3R7BA

Caspase-2 bound to one copy of ac-dvad-cho
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
159
structure length
156
Chain Sequence
MQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTGLEFRSGGDVDHSTLVTLFKLLGYDVHVLCDQTAQEMQEKLQNFAQLPAHRVTDSCIVALLSHGVEGAIYGVDGKLLQLQEVFQLFDNANCPSLQNKPKMFFIQACRGDETDRGVDQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-2 subunit p18
publication title Structural and enzymatic insights into caspase-2 protein substrate recognition and catalysis.
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 156
sequence length 159
chains with identical sequence C
ec nomenclature ec 3.4.22.55: Caspase-2.
pdb deposition date 2011-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3r7bA00
3H0EA 2H5JA 3P4UA 5LUBA 4NBLA 3UOAB 5IARA 1RHMA 2C2KA 1NW9B 1SC1A 1KMCA 4FEAA 4JJ8A 1RWKA 1RHKA 4EHKA 1RHJA 3PD0A 3OD5A 5IBRA 3V6LA 4I1PA 3GJQA 3R7NA 4D3YA 1RE1A 1SC3A 5IC6A 4FXOA 2DKOA 2XYGA 2CNNA 2XYHA 2HBZA 2C1EA 1F1JA 3NR2A 4QUHA 4DCJA 1QX3A 2P2CA 4LSZA 5IAJA 1PAUA 4JB8A 5JFTA 1K88A 3GJTA 3R6GA 4EHAA 3D6HA 4EHLA 5IASA 5LU8A 1CP3A 1I4EB 1QTNA 2QL7A 2QLJA 1CVRA 1RWMA 4NOKA 4PRYA 4QUEA 3R7BA 4PS0A 2H48A 2XZDA 3S70A 4AWBA 3DEIA 2QLFA 1RWVA 4EHDA 2C2ZA 1F9EA 2FUNB 1BMQA 3PD1A 4QTXA 5H0IA 3S8EA 2H4WA 3V6MA 3D6MA 1ICEA 1RHRA 4QU5A 5I9TA 5IANA 1NMSA 2H54A 1K86A 4N5DA 3NKFA 4JR1A 3KJQA 4ZVRA 4NBNA 3UO8B 4QTYA 5LU9A 1PYOA 3D6FA 5IAKA 4N7JA 5K20A 2XZTA 5I9BA 4QUDA 3E4CA 1RWXA 4ZVSA 4NOLA 4PRZA 4HVAA 1SHJA 2XYPA 2FP3A 5IABA 3V4LA 4HQ0A 4N7MA 2CNKA 3IBCA 2HBQA 3GJRA 2C2OA 2NN3C 3H11A 3KJNA 3R6LA 4I1RA 3H1PA 5IBPA 2H51A 2J31A 4ZVPA 5IBCA 4JJEA 3H13A 4N6NA 3K7EA 4QU0A 3EDQA 3NS7A 1RWWA 4QUJA 2CNLA 4QU8A 4QUIA 2K7ZA 4QUGA 3V3KA 4HQRA 1GFWA 2CNOA 3PCXA 4JR2A 1GQFA 3ITNA 4QUBA 3R5JA 3RJMA 4EHNA 2AR9A 3P45A 1JXQA 3QNWA 4ZVOA 4AW9A 3IBFA 1I51A 4NOMA 2H4YA 4ZVUA 4EJFA 5IC4A 5LUAA 4ZVTA 2FQQA 5IAEA 2HBYA 3BIJA 1SHLA 1SC4A 2HBRA 1I4OA 3GJSA 4JQYA 4PS1A 2Y1LA 3R5KA 1NMEA 4AWAA 2QLBA 3DEJA 2C2MA 2WDPA 1RWPA 4N6OA 4NOJA 3EDRA 4EHHA 4JJ7A 3V4OA 4DCPA 3R7SA 2J30A 2CJYA 4D3ZA 2QL5A 1RHQA 3DEHA 4JR0A 4ZVQA 2CJXA 2Y0BA 4FGUA 4JQZA 2QL9A 4QULA 1NMQA 4FDLA 4QUAA 1RWNA 4IYRA 4QU9A 4M9RA 3SIRA 5IAGA 3SIPA 1RHUA 2H5IA 2J32A 4NBKA 4IEFB 3DEKA 3H11B 1IBCA 4N6GA 2J33A 1I3OA 4DCOA 3V55A 2CDRA 1RWOA 2H65A 4EHFA 1QDUA 3KJFA 1M72A 4D3XA
chains in the Genus database with same CATH superfamily
2B9VA 4NZPA 4MVJI 3RTBA 3QTBA 2BBOA 2OKCA 3R9IA 1ZR2A 3R3XA 3EIUA 1ZK2A 1E58A 3PENA 1RLIA 2QAJA 3KYJB 5IXSA 5KREA 1G6Q1 5DW0A 3Q7TA 4CIAA 3GPBA 3QOWA 5CW2A 4YI3A 3CRMA 4UNPA 4ZT2A 3WJ7A 4EKYA 3N39C 3ABRB 4HNTA 5A5EA 1ZOIA 3KQMA 3L1UA 3R4VA 4DA8A 3ZWPA 1WZIA 1OLUB 4D4MA 5CJPA 1SXIA 2I34A 4P5EA 4C04A 1LRJA 1T1EA 2GZRA 1NYRA 2OZLB 4FJ2A 4MAAA 4ZARA 2OMEA 3TNLA 5EMJA 4UAJA 4Y2TA 4A92A 4EPRA 3EY4A 3WZLA 1QX3A 1COWD 2ONCA 2ZIGA 1WMEA 4V0KA 4YFYA 3EH1A 3L0ZA 4GPIB 1N0WA 3T7IA 3D3WA 3A27A 3HRHA 5KNBH 4TN1A 1RRGA 1WXIA 2AOTB 2BN4A 2EZ4A 2X4GA 2F3QA 1MH1A 4FMBB 3QXGA 5E4YA 5ER6A 2XECA 2ZIEA 4IWNA 3DEAA 4CL3A 3AR5A 2C2XA 3C3DA 3LYUA 3E0QA 3SMVA 1C8BA 3M4NA 4WQMA 4TS9A 2AG5A 5KNDA 4BXOA 3VPDA 3K2EA 1ZK4A 2C98A 3K0BA 1AKNA 3VHQA 3PQCA 5CH5A 3LBHA 3MT7A 4ROTA 1Z45A 2I8LA 3BX1A 2QDKA 3ADKA 2XMRA 5T41A 5K7SA 4KXYA 1KSGA 3RYHB 1RI4A 1IVSA 5GJVC 3PC2A 5IEJA 3UJ3X 4ETWA 5IT4A 4N7JA 4IZ6A 2YV3A 4N0QA 3GLIB 2QUKA 3E4CA 2YFQA 1WL8A 2D1QA 2RBEA 4GECA 1AO0A 3B1YA 4PSCA 4YP0A 4YMGA 2YS7A 4G8DA 5CDFE 1R5NA 2P9HA 1CNFA 3OZCA 1MJGA 1BWRA 4PAWA 2OCDA 4OQDA 5AJWA 3UG6A 3QEMA 5EESA 3TL2A 5LIRA 1HY3A 1A2KC 3SQWA 2QV7A 3VU0A 3PFGA 1EXDA 1L8QA 1XAIA 3A3NA 1J9GA 5HGJA 3WICA 1S8AA 4EA8A 3LCJA 1U3UA 3KSDO 4OQYA 4GLFA 4EW1A 3C8UA 2Y1XA 4Z4IA 3MK31 4OQEA 1C2TA 3FRIA 5CPBA 1O5TA 2JFPA 4QPPA 3RAEC 4ZVUA 2GJ8A 2VJPA 2MTBA 3T99A 1FDRA 2IYOA 3JQEA 1AO3A 2YHIA 1FU7A 4G4GA 1FW6A 4C0XA 1XDGA 2OHFA 3D02A 1CS0A 1NHWA 2CLFB 4LHZA 4MDYA 5DV9A 1EP2B 3GAFA 1GPJA 1GQQA 2BLNA 3P7MA 4XUEA 2Z0MA 2WPDA 4N5LA 3V97A 4BQNA 1HL3A 1ZD9A 4ZCLA 1YQTA 3OM0A 2Y0DA 3N8NA 2QF7A 2Y4OA 1U7PA 4OYRA 4FJ1A 1G41A 4WVLA 1RQRA 4M83A 2EOAA 5BN5B 1UAYA 4EY5A 2N0SA 1V16B 5INTA 3GN1A 1DAHA 1L7QA 4DKXA 1YC5A 1DT5A 3EGDA 3Q3CA 1WCXA 3IUBA 1IE3A 3WHLA 3DFUA 5BQ5A 4DEVA 1RWOA 3QMPA 4K8RB 4F4DA 2QBYB 3HSYA 3AR4A 3ZJVA 2NO9A 3O4JA 2HIHA 2JCGA 5D6NA 4XM1A 5ITVA 1T5SA 3NPAA 1WKBA 4G4JA 5AJYA 1NW9B 2FCRA 2DVMA 1J07A 1TAHA 3L7OA 1CF9A 2J67A 4LISA 1O6GA 3LGAA 3PD0A 1FRQA 5DBOA 1OGYA 4CL2A 2Y27A 1GN8A 4MPJA 4E33A 2ZUWA 3EMDA 1XYGA 3K72B 4KVGA 4NMXB 5K0SA 4Q39A 3OLCX 1KSJA 3P26A 5EZ6B 5LZ8A 5ITZA 5GQSA 5HE8A 4BNWA 4DGQA 1PTJA 3BD7A 3ZCVA 1GY8A 1W2HA 4POAA 5HQTA 1ZN2A 3AQ4A 4M1ZA 1DWUA 4N7BA 1ZM2A 2RG7A 3NDJA 2EQBA 3ZDRA 1GUZA 1G59A 3F6SA 1UFRA 2NLOA 3EXIB 4CL0A 4KQKA 3RNLA 4L8GA 2I29A 5FUXA 2GN1A 3T1NA 1BKDR 1M7BA 1EBFA 2IK8A 5C5EA 1Y81A 1ZAYA 2Q49A 5F1OA 2ID4A 2OSBA 4U2EA 1E2KA 4LJRA 3LU1A 4NX2A 1IWOA 1L4GA 3IXMA 4Y3UA 1XDDA 1RWVA 2ZS7A 2YDYA 3OQJA 3DONA 3AEYA 3V00A 3QI2A 2JKVA 3CURA 2Q0XA 4JELA 1Z47A 1KFEB 3R1IA 4KN6A 4QYTA 5JQGB 4WKNA 1LS6A 4OHCA 3GMTA 4B47A 3IA7A 5IVHA 4UASA 2E21A 