3R7BA

Caspase-2 bound to one copy of ac-dvad-cho
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
159
structure length
156
Chain Sequence
MQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTGLEFRSGGDVDHSTLVTLFKLLGYDVHVLCDQTAQEMQEKLQNFAQLPAHRVTDSCIVALLSHGVEGAIYGVDGKLLQLQEVFQLFDNANCPSLQNKPKMFFIQACRGDETDRGVDQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-2 subunit p18
publication title Structural and enzymatic insights into caspase-2 protein substrate recognition and catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 55
structure length 156
sequence length 159
chains with identical sequence C
ec nomenclature ec 3.4.22.55: Caspase-2.
pdb deposition date 2011-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3r7bA00
3GJQA 4JR0A 2DKOA 1CVRA 1RWKA 4NOLA 3NR2A 4JB8A 4QUJA 3PD0A 5IBRA 4HQ0A 4M9RA 3R5JA 3PD1A 2C2MA 4QULA 4N5DA 3V4LA 4QUBA 4N7MA 2WDPA 4EHFA 4JQYA 2XZTA 2C2KA 1ICEA 3PCXA 4IYRA 3DEKA 3D6MA 5K20A 3EDRA 3S8EA 1RWXA 4QUAA 4EHAA 1RWVA 3GJTA 4FEAA 2H65A 2AR9A 2CDRA 4JJ7A 1RE1A 2CNOA 3R7SA 1K88A 1NW9B 3DEIA 4D3ZA 1SHJA 1I51A 3IBFA 1NMSA 3KJNA 3RJMA 2NN3C 1RWOA 1RHKA 2QLJA 4NBLA 4QUDA 5IAEA 2J32A 1NMQA 4QUGA 1QTNA 4EHKA 3R5KA 1JXQA 3V3KA 4DCOA 1GQFA 4EHHA 5IC6A 3S70A 2CNKA 2QLBA 3KJQA 4D3XA 1SC4A 4JJEA 2J30A 1RWPA 1RWNA 1RWWA 4AWAA 3H11B 1BMQA 1RHJA 5LU9A 4NOJA 4DCJA 2Y0BA 3IBCA 1I4OA 4I1RA 2XYHA 4ZVQA 4NBKA 1IBCA 1KMCA 3ITNA 4I1PA 1PYOA 2J31A 1M72A 2QL9A 3K7EA 5H0IA 4D3YA 5I9BA 2FUNB 3D6FA 3OD5A 1SC1A 2C2OA 4PS0A 1RHQA 5IC4A 3SIRA 4N7JA 4AWBA 2C2ZA 5IBCA 2H4YA 2CNLA 4PS1A 3NS7A 4PRYA 3R6GA 4HQRA 3V6LA 4EHLA 5LU8A 3H1PA 4FDLA 4ZVOA 2XZDA 1NMEA 2QLFA 4IEFB 4N6GA 1SC3A 3KJFA 4JQZA 5IASA 4QTXA 4QU8A 5IABA 4NOMA 3V55A 3P4UA 