3TZKA

Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg)(g92a) from vibrio cholerae
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
247
structure length
247
Chain Sequence
b'SQFMNLEGKVALVTGASRGIGKAIAELLAERGAKVIGTATSESGAQAISDYLGDNGKGMALNVTNPESIEAVLKAITDEFGGVDILVNNAAITRDNLLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVGSVVGTMGNAGQANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMTKALNDEQRTATLAQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMYMI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-[acyl-carrier protein] reductase
publication title Dissecting the Structural Elements for the Activation of beta-Ketoacyl-(Acyl Carrier Protein) Reductase from Vibrio cholerae.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Oxidoreductase
total genus 92
structure length 247
sequence length 247
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2011-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3tzkA00
3GMDA 3T7EA 5A05A 4L8VA 4PLZA 1QYXA 3U09A 1HE3A 1OC2A 2VZ8A 3D5QA 2PNFA 1U3TA 1WDLA 4XB1A 3T7CA 5AXDA 1F0YA 1IPFA 1PR3A 2J8ZA 4J7CA 4DBVO 1AXEA 2O3JA 4XEHA 4BMVA 5L53A 3NEPX 5L7TA 3FBGA 4B3IA 3I9KA 5KKAA 3KSZO 5AVOA 2NQ8A 2O3UA 2DPGA 3PYMA 3H9JA 3PQDA 1ZXBA 2NU9A 3VH4A 4WLOA 5TQVA 4M49A 5I9NA 3C7DB 2QZZA 4QX6A 2RH4A 1IL0A 2PKQO 4UEOA 3JYNA 4YR9A 1H6DA 2YV1A 4CMEA 1BXZA 4HFJA 3UOGA 1NNUA 1ZVMA 4XIYA 5IAAA 2HK9A 3OEWA 2Y67A 1Y9AA 3QE3A 4R9RA 4J2HA 2VWPA 1YVEI 2VT2A 4CLOA 2AQIA 3EHEA 3IP3A 1X13A 4FJ2A 3UVEA 3FHLA 1P74A 3DBRA 4DMMA 5ADHA 2WD8A 2TMDA 5FWNA 1XHLA 1PR9A 5TT1A 4WGGA 3CSDA 1YQXA 1Z7BA 1HEUA 3PFWO 2V65A 5TF4A 5JC1A 4DIBA 4PLHA 3JQEA 1XIVA 4OXNA 3VKVA 5HTOA 1GU7A 1ZMTA 5IXSA 1L7EA 1IZ0A 1OAAA 3ITDA 1RPNA 2DLDA 5KVSA 1P33A 3ZCXA 4WEOA 3OP4A 4LSWA 1LXCA 1LJ8A 4RZIA 1JU9A 3ZWPA 1RM4A 3GEDA 2YJZA 3GOHA 3QVWA 3LF1A 3VPXA 4DUPA 1NVTA 2HK8A 1Q0QA 1Z73A 1QG6A 3I3OA 3IP1A 3WGYA 3F46A 2ZATA 3RUAA 4BL5A 1LSUA 4E5KA 1MXFA 4BUCA 1XCBA 3N7UA 4A2CA 1A9ZA 3JQ9A 4YAGA 4XQEA 1N92A 5T57A 3PZRA 3WFJA 2AA3A 4JP3A 1E6WA 3QP9A 4ND3A 1DJQA 5KVQA 2AQKA 3I9LA 2JCVA 4NHEA 3ZV6A 4JX8A 5FFFA 3SJUA 2G0TA 3OQBA 2CF5A 4R54A 3H2SA 1E3WB 3LDHA 4L76A 4IGFA 3UCFA 3OF2A 5GZ6A 2A9FA 1E7QA 2W4QA 4PLVA 3DFZA 1TB4A 1UXIA 1ORRA 2GN6A 3FNGA 4HBGA 4DLBA 3NJ8A 3NDRA 3F47A 5T5QA 4BNGA 2WE8A 1ZK1A 2UDPA 2W90A 2C5AA 1U4SA 1MV8A 5IZCA 3GPDG 1DOHA 4BNYA 4FFNA 2BKAA 4FN4A 5JO0A 2GSDA 2BGLA 3OM9A 1EBUA 4FBGA 3H65A 1BRMA 3GNTA 2X0RA 4BQPA 3E5RA 4I5FA 1I3NA 1QV7A 1PS9A 3RKRA 5MDHA 3AUUA 3FRJA 5U9CA 1QXSA 4BO0A 2ET6A 3B1KA 3VPHA 2IEDA 3WWZA 4AICA 5G0SA 2VN8A 3I4CA 1GQQA 1MLDA 4E12A 1Z82A 2B4QA 1K3TA 2VNAA 3WGHA 5ICMA 1E5QA 3HDHA 1LC0A 3RJ9A 4AJOA 4J1TA 4UAGA 4RPJA 3GDGA 2POQX 1GQ2A 2DPHA 3S1LA 1N7HA 3OICA 4B3HA 3GHYA 4D42A 4FPXA 1KEVA 1QRRA 2A94A 3KV3O 2RIRA 5JY6A 3IJPA 3DQPA 1EUDA 4N7RA 4RL6A 1ZMOA 3MJ4A 5A3JA 3TL3A 4WLEA 1I5RA 5AQ1A 1PJ3A 3OSUA 2GN8A 3QJ5A 3ZI0A 1O6ZA 2PK3A 3RFVA 5EJ2A 4BO2A 2OP0A 3DR3A 5IDXA 1KS9A 2FHSA 3AJRA 4IS2A 5JO9A 1PGJA 1GZ3A 1UZLA 2OBYA 1JQBA 4LCEA 2IZ1A 4CM3A 5CDUA 1JW9B 4MIOA 1WZEA 1JKJA 1VC2A 3ZNNA 4RDIA 5BQFA 3AFMA 5LDGA 2X58A 2NVWA 5FI3A 1PQUA 4HXYA 2HJSA 1E3IA 4YJFA 5I9MA 1H6BA 5DBFA 4CMIA 3GPIA 1B0AA 4II3A 1M66A 2H1SA 3LVFO 4DPLA 3DONA 4I1IA 2AW5A 3L9XA 2B83A 3VKUA 3TL2A 3W4KA 4GWKA 3DFUA 4CUZA 2CNBA 3I23A 4WCDA 4WLVA 1X0XA 4E5NA 2V6GA 4D43A 5DF1A 4B7CA 1ONNA 1E3LA 4XJSA 4LK3A 3LT4A 5T64A 1GZ4A 4PVDA 1NWHA 2AG5A 2B5VA 1HLPA 1QV6A 2P9CA 1K5HA 4A27A 3A4VA 5KNLA 3PJFA 2GZ3A 4IIVA 5KJCA 2Q1SA 5A9SA 3GHHA 4D46A 1YB5A 3E18A 3W1VA 1PJQA 3LT1A 3WBFA 4N18A 4S3MA 2D3TA 3EDMA 3GVPA 4AJPA 1HKUA 4TRNA 5IF3A 4BOYA 3W4JA 2HO5A 2Q1TA 3OBBA 1D3AA 4IPTA 5KIAA 3CH6A 1B3RA 1HF3A 4Q3EA 1X1EA 2EGGA 4ALIA 1V0JA 3JQ7A 4E5MA 1AUPA 4EDFA 1Y7TA 2VTEA 3TNLA 4GSKA 2Q3EA 2GCGA 3ONFA 2ZB4A 1B2LA 2ZTUA 1U3UA 5I8WA 5IG2A 4YQZA 3E48A 3G0OA 1VI2A 3ENKA 4CLDA 3TF5A 2ZTMA 4EYEA 5HWSA 3JYOA 4TMFA 2I76A 1CETA 3L6DA 4PGFA 3WICA 4BNWA 3WR5A 2IDZA 4XYEA 1VJ0A 1NFFA 4XQ9A 1PZFA 4J2OA 3WGOA 1WDMA 2C20A 1V3TA 4YCAA 3GT0A 3HG7A 1T24A 4RLHA 3U62A 1L1FA 3RUIA 1A7AA 1HSZA 2GN9A 2PGJA 3WSVA 3K2BA 1I8TA 1DIHA 5CPFA 3Q6IA 2BLLA 4IS3A 1FK8A 2G1UA 2ZB8A 3NX4A 3EZLA 3PGXA 4R3NA 3NGLA 1W6UA 2YQ4A 2VZ0A 2EIHA 4BIIA 1JN0A 1N2SA 2BMAA 2HMUA 5FI5A 5JYEA 1EUCA 1GEEA 1A5ZA 5BNFA 3HB4X 1B8PA 2WWRA 4OH1A 3DZGA 4FDAA 3BIOA 2G76A 4BNUA 4FCCA 4NK5A 4EGFA 2HQ1A 2C29D 4BKOA 1P3DA 4YAKA 1D4FA 4FFMA 3E8XA 4PLFA 4BQRA 4PFJA 2QW8A 3ROPA 4ND4A 4BNLA 1DHRA 1Z7EA 3E03A 1YKFA 4XCVA 4AVYA 3M6IA 3RI3A 4BNIA 2O23A 4RO0A 3NT5A 3QWIA 3L0DA 2JAHA 4J0FA 5A03A 2BGKA 3DL2A 2YFQA 4YAJA 3JQDA 4B4WA 4WLNA 4NU5A 3V2HA 2QHXA 1TT5B 4ND1A 4CR8A 4J6FA 2YQ5A 3KLMX 3OJ0A 2C82A 3DZJA 4CL8A 1H93A 4NG5A 2PY6A 2I3AA 3FCOA 3IOYA 2AEJA 4OKIA 1D8AA 4B3JA 2FRDA 3PZBA 4E4YA 2AG8A 4GLOA 4IMRA 3RBVA 2P91A 4GPD1 4Y6PA 3BMOA 1I2BA 1R4MB 3WIEA 1GUFA 3ZWWA 1LQTA 4RCVA 4E2YA 2PZMA 4MIEA 3UAGA 1WLYA 2CMDA 3CXRA 4BGUA 5I7VA 4J4TA 1QORA 4XYLA 7MDHA 1X15A 1KY4A 4JCOA 1SEVA 4NNJA 1XWFA 3H9EO 4K6CA 5K0ZA 1GUZA 4LRTB 3RJ5A 3PEFA 4GSLA 2O3RA 1XSEA 1P0CA 2NADA 2EG9A 4DMLA 5H81A 