3TZKA

Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg)(g92a) from vibrio cholerae
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
247
structure length
247
Chain Sequence
SQFMNLEGKVALVTGASRGIGKAIAELLAERGAKVIGTATSESGAQAISDYLGDNGKGMALNVTNPESIEAVLKAITDEFGGVDILVNNAAITRDNLLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVGSVVGTMGNAGQANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMTKALNDEQRTATLAQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMYMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-[acyl-carrier protein] reductase
publication title Dissecting the Structural Elements for the Activation of beta-Ketoacyl-(Acyl Carrier Protein) Reductase from Vibrio cholerae.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Oxidoreductase
total genus 92
structure length 247
sequence length 247
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2011-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3tzkA00
4WLUA 3G49A 5KVCA 2C7GA 2O2SA 3QSGA 4OAQA 3Q1LA 1T2DA 3WTBA 1QYDA 3VTZA 5KNLA 1JAYA 4XYGA 3W4JA 1B8PA 1T26A 2CUKA 1OFGA 1ZFNA 1O9BA 2DAPA 2VOJA 2O7QA 3HADA 4ND3A 2PA3A 4GX2A 4AICA 1ZZEA 1NASA 2X0RA 1BDBA 3FBTA 4MJLA 3NT4A 3RUAA 4H16A 4TSKA 1OI7A 3OBBA 4ZHSA 4E4YA 4D44A 2J5KA 2Q2QA 4PG8A 1IE3A 4DXHA 3JQGA 5TGDA 1XCBA 5TSDA 1RPNA 3RFXA 5KWEA 1SCUA 1VLLA 3U4DA 2I3AA 2I76A 2GRAA 3VZSA 4BNLA 4BS9A 2PFGA 4ND2A 4LMPA 3GEMA 3ZNNA 2C0CA 2W4QA 4DC0A 1IB6A 2Y1OA 2RAFA 1LSSA 5F1OA 1U4SA 2HCTA 3ONFA 1O94A 1GYQA 3MOGA 1TLTA 4PLGA 2O48X 3E5RA 4E5YA 3OM9A 1BXGB 4NBVA 4CM5A 3MWDB 2VT3A 5AOVA 4RJTA 2C2XA 4QECA 2DBVO 3F6YA 4OQYA 3ZI0A 4AFNA 3JCZA 5L7WA 1P1KA 1ID1A 4NPCA 3EY4A 3VTFA 3VH4A 1KY4A 1PJSA 3W8FA 2WSBA 1XYGA 3GR6A 4WLVA 1YGYA 4Z9XA 3UGKA 1Z82A 4EJ6A 4INAA 3ANLA 3IJPA 5G0UA 4BMSA 1ENOA 5JBIA 4RDIA 1U3UA 4Z6KA 1I2ZA 5DBIA 3TFOA 4RGBA 4JXKA 1MFZA 1J0XO 2B5VA 4Z0TA 5MDHA 4MIEA 3ITKA 3PZRA 4NIMA 3C1AA 3WWZA 3PFWO 4OXYA 1Q7BA 1TI7A 3UOGA 4DL9A 3ZU2A 3P7MA 4CLRB 4BO6A 3WQRA 1HLDA 1JWAB 4GH5A 4GKVA 1SO8A 1H6DA 4FFRA 4ILKA 3IUSA 1A9YA 1VC2A 1FDTA 1U8FO 5L40A 4BKOA 1IYZA 1ULSA 3AM3A 3GEDA 5HS6A 1GUYA 5IDQA 3TZQA 4HX5A 1HKUA 1YL6A 2P9GA 4II2A 1JVSA 4NJOA 3D4PA 2W2KA 4R5MA 3RU9A 4XQEA 1WXDA 5JE8A 1DRVA 4R1NA 1ML3A 1DJQA 3PXXA 1LEHA 1GCUA 2X6TA 3JQGB 5JMWA 1HDOA 3QV1A 1FK8A 1NVMB 1JN0A 2UUPA 2YFHA 1H6AA 4OO3A 1PZGA 2E6UX 2XAAA 1PWXA 2FP4A 4YBZA 4S3MA 2WE8A 1V35A 4B8WA 4PLFA 1ZVMA 3H9UA 2X0NA 2BFOA 1JWBB 4M87A 4RVDA 4R1UA 1MFPA 1LDMA 2ZB4A 3E03A 1KVRA 2ZB8A 2BI7A 2D0IA 3EGOA 3D1LA 1QLHA 1MX3A 3I23A 3BMNA 2RH8A 3TZCA 4OKNA 4JBHA 2X86A 2B35A 1A71A 2JAPA 3PJFA 4CM6A 2GZ3A 4BNWA 5JC1A 3IL2A 2FHSA 1GUZA 1I3LA 2IXAA 3GUYA 3HSKA 4XRRA 3PVZA 2WTBA 3NUGA 3KETA 5G4KA 4CUZA 3UUWA 3ETGA 2I3GA 2CDAA 2J3HA 2OFPA 4PLTA 1NQAO 4GAEA 3JQCA 5JDIC 3NDRA 2JD1A 3PGXA 4Q3BA 4S1VA 4HY3A 5JDIA 2Q3EA 1VJ0A 4U6QA 3ZWAA 1B8UA 1KEVA 4DGSA 1TVEA 2EW8A 1E77A 4E5NA 3ULKA 1IZ0A 1NFQA 1W0CA 1M75A 1SC6A 1QYXA 3RASA 1P1HA 4PG6A 4DRYA 4MVJH 2W2KB 4MP8A 4ALLA 4DPMA 3LZ6A 5DCYA 5TX7A 4DQVA 2BFMA 4YAKA 6ADHA 2ZKLA 4E31A 3RU7A 3U09A 2HRBA 5IXYA 2A4KA 4IDCA 4BO5A 3H3FA 3RROA 1XELA 4D0SA 3L4SO 4HKTA 3QWIA 1QG6A 3TZHA 3MJ4A 4RF2A 2O23A 5ITWA 3GDOA 1W6UA 4F46A 1UXIA 1BRMA 4R54A 1Q0LA 4CV3A 3I1JA 1DLJA 2VNSA 3DZJA 1NXQA 4AJHA 1ISIA 4OJNA 3KEOA 2WDZA 3TJRA 3AUAA 3CSDA 4AVYA 3PRJA 3H9GA 4JROA 2YZ7A 3I9OA 2Y05A 5F1PA 1MC4A 5COAA 4YJFA 2FPPA 3QE3A 3DAFA 3IP1A 1N92A 3E82A 3HDHA 1DAOA 1GU7A 4W9NC 2FSVA 3KO8A 1SMKA 3EVNA 4B7UA 2I66A 4W9NA 3H2SA 4CLDA 1B15A 3H5RA 2AHRA 2R00C 2JD2A 5I7EA 1H94A 2Y1EA 3ROMA 1PGNA 2YUTA 2R00A 4JX8A 4PLYA 3Q6IA 2Z5LA 1UXKA 5JC8A 3L77A 4QEDA 3ZWMA 4CM4A 1DC4A 5G4KB 1WP4A 3ZV6A 1PWZA 4M49A 4KWHA 4I5DA 3O8QA 3PPIA 3GA0A 4ZQBA 1EFKA 1U2DA 3PIDA 4KWIA 1BVRA 2ZTUA 1YH3A 2PKRA 5TT1A 2EWMA 3ZGYA 4AJOA 2HLPA 1PZEA 1MXHA 3FCOA 3JD4A 4BNMA 3HFGA 1NPYA 3JYPA 1OMOA 2BLLA 4CMIA 2YV1A 3K8ZA 3MCVA 4G81A 4U8GA 5JAIA 2PY6A 4XKJA 4B3IA 3GRPA 2HMUA 2J8ZA 4RZHA 3RC2A 3U4IA 4BNIA 5L95A 4LMRA 3ENNA 3K30A 1HLPA 1E3SA 4XWYA 2VUSA 4D46A 1LRJA 2PD3A 1LJ8A 2CMDA 3I9LA 1DFIA 2Q2VA 1QKIA 3OMLA 4JBGA 1ZSYA 2GZ2A 3OFSA 1BWSA 4I5EA 4B4WA 1LUAA 1IHXA 3LDHA 3F5QA 4BNVA 2VQ3A 3RKRA 4PFJA 3SC6A 4RQUA 4DQUA 4OXNA 3ZU5A 4XQGA 2GPTA 3VZQA 1WNTA 2X4GA 2C59A 3D0OA 1KIFA 1L7DA 5DOVA 4LGVA 4GSLA 3WIEA 3QVSA 4YJGA 3D3WA 2G0TA 2PGJA 4N5MA 1WPQA 2HMTA 3AY3A 2WYWA 3Q9UA 4NFYA 3IAHA 4J7CA 3ETDA 1GADO 2FY8A 3NTQA 3PYXA 3PYMA 2IYPA 5FEUA 5I9NA 4RO0A 4IJKA 1UDCA 2WE7A 4P38A 2JHGA 1C1DA 3RJ9A 5BNIA 3F3SA 5ILGA 4NH4A 3TWOA 5GZ1A 3ZHYA 3NDIA 2B4QA 4DWVA 4CM4B 1DIGA 3I5MA 2V6BA 4NR0A 4U0JA 3GZNA 3EDMA 4R16A 4OH1A 5JYEA 1IY8A 4W7HA 4HFJA 4DYVA 2YHIB 4XGIA 2H1SA 1J5PA 1FF9A 3NDJA 2W90A 3GN1A 1ARZA 2D59A 5GZ3A 5HRUA 2V6FA 4QQRA 1HTBA 4CMIB 1LTHR 4BNJA 4Q3CA 2NU7A 4O5OA 4BNTA 1EFLA 1PS8A 2QRKA 4NFHA 4LRTB 2X23A 3HQ4O 5A03A 3C7AA 2O4CA 4BV9A 4CLOB 4CLEA 2D8AA 4R68A 4DTIA 3U5TA 3K96A 1GV1A 1LSJA 1CJCA 4WLFA 2EF1A 1YB1A 2VWGA 3DMTC 3M1AA 4TRNA 2YV2A 1Y9EA 2OP1A 3JQ6A 4FFOA 5KJ6A 4B4VA 3DMTA 5ITVA 3RD5A 3GQVA 3GNQA 1ZNQO 4CV0A 3EMKA 4FJ2A 3S2GA 5KJCA 4PRLA 1O95A 