3H13A 1SHLA 3P45A 4HVAA 3SIPA 5LUAA 3EDQA 5IAJA 4N6OA 5I9TA 1CP3A 2HBYA 1RHUA 2H51A 1I3OA 1GFWA 4FGUA 4QUEA 3H0EA 4AW9A 4QUHA 2FP3A 1PAUA 5IAKA 4QU9A 2HBQA 4JJ8A 3V6MA 2QL7A 4ZVUA 3UOAB 1RHRA 3DEHA 5JFTA 4EHNA 3UO8B 3V4OA 1F1JA 4PRZA 5IBPA 3D6HA 3R7BA 4ZVPA 3NKFA 4NOKA 5IANA 2H4WA 2QL5A 4QU5A 3R6LA 4QU0A 2H48A 1QX3A 2CJYA 2P2CA 4ZVRA 4QTYA 1QDUA 1RHMA 3QNWA 2XYGA 4N6NA 4ZVSA 5IARA 3GJRA 3H11A 4EJFA 2H5JA 4FXOA 4QUIA 5LUBA 4NBNA 2Y1LA 4DCPA 4EHDA 3E4CA 2K7ZA 4LSZA 5IAGA 2H5IA 4JR2A 3BIJA 3DEJA 1F9EA 1RWMA 1I4EB 2C1EA 2J33A 1K86A 2CNNA 2XYPA 3GJSA 4JR1A 3R7NA 2FQQA 4ZVTA 2HBRA 2CJXA 2H54A 2HBZA
chains in the Genus database with same CATH superfamily
1B73A 3SEZA 1PJAA 2V7QD 5JH7F 2H7XA 3MCZA 4QXOA 5C53B 3WHKA 4DDVA 1LBHA 1RCUA 1XCOA 1OF1A 1WB6A 3BXZA 3F0TA 4PRKA 5KOHB 2YYAA 1I10A 2ZRDA 4K0RA 1UWCA 3OX1A 1I13A 1QLWA 3HU5A 3K2QA 3LPAA 4NCBA 1UKCA 1VKJA 5TPWB 4J75A 4WKNA 2P41A 1ZOLA 3H4MA 2OYRA 4V24A 3KCQA 3V1KA 2IP4A 1L3IA 1S5PA 4H0CA 5CCBA 2VDPB 3M2TA 4B7ZA 2A0FA 5BUSA 5CB4F 1HSZA 4JH0A 1PFGA 1SBIA 4G0ZA 4JI3B 3ENKA 1U0GA 4JJKA 4ZO9A 4U2FA 3ZHRA 3IPRA 1RWOA 2ZUUA 3KPUA 3Q40A 2IX3A 2C4VA 5F9HA 1V16A 3NHFA 1NC3A 1E9FA 4P22A 2OG2A 5PGMA 5DN9A 1CG6A 2IIBA 4PQFA 5H80A 5YASA 4E70A 2IH5A 4RVFA 1EWTA 1JXQA 1YB1A 2P62A 4YYEA 3VPAA 3LP5A 4GEGA 4S12A 1X9IA 4G0PA 4KWCA 1L7QA 7MHTA 4RZ3A 1TQ8A 3G0OA 2QRQA 1AUPA 1M2EA 4GG1A 5AM2A 5B12A 3RASA 2BCGY 2HJHA 2XMQA 2DJIA 1PSWA 4D8YA 2ZFUA 3MIIA 1ZM2A 3PEVA 4IICA 4MVCA 3RYIA 1X0XA 4C05A 4EO9A 3WLQA 3JWJA 2DE0X 2AWOA 2RHRA 3CS3A 1MG5A 3QU2A 4QGAA 4RL4A 5LKAA 3H19A 3F8TA 1A76A 1A9PA 3NNSA 2J31A 4K9LA 2EYQA 5DCWA 4D45A 2P0AA 1TCBA 4G5XA 2C8LA 3LHFA 5DSXA 1P2VA 3JQAD 3L8CA 3NWOA 1RHQA 4WKCA 2R1TA 3DGEC 3LL7A 5IDQA 2R5NA 