9LDBA 4EEZA 1Q7BA 4HWKA 1LDEA 1VE9A 2PLAA 3LQFA 4INAA 1XR3A 2DUWA 1NPDA 1NPYA 3GLQA 3CZMA 4IINA 4DPKA 4Z0HO 5L7YA 3Q11A 1QYWA 3WOHA 1U4OA 5LC1A 3OA2A 5JPIA 3CE6A 1M76A 4BNXA 4CMJA 1MX3A 2AXQA 1XGKA 3ROKA 4ALLA 1TVEA 1U28A 2CFCA 2LDBA 4FR5A 4PG6A 1KVRA 4LVCA 4DPMA 3HZZA 2X0NA 3DBLB 3ON5A 2C07A 1W73A 1QP8A 1NFRA 4R3WA 1R4MA 5L40A 4G81A 4NJOA 5DBGA 4NFSA 4B79A 5ITWA 1GPDG 3DHEA 2Q50A 3PXXA 1F17A 5G0UA 1NASA 1ZW1A 2VYND 2XAAA 1UZMA 4R4JA 2R6JA 1O89A 3S55A 4AJ1A 4E5YA 1LEHA 4GLLA 2YFHA 4RVDA 4YT5A 5AXBA 4CQLB 3OJOA 3STHA 4L74A 2PH5A 4XX0A 2HDHA 3FNHA 3GRKA 1PJSA 1P0FA 1ISIA 1E1LA 2VYNA 4ALMA 3INRA 3ZWXA 3GA0A 1BVUA 1RYDA 3JQFA 4WCFB 1DHTA 5TC4A 2V6FA 3VPGA 1PX0A 1SEPA 4B7XA 2JAPA 4XGIA 1JVSA 5HA5A 3H5NA 3PWKA 3B20A 3FR7A 2PD4A 1LA2A 3ZNQA 1PL6A 2YY7A 1NAIA 1XEAA 2JHGA 1C14A 5ENVA 2VQ3A 5COBA 2GASA 1ADGA 2G82A 3WQQA 3C3XA 2X9NA 1HWYA 4YRBA 1LNQA 4MDHA 3GGPA 1Y1PA 3P7MA 1P1RA 2OXIA 1E3JA 1OMOA 2PKRA 1H94A 4TVBA 4CMGA 2VHYA 5TT0A 2P9GA 3ZHBA 3I9OA 4XDZA 5BR7A 3CZRA 2RH8A 2R00C 5COQA 4M54A 2YYYA 2WYVA 5B1YA 3WGIA 1ZSYA 2Y0DA 3HHPA 1E5LA 1HLDA 3NKLA 4NFYA 1F8FA 4R41A 2H6EA 5JMPA 2O2SA 3ORFA 3C24A 5L3ZA 1ZNQO 4GBJA 5BSFA 2TMGA 1PIWA 1W4ZA 4W99A 3I4FA 1C0KA 4YBZA 1S7CA 3I9MA 4L0QA 4AJLA 2RBEA 1GADO 1HDRA 1T4BA 3JV7A 4GL4A 4TZTA 4XYMA 5C3MA 1YE3A 2WSBA 4I9NA 4KQWA 2HMSA 4J1QA 4BO8A 3PI7A 4CMAA 1FXSA 2HCTA 3E9MA 3OMLA 3RC7A 1X1TA 3ANMA 4Z9FA 3D64A 2E82A 3PP8A 4IQGA 1PQPA 4I9UA 1B26A 1NVGA 4RVHA 4TROA 3TSCA 3VHRA 4FFLA 4RF3A 1U5AA 4RORA 2HMVA 4YB8A 3DO5A 1FDSA 3JQGA 4OXKA 3W4IA 3ICPA 1VL0A 1PEDA 4U6SA 4YPOA 1DIRA 3ZU4A 1DDOA 4U6QA 1LDYA 5IN4A 1Y8RB 2YHIB 3ETEA 2D2IA 3I9JA 1CQIA 2Y66A 4TZKA 2RHCA 1FDWA 4IDDA 5G4LA 1T2CA 4YWJA 5EERA 3VDRA 2X6TA 3FF4A 1HE5A 1U2GA 2NQTA 5JS6A 1E7SA 3CMCO 2Y0EA 2O4UX 3F3SA 4MPDA 1GYRA 1DC5A 2SCUA 4Q3DA 5KTKA 4PLYA 5JXWA 4JNKA 1PL8A 1NP3A 3W8DA 1YS4A 4WECA 3TZQA 1WMBA 3V1TC 1PS8A 1FDTA 2CSUA 2X5JO 4QQRA 3Q1LA 3VC7A 1LU9A 2WE7A 3W6ZA 2UAGA 4A7PA 3A06A 1IHYA 3F9IA 1E7YA 1VPDA 2G5CA 2DBZA 2E49A 4Y6RA 2DBVO 1FF9A 3LC2O 1R0SA 1LRLA 3TZHA 1Y6JA 4B8WA 1I0ZA 2NNLD 2C2YA 3IDSA 4J3FA 2D8AA 1ARZA 4YYZA 2OMEA 2Q2VA 4ZICA 1N9GB 3WMWA 2NM0A 1BXKA 2DKNA 3WFIA 4ZQBA 2VYVA 1XDWA 2JFGA 2UVDA 4CV0A 4TQGA 3KETA 5EL0A 4WLUA 4U5QA 3GEGA 3W8FA 1E3SA 1ZFNA 1XU7A 3KZVA 4U0JA 2HJRA 1DIAA 4MVJF 3JD0A 4MKXA 2EF1A 2ZTLA 3M2TA 2Z1NA 1T25A 4W9NA 4BV8A 3S2GA 4ZHSA 1KEWA 2RHRA 1JKIA 3G1TA 3AW9A 3D0OA 4RF5A 2OZPA 2GF2A 1GQYA 3SLGA 5TGDA 1C1XA 4J16A 4RQTA 3ST7A 1I2CA 2OGUA 5DBIA 5A3VA 2GN4A 4LSMA 4PG8A 4FJ0A 4A0SA 2GZ2A 1MA0A 4TVOA 4I5EA 3GK3A 5CFZA 4BO1A 1DFHA 1NHWA 2CVZA 3NT2A 3GMSA 5H82A 2I6TA 4DQVA 3FWNA 4EUEA 5K6AA 1QLHA 2GNAA 2IEBA 4HV4A 2HLPA 3VOSA 3KRTA 4Q3CA 3D4OA 4LRSB 4YAEA 3QWFA 3RBZA 4RVSA 4IQ0A 3ULKA 3JQ6A 1GYPA 2EP7A 3JD4A 4XDYA 3AUSA 3WX0A 1XLTA 1U1IA 4JIGA 2Z95A 4PLWA 2B4TO 2X5KO 3INTA 4RVUA 1G6KA 3LSYA 5L4LA 4IIUA 1JAXA 4YRAA 2QIOA 1C0PA 2D0IA 1HT0A 4EI2A 3HNPA 2NV6A 4IUYA 2OOSA 4ONEA 3MJEA 3RIHA 5AXCA 3WJ7A 2C54A 1DEHA 2BGMA 5JDIA 2BFMA 2O48X 1YO6A 5L51A 4DC1A 4BO6A 3QVOA 4BNZA 1XU9A 1B15A 1WMAA 3GFBA 4CV1A 1RWBA 2OBNA 4M87A 4O1MA 3RROA 4XIJA 4OAQA 1JVBA 2W2KB 2I66A 4XYGA 1IHXA 2Y1FA 4M89A 2V7PA 3H2ZA 1LBEA 4P4LA 4BKPA 1SB9A 5CAEA 1R15A 4MVJI 1ONPA 3TFOA 2C7GA 3WBBA 2QQ5A 3GFGA 4FD3A 4XZ3A 1GCOA 1UAGA 4RPKA 3DB2A 1R12A 5I7SA 2EW2A 3GG2A 3KUXA 3F1LA 4JBGA 3DMTA 4BO9A 4BO4A 3HWRA 2NU6A 4MJLA 4W7IA 3G17A 4NBWA 3D4PA 4E2WA 3TZ6A 2E4AA 2VHXA 1BW9B 2NU8A 3RU9A 4KOAA 1VSVA 2DTXA 3ASVA 2FSSA 2CD9A 4DA9A 5FEUA 4YACA 3L4BC 3H7AA 1NXQA 4BNHA 3OHSX 3PHLA 2EXXA 1M75A 3GAFA 4CMBA 3FPCA 1F8GA 1X7GA 1I24A 3LLVA 4JROA 1E1KA 3X2EA 3HUDA 2I3GA 3DWFA 2X4GA 1HDXA 1N1EA 3NJ4A 4KZPA 8ADHA 3JQBC 3K5PA 1YXMA 3RC2A 4BNVA 1AHIA 5TLSA 1NAHA 4OQYA 4XD2A 3A14A 3T4XA 3CPSA 3HB5X 4O5OA 3AOEA 3MTGA 3HSKA 3LU1A 3WYEA 2EJWA 1OBFO 1Y9EA 3KSUA 2PWZA 2XPCA 3GN2A 3OJFA 4MVJE 4WKGA 2UV8A 3DZIA 5B4VA 3HDQA 4F3YA 5C37A 4RF2A 3PHIA 1WXDA 1SNYA 2HK7A 4WJZA 4OSPA 1YRLA 4FSHA 3LK7A 5CEFA 3ZW9A 3U4CA 2DTEA 4R9SA 4XKJA 1UXJA 1NPTO 3OIFA 2ZJ0A 1FDVA 2GZ1A 4JN6B 3ADOA 3KEOA 3BTOA 4FW8A 4BNJA 4CL3A 4OXYA 1WVGA 3ENNA 1C1DB 1O9BA 3NT4A 2VTDA 1LDGA 3GZNB 3X2FA 4YEDA 3ETDA 3G3EA 1SO8A 4TKMA 1ID1A 2OUIA 4NDNE 4Q3AA 3PTZA 2X1HA 1HXHA 1XG5A 1ZCJA 2HMWA 3S2IA 1PWZA 1BSVA 5KWEA 3L6OO 3FR8A 3AI1A 2Q99A 3UN1A 1U9JA 3MCVA 4R1NA 3KYBA 1V8BA 4U7WA 3NUGA 1YQDA 5DOVA 5KJ6A 5ER9A 4HNGA 1QR6A 4Y8VA 1J0XO 1YWGO 4IBOA 5JY1A 5K9ZA 3SVTA 3PHHA 4UUNA 1W8DA 1ZO8A 1VM6A 4KUEA 2LDXA 2ZTVA 2O7QA 3DOOA 3UCXA 4CJXA 4QTZA 2X5OA 4WNCA 4JXKA 5DDIP 4CMEC 4FOSA 4LW8A 2I5PO 3MJTA 4OO3A 1CRWG 4JBHA 4K9DA 1ENOA 2O4CA 4AJNA 4CMCA 4L4SA 4RGBA 3DOCA 4GX0A 3ZNOA 3P19A 2J3KA 3DZKA 3WWYA 1A27A 3OQ1A 2DBRA 1E3WA 1BDBA 5KKCA 4YVFA 3MWDB 5JAMA 4CR6A 5IDWA 5TS3A 1C1DA 3U3XA 4Z9YA 3GZNA 3PVZA 3WNVA 1G1AA 1U3WA 3KYCB 1UP6A 4BNMA 1EFKA 3EGOA 1PGNA 3ZV4A 1EDZA 3Q9UA 3I6IA 4DLLA 4DYDA 2F00A 3BTUA 2IE0A 1ZH8A 5C7OO 4D3SA 4RPHA 4M8SA 3TZCA 1CQJA 5JNLA 3P2OA 2VOJA 4HFRA 3QY9A 3WLFA 4J7XA 4AJIA 1FDUA 1OC4A 3F5QA 2QRJA 5C5IA 3CKYA 1PSDA 5C7IO 1B8VA 5I7EA 3B1FA 3PQEA 3KLPX 4MOWA 3PJEA 1P1KA 