4QAQA 1B23P 3HV0A 3I53A 3FTCA 3OLVA 5BY2A 4YT5A 1R00A 3IPLA 3QBVA 3A6HA 4TYMA 1QF7A 5FPQA 2CXTA 3ZHVA 1XMVA 1YBMA 5FAXA 2QRLA 4UTOA 1TVKB 1SXJD 3T4PA 5HHTA 5CX4A 2FPSA 3BRQA 3KT8A 4OBXA 2IWRA 1JXMA 3PJGA 5HZKA 3OPYB 3AVVA 2BTQB 4AL4A 2J31A 4WBNF 4MA4A 4Y18A 1MDFA 5T6BA 3LQ4A 5KWJA 2QV0A 2Z5FA 4LF6B 1YNOA 2QZZA 1Q21A 2NP7A 1J2TA 1SIOA 4ETIA 2C3PA 4EYOA 3RYCB 3MAGA 4UPEA 4YRGA 1X9HA 3L18A 4KUHA 5CM2Z 4CM6A 1B6TA 5B7NA 5EXEA 1FUEA 1XZHA 5ICGA 3KQLA 3OQ1A 3WQBA 3IUPA 3ZHZA 3L7NA 3F98A 4ZVTA 3AJ9A 3MS7A 4UAUA 1RPZA 4X1YA 1KI8A 2C0QA 3TOZA 1PFQA 4FHFA 1J8YF 1E5LA 3IURA 5HKBA 5BWMA 4EARA 4H18A 3SAJA 1X1EA 5IDWA 1G2OA 1T29A 1Q7CA 1Z73A 1RXCA 2NV0A 4CF5A 2RHRA 3LHIA 3TTWA 1YDFA 5JAIA 1YQDA 3GZNB 2PUTA 3O82A 3B13B 3HEBA 1Y7IA 2ECFA 2Q6IA 3FSEA 5EOVA 5AXDA 1EFAA 3C98A 1UT6A 3DE5X 2JGRA 2ZDGA 3CTMA 1KY4A 4Y2JA 4DUGD 5E4JA 1GTG1 1T5DX 4IEIA 3AI3A 4JVMA 2PLWA 2GM5A 2WSSD 1W5AA 2QRPA 4PVDA 1NBWB 4LRQA 3V2GA 4ESHA 3FOFC 2J32A 4TWIA 3H11B 1CDEA 1DAKA 1PJAA 1X8JA 1DHTA 3WJAA 2O8BA 4LWZA 3NEPX 1KJQA 1DNPA 1Q22A 5EHIA 1LJUA 1XA4A 1VIAA 4C6SA 2OV8A 3PGXA 1AB6A 3ANLA 1TJYA 1N9ZA 1CJVC 1U8TA 1W85B 3PHGA 3RC3A 4BPBA 4D9CA 3KZNA 2GCGA 2H52A 2WT4A 3IJEB 1G4AE 3PC6A 3UTDA 5HIAA 2XLCA 3L8DA 2WHRA 3RS5A 1CUIA 1OIWA 1T9DA 4NF2A 4PPQA 4RNCA 3SSNA 2P6RA 3STTA 3TEJA 5CVTA 1MB4A 1TFUA 1XWWA 3AHEA 3CIFA 5D2CA 1Z9BA 5TXGA 1LW6E 1AUPA 3H4VA 5ADUS 3LWBA 3FHJA 4LOHA 1QOQB 4Y1EA 1BXGB 3S29A 3TOXA 5K0JA 2UKDA 1QE3A 3F46A 3W8RA 4A0HA 1Z75A 2QUHA 4OJQA 5IW8A 1GPAA 1P1BA 1P2SA 4L6CA 4AURA 1E32A 3RTAA 2IEYA 3K4QA 4WKBA 1MGOA 3TZHA 3C3YA 3EMBA 3TVYA 2GPJA 1TJ3A 4D1YA 4CT0A 4YAUA 4JL6A 3TECE 4HLUA 3ZJ5A 4BY9E 3OFVA 4QLBA 2WZCA 4KXUA 3VMMA 4L8VA 4J29A 5BR4A 2EF0A 4OMFG 3BB3A 4JP1A 4GI5A 3SJBA 4EB3A 3O92A 3OZSA 3M6FA 4IUDS 3RS8A 3WLIA 1PFUA 5TT0A 3O8CA 3BL5A 5GJWC 5AH0A 2F17A 2VTBB 2VRNA 3FPKA 4TSRA 2FPPB 3D7MA 3HP7A 2OCXA 3D43A 4E46A 2D2VA 4CIDA 1T9BA 1GT6A 1CCWA 1N1EA 1NSTA 2ETXA 4OK6A 3SKXA 3HJTA 3QEBZ 1M6NA 3QVTA 1FMCA 1ADJA 1LRLA 1TECE 1N2GA 1ADGA 4JJGA 2VHYA 1N2EA 4B71A 2WVHA 3SHOA 2OLJA 2A88A 2PYZA 3R6LA 4ZVPA 2JD0A 1FDUA 1M1XB 4HFJA 1JTVA 1Y1RA 2ZJ5A 3H13A 4XQEA 4YRQA 5KTOA 1CJMA 1OY1A 1XN4A 4GPD1 1NW6A 3JAWB 3N2YA 4HK4A 3DBLB 3K31A 4M89A 3T5GA 3RIEA 2GESA 3PIDA 2PZEA 4EFMA 1GQFA 3QFCA 3IMFA 3LKZA 2AGVA 3KPYA 3C4JA 3OE1A 5JWRA 2ZBDA 5KYGA 2ZBEA 3GVHA 4UCWA 1X0XA 2JJ1A 1HDGO 3FY4A 4OSOA 3E7XA 3IEMA 4W4TA 4AYWA 4G8CA 4DQXA 1YMUA 2C7OA 1CZNA 4Q1VA 5C46F 2YNMD 2X5OA 3RVLA 2VPXA 1OV6A 4X1OA 1N33B 4PQEA 2C2MA 4IDPA 5JXHA 3WNQA 4NESA 3GJ5A 5LQKA 1NURA 2FUCA 2P8JA 2GNPA 2FH5B 1H1LB 1FX0A 5K0NA 3D3NA 1UFKA 1RC8A 4EI9A 2YW2A 3HDHA 2JW5A 1YOVA 1QSGA 1TA4A 1UT5A 1O54A 4W9NA 3P52A 3CBGA 4KLZA 1Q6ZA 1Z0JA 2GNOA 2Q1YA 4G5HA 3SICE 4BQSA 2WTMA 3F5DA 2V6FA 1S2LA 2JBHA 2WF8A 4RIFA 5DX1A 3VR4H 2GO7A 1Z29A 2LXNA 3GLFA 4C4AA 2CK3A 3JQ8B 3A58B 3KELA 2I2CA 2EP7A 4XB2A 4EW3A 2HY7A 2E89A 4GI2A 3WMFA 3NHRA 3FKQA 1IY9A 4JUCA 1PVVA 3AI1A 2QVYX 4MQUA 4JI2B 3FHLA 4EVRA 1QIIA 2OQ2A 2VJLA 4OQXA 5FLYA 4BV9A 3CR3C 2AYXA 1JQ3A 4F21A 4QG3A 4AP5A 4C29A 5JNVA 3B1WA 4H31A 1KRHA 5CXXA 2W6JA 2XEXA 4OOFA 1IOLA 1ESDA 4NFYA 1ZH0A 2LTAA 3AEKA 3B9QA 3GAMA 4ODIA 2QPOA 5IKOA 4AU1A 1Z5PA 4DUPA 1W1WA 1JEYB 5H3HA 4V39A 1NF9A 2BZGA 3L6OO 1W4ZA 4Y9DA 1PUXA 1QUEA 2JKYA 1Q92A 2JS7A 2Q41A 1RKVA 4HKTA 4PZ9A 3CWQA 1JQJC 3UC5A 3FTFA 4OYHA 4NYIQ 4R31A 4BO4A 4U4AA 1QS0A 2KYRA 4LJ8A 5EJ6A 5IXYA 4JBLA 1V4NA 1IMOA 1LVUA 4WCDA 3T1VA 4DSUA 4Z6KA 3IQHX 1NAHA 2SECE 1JDJA 5DK4A 1NDHA 4DR6B 3L4SO 1YZLA 3O94A 3TUJC 2ZTLA 3I5XA 2UVPB 1YUNA 1Z3IX 4JXZA 2CDNA 4YP6A 3KQHA 3ZVLA 1QRDA 4PO8A 3GBSA 4G86A 3ZTTA 3FB4A 2YHAA 1SKBA 3DUFA 4NPCA 4B5KA 4DIUA 5A62A 1YIOA 4PSUA 1RZRD 1L5GB 4RAQA 3D6FA 1P75A 4UBIA 1SXGA 3AMVA 2RAVA 4HGOA 2AX3A 4F1KA 3PQFA 3CS3A 4XGKA 4NOLA 3PICA 1ZVKA 5U4QA 1AHHA 4ER0A 3IIJA 2A58A 3O9VA 4HLCA 3OCXA 4IM7A 1Y1TA 2FF5A 4KN9S 1XMJA 4LJ7A 4MITA 4P8RA 1U9JA 1OYOA 2X3FA 4ZQCB 3T7EA 3TRKA 1K63A 4YV1A 3MWEA 1A9RA 2XRZA 2WJAA 2EZ8A 1C41A 4G9GA 1IWPB 2EKBA 4HMOA 3RK0A 1FXWF 3M6MD 4XD7A 1ZD5A 4MGKR 1DCFA 4L8WB 3HCEA 2GEVA 2XJ9A 5AM2A 1VQ1A 1NJGA 4QXPA 3MW8A 3CUSA 5CXQA 3LYLA 4CM8A 4ZAWA 1RIIA 2F2TA 3W9BA 3P9ZA 3ZZMA 5HTOA 2JIBA 4PPYA 4BMOB 2AOUA 2R2AA 3R6WA 1PLJA 4TWJA 3H8JA 2Q1XA 2R7KA 1UWCA 2OC4A 1IN5A 3PNVA 4F3RA 4YFVA 4BEJA 1N78A 2RH4A 2QZ4A 3MAJA 1Q3TA 1RT9A 4J0DA 3ACDA 4M87A 3SXUA 2JEYA 3BBPA 1YDMA 3CR8A 1NIJA 1J8QA 4QDZA 4N3CA 2OAQ1 2E4VA 2NU6B 3PPYA 3ERCA 1JSXA 4ICIA 4X8MA 2J0UB 3LHKA 4MRMB 2V7UA 1V1RB 3GNTA 1H2EA 4H1WA 4CEIB 4GM0A 1X1QA 3M6LA 1WEKA 4QU9A 5D86A 4YUVA 1K4MA 2XA9A 1YONA 4TTTS 1RHUA 2R8RA 4RWEA 1B14A 3GEMA 1WXEA 5I47A 4ASUA 2ZYTX 2Q3MA 3FUTA 3HKDA 4RBNA 1KIAA 1NLZA 2R62A 1PJQA 4KO1S 1Q17A 1X1TA 1XD2B 2CFSA 2IPAB 2W6OA 2Z9BA 5ALXA 2WDZA 5G2OA 1YB5A 5EJGA 5B6PA 1BCRA 2GXSA 4ZAZA 4MW5A 1OAAA 4LNHA 5FKJA 4CV2A 3I8XA 3C3PA 1KTVA 3MCZA 3VR2A 1OJLA 1X7ZA 2TMDA 3ZYCA 5KZMB 3U7RA 1ZVQA 1IONA 5K3CA 1H8ED 1JALA 2MYTA 4JU9A 4BRWA 3GFGA 5EXPA 3ADPA 1BJKA 3QVGA 3S8YA 1JR4A 1TK3A 4W9RA 3Q7RA 2MSCB 4KX3A 1H4TA 2NTNA 4P83A 1NRJB 4YPFA 2PY6A 1GNTA 4F5EA 4C30A 4UUOA 