3TZKA

Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg)(g92a) from vibrio cholerae
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
247
structure length
247
Chain Sequence
SQFMNLEGKVALVTGASRGIGKAIAELLAERGAKVIGTATSESGAQAISDYLGDNGKGMALNVTNPESIEAVLKAITDEFGGVDILVNNAAITRDNLLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVGSVVGTMGNAGQANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMTKALNDEQRTATLAQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMYMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-[acyl-carrier protein] reductase
publication title Dissecting the Structural Elements for the Activation of beta-Ketoacyl-(Acyl Carrier Protein) Reductase from Vibrio cholerae.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Oxidoreductase
total genus 92
structure length 247
sequence length 247
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2011-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3tzkA00
4WUVA 1T2FA 4FFNA 1KVTA 3U5TA 1MC5A 2W2KB 3ABIA 3GC6A 3L4BC 5JYEA 1P74A 2O3RA 4W82A 3RFXA 3TFQA 1E92A 2C5AA 1U7TA 1GTMA 5JDIC 3NTOA 2WD7B 3E5RA 2PFGA 1C1XA 2P68A 3IP1A 3ZNOA 4BO0A 1EDOA 4BGIA 1C0PA 1IB6A 4GWKA 1IZ9A 2EJVA 5L7YA 1H9BA 2G1UA 4Z3KA 2DBRA 4M89A 3VZQA 4B7CA 3VH4A 2GUGA 2VN8A 4A0SA 1YBAA 4BGEA 4R1NA 5EIOA 1N9GB 2E48A 2JJYA 4YB8A 1U4SA 4RPLA 2PGJA 2NV6A 3ZWCA 1H93A 1JWAB 2O3JA 3N58A 1QV6A 5CDGA 2EP7A 2Q46A 4XWYA 4CUKA 4CV1A 1VE9A 1UDCA 1N1GA 2Q45A 2HMTA 1M67A 7ADHA 2JAHA 4R1UA 2C2XA 1BXGB 3PVZA 5KVCA 3W4JA 4WJZA 1I8TA 1LDBA 1N7HA 3JCZA 3CINA 3OEWA 5G0UA 4BO6A 4JXKA 2CD9A 3A06A 3LLVA 4E2ZA 1Q0HA 3ASUA 3KLPX 1XU7A 1YGYA 2JD1A 4UVIA 4ZQBA 4INAA 1JAYA 2TMGA 4R68A 1ZSVA 1QORA 4GL4A 4GVXA 2FPGA 3GGOA 5T64A 5I7SA 4Q3DA 2GD1O 3WMWA 4CV2A 4NBTA 3PZRA 1GY8A 3VH3A 4CM8A 5KWEA 4E0BA 3KOUA 5H81A 3OQBA 1HYHA 1YXMA 2UDPA 1T2AA 3V2GA 1O6ZA 1G1AA 4CM9A 4G5HA 4LVUA 1GYRA 4PLPA 1SEPA 4WCFA 3WGYA 3I23A 3RU9A 1KEUA 4K6FA 2VHYA 4HADA 1Y6JA 1PL6A 4L74A 2Q2VA 1YJ8A 3LSYA 5DNAA 1FK8A 4CM4B 3ZV3A 1EBFA 4PLVA 3SC6A 2QHXA 4U6SA 4BKPA 4L73A 5AXCA 1GCOA 1PL8A 4FSHA 4A26A 1Z7EA 1IHXA 2J5QA 4DVJA 4J0FA 1VSUA 1IZ0A 3EVTA 3U09A 1P9LA 3WMXA 4EZBA 4FJ2A 1JW9B 5T5QA 5AOVA 2D3TA 2RIRA 1VL0A 4PVDA 1ZFNA 2EKQA 1OBFO 1VI2A 1P31A 1A9YA 3BXXA 5F21A 5C7OO 8LDHA 5JMWA 1DO8A 4BKRA 3H3JA 1W73A 3HDJA 1I33A 1UZMA 3GEMA 2B37A 5HRUA 3ZWPA 1DAOA 1QP8A 4QFCA 3W6ZA 3A9WA 4IQGA 2AG8A 4CQMD 5A9SA 1M75A 3LVFO 4FCCA 5CDTA 1V35A 4RPHA 3A14A 4UAGA 2VOJA 4RF4A 1UZLA 2IEDA 3MOIA 3BMOA 1BGVA 4S1VA 2GR9A 4TZKA 2P9CA 4R1TA 4JK3A 4RPJA 3I3OA 3LQFA 1NPYA 4PN3A 1ZEJA 1PS8A 3OIGA 5KJ6A 2B69A 2BI7A 4WGGA 1PJQA 5AXDA 2GYYA 2EIHA 2NSDA 1KEVA 1HE4A 1VKOA 4GLOA 5HA5A 2OO5A 3VVCA 2OZPA 1HDOA 1FDSA 2UV8A 3PJFA 4HFRA 3HDQA 3G79A 4BB5A 1NAHA 2EKPA 1D8AA 5JDCA 2HAEA 4QX6A 4BO3A 4YR9A 5B4UA 1SAYA 3WFIA 4E5NA 1Y8RA 1V3VA 2Q1TA 2VRBA 1DJNA 5FYDA 3DOOA 5GY7A 2EG9A 1E6EA 3KYDA 2Y66A 4NFHA 4BO2A 3FNFA 4WOJA 5G4KA 1F06A 4PLCA 3INTA 3IQDB 2JD2A 1YOVB 4IXWA 1PIWA 4G65A 4ITUA 4CLOA 2HJRA 1J49A 2J3JA 2OMEA 2HKIA 1DJQA 5CAEA 2FWMX 1BXKA 1T2CA 4JBIA 4B8WA 3G0OA 2C82A 4IY1A 4BNJA 4J49A 1OC2A 4XKJA 2PD6A 2VHWA 3WSWA 3CTMA 1SZJG 3K31A 5ITWA 4NU6A 3GF4A 1I0ZA 5DF1A 5BSHA 2Z5LA 1HDRA 2ZCUA 3DOJA 3ZWYA 4ND4A 4ZJUA 1I30A 4OYRA 3C24A 3A4VA 5I9LA 2P5YA 2VWQA 4CM3A 4A5OA 4URFA 1X0VA 2GLXA 1ZH8A 3LDHA 2X4GA 2C2YA 3F9IA 1U1IA 4WECA 4CM6A 4NBUA 2V6GA 3WXBA 3JQAD 2PR2A 1MA0A 3CUKA 1C1XB 4YJHA 4FN4A 4ZGWA 5G0VA 3U9LA 2EKLA 2PTGA 3PJGA 1CETA 4OL9A 1ZMTA 2V6FA 5DDIP 2DC1A 2VT2A 5F3RA 1H5QA 1ZK3A 4CMEC 3AY6A 4QO8A 3H65A 1Z45A 3H9UA 3ETDA 2H1SA 5L45A 2VNAA 1PX0A 4IGEA 3BHIA 3WOHA 2O7SA 1NQTA 1PZGA 4YT4A 1LSUA 4PGFA 3OQ6A 5I7EA 3FN4A 3ROKA 1UXKA 3AWDA 4E5YA 3KVOA 4TRNA 2V6MA 3JQFA 3JQBC 2VYNA 4XQEA 1ARZA 3GMDA 3B1JA 2QZZA 3X2FA 1I2ZA 3QWIA 5IF3A 1EDZA 1IUKA 2DTEA 2YFHA 1CDOA 4BVAA 3FRJA 1A9ZA 5IZCC 4WLOA 4BNYA 3AOEA 2BRUA 2J5KA 3H9EO 2WYVA 1RPNA 1VLLA 4OMUA 4QEDA 2ZB7A 1B3BA 1OAAA 4NNJA 1VL8A 4JP3A 3F47A 4BNGA 4I5FA 1TA4A 4Q9NA 4CM8B 2Q1UA 2IXBA 1E7WA 1I10A 1VPDA 3I1JA 4A03A 3BTUA 1E1KA 1NNUA 1HRDA 4YJDA 4EBFA 4ZHSA 4K26A 1GV0A 1DFGA 4JJIA 4WCFB 2VUSA 4BQPA 3TPCA 4JGBA 3OJFA 1ZKMA 5CDYA 1TT7A 4N7RA 2FR1A 1H6CA 2HO5A 3AU8A 4RLSA 1E3IA 4Z0TA 1U2GA 1HYGA 4QECA 4E21A 2PGLA 3HDYA 2WD8A 3RC7A 2AQKA 1PZHA 2B83A 1HDYA 1HYEA 3B1FA 3K5PA 4CMKA 3L0DA 3WGZA 4MP8A 2CF5A 3ZI0A 1M2WA 1UDAA 2EV9A 2X1HA 3GN1A 1CIVA 4DIFA 3WGHA 5KCZA 5ILGA 1WMBA 1X13A 1VRWA 1KY4A 3CMMA 4KWHA 4NZ9A 1QG6A 1VJTA 3B6ZA 1QYCA 3LC1O 2DUWA 3EW7A 3ZHBA 2Q50A 2VTDA 3QHAA 3CH6A 3LF2A 3NT5A 4PLWA 4II2A 4TWRA 4I8XA 1LC3A 3N74A 5A02A 2D5AA 1MC4A 1ZK1A 4L8VA 1I3NA 4YWJA 3FTPA 1P1JA 3DZBA 4PRLA 5EESA 2A4KA 2Y1OA 3QWAA 1Q0LA 2FPPA 5A9SB 3IMFA 3RASA 4KTVE 1OOEA 5DULA 4A10A 1NP3A 1ZK0A 5A9TA 5TF4A 3SLKA 3GRPA 3SJUA 3BMOB 4RF2A 3UN1A 3AM5A 1AGNA 4PRKA 4BO5A 2AMFA 3H6KA 3ZWVA 3KTDA 1ZK4A 3L6DA 4JROA 2Y1FA 4OKNA 1W6UA 4IGFA 3JV7A 4CR8A 2Z95A 3DONA 1NAIA 1MP0A 1LRLA 3GQVA 1MXFA 2XXJA 3QVXA 3S2GA 1ZBQA 1LDEA 3VZPA 4IZIA 3OBBA 4FW8A 4XYEA 2I5PO 3I5MA 3PI7A 4DYVA 1AHHA 1BMDA 3PP8A 1B8PA 4ALLA 1ADBA 1Y8RB 1GZ6A 