1EQ2A 2X86A 4IJKA 3EMKA 4NI5A 3LYLA 4YJGB 2VWHA 2PGDA 4YDRA 2BFAA 3DZFA 4H16A 4G2NA 4WK6A 3OEYA 3I52A 1EUZA 1T2EA 1SCUA 4O0LA 3R3SA 4E32A 1E92A 2J3IA 2NWQA 2X9GA 3JQ9C 4W82A 2J5KA 4IJWA 5JSFA 2A92A 1D1SA 3F4LA 1UDBA 3WB9A 1UH5A 5COAA 4DWVA 2EKPA 3PWSA 1VRWA 3PLRA 4O63O 3WJAA 1ENPA 2BH9A 4JLWA 3RKUA 1GUYA 4BO7A 5CPBA 2XF8A 4Z3KA 2WYUA 1QYDA 3LLSA 1J6UA 3WGQA 1EK5A 2FZEA 2YDXA 3RFTA 2QZ9A 1H9AA 1T2AA 1GTMA 5KJEA 3D3EA 4JQCA 4UREA 3ZWNA 3PWZA 4E2ZA 1K2WA 3DMYA 1K6XA 1KVTA 5T8KA 5IZCC 3VTFA 3JYLA 5DZSA 3D5TA 4Z0PA 5KJFA 1E7RA 1KEPA 2IYOA 1HSOA 3HJAA 4C4OA 4ALKA 4IDFA 2VRBA 1P44A 1YBVA 4E21A 5EPOA 2HKIA 3RUDA 1JWAB 3MOGA 2J5RA 4I5GA 2DVMA 4NQZA 5A04A 3AY7A 2JCYA 2VRCD 2J3JA 3C1TA 3UCEA 4BO3A 3Q2IA 3C8MA 3D7LA 2C2XA 4QXMA 5JBIA 1WDKA 4KUGA 3KYDB 3JD1A 4JJGA 3K30A 1UXHA 1CEQA 4WOJA 4JJIA 1YB1A 3BHIA 2VRCA 4S1VA 2EEZA 4EZBA 2E37A 3KVOA 4FGSA 2WM3A 5I9LA 3DOJA 3K92A 3ASUA 4IMPA 3U4HA 4U0KA 3QSGA 4LN1A 3WS7A 6ADHA 3ZU3A 1Y5MA 2PV7A 4FS3A 1LQUA 2Y0CA 2YDYA 1ZEMA 4XB2A 4EUFA 5EIOA 4DTIA 3FNFA 1K89A 2PGLA 4J4BA 1C3VA 4N5MA 4E6PA 1MGOA 3OH8A 3COSA 3GGOA 3RBXA 4YRDA 4IQ8A 2P4HX 3CTMA 3NDIA 1E6UA 2UUOA 2NVUB 3UICA 5JDCA 3QA9A 1NQ5A 2Y93A 1T2DA 3U4DA 1NQTA 5KOIA 1SOVA 2HRZA 2OL4A 3E5MA 3DAPA 5FYDA 3VZSA 3PIDA 4MINA 1SB8A 4EJ6A 1QKIA 1TEHA 1A9YA 1ZSVA 3GVIA 5LDHA 4WASA 1F12A 1XQ1A 3QVSA 1BGVA 5A5EA 4AJKA 5L4NA 2C5EA 1KC3A 5DCWA 4AFNA 1WNTA 3EW7A 3LC7O 2V6MA 1LSSA 2ZQZA 2PR2A 4RDHA 2FWMX 4CV3A 2GERA 3ZW8A 5JMWA 4KDFA 1CDOA 1ULSA 5A1TA 1NR1A 2A4KA 3S2FA 3H9QA 3ZWMA 3F1KA 3QLJA 4PZCA 4YT2A 3DHYA 4ITUA 4OGWA 1Q1NA 4P38A 1E0DA 1QYCA 4K26A 4AJ4A 4NBTA 3GG9A 4R01A 1JAYA 5HRUA 3K2EA 4HP8A 4LISA 1AXGA 1EE9A 4BHTA 1YL7A 1LI4A 2WD7B 5L7WA 5EMHA 1SOWA 5A06A 3CUKA 3N74A 4DRYA 1IOLA 3KTDA 1GEGA 4D0SA 1FJHA 4PRKA 3GDOA 4KQXA 1N8KA 2NVUA 3AI3A 2QRLA 4ALNA 4GMFA 1N7GA 1R0LA 3VVBA 5L9AA 2VHWA 4CQMB 3GNSA 2JCXA 3PHGA 3IIEA 3WNQA 1TT5A 4IDAA 3KOUA 4NK4A 4ND2A 2Y1GA 2O2YA 3MZ0A 4NPCA 3D3WB 1GPJA 2P4QA 2Y1DA 2CDAA 4JP2A 2D5CA 1ISMA 4J49A 5LCXA 2EKLA 1AGNA 2P5UA 3BTVA 5EQFA 4ZD6A 3ZDFA 5JAIA 1BWSA 1MFPA 1B3BA 5IDYA 3JTMA 1DFIA 1I01A 1PTJA 1GDHA 1PJLA 1UXGA 4XR9A 5ILOA 3R6DA 3GAZA 4HUJA 1CYDA 5L95A 1EZ4A 1U5CA 4ZQFA 3M2PA 2X22A 5KCZA 3NTRA 2JL1A 5G4KB 5BT9A 1CWUA 1F14A 5CDTA 2JD2A 1MG0A 3R1IA 2CDCA 3PQFA 3HADA 3I6QA 3NGXA 2FR8A 4JK3A 3JQ8B 4UEKA 3WGGA 3KB6A 1ZSNA 2FPIA 4CMKA 4IDGA 2HUNA 3VPSA 1WWKA 2GGSA 1HDZA 4OOFA 4GAEA 4RVFA 3D3WA 2W2LD 3HQ4O 3WTBA 3MJSA 1E77A 4IY1A 4PZDA 4CODB 1R37A 3RQSA 5IN5A 3DBLA 2Y05A 4KTTE 3I83A 3DEYX 1AE1A 5F1PA 2X0IA 2W2LA 2ZB7A 3U0BA 3FN4A 4NJMB 4ZVVA 4XR4A 2VOEA 3S2EA 2ZK7A 1PJBA 1GCUA 2F1KA 2VHZA 3B6ZA 1ISFA 3LF2A 3QQPA 1BVRA 2WYWA 2GYYA 4U8GA 3AU9A 2JKVA 3DTTA 4N5NA 4TRRA 4B4VA 3BA1A 3AY3A 5CG1A 4IGEA 4CQLA 3ZNPA 1CIVA 2J5QA 5G4KA 4XRGA 2OHXA 2UUPA 1DBVO 3BMNB 3FI9A 2OO5A 4LMPA 4RPLA 4Y9DA 3L77A 3K73O 1CJCA 1YBMA 1FMCA 1U7HA 2UYYA 1LLQA 2PD3A 4WCFA 5BNTA 1TA4A 2Y99A 3ANNA 4ZRNA 4ZQEA 4YJHB 1GD1O 3O03A 4F46A 4ZQHA 1XQ6A 2GLXA 4F45A 4AJ2A 1T1RA 1VSUA 1PGPA 1Z74A 4EJMA 3GUCA 3PYLA 3IL2A 2Z5LA 4P4NA 7ADHA 1Q7CA 3SLKA 3TPCA 2Y1CA 1E3EA 4BKUA 3WGZA 1EEHA 1LRJA 4CM9D 3WQRA 4BMNA 2OP1A 5HS6A 4MIYA 5G0TA 3RC1A 1P1JA 3H8VA 4NZ9A 1KOLA 4MKZA 3DBHB 1P77A 1QMGA 4XQCA 2BRUA 2RCYA 4XYBA 4UVIA 5JE8A 3B1JA 1IZ9A 4DBZA 4KUHA 1K6JA 1WAMA 1Y8QB 3HN2A 4CM9A 3TN7A 1BTOA 4FIZA 2B36A 3UGKA 1M67A 1GR0A 1BMDA 3QWHA 3W6UA 3MJVA 3R3JA 1YGYA 3QWBA 1U2DA 3HFGA 6LDHA 4Q39A 5B37A 4K6FA 1LDBA 3FNEA 3UW3A 2VYVD 3AWDA 3V8BA 3FTPA 4PCVA 3ZHXA 2ZCVA 4CM8B 5GZ3A 4P22A 2CVQA 1DRUA 1IY8A 5IFLA 2G17A 2EGHA 2AE2A 1LDMA 1GY8A 4PVCA 1RM0A 3JQFC 1PGOA 2Q49A 2NTNA 5MGBA 4BKQA 3TQHA 4JGBA 5L4SA 4NH4A 1ZBQA 1Y8RA 2YHIA 2YW9A 4IDBA 3RFXA 1SC6A 3FD8A 4A26A 3UKOA 2D59A 1DC4A 4CM4B 3GDFA 2AE1A 1D1TA 1C0LA 3CINA 3GNQA 1VLLA 2B5WA 3JQAB 2JFFA 3GVXA 5ICSA 1ZUD1 2IXBA 1PQWA 5TJ9A 2DU8A 3NV9A 2IZZA 4B8ZA 3H3FA 3TOXA 1DIBA 2PKQP 3AFNA 3UF0A 3PJDA 1PJTA 1MB4A 2VWGA 2Q1WA 1MG5A 4MP8A 4AJEA 4A10A 1JLLA 4IJUA 1Z6ZA 2DTDA 3AI2A 4J7UA 3NRCA 4WUVA 5F5LA 3WQSB 1V9LA 2XXBA 3U9LA 1V3UA 1Q2XA 3HDYA 5JCJD 3ZN2A 3OA0A 3GR6A 2GPTA 1XELA 4OKNA 3FTNA 5JFOA 2O50A 1B14A 4W6ZA 2YV3A 5DCUA 3DAFA 5JLAA 3IC5A 1N9GA 3O9ZA 1IULA 4O59O 5F1KA 3TFQA 2CDBA 2Q45A 2GRAA 5L45A 2XOXA 4FOOA 5JCJA 3F5SA 1Q0LA 4KDEA 1A71A 1RM5A 5THKA 4BO5A 3H9GA 2J3HA 1ISGA 4A73A 2FMUA 5F3RA 1YB4A 1WZIA 2R2GA 4YJDA 4FFPA 4CLOB 2ZQYA 1KYQA 3ANLA 4QEDA 1O0SA 3DBRB 4WNIA 2QRKA 1YL5A 1XA0A 3PRJA 2IXAA 4LVUA 4MKRA 4F6CA 3ZH2A 2RAFA 4YT4A 3ZWBA 2P9EA 3AM3A 3E82A 4DIOA 1IB6A 1ENYA 3D4NA 4CLXA 3TJRA 3LZ6A 2I9PA 4E33A 3U5TA 5U1PA 2Q1UA 3ZWAA 4HADA 1DJNA 3FWZA 1T4DA 2EERA 4Q3NA 3IKVA 5B4TA 2C7VA 4IM7A 3WXBA 1YJ8A 3RAJA 1P1FA 3WIDA 4GKBA 3OETA 2NUAA 1HYHA 1MXHA 3KSDO 4GGOA 2EJVA 4AJHA 2GUGA 3ONEA 4GX1A 4ALJA 4E2XA 1NBOA 3JCZA 4D41A 4TKLA 1RM3A 4MVJG 3IMFA 4X54A 2NVBA 1Q7GA 2QG4A 4XWYA 5G0VA 1DC6A 2CY0A 4D7AA 4Y67A 3CIFA 3H5AA 2C59A 3WYCA 4D45A 1NR7A 1ZK3A 1PJ2A 3PK0A 3L07A 1VKNA 5TX7A 5BSEA 2P2SA 5ES3A 3MEQA 1DO8A 3UFXA 3ROQA 3IQDB 1DAPA 3WGTA 4L9RA 3VDQA 3F6YA 4QFCA 3PFFA 4XGKA 4NBRA 5JYDA 4NBVA 4OIMA 3ICCA 