1B6RA 2BI7A 4C89A 1IFXA 3D6AA 4DPLA 4JC4A 1DKOA 3CUVA 2XIQA 3OTQA 4ZIRA 4EEKA 2OV4A 1CBUA 2JHCA 1EJ2A 3BE4A 3Q8XB 3KVRA 1WG8A 3CHYA 4P82A 1NSYA 3GA5A 4PBTA 1UMBB 4EZIA 4IIJF 2B82A 5HKOA 3BFPA 3LS2A 5J59A 2Z5LA 4DV6B 4G23A 2F1HA 4QOHA 5F64A 4YB8A 3TX6A 1XAHA 4BP1A 5HYVA 4Q01A 1Y8QA 3QPWA 3QYPA 3PUVA 4CM1A 1EVQA 4EECA 4EG1A 1OH5A 3T9BA 4QU5A 3UHAA 4XM0A 3ZV4A 4DYVA 2PKWA 1YF3A 1TIPA 3ST7A 2WHPA 4ZO9A 3PFIA 2FEWB 1TM4E 3BCSA 4H27A 5CTJA 5JDCA 2GZ3A 3R6TA 4MR7A 2E4YA 2WJPA 3MGGA 1TLLA 3PQ2A 1IY0A 4X45A 5CB4F 2XNDD 1KBOA 1LBEA 3KDSE 4NCJA 3VJMA 2HA4A 4RTRA 4TTSA 3RS0A 3RWOA 1I6KA 4DDVA 2FW0A 1JHVA 4FCCA 2NAPA 5TE9A 3TNFA 3NHMA 5KAPA 5C1IA 4NR0A 5T7BA 1ZW1A 3QLJA 3RIGA 1IZ0A 4EABA 1DIGA 2HXYA 5HJEA 2VYFA 5TVGA 3E7PA 4J1TC 3B5EA 1ZGBA 4E11A 4F2HA 5IF9A 4Q3KA 2ATEA 2J4DA 2HZBA 3F9IA 5EQJB 3ORFA 1ECPA 3ID6C 3MOIA 5CFZA 2QTHA 1NDQA 2W2LA 3T06B 3KSMA 2FN8A 4JEIA 2CYBA 4WFQA 3ROPA 2IKSA 5DT9A 4EKGA 4H1HA 2NGRA 5EJFA 5CD9A 1O8BA 2C4NA 4IP0A 1NNLA 2XF8A 4BWFB 2RGNC 2BP7A 1EHYA 3AYXB 4B74A 4QZVA 3FVTA 4PR0A 1E7SA 3ZZUA 5BNIA 4I5FA 5AJTA 4PX9A 1JG6A 3V33A 1LC0A 2BEVB 2B5OA 4YS6A 4GW3A 2J9FB 2I0FA 3WRVA 3WKDA 3ANNA 1OILA 5LDDC 3A4LA 1J2JA 1CRZA 1JS1X 2GPAA 3AEUB 5FJJA 4BGEA 4FZJA 3GLIE 4FX5A 2HIAA 3CUWA 2VJCA 3L79A 1WAMA 1GG5A 2JI9A 3H9QA 4QYWA 1YS6A 4L3WA 3THWB 2P0YA 3MHPA 4IGIA 4C6RA 2P9JA 4YRTA 1Z2AA 4PQGA 2ID8A 4OQMA 4PTLA 4NZZA 4QBTA 1NUHA 2V7BA 1K7XB 1KS2A 3WK4A 1M72A 3OOJA 3H3FA 5DP2A 2HX1A 3W5DA 3Q0EA 4CRWB 1NG9A 3RV3A 2GYWA 1XI2A 3RKSA 2IELA 1Y80A 4NXMB 3UOWA 1GZ4A 1N8NA 4QFCA 1HOXA 2BFDB 1XVAA 2FQYA 3OF2A 4RD2A 4U8GA 3UMCA 1VE6A 4JBGA 1A9SA 1SBYA 2OAP1 1MAHA 1OFGA 3F5FA 2W90A 4KXQA 5TV2A 4EG8A 3OQIB 1PHPA 2CZGA 3I32A 9MHTA 2VAVA 3M5PA 1GEEA 3NYRA 3MD0A 1ZUNB 4AMVA 3KAPA 5FBLB 5IAJA 3CISA 1N0IA 2WY2D 5CG2A 1PZHA 4HGNA 4WACA 4I55B 5BWBA 1U0LA 2AT1A 5BV8A 2GYYA 4YUZA 3OO0A 4L9AA 1QOZA 4N12A 1S7GA 1SUDA 3E9YA 4LRSB 1BW9B 4WH0A 1TYBE 3A6ZA 2D6FA 1KKUA 1KKLA 3DV2A 3MTJA 4MUIA 4NMLA 2EVWX 3UMMA 4QYXA 3CZPA 3FD8A 1KAGA 3IIMA 3OQBA 3OUZA 3EXHA 5G4LA 4DN6A 2V7PA 1BKYA 3U80A 2CXPA 5C32A 4TPKA 1Z22A 2N9UA 1SKAA 2JDIA 3FZNA 3DZFA 1C1HA 4GFDA 4LQDA 4CLOA 1Q7RA 3UK1A 4QGHA 2XQGA 3QMVA 4DS3A 1ML4A 2ADFA 1CK4A 3U7FB 4NJMA 4A8JA 5HF5A 4EF5A 3RROA 1TQ8A 5CCBA 4QQRA 1JKJB 4U39A 1TGVA 2OA0A 3U3OA 5GPBA 3B1KA 3DL7A 3I4LA 2CHQA 5EWLA 1P9NA 4ERNA 3TLJA 1U81A 2NXNA 4I3HA 1YR2A 3KR1A 1KYQA 2ZBPA 5AJXA 2QZ9A 5JE8A 1U4NA 2WIKA 4JZKA 4DMFA 1VLMA 4QLOA 3I2JA 4Q7KA 3OX3A 1RTTA 2QRUA 2RI1A 3HXTA 2BKLA 4NCBA 3JV7A 4Q34A 2DTDA 3AF4A 1OBFO 2HWKA 3FCAA 3D7RA 3LQ1A 4WW0A 5DU2A 4E5MA 4ESOA 3B51X 2MYPA 3KAJA 4PFSA 4Q3OA 1Z88A 4R9VA 5EMKA 5IAEA 4FYHA 1J2UA 2PFGA 4XFKA 1TO1E 1L5VA 3NTRA 3WOHA 1LXCA 4EJSB 5AVYA 4DB4A 4AWAA 4BEWA 2EX1A 3OJXA 1DBQA 1KFKB 1U7UA 2EBFX 2P90A 2HSJA 2VJQA 3D6JA 5CH8A 5DHTA 4BX3A 1CRWG 2WU8A 4Z8XA 3N2IA 1ABEA 1VG9B 4FDTA 4HDMB 2OCLA 2ZATA 2PYDA 1GPWB 2FMXA 1YZKA 2YQZA 4J1NA 2GILA 2ID9A 2C9DA 4P58A 3D8TA 1S2GA 5GGXA 2Y66A 1H94A 3UMSA 5E4TA 1V37A 3HV2A 5K3DA 4BNVA 1U0NA 1MPTA 3ND8A 5AQ1A 1UL1X 1UKEA 1JLKA 4QNNA 4MP3A 2F90A 3AB3A 3UANA 1NAIA 3RUDA 3DUWA 3Q11A 4YRKA 3CNNA 4F8YA 4ZQFA 3RK4A 4LVUA 4U2FA 2RCYA 1I6MA 5KKNB 2GBPA 5K45A 1IHYA 3QKSA 5F1KA 2ZUTA 3TLCA 1D9ZA 4Q1CA 3H2HA 5D51S 3IDAA 2C2KA 4F6CA 2C83A 2BM0A 7MHTA 3V7YA 3D5EA 1P0QA 1DXQA 3EEOA 1A9QA 3FI9A 1ORWA 3OM1A 2BBSA 4ZXPA 4B3DA 1U3CA 2IHBA 4LYHA 5JXGA 5KU7A 1JL3A 2RGDA 2XQVA 4IV5A 3GJQA 3MJHA 4MDHA 1UC9A 4X8OA 1E5XA 3FTDA 3T3NA 2P35A 4KQXA 1DKUA 4E0BA 2G1UA 4GX5A 1KDYA 3VDNB 1WV1A 4QEKA 4NNPA 5T3UA 4RFSA 3ASUA 4JKOA 2CLLB 2VJYA 3GUCA 1G20B 2C2GA 3AFMA 3ICPA 3TVDA 5L3VA 4D9FA 3KKQA 4RLQA 3ZK7A 3MGBA 1DAOA 2NVBA 4XIJA 4BFZA 1A1SA 9LDBA 1BS1A 3NIBA 4ZODA 2I4IA 1P0FA 1P74A 4I4NA 1N5RA 4H17A 4IGKA 3NG1A 3JPYA 4RL6A 2HW8A 2XW6A 3ZDFA 1V5FA 1Y9DA 2Y0CA 1PQYA 1W0JA 1EM6A 2NSJA 3FPLA 4OFZA 2TMKA 4JN6B 4QXOA 3RRYA 4AKTA 5JSUA 2HRDA 3MPUA 2YHUA 1FTQA 3PFWO 2OKGA 4HAZA 4KK4A 4PFQA 4TMZA 3N6XA 5GV7A 5L4NA 1CLEA 2JJMA 1EFUA 2FN3A 1TZKA 1T4GA 1X77A 4HN4B 5BMVF 1NC1A 1UEXC 5ENZA 3OZXA 1YQ9A 3CLVA 5REQA 1U7ZA 4OHYA 4JAVC 1N32B 1S2IA 1D4OA 4RF5A 3V2HA 1RFGE 1KJ9A 2X41A 2ZE8A 3FNBA 3N53A 5TX7A 3WNDA 5B2FA 5K0GA 3E82A 3QPCA 2ZSIA 4K6FA 4HXFB 4J6EA 4B45A 4OU4A 1VSBA 3GAZA 4CVNA 1ISPA 2HHHB 1N6RA 3TMAA 3ZXUB 4EKIA 2REXB 5BVGB 5EIXA 3ZTYA 1TZJA 4OHWA 4I1RA 5CM9C 4J0EA 1QGUB 2O0KA 3KZMA 4JENA 4YCJA 4ZYLA 3BM5A 3RVPA 2AXEA 2I6XA 2C96A 1GO2A 2WNHA 3B7PA 4E1BA 5BQXA 3PC8A 3KWMA 3DVAA 3I6MA 5G3ZA 3MBOA 3SBDA 4GDFA 5C8YA 5CDYA 4XFDA 1KI6A 1M6YA 1EQ2A 5LLTA 2JANA 2O23A 5LYJA 1VGQA 4LGMA 4LA4A 4LJAA 3ZNQA 1QU3A 4DT1A 4FOOA 2G0TA 4YP5A 4OL9A 5KJFA 3N75A 2VQ6A 2Q6TA 4FNGA 4D4HA 5C7YA 4JIMA 5AUNB 1R4NA 1LS1A 1PV2A 1XTUA 1JSLA 1ZGZA 2RHMA 4L27A 4PX5A 2VJKA 1RKQA 2VVTA 2H1LA 3QUCA 4PLPA 4RVOA 2HA5A 3O8OA 5ARCA 4RKWA 1YA8A 3NOXA 2HF7A 1GLNA 1EFDN 1RM0A 1XO1A 3MCUA 1FPQA 4NYJR 4WN9A 4EUEA 3E35A 1JVBA 3EXG2 4E7OA 4YR7A 1L5MA 3DMGA 2PLRA 1LF0A 2OENG 4M9RA 1K9VF 3BXOA 3T1HB 5LOVB 5JRDS 1QKIA 3LNCA 5A4FS 3DO6A 1QBGA 2P3LA 3ES9A 1QYCA 2WTXA 1SIWA 1KJIA 1BOFA 1EZ4A 1XTVA 