1HDXA 3PZBA 4BB6A 4GMFA 4QTZA 1N7GA 1RYEA 1WAMA 1PGOA 4KUHA 4OQZA 1W0CA 4AJIA 5G4KB 5TLSA 2B36A 4XR9A 5ES3A 3PEFA 2W4QA 4CLOB 3PQFA 1E5LA 2VWHA 5EINA 1OC4A 5A03A 3DAFA 4YT5A 4HNGA 4K9DA 1MFZA 2JFFA 1XLTA 3L4BA 2V65A 4FJ0A 4W7HA 3GG9A 1AE1A 2G82A 3ITKA 5JDIA 1ADGA 1YB1A 4XEHA 3NT4A 4PG7A 2GNAA 3SC4A 1Y7TA 4YA6A 5ICMA 3KXDA 2QW8A 2CZCA 1Y5RA 4MVJI 4R9RA 2YV1A 4HX5A 3JQ8A 1I24A 3UCXA 2I67A 1BW9A 4Z6KA 2HJSA 4GX2A 4CMCA 1O5IA 1AXEA 4RPKA 3ZU2A 2OBYA 1PJ4A 2W2KA 3RQSA 2GCGA 4DUPA 1SPXA 1U3UA 4HWKA 5BSFA 3GAZA 3DZJA 2EHDA 1ONOA 2DAPA 2NVUA 5T67A 3QV1A 4BIIA 1KC1A 4IMRA 1PGNA 5JY6A 1J5PA 4YJGA 4ZQGA 2D5CA 2X0IA 1DC3A 5T8KC 3KYCA 5TX7A 4E5PA 1LDGA 1DFHA 1NPTO 4FBGA 2HRBA 1YRLA 3ZWMA 4ID9A 5EERA 4LW8A 1H6AA 2PKQP 4W99A 1GEEA 1UR5A 1WP4A 2HMUA 1DSSG 1DIAA 3UCFA 2XOXA 2X23A 3ZHZA 3PHHA 3HNPA 4ALMA 2WYWA 3CMCO 4ILKA 1O94A 3ZH2A 1JVSA 3PQEA 3V2UA 2VWGA 3NTQA 3WTCA 2Q49A 3JYLA 3PGJA 3QE3A 1EE2A 1Y8QA 1VJ0A 1EZ4A 2B5VA 2DKNA 1GEGA 3FWZA 4NU5A 5HTOA 1NVTA 1KVUA 4KTTE 4DMLA 3VPSA 4GH5A 3TZKA 1I36A 1T25A 1FDUA 4U8GA 2Q2WA 2QRJA 3KEQA 4WLNA 4Z3DA 4Z0PA 1P1KA 2AQ8A 4MVJE 3GDOA 1TB4A 2JFHA 3QJ5A 2A35A 4BNUA 3C7DB 4FIZA 4DMMA 2B5WA 3K2BA 4EITA 1M76A 1YH3A 1AN9A 3O9ZA 5L4NA 1YE3A 2PZLA 4BO7A 4M1QA 5B12A 1PU2A 2VTEA 2QX7A 4BNHA 5A06A 4DTIA 4FGSA 2Y99A 2E49A 4BL5A 1F14A 3GLQA 4CODB 2NVWA 3DQPA 2P9EA 3NGLA 1WNTA 4WPGA 1LC0A 2OL4A 3Q0EA 5G2OA 2NLOA 4YBZA 4O6VA 4D3SA 4HV4A 2PD4A 1ZSNA 3Q9UA 4CM5A 3FD8A 2HCTA 3ULKA 4ND5A 3H5AA 4IDEA 1PJSA 4U0JA 3ICCA 3DZFA 1B15A 1KVQA 3HSKA 4P4LA 3K6JA 3MJTA 1MXHA 4F3YA 3M2PA 1GYPA 5EL0A 4EW6A 3QSGA 1CF2O 5IXSA 4NQZA 2EXXA 4AJ1A 5A5EA 4YRDA 2PKQO 1KOLA 4K6CA 1MG5A 1GZ4A 1GAEO 1I3KA 1LSJA 2DPHA 1M66A 2X9VA 4XX0A 3ZWBA 3WICA 5IZ4A 3PHIA 4YAJA 1HETA 1YVEI 4UUMA 3NKLA 3LC7O 5DBIA 1K0UA 5CFZA 2EJWA 4GVLA 4BNIA 4D0SA 1LNQA 1ZXLA 2ZTMA 1MUUA 3MEQA 2VUUA 2GPTA 1GQ2A 5ADHA 5IN4A 4YT2A 5FI5A 2VHXA 3RBVA 5JO0A 4R3WA 4CMHA 5CG1A 2HMWA 1HDGO 4R16A 1ENYA 1NR7A 1E1NA 3VZRA 3W8EA 1ULUA 4BS9A 3EAGA 1YKFA 3GVCA 1LU9A 2RCYA 3ZV4A 1MLDA 2F1KA 3DR3A 3KBOA 4EJ0A 4I9UA 4CLDA 4BNTA 1X7DA 5L95A 2E6UX 1DC4A 5JAMA 4DQUA 1RJWA 2C20A 1ISJA 4OIMA 4P38A 5L7TA 4XJTA 4RQUA 5HBRA 1N5DA 4ZRMA 1NFFA 3FR8A 2Y1CA 3LLSA 2Y93A 1UXGA 2PKRA 2PNFA 3TZCA 4B4OA 2FR8A 3I9JA 1IHYA 3EUWA 2AG5A 2GO1A 3UH1A 1JU9A 1P0CA 2HSDA 2QZ9A 5FI3A 1ZCJA 1LLDA 2RHCA 4YPOA 1UP6A 2JKVA 4CPDA 2PZMA 1MX3A 2EWMA 5DP1A 4RO0A 4PG8A 4R4JA 3JQ8B 4E4YA 1BW9B 2G17A 2AEFA 1R37A 3TWOA 1YQDA 1ISHA 1EQ2A 1AHIA 3I52A 5TSDA 1GPDG 3FPLA 1XU9A 2R6JA 4CMEA 4WEQA 4CM7A 2DLDA 1PJBA 3QLJA 4TQGA 1V0JA 1T2DA 2DFVA 2ZCVA 1HEUA 3QA9A 4FDAA 1ENPA 1GADO 3I4CA 9LDTA 3GG2A 3H9GA 3K96A 4CR7A 3SX2A 3X2EA 5DT9A 3JYPA 2G5CA 4CV3A 1X7HA 2NVUB 3JQBA 2ZATA 4UEJA 4YJGB 1GU7A 3OHSX 4IDAA 4R69A 1EVYA 1N8KA 3KYCB 1QMGA 5H83A 1WDLA 4ROSA 3AUAA 5JPIA 5G0SA 4BMNA 5BNTA 3UICA 4EEXA 3IJPA 5IZCA 1TVEA 2IZZA 1E6WA 4LSWA 3VPHA 4BNFA 2CVQA 3HB5X 4DRYA 1T4DA 4LVCA 2DM6A 1V8BA 1FMCA 4QXMA 4TKLA 4UVHA 1EQUA 3DO5A 4O0LA 5DZSA 2ZTUA 2Y0EA 3MJ4A 1Y8QB 2ZYDA 3S2IA 1FDTA 9LDBA 2AE1A 3JTMA 2O4UX 3PIIA 1SBYA 3GAFA 5K6AC 3DB2A 3S1LA 5BNFA 2W2LA 3A1NA 4AJEA 2EEZA 1HT0A 3L9WA 1BVUA 3ASVA 3B70A 1FXSA 3HG7A 4XDZA 5JYDA 3AI2A 4BNVA 1SB9A 5TJ9A 4UEKA 1J4AA 2VZ8A 5JS6A 3AM4A 1U3VA 3ETGA 5T57A 5JAZA 1Q7GA 2R2GA 2GF2A 1YL6A 3KV3O 4XD2A 3TSCA 3FF4A 3WSVA 4FQ8A 1HE2A 1HLPA 1TT5A 2YUTA 3PLRA 5KJ1A 3I9LA 1BVRA 4JP2A 4PLTA 4PZDA 1PWXA 2D0IA 4MVJA 4TKMA 3ONEA 3U3XA 1GV1A 3H9QA 1R12A 2HMSA 2VQ3A 1NHWA 2Y1DA 4EJ6A 1DLJA 2OBNA 2BMAA 4J4TA 3LT0A 1IY8A 4TSKA 4XYMA 4OM8A 4ZVVA 3WNVA 4XZ3A 3UXYA 3VKUA 3FCOA 2BFAA 4KUEA 1W4ZA 3ZU5A 3LT1A 5I7FA 1GR0A 2NNLD 3GR6A 3JD1A 4X54A 3KYBA 2NTNA 4D3DA 4J7UA 3P2OA 3HZZA 2H63A 4K28A 1LRJA 3KETA 5L7WA 2DUUA 5JXWA 1KEWA 4YCAA 3ZWWA 4WNCA 3BTVA 1DFIA 4PIVA 2ZJ1A 3H2ZA 2JL1A 3ORFA 1I2CA 5IG2A 1O8CA 4NHEA 3AFMA 1U5CA 3G1TA 4MVJM 2GDZA 3N7UA 3RI3A 2P4HX 2O50A 4OSOA 3AJRA 1B16A 3NDJA 4M8SA 3ZU3A 3HFGA 1R4NA 3EZYA 4OKIA 4B4VA 5KVVA 3VPGA 3HADA 5MDHA 1T4BA 3AY7A 4BKQA 2D2IA 2I9PA 2Q4EA 2ZTVA 1DIBA 3RKRA 3ROQA 4DWVA 2NWQA 1CERA 1KEPA 2HDHA 3R3SA 4J2HA 3CIFA 5C7IO 1HE5A 2EERA 3OEYA 2G0TA 5I9NA 1NASA 1F0YA 1Q1NA 3GN2A 4XB1A 4EYEA 2H9IA 3ANLA 5DN9A 3RUIA 1XGKA 1JDJA 4OXKA 1K3TA 4H16A 3ONDA 4M54A 1WXDA 4IPTA 1NX6A 1ZZEA 4YQYA 1ZW1A 1ORRA 3T4EA 2QIOA 4ZQFA 3GHHA 4DPMA 2VHVA 1H6BA 2ZJ0A 4EUHA 3GVHA 3MTJA 4L76A 3GGPA 1I3MA 3QVSA 4XR4A 2CSUA 1TXGA 4LCEA 5A3VA 2IODA 2VT3A 3HDHA 4J9VA 1JLLA 1QYWA 4YQZA 3U62A 4FB5A 5IN5A 1Y5MA 1LQUA 4RDHA 3AY3A 5JO9A 1XIVA 5BT9A 2IYOA 4LRTB 1B8VA 3E9MA 4MVJH 1P1IA 3OECA 3DFUA 3DMTC 3BHMA 1PEDA 4KOAA 3AOGA 1PWZA 3R3JA 3K92A 3E03A 3KLMX 1DHRA 1T1RA 1XHLA 3FPCA 4BO9A 4TRMA 4J91A 4LMRA 1CQIA 3OA2A 1U7HA 5C7LO 4RQTA 4E30A 3C8MA 3UFXA 1UXIA 3E8XA 3I6QA 1E3SA 3NEPX 4W7IA 4BGVA 3U4DA 4DGSA 3P2YA 5T8KA 3DBHA 3FBTA 4DPKA 3F1KA 3WWZA 2NADA 3QVOA 2AXQA 1PS0A 3OQ1A 3ZW8A 5THKA 1V9LA 4BO8A 5L9AA 1E6UA 4IDGA 3WTBA 2WTBA 3HN7A 3BHJA 1JKFA 4ND1A 5F1OA 2YV2A 1DRVA 3K8ZA 1PQUA 4ND3A 4E31A 4MKXA 4PLFA 2QYTA 1N92A 2X0NA 3ZNQA 2QRKA 4I9HA 1Q7BA 4GGOA 4RVFA 1Z75A 1J6UA 2NACA 1KIFA 5HS6A 