4WD3A 1GV1A 3EPPA 1L4UA 1NT4A 4NR0A 1YIOA 3CSSA 4PX9A 4RMHA 4W5JA 4II2A 2ZIEA 5ALLA 1PJAA 4S1WA 4BU0A 5EJEA 1WSWA 4PY2A 2PBZA 3AJ9A 4UZFA 5JNRA 3BRWD 2O8CB 4MQBA 3LOUA 3CUVA 4KR2A 2IYSA 2Q5IA 1WXIA 2XT0A 4BO7A 1M66A 3GVXA 2ZP1A 2C7BA 3OHPA 1QQAA 2VAVA 3VUEA 2A30A 4UPVA 2Y0CA 3D8UA 2I4MA 5GJBA 1OR8A 4J76A 3CVOA 1RYEA 1JG6A 1F8XA 2V0NA 3BMQB 3QPDA 5K5EA 1BVRA 1TGVA 2YN4A 1IZ9A 1CUWA 3F6PA 3MUOA 4UM8B 4ILKA 5U4QA 3SD7A 2FWIA 3T15A 4DA9A 1YRLA 2O3TA 1QHYA 3GCXA 5DBIA 2B35A 4FGSA 5BV8A 1YC2A 3KYCB 1GL3A 1NVDA 3ONEA 1X94A 1CR1A 2DB3A 1P33A 1EHIA 1M8JA 4G07A 3FW1A 4L4XA 3GRKA 3LTEA 4BLSA 4Z0NA 3TZLA 1UMBB 4OIFA 4IAOA 4DCJA 2F3UA 3T1HB 3Q3GE 3BIJA 1RAEA 1GL7A 1W5BA 2HKIA 4PLCA 1FK8A 1U8YA 3C6ZA 1U7ZA 2FSUA 2I4NA 3AFGA 3GJ0A 3UT5B 4FGLA 3WHPA 2B36A 3PIDA 4REOA 4QUEA 5DH9A 3MFQA 3MT9A 5EINA 3PR1A 1QDUA 3UKJA 3OF3A 3OFND 4JY7A 4HYQA 2NP7A 1LGYA 3RRFA 3TTYA 1SUPA 1ZUD1 2KX7A 4R1QA 3A3KA 4TX1A 1HEYA 1MJGM 2NU6A 1Z06A 3X3HA 5DHFA 2Y0PA 1KPGA 5TJHA 4K9LA 1HYEA 3LSTA 4YRSA 1OV4A 1M6HA 1E9DA 2V7VA 4A1FA 4D9NA 5TE9A 2Q29A 3T7DA 1TM3E 4B80A 5L3QA 4IGEA 1M0WA 1RRCA 2CLFB 1EFKA 5IVHA 1MJNA 3NO4A 3MRSA 5BUSA 2ZBPA 4NLLA 3RJ9A 4YRLA 3GVCA 4O0LA 3TPFA 3D8SA 3KWLA 5CLLA 2ZSFA 1KY4A 4UTRA 2X8AA 1WXEA 3FIJA 1Z7WA 4M0MA 4QJIA 5DB4A 1G64A 2P9ZA 2DBQA 1O94A 2J31A 4IEIA 4J43A 3TCXB 5I4KA 2A0WA 5JG7A 3GFRA 4C2BA 1W4RA 5JSZA 1A9XA 2IPNA 4EF5A 2PUCA 3PIRA 4M3NA 1CUYA 1VHQA 2YOHA 4V02A 5AJUA 4AUMA 5KPDA 1LKZA 1YFLA 2V3WA 2FZKA 4EY3A 3F71A 3WWEA 1T2VA 4QOGA 4RY2A 2JBAA 2BSQA 4ZTUB 1N5DA 1UBRS 4GEKA 1BFKA 1RLOA 3A6HA 5E9JA 3N58A 5H68A 3ER9A 3LHIA 1U2GA 5EGNA 1NJ1A 1QO0D 2ODEA 3B1FA 5FTNA 5LYYA 1OIVA 2E7ZA 3HGQA 1BD3A 3TGWA 1XZ8A 5ITZB 4C6HA 4ROSA 5DEIA 4JDUA 2ACEA 2VF7A 1VA5A 4RMJA 1GQSA 1JVBA 2PSJA 4LJ4A 1RM4A 1ZJ4A 1D9XA 1EBBA 2PVPA 2X4GA 3A1DA 3BCRA 3CO5A 4K81B 5H0IA 5A4AA 5L6MB 2GS9A 4LDRA 3NTRA 2FPGB 4IV0A 3D2AA 2BKEA 4KNYA 3UBTA 4FCWA 4RIEA 4JITA 1T3SA 4M1EA 3HYTA 2GN2A 3NHYA 4NZMA 3ND9A 5GGXA 1T5HX 1DEXA 1H65A 1NQXA 2GAFA 4J94A 5GJCA 4DDWA 1GKLA 1UQUA 4DA8A 2NIPA 4HX2A 4P53A 3RGWS 4JR2A 1J56A 3HO6A 4BB9A 4F6CA 3RQSA 3D6UA 2JHCA 