3CH4B 1A69A 1UJ2A 4D8YA 1JH9A 3WRYC 4GX2A 4WCFC 2C82A 1R0BA 3P4UA 3LZDA 4QHTA 1KYVA 2X6TA 1LD3A 1U0BB 4HQLA 5J9FA 5AVZA 3NVAA 3IAEA 4QOFA 1F8GA 5E9JA 3T1TA 1EM8A 3BHMA 4EHKA 5JZBA 3E3AA 2ZT8A 3FBTA 4NQRA 1ES9A 1N4AA 4ZZ3A 2J0EA 1ZU4A 4CEJA 1IB6A 4XZ3A 1VKJA 1C1DA 3LVFO 1N6KA 4Z54A 2DZDA 1LCIA 4X60A 2ZJYA 2CBZA 1YZGA 3HYRA 1E1RD 1MC5A 1MKYA 3DCJA 3L8GA 4R1PA 5ICSA 1LDNA 3X0DA 1VG8A 3AZOA 3BMQA 1JFFA 1DJMA 1TW3A 3OU6A 2ZDHA 2F4NA 4W5RA 4CETA 4G0UA 3ESRA 3NBYC 2LBPA 1YU6A 3QTTA 4XH9B 2V65A 2IS1A 9GPBA 3ZWCA 3FMFA 1L5HB 1P5JA 2YJGA 3SDZA 2PX4A 4DE5A 1YL7A 3P9KA 1Q3HA 4CW7A 2OZPA 2WJYA 1XJWA 4S0ZA 2Y92A 2QE7A 2C20A 4EY3A 1DXHA 1ODFA 1JAZA 1AUOA 3IC5A 1YVEI 3ISVA 4UEKA 3O4GA 3OEED 4ZCQA 4JT9A 3D1VA 4LJ4A 2CLOB 5H70A 3BB1A 1RZ3A 1Z2DA 3EVDA 1L8LA 1IOZA 2I4RA 3BCRA 1OTXA 3IPYA 4HNGA 2GPYA 2QM8A 3OZRA 4PGAA 5MGBA 3KTFA 1VA5A 3N8DA 1VOTA 1G8PA 1RLOA 1ABFA 3QUSA 2GBLC 4KMOA 4OHOA 3UJPA 5KC9A 3H2KA 4PYOA 1XNHA 1U63A 1NA5A 1NVUQ 3O0DA 3NB0A 2V6BA 5CHEA 2VDUE 1F14A 1R7RA 1QP4A 3SYKA 4OU5A 2C29D 2ZIVB 1OZGA 3EY9A 3TYXA 4PIMA 3G0OA 1KEEA 5AI8A 3BD8A 1X2BA 5BYJA 3FCOA 2WKWA 1OH6A 5LP6B 4KEAA 1I94B 3S55A 3A6FA 5LMCA 1X3SA 1XTPA 4BQPA 4PZUA 4TM7A 2V74B 3U4DA 4DQ0A 3EDQA 1I8TA 5GOZA 2AA3A 3M8KA 3MCTA 1CNEA 4CLHA 4FM9A 1D6MA 1NMXA 3G49A 3O47A 1NI4B 3OOEA 4FLEA 4G81A 4JR2A 5FTNA 1P9WA 3KTAB 4GM1A 4J8PA 1T8SA 2G9NA 3RHFA 4DNOA 1QGDA 3D7SA 3RSHA 3SZMA 1EX6A 1N2CA 1EFVA 2IOQA 2IFTA 3PYXA 3L43A 3FMGA 2GHQA 3HBNA 1XRJA 4L2IA 1XZQA 2PSEA 3F2IA 4GBJA 1E1DA 2GPTA 4NAUA 4RPKA 2FMFA 1FK8A 5GGYA 4DDWA 5DRYA 4UBJA 5CEFA 5DBFA 1XZKA 4GZ3A 3E1SA 2Q5EA 1OIXA 3DEYX 1CERA 3DO8A 5TMEA 3Q9NA 4NMMA 5H3LA 3TO5A 4EQZA 3L84A 4OHUA 3WOVA 1JZSA 2VRCD 3NBFA 1ID1A 1PRYA 2B0JA 2A3NA 4FB5A 4TXLA 1U0HC 3FLEA 3MAAC 4TM8A 4R8LA 4DLSA 5GZ1A 3VKWA 1WVGA 3CZMA 1PEKE 1PR6A 4OQPA 2PZKA 2XCTB 1HE1C 1USVA 2HTEA 4B8YA 3FCXA 1YQQA 3GWGA 1NPTO 3G2IA 4RH3A 3K70D 1M34B 3NT2A 2H5JA 2RARA 4MEJA 4RVFA 5AW4A 4ZYUA 2YIVX 2WVAA 4OM7A 3VHRA 5KYXA 1E96A 1TUGA 1XF1A 3AIIA 4P0TA 5DWQA 1G98A 2YYAA 2CLDX 4AK9A 1ZJ6A 3A6JA 1M67A 3W6UA 4BIMA 1D2NA 3THXA 3R9XB 2OZVA 2HSWA 3R0QA 1C8LA 1FFEA 3BWDD 5JANA 1QC5A 2DQ4A 2ODBA 5B6JA 1NYQA 3O8NA 4PBSA 4Q7JB 1Q7BA 1WA5A 3G6KA 2CNNA 4KOAA 1E3SA 1UDXA 1QGED 3PXCX 5K5EA 1F48A 2YZMA 1RJ9B 5ETJA 1DEAA 3AGQA 1GUDA 3DO5A 3NZEA 4TUYF 2I1QA 3SHTA 3U7QA 4J49A 4ALNA 3C8MA 3FWPA 3TTVA 4CGYA 4I1UA 3UWSA 3Q40A 1OZAA 3LH5A 4FWIB 3VPHA 3N2NA 1OFHA 4N0EA 1BH2A 3OTHA 3LY7A 4UPVA 5FH9A 3M1YA 2O8CB 3IP3A 2I91A 4X20A 1Z7EA 1BA2A 3ZYZA 1EWTA 1PTJC 1OXTA 2DWPA 3JQAD 5ADWA 3DEIA 5LFAA 2VOJA 1DDGA 1E7QA 2BV3A 2Q6KA 4YY3B 2PUBA 4P7KA 3ELYA 3CX6A 4MLCA 4PWZA 3CIOA 2YV4A 3RWBA 2VUUA 4FQ8A 3GEHA 2M6SA 4GPTA 4M9CA 4RAOA 4CM4A 5I9TA 5KVSA 1TAGA 1GGFA 5KEIA 3FVVA 3KE9A 1HYQA 3W2IA 1UAAA 1W93A 4B75A 2FPMA 1DWOA 1JSCA 3A9CA 4KXNA 1T4DA 1AURA 3JAKA 1Z18A 4N3NA 3UKOA 5I9BA 3GFOA 1BA3A 1CYDA 2JHFA 1NXXA 3IMKA 3K0HA 3VJLA 3WVNA 5KSWB 5KTRA 4U3JA 2F1JA 2ZR7A 3RSZA 1E0JA 2GPWA 5CYPA 1E92A 1K75A 3LWDA 2HBQA 2ZRCA 5C35A 1A9ZA 3E5HA 4C3OB 1XR3A 2CUZA 4BTEA 2ZRHA 2VHCA 2ZB8A 4DIEA 4IKEA 4WWHA 2WYVA 2QQEA 3WHKA 2RE8A 2QD3A 3ZIUA 3D2BA 4FS8A 1F8UA 3IDZA 2ZUEA 4M1KA 4TMYA 3A2NA 4RPHA 4NP6A 2HTFA 4KNVA 4R1OA 5ERYA 3TQOA 3AVYA 1XXHB 2O2IA 3SCZA 2VTEA 1WDWB 3FVQA 1VIDA 4LE1A 2QTBA 4TXHA 4O4IB 4TZKA 2JH8A 2ZIXA 4CR7A 2OCGA 4TLDA 1A4XA 4Y98A 1USGA 4MUYA 4W7HA 3GGGA 4FUQA 2JLXA 2ZAIA 3A1UA 3CWZA 2HLNA 4IWXA 1WD5A 3I9V1 1LA2A 1DG1G 3CZQA 1IYZA 4N48A 4RY9A 3VV3A 2WG0A 3RFTA 2WQ6A 2ODWA 2OPBA 3DPUA 3L7YA 2X9VA 4UFNA 2ZDQA 3C3BA 5G40A 3PVZA 3WNBA 4YT4A 5ALIA 4HZUB 1SXJB 4QL3A 3QSYA 1M2EA 3E9EA 3ICWA 3G2PA 5KNCA 1M0EA 5JJKA 4EATA 4QARA 2Y0EA 2EGHA 2IYYA 4GRDA 4UJ3A 1YULA 4FQ7A 3USZA 1QZZA 4AS3A 3HP4A 3RUFA 5KU1A 1FTYA 3R3ZA 3WAKA 3TW6A 2ZRIA 4IDOA 4MTLA 3I6QA 1A9TA 1L9XA 2BI8A 1WUIS 2I03A 2IYZA 3BMNB 1M5UA 1Y9EA 3K9WA 4HUQB 3NWOA 1AXGA 4XVCA 2OZLA 5A71A 2VNAA 4YCAA 2XUPA 3SIWA 2PMDA 1AKRA 3A3KA 1ID8A 1QE0A 3PE4A 3UMJA 1M0SA 4W8HA 4IHJF 1R15A 3C41J 5AI5A 2EYQA 3SJ7A 2WKRA 2PS9A 1A8IA 1Q0TA 3QXSA 5FFMA 1KYIA 3T8YA 1BN6A 1K5DA 3ABOB 5JVDB 2AOTA 221PA 1FMFA 1E9DA 1YK0A 1RJWA 3OFKA 4G4SP 4BLOA 5AUPB 4XQ9A 2W2TA 4RMNA 5HSGA 2IXFA 4G36A 1QAQA 2GTPA 2PA3A 2Q4DA 3MUEA 1P91A 1DRVA 3PXBA 4KH0A 4MIKA 2O6HA 1S01A 1O7JA 1I3MA 3IH5A 4GP7A 5AJZA 1AX9A 1JN0A 4KO4S 3C6BA 3WL5A 4COOA 5J2TB 1ILWA 2Y68A 3L8CA 3NOOA 4I4TF 3RFCA 4M0LA 1OAOA 1A7UA 1R4MB 4FMPA 1HNZB 3RYHA 1LNQA 4J0HA 4ZFNA 3A1FA 4YCDA 1EDBA 4HN9A 8OHMA 2F62A 5JPDA 1Q12A 4EX7A 5CCDA 1A96A 1MX9A 4DLAA 2VRBA 3HY6A 4LKRA 1IUPA 2PAFA 4KXXA 4QYSA 1I7QB 2BJHA 2SICE 1A9XB 1TLTA 3K4PA 4ENQA 2C4UA 3UFBA 4P4LA 4AN4A 1KJ8A 1T5TA 1Z4IA 5L4LA 3PPIA 5TF0A 3AETA 3L49A 4G0ZA 3WV5A 5F7OA 3KM0A 1O5OA 1GZ5A 3DHNA 1MC8A 4MV6A 2LCQA 1QGOA 1D0IA 4F91B 1I24A 5FYQA 3TBFA 1Z6GA 2YWGA 2GEDA 1Q15A 4L3OA 1G60A 2J3KA 3KKLA 4L5AA 4LYGA 4M9XA 3ROEA 4JEUA 2CNKA 2C58A 4OA8A 1JJ7A 4QQFA 4O4JA 3HZZA 5LVAA 4IIUA 3TZKA 2D7DA 1XJ5A 4QFBA 4YAJA 2RI6A 4S2EA 2GFIA 3U3DA 3DTNA 4N6NA 1K27A 5CA0F 2NO1A 4DCCA 1JBEA 2XRFA 1VCHA 1UPAA 3VJRA 3E7WA 5KOIA 1V96A 3GBVA 