2UUOA 3ENKA 4JN6B 3E48A 2C59A 4MO2A 2HU2A 3DZIA 3WQSB 2FZEA 1ONNA 4P22A 4NDNE 4OGWA 1PR3A 3OM9A 1U5AA 3ZWAA 4IS2A 3JQ7A 4AJHA 2YDXA 1GCUA 2CNBA 3PDJA 2GERA 3UUWA 3GEGA 3OSUA 1N2SA 1PJ2A 2PK3A 1DPGA 1IPEA 4MIEA 5J23A 1ML3A 5FEUA 1T26A 2UVDA 3M2TA 4IDBA 3PJDA 1WZEA 4CM1A 1LBEA 2J5RA 3ZWOA 2UUPA 4F6LA 3M1AA 4XQ9A 1DOHA 2BELA 4YDRA 4HFNA 4MJLA 5BSEA 5TC4A 4BUCA 4NIMA 3JQGA 2CVZA 4N18A 1TT5B 2V6BA 3IJRA 1LSOA 4OHUA 1XQ1A 5ENDA 3OF2A 1L7DA 4F45A 1GDHA 4JCOA 5IXYA 4BOYA 1HLDA 3V8BA 2A92A 4CMJA 1NR1A 1P0FA 2E82A 1H2HA 1WW8A 1X14A 3INRA 3RUDA 1UXHA 4R41A 3PHGA 1KERA 2DVMA 4GQAA 2H5LA 4II3A 3D4PA 8ADHA 4OOEA 1D4FA 1YBMA 3OIFA 3RJ9A 4UVEA 2ZK7A 5G0TA 3L6EA 4J9UE 2AEMA 3Q2IA 1X1EA 1JKIA 2X5KO 3L4SO 4XIJA 3EYWA 3GVXA 3NT2A 1VM6A 2D8AA 3MJSA 5AXBA 2OP1A 2YYYA 1XELA 1EBUA 4JBGA 5TT1A 2PV7A 2X58A 3BMQA 3DTYA 1GZ3A 1EUCA 2Q3EA 2GN4A 3DHNA 2Y0CA 3KSZO 1K6IA 2IYPA 4DA9A 5GMOA 3NTRA 4H7PA 5FFFA 3K2EA 3MWDB 5L40A 4AJPA 5G0WA 3EHEA 3UVEA 5EN4A 4L0QA 3KRTA 4CL3A 1Y81A 4M87A 1CYDA 3RC2A 3CZRA 4DXHA 3E18A 3NAQA 1K5HA 3KUXA 3PYLA 4UUNA 1R4NB 2FHSA 2UAGA 1O89A 3D4OA 4UVGA 3JQEA 3LYLA 4E3ZA 2X7HA 4JNKA 1ZVMA 4B8ZA 4CQMA 1G0NA 2AW5A 3VC7A 2JHGA 3WDSA 3M1LA 1ADFA 4B79A 2W8ZA 3OIDA 2C7VA 2OP0A 1CRWG 1GFSA 1PJCA 3IUPA 4TVOA 5IFLA 4FPXA 1YL7A 2BGMA 2Y05A 1ZK2A 5AXAA 3ZHXA 3DZKA 4DC0A 1MG0A 4BNWA 1E5QA 1TI7A 3W4KA 1I2BA 3ETEA 3HUDA 3SVTA 3H5NA 4AJ4A 4L4RA 3Q6IA 4FFLA 3U0BA 4XCVA 3PRJA 1GUFA 1LLQA 3VHRA 3LZ6A 1CEQA 2DTXA 1R0SA 2FY8A 2VRCA 2NTJA 4AVYA 4B7XA 4YT8A 1P1RA 4FFMA 3KO8A 4NBWA 4ZRNA 3FNHA 1B3RA 2XPCA 3ONFA 3Q9NA 4HKTA 4LCJA 5IJZA 1XKQA 2Q2QA 5L51A 4DBVO 3D3EA 3FNGA 5KTKA 2B4QA 3HN2A 4DLBA 4IJWA 2PD3A 1P44A 1UH5A 1Z82A 2BGLA 1BG6A 3RCBA 2BFOA 4XQGA 5C5IA 3F5QA 1NYTA 2I76A 1QYXA 5I8ZA 2OOSA 4FJ1A 4RDIA 3WGQA 4CLHA 4CUJA 2DPGA 4Q3EA 4XIYA 1O95A 3JYNA 4MP3A 1DIRA 3PHLA 2O3UA 4OAQA 3DBHB 5L4LA 4BV9A 5KVSA 1QR6A 1PL7A 2C29D 2BFMA 1H9AA 5A4DA 4O59O 2LDXA 5A3JA 4UREA 4N54A 3UW3A 3CKYA 3ZV5A 2OUIA 3DZGA 1Q0QA 4FS3A 4ALIA 1DIHA 4IJKA 3VPXA 1E7MA 1KS9A 4J2OA 5CEEA 3AU9A 1S6YA 5DBGA 4CMBA 3GNSA 1I3LA 3ZW9A 2JHFA 1KYQA 1F8GA 1ZEMA 4BKUA 5JC8A 5B4TA 1YQGA 4DIBA 3JQAA 4A2CA 1UXJA 5F5LA 3DAPA 3C3XA 2Z1NA 3QP9A 4J7CA 5K6AA 3HE3A 3VAZA 5F5NA 4NR0A 1GQYA 2ET6A 2H6EA 2IDZA 3JD0A 1C3VA 1O9BA 3NX4A 4FFRA 4HY3A 4GWGA 3JQ7B 1PGJA 4Y67A 1U3TA 5JFOA 5F1PA 1V3UA 3IUSA 4KMSA 2DQ4A 5U9CA 1OI7A 3WGGA 3C1OA 3H8VA 2EP5A 3I9NA 2BFPA 2AA3A 2GRAA 3AUTA 1E3EA 1YB4A 2PGDA 3H7AA 3WB9A 4HBGA 3WWYA 2VYVA 4JIGA 4QO7A 2RAFA 1A27A 3IOYA 3D4NA 4I5EA 4DBZA 1IL0A 3G3EA 5DCYA 4QT0A 3RFTA 4E13A 2VNSA 4WLVA 3WGTA 4DQVA 1DAPA 1VKNA 1SC6A 3KSDO 2DTDA 3O8QA 4RCVA 1XA0A 2O23A 4XGIA 4XA8A 3GY0A 4WK6A 4D44A 4D46A 3I6IA 1QLHA 3LU1A 1H0KA 3JQGB 1KETA 4XRRA 4B3HA 4EJMA 5AQ1A 4D43A 3GT0A 2X86A 1ADCA 3KB6A 3RBZA 2DBQA 2FMUA 3TDKA 2AEJA 3DTTA 4AJNA 4W6ZA 2VHZA 4YJFA 2CF6A 3FSRA 4CM9D 2JCVA 1DLIA 4GPD1 4PLZA 4AJKA 4I08A 5FF9A 3WLEA 4MVJD 3UAGA 5I7VA 4G2NA 1FDWA 1GL3A 1HSOA 1K6JA 2E37A 2I99A 3COSA 4RORA 5B37A 4R5HA 3GDFA 1LDMA 3U4IA 2X0JA 3EGOA 1LDNA 3NDRA 1WDMA 3GNTA 1RM5A 2I3AA 3T4XA 3L07A 5CEFA 6ADHA 3QW2A 3BMQB 4AJLA 2FP4A 2BF7A 1DDOA 1NHGA 3W4IA 4DLAA 4IMPA 3SJ7A 4G81A 4O1MA 2WJPA 3AUUA 3CPSA 2QYSA 3CZMA 1DRWA 4IIUA 5TT0A 4QSMA 1JTVA 3ROPA 4CUZA 3UKOA 1HXHA 4UUOA 4E5MA 4F46A 3NJ4A 4J1NA 1EUDA 1T2EA 4TRRA 3UOGA 3MJEA 4ZICA 1NPDA 5CPFA 4MINA 4PZCA 4LGVA 1NVGA 2P91A 1E0DA 2FN7A 3LK7A 4RVDA 4WOKA 4E33A 4CLRA 1BDBA 4ZU3A 1ISGA 2QRLA 3VVBA 4CQMB 3WG9A 3EMKA 3DBVO 4A7PA 2C54A 1DRUA 3DBRA 1BTOA 1LXCA 3E5MA 3IAHA 4RVSA 1YDWA 4B3IA 1X7GA 2X8LA 1EVIA 2YY7A 3EY4A 3U4HA 5A04A 2FRDA 3K73O 4GKBA 4PG4A 3T7EA 3LC2O 3Q11A 5JW6A 1F12A 3VOSA 3QWFA 1Z6ZA 1DBVO 5KJFA 3PK0A 3C85A 4MKRA 3DHYA 4I5DA 3V1UA 1SNYA 1TLTA 3HHPA 4P4NA 2C07A 3DMTA 5HS4A 1M6WA 1E3JA 2B4TO 3OJEA 5ICSA 2AHRA 3GA0A 2P4QA 2CDAA 2HQ1A 3JYOA 1YBVA 2FSVA 4AJOA 1NQ5A 4WEOA 4WLFA 3HB4X 1EVZA 3BTOA 2C5EA 2NU9A 2WWRA 4GI2A 3WYEA 5TNXA 4IBOA 4P4GA 3D3WA 4TVBA 4GMGA 1A7KA 3ANMA 4HFJA 1RM3A 2ZB8A 5IDQA 4Z9FA 1T24A 2IZ1A 3QRWA 4YAEA 1YS4A 1Z74A 2W98A 2G76A 3S55A 3OJ0A 1PJ3A 1R0KA 3ZZNA 3OH8A 4QFDA 4IDCA 3F46A 5DCUA 4J4HA 1RM0A 3O38A 4XGNA 3WIDA 1LLCA 3VH1A 3ITDA 4BNKA 1B0AA 2BH9A 2PZJA 3AI3A 3G1UA 3IP3A 4YAGA 1DEHA 1L7EA 3RSHA 4FR5A 4EGFA 1A4IA 4Q3AA 2IXAA 4JQCA 4D3FA 5I9MA 1EEHA 5JAIA 3C7AA 4CMGA 3DOCA 1WWKA 3WYBA 1LLUA 2O2SA 5DOVA 1MGOA 2GSDA 1G6KA 4CLXA 4BGUA 4EUFA 5ITVA 4R5MA 3ZWXA 1P1HA 3JQAB 3DWFA 5JCJA 5KVQA 1KVRA 3I9OA 3OJOA 4XYGA 1HDCA 4J1SA 5K9ZA 3P7MA 5DBFA 2WYUA 4F6CA 1CWUA 5I8WA 4NFSA 2AE2A 4U5QA 1D1TA 4NG5A 4RVUA 1Y9EA 1Z73A 3O03A 3F6YA 2ZYAA 2FSSA 1SEVA 5A9RA 1C0LA 1CQJA 1S7CA 1SCUA 3INGA 3KZVA 1PJTA 2GN9A 5GZ1A 4N5NA 2CUKA 4O63O 1YWGO 2DU8A 5MGBA 2VYND 4BNZA 5BSGA 2Y67A 4W9NC 4RZHA 3D5TA 4KQXA 1L1FA 1CJCA 4NJOA 2Y1EA 1ZJZA 4FOOA 3O8QB 1E7RA 1DC5A 1PJLA 3IC5A 3OJLA 3WGOA 1DC6A 3UHAA 1XG5A 4IDFA 3F4LA 1BWSA 4ZA2A 1A5ZA 1HF3A 4B4UA 1UAYA 4LN1A 1GPJA 4GKVA 4L4SA 4NI5A 4C4OA 2XXBA 4IZHA 1ID1A 4A73A 4YJFB 1WZIA 2P9GA 3JQ9C 2C7GA 1YDEA 5KJEA 4J90A 3CE6A 5CEJA 3P5SA 4IDDA 4IXTA 4KP7A 1C1DA 1MV8A 5CPBA 1V3TA 4LK3A 2B0JA 