2A94A 2AMFA 2VHXA 5DN9A 1N5DA 3WTCA 4NNJA 1U9JA 3FI9A 4ALKA 5G0VA 1VJTA 4A0SA 4O59O 4LW8A 3VKVA 4IIUA 1V6AA 3HUDA 4TRMA 5L45A 1NTOA 2PZKA 3FF4A 4LK3A 3S1LA 1JLLA 5BSGA 1HDZA 3PQFA 1X1TA 2FWMX 4FQ8A 3ZWOA 3NEPX 3ADPA 4YJGB 1YWGO 3ETEA 1QMGA 1XG5A 4WE3A 4E2ZA 2BGMA 1HDYA 2EP5A 2HKIA 4KDEA 2NVUA 4XGNA 4B3JA 1R0SA 4UUPA 1PEDA 2VUUA 1GR0A 1U5CA 2BRUA 5L3ZA 1YE3A 3H5NA 3NT2A 2C7VA 3OJ0A 4W6ZA 1QORA 4IUYA 4K28A 1NM5A 1I3MA 2WWRA 2B4RO 4IQGA 3H6KA 3SLGA 3O9ZA 2YQ4A 2CVZA 3WLEA 5JAZA 2Y1DA 4BNXA 1ISJA 3D7LA 5AVOA 4FJ1A 2DFVA 4D41A 3IKTA 1FMCA 4PGFA 5FWNA 2VN8A 3ZV3A 4CM7A 1HYGA 4D7AA 5ADHA 4HNGA 2DTDA 5IJZA 1KBZA 2PH3A 1ZH8A 3N74A 3PQDA 2J5RA 1M2WA 4QFCA 1GFSA 5B4VA 1HXHA 2GDZA 2OBNA 3FHLA 2DTEA 4FJ0A 2VNAA 2G82A 3TZKA 4WEOA 5EIOA 3SLKA 3ZWWA 3GNTA 3PHLA 4J9UE 4BO8A 4KDFA 3RC7A 4YR9A 1EUZA 2XXJA 4YAIA 1UUFA 5JLAA 5BR7A 2PNFA 9LDBA 5CG1A 2NU6A 2EKPA 2VUTA 1WVGA 3KYDA 4J1QA 4R4JA 1LDGA 5EJ2A 3SC4A 2HSDA 3KSUA 3BA1A 1VPDA 2GASA 4IDGA 1ZK1A 5THKA 1X1EA 4XEHA 1SBYA 2P5YA 4CPDA 4M89A 2OORA 4XYEA 1T2AA 5CEEA 1GDHA 1X0VA 4YJDA 2DBRA 3CH6A 3CKYA 3KXDA 3HE3A 2JFFA 1I36A 4UUOA 1VL6A 5A04A 1ONPA 3K9QO 4WASA 2ILTA 5KVSA 2YFQA 1KEPA 2TMGA 1H0KA 1SEPA 3JQAA 5EQDA 4IINA 4F45A 4XR9A 4GWGA 4IIVA 5I7FA 2NVWA 3TZ6A 2QZ9A 3X2FA 5I7SA 3L9WA 4M54A 5CEJA 2YW9A 2WYUA 3FR7A 3LC2O 4CL8A 5F5LA 4MPDA 1C0PA 1KVUA 4JQCA 1MG0A 3LQFA 4R9SA 2DUUA 4MVJI 5C7IO 2JCXA 2ZQYA 3DBHB 4W4TA 4W99A 5B4TA 5I8WA 2UVDA 1O5IA 2GZ1A 3NGLA 3GG9A 1P9LA 1Z74A 2OMEA 5LDGA 1HE3A 1L1FA 3JYNA 2Y99A 1B14A 2CVOA 4XDZA 5JO0A 3WB9A 3JQFC 4AJIA 3KSZO 5T6BA 3D5TA 3JQAD 4FR5A 3JQFA 4IS2A 3GK3A 2GYYA 4MKZA 5IZCC 3HB5X 1T4DA 5IZCA 3LF1A 1YQDA 3RFVA 4U7WA 3S2FA 1E3LA 3DBRB 3JD1A 3MJCA 2CD9A 2PKQP 1A7AA 2O3SA 4FDAA 1ADFA 4LCEA 3OEWA 3GVPA 1LC0A 2NTJA 4XRGA 5TF4A 5ICSA 2AQ8A 2V65A 4ZVVA 4F3YA 1JQBA 3WSWA 5H82A 2LDXA 3MJTA 4LN1A 3SEFA 1YB4A 1ZW1A 3AW9A 4WPGA 1C0KA 2W98A 3HZZA 4PLPA 1MXFA 1BVUA 2P4HX 4O1MA 1ZXBA 1EUCA 1L7EA 5C7OO 3MJSA 3IS3A 3FPLA 4D43A 1SAYA 3ZCXA 3PHGA 1PGOA 1KVTA 1VL0A 4L75A 2AG5A 4B7CA 2EKQA 1A4IA 1ZMOA 4UAGA 3AM5A 4UVDA 1I33A 2E49A 1DIBA 3JQAB 2ZTLA 5I9LA 1YL7A 2FR8A 4RF5A 4XQ9A 3VPFA 3GC6A 4ZRNA 5KVQA 3RUFA 3TFQA 2YYYA 3BHIA 5G2OA 1YKFA 3KB6A 4IQ8A 3K2EA 4IZHA 1H9BA 4I9HA 5BNFA 3GFGA 1E7WA 4JJIA 1UDBA 3H8VA 3PDJA 1FXSA 3P2YA 3BTVA 1YJQA 1RM0A 2OZPA 3GGGA 2EG9A 1XU9A 1IULA 1X15A 4X54A 2ZYDA 1D1SA 3CINA 1OZAA 2GGSA 1Z7EA 3BMCA 3S2IA 5B1YA 4PVDA 4O6VA 2FSSA 2DM6A 4L8VA 4XYBA 3V1UA 4FGWA 3PI7A 4N7RA 1P45A 2ZYGA 3ASUA 2EP7A 4KP7A 2J3IA 1NWHA 1PZFA 3GVCA 1GPJA 2G1UA 1TT5B 1NPDA 2BKAA 4DPKA 1NWCA 3FD8A 1PU2A 1YQXA 4BV8A 1WDMA 2DPGA 2X1HA 1IPFA 3H9QA 3OA2A 1ISHA 4LVUA 3JQEA 3ZHZA 3H65A 8ADHA 1V9LA 4Q3AA 4OKIA 1I2CA 1ULUA 3DZIA 1NP3A 4A2CA 4DQXA 5KKCA 1Y81A 2GSDA 4MVJP 1CEQA 1XA0A 2QW8A 4OQZA 4I1IA 2UYYA 2P68A 2VRBA 4DBZA 4M1QA 2GD1O 4ITUA 5JY1A 5JS6A 2QQ5A 3ZNOA 1SB9A 4YAGA 5U9CA 3AI2A 4FFLA 4FD3A 3VHRA 3I9NA 4BO7A 4UULA 3C1OA 3WNQA 1H2HA 2EERA 2BFPA 1LDNA 3K6JA 1VM6A 5BT9A 5IAAA 4YQYA 1HETA 4BKUA 3BZUA 3GPIA 3MOIA 3H7AA 1PJ3A 1T2CA 2FR0A 1Q1NA 3WJ7A 5L7TA 1R4MA 2DPHA 3GY0A 4FFNA 4DIFA 1NNUA 2X5JO 4CJXA 1H5QA 3ZWVA 2WM3A 3O03A 5ILOA 4YRDA 4D3DA 2NQ8A 1HRDA 3F4LA 4Z0PA 2H5LA 2DQ4A 3H2ZA 1PJLA 4H15A 3LSYA 4KQWA 5BSEA 1XR3A 1V3TA 4D3SA 4J7UA 4E6PA 1T2FA 3BMCB 3QVOA 1I5RA 1U7HA 4NI5A 3MEQA 1TB4A 3FBGA 4BGIA 3ZDFA 1J4AA 4KQXA 4MKXA 1GUFA 1ZSVA 2Q2WA 3U0BA 1O0SA 3E9MA 2UDPA 2Y93A 3ZWBA 3WGYA 1RWBA 3DMYA 2VT2A 4DUPA 2ET6A 1W4ZA 5ENDA 4ND4A 3D3EA 2D3TA 2WYVA 4A03A 3QA9A 1DOHA 3V1YA 4MVJG 4ZICA 4RPLA 1U2GA 2EJVA 4RVGA 2CSUA 3BTSA 1ENYA 1LLDA 5JY6A 4RLSA 4A73A 2EV9A 3R0IA 2EGGA 3TL2A 3VOSA 3E48A 3WLFA 2RHCA 3JSAA 1ZCJA 4WUVA 5GZ6A 1PQPA 3DONA 4Q3EA 2NU9A 1AGNA 3IC5A 5ENVA 2AA3A 4I9NA 4NHEA 4PCVA 3NYWA 1QXSA 4WOKA 4CMHA 4KUEA 4J43A 3VC7A 1DXYA 4CQMA 3JQ9C 2QHXA 1K2WA 1T24A 4E5MA 4OM8A 3G0OA 3JQ9A 3TOXA 1FDUA 1NQOA 3UXYA 1FDSA 2HJRA 1BTOA 3KLMX 5K0ZA 4GLOA 3FWZA 1NFRA 3IIEA 3W1VA 3WNVA 1HWYA 4CV2A 3GH3A 2GR9A 3A28A 4F6CA 5L4SA 2VYNA 3BYZA 3U3XA 2X0JA 3RC1A 4FCCA 3LT4A 3H3JA 4G5HA 1PJQA 1YB5A 4XGKA 1F8FA 1R4MB 5F5NA 4U6SA 3DBVO 1KC3A 1HL3A 1ZBQA 4ZQGA 2AEJA 1QYVA 2XXBA 5DCWA 5TJ9A 5A4DA 4OYRA 2V7PA 3DR3A 4DYDA 2D5AA 3KVOA 3LVFO 5C37A 3CPSA 3KZVA 4CMAA 1HYEA 3GGPA 2X58A 3DOJA 5TS3A 1I0ZA 4R69A 3ZH2A 1D4FA 3AOGA 1ADGA 2EHDA 1AN9A 1V3UA 4PLHA 4CMKA 1WLYA 3ZWCA 5AXBA 4HXYA 4NMHA 2C2YA 4XX0A 3W4KA 1YQGA 3FRJA 4CUJA 4HBGA 3GDGA 3T4XA 4DIBA 1ZSNA 2JD0A 3AUTA 2VYND 3P19A 3TQHA 4D3FA 3ZU3A 4BHTA 2VTDA 2CY0A 4ZQEA 4HFNA 3GEGA 4DA9A 2Z95A 3H9JA 4R3NA 1IL0A 3DTYA 3G79A 3JD3A 1WAMA 4MKRA 1G0NA 4N54A 2ZIZA 5LC1A 2OOSA 4BKPA 5A02A 1QLJA 3KUXA 1AHIA 1LLCA 4MP3A 3OQ1A 2G5CA 3WFIA 5U1PA 3F47A 4GX1A 5L9AA 3DO5A 4A27A 2EGHA 1Y5MA 4A5OA 3TOZA 1E5LA 3INGA 2D1YA 5JYDA 4L4RA 5DCUA 4C7JA 1I3KA 3A9WA 3C3XA 2E82A 4CQMB 2PGDA 4IDBA 4N5LA 3JQBC 3KEQA 3ITDA 3PHHA 1ZMTA 4IJUA 3JQBA 3T7CA 1Y8QA 4WNCA 5JW6A 4AJEA 3VVCA 1H2BA 4R51A 4DPLA 3PP8A 2WMDA 5COBA 1M6WA 4AJ1A 3DL2A 5T8KC 3BXXA 1LC3A 1V8BA 4ALJA 3MWEB 4GQAA 5T8KA 2IEDA 1U1IA 4K1LA 4K6CA 1WDKA 5BSFA 4W82A 5BSHA 1HF3A 4J1TA 4KTVE 