1YDWA 2W2KA 2JHFA 4AG3A 3AUAA 4W9NC 1HDYA 4RQUA 3GVHA 1ZK4A 1GV1A 3HFSA 3VZRA 3EZYA 2WDZA 4WPGA 2O3SA 3PLNA 3ZV3A 4C7KA 3QIVA 4D79A 2IODA 2NSDA 1U8XX 3F4BA 3OQ6A 4K1LA 4QFDA 1EK6A 3AY6A 5TSDA 1E7WA 3BMCB 1TXGA 3EVTA 4OQZA 4Z6KA 4Y98A 2DUUA 2NTJA 2YZ7A 1EVYA 3ETGA 4F6LA 5K6AC 1PGQA 1EE2A 1BW9A 1J49A 1KVSA 1HE2A 2B37A 1I33A 4IXTA 4J9VA 4MO2A 5IJZA 4WEQA 2QX7A 3AM5A 2FOIA 4IJVA 5G2OA 2DT5A 4I9HA 3C7CB 3IKTA 5FF9A 1A7KA 5ITVA 5KVCA 4I5DA 1HE4A 3ZU2A 1YL6A 5AXAA 2E48A 3IUPA 2CZCA 1IE3A 5DN9A 1JTVA 2FZWA 3INGA 4Q3BA 5CG2A 5A5FA 3GF4A 4CMHA 5BNIA 1E1MA 3SXPA 3JYQA 4IZIA 1NHGA 4EITA 5JDIC 2PZJA 3EVNA 5F21A 2EW8A 1GAEO 4OJNA 3O26A 4D3FA 1ZJZA 4DQXA 4QUKA 4UVGA 1WP4A 1I3MA 4PN3A 5GZ1A 2DQ4A 3JD3A 3DZBA 4LCJA 1EBFA 4GVXA 3IS3A 5CHEA 2VHVA 5JAQA 3BMCA 4IZHA 2CVOA 4OSOA 4BNTA 4E0BA 3AUTA 4YQYA 3RASA 4I8XA 3BYZA 5A4DA 1EDOA 1X14A 4ZA2A 1D7OA 1DIGA 1KIFA 3UXYA 3VVCA 8LDHA 4YJFB 3DMTC 5DULA 1HYEA 4OMUA 4LMRA 1MC5A 4CLEA 3LC1O 1PZGA 4H3VA 4CMIB 1X7HA 1HL3A 4ND5A 1ZKMA 1UP7A 2VUSA 4UUMA 3W8EA 5CDGA 4TSKA 1UDCA 1HZZA 4M55A 5CP8A 5KJ1A 3GVCA 3WDSA 3H6KA 4NMHA 4MVJD 3GH3A 1X7DA 4B4UA 3ZWOA 4BV9A 1P45A 3RUFA 2P5YA 1Z75A 4NU6A 2BF7A 3RUEA 1V6AA 4BVAA 2I67A 2W8ZA 1JKFA 1O95A 1YQGA 5A9SB 4YXFA 4O6VA 5G0WA 4NR0A 1OOEA 4HKTA 4MVJA 5CDYA 2Q4EA 4WOKA 4KWHA 3ZZNA 2IRWA 4DREA 1R0KA 4GMGA 3MWEB 2X0JA 4Y6SA 2BFPA 1YBAA 4GGPA 3RCBA 3AOEC 4H7PA 2H63A 1LTHR 1T26A 1PJCA 1Z45A 2FR1A 4TWRA 1IUKA 4E3ZA 3AU8A 2XXJA 4FGWA 4XGNA 1ZEJA 5T6BA 3JQ7B 4MVJP 4C7JA 3P2YA 4P8RA 1WW8A 5A9RA 4EEXA 2EV9A 1O94A 2GD1O 1YONA 1SAYA 3K9QO 4NBUA 5TJHA 1X0VA 4E5PA 2FN7A 3KHUA 3KYCA 2A35A 4GI2A 5JCXA 4TRMA 1P9LA 1VL6A 4PLGA 4BNFA 2BI7A 4D3DA 1JDJA 4PZEA 1ULUA 3BTSA 1HTBA 2P68A 2I65A 3U4IA 4N5LA 4IXWA 2WEKA 2JD0A 5AYVA 3BXXA 1H6AA 4L73A 3AK4A 2W98A 2X9VA 2FY8A 1O8CA 2DM6A 3EK2A 5EN4A 5J23A 3GUYA 1UZNA 4CR7A 4M86A 1EVZA 5HM8A 4FC7A 1KEUA 1DLJA 3QVTA 1P31A 3GN1A 4QSMA 4RPGA 4J43A 1H5QA 3I9NA 4YJGA 1W0CA 5AOVA 4R1UA 3DBVO 2FR0A 3ZHZA 4L4RA 3KO8A 1IPEA 2JFHA 2OORA 2ZCUA 4CV2A 3SBOA 2AQHA 4R16A 4RVGA 5EINA 3PGJA 2B69A 4BGIA 4J1NA 4RV9A 2ZB3A 3S8MA 4CPDA 1HZJA 2EP5A 2CUKA 3G1UA 1IYZA 4Z3DA 4BKRA 3C1AA 4R68A 2J6IA 4DLAA 1EMDA 1HETA 2VZ9A 2WMDA 2VNSA 1R16A 1NQOA 1TT7A 5DOZA 3A28A 3I5MA 1R4NB 3ONDA 2DC1A 3DTYA 3LT2A 1GYQA 4ILKA 4BS9A 4CM6A 3ROMA 3UHAA 4E13A 3DXFA 4BMSA 4UUPA 4ZJUA 1Y5RA 4GQAA 3SC4A 4MP6A 2O7SA 4OYRA 3PDJA 3E9QA 1H9BA 1KBZA 4DC0A 2PFGA 1DLIA 2ZKLA 4II2A 4HX5A 4AL4A 1PS0A 4PIVA 4PG7A 3BMOB 1ZJYA 1PZHA 5DP1A 1NVMB 4W7HA 4CUKA 2YV2A 4KMSA 2HRBA 2BHLA 3C1OA 4UULA 1EQUA 3HN7A 4ZRMA 4EJ0A 3NTOA 1EVIA 4GH5A 2V6BA 4FC6A 1UJMA 4UUOA 2EWMA 3OIDA 3VZQA 3DHNA 2PZKA 2Y1EA 1G0OA 1H6CA 3EC7A 1DFGA 4G5HA 5H83A 3WTCA 4BGEA 4URFA 3ZWCA 1A4UA 4IDEA 5C7LO 4R5MA 3QW2A 1KETA 1LC3A 1I32A 3KYDA 5A02A 3AM4A 4TRJA 5U4QA 2QYSA 3Q0EA 4XRRA 2D1YA 4R1SA 4GKVA 1R4NA 3M1AA 1SMKA 2C0CA 4J4HA 1ML3A 4UVDA 1UXKA 3O38A 3Q3CA 4R5HA 4WLFA 2H9IA 3GZ4A 5TNXA 2QYTA 3V2UA 1I3KA 2FP4A 1MC4A 4KTVE 5EESA 3VH2A 1PZEA 5IXYA 3ZV5A 1BHSA 3PJGA 3PPIA 3DC2A 2ZYDA 2R00A 2E6UX 3BAZA 4GX2A 1CERA 2WJPA 3V1UA 3JD2A 1K0UA 1YJQA 3M1LA 3ZGYA 3CMMA 3MOIA 3FSRA 1LSOA 4GX5A 4DGSA 5KVVA 4JBIA 3DDNA 3R0IA 4CM7A 1DXYA 2O3TA 2VWQA 3GGGA 3SX2A 1PJ4A 1PWXA 5F1OA 1VJ1A 2FPGA 3ZU5A 5T8KC 3L6EA 2DFVA 1ISHA 4CUJA 1B16A 4K28A 1UUFA 5IZ4A 3DZHA 3E9NA 3TZKA 1NWCA 1XYGA 1ZXLA 1VKOA 2IZ0A 4PLPA 3QWAA 4BNNA 4OM8A 1AN9A 5GMOA 3KXDA 3K8ZA 1SPXA 3VH3A 1E1NA 1UR5A 2GDZA 3L9WA 1NM5A 4FFOA 5I7FA 2HMTA 1HDOA 4MP3A 3C85A 4EW6A 3LT0A 4BB6A 4R69A 5B4UA 1JA9A 3SEFA 3Q2KA 3H5RA 4QT0A 2NLOA 1BXGB 2O3QA 4ID9A 3V1YA 4XQGA 2YUTA 4GVLA 2BFOA 1O5IA 2B0JA 4FQ8A 1U3VA 1I36A 2EKQA 1MFZA 1NYTA 1YDEA 2WD7A 4QO8A 1DB3A 3KBOA 3BHMA 4CQMD 1H0KA 2DAPA 1QLJA 4FJ1A 1P1HA 1WPQA 2NTVA 4RZHA 3TOZA 4DQUA 3NDJA 1OI7A 1ZIDA 2HAEA 2X7HA 5JC8A 3PHJA 3GRPA 5DT9A 3ABIA 3PYXA 3WLEA 2NACA 3IUSA 4QECA 2DFDA 4B7UA 3B70A 4L4XA 3T4EA 4CQMA 4H15A 1NFQA 2X8LA 1ADBA 4ZQGA 5ILGA 3SJ7A 1OFGA 3MJCA 4A5OA 1A72A 3N58A 3RU7A 5JDCC 2Q2QA 4BGVA 3H4VA 1NTOA 2ZJ1A 1M6HA 3OJLA 3WSWA 1YOVB 4AJJA 4DYVA 3HDJA 3V2GA 2DBQA 3BMQB 1LX6A 3QV1A 1GV0A 1HRDA 3I1JA 2BD0A 3WG9A 1E6EA 1LRKA 3ZHYA 4BNKA 1DPGA 3DAGA 1H2BA 1S6YA 4J1SA 1TI7A 1HYGA 1BXGA 1DSSG 1R66A 1UDAA 1TLTA 3RWBA 3PDUA 2Q46A 4CLRB 1G0NA 2D5AA 3JQGB 5TIIA 1T1SA 4GWGA 3UUWA 3EYWA 1MUUA 3EAGA 4YT8A 1V3VA 3O8QB 2Y68A 1L7DA 4ZGWA 3AOGA 1ENZA 3OIGA 1LSJA 3V5NA 3CEAA 4OL9A 3RSHA 3JQ8A 2VT3A 1PU2A 4JJFA 9LDTA 2Y1OA 3KM0A 4HFNA 1RKXA 4FB5A 2GR9A 4DVJA 3IAHA 2D4AA 1ONOA 3RD5A 3L4SO 1GFSA 1U8FO 1UAYA 4RJTA 2WTBA 4PLTA 2H5LA 4Z9XA 4PG5A 2B35A 4Z0TA 1ADCA 3K31A 4J91A 4ZN6A 2FSVA 5CDSA 3KEQA 1YOVA 2OFPA 3VAZA 3NTQA 2AEFA 4R51A 4G65A 3BMQA 1UP4A 2GO1A 2ZIZA 3WYBA 1AHHA 4ZU3A 3NAQA 5ENDA 1H2HA 1JWBB 4HNHA 2HU2A 4YTEA 1K6IA 3MTJA 4NJMA 4PG4A 1MP0A 4UEJA 1DC3A 3TDKA 3U49A 1LUAA 5TRTA 2AHRA 2YHUA 3Q9NA 3H9UA 3BZUA 4PLCA 2IYPA 4ROSA 1Y81A 1DRVA 3TWOA 4CLRA 3GEMA 3O4RA 4EUHA 3JQCA 3TRIA 4E31A 2VCYA 3EY4A 3BHJA 2Z1MA 3ZWYA 1QSGA 1F06A 3O8QA 4YAIA 3BMNA 3QRWA 1T2FA 1ADFA 4E30A 2PTGA 2PZLA 2AQ8A 5T67A 4YA6A 3JSAA 3OJEA 3HE3A 5JW6A 3SC6A 