4J1TA 3TOZA 1VL6A 4CLEA 3ST7A 5AYVA 4YAIA 1HE3A 1YL5A 2BD0A 2R00C 1LUAA 2VZ9A 1A7AA 4KUGA 4CMIA 3RAJA 1W8DA 4IQ8A 2YDYA 3GPDG 1BRMA 3RUAA 4LMPA 1WVGA 1SOWA 5TRTA 1NQOA 1UAGA 5EQDA 4TRJA 3PTZA 2ZQYA 3NGXA 4OOFA 3BMCB 3KHUA 1VSVA 4MIYA 5ER9A 3RU7A 3MJCA 2HK7A 3R6DA 1EFLA 5HM8A 2J3KA 2WDZA 4BMVA 1SO8A 4IJVA 4CQLB 5KJCA 3MJVA 2GZ2A 3WQQA 3GUYA 1HDZA 3L77A 3U49A 1R66A 1NFQA 3NYWA 2BGKA 1MFPA 1EFKA 3GZ4A 3I4FA 1XEAA 2EF1A 3QWBA 5GZ6A 3VDQA 3W8DA 2RH4A 4CLRB 1U8FO 2CVOA 3OFSA 1I5RA 2WMDA 3OICA 1H94A 3R0IA 5C37A 4D0RA 4GSKA 5CG2A 4EEZA 4NH4A 4E2YA 3DBRB 2GN8A 1O0SA 4J43A 3H4VA 4CJXA 4O5OA 2FR0A 3CXRA 2YJZA 3PFWO 4WLEA 5COAA 4R51A 3ENNA 2E4AA 4J7XA 4RVHA 3RBXA 2FZWA 4D45A 3RUCA 2ZQZA 1R4MA 4KQWA 2CDCA 1Q7CA 4MDHA 3AK4A 3B1KA 2GN6A 3T7CA 3VTZA 5TJHA 2YHIB 2YW9A 2DBZA 3GH3A 4XB2A 3JD3A 3MWEB 3PWKA 1EVJA 2X9GA 1X0XA 3E1KA 4IQ0A 2X0RA 3QVTA 1X15A 1UP4A 2I66A 4AJJA 2Q99A 4XJSA 3TQHA 4Z9YA 4E6PA 5F1KA 1ENZA 3FR7A 3QY9A 4OXYA 3PPIA 3Q3CA 3DXFA 1QKIA 1PSDA 2Q4BA 2V7PA 2VRCD 2YQ5A 3D3WB 3F5SA 3WJAA 4YAKA 4PCVA 2Y0DA 4R1SA 1YJQA 5COBA 3Q2KA 1ULSA 3U4CA 4E12A 3GOHA 4YACA 4H3VA 3WX0A 4HFMA 3LF1A 4IM7A 1ZO8A 5LC1A 4R9SA 4Y6RA 3G49A 3DBLA 4UEOA 5KKCA 1JQBA 4JBHA 4ESOA 1E7SA 1ISMA 2BKAA 1QYVA 4AICA 2X5OA 5THQA 3D5QA 1A71A 3STHA 4E5KA 1FDVA 5GZ3A 3TZQA 4XRGA 3PQDA 4PLYA 2OHXA 3D0OA 5G4LA 2VUTA 3JQDA 3ZN2A 1XSEA 4BO1A 1HSZA 1WLYA 4EDFA 2NU7A 2W90A 1DHTA 2D1YA 1LDYA 4U7WA 2X6TA 3VPFA 2WE8A 3RIHA 3S8MA 4ALKA 1F8FA 3GPIA 1XDWA 3ANNA 4PLGA 3JYQA 2XF8A 3HJAA 3ADOA 3D64A 2BI8A 3BZUA 4IIVA 1D3AA 3RJ5A 4BMSA 4RGBA 4L9RA 1R6DA 2X9NA 1WMAA 2I65A 3PYXA 5L53A 4UUPA 1C0KA 1U2DA 2WE7A 1RM4A 2ZB3A 4CMAA 4R54A 4DPLA 1E3LA 2PWZA 3RC9A 3RUFA 1KVSA 2J3IA 4YVFA 5ER6A 1UJMA 1QYDA 2PZKA 3AI1A 4NK4A 4C7JA 3NRCA 3VZSA 3NJ8A 5C3MA 1M6HA 5A05A 4XYLA 2SCUA 4U0KA 1B14A 5ENVA 5CP8A 4GX1A 4BQRA 4WCDA 5JCXA 2NUAA 4B7UA 1PS9A 1V6AA 2NVBA 1LJ8A 4FFPA 5EJ2A 4TMFA 2PA3A 1ISIA 1KBZA 4OH1A 1UUFA 1B8UA 1J0XO 2OFPA 3SLGA 2PH3A 5BR7A 4OQYA 2A9FA 2PLAA 1R0LA 2VYVD 4YRAA 4MPDA 2OORA 3ICPA 3TL2A 2J8ZA 6LDHA 3ON5A 4JX8A 2FPIA 1DB3A 4FD3A 1R15A 3MZ0A 4Y6PA 2PH5A 2IRWA 4U6QA 2TMDA 1U3WA 4RV9A 1VC2A 3UCEA 1C14A 4KWIA 5A5FA 3KM0A 4YYZA 1EE9A 3FTNA 3IL2A 4Q39A 2ZB4A 4NJMA 1B2LA 4IUYA 1U8XX 3MTGA 4IS3A 2VWPA 1U28A 1C1DB 2EW2A 3EVNA 4QUKA 1QSGA 1ZJYA 3CSDA 5DCWA 3WFJA 1RKXA 2JCXA 2NQTA 3IDSA 4M55A 3R1IA 3V1TC 4YRBA 1EK6A 2JD0A 3PJEA 4DYDA 2YV3A 5JBIA 3EK2A 1E1LA 1OZAA 2NTVA 2I6TA 4CMIB 1YO6A 1LSSA 2A94A 2POQX 2WEKA 2BHLA 4BNXA 1HWYA 1IYZA 3WYCA 2DBVO 5IDXA 4GX0A 4GSLA 3VKVA 4BKOA 3H3FA 5BQFA 5EQFA 1C0IA 1H6DA 1SOVA 1FF9A 3WR5A 3QVWA 1BHSA 3ZNNA 3ZGYA 3JD2A 4RLHA 4EUEA 1GUYA 1E7YA 3SBOA 3TF5A 5LDHA 2HMVA 2HK8A 2Y68A 4P8RA 1AUPA 1NFRA 1IOLA 3E9NA 3RFVA 4Q3NA 2DFDA 3WJ7A 1U4OA 4AL4A 3E9QA 4WCFC 4B4WA 4EI2A 3NDIA 2F00A 3PYMA 1E7QA 4IINA 3W8FA 1LA2A 2O3QA 1WDKA 4UULA 5HWSA 4WNIA 1NQAO 1XQ6A 4W4TA 2VZ0A 2QG4A 5JMPA 2Q1SA 1G0OA 3GK3A 4DREA 3CEAA 4ZQHA 4JLWA 4Q3CA 1PGPA 4DC1A 3OETA 4Z0HO 2YHUA 1Z7BA 1JVBA 1YONA 3WBFA 1R4MB 2NU6A 1Y1PA 4BNMA 3DC2A 4WKGA 3IS3A 1N1EA 1HL3A 4NFYA 1LX6A 1HZZA 1AXGA 1XYGA 1ZNQO 4K1LA 1ONPA 4FOSA 1BXZA 3EC7A 3TZ6A 3GZNA 1P1FA 1ZSYA 3PHJA 1Y9AA 3PWSA 1VJ1A 2IZ0A 3G17A 4FGWA 3AM3A 3GVIA 1JKJA 4L75A 3IIEA 3RVDA 3ZWNA 3SEFA 4YTEA 3GGGA 3WNQA 2O48X 4WLUA 1EMDA 4LISA 1XR3A 4BHTA 1IE3A 2WSBA 2IEBA 5TS3A 1LI4A 1NM5A 3GNQA 4PG6A 4YEDA 4RZIA 4BO4A 2XAAA 1K2WA 3OP4A 4J1QA 3WS7A 4JJGA 5KNLA 3KYDB 3DBLB 3MOGA 3ZCXA 5AVOA 3S2EA 3FBGA 4B3JA 1T1SA 3JD4A 4J6FA 3BMNA 3GRKA 2HLPA 2WM3A 4AFNA 3O4RA 1K6XA 4I1IA 4RF3A 3WGIA 1D1SA 1YB5A 5U1PA 3I9MA 5JNLA 1TEHA 3KEOA 4KZPA 4LRSB 4RF5A 1LRKA 4FFOA 1I32A 3BAZA 4AG3A 5JDCC 4N5MA 1NBOA 4TZTA 4UVDA 1YQXA 2RHRA 4WE3A 1R16A 4NPCA 4GBJA 3DMYA 3IKVA 4LSMA 5DP2A 4OO3A 1E3WA 2JFGA 2ZIZA 4RJTA 3NUGA 3TFOA 4TROA 4BV8A 2B35A 4DIOA 4I9NA 2CY0A 5JSFA 3EZLA 4MVJG 2NU8A 2GZ3A 1X1TA 3GFBA 3KSUA 1EK5A 2NM0A 3GUCA 3TL3A 4Y9DA 2LDBA 3DAGA 3JSAA 1RYDA 5LCXA 3AFNA 1LQTA 4W9NA 1F17A 2CMDA 2OGUA 5JCJD 1E1MA 3ZU4A 4MP6A 2X5JO 4XGKA 2HUNA 4YJHB 3RUHA 1BSVA 5KKAA 5B4VA 2HK9A 3F1LA 1NVMB 2WD7A 1D7OA 5CDUA 3PDUA 4GAEA 1DIGA 1HTBA 4OJNA 3EDMA 1XCBA 4C7KA 1P45A 3L9XA 3WQRA 5H82A 4WASA 2O2YA 1GUZA 2J3HA 4AJ2A 3H9JA 1UDBA 3RUEA 4CR6A 2QQ5A 2EGHA 4XDYA 4BNLA 3FWNA 3JQ9A 4PFJA 3QWHA 4PG5A 4YXFA 4PVCA 4ZN6A 2YFQA 3FHLA 3HQ4O 5TIIA 1B26A 4FC7A 1H2BA 4Y8VA 4BNNA 1N9GA 2AQHA 4E32A 1PGQA 2ZYGA 4R3NA 2P2SA 4MVJF 3C7CB 2JAPA 3E6AA 1BDMA 2NQ8A 2W2LD 1IPFA 2BLLA 3OA0A 2OXIA 1NTOA 4RPGA 4ALNA 2R00A 5DOZA 3LT2A 3V2HA 2Z1MA 5IDWA 1U9JA 4MVJP 3GMSA 1BXGA 2AQIA 3JQ6A 5KOIA 4NJMB 4J3FA 3JQCA 2GASA 2X22A 3BTSA 1K89A 2C0CA 4XYBA 5KIAA 4DL9A 4QQRA 3DDNA 1EUZA 1NWHA 3TRIA 3D1LA 3MCVA 2IE0A 5U4QA 2ILTA 2ZKLA 4KDFA 1ZMOA 3JQFC 2RH8A 3C1AA 3M6IA 4OSPA 4JJFA 1IULA 1P77A 3P19A 3Q1LA 3ZDFA 3AW9A 5IDYA 4D79A 3I9KA 4NK5A 5LDGA 5L4SA 4PLHA 1QV7A 4N5LA 3PWZA 1PQPA 3GVPA 4NMHA 1ISFA 3AOEC 5JE8A 3RROA 5IAAA 3H2SA 3K30A 4GX5A 4H15A 1Q2XA 3AUSA 2O3TA 1A4UA 4GGPA 3LT4A 5T6BA 4CL8A 3C1TA 1ZIDA 2P5UA 2O4CA 1GYQA 5B1YA 1A72A 2ZTLA 2FOIA 4RVGA 3BMCA 4MIOA 4CM4A 3NV9A 5FWNA 2PY6A 3FI9A 