5DXFA 3B85A 5IFKA 3KZCA 5EJFA 1K08A 3DDOA 4LDPA 4R2IA 4YCSA 4PC1A 3MQFA 5ELLA 3TRDA 1L8XA 4TMWA 2R1ZA 1WBJB 5JALA 1NATA 4DDHA 4Y2PA 1ZJWA 3SFZA 4X45A 5BWNA 5JCPA 3K94A 5F4BA 2PKRA 3AR7A 2Z95A 4Y2RA 5HKOA 4TTPA 1JR6A 2NO4A 1DIRA 4ZOLF 4NARA 2SKEA 4MGEA 3SJUA 1OLUB 3D1JA 2WSMA 1TIPA 4KL8S 1JQEA 2IP1A 2CFOA 1QK4A 2KHZA 4RGQA 1EKXA 4DC0A 4ANFA 1KI6A 2GZMA 3FMIA 3OD1A 4UEOA 1A5SB 3FSJX 4GRDA 1KZYC 4KXWA 1L5LA 4CLXA 1JXAA 2FPGA 1DPFA 2IYQA 5M34A 3ODGA 2F59A 2HU5A 5E2AA 1TA0A 1MB3A 1YOBA 1OGYA 1CCWA 1P6QA 3EZYA 3U7GA 2JL1A 3EQ7A 3GRAA 2BFBB 1CNFA 1T4GA 2JI9A 3PNMA 4NQRA 1SBNE 1Z83A 3F6YA 1UH5A 1KYWA 2PGIA 1Z0SA 2PX4A 1MA3A 2YH2A 4P4NA 4ZVMA 3OCVA 3QLUA 2QVXX 2Y4OA 4HX2A 2WUWE 4U7DA 3ZEIA 4DCVA 4GVXA 2V97A 3IKJA 1NE2A 5KZMB 4Q18A 4UATA 1X80A 2N75A 2DAPA 2GYUA 4K5QA 4QGSA 3CMCO 1CXZA 1M2WA 2DWOA 1NXWA 3G82C 4EBFA 3C5CA 4ZVTA 1F17A 2CJXA 4AUEA 1ILEA 4ZCLA 2IF2A 3C70A 4BRSA 1U5BA 2XBLA 3ZIAD 4BCDA 3ORRA 1HTBA 3TRFA 1J6UA 4YUZA 3TGLA 4X92A 2WKQA 1GL9B 3EDYA 3HFSA 4IFIA 1G8SA 1GU1A 2C0QA 3HBLA 3NKVA 1FBTA 3QXHA 1ZWLA 2L18A 2JH9A 4J0KA 5CX1B 1HMPA 2I6UA 2HYDA 3MSCA 3EXG1 4AY2A 4P5DA 2ZXFA 3NLLA 3UHOA 1DFHA 1XDBA 3J7TA 4FBGA 2V7UA 1CR1A 3LPCA 1RWVA 4TWAA 2D2EA 4C08A 1ISPA 1C30B 4YGYA 4F4UA 1MFPA 3Q10A 3EARA 3JZDA 3U44A 2WIFA 5HE8A 4D9GA 1XEAA 2TECE 2Q50A 2W2LA 5EZ5A 5AW9A 1GG9A 4BO3A 5FLEX 1SM4A 1QNFA 3R3YA 4QUDA 2FPUA 2C9MA 4GBMA 4E21A 4Q6BA 1H8ED 1EU1A 1VJ1A 4NS1A 4RD1A 3UAGA 2WIDA 1V3UA 1NSTA 1RYHA 2HHLA 2HRDA 4GM0A 1OBHA 3CY6A 1EK0A 2IU6A 3LWNA 3WYFA 3KU4A 3ZHUA 4E5MA 1JHQA 1J2EA 3N9IA 3R0JA 4LY0A 1I7DA 3I62A 1SOMA 1GTSA 1VC2A 3DMYA 3SSAA 4GF5A 1TCUA 1NXOA 4IFTA 3OOYA 3VR5D 5EL0A 2GNPA 3OHSX 1OBCA 1QYCA 2WAMA 1E2JA 2B4AA 2WW8A 3D7SA 3ZE8A 3ZDQA 1AURA 