1ISJA 4R1TA 1KERA 1EVJA 3QVXA 3A9WA 4DL9A 2ILTA 4D44A 4UVHA 5HBRA 4P4GA 5BSHA 4YJHA 5EQDA 4J90A 1LLDA 3IJRA 4Q9NA 1SBYA 4A03A 3OFSA 1C1XB 3JYPA 4CM5A 1LLCA 1KC1A 4NIMA 4DXHA 1A4IA 5CEEA 3ZWVA 3GY0A 4RF4A 5I8ZA 3GC6A 1BDMA 5HS4A 1I2ZA 4IDCA 1NX6A 4XA8A 3PIIA 1BG6A 1V35A 4BB5A 1M2WA 3P5SA 3OECA 4UVEA 1OZAA 3QHAA 2BI8A 3D1LA 4WE3A 1J5PA 1LLUA 3RUHA 1HDGO 2VUTA 1EFLA 5DNAA 3G49A 2HSDA 3RUCA 4XJTA 1PL7A 4CLHA 1VL8A 1GZ6A 3L4BA 3DBHA 3G79A 2JJYA 2ZYAA 1M6WA 1ZK2A 3FBTA 1LDNA 5CEJA 5IDQA 3VH1A 1Y8QA 3VPFA 1N5DA 1KVUA 4HY3A 5THQA 1CF2O 5DP2A 3ITKA 1NQAO 2EHDA 4FFRA 1B8UA 2Q4BA 2VUUA 4L75A 1RJWA 1P1IA 4ESOA 5A9TA 2PA3A 3JQBA 4OOEA 5F5NA 4KWIA 4RLSA 1DAOA 5JAZA 3H3JA 1I3LA 2ZYGA 3C7AA 1J4AA 3K96A 1XKQA 1GL3A 2PD6A 2AEMA 1KY5A 2X23A 2Q2WA 4QO7A 4MVJM 5B12A 3VZPA 1HDCA 4CM8A 1C0IA 4J0EA 1YH3A 3RC9A 4M1QA 1QYVA 5ER6A 2FPPA 3NYWA 4DIFA 4PRLA 4N54A 2NU7A 4WCFC 2AMFA 4EBFA 3VTZA 1VJTA 2CF6A 4NFHA 3JQAD 2I99A 4D0RA 1B7GO 4KP7A 2JD1A 4HFMA 1E7MA 3FPLA 3UH1A 4LGVA 5BSGA 1U7TA 3WMXA 3GQVA 1SZJG 4W4TA 4CM4A 4CM1A 1Q0HA 2B4RO 3A1NA 4I08A 4MVJH 4J9UE 5DCYA 3ADPA 3E1KA 1KVQA 1I10A 3RVDA 3JQAA 1R6DA 3EUWA 1N1GA 3E6AA 2PH3A 3K6JA 2BELA 4OHUA 1DRWA 1ZZEA 1I30A 1RYEA 1ZK0A 4B4OA 5GY7A
chains in the Genus database with same CATH superfamily
1KGSA 4HGRA 5E1MA 3DOEA 1QYXA 3FPSA 1R6VA 4PX3A 2VZ8A 3D5QA 4UQOA 1KARA 1V1MB 1GA1A 2Q5IA 3T7CA 1CUBA 2ZM5A 1IPFA 1E3DA 1PR3A 4HO1X 4L3VA 4UFOA 1FQWA 3GBPA 2O3JA 1L5FA 1QIMA 1NXPA 4IIBA 1MN6A 4BMVA 4DBVO 1BC5A 3FBGA 4A2PA 5L53A 4H0NA 5EFZA 4LXTA 3I9KA 4PCLA 2FN3A 4DCVA 4YCDA 5AK0A 2W37A 3B3JA 1G21B 3VH4A 5TQVA 3VU8A 3NLLA 4PAMA 4C7VA 3NHSA 2NZYA 5BYAA 4RQAA 3KFLA 4XCQA 1XCOA 2DZDA 3AEQB 1YUMA 3TCNA 1F3OA 5A62A 3TLMA 3ICWA 4HFJA 1WCIA 2CL0X 2FFRA 2EX1A 4LZZA 3WRWA 3QX7A 2HK9A 3A3OA 5IAAA 2MSNA 3NC1C 3IESA 2IYSA 4FDTA 4E5SA 4JLNA 1O8BA 3PE6A 2CNOA 1QNFA 2B98A 2F6RA 2VT2A 4Q4AB 4TTSA 3O92A 5FKJA 4CLOA 2AQIA 1QANA 3GFFA 3UVEA 1P74A 2YZ2A 1DC8A 4EYSA 3RAEC 1TLFA 1LPSA 2XY4A 4EX6A 4KI7A 1IN8A 4CNBA 3I5YA 1XEWY 2ECKA 4WGGA 3CSDA 1YQXA 1HEUA 5ADWA 3PFWO 3L8ZA 5JC1A 1CY2A 4BEWA 5C46F 1TKCA 3I9V1 3NBYC 4NSNA 2WU0A 4QUJA 1XTVA 4IKOA 4OUDA 1ZMTA 1NI5A 3CZPA 3S5JA 1OFHA 4YCCA 4DM7A 1SD1A 5CB8A 1L7EA 2JH9A 3DCNA 3I04M 3PXEA 4GI5A 2VTBB 2PHZA 4F9TA 1OAAA 5KVSA 5HIKA 2AFHE 3PPYA 3UK7A 1XDSA 1XP5A 2WF9A 1NR5A 1OPRA 2WU1A 2QUKA 1KDTA 2YWCA 2OHFA 4LS3A 4RZIA 1GAJA 2WFLB 2XMBA 1L5WA 1JU9A 5HK8A 4OJTA 4LF4B 1E89A 2UZ1B 3G5LA 1W5TA 3H87A 3NP9A 3G9UA 2AVDA 2E21A 3MYYA 5E1OA 3ZWPA 3GEDA 3GOHA 5HIJA 2IYVA 1WMSA 4KXYA 1WIWA 3BK2A 2H51A 3LF1A 4GVPA 1W4CA 1YRYE 1X7WB 2WVGA 2JLSA 4ZARA 2NSJA 2QV7A 1Z73A 4WXPA 5CDHA 5JAOA 2AWNA 1E9BA 4QBGB 1ZCFA 1A0OA 1VQ1A 2CHEA 1KMIY 2R8EA 3HCFA 3QVUA 1W7AA 2V97A 3F46A 5TMEA 4PFKA 3UUEA 2ZATA 2BGWA 2D13A 2OK7A 1HRKA 4KPYA 3V1MA 3OQNA 2JB9A 3IGFA 2QRZA 5AVJA 3HCDA 4H2DA 3H5VA 2E0IA 4HH0A 3N7UA 4HRAA 3H05A 4LGYA 4YP7A 2QM0A 4X91A 1U8YA 3QPUA 4JLKA 3HV2A 1GRCA 4QBTA 3RS9A 1NU8A 4JA0A 4JP3A 1ECLA 1L5SA 2AI1A 1UBOS 4GE3A 3QP9A 4FYJA 1QFYA 2HSJA 3AP3A 4ND3A 2NGRA 3TCKA 1YQUA 2PRIA 3BWMA 3S1SA 2AQKA 2P27A 1GGMA 3PXGA 4LW8A 1VLZA 4B4DA 1Z3IX 3NNDA 4KDRA 1KKUA 1J23A 2YIMA 3FFWA 4JX8A 3SJUA 5AIBA 1W5BA 5IAOA 3OQBA 2O8CB 1E60A 2IXDA 4B7AA 4Z7NB 1VPVA 4GM0A 3EYAA 3OF2A 1BJTA 2ZRGA 2A9FA 3NV7A 5EHQA 5GZ6A 1CQWA 2W4QA 3OUZA 2ONJA 4YMWA 5FB3A 4DLBA 3C6ZA 3SS9X 1L5KA 3K8YA 3NJ8A 3W2IA 4GL2A 1XZBA 4BNGA 1OXTA 1PFKA 3HBNA 2A59A 4QQKA 2UDPA 1GA4A 2W90A 3IQEA 1MV8A 4IIJA 1MW9X 1NTRA 3KDAA 4R84A 3GPDG 4W5NA 3EF3A 4FN4A 5FTMA 3V4PB 4EGAA 2INGX 2LCIA 1JEJA 3PQCA 3LVQE 4ZU6X 1JKJB 2WFAA 2XUPA 4PPGA 3W6NA 1WV1A 5JI3E 1KI1A 3AR6A 2YV4A 2X0RA 2QN7A 1F9EA 1AGXA 2KQUA 3OE5A 1QVAA 5JRZA 3RKRA 1SG0A 4LOLA 1SY7A 3D4IA 3LECA 3B1KA 3VPHA 4U63A 3I2JA 4AICA 2N42A 2UU9B 3DDSA 2E1RA 3QG1A 1QVRA 5LJLA 3I0NA 5DSXA 1KS2A 3HU2A 1OW3B 4XXHA 5ARDA 3UC5A 3HDHA 4EO7A 1YR8A 1UMBB 4AJOA 4ESVA 4HQOA 1NT2A 3R5HA 2OFWA 4RPJA 4KAJA 1AQIA 1G64A 3OICA 4KX3A 3ABOB 1R64A 2ID9A 3FVQA 1KBQA 3R3ZA 1IOWA 1FTQA 2A94A 1U0BB 1J90A 2QZJA 4IIEA 5SICE 5INTA 2WMOB 1P0IA 4LVNA 3DQPA 4B1FA 4EHAA 4GQBA 2I3DA 4RL6A 3RC3A 2R1TA 4EK9A 3HBAA 3I72A 2Z2KA 5A3JA 4I14A 1Z4LA 1I5RA 1PJ3A 4Q15A 4W5JA 3OSUA 1CSEE 2GN8A 4RMNA 3ZI0A 2C95A 1O6ZA 2PK3A 3HU1A 1R9MA 4H4DA 4MO9A 3TVDA 1KFJB 2EFEB 3W5JA 4B3BA 5B7GA 3IV6A 4B85A 5GPBA 1W4LA 1X7XB 3ZVMA 4RMGA 3L7KA 2P7IA 1UZLA 1UBKS 4YREA 1WXWA 4RIHA 4CM3A 1G7RA 4HNUA 1PNRA 4MI6A 2PS0A 2CFIA 4RDIA 3PNOA 5BQFA 1GVHA 2K6GA 4FSDA 1FJXA 5YASA 1PBTA 3HSYA 3LCVB 4NRDA 5FEUA 4O3FA 2Q8PA 4YRTA 5JJCA 1Q16A 4HXYA 1WDTA 2HJSA 3DVLA 3DPIA 4YJFA 5T3YA 5TQJA 4DNOA 2I91A 2BP7A 2WA1A 2HDOA 3N3AC 1HH4A 4II3A 4BXOB 1A50B 1E6MA 1HTWA 1M66A 2H1SA 2PVSA 2RHTA 3GJ6A 4QU5A 4DPLA 3MD0A 1BEZA 1KJYA 2YV5A 3TW0A 1QWSA 4OP1A 2PXAA 3VKUA 1WTCA 3TL2A 5CB6A 4K6HA 4OX9Y 2IYLD 1NBMA 3CISA 3TQRA 4KJXA 3UK2A 3I23A 3X1YA 1PYDA 3HA3A 1X0XA 4WCDA 3LWNA 4DV0B 4X85A 4C06A 5MGNA 2CMFA 1P7ZA 2CNLA 4ZV7A 2EKDA 2AJTA 4K6GA 2OZLB 2NUPA 5T64A 4RHCA 4YRMA 2R6AA 3G23A 5AM2A 2AG5A 1MT0A 2ZOSA 2NUTA 1D04A 1T6ZA 2HU8A 4YCNA 1USGA 1HLPA 2P9CA 1CUEA 2P41A 1K5HA 