1PR9A 3V1YA 1SB8A 4L4XA 5JLAA 1HZJA 2Y1GA 4IJUA 4A27A 3H5RA 2VCYA 1PQWA 5JC1A 1PTJA 4CQLA 3BYZA 3W6UA 3ZV6A 3ZHYA 4E2WA 2JCYA 3VH2A 3VTFA 4R01A 2EGGA 1QRRA 4FC6A 1KY5A 1FJHA 1P3DA 3I83A 3PGXA 1RWBA 2YZ7A 4HP8A 5CDSA 3E82A 1QLJA 2RBEA 4D42A 3TZHA 1JAXA 4ZD6A 3RWBA 2O7QA 3ADPA 3TN7A 4HXYA 1GQQA 2D4AA 5CHEA 3DEYX 1NWCA 1E77A 3DZHA 4MKZA 3DFZA 4XQCA 3GZNB 3SXPA 3B20A 1PZFA 4M86A 2YHIA 3L6OO 3BIOA 1LEHA 4KDEA 2I3GA 5EMHA 4D7AA 3F3SA 1QXSA 3FNEA 3QQPA 5JY1A 5JAQA 3RC1A 5TGDA 3S2FA 5COQA 3WIEA 1B7GO 3RD5A 3PXXA 4ONEA 2UYYA 1KC3A 3QIVA 4OXNA 3A28A 3OMLA 5L3ZA 4NBVA 2B4RO 3VDRA 3PIDA 2GZ1A 1JA9A 4J0EA 3TNLA 2Q1WA 2CFCA 3ROMA 4ZQEA 3TOXA 3BA1A 3W1VA 1DXYA 4M49A 1P33A 1I01A 4RL6A 2EW8A 1JWBB 3O26A 1JN0A 3WBBA 1HKUA 3WLFA 3F4BA 3UGKA 4DLLA 4ALJA 3PFFA 3IKTA 4J4BA 2D59A 5A1TA 4Q3BA 4Y6SA 3BMNB 4I5GA 3ZNPA 2GGSA 3HFSA 2CDBA 3UF0A 4ND2A 1UP7A 3DL2A 3DHEA 2VOEA 7MDHA 4GLLA 3PLNA 3GHYA 1NXQA 1YOVA 4J16A 4E2XA 3GDGA 1ENOA 1MB4A 4Z9XA 1ZUD1 2DT5A 5BNIA 1GD1O 4DQXA 1LTHR 3D7LA 1OFGA 3K9QO 4PZEA 3GFGA 4NBRA 3V5NA 1E3WB 1SMKA 4Y98A 1UZNA 3GEDA 5ILOA 3TJRA 1OMOA 1PZEA 2HRZA 4S3MA 5EPOA 5TQVA 1WPQA 3RKUA 4MOWA 4HNHA 1ZXBA 4D41A 5K0ZA 4CV0A 4HUJA 1XWFA 2J6IA 2O3SA 3HWRA 2YQ4A
chains in the Genus database with same CATH superfamily
4WUVA 1WB4A 2AD1A 4FFNA 3GC6A 3ABIA 3T5MA 3ICVA 3VPBA 4W82A 3TFQA 5IVHA 4RHYA 2C5AA 3EHDA 4RHXA 5CW2A 5JDIC 2Q3LA 5BN4A 3NMUF 1AK2A 2V7QA 1SD5A 4Y9TA 4YRMA 2PFGA 4X8HA 1K0FA 4OSEA 5I7HA 1OWLA 4JZYA 2V54A 2P68A 1F51E 3MQFA 4YUVA 5LZ7A 4OFZA 1RLMA 1EDOA 4PAQA 1H9BA 1USVA 5LN1A 3HK2A 2IXFA 4DM3A 2DBRA 1S1MA 2CZGA 4M89A 2VYCA 4LSZA 2GUGA 1SBTA 4C20A 4KVGA 1GDDA 1QIFA 2VN8A 3OAAA 3O4FA 4KI0A 4U2GA 2Q3BA 3AR7A 2E48A 3Q0IA 4YB8A 2V4MA 4ZU1X 5E6RB 1H93A 3THOA 4MB2A 1XWWA 1TO2E 1NUSA 3AHJA 3N58A 3NIDB 4AYXA 4TKVB 3N59A 3G5TA 4Q4AB 5JCOA 3JWIA 1STOA 4DB4A 2X7XA 4CV1A 4Z4EA 3CSUA 3PUXA 3EXIA 4J0CA 3S5UA 3LLUA 1SJ9A 3UTDA 4Z3OA 3SXUB 3T3MB 2B2CA 1M67A 3HXKA 2JAHA 2VDKB 3OM0A 4GRDA 5FJIA 1SD2A 3WKBA 1B74A 1QIKA 2C9CA 3WADA 3PVZA 3UG7A 1AF7A 1S8AA 2IX9A 3ZCTA 3GCDA 1P6XA 2BWJA 4IIJF 3RRJA 3JQQA 2CD9A 5TPZD 3OM8A 2V7WA 2DHQA 3LLVA 3U31A 4DVGA 1DKLA 4E2ZA 1QP7A 3I6MA 3VU0A 2JD1A 4UM5A 4UVIA 2JLXA 4INAA 1JAYA 2TMGA 5EXEA 1ZSVA 5DTQA 4JI8B 3TRDA 4GVXA 2VBFA 1U7DA 1ZOOA 4KKXB 1QH1A 1EFPA 4Q3DA 3UTCA 2I3DA 5I7SA 4JLMA 1B76A 4NBTA 3PZRA 1CXZA 2JLBA 4RMNA 3DYBA 4KN6A 3P9PA 3VH3A 4CM8A 1TJ4A 4HDMB 1CZLA 3KOUA 4MLCA 2FEOA 4I3GA 2V1XA 3OQBA 3PNPA 1YXMA 2FSUA 4JL8A 3T06B 1ZKDA 2D1FA 3V2GA 3VC2A 1FZQA 5JCZA 1O6ZA 1F4LA 2FQWA 2PH7A 4QVKA 2P6OA 3CKKA 1WR8A 4G5HA 4LVUA 4RNDB 3WGYA 3O8BA 4GZMA 1XN4A 3I23A 4HADA 1EFUA 1Y1QA 3D54D 1G98A 1Y80A 3ODPA 1KIMA 1PR2A 2YBDA 4FE7A 4H18A 4L74A 5ARCA 3ZE1B 7AT1A 2OQRA 4OEHA 5DNAA 2WU1A 4QAJA 4JP5A 2QHXA 4U6SA 3RYHB 4L73A 1GCOA 3DT9A 5P21A 3VO1A 3SYKA 1MVOA 4KK4A 4LYYA 5TMDA 2ZIWB 4DG9A 7REQA 4DLTA 1ZS9A 1SU4A 3DMFA 5FL3A 2ZYRA 2H7YA 3BJEA 1DMRA 2WU0A 3EVTA 4KIFA 3WMXA 3HU5A 1KKMA 4ZVPA 1E2DA 4NU8X 5TQJA 3U7JA 1EWRA 1HH4A 2NG1A 2AI3A 3F90A 3L0YA 4PVDA 2XB8A 4LKRA 3I01A 4B17A 1WCIB 2ZBEA 1OBFO 2YC4C 1VLVA 1M8PA 4F97A 1KBOA 1IXYA 3O1LA 4Y1EA 4FE3A 4JVOA 5HZKA 2OAGA 1NTRA 1QCCA 4EK9A 5HKKA 4BZXA 1O5TA 2AG0A 3H3JA 1XAHA 4NATA 2E6KA 1A88A 3KZ1E 2IYTA 4EB3A 3IPCA 4BVEA 3N7TA 2JLVA 2VXYA 3H11A 4QFCA 1QP8A 3EG9B 2VP9A 5I4KA 3SBDA 3DXXA 4CQMD 2DWQA 4W9RA 1I4WA 1KZ1A 2OWEA 2G9QA 2FB9A 3LVFO 1IZ8A 4R0VA 2C2OA 4IIYA 4R83A 1R10A 4WKCA 5AW5A 3V9AA 1TF7A 1U65A 2NZUG 4RF4A 3TCXB 6Q21A 1CJMA 1UZLA 2WJVA 1FNSA 2HBZA 1OKKD 1OILA 1R0RE 4FBMA 4Q9JA 3MF4A 3DE0X 1ZQ9A 2GR9A 2RJOA 4TZKA 5C1BA 2J09A 2JBWA 2OTCA 4QDZA 2HCBA 2X5XA 3K0BA 5FTWA 3EDCA 4UTRA 4NENB 4RPJA 3TX2A 1NPYA 4NFLA 4PN3A 1PS8A 3KIPA 2Y2UA 2AZXA 1X8KA 2ERCA 2Y0BA 3MGKA 1MMFB 1PJQA 1DKMA 4WGGA 2GYYA 3SMVA 2JIZD 5HA5A 4YCSA 5EIBD 3VVCA 3I01M 1FNCA 1FDSA 2UV8A 4J7AA 4URWR 1JKMA 3LP6A 4C78A 4BBPA 2GTHA 3KFLA 1JJFA 1AURA 1RWQA 3NLLA 1POWA 1TUBB 4QX6A 3T9BA 5EAIA 1U3DA 4YR9A 3IBCA 3PEUA 2I2XB 3WZ2A 4F8YA 5IWCA 4DR7B 1Y8RA 2ZDHA 3HGMA 4JDPA 3TKYA 5FH9A 1DJNA 4F4UA 2GOYA 1I6MA 1E6EA 2Y66A 4NFHA 1GTZA 2AK3A 4HG2A 5B7GA 3FNFA 5CNKA 2QQFA 4WOJA 5G4KA 4RSGA 4CT4B 5JANA 1MQAA 2JD2A 2FF7A 5G1NA 4I1PA 4TN5A 3L7IA 4ABYA 2BTOA 2J3JA 3ELYA 3KP1A 3QI7A 3WL5A 2HXSA 1DJQA 2HC9A 1NKSA 3QKSB 4B8WA 2G1AA 2OOKA 4W5NA 4BJ3A 3EQ8A 2CEKA 4YECA 4S12A 1EI9A 1SXJB 3A9UA 4GMXA 4DE5A 4J49A 3HO1A 3ASZA 4MRRA 1WBBA 2EG5A 1O9HA 2O2XA 4GP6A 1T2NA 2HF2A 4IRXA 4GI1A 3TE7A 3AEQB 5BSHA 2X2FA 2CV1A 1RR6A 2R66A 4ND4A 3CN9A 4JWTA 3L1HA 2Y8EA 2YWJA 3I45A 1JT2A 3A4VA 4Q01A 1J99A 2MYTA 2P5YA 3Q8KA 1GZVA 1SURA 4MRMA 1TK9A 1POXA 1TVMA 3HACA 3LQQA 3U3OA 4A5OA 4EEKA 4ZYUA 5DYWA 1X0VA 2GLXA 3OPYI 3M83A 3LDHA 1K86A 2X4GA 3L06A 5J2TA 1JAIA 1V1JA 2AUNA 3IP7A 3NOOA 4LZOA 2IIQA 3F3YA 4PZ9A 2V6GA 3CLRC 3E9DA 3TTVA 3K20A 3TQOA 2Z3WA 3HB1A 4WD3A 3SS7X 2NZWA 4X62B 5BNZA 3DLHA 1C1XB 2UYHA 4TV9A 3IVXA 2A5FA 4J3NA 5IT9A 3FFWA 1VB3A 1G4AE 1XQVA 2EKLA 3EEIA 1KA9H 2ZWAA 1CETA 3GMTA 3OBIA 1NVBA 4PWZA 1MJHA 2DC1A 3QFSA 1DTSA 3QF4A 3FPFA 5FOTA 3AY6A 4E03A 1YDGA 5H16A 3HYLA 3PFGA 1L7XA 2H1SA 2P77A 