1Z0AA 3PXAA 3EXAA 4F38A 1BX1A 1XJ0A 2WJ3A 5LKAA 1J39A 1RXIA 4DWOA 4PONA 3CF4G 2IU4A 3QKRA 2HW8A 1CZUA 2Z8YM 3LBHA 5HKKD 1U8CB 2JGEA 3QA3E 4YAKA 1QE3A 4CM6A 1BS2A 3NMUF 1QH0A 2X0EA 1JHVA 3PNBA 3TVTA 5G0VA 4C7OA 1G8AA 1NJGA 3GDHA 5H02A 3RSZA 1PT6A 1TEHA 1SQ0A 2J9RA 2RAUA 2YRWA 2VPZA 4PC3A 3SX2A 1Z36A 5FOWA 2HJRA 4TYYA 1MGPA 3FUUA 3LIPA 3T5DA 5LSAA 3VI3B 1JIXA 1ZX1A 3LA6A 4Q48A 1T4DA 4EX7A 3W7BA 2HSZA 1JLHA 2E49A 3EDCA 3WB9A 3SK0A 4E5YA 3LS2A 2Q28A 2YWXA 4M88A 3SEZA 3W04A 3UG6A 4HPXB 4JT2A 3SWWA 4P08A 3QU9A 4ZQEA 3QVTA 1S89A 4DL9A 5TEVA 4I4CA 2NACA 1EG2A 3MXOA 1B0ZA 4KIJA 1YCGA 4OQLA 4OQNA 4AO7A 4Z4HA 1JDVA 3H97A 3K5PA 1VHJA 3GZ4A 1GUDA 1C8KA 3ZOKA 1OAAA 4BQNA 3ZIAA 3DE5X 3B1ZA 4TMFA 3LKDA 4BMXA 2O2ZA 5IWAB 2GZ2A 4HB3A 5B7NA 5BOSA 5EMHA 2R6R1 1J5PA 2R86A 3DBHA 2Q5HA 2BFOA 1LLCA 3IVXA 3AVPA 4FBGA 4IDAA 4WKNA 3PFWO 1UDRA 3KZKA 2ZUWA 2OMKA 2FF7A 4J0HA 1QVWA 1TZMA 3F4LA 3N2KB 4NCXA 1LW6E 1H42A 4REMA 3C3EA 2X13A 3K1AA 3HZRA 2K7ZA 1USIA 1XMSA 3IS3A 4MB0A 1BIFA 4QXAA 3SJUA 3AH8A 4A10A 1ZBQA 2Y05A 1TZCA 2I5PO 1YD7A 3MEQA 2H51A 1ZXBA 1DC5A 3L6BA 4FS3A 4OUDB 3ZHRA 5AVQA 1TTPB 1XD2A 2R6FA 1KORA 1MVLA 2BHLA 3L0CA 4DUYB 1FC0A 3Q7QA 4Q34A 3MUNA 2PVCA 4ND4A 5CNJA 4UNPA 2GM5A 5AO9A 2Z2XA 4PLYA 4CIBA 5H7XA 1BMFD 2RONA 2UZAA 1Y6QA 4A5SA 3RUDA 1EQ2A 1Y1LA 2GTHA 3RRMA 4BU1A 1AZWA 2VHTA 3EUEA 1T0HB 3OETA 4ZJPA 5JRZA 3H8JA 1SHLA 4N8SA 2HSWA 3O8QA 3URKA 4UCWA 1V4BA 2CSUA 1GGHA 5JANA 1TYEB 2KI5A 3CRMA 4L95C 2QI9F 3BMCA 3TZQA 3V2IA 2YFQA 3JVVA 3QUBA 4K9OA 2PUEA 5AHWA 3ZGOA 5BPHA 3UB2A 3PX2A 2DR3A 4C2TA 4RSGA 4AX8A 4LECA 1NX6A 4DUGA 4PAGA 1MRNA 4NS1A 3EVTA 1KQFA 2W58A 1UZMA 3CLHA 3DC2A 1G6OA 1GADO 3EG9A 1G5RA 3H4TA 4GS5A 1K4MA 1SUWA 3BJEA 3DE2X 4I4LA 4ID9A 4KE9A 4L08A 3RC3A 3WGIA 2O3UA 3IBTA 1M2NA 1E62A 3TJZA 1XD9A 3NAGA 3B8HA 1GKUB 4LN1A 4EB3A 4U2KA 1RZRA 4FB5A 1QGDA 2D5IA 4NOJA 5KZMB 2AKYA 2DUMA 5ALEA 4B6EA 5JHHB 3RYCB 3FTFA 1TO6A 1EDOA 2W9XA 5F77A 1HFKA 1GPBA 3EX7C 3AF6A 3NM6B 2Q3HA 4DLSA 4B84A 2RAFA 2I8CA 2OFPA 3CLSD 3KX2A 4ZVUA 3TTSA 1HL7A 2HREA 1TMGE 4F84A 3UXYA 2HNKA 3PC6A 1XQ9A 4MI3A 4UFPA 4UREA 2CE2X 1JEYA 1A82A 2DQ4A