2YZMA 3WK6A 3WMGA 2EL7A 1KI2A 2YIJA 4UTOA 4I5IA 4IIVA 2GZ3A 4A27A 2WJJA 4M9XA 5F52A 2PQ2A 3FYCA 3OX4A 4GMKA 4RV4A 3QM1A 4MLPA 5AVTA 4F4FA 3V4SA 3WBFA 1EX9A 3B13B 3PI6A 2X41A 4HLUC 1RWPA 3L8DA 4S3MA 3W8NA 1O9GA 3EDMA 4IF6A 3AEUB 1RKBA 2VH5R 3OO1A 2IUEA 4XVRA 2IU0A 5HJ7A 3FVVA 3W4JA 1HURA 4EG3A 1EK1A 5JEDA 2PQMA 1ISRA 2AFIA 1D3AA 4X6UA 3KKNA 2VSQA 3E15A 3NC0C 4KRYA 4YRPA 4Q3EA 1JSLA 2IP4A 4NCIA 3REFA 3TINA 1W87A 5BYKA 5K5EA 5FX2A 3U1VA 2QJFA 4ALIA 4EDFA 1AUPA 1DAEA 1NUQA 2I6UA 4GSKA 3TNLA 2Q3EA 2IBMA 4NBLA 5D5PA 3QKRA 4BJ6A 3MCUA 5GWXA 4PYLA 3FMFA 4OGFA 1U3UA 5DN6A 3UO8B 4YQZA 3WDLA 3BGDA 1DRKA 3IBTA 3P9RA 2NZ8A 4C0QC 4CLDA 2ECFA 2VF2A 5EKSA 1IHDA 4FDVA 1DQSA 2W93A 4WHMA 5ALFA 3WR5A 4AQDA 4XYEA 1I94B 3CPHA 1IQRA 1AK2A 4XQ9A 1JJIA 1KHTA 3KT3A 4YIHA 1HOXA 4DV4B 1GLNA 2O1WA 3H19A 3UQYS 3WGOA 5CJ2A 2C20A 2IW1A 3AUYA 5CVCA 2WD9A 5HKKA 4FSXA 3NR2A 4A4DA 5I9BA 3KZXA 2L69A 4Q9DA 5I47A 1EZZA 2A5GA 4RMJA 1L1FA 2VFAA 4D9IA 4S04A 4NOMA 5LZ9A 3WSVA 2CBGA 3EH2A 4HLNA 4X1YA 4P3OA 1J33A 3RARA 3NVAA 4D74A 3FHTA 1FLVA 4XSVA 4EPWA 3NQ41 2ZB8A 3NX4A 3PGXA 2OXTA 4B5LA 1W6UA 4BVFA 5IANA 1IXSB 1F3LA 2IY9A 4Z7QB 3NBMA 3HEBA 4OYHA 3EMBA 2RJOA 4NICA 5FI5A 4UTVA 1EUCA 3IFSA 5ESXA 4A91A 1JT9A 2P9QA 2O0KA 3R3HA 2IYYA 2O8FA 3NIDB 4HAUA 1VGVA 4OH1A 2QSJA 2VDJA 3C5WP 2VXYA 4MV8A 3UB3A 3M33A 2M1ZA 3BIOA 1KRXA 1ZN9A 5AW0A 2XGGA 5HTKA 1O95C 4FCCA 5ECYA 1SIUA 5HJEA 3BILA 1Q1ZA 1FYEA 1J8FA 1GTVA 4MPPA 1BE8A 1QQBA 3TD6A 3E8XA 5GOTA 2VJLA 3DW3X 3H2KA 4RSMA 3C6BA 4CTMA 3N70A 2QW8A 4ZFNA 1EINA 3E03A 1DCFA 2QI9C 4LHEA 4B81A 3M6IA 3R7BA 1R5OA 2I33A 4FP9A 3VHXA 3QWIA 4PC6A 1BFDA 1EM8B 1IB0A 1KSHA 2KLHA 4RSRA 1PVOA 1Z39A 5FBQB 2MT9A 2BGKA 1BX0A 1D2GA 4X44A 3DL2A 3T3GA 2JIZA 2ZJ6A 3TLEA 2Z83A 4WLNA 3W0LB 2JFVA 2QHXA 1BH6A 1UBMS 4ND1A 4LNUB 4DM4A 2J5BA 1UT6A 1G6OA 2FRVA 3BGIA 3E3NA 1E2FA 2PY6A 2DYKA 3IOYA 2AEJA 3LQ1A 3GAMA 4OKIA 5J1TB 1WEHA 4C29A 1AX9A 1SULA 4IIDA 4F5DA 4GPD1 4ARUA 1H2ZA 3AVYA 1IG0A 4Y6PA 1AH2A 3W3AH 4NYMR 1R4MB 3DMGA 3WIEA 3FNIA 1JA0A 3K2IA 1HOTA 2OCKA 4L5IA 4EJFA 4MIEA 4YY3B 4HI0E 4ZT4A 1RVDA 3L0CA 3VX3A 4HX2A 4BGUA 5I7VA 4UDNA 2P2YA 4XYLA 5A3QA 4FM9A 5I6DA 1GG9A 1KY4A 5JZMA 1SEVA 1OYWA 4LF5B 3INYA 5G0SA 3WAKA 1KZGB 3H9EO 4MV1A 5K0ZA 2BFBB 1OIVA 4RU1A 3PUYA 3PUKA 4LRTB 4MS1B 4NCHA 1YAHA 3OM0A 2JLVA 3PEFA 4MR9B 1DRJA 4TS4A 5DNEA 5EE0A 2ATCA 2GOYA 3CUWA 4WXYB 5IAGA 1C30B 2OORC 2ZJZA 4J0GA 4ZTUB 1AU9A 1YR1A 2P35A 1YCFA 5JXHA 1E63A 4Y2JA 5H9VA 5HQ3B 1LDEA 1NJ5A 3LQFA 1P81A 3OPYI 3QKUA 1NN1A 2XD4A 3O1JC 4CEJB 4QWMA 4YCJA 1P19A 2OBFA 1ADJA 5IF9A 3CZMA 4Y2QA 4DPKA 1OXMA 5B3LA 5F78A 4LJRA 1PFYA 2WJYA 1EFVA 2YYSA 1N1MA 5LC1A 3SJBA 2Z3ZA 5ALWA 2BEUA 3G2KA 1AD2A 4OVKA 4BEJA 1TVEA 4BUJA 4F7DA 1IXZA 5BW4A 4PG6A 3MPOA 1KVRA 2ACKA 3S8EA 1ZR4A 2CEKA 3CFYA 2X0NA 3DBLB 1YBHA 1GRNA 4EPYA 1QP8A 4NG4A 5FWXA 1RABA 3P20A 4R3WA 4X1KB 4Y2SA 5L40A 4PXSA 2BTQB 3NNNA 4G81A 3A1DA 3FKSA 1OWOA 3PUHA 4NFSA 1EZ1A 4B79A 4MW1A 4BNDB 3DHEA 1XQ9A 3BN3A 1UIRA 5AHWA 3PXXA 1NDUA 1RKUA 5HBGA 5G0UA 4RTKA 4M9UA 6Q21A 1OAOA 1ZW1A 2NIPA 2XAAA 1NUAA 5JRJA 3TZBA 4U5XA 1A9OA 4RIFA 4E5YA 2YFHA 4OXQA 4AY5A 3OJOA 1AA9A 4AUNA 1YR6A 4RULA 2RHWA 2PH5A 4KJZA 1KE1A 3TQSA 3R0VA 3Q87B 4MR7B 5LSAA 3B3GA 4TUYB 3FVTA 5D7BA 1ZL0A 1BFKA 1UKVY 5ALJA 4WCFB 4M53A 4BLTA 4URVR 4XDHA 5EJ5A 3GJXC 4MZXA 2JGEA 1M2GA 4ZT6A 3ZHOA 4P82A 1SEPA 1ULHA 2JAPA 1SHJA 2J9FA 1ZPDA 2RKOA 4TL9A 3FOCA 1FDRA 1PSWA 3QHQA 4FFBB 3FR7A 5EWJB 2PD4A 5J58A 4ZJPA 2JIBA 5TGZA 4BLSA 4QGSA 2Q0XA 3INNA 1NAIA 4LQDA 4IWXA 1H2RS 1ZGGA 2J09A 3NEJA 5ENVA 3IR5A 2VQ3A 3T1VA 5JPCA 4C21A 3IO3A 3ZGVA 3KSRA 2RGNC 3U0VA 1ADGA 3B82A 4ZAYA 3G0CA 4HDMB 1LX7A 1SUSA 1SXJB 3ZWNA 5E1BA 3MWKA 5D85A 3T3IA 4ESEA 3GLGA 1TK3A 3TBFA 3TG2A 5LYJF 1P9RA 1TTTA 2ZRMA 3GGPA 2WFZA 3P7MA 4LY3A 4CIVA 4RWZA 1I5OA 1XJ0A 4TM8A 4OJYA 2PKRA 3G02A 3KKQA 3E3AA 4PQGA 4TVBA 1ULBA 3MILA 1FS6A 2VHYA 4OFZA 3CZRA 4H59A 1VJ5A 2OE2A 5COQA 4CKXA 3EVBA 3HVIA 5EI5A 2Y0DA 1UDXA 2EX4A 3UH0A 4EF6A 3BD6A 3HHPA 3L0IB 3WB0A 5FPQA 4DCPA 1CVRA 2M6LA 1EXNA 1LZLA 3HO6A 5E8RA 3VU1A 3C24A 1X3SA 4L4UA 1VA4A 4O8CA 1Z4MA 4UFNA 3S2UA 3EXEA 4RTJA 5I3ZA 3I4FA 3O8BA 4MWSA 4RBNA 3O4HA 4YBZA 4L0QA 3I9MA 2QVXX 3X0DA 1XJWA 3PDIA 3JV7A 1C3OB 1Z9BA 2DWPA 2QN9A 4KLRA 4WFJA 4ZCSA 3TTTA 4DMFA 4ENRA 2IQIA 4TMWA 3PI7A 1OA1A 3HPQA 3EDRA 3OI7A 2HCTA 1XMXA 1RMYA 3E9MA 3FYUA 3IPRA 1X1TA 3OMLA 5FPHA 3RC7A 3TAXA 1RI1A 1QQTA 2I4MA 3Q5GA 3HYCA 3PP8A 2X0EA 4I9UA 3VHRA 4RVHA 3TSCA 3OPYB 1TUIA 3G2JA 5MN6A 5KOJB 4BYGA 4YNBA 3W4IA 2XCIA 3ETJA 3FB4A 3OFND 1VL0A 3P9PA 1KDVA 4MYCA 4WZ6A 2I1VB 3WZ2A 4BTVA 1FMTA 1GCIA 3NAMA 1CUIA 1DIRA 2WSSA 5A6SA 1LDYA 1FNCA 1A9SA 2PG3A 3OZ7A 5B7QA 1KU0A 3WI7A 1CQIA 1WSAA 3KKOA 5KTPA 2JI7A 3A3NA 3SR4A 1EK2A 1FOEB 4YWJA 1MIHA 4KO8A 1J97A 2OMKA 2PWPA 2XODA 2Y0EA 5CM8B 2FE1A 1DKOA 4K9RA 3MLBA 2AX3A 3GGSA 3VTAA 3WISA 2YJGA 3FYSA 1JA1A 2SCUA 2ZRBA 3AL2A 5BSRA 1NKTA 3RTEA 5EKTA 1KFCB 5G3ZA 3VXKA 4QBHA 5IBCA 1LNSA 1C8BA 1PS8A 5HSGA 2CSUA 4B7ZA 3PNSA 1XRSB 3DG9A 2QA5A 1E9CA 3VC7A 1K7CA 3IP8A 3W6ZA 5K2OA 5EIHA 5M04A 4AKIA 4J6EA 2E49A 1P4RA 1W36C 4DCCA 3AVXA 1KSJA 1LRLA 3V3KA 