2PRZA 4G4SO 3ZHCA 3X1DA 1KMCA 4IGEA 1LPSA 5AKYA 4TZ6A 4WK0B 1OZ0A 1GO2A 1KR5A 1RJGA 1U94A 3SHQA 3UJBA 3FN4A 1FSPA 1K63A 1PG5A 2QD4A 1NBAA 4O2AF 3KVOA 2B30A 2F1OA 3ESZA 4Y18A 1DKPA 4REQB 3JQFA 1B23P 2X4DA 4OYHA 2BFNA 4R7GA 2O1WA 3QU5A 4EVQA 3LD9A 3B1JA 4QZVA 3S4YA 2QZZA 1U1EA 4L85A 3QWIA 2I4MA 3NHFA 3E1SA 2OT3B 3I12A 3C3DA 1CDOA 3OUUA 4OP2A 1NZJA 1SG0A 3FRJA 5AKEA 5IZCC 2WQZA 1KEEB 3R5TA 2XGMA 4DR6B 3ZZTA 4LECA 3JATB 4PAWA 5LJLA 3W79A 5HZGA 2H4WA 3N8GA 2WYVA 2VL7A 3V3TA 1G8SA 4NNJA 1LB1B 3C3AA 4JP3A 1JSRA 1NVVR 3F6BX 4UAUA 5DIFA 1JEJA 2BBSA 1UJ6A 4GOKA 4Q9NA 3QOXA 5H4HA 3S8EA 5A3QA 4V0NA 4A0FA 4XUEA 2GMWA 4XM1A 3W7VA 1NBME 3FOBA 3BQMB 2WMOB 3BTUA 4I6JA 4QQFA 5CYFA 5D51S 4A3SA 4ETIA 5BRNA 3FMFA 1ZESA 4FMDF 3B3QA 3DVAB 4JJIA 3A26A 4WCFB 1GA6A 1IBMB 3FUTA 1KJWA 3SR3A 4BQPA 4WZAB 1TMGE 3PXDA 1KDTA 1NXXA 3ZLUA 2N1BA 4N7RA 5FJJA 4TXNA 2FR1A 1IHUA 1ZD9A 2GXSA 1PCXA 2BN4A 1UPUA 4UXHA 4LY0A 4RLSA 2APJA 4XR4A 4DF3A 1HYGA 3WDLA 4EW1A 3ZD8A 5I9TA 1Z8FA 2AQKA 3CW9A 3RC7A 4E4RA 3T12A 5U4XA 2XVMA 2AC7A 3T34A 3IRUA 1RP1A 4O1HA 1QHGA 4N39A 3WHKA 2WC1A 2IIVA 5DMHA 5KYUB 4MP8A 2CF5A 5I9BA 2DH5A 2FZLA 2X1HA 1ND5A 5D3ZA 5EXSA 1QH8A 5REQA 5A0FA 1J07A 2FWIA 3EH1A 1PNVA 2HLDD 3OFKA 4JEIA 5LB4A 4C30A 4B74A 1V4BA 4E1VA 1VJTA 2UYGA 3QUAA 1QYCA 3HCEA 5CA1B 2PUFA 2DUWA 4ZOBA 4DHWA 4EY5A 3SHWA 3ZHBA 4F4IA 4G85A 1CNEA 3QHAA 1E5XA 4LZWA 4F3CA 3LF2A 3ZD7A 3B6JA 1AZTA 4I8XA 2D5AA 3G68A 3K70B 2W2VA 4LFCB 4KMRA 4L8GA 1P1JA 4KQJA 3DZBA 4HWGA 4L8YA 5EESA 1SKAA 3QWAA 2PVCA 1Q0LA 2FPPA 4P98A 3COZA 4PYRA 3EZ7A 1Z0FA 3RSOA 3D7KA 2DE0X 2PSEA 3DLCA 1T6ZA 1ZK0A 1RYMA 2XOKA 3BMOB 2R3SA 2BM8A 3UN1A 3AM5A 4PRKA 4BO5A 3H6KA 3VSCA 2RBGA 1B93A 1FUEA 3W5VA 2HIGA 4A4DA 1S9DA 4IGFA 3WQHA 1OAOA 2CJWA 2Z95A 3LPMA 1YQ9A 3D8RA 1DCFA 1NAIA 3DL0A 2A1UA 3G89A 5B2FA 3K9HA 5HVNA 1MP0A 3PRKE 2WM2A 1FFCA 5SZIA 3GQVA 3E3NA 4G63A 4N8SA 4JLOA 3QVXA 3PSHA 4PYKA 1OZGA 3D5EA 4KZKA 4M9ZA 3ROGA 1SZCA 3NOXA 2FU5C 3AEZA 5T4HA 2GHTA 5AVZA 3PP8A 1AK9A 5DYTA 1B8PA 2QX6A 2XAUA 1OX5A 3LCJA 5H3LA 3TOZA 4AAYA 5BRJA 3C48A 1HDXA 2G5PA 5CFRA 3WGNA 3ORQA 1N7GA 4BMXA 2I6XA 1KJ8A 1RYEA 1WAMA 1CDEA 1Y4SA 2XNDA 4PSAA 4TMWA 1RLTA 4OQZA 1R5JA 1LV8A 3N05A 1SXJE 1C9KA 4AJIA 3FLBA 2B36A 2H2FA 3QLTA 5B6IA 3P9CA 3FTFA 5JXGA 3NI2A 3MG9A 2B4KA 4TLEA 4HDAA 4Y0AA 3UWMA 4CLOB 4D9BA 2H54A 3LYHA 5CLFA 3AESA 2Z43A 3UJ8A 4AX4A 1DINA 4D4KA 4YT5A 2YIVX 2AI2A 4K6KA 4IWYA 4UHEA 2JFFA 3BB4A 4AWBA 3AHCA 2V65A 4FJ0A 1MAVA 2YW2A 2MCFA 3I1IA 1VFPA 2YVAA 3FVVA 2CL6X 5JDIA 1YB1A 9MHTA 1K8RA 1YK0A 3NT4A 2JNWA 4PNPA 4DIDA 3ZQ4A 3QH4A 5CM8B 2ODAA 1IM8A 4W1QA 1F5SA 4R9RA 1X7XA 4W8HA 4HX5A 2QRNA 4FFBA 4FYJA 2OAP1 3UCXA 4DLPA 4E22A 1HOTA 4CMCA 2H57A 4C4TA 1O5IA 3HXMA 2IUUA 5KSWB 1XLWA 2CLCX 3C5CA 3OCZA 1MIOB 3ZK8A 2YYAA 3GT4A 5TVKA 3D8BA 3DYVA 5F7JA 3VU1A 4CN8A 1XLVA 1Q1QA 3RSZA 2PZFA 4Q4JA 3FGZA 1NLZA 1WXXA 1YRQA 5LBTA 5JVDA 4UHFA 4M0FA 4JSRA 1SPXA 3PITA 5E2IA 3T94A 2NXEA 3TQFA 4L5AA 4DUPA 1VBKA 3GAZA 1FB5A 3IODA 4GEGA 4DSZA 2O19A 4KBYA 1ONOA 1LPBB 3DC7A 3QV1A 4BIIA 2XADA 1J5PA 1GXSB 2JFYA 2F43A 1DBRA 4DTCA 3WYGA 1U99A 4X90A 4EYKA 1GZSA 1LLFA 5JXHA 2H11A 3ID6C 2XVYA 2OCIA 1GRQA 5K3FB 1DFHA 3SYMA 3VV2A 2HRBA 4XEUA 3C8ZA 1JLKA 1UCFA 3K05A 1B00A 4PGHA 1BQ3A 1I3CA 1HUQA 3KXKA 2FUKA 1DC7A 2PKQP 1JE0A 1I2AA 1GEEA 1S3GA 3QFHA 5F52A 2HMUA 2NYUA 3SK0A 4DSTA 3ICEA 1UK7A 3DLAA 5AJHA 3ZHZA 1TU0A 3CMCO 4ZVKA 5E1MA 3PQEA 5HJ2A 4FGLA 3WTCA 2AG1A 5SZKB 1EBBA 1P17A 1JDPA 1Z6XA 1CBUA 1DO2A 2Q49A 3ND5A 2QM0A 3JYLA 1L5RA 1MB3A 2P6UA 3K2IA 3PGJA 3WAKA 5C5CA 3QEAZ 3BXOA 4GOND 1O8BA 1BOFA 3IHKA 3CSSA 3DVLA 3LWNA 3O82A 4NU5A 5HTOA 2HRDA 4OL0A 4KTTE 3VPSA 3TZKA 1D6JA 1I36A 3W5CA 1T25A 4KPUB 2XCRB 4EHJA 1CKEA 1HG1A 3G82C 1HMYA 2FFHA 1D0VA 2BI4A 2WLTA 1XP8A 2FSPA 2YWBA 1AO3A 3QF7A 5IVPA 2O8FB 4WZAE 4ER6A 2FPLA 1CR4A 2VPZA 4MVJE 1M1NA 2JASA 3KV1A 2C4KA 5IS2A 3QJ5A 4YMTA 2V7XA 4OMFG 5AHKA 4ENSA 1M0WA 4H7EA 4J75A 3EVEA 3ZY5A 2QQGA 1IRIA 1IZZA 4MMXB 1T0UA 4P08A 4TUYB 3CXUA 2I8AA 1WD5A 3O9ZA 1G7RA 1MAUA 5AKHA 1V43A 1CNMA 3EEFA 5JNUA 1AUXA 4UD6A 2EP8A 4F92B 2QW0X 1AO0A 1NJ2A 4CCAA 1A1SA 2HJHA 3QGMA 3ZXYA 1W85A 4FZRA 1N3IA 1PU2A 2G4CA 4O2AA 5A06A 3PGA1 4FGSA 1FFDA 1GU0A 4FWIB 1WBJB 4BL5A 2YICA 1F14A 3OX4A 2O6LA 4CODB 1N2GA 3NBFA 3PTAA 1CHNA 1A9XB 4D4JA 3AETB 3HWX1 3DQPA 3OJXA 2QP4A 5HOQA 1GWNA 4HYQA 5EZYB 2DFLA 2VJMB 4WPGA 3WRXC 5JJKA 2JDID 2OL4A 1ORVA 4RV4A 1MAHA 1L8AA 3S70A 5NULA 1FDOA 5LMUB 3H0KA 4D3SA 1QQAA 3BH0A 3DSRA 2HV8A 3UT0A 3L8YA 4CM5A 4X1KB 1JYFA 2FSIA 3ULKA 1PJSA 4EW2A 1ZH4A 3B36A 1QFMA 4HYTA 4U0JA 3GJQA 5ITSA 3GQBB 5E6UB 3BCUA 3HSKA 3K0EA 1UMBA 3K6JA 2BKVA 3KXLA 4MMZB 1MXHA 1T34A 3SIPA 4F3YA 1GYPA 2BR3A 5GJVC 2CNWD 5EGNA 4YRGA 4ZYVA 1IU9A 2AX4A 4M83A 5IXSA 1NONA 5A5EA 1PRYA 4UU1A 2XMQA 1J33A 3C14C 2XDWA 3PWTA 3IDQA 1MG5A 2ZANA 4R98A 1I3KA 2A1TS 3TNFA 2DPHA 2X9LA 3D2BA 2X9VA 4RZ2A 1S2MA 3ZWBA 5AVWA 2QNRA 3WICA 5IZ4A 5D87A 1M5UA 1R5BA 3RIXA 3UHOA 1KTIA 1GNPA 1PWHA 1YVEI 4UUMA 1YHZA 1JB9A 4HH1A 2EZUA 5AKIA 3RYCB 1QUEA 3NKLA 4DSAA 4LE1A 3ER6A 3LBYA 3SJCA 2J7PD 2PRIA 1FDRA 2FE4A 5CFZA 2CFOA 3O83A 4P4TA 2QYOA 4AW9A 4BNIA 3FHJA 