2ZB2A 4B4KA 3E7DA 1A5AB 1GLNA 4M3NA 3ZYZA 3W7VA 3LK7A 4XYEA 2EP7A 2YICA 3EPRA 4JK3A 3Q8KA 3W8EA 4KQMA 4EPVA 2BMAA 1K92A 5M5BA 1NMEA 3PVZA 4KQEA 4DA9A 8GPBA 2QLFA 1U8ZA 4R1TA 4WCDA 4QQ8A 2WTAA 2M2IA 3AUTA 1PNQA 3HCRA 3C0KA 1NVVR 4BZXA 5B2FA 1KU6A 3FTNA 3IUSA 4CU5A 3AV3A 1A9OA 1M6VA 3ILSA 3EF3A 1XFAA 1P74A 1E96A 2J9RA 4OGFA 1L3CA 2A33A 2C4KA 3QH4A 4P32A 1JDBB 2R2GA 4ZCMA 4RJJA 3EZNA 1FJ2A 1FMTA 1GT6A 2I6QA 4MQLA 4PWZA 4CODB 1MKYA 6REQA 4H3VA 4NEGA 3GP8A 1JG6A 2YMPA 2VP9A 5KQLA 4LOKA 1VGVA 1IH8A 1PAUA 2CXUA 5FLXA 5LQNA 2O50A 1VMIA 4IGEA 3BZUA 4H6PA 3GARA 1P7CA 2W6NA 4OMCA 4F1KA 3DBHB 3II6X 3EB9A 2B1RA 2OXFA 4YASA 4BFWA 2OD9A 3BIWA 5AVKA 4Z4CA 2YKGA 2OCXA 1SHZA 4LPKA 5FOWA 4QU0A 4DHEA 2BLLA 2PKQP 4QPPA 4Q4CA 4QXAA 4C0QC 3FHCB 1B15A 1ZDMA 2WZBA 1IN1A 3D0RA 2A58A 3O91A 2XZOA 1R6DA 1FVHA 1O0CA 3M6LA 4JR2A 3B52X 3QLVC 3UM9A 3AESA 1SXJB 4A8HA 3KSMA 3WGYA 5IT9A 1LI4A 4DANA 4PYMA 3RLFA 3NGMA 4WBSA 4B4DA 4BWVA 4ZZ1A 1CQPA 4JBWA 1ZXLA 3OEYA 4OHCA 5EP4A 4EITA 1ZC3A 1R9JA 4HXGA 4B44A 2ZR8A 4ZCQA 2XHZA 2R2AA 1BXKA 2AVDA 2VTKA 3BZWA 4TUYF 3ZD6A 4G86A 5B57C 3UC9A 1E6EA 3LDGA 4G5HA 4CWAA 1V5FA 4P3XA 3RC2A 3ASYA 3PL1A 2QRMA 2E18A 2WJJA 5D3MB 4RQTA 3RS5A 4E1VA 2AJCA 2EKPA 2VQSA 2OSBA 5JH7B 3CX4A 4U63A 2DQKA 5M7EA 3H6KA 4OOFA 4P9NA 1F0NA 3N1UA 1JPNA 1U8YA 2BGMA 4JJAA 3S1AB 1XRLA 3L0BA 3I52A 4QEDA 4MK4A 2O8FB 2GVNA 4NF2A 1GSOA 4GQBA 3FYSA 1MBZA 4WW0A 1ELOA 4AJNA 4BJ3A 4Z4FA 1R37A 4YC7A 1LVHA 4IIXA 4WX2B 3HWRA 3MTBA 3C3WA 4XB1A 3HLKA 2EOAA 3IA2A 4LDJA 2F3UA 4XD7A 1AUVA 4HAUA 3SE7A 4MYTA 3NW9A 1KP2A 1LPMA 2C98A 4PN3A 1MQAA 2VRBA 5CB4B 1B00A 1CQJB 3BAZA 2CK3A 4DNFA 1O08A 2QV7A 1Z2EA 3A6FA 4FHEA 1Z5PA 3NRJA 5KSOA 1NQXA 2GERA 1L1EA 2OHVA 4FILA 4TXHA 5IF9A 3HE3A 3IMCA 