4CM9A 5KOHA 1PW7A 1P1CA 3W5UA 3R5JA 3HNOA 4NDAA 3UUEA 2FPGB 3KKEA 1PFVA 1OJ7A 3C8DA 3OLYA 4IXWA 4KDFA 1JPVA 4F9TA 2FOXA 3BJIC 3PXGA 4F85A 2Z2IA 3ZV3A 4IGFA 1W4BA 1A97A 1G8JA 1KK1A 1OASA 1RM4A 1Z16A 4M8KA 1GLVA 3ORSA 3DTVA 5AKEA 4F8EA 2Q8QA 2O7VA 4HNRA 4R1TA 2G04A 1OBHA 1KJJA 4IICA 1E89A 1SOVA 4U9IS 1CUJA 1THGA 2BUCA 1QHNA 2HSGA 2WP0A 1V16A 1B0UA 4JDUA 3EDMA 3DDNA 2Z8YM 3PKJA 1R6UA 4NCNA 4OGWA 4OMUA 5EL0A 2Q3FA 4PGMA 3IVRA 3LC1O 3AIMA 3NRBA 4LOAA 2ZSEA 2ZRPA 4HFNA 3NDPA 4JQZA 3UGTA 4PXAA 1IZ8A 5A02A 5J1TB 4HB4A 4I46A 3U6BA 1ULAA 3DB1A 5IYZF 4QDKA 1AUQA 4NIMA 3UQYS 2OSVA 1QPZA 5C18A 4N4AA 3DS8A 2H5IA 2YV5A 3CW8X 4OX9Y 3R77A 1SOAA 1NW4A 1DO2A 5FNVF 5J58A 2PMWB 2HDNB 3E3NA 4ZQHA 1XDBA 4W9NC 2DKNA 3NHYA 1QIDA 3WNVA 1O77A 4FD3A 4AFNA 3RH0A 1SXPA 5AHOA 3HNRA 4IJMA 1RYNA 3HVKA 4Y9UA 5D5PA 5I8PA 5KYYB 3EXIA 1HR0B 3ASVA 3C6QA 4HVLA 5K8CA 5T8KA 1A9OA 1OXVA 2O2DA 3KETA 3OZWA 2CNWD 5AXAA 3AONB 5K4GA 2VT6A 1D04A 3VRHA 1MV8A 5KTKA 1CEQA 1RPJA 2C1ZA 2WUGA 3PEFA 4GU5A 4K1LA 1OAKA 3DMRA 1NY5A 5KCMA 3AEXA 4ZU3A 5JQGA 3NHKA 3C3EA 1CB7A 3FMVA 4TQAA 1TFRA 3EF1A 2D8AA 3PRYA 4I1VA 4QGAA 5ALNA 4TLBA 4ZEMA 1H42A 1WV0A 3TLBA 1WS6A 3BQ9A 5KYNA 3WWDA 2E5LB 2YRXA 2I6FA 3QITA 2B25A 1WDLA 1TYEB 3IIIA 1G21A 1JJBA 2FLWA 3TFQA 4CM7A 1SA0B 5EZYF 2P1ZA 4K05A 3VVBA 1H2AS 5FOVA 4A8HA 4P3PA 2VXYA 2I80A 1L5NA 4PYMA 4JLKA 4OBBA 3HQ4O 5AKLA 3A1NA 3ND5A 1SC9A 1DWQA 1RHRA 1I9GA 1GYRA 2WWRA 2I4OA 3NBKA 3RVMA 2Q9CA 3OPYA 4YO7A 4F93B 3CX4A 2FW8A 5FBKA 3BJEA 1IB0A 3QNMA 2WSBA 4KXLA 4LGYA 3RJZA 4JT8A 4EZEA 1CJKC 4EGCB 1QQ7A 1B4DA 2VA9A 4Q1DA 2QSUA 1F20A 5E7MA 3L1KA 3RYCA 4RF4A 1U8ZA 5DBEX 4OKIA 2R7MA 1ZOPA 2IU0A 5TSDA 3PJRA 1K4KA 4IYJA 2JGDB 3CF4A 1H2RS 4KLAA 1CHDA 2CFTA 3I5UA 3I01M 1E3EA 1RMQA 1VIYA 5JMPA 4E5NA 4WNAB 1CHNA 2OT3B 3E1KA 1U98A 3IQFA 4JEHA 4Q4CA 5TPWB 2C59A 1J0CA 1H0RA 3PEVA 2GEJA 2Q99A 3MBIA 1XXLA 3CCCA 4YWJA 2QQ0A 5JSHA 4FGZA 4IX1A 2XBLA 2FPIB 1SCKA 1Q1ZA 3AFGA 4L0DA 3GZNA 1VJ1A 3JATB 4UFPA 2ODNA 1CQIB 3P94A 3E22B 4MZDA 4TMTA 4X71A 1LBHA 1PF7E 1TM1E 2UAGA 3B36A 2VYCA 5HM8A 1NNEA 3IAS1 3G2OA 4DSNA 1EFPB 3G9ZA 2HK7A 5C1OA 3G0GA 3KAQA 1G0NA 3BZBA 4PX2A 1VLQA 2E3JA 3UAGA 4RSGA 4CKZA 4IOJA 1XD8A 3WXBA 1Z2OX 3W3AD 3WKBA 3CTPA 3ZIDA 2GA9A 3ZBQA 3JQ7B 1S0UA 4AUNA 1V47A 1RS0A 1YZ3A 3VYSB 1OXUA 3LA8A 1ZBQA 1W85A 4QWMA 1RLMA 4OQFA 4OXQA 4BNMA 3GDGA 4UQLA 5DISB 1O94C 2ZE7A 3C5WP 1QGYA 3AYZB 3HXQA 3G85A 1KZ1A 4MVJF 5H68A 1U2TA 4GZLA 4BNZA 2FHSA 2H9IA 2R751 2XB6A 3M70A 1C3LA 4UHFA 3HU3A 4DILA 1ZHFA 3OCVA 4Q9JA 4B4DA 4IDFA 5JH7F 3T9FA 4RK6A 1QB8A 3G82C 2YR0A 5IT0A 2QMEA 2WAAA 2AJCA 2PH7A 1JLSA 2JPDA 1KP9A 121PA 1MO6A 2Q21A 1YJCA 1LU9A 4GGMX 1T6BY 1OKKD 2G5CA 2NUTB 3COPA 4IG9A 2WIJA 4WGGA 4DHEA 5DMHA 5IKXA 1P80A 6LDHA 4MUKA 4QAJA 1FP1D 3G9XA 4FIZA 3P71T 4JLNA 4OXXA 5ABPA 2FG5A 1XK7A 1QHHB 1TCBA 2O7SA 3ET4A 3K9HA 4OF4A 4PIVA 3QYAA 2NZXA 3G88A 2A5FA 3RU3A 4AVYA 4KBYA 1OF1A 3RYFA 1JZTA 4DCJA 1TEVA 3I5YA 3FGNA 4GKBA 1YRLA 3IFSA 4XQCA 5PNTA 3I5MA 1PNVA 1WABA 2B4AA 1PV1A 3H8WA 3OX2A 5IABA 1UM8A 3CF4G 2VHXA 2HCTA 1FTGA 3M5CA 3UYLA 2IUFA 2VTBA 1YA6A 5D85A 1V7CA 1C7QA 2IIBA 2AZTA 2FPPA 2C54A 2OAEA 2PZLA 1WQ3A 3EAFA 3ENZA 1IIBA 4GI1A 4B2YA 5JASA 1BE0A 2JRCA 3U9TA 1IZYA 2GEFA 1IAVA 2CFCA 2IU3A 1N5MA 2F6RA 4HAIA 4KQ1A 1QQTA 3FKSA 1D8TA 5F78A 5BWOA 5KSYA 1KRXA 1SU8A 2FJUA 1D4AA 4HNAB 3VZRA 3NOVA 2ZJ6A 3QM1A 1MHPA 5EERA 3MTGA 3L1HA 3LUGA 4WXRA 3ROTA 5GONB 2EW8A 1DDIA 4X66B 2H3EA 3JAWA 5KWEA 4ZVKA 3DBLA 2H1IA 3BMXA 3QEAZ 3UJ8A 4CT4B 1KZYC 4FBLA 1QOPB 4RVSA 5HIKA 2QTNA 4MSUA 2G80A 4P9NA 3T9CA 1R0LA 2F00A 1YJ8A 2QSZA 3GVCA 4MUNA 2FPUA 2GH1A 2NV6A 5JDCC 5M3BA 5HUJA 4OLJA 1IZ9A 2GEKA 3NHZA 4KR0A 4NEQA 3LOQA 3SC4A 2GD6A 1OOEA 3Q3JB 3HWWA 4X6UA 5DW3A 1DX9A 1QH8B 1GAJA 4GWLA 1SCIA 3H7IA 1GZ3A 4NE9A 2I8AA 5IVIA 4JASB 2ERCA 1GFSA 4GEGA 4HT3B 1Q0HA 5CFPA 1WCIB 4QJIA 5DJ5A 3KKZA 1JX6A 1X7HA 2P9TA 1Y3HA 2P6MA 2ZG6A 5AICA 5EQTA 4DTCA 5CA1B 5EJ5A 2OO5C 4CMIB 4LC1A 3C5HA 1DLJA 1KERA 2YASA 4MW0A 5HE9A 3RBVA 1DIRA 1T5LA 2AD5A 3H18A 3KOUA 3A70A 1EDDA 3HFJA 4JQYA 4N01A 3TD6A 4C87A 4HBGA 3N0RA 4EUKA 1ZUD1 1PNRA 3GROA 4D2IA 1KO8A 1H93A 2KB0A 2RH8A 1Y8RB 2VJBA 3JQ8A 3KQSA 1ZXLA 4FYMA 2JI4A 5CX1B 3SVZA 1BKSB 2WILA 5AMXA 3G0CA 3TIIA 3WRWA 2C8JA 2YIJA 1KGDA 3AG5A 1UBGA 2XVZA 2IXAA 5I7HA 1YE8A 2VO1A 1UKYA 2VAMA 2XE4A 1J5PA 3WMEA 2ZZNA 3SJCA 3KG2A 3F47A 3RHZA 1ZDMA 1Z37A 2W0MA 2QTWB 1IDOA 1OI7A 3HZRA 1LVHA 5F5NA 2MHCA 1S6YA 5ALFA 3H99A 5IAGA 3RSOA 5CP8A 5G4KB 5HIIA 5LLSA 5B6IA 5CFRA 5KUTA 3ICQB 5A4KA 2N46A 1HURA 1SU6A 2JBWA 4GRIA 4BNIA 1I3OA 1T2NA 2OECA 2RGBA 1MJ5A 3ELWA 1HLDA 3OTIA 4LGVA 2XBUA 1N7HA 1B43A 1YC2A 2BSAA 2QL6A 1BS9A 4X54A 2ZB3A 1W6UA 1UODA 1ORIA 3RS9A 3WIVA 5I01A 3FUXA 4R7ZA 3OFND 2Z09A 3PDIA 1E69A 1T36A 4B44A 4DIDA 1OCEA 4C3ZA 4AI6A 1XF9A 1JEQA 4IDDA 3TQHA 3G2QA 4Q02A 2FN7A 1SXQA 2OESA 3CZ5A 4A0QA 2XB4A 5ALQA 1JPNA 1V2HE 2P1RA 3IOYA 4XJTA 5EP4A 3VDXA 3E3OA 2COEA 4QRDA 3RVSA 3I04M 2AI1A 4PIPA 1WXDA 3VU8A 2R1VA 2WWIA 5IVPA 2UVPA 3ND9A 4OXNA 3ER8A 1AHNA 1NN0A 2WLTA 3L93A 2CB0A 4L4SA 1MVLA 5JTUA 1W88B 3U4AA 1HDYA 3I0MA 1A5SB 4WX2B 1ODCA 1KSHA 4HLNA 