5H8WA 3R0VA 5CT6A 4KWTA 1MRNA 2WPDA 1LNQA 5FORA 1BKSB 1ZBDA 2BP7B 1XTJA 1C5KA 4O1IA 2FSHA 5E8RA 5ADHA 5IN4A 3DEKA 2H3HA 1AKTA 2HMAA 3RBVA 5JO0A 2CK3A 3EAQA 4K9RA 4BJHB 2HMWA 4R16A 5D7NA 2GNPA 1QTQA 1BHO1 3W8EA 4PIMA 3GMIA 2XMRA 3G85A 4K9QA 2FWPA 2QTVA 4R9NA 1EB9A 4YCMA 1E58A 2QR5A 4MV7A 4F7WA 3D43A 1E0JA 3M6XA 2ETXA 4FHEA 2VCHA 1OTYA 2WJGA 4Q6WA 2DHDA 1MF7A 4GI7A 1IFXA 3DR3A 4IKOA 2WAXA 3NB0A 4EJ0A 2ZRDA 1SCDA 1E69A 4DQUA 5ARBA 1WPRA 4P38A 3EA4A 4RQUA 4XJTA 1RXYA 3D3QA 3E53A 4XQ0A 5HBRA 1C30A 4Q7LA 3TSZA 5CD1A 2V55B 1DGQA 3HRHA 4FVTA 4QUDA 1NFFA 4GM0A 1VXOA 3KD2A 2Y1CA 2PKXA 2PX0A 3QUTA 1U7XA 4GOJA 2Y93A 1ZGBA 5HSGA 5KMGB 2HYIC 4WL0A 3W0LB 2PNFA 3X0DA 1VYHA 1EWQA 4CHGA 3I9JA 3HI6A 1DTWA 2OD7A 1YF3A 2QTLA 2ZROA 5ERYA 3ABZA 2AG5A 4GYWA 4WNAA 4LDRA 2QNIA 4V0MA 2HSDA 3OCWA 4OHYA 5G53C 3M4JA 4I7EA 5LQJA 2IXDA 1R4ZA 2AUTA 5DLDA 4LQCA 4YPOA 3MJHA 2JKVA 2HRRA 2MJLA 5K3CA 3FDZB 1PAUA 2EWMA 3MGBA 5DP1A 1NQXA 1Z4MA 3H5IA 4PG8A 5AHRA 3TZBA 3JQ8B 5CA0B 3HB7A 1WUYA 2PEZA 4MWZA 4N3CA 1SA0B 1EQ2A 3CR3C 1TADA 5DTRA 3T6KA 5IULC 4TXJA 4B87A 5KWSA 2CNKA 4GGMX 1PJBA 1RRKA 2C9MA 1T2DA 3RSFA 2ZCVA 1VL5A 2JRCA 1E1YA 2NZXA 3GG2A 2FXVA 1XJ0A 4R8VA 3H9GA 2D0OB 2HTFA 4CR7A 5JRZA 4CDGA 3EFOB 2VBIA 2LD4A 1JR3D 4BZZA 1ZC3A 2G5CA 4CV3A 1X7HA 3GRYA 3UG6A 1YZTA 4BCCA 1YAJA 4FILA 5AM5A 2ZATA 5JISA 4C2TA 5FUWA 1C2TA 2YS6A 2RGWA 1RKUA 4V38A 1A8HA 1T3SA 4A92A 2Q4RA 2GF9A 3LGSA 2GO7A 3CPJB 4ASUA 3KYCB 1QMGA 2H29A 1WDLA 5HZHA 3THWA 3WLSA 4PBSA 2KBFA 4BMNA 3EXG2 3CYFA 3IJPA 5IZCA 1MO3A 3L4KA 2Z9DA 4LSWA 3DT6A 4DRYA 2VSNA 1IVNA 1KXJA 5ALSA 5EMMA 2XF2A 1UKBA 1QE0A 1FMCA 3QEOA 3W3ZB 4FB4A 5MHTA 4K9MA 4BP8A 1QYIA 4G4GA 2RHOA 3D59A 1EQUA 5AK3A 5HE8A 3DO5A 2JBAA 4G0XA 1AU9A 1GITA 1R27A 2I1LA 4PGGA 5D3MB 2W9XA 5AUNB 3U4MA 2ZTUA 1YV9A 2WVGA 5F2EA 1JA0A 1IY9A 3T1VA 2ZYDA 3CC8A 1FDTA 1O03A 4C01A 1XZIA 5FUMA 2ISSD 2BMDA 1V39A 4BZQA 4BQNA 1XAGA 3O31A 3DB2A 1VHTA 1VECA 2WWGA 5AOBA 3EIOA 2C9YA 3S1LA 1WVMA 3VU9B 1Z2CA 4BC1A 3PX7A 3T7DA 4WZZA 5ELLA 4P84A 1TW3A 1BVUA 2UUAB 1KDYA 2HA2A 4TTIA 3U6BA 4XDZA 4B8YA 1XZDA 5C9ZA 4MHTA 2EVWX 3E23A 4ESVA 1DNPA 1TGVA 5TJ9A 4AKSA 4UEKA 2YYZA 1J4AA 1VPTA 1YCDA 4KBGA 4QOSA 4XTCS 3KJNA 1Q7GA 2R2GA 3KV3O 3OZGA 5G40A 1RDFA 3WSVA 1N5JA 2AOUA 1HLPA 2H0AA 3BREA 3N3AC 3R0ZA 4JT4A 4Z7NB 3ZQKA 3GRAA 1GUAA 4DR5B 2HWXA 4PLTA 1LVUA 1YC2A 2RSLA 4NCHA 4RVCA 4DR4B 4FOOA 3U3XA 2D1TA 3RU3A 1K4MA 3UKDA 4U3JA 1LBSA 1PD1A 2OBNA 2BMAA 1K06A 5GTDA 2RGNC 4FHGA 2CLKB 4BPRA 4UOEA 2Q21A 1TAGA 1HC7A 1Z5ZA 2PU7A 2D2XA 2GETA 2JBHA 4R81A 4Y2GA 5CX1B 5FUXA 4F0JA 3VKUA 1WZCA 3SKVA 4C3ZA 5KWJA 2X14A 3C39A 1IJKA 2QMQA 1M7GA 2NNLD 3T0FA 1OE0A 5H80A 1C1YA 1GPAA 1Y6ZA 3JD1A 3RVNA 4M9CA 4D3DA 3SHVA 4ARSA 4ZCTA 4J7UA 4RZ3A 2XHEA 4K28A 2PIAA 1G3UA 3WIVA 5L7WA 2DUUA 1R0WA 4JI2B 2JFUA 2NNWB 4YCAA 3RRFA 3ZWWA 4CG1A 1J1UA 1B6SA 4HEQA 4R05A 4ZT4A 4Y6LA 3H1PA 1ZHHA 2CXQA 3DWGA 3CO5A 1I14A 2PX5A 4XX0B 3CR8A 2XCQA 4N47A 5K8TA 4EGQA 5IG2A 1E2UA 2H4XA 3HV0A 4KDCA 4NHEA 1KO1A 4I36A 3RVBA 1OLUA 4M1MA 3FCEA 5HRCA 5BNWA 5FPKA 4BX8A 1D2NA 1ODIA 1O4WA 2ERXA 2O50A 2P4HX 1B16A 2Q3CA 1SK8A 1YQWA 1A9TA 1IATA 4WQMA 3ZDXB 4BGDA 1I3OA 1R4NA 4OKIA 4BMPB 4LFAB 3Q15C 4J07A 5A2GA 2ODQA 3TUJC 1P2TA 2IY7A 3AY7A 3RKRA 1T36A 2ZTVA 1IHDA 4ZAZA 3WKCA 1RADA 2NWQA 3VNBA 1A82A 3I76A 3R9IA 3RS5A 4J2HA 4DW8A 1UK9A 1V45E 4L7QA 3N86A 3OEYA 4LXQA 2ECKA 4MNTA 5HQ3A 3MINB 2CXTA 3OLWA 4XB1A 4TX1A 3ZQ6A 1U0EA 5KWVA 3ZX4A 1BFUA 1JDJA 3PNKA 3BSWA 3HB9A 4N0DA 4OXKA 4QTUB 4YMWA 2L69A 3E9ZA 4M54A 1NYQA 2BBWA 3L0ZA 3COVA 3ZZ0A 1ORRA 1PEKE 2QIOA 4YLEA 2IU4A 4ZQFA 2AHOA 4EH1A 2C7PA 4LOLA 1BA3A 4L6IA 1OI2A 2CGEA 4EUHA 3MT0A 4YV2A 5BR4A 3TLGA 1E1CB 5A3VA 4Z49A 4P82A 2IODA 3CUSA 3HDHA 5HQJA 1AOXA 3ANYB 4LS3A 4LOAA 3V4PB 1M6EX 3U62A 4FB5A 2ZVPX 4JR2A 2PSHA 5IN5A 1H66A 1LQUA 4RDHA 5IANA 4BFLA 3T9CA 5BT9A 5HG0A 1UBHS 3QEBZ 4PQYA 1HE8B 3FF1A 5TGZA 3WK7A 4EI8A 4LOIA 4EJSB 5BOSB 4QPDA 4HZGA 4Q1FA 3RANA 1GG2A 2CLHB 1P1IA 3NOQA 4Q24A 4P3OA 5ETJA 2O8DB 3LGXA 4KN5A 1PK8A 3Q8WA 1K3UB 5I48A 1AS2A 3K92A 2QVCA 1XMIA 2CB9A 5GOZA 1UBMS 4U7PB 3ILXA 1GNQA 4JI6B 1KSJA 2OZEA 1Q3TA 4J91A 1U7HA 2VDWB 4RQTA 4RH0A 2CJXA 3DE2X 3MWLA 3B6MA 4E94A 1IRXA 1UXIA 2ECQA 1SC1A 3E8XA 2VJDA 5DRYA 3FDJA 1E2QA 1A5AB 4EA9A 2GK4A 3KT6A 2QLNA 3FBTA 3AJ8A 2PMBA 4YRNA 4B4DA 3RVJA 1JG3A 1PS0A 4LJ8A 4LNUB 1X3LA 1L5SA 3BJMA 1J8VA 1NJGA 1AS3A 2GAFA 2Q6KA 2XBUA 1KAQA 2XNSA 3B38A 5FPSA 5HILA 4BO8A 5JYBA 5L9AA 1ZVKA 3NHWA 3WTBA 3AP1A 4KEAA 2AI1A 3OZWA 1P9WA 2BHTA 2AJ8A 2SKDA 4ND1A 3VAAA 1KE1A 5DSTA 3WWEA 3K8ZA 1PQUA 2EQBA 2YJGA 3C87A 1XNQB 3A1VA 1GLVA 2WHYA 4PLFA 4R1QA 4NZPA 4AU1A 1ZZGA 1KO7A 3VMFA 1IY1A 2NX2A 3ELWA 4B3BA 4OHFA 1J6UA 2NACA 3RPEA 4XOUA 1JXQA 2E7ZA 3ENKA 4G9EA 3E48A 2X6QA 3R40A 4JN6B 2G71A 3UMGA 2OV4A 2HU2A 3DZIA 1VSBA 2GZDA 1QH9A 1NVKA 4P53A 4UMDA 3W6NA 1YAHA 4P22A 1Z5WA 5TGTA 2R7LA 4HGRA 4ARZA 2PEYA 2X2EA 1W88A 1CRQA 1DJPA 1PR3A 4KLCA 2DPYA 3QVJA 2P2YA 5BSWA 1T9BA 2XXAB 2EQAA 3KUUA 2O8BA 1CUXA 2JLQA 4EWLA 1GCUA 2CNBA 2PCLA 2J0VA 1B73A 1C3OA 2GERA 1XUOA 1ZUIA 2NZVG 2YWFA 4AZ0A 4EKIA 3HXOA 2ICAA 1DPGA 1E6MA 5DYGA 5J23A 1CY2A 