4CR8A 2QRJA 1EQUA 1IZ9A 2GF2A 4BNUA 2PZMA 4YAEA 4CODB 1HE2A 1K0UA 1FDVA 4OOFA 3S8MA 3EAGA 1H9AA 5CPFA 2FPGA 3PFFA 3ONDA 1Z75A 4TVBA 3I52A 2ZQZA 5F3RA 5JNLA 3ZWYA 2I99A 4YACA 2H6EA 1TXGA 2HMSA 1WMBA 5TRTA 3DC2A 7ADHA 3EVTA 3C24A 1KERA 5I9MA 5KJ1A 3VPHA 5EPOA 2YY7A 3DXFA 2Y0DA 5THQA 1UP7A 4GGOA 4RVHA 1VL8A 3GAZA 2JHFA 4B3HA 1NBOA 1EVJA 1BGVA 1DHRA 2QG4A 4J9VA 4XQCA 2JJYA 3NKLA 5EERA 4AG3A 5B37A 1EVIA 3AY6A 1WZEA 1E7QA 4HNHA 3WR5A 3E9NA 3R1IA 3E18A 2YHIA 4PZEA 1PJ4A 3DWFA 5TT0A 3ANNA 2PV7A 3KM0A 1KEWA 5EINA 3S55A 1CIVA 4JNKA 3ZHXA 4RV9A 4BGUA 1CRWG 4AJPA 4L9RA 5G0WA 2V6MA 4CLOA 3NV9A 2CNBA 3QJ5A 3DB2A 4QSMA 4NK5A 1OAAA 1U3TA 3UICA 5KTKA 1Y8QB 2PD6A 3LU1A 4IGEA 4CM1A 1ORRA 1NAIA 2RIRA 4L74A 1E0DA 5C7LO 5DDIP 3N58A 4HV4A 1VSUA 4I9UA 3AJRA 4RF3A 4YXFA 2Q99A 3X2EA 1HDCA 3L07A 3PK0A 1B2LA 4RQTA 5LCXA 4Z3KA 4IMRA 3HNPA 5G0SA 4DC1A 3WDSA 4EYEA 2NADA 4BIIA 5BNTA 1WMAA 4PVCA 2FMUA 3GDFA 1GEGA 1NVTA 4L4XA 4CM3A 3B20A 3ON5A 2YHUA 2NTVA 4EZBA 3KSDO 3RFTA 1EMDA 1B16A 3VPXA 3V2GA 3JTMA 5KIAA 4GX0A 3HWRA 3PLNA 4DLAA 4IXTA 1P0FA 5ES3A 5T67A 4BO1A 3GMSA 3I4CA 4JGBA 4HUJA 4BL5A 3CXRA 3K92A 2IRWA 2CF5A 4R1TA 3AFMA 4UVEA 4Y8VA 4BNHA 1QR6A 1NQ5A 4D79A 3DBLA 4UVGA 3OQBA 2BF7A 1JU9A 1E7MA 5KJEA 2NNLD 5FI3A 2Q45A 4RPHA 1O8CA 3SJ7A 2X5KO 1BXKA 3LF2A 1NQTA 4H3VA 3E1KA 4NK4A 5DULA 5KKAA 3IDSA 1GQ2A 4O0LA 3GLQA 4J16A 1RM5A 2EIHA 3C8MA 4IJVA 1MGOA 1A27A 1KYQA 3VH2A 1JKIA 2VHZA 3UFXA 1Y9AA 1ONOA 4Y6SA 4GLLA 3K2BA 4ND1A 1R6DA 1C3VA 4CR6A 1SZJG 2J3KA 1CERA 1HDRA 3LLVA 5T64A 2GUGA 1LDEA 1LBEA 5IZ4A 3ADOA 2AXQA 5DNAA 4A10A 4JCOA 3OA0A 4PLWA 3M2PA 4I08A 1EEHA 2HJSA 4CMGA 3VVBA 1HZJA 1F8GA 4URFA 2JFHA 1EE9A 1X7GA 3QHAA 1B8VA 1NYTA 4Y67A 2H63A 2WD7B 4NZ9A 1JKFA 2NVBA 3OETA 3QQPA 4MVJM 1E1LA 2HMWA 2JCVA 4PRKA 4R5HA 2UV8A 2Q4EA 3SX2A 4UVHA 2A92A 4DMMA 1R37A 2CVQA 1E3EA 1DSSG 3FWNA 1XKQA 1W73A 3M2TA 5B4UA 2ZB7A 5JPIA 2C29D 1X7DA 5JO9A 4BUCA 5FFFA 1ENPA 4ZD6A 4U5QA 3ROPA 3CMMA 4DREA 1T25A 3NGXA 3RUCA 4QXMA 3M6IA 5KVVA 3O4RA 2I65A 1DIHA 3A14A 1PR3A 3DBLB 3ASVA 3TPCA 3DBHA 5KJFA 4BNYA 4I5FA 4LISA 2X9GA 1P1RA 1GQYA 3WGHA 3A1NA 3M1LA 2I67A 4MIYA 3TNLA 3W6ZA 1TA4A 1I10A 1VJ1A 3DHYA 4YQZA 1HDXA 1RM4A 1RYEA 4BB6A 3A06A 1M66A 1SOVA 3AOEC 5JFOA 3NX4A 1P0CA 2O7SA 2WEKA 3AM4A 1A72A 3AOEA 3I6IA 4HP8A 3V8BA 3ENKA 3DBRA 2DBZA 1HSZA 4TZKA 3KTDA 3INTA 3JV7A 3AY7A 3LT2A 5AXAA 5EMHA 4D45A 2FOIA 3U49A 1EK6A 4GSKA 3GPDG 4UEKA 3WMWA 3R3JA 3L0DA 1GYRA 3CIFA 5I8ZA 3VPGA 1YVEI 4IJWA 1VKNA 4IQ0A 5GY7A 4CMBA 3W6UA 3FPCA 2Q50A 2HK7A 1E3JA 1GY8A 2PR2A 3UCXA 3V2HA 2Q4BA 2GN8A 2X9VA 1XWFA 2CFCA 3MZ0A 3UN1A 4J4TA 4IM7A 4BKQA 1KEUA 1ZO8A 4Z3DA 1IOLA 4M86A 1DC3A 1KOLA 1MG5A 4OXKA 1DO8A 1HE5A 1Z73A 2GLXA 2O3RA 4YVFA 3WXBA 2HUNA 3WGGA 1CQIA 3D64A 4UUNA 4FS3A 1YBMA 5TNXA 4KTTE 4FB5A 3DAGA 1E3WA 2A35A 3C85A 4EJMA 3DZHA 2FPIA 5A9RA 1Z7BA 2PGLA 3QY9A 3FN4A 3PWZA 4JK3A 2IE0A 4N5NA 4XR4A 5JCJA 1F06A 4DMLA 1FDWA 5TC4A 3BHMA 1RJWA 2VCYA 5L7YA 5IDWA 3TSCA 3BMQB 5C5IA 1UZMA 3ABIA 3FSRA 2DC1A 4JBIA 4Q3NA 3FNEA 3TRIA 1LRLA 2Q1SA 3UCEA 3QWHA 3WWYA 3JYQA 4K26A 2POQX 3TL3A 4E0BA 3F9IA 4IDDA 1LRKA 1PGJA 3I9KA 2NV6A 4E21A 4ESOA 2DVMA 1UP4A 2NU8A 2HMVA 5A1TA 5DT9A 1QYCA 4GVXA 2ZTMA 3RI3A 4EI2A 1YDWA 1E6EA 2AEMA 5JCJD 4XB2A 4J2HA 3RIHA 4BOYA 1EQ2A 5TLSA 3OJOA 1TT5A 2I9PA 1DHTA 1D1TA 4E5KA 3ORFA 2VWPA 3EC7A 4KUGA 4OSPA 3HDYA 3CMCO 4OMUA 1H6CA 1XDWA 4XB1A 4CMJA 3CZMA 3BTOA 3MTGA 3FR8A 4WECA 3KRTA 5L4NA 5DP2A 3ZHBA 3RJ5A 3S2EA 1XSEA 3ICPA 3KBOA 1Y1PA 3HDJA 4YTEA 1K6JA 1LNQA 2PK3A 2DKNA 3DDNA 4NBTA 1N1GA 2AE2A 3W8EA 4PIVA 9LDTA 1IPEA 2DT5A 4PZDA 2O3TA 4KZPA 4NBUA 4RPGA 4Q9NA 1QYWA 2O3JA 3D5QA 2OO5A 4XDYA 4AJ2A 3FTPA 4JN6B 1LI4A 3DOCA 2GCGA 2Y1CA 2XF8A 3GRKA 4MINA 1JDJA 3IUPA 5DP1A 5ICMA 5G4LA 4ZRMA 4NBRA 1E3WB 1ISGA 1LSOA 4CLHA 2AE1A 4K6FA 1EUDA 2E4AA 4DLBA 1S7CA 1YL5A 1VSVA 2VZ8A 2DUWA 4BO0A 4O63O 4BGEA 2NTNA 5IF3A 5JCXA 2PLAA 5JAMA 2ZJ1A 4R41A 4FFMA 1P1JA 3AFNA 1TEHA 1EBFA 2LDBA 3WS7A 4GGPA 3QWAA 4IDFA 2VYVA 5HS4A 1P74A 2I6TA 5DOZA 2G17A 4KOAA 1MP0A 2OP0A 4ALNA 3QVXA 3QWFA 2R6JA 4FPXA 4LSWA 3F1KA 1Q0QA 4CQMD 2HDHA 2O3QA 3C7DB 4UEJA 3EZYA 3VZRA 1E1MA 4XYLA 4FOOA 5EESA 1U3WA 1DB3A 4NU5A 2ZCVA 4WEQA 1T4BA 3BAZA 5L4LA 3K73O 1R12A 2YV3A 3JQDA 1M6HA 3DZBA 3QP9A 1U28A 3TDKA 4XYMA 1OC2A 3B1JA 4WLNA 2C82A 5K9ZA 2QZZA 2VYVD 5JAQA 1E1KA 1K6XA 4DBVO 2PH5A 5L51A 1EE2A 1GCOA 4MP6A 1XU7A 2VTEA 1EVZA 3IOYA 4IS3A 3U9LA 4YJHA 1PL7A 5AXDA 3GN2A 3BIOA 4YEDA 3RBZA 3A4VA 4IMPA 4BNFA 2DLDA 1RM3A 4PLCA 3RQSA 2Y66A 1N9GB 4ZJUA 5H83A 2VZ0A 4YT8A 3HB4X 2JAHA 4WNIA 1N1EA 1PJ2A 3HHPA 2PKQO 2X7HA 3F4BA 1UAGA 2B5WA 1LQTA 3STHA 1EK5A 3NAQA 4ZU3A 4WCDA 1KC1A 3ZWPA 4JJGA 3MJEA 1R0LA 4UEOA 3DZGA 5A05A 5I7VA 2VHWA 1LSUA 1CWUA 2IZ0A 1I3NA 2HK9A 1P44A 3F46A 1J49A 4QUKA 5EN4A 4G2NA 4L0QA 3B70A 3L4BC 4Q3DA 1P3DA 4PLZA 1R66A 4TMFA 4Z0HO 1ZIDA 2X9NA 3L4BA 3LC1O 4QX6A 3F5SA 2Y1FA 2FZEA 1NHWA 4I5GA 3I9JA 4J1SA 4PG4A 3T4EA 3ZU4A 1D8AA 3UHAA 2RH4A 1UR5A 1BW9A 1UP6A 4AJ4A 4GMFA 3KYBA 1GZ4A 1CF2O 1NPTO 5A3JA 3VH3A 2FZWA 3GUCA 1X14A 2RBEA 1E1NA 3DHEA 4M8SA 1ZK0A 3GF4A 4FC7A 1SOWA 1A4UA 1DPGA 2AG8A 3GAFA 4RORA 4E2YA 3DAPA 3HN7A 