2I2AA 2E87A 2XF8A 3IV7A 1B74A 3IA7A 5A4AA 1TEXA 5LQAA 3AW9A 3ZY5A 2Q2WA 4CM9A 5CA1A 4KQKA 1MX9A 3H2JA 5K8LA 3R9XB 3KXKA 2XYHA 3WLRA 3SEFA 1GG2A 4F12A 4OLJA 4Q4JA 4TV9F 3W9YA 1K4YA 1PR1A 4DF3A 1VMEA 2ECFA 4OJKA 1YO6A 1ZA1A 1YR9A 5ALTA 4YAKA 3BDIA 2RHGB 5KOYA 1WDTA 3HRIA 1JHVA 2ODTX 2XTJA 3AILA 1SEVA 3I6MA 4N03A 4ZJZA 1CRPA 2X8BA 4J16C 4WFIA 5KHOC 1FP4B 5J59A 2A57A 1L4HA 2AZTA 3CN7A 1U8CB 5E6RA 3WHIA 1XJCA 2CJPA 1K4KA 4B3TB 3ICOA 1SVNA 2FQ1A 4GYYA 3E3MA 4R7ZA 3RC1A 3QMMA 3KWMA 4LXYA 2NXWA 2R1VA 5T4EA 3TTVA 5KU1A 1E61A 1RKBA 4U0KA 4AJEA 3KQSA 4A92A 1UCFA 1E0AA 4Q7MB 1VJCA 3Q8MA 2ZCVA 3VVLA 3WLKX 3UK7A 3LCRA 3IAM1 4QJIA 1GGMA 4LX0A 1FYDA 1FSPA 1LF0A 2QS9A 1VZ3A 3UGKA 2GRUA 2FZ5A 4NY1A 5KYYA 3R44A 4YMGA 1L7XA 1O03A 5CRIA 1OLOA 2C88A 2EAUA 4ZOLB 1P9NA 2Z5LA 2QN6A 3KSAC 1GRNA 3UKJA 2XRYA 1M1YA 4H7FA 3QKRA 3QVJA 4OXXA 2DR2A 5BUQA 2H5LA 3AV0B 3OT1A 4OFXA 2NOAA 3PV0A 4HAIA 3M6XA 1ZGJA 2FFQA 3DFIA 3F7MA 1E0DA 3AJEA 4NH4A 5ADVA 2Y92A 1DB3A 5JC8A 3RYFB 2EWWA 1T6BY 2HA7A 1YZGA 2IBMA 3Q3EA 4Q3OA 1DKNA 2PKCA 1RQGA 1C9NA 1JMKC 1Y7HA 4GRIA 5G1NA 1P7YA 4AC9A 1ZMXA 3D8RA 4JR1A 2CXRA 1YRWA 2VHQA 2JAPA 1TEHA 3CVJA 4JP1A 4K2HA 1YJCA 5MFPA 3EG5A 1PD0A 3JQAB 5KQMA 4UUBA 1G5RA 4OQMA 1NBMD 2B8NA 5EIOA 5FUMA 5E2IA 3D02A 1YI8A 4BCBA 2FZ4A 2J67A 2JH8A 2HA4A 2JJYA 3DHYA 4KQCA 4PM4A 4V38A 5JYDA 2ZIXA 3OE5A 2Q99A 4YAJA 1F0YA 3EFOA 2RGNA 3IQEA 1NKVA 3HCEA 4L8GA 3H2HA 4DBZA 1GGVA 2GN8A 4PPQA 5E1OA 2WUFA 2AEEA 1ZUIA 3I28A 4DVJA 1V8PA 3RVDA 4C4OA 4B8ZA 4LJKA 3HA5A 3KKKA 3TE6A 2VYND 3QFRA 3VH3A 3KVVA 2YS7A 1LA2A 2WKRA 1SOWA 4DVGA 2HTFA 3ZHXA 4UNSA 1EVYA 1JDTA 3D3EA 1WKCA 4KGZA 3W5AA 3OFND 1ID1A 3ZVKA 3HCBA 1OE0A 3MIZA 4YDSA 4JDUA 5LC1A 3PU6A 3RIYA 2GESA 3JD1A 1NZFA 2C7RA 1IHPA 