1ZNZA 1ML3A 1SHLA 3ZZUA 1FX0B 4F6RA 4X20A 2WWTA 4TSFD 2KYRA 3PJDA 1WZEA 3R5FA 4Q21A 5BVGA 1D03A 4MWTA 4CM1A 1KYYA 1N2CA 3O74A 5FNVA 1DG1G 2I80A 2IZOA 1KHTA 2R7KA 4JWKA 3ZWOA 1VE7A 1HY3A 2H2GA 5HKAA 1PR4A 2EIXA 5E4TA 1DOHA 4X85A 3B1ZA 3K71B 3GPCA 1VLHA 3FWPA 4GHWA 2OCLA 5J58A 1XMOB 1RLUA 2HIAA 3FUCA 3A70A 4MJLA 4Y0VA 1GSOA 1BDJA 2G5GX 3EGWA 4JLBA 1HKHA 1UBKS 1OY1A 3EQ2A 1E64A 4XPIA 4O4JB 4PAMA 4E1BA 1U9CA 1E5DA 2C2GA 3E9RA 4DARA 5CFMA 1TT5B 1WHTA 2V6BA 3IQZA 1ODLA 3AVPA 1H2RS 4XUGB 2VP4A 4JCOA 3V8BA 3I2FA 4L78A 3TECE 4UTNA 1NR1A 5FKJA 1RI1A 2FPRA 1U8ZA 4LE2A 1WOYA 1PE0A 1CZNA 1WW8A 4FKBA 3GCGA 3GRUA 4ZT5A 3I92A 1ZM4A 1N3YA 1VG1A 4CKWB 3TLXA 1ACJA 1UXHA 2G88A 3CWCA 3RUDA 2WW8A 1HQYE 2DVMA 1RWKA 5CFPA 1X1CA 4XLTA 5TARA 4YREA 3RJ9A 1NBMD 2ZK7A 3WLNA 5BV1A 4YAUA 3L6EA 4PXYA 3WAJA 1X1EA 2X5KO 4TLAA 3G7SA 4C6TB 1IVSA 1LW6E 4LTMA 5DBHX 5FWXB 3U7RA 3RKSA 4O2BA 4ADSG 5LFAA 4C7XA 2PQ6A 3PL5A 4UZFA 2PV7A 1MORA 3DTYA 2PUTA 3EQ6A 1EUCA 3LVBA 2XD4A 3S5JA 2Y0CA 4D56A 1ZUNB 3KSZO 5D86A 1AVTA 2IYPA 5GMOA 4RA6A 1QIGA 2VF2A 1EFVB 5DGCA 3CV3A 1QRTA 3FCXA 4X1YA 2IPLA 3PC8C 1NXVA 2YZGA 2OY0A 4QYMA 4OPMA 2CXNA 3UVEA 3TE6A 1HRKA 3C15C 1T3TA 3ILYA 4KQMA 1J8QA 1CYDA 4M7WA 1U31A 4DXHA 3E18A 3I8SA 3FROA 1VMIA 3NAQA 1VPWA 3IAM1 1Q91A 3GZTB 3N2IA 1LTKA 3Q41A 2WWWA 4LC0A 1Z4PX 2IUFA 3D4OA 5D01A 4UVGA 2I29A 4ZYZA 4E3ZA 1GGKA 5EIAA 4CQMA 5BYJA 3EPPA 5ALKA 3VGJA 2AW5A 2FDRA 3AGPA 4F5DA 2VAMA 1A98A 2W48A 4B79A 1BC5A 3R5HA 2C7VA 1SUEA 2FMKA 2OP0A 3LDUA 7YASA 2G28A 1OKKA 1T8PA 2ZT5A 4M1WA 3EEYA 4JQZA 2YWEA 4OHWA 3IUJA 3EX7C 4MW0A 1L4YA 1YL7A 2BGMA 3OZVA 1NMYA 1MG0A 3KVYA 4PQFA 2OSVA 1XZPA 3WVNA 4D9JA 1PR1A 2FKNA 2FG6C 1PJRA 4AJ4A 1AF4A 3Q6IA 1RHMA 3R8XA 3VR6D 4BVJA 5EJAA 3BWMA 3CBQA 5FO1A 3BZBA 1JEYB 5LWHA 4UHCA 3IJ5A 4ZVSA 1H2ZA 3SR0A 3OHMA 4MRNA 3ZGVA 5ITZB 4BPBA 3ER8A 2CHUA 4C7MA 4HKTA 3ONFA 2XPCA 1QHFA 2ORYA 4ARCA 2VNIA 2Q2QA 4KXYA 4DBVO 3D3EA 4WACA 5DNCA 1Q3KA 3MLEA 1VP9A 2CXUA 2WWIA 4WY8A 3ZDYB 1NKTA 3LY9A 5DASA 5C8YF 1P44A 1T6NA 2B6HA 3TVDA 3TMYA 3U56A 5J4KA 3THXB 1YFJA 4HAOA 4XQGA 4C87A 3T5PA 3F5QA 3H19A 3SIWA 2ZRFA 4DMRA 1L5KA 1W2WB 5LA6A 1CQIB 4RDIA 3WGQA 1I6KA 3UMVA 1C7RA 2ZAGA 4CLHA 2DPGA 4QPCA 2D5BA 3UFXB 4MP3A 5C1PA 1UMCB 2Q3FA 4UDOA 1GA4A 2CJFA 4BAUA 3MUNA 4MR7A 4X8LA 1JDBB 1TM3E 5FLEX 3R7AA 3WYFA 4BV9A 4ZGGA 3SYNA 1N5OX 1EK0A 4A6EA 1JL3A 2VK1A 3SX4A 4A0RA 2OCXA 3NUZA 1E98A 5D85A 4JC4A 2LCQA 3RJZA 3C3BA 1XZKA 3AZPA 4UREA 4X1IA 2KJQA 4D3ZA 4AY6A 3H16A 2OUIA 3N2NA 4Z4QA 3R5XA 2BAGA 1DBSA 2LWIA 2VFAA 3J81k 3PQ4A 4WTOA 1F9EA 2A7XA 2FCRA 4XDGA 3ANXA 1L5GB 1JUDA 3ASYA 1NLUA 1MO6A 4IJKA 4PU0A 1FX1A 1E7MA 1UL1X 1XTQA 1YRWA 4UKDA 3E7XA 1VYUA 2NXWA 3I9FA 4P5EA 5GVRA 1G5HA 2OPHA 4LYJA 3ZW9A 2WILA 3D4IA 4Q1EA 2NYRA 1ZEMA 5B4TA 1WW3A 1YQGA 4DIBA 4G07A 4OGFA 2ORIA 3C4QA 2Z1NA 3CISA 1V8OA 3EIXA 3QP9A 3DZ8A 1V25A 4INJA 3CVWA 4DV3B 5F5NA 4NR0A 3AMVA 4RY8A 4XH9B 1GU1A 2C2BA 2ZRIA 1DEXA 3EZ9A 1NNSA 1C3VA 3VHXB 1SQ0A 3LCVB 2I62A 4OA8A 2AR7A 3HKBA 3JQ7B 4H08A 1PGJA 2I2AA 2R1VB 4KQ1A 4ZDIA 1QBKC 5LUAA 4F8EA 1JZTA 2XKKA 3VR4D 3WGGA 2AR0A 3C1OA 5TF0A 5H59A 2A3NA 5E3HA 4Q66C 3R3XA 2GRAA 1BA2A 2FPOA 3FNIA 2CBXA 3IESA 1E3EA 3GJXC 4P7GA 3TQRA 3ZDRA 3PNLA 1WKBA 3Q40A 1RS0A 3EZNA 2JH3A 2O7RA 2WAAA 4QO7A 1MB2A 4QL3A 4AG5A 2RAFA 3IOYA 3D4NA 5TEVA 4DBZA 3DOHA 1IL0A 1XJ5A 1FSGA 1KGDA 3NWOA 3U4GA 4HDSB 1NI4B 3KSMA 1AGRA 4E13A 5ADVA 3K0FB 1DAPA 5KTSA 3KSDO 2DTDA 3C97A 5ARDA 3FOWA 2CMGA 3G2LA 3DUWA 3OU6A 1XA0A 4LBZA 4XGIA 5BSMA 3BM5A 2YVKA 5I7AA 4WK6A 2C3OA 2RGNA 5CLJA 5GADl 4EJ2A 1XNRB 2IH2A 3NQ41 5L3QB 3KB6A 1KO5A 4YV1A 2QAGC 4AJNA 3QVMA 2WIJA 1OASA 2NXNA 1SCQA 2IYZA 3N3BC 4IUDS 4Y1RA 3W5IA 1N77A 2QRGA 4YV0A 1FTNA 5LOVB 4EO9A 3IQHX 1Z47A 2RGDA 4CM9D 2O5RA 5AQEA 4FINA 4LF6B 1XTIA 1QCYA 5EEGA 3O8OB 4KO8A 4GPD1 3WRVA 4HZUA 5KQMA 4PLZA 3EEBA 2WKRA 5FF9A 1LK5A 1XL0A 4MVJD 3LUFA 2VNJA 5G1PA 4BYMA 5I7VA 1LVGA 1FDWA 3KKMA 2BCEA 1E9RA 1HSOA 3FZQA 2Y1XA 1BE0A 5GONA 2BUBA 3HFRA 4F9TA 4ZYTA 4QRHA 2RKOA 4X61A 3ZBUA 3EGOA 3JX9A 3FMVA 4EG3A 4PO9A 2C04A 1WDMA 4D9NA 4EFDA 5KHLB 3TLAA 4QVIA 2GZSA 3AKDA 3LKZA 2F8SA 2J3QA 4HRAA 1EXMA 5CEFA 4JOCA 4WY5A 4AJLA 1U6IA 1ORWA 1NBIA 1GHTA 4FYPA 4MQBA 3B6IA 4TM7A 2PUEA 3IBSA 3TM4A 3SJ7A 4O1MA 1CC1S 1DUVG 5F7OA 4OUDA 1ZVJA 4QSMA 2WUEA 4DY4A 1XPOA 3QLVC 3DNPA 2HLDA 5DT2A 3JR3A 3I3SR 4PZYA 2ID9A 1ORIA 1LWNA 1CUJA 1HXHA 2B1JA 2KB0A 2VJOA 3AB8A 3MC1A 4QXRA 4IV0A 3UOWA 1XKTA 2ONCA 4NLLA 3K70D 3ZDZB 3AQ4A 4TRRA 2CFSA 3MJEA 1NPDA 1RQ7A 1Z2OX 2RC5A 3C98A 4MINA 3UWOA 4EZEA 5AUPB 5HX7A 1VMEA 2BFCB 4PICA 2P91A 6GPBA 1OI4A 3O8DA 3GA7A 4RVDA 5BUSA 2ZJ5A 3KE8A 4P0PB 2IHKA 1ISGA 3ZJYA 2QRLA 4GM1A 3VI3B 1ZJJA 2BFWA 1D2CA 1C4XA 2PRJA 1LBHA 1W1UA 3DBVO 3IAHA 4PHHA 1LXCA 3KPYA 4KPYA 4YMHA 3ZHSA 4EGCB 3ZPXA 5BMOA 4HWOA 2GAJA 1X7GA 4WX2B 1MO4A 3A6KA 2SNIE 3EY4A 4A0GA 2NZYA 5HXAA 1SVLA 4MCIA 3MW8A 4YRIA 4JC0A 4KSYA 1Q92A 1UMDA 3RREA 1U11A 3EZXA 3QWFA 1L5NA 5JMOA 1KH3A 1GAXA 5ALIA 4N7BA 1T9CA 3C85A 1JECA 2M98A 2KPOA 3AL2A 3LX8A 4I5DA 4M6WB 4AMYA 4P4NA 3D0KA 3OZBA 2C07A 1VKRA 2I8CA 1IXSB 1ZD4A 1E3JA 5ICSA 3PNYA 3GA0A 3B82A 1KI6A 1XVLA 1AZSC