3WX0A 2SCUA 3Q11A 4BO4A 1HDGO 3ZW8A 1BHSA 1E7SA 1K6IA 4N18A 2GO1A 2P5UA 4E2WA 1GZ6A 3HN2A 1DIRA 3NTRA 3UVEA 1VKOA 5EL0A 1JKJA 1QV6A 3VAZA 2BGLA 3LT0A 1BG6A 4WGGA 4QO8A 4UUMA 4ND5A 4YJHB 5JDCC 3ZNPA 3GG2A 3RUHA 1XHLA 1HE4A 2BFAA 3PEFA 4I8XA 5JDCA 4YRBA 4TRJA 1IHYA 3OHSX 4OL9A 5CDUA 3EYWA 4YDRA 2J3JA 1DAPA 3QVTA 3OH8A 3AU8A 2B4TO 1PL6A 3ANMA 3GMDA 3ZW9A 2TMDA 2OBYA 4RPJA 1GV0A 1PS0A 1E6UA 2DTXA 4EW6A 3AU9A 4MVJE 1R4NA 4J0EA 4IGFA 4RL6A 3L6DA 4EJ0A 2ZK7A 5A06A 5U4QA 4EUFA 1VRWA 2BGKA 2GNAA 2JCYA 3QWBA 4TWRA 4NBWA 1NFFA 4RF4A 4CM9A 3PGJA 4BO2A 2AQKA 3R3SA 3GOHA 4YRAA 4LVCA 4E33A 4JP2A 4TKLA 1B7GO 3WYEA 3GVHA 3Q3CA 3NJ4A 4XJTA 4BO9A 5BQFA 2P9EA 4II3A 1BW9B 2Q1UA 1Z6ZA 1PL8A 1PQWA 5JMPA 3JD2A 4AL4A 3IKVA 4YAJA 1O6ZA 1ISFA 3O38A 4P4LA 4TROA 4YB8A 1H6BA 3K31A 2Y0CA 1EDOA 1D7OA 2BH9A 1Y8RA 2ZB3A 4IDAA 4YT4A 1ZJZA 5A3VA 1MLDA 4BKRA 5DBFA 3WFJA 2OXIA 3WSVA 5CEFA 3BTUA 4EEZA 2P9CA 5C3MA 1E5QA 2WD8A 5IDXA 2C5EA 3VZPA 1AXEA 4CM9D 1T2EA 3DFZA 3OJFA 3Q2IA 1P33A 5G0TA 4FW8A 4EITA 1ZK2A 5CDTA 4IZIA 1V3VA 3ZV4A 4P8RA 1AE1A 1T1RA 4EUHA 1AXGA 1SB8A 4CMEC 3R6DA 4BGVA 4BMVA 1C14A 3EUWA 4CMEA 8LDHA 1MA0A 4IBOA 2DFDA 2OUIA 4HFRA 4YYZA 2UUOA 4ZQFA 1CQJA 3PWSA 4YWJA 3VH1A 3NT5A 3UF0A 2PTGA 1E6WA 3T7EA 4R3WA 3WQSB 4R9RA 5IFLA 4AJLA 5A9SA 1OBFO 4PN3A 4BNNA 1CYDA 5IN5A 1R4NB 3WGQA 4LCJA 1ADBA 3RWBA 4YT2A 1KY5A 1LDBA 1R15A 1QSGA 1PZHA 1DC5A 4B8ZA 1LLQA 3D4NA 4IY1A 5HA5A 3WGZA 3EW7A 2AQHA 4JIGA 3PYLA 3KLPX 4GVLA 4PG5A 1PIWA 3COSA 4BNZA 2VHYA 3ONEA 4J4HA 4J3FA 1GYPA 4IXWA 3WGTA 3WBFA 1Y6JA 2O3UA 5DBGA 3EK2A 1YS4A 2E37A 4ALMA 1ZK3A 3F1LA 2NQTA 3K5PA 1U4OA 4HADA 2Q1TA 1ONNA 3GHHA 4WOJA 3DZKA 1ADCA 4LRSB 3PHIA 4HFMA 4BVAA 3E9QA 3PIIA 4LSMA 3AWDA 4QFDA 4C7KA 1DDOA 4MOWA 3ZNQA 3OEYA 1E3IA 5AQ1A 1WWKA 1Y8RB 4CLXA 5MGBA 1UAYA 2I5PO 2PZJA 3PZBA 1R0KA 4R01A 5CDGA 1Y7TA 2BI8A 2A9FA 1XQ1A 4ROSA 4TKMA 2Y68A 3DFUA 1UH5A 1PGQA 4U0KA 1LU9A 3VDRA 5EQFA 3TF5A 4RLHA 2B0JA 5H81A 3H4VA 1P1FA 3IMFA 2OGUA 5CP8A 1LXCA 4FOSA 3Q9NA 1HSOA 1G1AA 3GZ4A 4GPD1 4L73A 1B26A 3WYCA 2FR1A 2NACA 2D4AA 2EJWA 2J5QA 2X8LA 3LK7A 3O26A 4M55A 1KS9A 1XGKA 3BMNB 4MIOA 2VWHA 2Q1WA 1N2SA 4D0RA 1N8KA 1LDYA 3N7UA 2O4UX 2R2GA 5FI5A 1NR7A 3VDQA 1G0OA 4QT0A 1MC5A 2X0IA 1JTVA 3DTTA 1AHHA 1NHGA 1UXJA 3OSUA 3NTOA 2OL4A 3PWKA 3LLSA 2Y0EA 1A7KA 5A9SB 4RPKA 3B1KA 2W2LA 1U7TA 1JA9A 3JD0A 4YCAA 1M67A 1ZXLA 4IDEA 1HYHA 4HWKA 1BMDA 3CEAA 2HU2A 3WGIA 1R16A 4BQPA 1UZNA 3PHJA 4D42A 2O2YA 2V6GA 4Y9DA 3Q2KA 4EGFA 2IYOA 3OF2A 3V1TC 3MTJA 3QIVA 4G65A 3CE6A 4L4SA 2NUAA 2WD7A 2AEFA 1EZ4A 6LDHA 1PX0A 4E5PA 1H93A 2GN9A 1C0IA 3C1TA 4J2OA 5FF9A 1P77A 4BQRA 5JSFA 4MO2A 3GGOA 4KUHA 1P1IA 2W2LD 4J91A 2VOEA 3DOOA 4NU6A 1C0LA 2UAGA 2IDZA 5B12A 4R1SA 4W7IA 1X13A 5CPBA 2ZTVA 1C1XA 3QW2A 1N7HA 2XOXA 1Q2XA 1ZEMA 1ZEJA 2C54A 3WYBA 2PD4A 3PJDA 4AJKA 2HQ1A 3AK4A 4E2XA 4Y6PA 1VI2A 1F17A 1BSVA 1PJCA 2CDCA 4YJFB 3RC9A 3KOUA 4EBFA 3HFSA 3SJUA 2QYTA 3EHEA 3KYCA 4GI2A 1F12A 4WCFC 1I2BA 5AYVA 1ENZA 1E92A 4OOEA 3JYOA 3WJAA 3RAJA 4FGSA 4WCFA 2CF6A 2VHVA 3LYLA 3AI1A 1YBAA 1TT7A 1GEEA 3ICCA 3PJGA 4B4OA 3JYLA 4PG7A 3U4HA 2RCYA 3I6QA 5ER9A 3GVXA 3HJAA 4FBGA 1DRWA 4FIZA 1F14A 3O8QB 4GL4A 3TN7A 3ZWNA 4XD2A 4WKGA 2CZCA 2E48A 2EKLA 3OIDA 1F0YA 1YOVA 1LLUA 4FSHA 1DBVO 4E30A 3IP3A 2WJPA 4NJMA 3NJ8A 4IPTA 3HG7A 1A9ZA 1JAXA 4TQGA 1FJHA 1OC4A 3GVIA 4PLVA 5FYDA 2JKVA 3RUDA 2ZATA 1PJTA 3U4CA 1XIVA 1I01A 2HO5A 4JP3A 4J6FA 2ZCUA 1DEHA 2YDXA 4GX5A 3P2OA 4NQZA 1Q0HA 2QX7A 3L9XA 4BMNA 1ZKMA 1O89A 1SPXA 5KCZA 1YJ8A 1ISMA 5HM8A 2Q46A 3V5NA 3WIDA 2Z1NA 3RVDA 4YPOA 3FTNA 2HAEA 2J6IA 3C7CB 1B0AA 1QRRA 4NDNE 1UZLA 4EEXA 2W8ZA 4RZIA 5IDYA 3L6EA 1C1XB 3LC7O 2QYSA 4CM8A 1DFHA 2PWZA 3CUKA 3OIFA 3VPSA 2FN7A 3BMQA 4XJSA 4J1NA 4ZA2A 4CL3A 3RUIA 1GAEO 2C20A 1KETA 3BMOA 3QRWA 1PJBA 3GT0A 4FN4A 2P2SA 1K5HA 4Z9YA 4WLEA 4PZCA 3D3WB 3UAGA 3KYCB 2X5OA 5K6AC 4DLLA 5LDHA 3ZWXA 4UREA 4Z9FA 4RCVA 1PR9A 1OOEA 3W8DA 1E7RA 5K6AA 4ZN6A 4TRRA 3DEYX 4WCFB 1YBVA 3SVTA 2C5AA 1N7GA 5IXSA 3GFBA 3I4FA 4B79A 4RVUA 2AQIA 5L53A 2Z1MA 1C1DB 2Y67A 1SNYA 3ZN2A 3AUSA 3GNSA 4EUEA 3MJVA 1A5ZA 3LT1A 4ID9A 4GBJA 1J6UA 1WZIA 3B6ZA 1Q7CA 1ZK4A 3GZNB 2Q49A 3H5AA 4L76A 1MB4A 1LX6A 1U5AA 1BDMA 2YDYA 1YOVB 4NJMB 1AUPA 1I30A 1YRLA 2F00A 3E6AA 2NLOA 2BMAA 3RBVA 1MUUA 2B69A 4ZQHA 4YA6A 1ZJYA 5A5EA 5COQA 4GMGA 3B1FA 1CETA 5T5QA 4AJJA 4B4UA 4NFSA 1T1SA 1PSDA 1NX6A 2EW2A 3I3OA 5DZSA 3CTMA 2IZ1A 4RVSA 2X22A 1DJNA 3ZZNA 1PGPA 1BXZA 2NM0A 3NRCA 5JXWA 1MV8A 3UW3A 5F21A 1UXHA 2DBQA 4QTZA 3JQ7A 4MVJF 3PTZA 1XQ6A 4ALIA 2B36A 4CM8B 3BHJA 3WG9A 3H9EO 5IN4A 2IEBA 3PDUA 4DVJA 2VRCA 4OHUA 3BMOB 5CFZA 3OJLA 3U62A 1DLIA 5CDYA 1UJMA 4TZTA 2F1KA 2H9IA 3INRA 2VZ9A 4WLOA 4Q39A 2NVUB 4E12A 1JVBA 3UKOA 3OICA 3JQ8A 2EXXA 1X0XA 5AXCA 4AJNA 3I83A 4TVOA 5T57A 4P22A 4J7XA 3WGOA 2D5CA 1P31A 3RUEA 1DC6A 3OECA 5TQVA 2NSDA 2DU8A 4J0FA 1V0JA 5HWSA 5IG2A 2B37A 4KMSA 4CV1A 1GD1O 1Y5RA 1HZZA 2Y1GA 1YONA 1YXMA 4J4BA 5F1KA 1U8XX 2PZLA 5HTOA 3ST7A 4GWKA 4CR7A 3IJRA 3SXPA 4RDHA 2JFGA 2B83A 1PS9A 3UH1A 2VRCD 3G1TA 3E8XA 3G17A 1E7YA 1B3RA 4QO7A 1X7HA 2RHRA 2IXBA 1GZ3A 3DHNA 1ZUD1 4XIJA 3WQQA 4BO3A 1K3TA 1UDAA 5GMOA 1W8DA 