3ZY3A 1MT3A 1Y6JA 2G40A 1X42A 1FMLA 4DV7B 3GROA 1KMHB 4G8BA 1ARZA 3K32A 2J41A 2OMEA 4HDCA 4FE7A 4MGKR 3BQMB 1NRWA 2Q2VA 4G6ZA 4ZICA 2RHMA 3N2NA 4ZQBA 2VYVA 2WG0A 1XDWA 4LV5B 5FOQA 5K0EA 2ZIWB 2MYUA 5EL0A 5CCDA 4G0XA 4D6YA 1OTYA 2G9VA 3DE3X 3W8FA 4DCGA 3Q6MA 4ZDJA 4ZYTA 4U0JA 6GPBA 2HJRA 4EYKA 1OLXA 1M3SA 5E7JA 1JQEA 1KSFX 3SS7X 1Q50A 1T25A 5K4AA 1P61B 2ZYVX 4BV8A 5FDFA 1Z63A 1V4VA 3E22A 2XWQA 1GPWB 4MHTA 5GJBA 1PEAA 1QF7A 1Z62A 3EULA 1I0LA 1J2EA 1CUZA 1ELOA 2FMHA 4H6WA 3VKHA 3D0OA 1FFEA 4Q21A 1N6RA 2OZPA 5JCOA 1GQYA 3FYDA 3LFHA 1C1XA 1V8DA 4I1UA 4RHTA 3T3HA 2V3VA 4RQTA 1I2CA 3ST7A 2OGUA 3U60B 2BM0A 5DBIA 5A3VA 1KA9H 2BH2A 4DLVA 4L28A 4A0SA 4GOND 4I5EA 4C07A 5H4GA 1FYVA 3HP7A 4ZPJA 4BO1A 3THOA 1NHWA 2QZ4A 3NT2A 3GMSA 4RPCA 1KFKB 2ZSIA 2IYRA 5F9HA 3C3EA 3ZDBA 4HV4A 2IEBA 5FOSA 1TYCA 2HLPA 3VOSA 4R6XA 4I55F 3KRTA 4D3ZA 4DANA 3LNTA 4QD3A 5CRIA 3RBZA 5HFJA 2NUAB 5HPYB 4II7A 4QPDA 5DH9A 1NSYA 4L5AA 2GRJA 1EJ2A 2NXJA 4QZVA 2XUKA 5IU6A 1GYPA 4XDYA 3TRDA 1K7FB 2O5EA 4TTTS 5DXAA 1XLTA 2W8BB 3CZCA 1U1IA 4JIGA 5E95A 5BSWA 3FHOA 5LN1A 2X5KO 2F90A 4MVYA 3LV8A 2NU8B 1Y8ZA 4UMEA 5L4LA 1JAXA 3OZWA 3P4YA 4B35A 1JIUA 2QIOA 4QUHA 4YRAA 3C6KA 1PR1A 5JD6A 5JJIA 3HXLA 4N0MA 4EY5A 4IUYA 1URPA 1GXSA 1OA0A 4GP9A 5CXXA 3U7RA 2O5CA 3DNMA 5LKAA 3PCTA 1Z35A 5AXCA 2F8MA 3THYB 2ZBQA 2GAIA 4N8DA 1G17A 3RS5A 2OCYC 3F74A 4TVSA 2NNWB 2BFMA 1P62B 3BKXA 1YO6A 3GQBA 4AN1A 2O0HA 3TTSA 4DC1A 4EA9A 3D4BA 4BO6A 4GLFA 2ZI4A 4OBXA 3UFXB 5JASA 2V9CA 1MB3A 4UM7A 5LU8A 4CEIB 2LUOA 3MT0A 3RROA 1NF8A 1QBGA 1Z5PA 5JS8A 1JVBA 4QGFA 4XYGA 1IHXA 1F1BA 1MVNA 1SC9A 3DXYA 3IODA 4WZZA 2V7PA 3H2ZA 4YPVA 4FE3A 4M7PA 1JEQA 4P4LA 5A71A 4HNTA 1A8QA 2NMVA 4MVJI 1UANA 2A0YA 2H2AA 1MTOA 3G85A 4KVGA 1OX4B 4KWEA 2C7GA 4DA8A 4TN1A 1DKPA 3VNSA 5PGMA 3FUWA 1IY9A 1KYYA 2CHGA 4XZ3A 2PUAA 2I3BA 2J4CA 2MTBA 2RAUA 2YY5A 3L8HA 3OZBA 4HAXA 3DB2A 5I7SA 4D2IA 1W76A 4ZYZA 1CUDA 1R4ZA 4LJLA 3VSDA 1GITA 4URYR 4JBGA 3DMTA 4ZCRA 2GBFA 3HWRA 3IPAA 2NU6A 3DZDA 4INJA 4MJLA 3G17A 2ZZMA 4FR2A 2DERA 1ODCA 4INOA 4PAQA 3RFCA 5I5EA 4TWZA 5GM2A 2VHXA 4QYMA 3HSSA 5K3SA 3RU9A 2JGRA 4KOAA 2GCEA 4UDYX 1EFHA 1IHPA 2DTXA 4ZIRB 2ZSAA 5HJ5A 4M8LA 1V1MA 1UKYA 4BQNA 1IVSA 2Z98A 3H7AA 3VQTA 4DLKA 1W1IA 3OHSX 4UM9B 4MB2A 1M75A 4IEIA 4M8NE 2ZREA 1YOBA 4GUDA 4CMBA 3UYKA 2F55A 1P73A 1POWA 4HX9A 1NVBA 1I24A 3K9HA 4RLFA 5HF8A 3X2EA 1C3XA 4X8LA 3HUDA 4BBAA 1MO2A 3B5JA 4HT3B 2X4GA 4JC5A 2CXTA 1FQOA 3LLCA 3NJ4A 4NNOA 5AJUA 1QTNA 2IDMA 3BSYA 4TLDA 1L5MA 3D8UA 4YCMA 4MRRA 1D1QA 3AEQA 5TLSA 3CLRD 3OIVA 2VBCA 1PZNA 4OQYA 2QYOA 4XD2A 4ZO8A 3A14A 3IMGA 3I30X 3CPSA 4O5OA 3NB0A 5K8VA 1J0CA 2CXPA 3MTGA 4AU1A 3KTAA 2QAIA 1M73E 4GMDA 1W52X 4Q4AA 3MCZA 5CIWA 3TRHA 2PWZA 2XUZA 1M8KA 3GN2A 3OJFA 2ZBPA 4AMUA 4BC1A 4Q9KA 1XZDA 5B4VA 5C37A 1N57A 3SYNA 3K0SA 1VYVA 1XMVA 3LXXA 3TIXB 3LKVA 3P32A 2X8JB 2RMKA 3L1HA 1YRLA 2VI5A 4PSKA 4Q66C 4A8JB 2XOKD 2FWJA 1DL5A 2NXWA 2TECE 1Z33A 1NPTO 3HNOA 3VO8A 4BX8A 1M8JA 3DCJA 3LPDA 1SIBE 3OJXA 3LO5A 3OZRA 4NYJR 4Y2VA 3RRMA 2H7VA 2QN3A 2WZBA 1NI3A 3BCUA 4NE9A 4OXYA 3W5SA 5HYVA 1RPAA 6AT1A 2VTBA 1DADA 1AKQA 4US2R 4ES6A 3X2FA 1IK4A 3A2MA 3VI3B 4KPUA 3RDPA 4RHFA 3D6TB 4TKMA 2OUIA 1V4NA 3H0KA 3K1TA 4NDNE 5BMVA 3TOCA 2X1HA 2UZ1A 5FBZA 4YV7A 1U7XA 1ZCJA 1R6AA 3KKKA 1AXRA 1BSVA 4GUAA 4MUAA 1FFXB 5GV8A 3IBYA 3JRWA 1AKUA 1JG1A 3R7WA 1U9JA 1HQDA 2LRHA 2QDXA 2W22A 3OLQA 1H4TA 1A5TA 5AW9A 4Q34A 1X7WA 3E9RA 3KNZA 1Z0ZA 1E9FA 1YQDA 3PUJA 4QOEA 5KJ6A 3A6KA 4HNGA 3D2CA 3IOMA 1AZWA 2OBMA 1Y3DE 1YWGO 3OQJA 4IBOA 5DNVA 1BWPA 4ZVUA 4UUNA 1MPXA 5BXYA 2QRPA 3CUUA 3UMFA 4A8TA 1V5EA 1XZPA 5SY9A 1VRVA 1KR2A 4KN6A 3TX6A 5KNDA 2FWNA 5FBKA 3D0QA 2VRNA 4JFRA 1JI3A 4L9SA 4QTZA 4WNCA 2OESA 5DDIP 3L79A 1PHRA 2R7KA 4C5CA 4BMDA 4L07A 3B2NA 2YQZA 1TUBA 3BULA 4X60A 1NYRA 3JR3A 4YALA 3VPDA 1J8YF 4CHTA 4EGJA 2CLHB 2O4CA 2Z43A 3A1VA 5E3JA 5CVVA 4Z1OA 3DOCA 4GX0A 3ZNOA 2ID7A 5FUMA 5JPDA 1WBBA 3DZKA 1STOA 1XTBA 3OT4A 4Y3UA 1A27A 3OQ1A 3TMAA 1KP9A 1BDBA 3WV5A 3R0QA 4ER0A 5JAMA 4CR6A 1G5FA 1TMOA 2AF4C 4Z9YA 1SC1A 3ZJYA 4YONB 1DZ3A 3GLIB 1G1AA 3AT1A 2D3WA 8OHMA 1UP6A 4BNMA 3VSCA 5FTNA 3RSSA 4E1VA 1T1IA 1H8ED 1PGNA 4CKYA 5IXJA 2FW1A 3T3OA 2H4XA 2IE0A 4O2AF 2O0MA 2AN3A 3F9IA 4FB4A 1J2JA 4IXMA 4D3SA 2A1TR 3B1ZA 3H1TA 4H4EA 2QL9A 4M8KA 5JNLA 2VDQB 3P2OA 1GZSA 4HFRA 3W1WA 3LXMA 4AJIA 3AIIA 3F5QA 5C7IO 3PQEA 4NMWA 3TJMA 2RBKA 3IKLA 4MOWA 3CJRA 3IT0A 2VJYA 4C03A 3D59A 4ETNA 4QG3A 4LAFA 1DKQA 4YJGB 2E4YA 3LYLA 3CVOA 3S1AB 2E5WA 1YI1A 1ZLYA 2BFAA 2ZSUA 2C3YA 3L7YA 1QIJA 1EHCA 3G6WA 3MXTA 1L5NA 4HSEA 2LCQA 1DXQA 2VDOB 4EB8A 2ZEJA 2ZJ7A 3ZYCA 2BYTA 2QLMA 4N3NA 2HF2A 3OEYA 1UMBA 4ZYLA 1K6EA 1QQ5A 3NOXA 1HORA 4HWTA 2FGJA 1M2OB 5KSZA 3EPKA 3FPGA 3QLUA 2BR4A 4JVSB 1EFCA 4A6XA 1T2EA 1Y6GA 1VPTA 5LA6B 821PA 5ERYA 1E92A 2M6RA 3KCQA 2YNMD 1CB7A 3JQ9C 1AF7A 4OJKA 4QA9A 1XX6A 1Z4QA 3OJCA 4W82A 5DXFA 3ZI4A 4E2FA 4WZAB 3MFYA 1UDBA 4ZTBA 4TZ6A 5LB4A 3WLTA 1VRWA 3TQTA 2VSXA 3TLZA 3PLRA 5IKXA 3L0BA 1JFTA 1XTIA 2X4LA 2ZRQA 5DTEA 4BDTA 1G8JA 4CMGA 2NT4A 1X7XA 4RAQA 2CLEB 3O8CA 4QPPA 1PUJA 3N2ZB 2YASA 3MS7A 4P4UA 2FZEA 3V2IA 2ZLBA 2H2FA 3RWOA 2B82A 