3GCXA 1T43A 4S1WA 2DECA 2D1RA 3BGOS 2YXLA 2O3QA 3JY6A 4DHWA 5IZ4A 1UPBA 2XTMA 4HGQA 5KNBA 1P2UA 3KJXA 3DOUA 3ETDA 3NBMA 3JQBA 4C5BA 4LJLA 4UDYX 4D8XA 2P4UA 2VATA 1PK8A 4ONEA 4XCXA 1O08A 3ZVNA 1YUBA 1M34E 3HI4A 5ALMA 4OAQA 1ODTC 3NH6A 2WMYA 1B93A 4BLRA 3K73O 3SMQA 4EM6A 1EVYA 3U3RA 1FUKA 1IJBA 2PANA 2M1ZA 1Q7EA 1HQYE 4KPUB 4ARUA 3U3XA 1E1NA 1BMTA 5DB4A 1JJFA 2JIZA 1DFIA 1PJTA 5AKXA 2WFLB 3EXHC 4LBYA 5JZVA 3NGMA 1UZNA 2VN8A 1A72A 5I48A 5T5QA 1NVDA 4GMDA 2OY0A 3KZCA 3T3MB 3Q1KA 4CV0A 3UCXA 2FWAA 1VLZA 3QU4A 4Q1BA 3ICVA 4XPIB 2B1IA 2R87A 4HNVA 4WGFA 1ADBA 5ES3A 4RANA 4A8JC 3M0EA 1QG6A 4P35A 3RTGA 1QWSA 2WD8A 3G79A 3UMBA 5AHXA 4Z3KA 3I64A 4HRAA 5B3AA 4BWGA 1R6DA 1Z5WA 3LZ6A 1P5ZB 4ER5A 4JVOA 1UR5A 5JW6A 4ZZIA 5IMBA 5F77A 1I4OA 3BHNA 2BHRA 5L45A 1F2UA 1SAYA 3VR5A 1L4FA 4CNBA 3C39A 3DEJA 5DIFA 4RJKA 4WA7A 2BDEA 5B58T 1Y3AA 4KHPB 3OQVA 3GRPA 4QDOA 2I99A 4JHLA 4WE3A 4ZV7A 4XPZA 2GM9A 4MHSA 1V41E 4E07A 3WBBA 1JG7A 2XWQA 4H3SA 5DHSA 4GRAA 1HTTA 3FOEC 3W79A 1T6NA 4OKSA 1IPHA 3ZPXA 4AJ9A 2ERYA 1KA9H 4LRWA 1OV4A 1XD2A 1YAJA 2FMIA 3OT1A 1D2EA 1JF8A 1NW7A 2GWHA 1NVFA 2YJNA 1UUFA 4O4HF 1L4EA 4R84A 1PK7A 1KP2A 4J9UE 5D8DA 2VT7A 1GAXA 1W9HA 1FOEB 2JIPA 3AR2A 3V8PA 4W5JA 2QQFA 2B8EA 1JILA 3GO4A 4PNPA 2Z43A 1VSQA 1XZMA 1KEZA 1E77A 2UUOA 4IUCS 2F9FA 3ZLJA 3Q8KA 1Y1PA 1E1KA 1OFVA 2VOEA 3I42A 5LXTB 5AUQA 1G8MA 3OE7D 1UBCA 1R10A 3OUUA 1RXVA 3V8NA 1YQGA 2XZLA 4ZHSA 2ZIUB 4BBZA 4HP8A 1ZO8A 3NHBA 1X87A 5DXJA 1USIA 2D0IA 1ZOOA 2ODTX 4EITA 3RC2A 1J49A 1IHPA 2AOWA 3GRRA 4I2NA 4AC9A 1C0LA 4C0KA 4Y8VA 1UMBA 2YYZA 4MV5A 4LQLA 5EFOA 1FX1A 1JWAB 4LDNA 2C4TA 1JDUA 4R9UC 3L0OA 2H5LA 4CZ2A 4ZI3A 4G0QA 3W6NA 4ZWNA 1IOWA 2PKEA 2RAFA 2V1XA 3G7UA 4DC0A 5JZ9A 2JIDA 3TUZC 2RHLA 3O7MA 1EVJA 1WSAA 1BDHA 2Z1NA 1DZIA 2X3UA 2LRHA 5FO0A 3T94A 4AWBA 4NS1A 4KAAA 3A1TA 4PQYA 1JQEA 2BEUB 2HQRA 4PGGA 3VC3A 1BMQA 2IUUA 3MQFA 4RESA 2XE7A 3BXZA 1GILA 2ZWVA 3QPUA 4QJ5A 5HG0A 5ICCA 3PQ3A 4Y2SA 4DSZA 1CUCA 1VPVA 5E6SB 4HMPA 2AWOA 4B6SA 2DE0X 4V0NA 3DF7A 3IXQA 3FMPB 3LO8A 4MWTA 2DFDA 3UO8B 3WGNA 4I2VA 4C08A 5ES4B 2BHLA 5LQJA 5E6UB 4UM5A 4QUDA 1EZZA 3RRBA 4URXR 3LWZA 2HSEA 1BO6A 1S2DA 1YQWA 1KJYA 5EXTA 5MN5A 1U1CA 2OBBA 2DBVO 2CF5A 5FI0B 2WWGA 1WOMA 3JXEA 1OZ0A 5BURA 5YASA 4CMEC 1ULSA 3BEOA 2CE7A 4DR5B 4XX0B 1CY1A 3BQMB 3UKDA 1KYTA 2YHBA 3HRIA 4F4FA 1KDPA 1P1HA 4YXFA 1OWPA 1B76A 3JYNA 2J08A 3EW9A 4JC8A 3AWDA 4L8FA 3ZWWA 3V4ZA 3R7FA 3VSCA 4JV5B 4EG5A 3LBNA 4GOXA 5IWAB 4XGNA 3JPWA 3TFOA 2QGNA 4OA5A 2JIRA 2BEVA 3FDFA 3KB1A 4IV8A 3QWIA 4P7FA 1ABBA 5HXAA 2J9FA 2Y99A 4NOMA 2VK8A 3W8DA 3DBHB 1IIRA 4RPCA 4B87A 4N3AA 5JEDA 5FLXA 2HBRA 2VZEA 2VQSA 1WE2A 3AEUA 3COWA 3B2NA 3KQPA 4JX8A 4XIFA 5DWVA 5J5VA 1YJ5A 4MYTA 4E15A 4IHKA 1GTZA 1I7LA 3PC8C 4XDGA 3ONFA 5LB2A 1ZR4A 2G67A 2BZ0A 3L40A 2CXQA 3RSFA 1YHZA 4B6FA 3FROA 3OPNA 4HGZA 4DIFA 5JALA 5DN6D 4KITB 1KMQA 3TIFA 5A3SA 2DFNA 3AX6A 2CMGA 3QF4B 1LI5A 2RKBA 3WLNA 5DLDA 4JROA 5LP1A 4MI3A 2Y0BA 4GVLA 1FFHA 3D4PA 4OSEA 1GZUA 4IFBA 5BV7A 3HRKA 1CSEE 5G0VA 1Q1GA 4JI3B 4AMYA 5IK2D 2DULA 4FFBB 4XWGA 2BYTA 4LYYA 4G3XA 2WB4A 4FUTA 4BQIA 3PHJA 2PUJA 1SCJA 1ULTA 4OH1A 5CLGA 4FILA 3L0CA 2PH5A 3E9QA 5LWHA 2R6GA 1E4EB 5DLEA 2IHTA 1T9GR 4QGGA 3ZH2A 3WQSB 1UK7A 2ZT6A 1KPGA 1C9JA 4D8WA 1SR8A 4ND8A 3U26A 3UM9A 3HO6A 4O08A 5ALRA 1ZUNA 4TKVB 3RODA 3TIVA 3V42A 5A7FA 1FIUA 3GW8A 1XCOA 4ESVA 2VDNB 4CKCB 1K8RA 4I55A 2H11A 4X00A 1ETHA 1ZRMA 1C7ZA 4YAGA 1JDVA 4X44A 1CDZA 4A0SA 1TQ6A 4ZHQB 4MR9B 3ZHBA 2B4YA 4ZI7A 1BW9A 4IINA 2IIVA 5TPZA 3L7DA 3A1EA 4YJDA 1QVZA 4UULA 3B82A 1HC7A 5KBYA 1AZLA 3UXEA 3K9FC 2BR3A 4AXXA 1VSVA 2VUSA 4HLDA 4YRZA 3QY0A 4PSDA 4GHWA 3DZIA 3D6HA 4MB2A 2A0YA 3HA3A 1YS7A 3FSGD 2V4UA 3EGWA 1TMOA 4P3NA 5G0TA 5BN4B 3RT1A 3GLRA 1Z5ZA 4MVJP 1NP3A 4JUIA 5AK4A 1PVOA 2VHEA 3ZWYA 2OCBA 3NTVA 3HLYA 1Y7HA 5KQLA 2ATCA 1HRDA 2DUMA 4RKFA 3ZZ1A 1JKJA 4FX2A 3OA2A 1WZUA 2FZGA 3PUHA 3Q88A 3I9OA 1MRNA 1MJFA 4KIUA 4B5LA 1MVOA 5IHXA 4LWPA 4ARZA 2JF0A 2VYVA 1GUFA 2VTVA 1IPEA 2ZVJA 1N6HA 2VPQA 4LXUA 2EFYA 2Y9MB 1TF2A 3HR8A 3LXMA 4UKDA 3RQIA 1E2UA 3ZKAA 3KEMA 2C78A 2JEZA 3HSSA 1ZK3A 5MFPA 1PJ4A 3ZBUA 5DYTA 1PJSA 2O2EA 1UFOA 3FOBA 4Z9BA 2X4LA 3GRFA 4AJ4A 3KZKA 4RUKA 1YUMA 4IH9A 3R8XA 1RP1A 2XQJA 5EZ5A 3UJ6A 2FYTA 5BVHA 3ROMA 1UDAA 3QKWA 5EG5A 4BJHB 3TRDA 5DI3A 2EU8A 1H9BA 3CVOA 13PKA 4MWCA 3VA7A 3MMXA 4O2BB 4X5OA 1KOJA 1VMEA 4X3OA 4BMCA 4EJSA 1GA6A 1TE2A 3ETEA 3UWPA 3QFHA 1CUZA 1TKRA 1NNI1 3SEZA 5AW7A 3LVQE 3W2HA 1WUHS 2AEEA 3UAYA 2DFLA 4JCOA 3EIFA 4EHNA 3BMCA 5H4GA 5IJ9A 4FN5A 3EQ8A 1V8FA 3LT0A 1CZOA 2IPLA 1DE0A 4HDMA 4J0GA 4MYDA 4BFTA 3HCFA 4AX8A 1TZMA 5JCJD 2JAUA 4M1MA 4Z4QA 3PUIA 5AI9A 5BRAA 3SX0A 2R86A 1UOOA 5TB5A 3E48A 2C9ZA 3ON5A 1GCOA 4FYJA 2O59A 2BY4A 1HE4A 4XLTA 4G5GA 4JLSA 3WZ2A 4B3BA 2YJ5A 4DIOA 3IKTA 1AIPA 4O1IA 2A1UB 3DLTA 5J5AA 4IG4A 2ZTVA 4LV8B 4OY3A 4RH1A 4RHYA 1R0XA 1DARA 3OZDA 2GN0A 3D54D 1HKHA 1SVOA 2HMYB 4P1ZA 4OQ4A 4FYWA 1XMXA 1DBIA 3D8RA 5LSAA 2P9BA 5I7RA 5IUJC 1B73A 2C88A 4TMXA 1XOIA 2DJ5A 1QFYA 4JYPA 3JWGA 2RJOA 5FWYB 2OBNA 4JJFA 3S7TA 3VNAA 5C7OO 3TGLA 1X0VA 4XWTA 3N8GA 2ZKIA 4EBFA 3BA1A 3VR4A 3QXHA 