2ZYAA 2D2IA 3GHYA 1HEUA 1I8TA 2HRZA 4C4OA 4RVFA 1RYDA 3PLRA 5J23A 1N9GA 3QLJA 5TJHA 2JL1A 4WK6A 3PJEA 2G76A 4J49A 4MDHA 2IZZA 4CUKA 3CZRA 3WICA 5A5FA 1DFGA 3G1UA 2P91A 3WOHA 2IODA 1NAHA 5CDSA 2OHXA 2QIOA 4ZGWA 3E5MA 4F6LA 4Y98A 4BNGA 3KYDB 3Q0EA 4CQLA 5CHEA 4FC6A 3QVWA 3JQ7B 1PQUA 3WMXA 1M76A 3OQ6A 1JW9B 1DRUA 1KVSA 1LQUA 1UXGA 3RKUA 4XA8A 1HT0A 4FFPA 2C07A 2BHLA 4ONEA 1U3VA 1QV7A 3EZLA 3FNHA 3HDQA 2FRDA 3V2UA 3SBOA 4EDFA 4BB5A 1LA2A 5A9TA 1IUKA 1Z45A 3W4IA 4NG5A 2EEZA 2NWQA 4J90A 3FNGA 1GTMA 3OIGA 4UVIA 4A7PA 3AUUA 4E3ZA 3OP4A 5ER6A 3JQ8B 2P4QA 3RCBA 1GL3A 2GN4A 3DQPA 1WW8A 3IQDB 4P4NA 5DF1A 1EDZA 1PTJA 3RSHA 1I24A 3ROKA 2HK8A 3G3EA 1WDLA 2GN6A 5KOIA 5CG2A 2YQ5A 1BXGA 4OGWA 2VWQA 5HBRA 4OIMA 4DIOA 3KV3O 4MVJA 1D3AA 4OSOA 4GKBA 4BNKA 1XLTA 1DIAA 1S6YA 4E13A 1QP8A 1SEVA 4XCVA 3PQEA 4P4GA 4JJFA 5CAEA 3RBXA 7MDHA 3VKUA 2CDBA 1NR1A 4E32A 1RKXA 2AW5A 1GQQA 1VE9A 1B3BA 1EVYA 4YT5A 1YDEA 2BELA 3ZV5A 3I9MA 4A26A 4WJZA 1YO6A 3L6OO 2ZJ0A 3OJEA 3AI3A 2XPCA 4K9DA 1KVQA 4XIYA 3WBBA 1EBUA 1CDOA 1G6KA 1K89A 2GERA 2QRLA 3FNFA 3ROQA 3UCFA 3D4OA 5TIIA 4Y6RA 4CMCA 1GPDG 2YJZA 2O50A 4JLWA 4CLRA 2BD0A 1Q7GA 4CQLB 4MVJD 3P5SA 4H7PA 1XEAA 3DZFA 4B7XA 1NVGA 3KHUA 4XZ3A 1I32A
chains in the Genus database with same CATH superfamily
4WLUA 3G49A 3HMQA 1EUCB 5KVCA 1K5PA 3S2SA 4NEHB 1YBFA 1QYDA 1JAYA 3GRZA 3ZVMA 3ECAA 2HOQA 5EZQA 4LY0A 3R8XA 1DIOB 4KZKA 2HJWA 4AICA 2YJ6A 4ZWNA 1SWWA 1Z6AA 1ZZEA 2WSYB 3ER8A 2VDWA 2X0RA 1CD5A 2OGTA 4TSKA 1M83A 1G66A 4TT3A 2X7JA 4ZHSA 2G70A 2Q2QA 2RGCA 3QA3E 4QBIA 1RPNA 4DV1B 5KWEA 1E0AA 5LL6P 4HNQA 5EHXA 1MIOB 1L5RA 2PFGA 2ID7A 4ND2A 4Y0AA 2IP2A 3ZNNA 2C0CA 4KIFA 4DC0A 3OIYA 2E21A 1RJGA 2Y3IA 4IVRA 4MA4A 4O0MA 1EXMA 2OZLA 1YTLA 3E3OA 4S1PA 3ONFA 3PQ4A 1ZIXA 3WWPA 5I6DA 1TLTA 4QBTA 4Q3LA 1YMQA 2QORA 4PLGA 1G5TA 3H75A 3EH1A 3JARA 4E5YA 1OBCA 3OM9A 1H1TA 3B6JA 1ZR2A 4CM5A 2B4KA 1VKZA 3EFBA 4RZXA 1JG2A 2VT3A 4EY8A 4RJTA 5IWAB 3LLUA 1PZMA 2DBVO 1IXZA 3F6YA 4OQYA 2O7RA 4BLSA 6GPBA 2NV0A 3M70A 4Q34A 1KJ9A 2P3OA 1GRNA 1ISPA 1ID1A 2NQ2C 4NPCA 5FPSA 1B2RA 4TQUS 3VTFA 3VH4A 3L4EA 2NZXA 4AY5A 3W5HA 4I50F 1Q84A 5HRCA 1P62B 4GOMD 4FILA 4MULA 2ZJBA 4I66A 1V48A 4G24A 2CYAA 1JA0A 2C3MA 3W9YA 1U3UA 2GK6A 2B94A 4Z6KA 3GLGB 4LXGA 1SBTA 3VO2A 4RM3A 2HW8A 4RHTA 4BZQA 3PZRA 3C1AA 3H17A 3WWZA 421PA 1U5BB 2WZBA 4KG7A 4OXYA 1DTWB 1J07A 3KOMA 3QEMB 1YE8A 1TI7A 3UV6A 4DL9A 3NJRA 3ZU2A 3P7MA 4P7JA 4ARSA 1V26A 2C04A 2HDNB 4V2IA 3DVLA 5C46F 4BDSA 1NVDA 4KQFA 3KOYA 1L8LA 2WUFA 4D9FA 1CCWA 4ID3A 1J0BA 3RNOA 2VQEB 3IUSA 4O4JF 1VC2A 4BPRA 4OY3A 4JYBA 3IDOA 3NG1A 3NM5A 1GUYA 2FXVA 2WPDA 1IHUA 3FBWA 3U7QB 3JATA 3PICA 3A1SA 1GTSA 4F5DA 1JVSA 3ZVKA 3DGEC 4R5MA 2KMLA 3JPWA 3RU9A 3ZHOA 1NU6A 5JE8A 3ND9A 3FCUB 3PD1A 1GCGA 3PXXA 1SRRA 3I5AA 3S1AA 2QSJA 2PL3A 2QAJA 3JQGB 4P86A 1JL3A 3C8ZA 4KSCA 4DBLE 2G7MC 1NATA 2HSEA 3GJ0A 3GP3A 3TMAA 1DKOA 1XD2B 2XYHA 2OAEA 3BRSA 3UGQA 4F4JA 1NVMB 3FA2A 3AVTA 2NYAA 3EZ2A 5JJBA 2V9ZA 2YFHA 1I6LA 4JEHA 4OO3A 3G5AA 1WDTA 2QRHA 1JLSA 3BWVA 3VGPA 2V03A 2IY7A 4S3MA 2ADFA 2GLUA 3BD9A 3MM4A 1V35A 1Q7RA 4JZYA 1JHQA 4GM0A 3SMVA 3UMSA 7MHTA 3OPQA 3VO9A 3G2NA 3H9UA 4TMYA 3EG5A 3KYJB 3RYIA 1QP4A 4XOUA 1V16A 2XUIA 3EDRA 1QWSA 1OFTA 3ND5A 1U8ZA 2W6CX 2PGNA 3QFSA 4BLWA 1MFPA 4D9GA 3R9XA 4XCXA 3E03A 4QRIA 3VV3A 1O57A 1Y9ZA 2ZB8A 4A23A 2P35A 1I0IA 5IM4F 3C16C 1QLHA 2P5SA 3R7WB 3BMNA 2RH8A 3LCCA 4OKNA 2X3UA 4G0WA 4GYJA 5JSZB 2OR3A 4CM6A 2R1TB 2GZ3A 1OIXA 3KR9A 3M82A 2FHSA 1I3LA 1IM2A 1AO3A 1C8LA 1GRVA 1W75A 2JGDB 2RB5A 2AI2A 3GUYA 3QKSB 4MS4A 3R3WA 5G4KA 5BPHA 4CUZA 1G8PA 5AI4A 5JECA 3BK7A 4P5EA 2OC9A 5BPFA 2J3HA 2LWIA 2OFPA 4N6OA 4BVFA 1DCFA 3DTNA 4TMWA 3AIKA 4ZO9A 2YZNA 2BEWA 3MWFA 5EIAA 4G0OA 3AEYA 4N12A 2JD1A 4PV7A 3PGXA 4Q3BA 2NU9B 1CUDA 1LD3A 1B6TA 3FHJA 1ILEA 2QMQA 4U6QA 1B8UA 2DFPA 3WL3A 2HJGA 4DGSA 1CRQA 2I6FA 2IXFA 1D6NA 1T5BA 3EY9A 3SXUA 3FCCA 3A4MA 5MGNA 2FMFA 3DLTA 1MNQA 5K09A 1SC6A 1QYXA 3QGMA 3RASA 4DRYA 1YBHA 4MVJH 2W2KB 3T54A 1SKYE 5JEDA 4MQ5A 4BQEA 5M29A 2VT6A 2Z43A 1LH0A 3LZ6A 4N1AA 4D8XA 3OOJA 4UZSA 4DPMA 4JI0B 3BCRA 1X80B 3A6EA 2V6IA 3U09A 4QHYA 2PQ6A 1KIAA 3EGWA 1XEWX 5JD4A 1CY4A 2FHPA 2WB2A 1TJYA 4FYMA 2VP2A 3WLJA 1IY9A 4BO5A 4BMCA 5KYXA 1FYXA 1XELA 4JVNA 3G2QA 5IS2A 3N5KA 3O1JC 3I92A 3T4UA 5J4YA 4Q4AA 3TZHA 3EPLA 1B23P 2O23A 4QU5A 4WACA 1W6UA 1BRMA 1JG4A 2PYDA 2FLKA 3D8TA 3LY8A 5JYCA 2G76A 4C04A 1JNXX 1RYNA 1URPA 1QZXA 1QF9A 2A2ZA 1NXQA 2VNSA 4RFSB 2JCGA 4UEWA 4EI9A 5KMGB 3NAMA 3H8JA 2CXHA 1JDTA 3HS3A 5ULLA 3TJRA 3AUAA 1IK4A 1CULC 2JHAA 2GJSA 1PW7A 2V97A 4AVYA 1S4QA 1TCUA 1FUUA 2OKGA 4EG4A 3QE3A 7REQB 2FSVC 1OLUB 2OOKA 3B5EA 3MG9A 1DAOA 2FPXA 2VDQB 3O84A 4QXPA 4XX0B 3D1JA 4URHA 1FRNA 1SMKA 1VLZA 2VPIA 2I66A 3GXOA 1CG6A 3CZCA 4W9NA 5TMPA 1O6CA 2EKBA 1B15A 3WLIA 1M2EA 3ELUA 3H5RA 2AHRA 3P97A 3R5FA 2HTEA 4B6FA 2OLKA 5I7EA 2Y1EA 3ROMA 4V0NA 3OURA 1L9KA 2YWJA 4IWXA 4I4TB 4U2GA 3TXXA 1KJJA 2Z83A 2X8WA 1TRHA 5D6OA 2OV6A 3KU1A 5EKDA 5F33A 5BSMA 2Z1DA 3TVDA 4B85A 1T9HA 1C8BA 1EG2A 1G2QA 4RZUA 1XRPA 3ZV6A 3ESXA 3UAOA 4OB6A 4KWHA 5EQJB 5BVGA 3VHXB 4WY2A 4GOOD 1FDRA 1UT6A 3GA0A 2V45A 2F4NA 