2V45A 1T2AA 5KJEA 2HA0A 3D3EA 2R8XA 3IXMA 4QBKA 4ZVNA 3K1YA 3PT5A 1Z37A 1TGYA 2OAGA 3ZWDA 4BVLA 4PBSA 4E2ZA 3MN1A 2XSZD 5T8KA 1YA6A 1X70A 1DWPA 3M34A 3RYCB 4I4TB 5EJMA 2H92A 1K06A 2FQQA 3L18A 4IWYA 3LCMA 5IM4F 3CZ9A 4HQ0A 1KEPA 4Q4HB 1X38A 2W5UA 5EZSA 4C4OA 3OZVA 2VRBA 4UBLA 2W6ZA 5FP0A 1O5OA 4AN0A 1NI4B 3RUDA 4ZYYA 5IUJC 1DDIA 4H7DA 1M2VB 2J5RA 4I5GA 4ICIA 5BYJA 1I7PA 4LOAA 3AY7A 1DV1A 2VRCD 3C1TA 4RXTA 4ZI7B 2OZLA 3ZDZB 3D7LA 2CXSA 4YXWA 1L4BA 2C2XA 3F8WA 3OQHA 2H17A 2DUMA 2W6JD 1E69A 1FS5A 4HEA6 4J1TC 3K30A 5DW0A 2ZYWX 5HZHA 5LP1A 3FG9A 1MQSA 4JVNA 1U8EA 2C2OA 2ODPA 1Q0ZA 1ZD4A 3IHTA 5AUNB 3QITA 3LX4A 3QX3A 3KVOA 3S7ZA 4FGJA 4C6RA 2QGZA 2AG1A 2WKQA 3Q6NA 2OAP1 3AEUA 3PIRA 3FCCA 5SZIA 1MRZA 2XOEA 2JC3A 4NV1A 1JECA 4HS9A 4URZR 3K70B 4BFVA 3EGCA 4EY8A 6ADHA 4EG1A 2HSGA 3RTGA 5HUQA 3AR8A 1LTQA 2IHNA 1Y5MA 2PV7A 3MUOA 4EW3A 2FMIA 2YDYA 3AILA 5BSMA 4DTIA 1FS4A 5EKDA 4J4BA 1WQ1R 1EVKA 4DNXA 4YRQA 1OX6A 4IX9A 3OH8A 3GGOA 5EXPA 4JI6B 1IDN1 4IQ8A 2P4HX 4BIMA 1EVEA 3NM6B 3C97A 3FZEA 3PEEA 1EVLA 4GBMA 1WCV1 4H1HA 3TNDA 1JV2B 3VFDA 2YVUA 4X71A 1PNTA 3NDBB 1UQRA 5FYDA 3R8XA 1RI4A 2PRYA 3D6UA 2VZLA 4HRVA 1CLUA 3EAFA 4JR0A 5C4GB 3QVSA 4I50F 1WUIS 4W1RA 3CF0A 2C5EA 2ZUVA 3C7TA 4OQMA 4MARA 5DCWA 1BS1A 2GBCA 4WFIA 5IT9A 1AG9A 1JFLA 1R8SA 3KOWA 3SKVA 1LSSA 2F9FA 5SZHB 2PR2A 2RH9B 4CVNA 2FWMX 2GRUA 3ZW8A 5DWVA 3OQOA 3VZDA 3NPMA 4KDFA 3TVTA 3ZS9A 2CV1A 1ULSA 3T15A 4BP8A 3A70A 2Z8YM 4J3JA 1OWPA 4KSBA 5HQJA 3HCAA 4OGKA 4AI6A 3EY9A 2ZSKA 3R7SA 1Q1NA 5DGDA 4P38A 5A0VA 1E0DA 1ZZGA 3SAJA 3QVVA 5EAIA 2ZM6B 2JFPA 1JFRA 4PANA 3K2EA 3B36A 4LISA 1F0NA 2BFNA 5FUVA 1NC1A 1VXRA 2ZRIA 1AXGA 2IHVA 3LC0A 1YBFA 1YL7A 1U8UA 3HZOA 5JCZA 3PF8A 2CFTA 1GTZA 1KJWA 1HI9A 1XAJA 2EATA 4CKCA 5I45A 3A6PC 1JFFA 3E61A 1TECE 3LUAA 1Y3AA 3FM9A 4Q7LA 4E70A 1FMJA 3GWGA 4CW7A 1BQ4A 4DXDA 1IOLA 1GEGA 4D0SA 4C3UA 3GDOA 3SSAA 1N8KA 2NVUA 1OLOA 3G89A 3AI3A 1G8MA 2XUGA 4MW4A 1EM8A 4MTCA 1DUIA 1UKAA 1GUBA 1E1RD 1H2FA 2X4IA 5BURA 1R0LA 4XM1A 3VVBA 1A8UA 5L9AA 2ZT7A 2ZJ2A 521PA 2ID4A 3PHGA 1P5RA 1PEYA 4KWTA 4R2XA 2GA9A 5DTJA 4UOEA 4XWWA 1Z83A 5AW4A 1T1EA 3LGXA 5E2IA 3MZ0A 4NPCA 5E4YA 1VMDA 5EXTA 2VA8A 1Z88A 3DZ8A 5KYKA 2Y1DA 2CDAA 1E2EA 1QB8A 1UC8A 1QE0A 2D5CA 2WC1A 4JC8A 3BVPA 3FSGA 3ROFA 3TMYA 1QJCA 2C7PA 2P9ZA 4FK8A 4X7RA 1TZCA 3BTVA 3BCRA 4YLGA 3ZDFA 4DUYB 4RL4A 3G8YA 1B3BA 1P2BA 1SVKA 4UHDA 1XROA 2JH8A 2SHKA 5CM2Z 4X7PA 3NWPA 3AXTA 1MNQA 4CGZA 3QOFA 1KGDA 2ZYSA 2F1RA 1GDHA 2P3SA 3QI2A 1DT5A 1UXGA 1UWVA 4XR9A 3UJ9A 1Q15A 1G59A 4HWOA 3ZZTA 2XMZA 2FX5A 1CYDA 4D3XA 6ABPA 3OCWA 4MYSA 1MOQA 2PMFA 2X22A 3M2PA 3NTRA 1SELA 2X2FA 1G3QA 2JL1A 4ND8A 4XARA 5G4KB 1EAMA 1SUFA 4J8PA 5CDTA 1M1XB 3ONNA 4YI3A 1OBCA 1VHLA 4MR9A 2JD2A 4EQ6A 5BWMA 3R1IA 1C30A 3AF5A 4HBZA 4ZAFA 1NYQA 3WNCA 2M1XA 4EB0A 4AD8A 5HQ3A 3LA6A 5KMGB 4JT8A 2I87A 5DNDA 3QHPA 1ZSNA 1JH9A 2VPYA 2H8GA 3GT3A 1CJKC 3L40A 3NHUA 1XRQA 2QD3A 3CW9A 3CUYA 4OIFA 3VPSA 5C8YF 5I7HA 2UVPB 1H65A 2EBFX 4IILA 1MH1A 2J3MA 4OOFA 4RXMA 4QKQA 4CG2A 1WV0A 4PIPA 1TPYA 3ZQ6A 1QYRA 3HRHA 2PRZA 1P60A 1E77A 4IY1A 4PZDA 3CH4B 3GJSA 5ESDA 2X5NA 5KQPA 3N8IA 2VAXA 1USKA 2Y8EA 4QM6A 2KHZA 3DBLA 3L8FA 5ALTA 4EW1A 1W88B 1WUYA 3AL3A 2C9CA 3DEYX 4XD7A 1AE1A 1MA3A 3ZHSA 2JIMA 4IYJA 5EJFA 4FT2A 4TMXA 3U0BA 2ZKIA 2ZS7A 4NJMB 2H1FA 4ZVVA 3W5AA 1NXVA 2FPMA 1AN0A 4BNDA 1L4LA 4M99A 3CVVA 3M6MD 2FRDC 3GCWA 4LV8B 3EDYA 2GYYA 3DTTA 3K5WA 3H2YA 4QC2A 5CG1A 1X2EA 3AHHA 5E4FA 4G36A 4XRGA 3WHLA 1RWVA 2UUPA 1DBVO 4LMPA 4MR7A 4RPLA 4RESA 1WO8A 3FUCA 4JLUA 4HL6A 1GPMA 4KBFA 4QPJC 2J1LA 1PK8A 3U4QB 4ADSG 3TG8A 3LDFA 1EXMA 1T8YA 1R27A 3NBUA 4WCFA 3AVUA 2FNAA 8GPBA 3KV1A 4GBED 1MABA 3SC3A 1KO5A 3WWDA 5U4XA 3KKPA 4WACA 5EWJA 4EARA 2CE7A 3ACDA 4Z1MA 1U6JA 1WMEA 1J09A 3BRCA 3G5MA 1Y6ZA 3IXQA 1K4YA 4KXWA 1OY1A 1PGPA 3OAAD 4EJMA 3B51X 2ISSD 3SMVA 4HDMA 3HB7A 4LJSA 4XDGA 3EF0A 3AKCA 3TD9A 3L0PA 2JBHA 1CBUA 3RYHA 3W2HA 5C1BA 1MQ8B 1E3EA 1OZGA 3TSYA 1XPRA 2DFTA 4Y1FA 2REOA 1C7IA 2BKUA 3K4PA 3T12A 4C6TA 1J07A 1X3LA 2J7PD 3MMNA 3UHJA 4BMNA 5HS6A 2Q5QA 2NZUG 1J00A 1T9DA 4LY0A 4RJIA 4RZ2A 3U7FB 4MKZA 5JSZB 4JGGA 4YH1A 5F51A 2R9VA 3LA8A 4M1ZA 4F86A 1IZ9A 4KUHA 1JHRA 4CM9A 4F96A 4HQKA 2QJTA 3C6XA 2B36A 2RKWA 4JASB 5LZ8A 5JAHA 4F6RB 1N6OA 2R6CA 4GXQA 1SVNA 2O2XA 5FL3A 3RC8A 3KD2A 1GR0A 3W6UA 3DWGA 2MWMA 3OCCA 5A6VA 2RGDA 1OI3A 3R3JA 3JWEA 1BE6A 1U2DA 3HFGA 3BFJA 3TEMA 1FDOA 2GZMA 4XSGA 1C3OA 1K7XB 2R44A 4KH0A 3TNFA 3QKIA 4GOXA 3WLNA 1OTHA 4Q3KA 3S68A 1Y6QA 3RYIB 3JPYA 3FTPA 2OHIA 4FBMA 4PCVA 4CM8B 1AK1A 4MRVA 4E88A 2G88A 2HTFA 4I4NA 3OHMA 4P22A 4U8HA 4HR7A 3MRXA 1Y1SA 1DRUA 2QL7A 4MWGA 4PQYA 3OPYA 3W3AD 4GFDA 2DSNA 3WYFA 3KZKA 4OEHA 2G17A 2J08A 5KOJA 3AJ8A 2EGHA 1ITZA 3D1JA 1XDGA 4NOLA 3V33A 3THWB 2XTJA 5FPSA 1E9SA 5IMBA 1OREA 1GQSA 1MC8A 1Y34E 4TMTA 3SIRA 4A8PA 1R1DA 3TQHA 5L4SA 4MKFA 1VDMA 1WUTA 2QS9A 2YW9A 1DO2A 1ZGZA 4CIDA 2XEXA 5AK3A 3FD8A 1V7ZA 5DU2A 3UKOA 2CCKA 2D59A 3ADCA 2C2ZA 3ONVA 1VLVA 5B7NA 2AE1A 1D1TA 1X86B 1RRFA 1Z0SA 3RYTC 4ILEA 1XKLA 3N0RA 1D4AA 3EASA 5TJ9A 1Y5LA 1HTTA 2IZZA 3H3FA 2GETA 3GGJA 4XSHA 3TOXA 1DIBA 3FAKA 2PKQP 5T4HA 3UF0A 1MJNA