3PFBA 5B7PA 2JLSA 4KYVA 3TM5A 5BPFA 4CQNA 3HL0A 1IQ0A 2LE0A 2JCGA 2AEJA 1H4TA 2I9PA 3KEGA 5TT1A 4F45A 4UC0A 4WLOA 2IW3A 1OT5A 5ICGA 4MRMB 2Q2OA 1PYDA 3DO6A 5T7BA 3A06A 3HUTA 4M37A 1DAGA 1C4WA 1XTBA 3QPWA 3ZHZA 2XMBA 5BW5A 3JZMA 2R79A 4A91A 3M6MD 5HSGA 4JYAB 3OBIA 2VSYA 3IP6A 4B3CA 4D25A 4BVBA 1D03A 3OICA 4ZTBA 3FPHA 1QOQB 2UZ1B 3K4HA 4DJTA 3WL5A 4LJ6A 2X76A 1F2UA 3MTAA 4GKAA 3UJ3X 2W22A 3CPHA 4MJLA 3VJRA 1CWUA 3JW8A 4LRSB 3GJ4A 4MEBA 2CGEA 3H4TA 4QO8A 4O4HA 1IZYA 1NXSA 4B73A 4NCAA 3HNRA 1E1NA 3TIVA 4Y6LA 5E4YA 1XQ9A 1C41A 2HJGA 2VI5A 5HF5A 1A7UA 2EBFX 1BE1A 3CZRA 3R4VA 1QAMA 4ZDKA 5EP3A 1RLTA 4NKRA 2BCJQ 4RV9A 1YMQA 2AJTA 2CHQA 1YVPA 2HIGA 1HDYA 2LCFA 5DEIA 3X3HA 1GU0A 3X2EA 4UEKA 4Z9BA 4Y7DA 4D46A 1FPMA 4LV5B 3OLXA 3D6TB 3AF6A 4L7VA 4UREA 5BYJA 1DFGA 4KWEA 3EDQA 4XA8A 2AS0A 4X97A 4CIBA 3A6JA 2HHJA 1GFWA 3ED5A 3DT9A 2NO0A 4K40A 2VS1A 3C3XA 4AKSA 4EYQA 4CM7A 1VJDA 2HLPA 4XX1A 4CMCA 2F7SA 1HDCA 2OGSA 3LUHA 2JIDA 5E6UA 1L4NA 3FNBA 5DBFA 3R74A 4ASUD 2C5LA 1DG1G 4EHNA 4Z4QA 4MB2A 5FR2A 2HCRA 4C14A 2QL5A 4JU8A 5L51A 2JEOA 3E4DA 2BEKA 1MV8A 3CGGA 2P7HA 3E22B 2C9BA 3PUKA 4GLBA 1N5JA 1SURA 2CE7A 3UB3A 3LKVA 3HCPA 4RIIA 1WQ4A 2PLRA 3F8WA 4DZZA 2PUFA 4DA4A 3GP5A 3VR3D 3DEJA 2FE1A 4P3KA 1YB6A 1AXEA 1SB8A 1RYFA 5JCOA 1NW7A 1IG0A 3GV0A 4C0HA 3N0TA 4C29A 4TKVA 2YYZA 1GNLA 5KYWA 1M66A 2Z2JA 3D4IA 4RHEA 5LZ8A 2GTHA 1VMKA 3UAYA 2JIOA 1RWKA 1IXZA 2X3FA 4RDHA 4M46A 3OZUA 4MXDA 1E0KA 1Y1RA 3FHJA 3GJ3A 1YDHA 3S99A 2WT8A 2C2BA 2GZSA 2OFPA 4C07A 1G3QA 4BFVA 3GLGA 1Q0HA 2WVJA 5H83A 3L8EA 4LSMA 3OQIB 4FZJA 2FMKA 2VJPA 1Y4UA 2Z5FA 2PKWA 3GT3A 4GBJA 1VSBA 1X3LA 1YDMA 2J7KA 1AUXA 2JFQA 1FLNA 1KOJA 2O3UA 1UAGA 2GZ2A 2XVYA 3AP2A 5EJMA 2OD7A 2Q0HA 3CRRA 4EARA 4TUYB 3GH1A 