1FFDA 1RJ9B 2C4NA 4S12A 3TW8B 3U6KA 3N2GB 1BVRA 1O96B 3D8SA 2QDXA 2EWMA 3CN9A 2HLPA 4NV1A 3FCOA 1JSZA 3JD4A 1NW3A 2QG9A 3ZVLA 4OQDA 4LX8A 4X8MA 5BN4B 4K3VA 4G81A 3MCVA 1SXQA 4S05A 5E1DA 5L6LB 1JX6A 2PY6A 3T3PB 3THYA 1YFLA 2IUSA 5D5HA 3D54D 4M8NE 3GRPA 2IXDA 1EK1A 4RZHA 3DV0A 5BOSA 1D2CA 4LMRA 5JV5A 5LMUB 4MVCA 5K0JA 3K30A 1H0SA 3KKPA 1E3SA 2QR2A 4XWYA 4ACAA 3PDIA 3GCDA 3IUYA 3VSDA 1LJ8A 3ASZA 3ZXUB 4AF7A 2PIAA 3VC1A 5IM4A 2Q2VA 2H5IA 1ZONA 4JBGA 4LQDA 3OFSA 2JAUA 4B4WA 1G3IA 1VJCA 1MX9A 2PDAA 1IHXA 3LDHA 3F5QA 3FYTA 3VTKA 2Q0QA 1Y5LA 3SC6A 3E22A 1RTTA 1VZ3A 1XL1A 5CK5A 4DQUA 2G0NA 2CJPA 5BRAA 2G40A 3ZU5A 5K8IA 3V4OA 1DT5A 4R6XA 1J24A 2BUBA 1IN7A 1D8TA 2ZUSA 3RTEA 3R4CA 1Q1GA 1G21B 2I6SA 2X4GA 4PCAA 1OJLA 4HQKA 4LC1A 3OQMA 5HUHA 3BIFA 4HDNB 3D0OA 1F60A 3LDUA 2FPGB 5DOVA 5CDHA 1UKAA 4EQ6B 1PK7A 2DHDA 4IOJA 1TMGE 3QOYA 3WIEA 2IX3A 1THGA 2QNIA 1R5NA 3A3YA 3GLTA 1T2NA 2PGJA 2X14A 4GS5A 4V3BA 3AY3A 2G72A 3F49S 3TLGA 3TW4A 5JJIA 2H16A 3IAHA 3PUYA 3IOBA 2EW1A 5CX1B 2IYPA 3L8DA 1JHVA 3QYPA 2V7WA 3T12A 4EABA 5TE9A 3DULA 5FWYB 3HUEA 1ZAYA 2GK3A 2B1QA 4GR9A 1OFIA 2Z04A 2JHGA 5LZ4A 3VXKA 1GTL1 3KR2A 4DRXB 2RGXA 2WFZA 2PMWB 3C6KA 3G82C 4ZV4A 1L7RA 3ZHYA 1OTXA 3HRKA 5GZ1A 4DWVA 4CM4B 3RRMA 4YPVA 1COWD 1DIGA 4C5CA 4ZYXA 1WQ3A 2PRYA 3HJRA 1B76A 3PXAA 4RKWA 4QG7A 4G2TA 4BCDA 5KVAA 5H3HA 3WO1A 4ZI3A 1W5BA 4NEQA 1JEJA 1TECE 5JYEA 3A1CA 4KXVA 3GJTA 4XGIA 3L6CA 3N8DA 3IQHX 2H1SA 1I7SB 1OVGA 3C3PA 4NPAA 4YJKA 4RTMA 1Z2EA 5GZ3A 1QVAA 2V6FA 4LYEA 4QQRA 5HRUA 1CNMA 3C5CA 4PEVA 1MJNA 2JFPA 3KCQA 4CMIB 5J2UA 1UBMS 2K2WA 4HOYA 1JE0A 1NGSA 2ODNA 2QL6A 2QX6A 3A0RB 4RGYA 5BQPA 4EAAA 5A03A 1V9CA 4CLOB 4CLEA 4DTIA 5K01A 3N1UA 3K96A 4G5FA 4LI3X 3OE1A 2EF1A 1YB1A 2VWGA 1JFTA 3RRNA 1EWTA 5JYBA 1Y9EA 4B4VA 1T9BA 2AK3A 3HY3A 4FNAA 4A2PA 1Y48E 2VH1A 1O95C 3IHLA 1YNOA 1IRXA 5KJCA 2RI0A 1Q14A 4H77A 2ZDQA 2WIGA 3NFRA 4KRGA 4AT1A 4O4IB 3ER6A 3OPVA 4UD2A 3V8NA 1RVV1 3SBXA 4EHLA 4YRZA 1WCXA 3KKOA 4KYIB 4QLAA 2DBYA 2ZEJA 1VL1A 3FI9A 3I39X 1KMQA 3SNKA 3G2JA 4URXR 1SQ6A 1TUBB 1N2IA 1IUPA 1QHEA 5B5SA 3ZEIA 4O59O 2D0OB 1HC7A 4FKZA 1YR1A 2Q3BA 4O2BF 5L45A 1ORTA 4KDRA 3U61B 1JLLA 4FFDA 2OM6A 5BSGA 1HDZA 3V42A 2DKOA 3B7GA 4FYHA 1T4GA 3ADPA 2E4ZA 1GQSA 1YB2A 3ETEA 4IH1A 4AZVA 1RZUA 3SJBA 2BGMA 4XGNA 4B3JA 1CY1A 4FR0A 4QVKA 2BRUC 3I2HA 3R5XA 1KZ4A 1IPHA 2NYRA 3W9SA 1O95D 2QAIA 1R6UA 3JZMA 1YE3A 3R6GA 4FINA 3BL8A 3DCNA 5EEGA 5HZKA 2C7VA 3DL0A 4HAXA 1QORA 1NT2A 5JCPA 2WIJA 3LCVB 1NM5A 2OCGA 2V3WA 3K7EA 3OZFA 1XTTA 4K28A 2C4KA 1DBRA 3H6KA 4M36A 2Y1LA 3PCTA 4WDQA 3ZQUA 1GTVA 1J9GA 4COKA 3IPYA 5FPYA 1QJCA 3R76A 2ZIXB 2Y1DA 1BE1A 2P6PA 5EJIA 4MUXA 4GZ5A 4INZA 1AOXA 2JGEA 4D41A 2F62A 3CRVA 4FHEA 4PGFA 3RYHB 2ZXEA 1HYGA 2AV6A 1NR5A 3A37A 2GETA 3I12A 1SXJC 3A9TA 5C18A 5E7JA 2PH3A 1ZH8A 2BMDA 3O4HA 3HJBA 3N74A 4QFCA 4WNAB 4YROA 4D80A 1KI1A 1GFSA 3COWA 4X97A 1L4HA 2COUA 2GPBA 3PA6A 1AQUA 2JK1A 3RIYA 4HUTA 4W5RA 2J0QA 1ETUA 3TSWA 1J0AA 4WEOA 5DHUA 1G7RA 3GFTA 3BT7A 3CM0A 4UHFA 4ZVLA 1X2BA 4BO8A 4P7FA 1QLWA 4A8JC 1G9XA 4KDFA 1VLQA 3DQZA 3AKYA 3TQOA 4BZPA 3MPUA 4X6XA 1FX1A 1TYZA 2HA5A 2CFOA 1Z13A 3B36A 1CZNA 2PNFA 4Z4FA 1EM6A 3EOAI 2NU6A 3KYIB 2COKA 2EKPA 3EXEA 3LQQA 4RCYA 1H42A 1Z6PA 1EZZA 2WSSD 2O0HA 3HI6A 5E3HA 3RHTA 4ARUA 2VPXA 4R4JA 3GPBA 5TMBA 1F3LA 3TL6A 1Z5NA 1D6MA 2VYFA 1W5AA 4MKIA 4EM6A 4BYGA 3GJ4A 4IDGA 4OYLA 3SWWA 1S8AA 1ZK1A 2OORC 1XZHA 2DPMA 2WTAA 4U7JA 5CEEA 4I55A 2UUAB 2Q6IA 1EJ2A 5CCXA 3BS4A 3A0UA 3CKYA 1SXJD 1YVPA 3B85A 2QE7D 3HE3A 3KXDA 4Q02A 2HBRA 1U0FA 4G97A 4JJ7A 1I36A 4EHIA 1ZX1A 1ZU5A 2Z4TA 1DXOA 5A04A 5BV1A 2H4HA 3DMHA 1KEPA 2C2GA 1E2JA 1SEPA 2JASA 5GGXA 4KFSA 4NENA 3WYDA 5FQOA 2B1JA 2LPMA 3KQPA 4G5YA 1KFBB 5E4YA 3UC5A 4F8JA 3PEWA 4IIVA 5I47A 3PFNA 2NVWA 5I7FA 2QZ9A 3N05A 3X2FA 2FCAA 3L9WA 4M54A 1UPXA 2GAOA 2KB0A 4IWNA 4X8LA 1DCMA 3LC2O 2OM2A 3QF7A 4L3OA 2J9RA 3H2YA 4MPDA 1ESZA 1C0PA 3MLBA 4OHOA 3R20A 5F5LA 5I9LA 1HT2E 3LVRE 5L3QB 2IE8A 1YZLA 3QMPA 1MG0A 1RYMA 2I4NA 2VDPB 1GG9A 1O6FA 1VSTA 4ABYA 2JCXA 4ZT7A 4KI0A 5B4TA 4LVNA 5I8WA 4YDHB 1RWKA 1HQCA 2JAQA 3HCDA 2DECA 1CYEA 3PTLA 1JILA 3TLJA 3K09C 1AKRA 2OCLA 1DTEA 3C3EA 4IJ5A 5LDGA 1ZRNA 1HE3A 3JWIA 1O2DA 3JYNA 4MX8A 1B14A 4E4TA 2QGZA 1JSCA 3W78A 1KKUA 2ADOA 2AZTA 3TLKA 3WB9A 4AJIA 4D9KA 4EO4A 2AOTB 2OGZA 3D5TA 4IIHA 4IS2A 4OBEA 3WC4A 3FWHA 1UXOA 5IZCA 1XHFA 4ZDIA 3I04A 3RRZA 3S2FA 3SOZA 2OYSA 1QB7A 2VJMA 1WUKS 4JEUA 3MJCA 2CD9A 1X7YA 2PKQP 3F71A 4GI5A 1ADFA 3UKDA 4FMDB 2YXDA 4BGDA 3EAFA 3ZW7A 2NTJA 3RABA 1XKXA 2YJGA 5ALGA 5ALXA 1N3IA 2CNKA 3W7VA 5BWCA 3SVLA 2AQ8A 3EVGA 3U4GA 1JQBA 1MR3F 2C7QA 1W34A 3ZJ4A 4A8JB 3BB3A 2LDXA 4OFZA 3RLFA 5E1BA 3E9CA 5EC8A 3AF5A 2WK1A 4D8UA 1VZ2A 5IHPA 4Z9BA 2LIPA 1C2TA 3T3DA 2R7MA 2VO1A 1C0KA 2FPMA 3QU5A 2W98A 4P3NA 4EW1A 1BVUA 1U8UA 4JL5A 1VTKA 3BXGA 5B1HA 2VBFA 4UHEA 4WESA 3QEKA 4ZIRA 1D0SA 4PYQA 2O0JA 2H17A 3G2LA 2XDQA 5E2AA 3LKBA 2QQFA 4WKPA 4AZWA 5BV2P 3PHGA 1PGOA 5HJ5A 1KVTA 3FVVA 3OWHA 1UPAA 1EFTA 5DGIA 1HX7A 4B7CA 1TVKB 5HR5A 2EKQA 1EM8B 4LWPA 1TM5E 4NOLA 4OTZA 4UAGA 4Y1RA 1KK2A 4F12A 3ADBA 3MUNA 2H11A 2VF7A 5AO9A 4M0MA 1GA4A 3NIBA 4DG5A 