4AMGA 2PK3A 2O07A 2HC9A 3G8BA 4S2UA 2JLQA 3TF5A 1GGNA 2CWDA 3AZPA 4BGDA 4R41A 2CFOA 1AS2A 2AI2A 2B30A 2CVPA 2ZBRA 1G20A 2UXDB 1EHIA 1V1JA 4LTMA 4FYVA 1WXHA 1UKAA 1NVTA 5CVVA 3ZVMA 3DHVA 1NWCA 1VPWA 2ADMA 3M9LA 1C2YA 3ZV7A 3HP1A 3OA0A 4O2RA 3H16A 5JNUA 5EJ2A 4F6RB 2AWNA 5F12A 4AO6A 4R98A 2GVDC 1XEXB 4JSRA 5K3FB 5JO0A 3A8TA 2CHGA 3SNHA 1GRQA 3L4EA 1QIHA 4ENRA 4POOA 5I4IA 1KYZA 1OBCA 1CDDA 2AFHB 3NPMA 3QWFA 4GICA 3TX2A 4BO1A 2I2DA 4C0AC 3HYNA 4RDXA 2Y1WA 3GUUA 1YI8A 2Q9UA 1QZ3A 3H4MA 3K0CA 3JS5A 5I9IA 4KNYA 1JJAA 2P4QA 3L07A 2FK7A 3PX7A 1U9YA 1NTRA 4KI7A 5CA1A 3DR3A 4C4YA 2FA9A 3PUJA 5BWCA 4LFAB 1NXOA 2PD4A 1T8UA 4KQJA 1C7FA 1H9AA 3L4BC 3A7DA 3JWIA 3K70B 3IKVA 2Y05A 3AF1A 1NI3A 5ED0A 1NU8A 5F51A 5SYAA 1P61B 3G2MA 5AK6A 4CMKA 2CBGA 1M2VA 3KOWA 3PNQA 3LGSA 3Q8WA 2Z30A 2X2PA 5H4HA 1X7YB 1YT5A 2Q0QA 2Y76A 3W6ZA 5J2TA 4XKJA 2ZXFA 3IPCA 2CV2A 1DEHA 1QVAA 4KWTA 4XRRA 4N1AA 4BUJA 2IZ0A 4NDNE 2EEPA 3BCUA 2LDBA 2VAWA 3JVVA 2GKSA 1RACA 4HQ0A 1TKBA 3EQ7A 4IXNA 1QAOA 4WERA 5TS2A 5FBVB 4LNUB 3E8XA 1L7OA 3JZFA 3L0YA 4W6QA 4IDQA 4NYJQ 4OH7A 5J1SB 1JRLA 2JLYA 3WGYA 2I7CA 2PQ2A 3PUWA 5HW0A 1PS8A 2H0AA 3G5UA 3FAKA 4KO8A 3RVJA 2LIPA 1NATA 2D06A 1AQLA 1GZDA 2JL1A 2RC5A 2VDJA 4LJKA 4L15A 1L6IA 4EMBA 6PFKA 2H2GA 4L5JA 4KR7A 4FPXA 3U4HA 3JQAB 3KXPA 3EA0A 5HJ5A 1OWOA 3P45A 3RABA 3IKMB 4ATNA 1JKXA 2J9ZB 1Y3FE 4GE3A 3B78A 4J3JA 4QPNA 2ZXUA 1DGQA 2CZQA 3GLGA 1B00A 1SCBA 3PCRB 4BMNA 4UBOA 1SHLA 1SG0A 1EWQA 1JBQA 1ZZEA 1Y4ZA 1QG0A 1B7GO 2NO5A 2Q5CA 4L5CA 1MXFA 1YFKA 4LZZA 4PO1A 5JCOA 3UATA 1GSAA 4CLEA 4QO7A 4DA9A 5B7QA 3HXOA 5J4KA 2NW6A 1MDBA 4OQLA 1J0XO 3ESXA 2R00A 3WWPA 4DLBA 4Z0PA 2Z4TA 3KBOA 2X0DA 3CGWA 3R44A 3SDBA 1EVZA 3RUEA 2O3RA 3UPTA 5KHOC 4YJFB 4EFKA 1ZM3A 2Z8ZA 5LQUA 2MR5A 3PEWA 1XDWA 4B43A 4KN5A 5ALWA 2I67A 1G3MA 2FSSA 3HJGA 1KU6A 5A3RA 3I9KA 4OKNA 1U1IA 1OB2A 3PNSA 4PCLA 5KI6A 1DDOA 1UFVA 3C7CB 3HM9A 2DFPA 2OILA 2HQOA 2Q8NA 3V8VA 4YRAA 3H6HA 4HI0E 3LPCA 4QJ4A 3TSZA 4AJ1A 1Z8DA 2CLKB 2YN4A 3DV0B 2GA8A 1VLJA 2AZXA 4KHZA 3H8VA 3R5XA 1DBPA 2L17A 5DGCA 1MB9A 4CUZA 4L1KA 4RVGA 1C8KA 1N8TA 2CUKA 3A6EA 3OZAA 1J0AA 4RGBA 1KEKA 3AUUA 1RAAA 2NO6A 5T4EA 1V9CA 1NUQA 1RHKA 1CFZA 3R8FA 2HSZA 4W5HA 3G8AA 3VDRA 3MTAA 2EZ9A 2Z5VA 4BQQA 4QREA 4YAIA 4CT5A 4XSVA 2PKRA 2ZREA 3FIJA 3NHPA 1EFHA 2YJ3A 1L5HA 1AK2A 1Z7BA 3VYVA 3WGZA 1BDJA 5J23A 4DJ5X 2GCNA 4JBNA 2R60A 2ZJBA 2G40A 3GH1A 1DPFA 2EHDA 3HDQA 4L6AA 5ILGA 4DWOA 5L6MB 2Z56A 2BCGY 4TXJA 4JJIA 5IS2A 2YN0A 4RK4A 1FNSA 4UOQA 3M4YA 3RS3A 2CMHA 3OO1A 3S2YA 4M0UA 2B3DA 1CPYA 4G0OA 1VPEA 2LV8A 1VKNA 2BZSA 3BQNB 4BZZA 3HKCA 5BPHA 2GF9A 2X8WA 3OURA 4EFLA 4MV1A 5SYMA 1YS4A 4CUKA 5JECA 4B6EA 1H3FA 2EG5A 1TM2A 3N5CA 4FFOA 3KSBC 4C2TA 3SHVA 2PMEA 4GOMD 3D6MA 4UOZA 1ACMA 4HD8A 1VDZA 3HUEA 2I87A 5E6RB 3N7AA 1OAOC 5LP6A 3D0KA 4Q3BA 2E85A 4ETNA 1EE9A 1COWA 2HJSA 3DSRA 4OJNA 3C74A 2QT9A 1ZICA 5EIOA 4JC5A 4AJKA 4KPEC 4WBNB 4RY0A 1M8PA 3VU9B 2G71A 3Q85A 1Y6JA 3KTAA 4ZJUA 2G63A 4RHXA 3IX7A 3LPNA 2Q3JA 2NT4A 3UH1A 4B84A 1N6LA 1YKFA 4UAVA 4BVJA 2WTBA 4EJ6A 3PXUA 2W2VA 5HMMA 5TARA 2XNHA 2QVGA 4R0MA 3JRXA 1P2VA 1M6HA 2R1ZA 3X44A 2FE4A 4RQTA 4MKHA 4CKWB 4OHVA 5B1YA 2PG3A 3QUTA 5CT9A 1BVRA 1THTA 4FGJA 3CA8A 3JARB 4R54A 4KI0A 1YKGA 3HR4A 4AYTA 2B6NA 1RQ7A 2WQ7A 1WZ2A 1T3ZA 1IM8A 1Q20A 1I2AA 2X13A 1CS4C 1ZFNA 4G4SO 2XT6A 4F11A 4FFMA 4RLHA 2WR8A 4J75A 2AIRA 2IXGA 5ISMA 2H06A 5K0LA 1SBZA 2F1IA 1SBTA 3HUUA 1G5RA 1EA7A 1RE0A 4FSHA 4IGAA 4MYUA 5CU7A 4XASA 1FSPA 4HDAA 1V45E 4GSKA 1FJHA 2K5UA 3ED5A 5MGNA 3OM9A 4A27A 3SYMA 2WM8A 2P2GA 1NW8A 4PPGA 4ZVQA 4BYGA 5A06A 1CUBA 3H83A 5K03A 3GEEA 1G42A 4UVEA 3U44B 5A05A 4G67A 3UQZA 5EP1A 2XH8A 1UXHA 5GVRA 1V9LA 3OEYA 1IK4A 3FVRA 4FJ0A 2YIMA 1AKQA 1LW7A 1JDZA 5HRAA 1MP0A 4LPSA 3R9XA 3NYQA 2QTZA 4H59A 3ICOA 3PXXA 1SG9A 2PGOA 4G09A 3E18A 4KE9A 4H1TA 4URFA 3CKKA 5LQRA 1V5EA 1GPDG 1Z82A 3DJYA 3K2IA 2W2XA 3TQQA 2BRUC 2GCOA 3STVA 3JYLA 1AQIA 3KBBA 3H87A 4R2LA 2B8JA 2NU7B 3EWNA 4LN1A 4WNCA 4RGVA 2DLNA 2XVXA 3EA5A 4BVFA 2H1FA 1ULZA 1XZAA 1K8XB 1M2HA 3TAHA 5H9WA 3DKIA 2AVNA 4CJXA 4PICA 1AQ6A 3X2SA 4MUXA 1E3WB 4HWGA 3ZQ4A 5AT1A 3PDWA 1DC8A 3HB1A 1Q44A 4G97A 5DM0A 4XUDA 4EHIA 3V4FA 3MJVA 4YMWA 2G9VA 4QQNA 4FN4A 4RELA 3ZXXA 1XRMA 4PEVA 5T8KC 4M46A 1IJFA 4G5OA 1J8DA 4J7AA 2DR0A 3FLAA 1D07A 4RFLA 1Y48E 3IUYA 3HG7A 5JYCA 2J3QA 3N8IA 1LSOA 1O57A 1PQWA 4FFNA 4ZC8A 4RA6B 4A5OA 1TAUA 3MF4A 3VTZA 4M99A 2JLWA 2A14A 2CY0A 4TGLA 5FYDA 3ENWA 1ZJJA 1HPLA 3NWPA 5AOBA 2FRXA 2GK4A 4LECA 1X1AA 3VAYA 3VYWA 4E5VA 3EGCA 1DTWB 1UOEA 1XFAA 3N8HA 2GEBA 4NKRA 3WGGA 3HO8A 4DZZA 1EFLA 1XMOB 1PVDA 4J7UA 3C3XA 1RJEA 1GZSA 1YFJA 1N3BA 3FNHA 4O0MA 2RGEA 1CUHA 5DX0A 5A4IS 1R0KA 4U02A 5EIBC 2SCUA 4GQAA 4GVPA 2OGZA 4XW2A 5CTAA 4OREX 3IT0A 2WJZB 5F1YA 2ZT5A 4DQDA 5LKRA 2O8EB 1JNXX 4N7MA 3DZGA 1CR0A 1XXHA 3MIIA 2WBLC 4DXAA 2QP9X 3DE0X 3GT7A 3PDCA 4GXQA 1UJ5A 2YWRA 1PCXA 4B4OA 1CIJA 4E30A 3AHDA 4BDTA 4DRZA 2RIPA 1EWYA 4B3FX 1E3IA 3PCXA 3RJMA 4ALMA 4JXXA 2X5XA 3IMCA 3HA7A 3PUKA 4HATA 1KZ7B 4GPEA 1A4UA 5EKSA 4DR1B 3LP6A 5E9WA 2P6PA 5AKYA 4U2GA 3PFNA 4K9MA 2XV1A 5LUAA 5DCUA 4HZUA 1SXJA 2HAEA 1BMFD 