2EARA 5J5VA 4EKYA 4UARA 4MGKR 3RVQA 2Q3MA 2ZJ5A 1H2RS 1JBQA 1K27A 1V5EA 3C3YA 3H2BA 4FQ7A 4G1EB 1N6KA 4OB8A 2P0EA 2WA1A 3UTCA 3EDMA 5DHRA 4C7OA 3RS0A 2E4AA 3GBPA 4ISBA 4O2AA 2XA9A 4HAZA 1QTNA 3CX3A 3QYAA 2AHRA 5BMOA 1SBYA 3DF7A 1Q84A 2OR3A 1H5UA 3C3PA 1UBHS 2JJ8A 4MO2A 2DPGA 2WOOA 4K1XA 1NKSA 3F5MA 1IMOA 3TAXA 3K92A 5HJEA 3PITA 2AN1A 5IC5A 1Z28A 2V7XA 4GOND 4PIVA 3V4SA 1V71A 1EE2A 1QE0A 2AXNA 2WABA 4D41A 5BR7A 5FUXA 1I1QB 3CX8A 4OXYA 1ZVQA 4IWXA 4BZWA 3P52A 4NOJA 1ZA2A 2Y0BA 1FU7A 4JQOA 4KR0A 3RVKA 3U39A 4E6EA 2MT9A 2JFOA 5ELXA 1E8MA 3PKIA 4BVAA 2X5XA 2Q1SA 4UZFA 5T8KC 2P9ZA 4ZAGA 4J4BA 1CQIA 3B82A 1OGJA 1MOSA 3G7UA 3MGGA 5F5LA 4DMMA 2JKYA 5JDCA 2W6JD 1JLLA 2AJ8A 4GIBA 4GPBA 4PS1A 4HQRA 4M1TA 3FVQA 1JHZA 2A1TR 4I66A 5CA0A 2WJHA 3WO1A 2COEA 2JLBA 2PSHA 1NW3A 4TV9B 4Z49A 3P0EA 4RV4A 2ZJ2A 2CFRA 4ZAYA 1XQXA 3MJFA 4PYNA 3PTLA 2F2TA 2P9TA 3ZQJA 1VB5A 3FTPA 4KXYA 4ZYVA 1UK9A 1ZD5A 4CVNA 1WTCA 1DAHA 4R2LA 1NQWA 2GTPA 3AUAA 5JS8A 1XHFA 5AHXA 2GD2A 2ZRMA 2VAVA 2AEFA 3TK1A 2FP3A 2JK0A 1EQ2A 2WJ4A 3LYLA 1XJ5A 5BSHA 1CR6A 1R4AA 3U5TA 4G4SP 3EGIA 4QYTA 4B33A 4WKPA 1H8HA 3VU3A 1NC1A 3LUPA 3PWSA 1SKQA 4PZUA 2Z58A 4V39A 2GFHA 5FUYA 3E7XA 1CY6A 1KJWA 3E6AA 3MF4A 4FOOA 5DBOA 1PJRA 2EGGA 1W5AA 2OBLA 3NRCA 1MENA 3MT0A 3EMVA 3P32A 1NTRA 3KZ1E 3OQ1A 2MINA 3P26A 4ZGWA 1D8AA 3CO0S 5TGZA 5EJ4A 3E18A 4L5JA 1OZ0A 3LZDA 1N7GA 4ITRC 4XCXA 1P0MA 5AKGA 1Y6RA 3ECSA 1VIYA 2G06A 2Z2YA 4HPWA 2BP7B 4QG7A 4GDFA 4FNAA 1WUJS 4RS3A 1MUUA 1L5OA 1V5GA 3OSZA 3JRNA 2QM3A 5IBRA 4RELA 4CM4A 4P38A 3P9IA 3RC9A 4CKBA 4JT8A 1B16A 1GQYA 1E3TA 4TLCA 3V4LA 3H8WA 1H9AA 2B0JA 2GWRA 3F5QA 3M7IA 3OIFA 3SX4A 4BIMA 1XWIA 3QG1A 1H2WA 1PNVA 3H5VA 5MN6A 2W4QA 2EJCA 2ZJ8A 2XDQA 4BWYA 3I9LA 1KBZA 3EAFA 