1STOA 1WB9A 2A9RA 3I2KA 3G13A 4XQ9A 5F51A 4D4KA 3TFQA 1I4LD 1U2PA 4IXMA 4P4SA 4KO4S 4D5EA 5JIBA 3PEEA 1DG3A 3HVIA 3LUBA 4HI0E 3FDFA 2CLFB 5DM0A 4UU1A 3ETNA 2D7JA 4IZHA 2AN9A 4HUQA 1H9BA 3PD0A 5BNFA 3GFGA 4PZZA 2RGUA 2VAPA 4E03A 1HLFA 1NW4A 1UDBA 2R47A 2IGBA 5ALVA 1FXSA 3V8RA 2IUYA 1KOGA 3UW1A 4ENTA 3T1VA 3U4AA 3UFBA 9ATCA 1XU9A 1P0QA 1X15A 1NMYA 2VRWA 1Y1LA 4GICA 1ESDA 3VGJA 1JG1A 3R24A 3TTVA 1Z7EA 2CL0X 3ZE8A 2O8CB 3S2IA 1JJFA 1ZUHA 1EAMA 4X8HA 2NU8B 2OXCA 1KK0A 2DM6A 3V1UA 1N6KA 4JEMA 3PI7A 1V37A 1K6MA 4HTAA 1P45A 2WILA 1XDZA 3GRUA 3R23A 1BJRE 2HQSA 3HBJA 1QS0B 5CBPB 1GPJA 4G9GA 3AR7A 4TKVA 4NL4H 4UFOA 3USES 1NWCA 1IATA 3K2QA 1OXTA 1YQXA 3CURA 1UBOS 3ACDA 1K68A 2DPGA 1IPFA 1X19A 3KLOA 1FLVA 1ISHA 2AOWA 3OA2A 4G5RA 2IUEA 2J9ZB 3JQEA 1PE0A 1PKEA 3ZHZA 4MDEA 1V9LA 4Q1FA 4RY2A 2ZYIA 1I2CA 2G08A 1E5TA 1BXRB 4R2MA 4NS1A 1ULUA 3DZIA 1VE5A 1E9SA 3ESDA 2EC5A 4FHFA 2YXNA 4JVOA 3EOBI 2QW8A 2QLTA 1TJ3A 1CF9A 1QH1A 2P68A 4TTVA 4CKBA 2CNWA 2WWXA 2RI1A 2GD1O 3D0QA 3H2KA 4DQLA 5JS6A 5JY1A 1ZG3A 2GAAA 3BWMA 5FOSA 3TRHA 2O6LA 5KSWB 3IVRA 5LIRA 1RJDA 1YR7A 3GLHE 3MT9A 3HJCA 4L2IB 5KHOC 4MAAA 4DIEA 3BM5A 4OHYA 4M98A 3E81A 2KJQA 3PA8A 3WNQA 2R5FA 3ZTYA 2EERA 2X3YA 3N8GA 2GNOA 1OU4A 5JSYA 3GT7A 3K6JA 2H92A 4N3BA 2XXAA 4P54A 1RWVA 1NLMA 4NBLA 2PGAA 3TZEA 4KWEA 4FW9A 1ORHA 2ODAA 4BMOB 1N6HA 3LAWA 2IX9A 1XK7A 3R5JA 2JIPA 3NIDB 2FF7A 2J3DA 3Q98A 5C4IA 2X5JO 3HCEA 3PXCX 4CJXA 3K9FC 1QGED 2I2AA 1H5QA 3GFRA 2DRIA 5ILOA 4MRMB 1JJAA 3I9FA 4YRDA 2FMTA 1KTVA 2V7XA 4XWWA 1HOXA 2LUOA 4WRRA 5FNVB 3RFCA 5B3KA 1IG3A 4ROTA 3B8HA 4KQWA 4R81A 4TTSA 5I9SA 1T6NA 5HZMA 2XZPA 4FZ3A 4BN4A 4LS3A 3I4LA 3C15C 1RE1A 4P3XA 1DOZA 1I5RA 3ORHA 5IC5A 5B6IA 4X6YA 1OIWA 3FBGA 4BGIA 3A4LA 3KT3A 1Q50A 1N4AA 1J4AA 2I2DA 1FRZA 4IICA 1IFXA 5C1IA 5BQ5A 3U0BA 1O0SA 3V7YA 4PGAA 2PANA 3WGYA 3LX6A 3O9MA 2F43B 4C9BA 5ENDA 8ATCA 5JAHA 5FI1B 4A03A 4NCNA 5EFZA 3FMGA 4X90A 2VJYA 3F2IA 1GO2A 3IAM6 5LVAA 3H2IA 1AUOA 5EYPA 2PSJA 4RPLA 2EJVA 3A36A 1Z5ZA 4LV8B 4RVGA 4CHGA 1ENYA 1ZI8A 3FGNA 2EV9A 3CNQS 2GOYA 3EEOA 4UQLA 1PT9A 3OLWA 3T3HA 2RHCA 3M3HA 1A7UA 2HHCA 4WUVA 4LDZA 3U6BA 4EKGA 1U0LA 4Q3EA 3NFYA 2JK0A 4HXEB 3N70A 2MCFA 1KDVA 2GAFA 4CMHA 5IYZB 4PGGA 4H2DA 4J43A 4ZOQI 1O54A 3FI0A 1AQ6A 2WMOB 2ACVA 3QYJA 3B1ZA 3UYLA 1YVDA 3N53A 4A6EA 4E5MA 5P8WA 4OM8A 4P33A 5FV7A 3BJEA 4IDHA 3DTVD 4LKOA 4MUYA 3TOXA 4DMHA 4DSAA 3LIPA 3LPMA 4D4GA 3TW0A 3TUZC 5DLEA 3ZXXA 4BWFB 2ZUWA 3LHSA 3UG6A 4ZYYA 3KLMX 2ZTHA 4GLOA 2VXYA 4HD8A 3SXJA 1J2EA 3FWZA 3ADCA 2AK2A 3QFRA 3JVDA 1HFEL 1XVLA 1N75A 2RK3A 3GH3A 1I5OA 1ECGA 2DT8A 2GR9A 3A28A 3QXGA 1PX2A 4IJ6A 4L8LA 3KKMA 1YS2X 3U3XA 2PSHA 5LOVB 1NXXA 3RRJA 2HA0A 2Q6KA 4FCCA 3LT4A 3H3JA 3RS8A 3QKIA 2QT1A 3FVRA 3W04A 2AC4A 2JEZA 3DFFA 4HR7A 4WY8A 4XVQA 1KC3A 5AK6A 4I14A 2IDKA 4BIMA 2AEJA 1L5ZA 5G1OA 4PONA 4DTCA 3BA6A 2NXWA 3UJ3X 4FSXA 1TYCA 2W93A 3DR3A 3KVOA 2ZUDA 4DYDA 3AF0A 3CPSA 4OF4A 3GGPA 4QJBA 1KGSA 3DOJA 1XXHE 4QAQA 3QFHA 4NAHA 4R69A 5FUWA 5I9BA 1ZOLA 1AN9A 2PL1A 4ARVA 1DAIA 3O8OB 4TYMA 3U40A 1GU1A 4PLHA 3W9BA 4GMXA 5BSTA 4NY1A 1WLYA 1N2CB 3MUOA 5AXBA 3C7KA 3W4KA 3CF4G 2C2YA 4YQFA 3KAQA 1D0IA 1GPKA 2R5NA 2RC6A 1I7LA 4INOA 5CB6A 3BCUA 3GDGA 2XGMA 4X60A 2YYZA 3NBUA 2JRLA 5IBCA 3MTQA 4B47A 2AZXA 2H1OA 4PRYA 4M1MA 5J5CA 3SDSA 2QZPA 3EA4A 1BN6A 1SBHA 4ZEVA 4D3FA 2C1ZA 1WP9A 3L1JA 2WJIA 1AUVA 2QQGA 5A5VA 3ESZA 5KTSA 1ZR4A 1T9DA 4RHXA 4TTTS 2XB8A 1JKJB 2J6BA 4PC3A 4V2UA 3A1VA 5MFPA 4MAMA 2WKQA 1IL0A 3JD3A 3A3KA 4MKRA 1G0NA 1UM8A 4QUAA 1MNAA 5LC1A 5IVKA 1CUJA 2OOSA 3VYRB 4BKPA 3KUXA 1O58A 4KSBA 1CUGA 3F78A 1LLCA 3MTDA 4WZBE 3WFIA 4MUIA 3F47A 2SHKA 1U80A 1DZ3A 3KQSA 4LRUA 5L9AA 1ZQ1A 2ZJ7A 3IBTA 2WKRA 1U6KA 3L7MA 4H7IA 1ADJA 1ZLYA 4A5OA 2FZ4A 3TOZA 1LS6A 3RIGA 2D1YA 4L4RA 5DCUA 2V7EA 1N5OX 1CS0B 3DE2X 5FPPA 3DE6X 4OP1A 1I3KA 2V7GA 3QPDA 1EWVA 2ODEA 3A9WA 3WMFA 1OBVA 2E82A 2PGDA 1P4JA 2XMCA 3CUSA 1JHYA 2CB0A 3GNLA 3JQBC 3KEQA 4TLDA 3AEUA 3UJCA 1ZMTA 5AK5A 1ZN9A 2QY6A 4CG0A 1YI1A 1EFVA 5HKLA 3AZPA 1WW3A 1I80A 4IIBA 2D1FA 2ODQA 3U7EB 2FEWB 4DSZA 2AW3A 1II8B 1MJHA 2GYUA 4LTMA 5DGXA 4MYHA 5INTA 4QGFA 1FNDA 5T8KC 3BXXA 4QPNA 1WSAA 1V8BA 4ALJA 3LTNC 3H05A 1CR0A 5TVGA 3COPA 3UWSA 2YJ5A 2JGMA 2IEDA 3E8MA 2AMYA 2J7PD 1WDKA 1LJUA 3DMGA 3TKAA 2Y4NA 1IY1A 1XRJA 2IL1A 2WT9A 4C78A 4DRZA 5JH7A 1W0KD 2HXSA 3PWTA 1NXTA 2V7TA 2O8DA 4BNUA 3GQBA 2PZMA 3UQZA 4YAEA 4O4HF 4EG6A 2JJ2A 5DGDA 3K6RA 4OOFA 2YIJA 3FPJA 4OHVA 3S8MA 5J58A 1HGXA 1H9AA 5E7MA 3EVZA 5C8YB 4ESHA 2BFDA 3HJFA 4KREA 3GJYA 3E3LA 3I52A 3LQ4A 5GV8A 2ZQZA 1A9XB 1VJDA 3ZWYA 4FOTA 2QQ0A 3GH1A 3PXEA 2XZOA 2EJUA 3CWCA 1XOIA 3EZNA 1WMBA 3OWOA 2QRZA 1EB8A 3EVTA 5DLQC 1Q21A 2AHOA 1BE0A 1P72A 1UFKA 3ANTA 3QG5A 2PT9A 4TWJA 1D4OA 4IIYA 5HJ7A 1QX3A 1WQ4A 2X40A 1VL8A 2IS2A 2JHFA 2YYAA 1OCEA 2V6JA 1H3EA 1EVJA 4GYWA 1SCQA 3WADA 3PUVA 5A3SA 4XQCA 3F2VA 3CU5A 3IA7A 2QROA 3NKLA 3DVQX 4R2HA 5EERA 4HVAA 5DSZA 3N2KA 3RSFA 1WG8A 1C1YA 4QXOA 4BP9A 3GD5A 1QCYA 4HMOA 1E7QA 2JKZA 1DPFA 2OTCA 1NW9B 1UBEA 3E9NA 2FSGA 2O05A 3R1IA 4C6SA 4F93B 1DKUA 2FG5A 4QAJA 3SYLA 4DJEC 3WKBA 1XYYA 2JBWA 2PV7A 1IHDA 3IUEA 4QFMA 3L7YA 