1GZ7A 2RK6A 1E9RA 4E08A 2PGJA 3DDSA 4WIAA 3UT0A 4EWLA 2VDOB 2QJFA 1EGQA 3WLMA 1R0WA 1WW3A 4Y6QA 2OGSA 5H02A 2MU1A 4LHXA 1NXTA 1RBMA 1QFSA 3QHQA 1X8XA 3OC0A 2AG0A 3U40A 2UDPA 3QFFA 1Z6AA 4AUKA 4J90A 1BFDA 1G2IA 1VPTA 4IXTA 4GYJA 5C1PA 1K8ZB 1F06A 3BMNA 5KYUA 4AMZA 1PZGA 3E0XA 2ZRJA 4I6EA 4IVRA 3MT0A 2RC6A 1QNFA 2AMLA 3HVJA 1P7VA 3OZ7A 3NTUA 4R1SA 3WP0A 2G1JA 4DCTA 4MW1A 5B55A 3KHSA 5JYBA 2FSPA 3AFHA 3SY8A 1F0KA 3D8UA 2XWSA 1K3UB 3AILA 3EZ9A 3GVIA 3OEWA 4ND4A 2GLUA 1ZK0A 4E94A 4QVIA 1CC1S 4MS4B 4NEGA 5IDVA 4DLLA 3V55A 4DDKA 2AFIA 3CT4A 5JVDA 1F5NA 4FVTA 4WOCA 3PNKA 2X2OA 2E5FA 1Y4AE 2Y1GA 3GELA 2HPAA 4R2XA 3KV1A 4ABYA 4PLYA 4BJ6A 4BKRA 1N3YA 2TMGA 2WZQA 3KCNA 1GHTA 3DQQA 4RZXA 4BUZA 1V0JA 3EMVA 2RHBA 1IOVA 3PA6A 2IU6A 2PN1A 1T0UA 3S68A 1U2GA 1MZPA 2WSSA 5IC6A 4JBXA 4A0GA 1NLFA 4AY2A 3PEYA 1J9ZA 1XDUA 1DINA 5FUYA 1TTTA 4MI1A 2RI0A 3D5QA 3OLXA 3KHKA 3L8YA 4S35A 1MB2A 3FOAA 4PTZA 2LKCA 4K6GA 3RF7A 3DZJA 4D41A 4EPVA 1AVTA 4F1WA 4C6HA 1A9XA 1PN3A 4TZTA 1KHTA 4TTVA 1T0JB 4Z0NA 3AHFA 5KTSA 1L7XA 1ODJA 2C03A 2QGFA 2P9CA 3OICA 4K3UA 3ZWOA 1NVBA 1YCGA 1RI3A 4MGIR 1L4YA 1LBQA 4HCJA 2EQAA 1R3DA 2RBGA 4HDKA 2C0CA 3LCCA 2DY1A 1DXOA 1TIBA 2PGXA 2RHGB 4YBZA 2XGJA 2GB4A 3X1XA 3URKA 4OFBA 1SXHA 2BPOA 3H1EA 4PPFA 2GBGA 4UZFA 1ICEA 4CE6A 3SIXA 3KJGA 3F5SA 4R3UC 3MQ4A 3UB3A 3CJRA 1ZA2A 3DF9A 4NZYA 2BMDA 4J03A 4TTQA 5CVDA 3HCDA 3I58A 4HB3A 2IYNA 3BGDA 1XZEA 3NIDB 1TA0A 3KYDB 5EPOA 1WP9A 3HXMA 4LG1A 1BOOA 1DADA 1PFYA 1UMCA 3LUCA 3MTIA 1B8UA 3QKUA 3IUSA 4YRLA 2IYAA 3CZCA 2XYPA 4JU8A 1OXKB 1EQUA 4WASA 4YMIA 2Z83A 5C1DA 5H9VA 1SWVA 1AG9A 1P1RA 3LHDA 1PL7A 3GZTB 1NOKA 2Q50A 3B60A 5EVCA 2JAQA 4GL2A 2Y77A 4MMZB 4B3JA 1H0SA 1O89A 1OU0A 1DPGA 1PR3A 1RWWA 4NULA 4BP9A 1E7WA 2WU0A 3WDLA 2XDYA 1QO7A 2K4MA 4G4IA 1A88A 3ROKA 1G4HA 3RG2A 2XA2A 2JLAA 2Q0SA 2X7XA 3FR7A 5A5GA 1QH9A 2I3GA 1U5BB 3JCZA 4OB6A 1L5LA 4BCDA 5ARBA 1RRCA 2HBYA 4AQDA 5F98A 2H0RA 1FFCA 4XVUA 5I7AA 4YRJA 4C0HA 2JGNA 2DPXA 2K87A 5ADHA 1R0SA 1H66A 5HIMA 2B4QA 4UCXA 4GX0A 1PZFA 2Z5GA 3SC3A 4NOJA 4E31A 1Q0LA 2AK2A 2BFFB 3EZ7A 3IERA 3H0KA 3KE8A 5B2EA 5AOCA 1VRVA 2I33A 1CY4A 5ALVA 2F9LA 2VEDA 4H15A 4KQ2A 2DQKA 4ALLA 4Q03A 3OZVA 1M2OB 5K8LA 3F6EX 3VPFA 2ZYVX 2GCPA 3KYBA 3W2GA 4PN3A 3WYEA 4LS3A 5HDQA 5TIIA 4JSYA 2MSWA 4JQOA 2R5NA 4JBIA 3ZEIA 1HDEA 4MJ3A 3GLHE 1IAQA 3CMCO 1CDOA 2Z1MA 3LYAA 1RPTA 1N0UA 2VZ8A 4M36A 2I4MA 1XN1A 3NCHA 1WPGA 3Q3IA 2J33A 1EZ1A 2O2YA 2YNMA 3B7WA 1AV7A 4EHFA 1CE8B 4G41A 3A9UA 3EEYA 4XDYA 2Z3VA 3KXKA 1E0DA 4YMTA 4URHA 1A8QA 4PV7A 1RHMA 1KO7A 4C7MA 3HU2A 2PZBA 5JCXA 2G06A 5K0TA 4KR3A 4S1NA 4WKCA 1EHCA 4ZAYA 1UPXA 2ZYWX 2EIHA 2WM9B 2ZTSA 3HKBB 3IP9A 3OBBA 4LCBA 2PBZA 4Z99A 1SQ6A 3BIWA 3TTTA 2BGWA 3A31A 2QD1A 1W96A 2P2YA 3TLKA 5F35A 5A04A 3T41A 1SA0A 2YOHA 2OFPA 3HN6A 2E4ZA 1U5CA 1PBNA 4FE7A 4QIHA 3M2PA 3UCEA 2WWHA 3I76A 3QE4A 5EYPB 4B85A 4DV0B 3ZOZA 3KSZO 1NQTA 1U1FA 5EMNA 1XUOA 4IIJB 2I6SA 2WUEA 4BQOA 1MB3A 2Q3CA 2BFEA 1FFDA 4JVLA 5EFZA 1OVGA 1QE5A 2OP0A 3ORQA 2Q4BA 3RKRA 1ECCA 3R75A 1LTHR 1E1YA 5BQFA 3UW3A 2H9YA 4CMCA 4HSEA 4GYKA 2C9BA 3H0CA 1ZCZA 2B21A 2P9EA 2L2QA 5CB4B 3H5IA 3C3AA 4ZALA 2NUAA 4F12A 1KZ9A 1V4BA 1R9NA 5DGHA 2FEPA 3ZCPA 4BBAA 5CG1A 5HJ2A 1HSZA 1H2ZA 4EI2A 1PL0A 1WOYA 5F2EA 3KTOA 5HILA 3S4YA 1XRNA 4RHTA 3ZU3A 1I7DA 1MQSA 1WZEA 3MRXA 3NH9A 1O6BA 2XZTA 4YP7A 1R50A 3LW8A 2O57A 5TPWA 3BGWA 3MXTA 2PSJA 3H5LA 3PWZA 3IDFA 3NWBA 2QORA 5EJ9A 1NRXA 3JQBC 4HH0A 3T1OA 1UC5B 2FPIA 4Q47A 4JP5A 5IH7A 3A37A 4CDNA 5CHYA 1C4WA 2I78A 2QM7A 3E22A 1G7TA 3NCTA 5FI5A 4JSTA 1NUPA 4IH4A 5KJCA 4YRPA 1XA3A 1UAGA 3K8QA 3SBXA 3TTSA 1EFPA 5JFOA 2X7JA 5L7TA 3JQGB 3PYMA 5AP9A 3C0KA 1GXSA 2YX1A 2VCEA 3PT9A 3L0SA 3FDZB 5JXWA 1RZRA 2GZ2A 1JQBA 1ZI8A 4LIPD 2BGIA 4XVQA 3WLRA 2FWMX 1ZVMA 3JQ7A 3PGJA 1SVUA 2I2BA 1PDOA 2KBFA 2LCIA 1NUSA 1IC6A 3GJSA 5DDIP 2GZAA 3HFRA 3CLSC 4AIIA 2BKAA 4F2PA 3VJKA 1U0OC 4PN7A 4OX9B 1PT7A 2FDRA 2BF7A 2QYSA 2VXBA 1GPYA 2JIOA 3AJRA 4OAPA 2OXTA 1J9EA 2A5LA 2I2XB 7ABPA 4RTMA 1P3JA 3HDYA 4MDEA 3QHAA 4M53A 1ZUHA 4P31A 3ENQA 4EY4A 4K9PA 4LJSA 2GK7A 4P4SA 3T9AA 4B7UA 1ZWKA 4QQ8A 4QJ3A 1WNTA 4AO8A 2UV8A 8LDHA 2LIVA 3EXEB 3I39X 1NBMA 4B31A 3G2HA 4PZCA 4TV9A 4LYJA 4UQPA 1G291 2IHZA 4LZAA 1WF6A 3K4HA 1RPNA 1AHIA 2AQKA 2GASA 1IBCA 3QLEA 4J4TA 4F86A 2OCAA 4FINA 4B0PA 1SOWA 3OQNA 1UBUS 3CB4A 4ND6A 4U6QA 4UU1A 3W9UA 2X1MA 4JLAA 5CRIA 1P29A 2IZ6A 4QJBA 3ADBA 3C6XA 2QRJA 2VYNA 4V0ME 3VPGA 5BNZA 3K8OE 1SRQA 2PIAA 4YDSA 1QHHA 2OO7A 2WMNB 3F9CA 1OLSA 1T9ZA 1U1DA 3AF3A 1LI4A 3G9TA 2IPMA 4I36A 3AL2A 3B6KA 3PX3A 4LPKA 1QM5A 3SF0A 3TQCA 4IHQA 1ZHOA 2P4EA 3ELDA 3C70A 4OIFA 4XOIA 4R71A 4BMPB 2IYSA 2Q6OA 2ZAGA 1OWNA 3NTOA 4XWKA 4C0LA 2J48A 1T0IA 3HWX1 3VR0A 5C8YF 1U7OA 4C6TB 3W1VA 5LYJF 5C4GB 4ZI7B 2ASEA 1QFMA 1D2CA 3S2ZA 4MV4A 3BZWA 4PZPA 3ZX5A 5CCEA 1JQDA 4A3SA 4A8TA 1DZ3A 4PZLA 1EMDA 1JYEA 1PE0A 4P54A 3P4YA 3V2IA 3PHHA 5EAIA 1GGEA 1FSSA 3C4QA 1TKCA 3HGMA 3IAM6 2TRSB 1KIFA 5CLJA 1LGYA 4WL0A 4B1FA 2ZUBA 4QDXA 2Q27A 4DCNA 1CZUA 1TC2A 3MWKA 3UY4A 3P5SA 3U48A 1OIVA 1B6GA 5GONA 1QP8A 1US8B 3LF1A 3M4XA 2ZI3A 2FZCA 5H0IA 5B2ZA 1H8EA 3UAXA 1AJEA