3KM0A 1T15A 2M9MA 3Q4GA 3C45A 5EINA 1XFAA 3S55A 2BBOA 4FZ5A 2PT6A 4BGUA 4AZTA 4DR3B 1MKYA 3BZBA 1VHWA 3CIOA 3C8UA 2I8LA 3R7NA 3M1IA 2SKEA 2QDKA 2HEGA 3EBPA 5LDDC 2DQSA 5ICFA 2VQ6A 3M81A 2YHBA 3UICA 2CCGA 4CM1A 3VU9A 5C7LO 1ZCZA 1GPBA 1J39A 1PT6A 2GF9A 3ES9A 4UMFA 5DDIP 3KQKA 1P5RA 1U3CA 1Z39A 1FSZA 4DSUA 1KEEB 1XYVA 1YQQA 4YXFA 1UL1X 2IP1A 3GDWA 2GHRA 4JVLA 3HL0A 1B2LA 2E0IA 3INYA 3SI7A 2HJHA 3GJRA 2AF4C 4H7EA 2ECFA 3EF0A 4IMRA 3A2MA 4YUWA 4NTZA 3L93A 1FP1D 3ZGNA 5B1DA 3R3HA 3UMMA 4MLDA 2R7KA 4UE6A 1QGZA 1Z29A 3GFOA 4PVCA 1RWWA 1J97A 1VECA 4I46A 4G0MA 4L4XA 1U6JA 4CM3A 4BAZA 4F1KA 4YPFA 4F5YA 1QONA 1W29A 1L5OA 2R97A 3VRHA 3JTMA 4M0DA 5B2EA 3H6HA 1YULA 4D6XA 5JHHB 4P3YA 1RIIA 3PLNA 5CH8A 4WIAA 5LUBA 3A9RA 4TLAA 3T94A 4IXTA 3QNMA 4Y2YA 1DNPA 2ATVA 2EQBA 4KGDA 4EW2A 1U0TA 3DDWA 3HYSA 2B7CA 1VB5A 2Q0HA 2BZ1A 3GMSA 4ND6A 5E7IA 4E4RA 5LNK6 3N0WA 4DLSA 4A2QA 5KS2A 1L6IA 2AEEA 1BJKA 3AFMA 3QJGA 4BNHA 2CL5A 1NQ5A 1JKXA 2WICA 1NP7A 4D79A 4IHJB 5AUPB 1J9EA 2D2FA 1JU9A 3DT6A 4WOCA 5F4BA 2ZSBA 5KJEA 1MX5A 2PMDA 4N03A 3QLUA 2EL7A 4OUDA 3L46A 5EE5B 5CT4A 1HNXB 2E89A 5FI3A 2Q45A 4XFJA 5SY6A 1M7HA 3QKWA 1VRVA 3DLAA 3W5BA 3ANXA 4LJ7A 4H7HA 2YS6A 3ISJA 3LF2A 2E7ZA 4H3VA 3ZH9B 4N9WA 4ZTUB 5EXSA 2CV1A 2Z3VA 4YN3A 3Q3GE 1GQ2A 4O0LA 3SR3A 2Z8YM 3KR1A 4OGGA 2ZWVA 3ICEA 2OXRA 1KYQA 3NHRA 3IHWA 2A5YB 3Q7SA 4MZDA 4U3JA 3UWPA 3CVJA 3F8SA 3UEOA 1FNCA 5KAMA 2OCDA 5J2TF 4BLQA 1V95A 3IIIA 2CXQA 4XAQA 4QBHA 4F91B 1GZ5A 1R6DA 3LW8A 2D1TA 3QE2A 4DYHA 1A2BA 1JU3A 1ZWKA 3CUVA 3EGCA 3IOEA 5KTRA 3LLVA 2VDVE 5T64A 3OCUA 4DANA 1T8TA 4D9IA 4DIDA 221PA 3ADOA 3WL6A 4DA7A 2C3PA 4OLBA 3PEYA 4KHPB 2ODTX 3HCFA 1JQDA 3KZNA 3PL1A 5K51A 1SFRA 3M2PA 4I08A 4LDPA 1EEHA 3N6VA 4IQ4A 3GROA 3RYFB 4A16A 3M83A 1VKJA 1XZBA 2HNKA 1X7GA 2WF9A 1OF1A 3PDCA 2BCGY 2J0UB 3QHAA 4RD3A 3WBJA 4U2DA 5L3RA 4A9AA 1KO1A 3EXG1 4F38A 3EVEA 4IDNA 1KIMA 1EFHA 2H63A 3KSMA 4IRUB 1XPOA 5DEOA 3S5UA 3OZIA 2X8JA 1LW6E 1OROA 3F8WA 4J03A 3FKSA 1VE6A 2HZBA 3WWCA 1JXQA 3HN6A 1E1LA 4PRKA 4FMPA 5FWAA 2A4MA 5TPZA 3SX2A 3N8NA 4JL8A 2A92A 2VAXA 1OA0A 4HAUA 2CVQA 4MEJA 2D7DA 4DNQA 5HE9A 1I4DD 4LZLA 4ZAVA 5CM9C 2A88A 1XKQA 4EJFA 2XB2A 4JOCA 1W73A 3HV2A 1T3TA 3IT3A 4JITA 4UNPA 1MO3A 1KYWA 4XUDA 4EB3A 3OFND 6REQB 2IYRA 1X7DA 4EATA 2YY5A 3ROPA 4OP3A 3N6RA 4XH9B 3U13A 1T25A 4JKYA 4DREA 3RR2A 5A4FS 3NGXA 2V0CA 5GINE 5A6SB 4ZGBA 3M6IA 2D2XA 1IC6A 3LHKA 3F90A 3TK1A 1NN5A 1V1RA 3A27A 1PR3A 3AFOA 4HDSB 2OLEA 3ORSA 2BKXA 3VYSB 5KJFA 2D4HA 4R8KA 2C9MA 1I2AA 4RA9A 4UTOA 3U3JA 1GQYA 4OGLA 3WGHA 5REQA 4NESA 4JUDX 1TA4A 4GZ6A 4Y9TA 4YQZA 4CU5A 2JS7A 2ZLBA 2J1LA 1XRSB 4KO1S 4BB6A 3LOPA 2HGZA 3RODA 4EPWA 5EXXA 1GN9A 2FEPA 2WWWA 2ZCJA 3ZGZA 3D8UA 2Q4RA 3AOEC 4NNPA 4DMUB 3IJ5A 3QLEA 3KVRA 3ZE6A 3HDTA 2VCEA 4R9UC 1LKZA 1NUQA 4JI8B 4YCJA 3DBRA 2DBZA 1HSZA 2POCA 3K15A 4TZKA 4D81A 1Q74A 1V5WA 2PBLA 4NHOA 4DCJA 5AXAA 4D45A 2RHHA 2OWEA 4O2AB 4PGHA 3IP8A 3CLHA 3WMWA 3L0DA 4LC0A 3CIFA 2Y1KA 5FA5A 3KZOA 1CBUA 4IQ0A 4XPIA 3HXOA 5F9HA 1CEYA 5DHTA 2EYUA 1WSWA 1ODFA 3BB4A 3N86A 3ZZTA 1ULBA 4QATA 3U0VA 2ZIWB 2KW5A 3I2YX 4XD7D 4MGHA 1GY8A 3H9BA 2C5SA 1G6OA 2PR2A 4CTJA 3AX6A 4NXNB 3EXAA 1CNFA 1YS6A 2QD1A 2H4XA 1SPBS 3C3CA 2CFCA 2C9YA 3MZ0A 4V39A 3UN1A 4Q7LA 3I5XA 1TJ4A 1NUSA 4IHQA 3T7TA 4BKQA 1NJFA 2PUHA 3TQFA 3RQIA 3AV3A 1JDPA 4YECA 3HY6A 1GVNB 3THWA 2HF8A 1ZJ4A 1J7JA 1J8QA 1JJBA 2IITA 3RTGA 4FDUA 4DCSA 2D0PB 4WY5A 1N25A 2HUNA 3WA6A 2HZ7A 3OY7A 4NAUA 5TPWA 4FB5A 2A35A 3C85A 4A1OA 2GH1A 5LZ5A 3RT9A 5J2TA 5FUQA 2CHQA 3VU3A 3QTTA 4LWZA 3ZHSA 2R8YA 2ZG6A 3QY9A 3PWZA 2IE0A 1F06A 4DMLA 3RVSA 1OWNA 4FXOA 2ZWPA 4LE0A 5L7YA 2IS6A 2BJHA 2VKTA 1NZJA 1UZMA 1HQYE 3BMQB 3ABIA 5I5GA 4YRTA 4Q18A 3PX2A 5C5IA 3USZA 2HSZA 3BXPA 3FNEA 4UHJA 3TRIA 3T06B 5AW4A 1OXBB 2WD9A 3PG5A 3R7AA 5D7NA 4RAQA 4K26A 4P3PA 1QRDA 4OV6B 4X61A 3C4JA 3TL3A 3F9IA 2VHJA 3I9KA 1PNTA 2A5FA 2NV6A 2W2QA 4G1MB 4ESOA 2W6IA 1N8TA 2RARA 4DLUA 4C0AC 2DX7A 3K32A 4U39A 1WBJB 2HMVA 2MTBA 3OZAA 3H1AA 2BE9A 2HX1A 3WDKA 4E3WA 1ZM4A 4KR9A 2ZZMA 2PT7A 1PR6A 2AZ4A 2QVCA 4C43A 4H6VA 4TLBA 2MYTA 4J2HA 5HQTA 1EQ2A 1JYEA 1ZH6A 1TT5A 1HE8B 4JI5B 5J5AA 2XNJA 3BSYA 1DHTA 3L1HA 2HSGA 2O1XA 3PR2B 4KUGA 1RYHA 3LUAA 4OSPA 4BQFA 3GFQA 4ARAA 2C42A 2W6ZA 3BULA 3P2KA 1R0CA 1XDWA 1H1LA 1RJEA 2OCAA 4MLZA 4WXHA 4BZZA 4EX7A 1MZPA 2OPBA 1P7ZA 3CX8A 3MTGA 4WECA 1TQ2A 1GILA 1YR9A 5DP2A 3ZHBA 3ZCPA 2XMDA 3KQNA 2ZIUB 5YASA 2JGLA 3GUHA 2M98A 1XRNA 1LNQA 2PK3A 3DDNA 2DKNA 1M7BA 3N8KA 3RT1A 5JD5A 3KKNA 4PIVA 1QC5A 1NJSA 5EP2A 1A1VA 3KOXA 4ZRDA 3SSMA 1N77A 3Q8WA 5JEEA 2A9JA 2OO5C 3VR5D 3URKA 4PINA 1IJBA 5DNUA 4RPGA 2DR3A 1T1GA 1QYWA 5JQGB 3EIWA 4Y2UA 2WQ6A 3DOCA 5C1OA 2Y1CA 2XF8A 3OZSA 2J85A 4R8RA 3QX3A 2GYVA 1YZTA 3IKMB 4XUEA 2KHZA 3TRFA 1TA9A 1NDHA 4E6EA 4DMRA 5ICMA 1SUEA 4ZRMA 2RGWA 3KAPA 5A5DA 2XYGA 3T3NA 2AE1A 2OAP1 2IGTA 1S7CA 2FPIB 3PKZA 2ZT8A 4C1BA 2UZ3A 4MR8B 1XVAA 3FOAA 4B3DA 1YK1A 4BO0A 3DFKA 5I01A 2RFLA 4GE0A 4BP8A 5BWMA 2PLAA 2CDNA 2OV4A 4O29A 1THZA 1P1JA 3AFNA 2SECE 4M0UA 4R83A 3U4QB 2XMGA 1EVKA 1K8YB 2RCNA 4RL4A 1UODA 3BAFA 1P74A 5T4HA 3HVHA 2OEPA 4LSGA 1O6BA 2YHSA 4WXMA 2G17A 3TR5A