3ZG6A 5HCIA 4YRAA 4JB0A 5EZ6B 1HE8B 3ZV3A 3Q5GA 5K09A 1IY1A 1L4KA 1ND6A 5KHLB 1DZIA 3DOEA 3E70C 2J8ZA 1Q7BA 4DIBA 3BH0A 1YA6A 2JEYA 4EO7A 4YWHA 3SBOA 4C04A 5JATA 1K98A 2H18A 4ZU1X 4X85A 3QKSB 1YVRA 2FX5A 2IYVA 4EUFA 3A6GA 2ZGVA 3OTQA 1E3WA 2MSWA 3L07A 4JB2A 3AF1A 5AVXA 1XLVA 2W0SA 4PPGA 2DYKA 1B6TA 2XXBA 4L07A 4ZTUB 2ZK7A 1P0PA 4HEA1 1IXSB 1TOAA 3LJKA 3PDUA 4KZPA 5CJ2A 4JI1B 5ABPA 4C4PA 4EJ0A 1TGVA 1Z34A 1JSZA 1NUSA 3J81k 2OB1A 5JAQA 4UNQA 2LNDA 2V3WA 2J85A 3T9EA 4JLJA 3B1WA 1J97A 3ZK9A 2IGTA 5LYJA 4U5QA 2OXCA 4WACA 5DRYA 3A3OA 3EGEA 3GFOA 2G5GX 5ESXA 2C9YA 1L2TA 3REGA 1SG0A 5JXWA 3GN1A 2R6R1 1C50A 4FS3A 4IX9A 4AMZA 1IPFA 1X2EA 2C5SA 1J9EA 2XBUA 3EIOA 3M8KA 3T35A 1A4UA 4Z7OB 1L4BA 3LSTA 1XVUA 3EK2A 4KP7A 3BE5A 2PA0A 2W6PA 3NHLA 4B9EA 5EE5B 2OECA 4IPTA 1X7YB 1Z7BA 1XZGA 1NRJB 1FMCA 1NI4B 2R8PA 1CEQA 3EJWA 4ZPJA 3JD2A 5B53A 1VRCA 2PMDA 4GBGA 5GP1A 4V0NA 1X7HA 1NOIA 3FR7A 5ALJA 3MLBA 3JAKA 3WYCA 2O2HA 3DT6A 1PJZA 5DPMA 5CD9A 3NOOA 4F04A 1O6BA 2B9VA 1RJEA 1D6MA 1DBIA 1NJ8A 1EWYA 2HMSA 2WLTA 4F3KA 3IAFA 1XAGA 3FOWA 4FE4A 4QELA 2DUMA 3VPDA 4CMIB 5BSFA 1G66A 3HO1A 1CDEA 1YBFA 1WV0A 2HRRA 4K7JA 3TLGB 1GQRA 3EZ9A 3AGQA 4XWYA 4CHGA 3O75A 3CTMA 5FWAA 3ANXA 4GX2A 3O84A 1CUVA 5BNWA 4D97A 2R5FA 1MHPA 4X0EA 4FBLA 3TW8B 2O07A 1E32A 2AC2A 5J1SB 3DVQX 1EAYA 3NCTA 4KPUB 3E5RA 4YNBA 4B80A 5I7VA 5KOIA 1Y4AE 1RXYA 4G1UC 4WN9A 2X13A 2FLVA 1LEHA 2R68A 3AEQB 3DO5A 5LUBA 3ZLJA 2BDTA 1H2EA 2GZHA 3LNTA 2MCFA 5I45A 1X6VA 2ATEA 5CEFA 3T1HB 3GO4A 3QVWA 4KN6A 5ALMA 4BMSA 2Z9BA 1UBRS 1H4SA 2EKLA 1JEAA 4E7OA 4IDGA 1L4LA 2HBRA 2QOEA 4GOXA 2J7PA 3N75A 4Z9AA 2NMVA 1DTWA 1XCBA 5FL7D 3U7RA 1YS1X 3GXBA 3PE4A 4F3NA 2FAXA 1SCKA 2PUGA 3PD1A 4PYOA 4OAQA 4ESEA 3CE6A 4ZQCB 5DKFA 2PZBA 5DP1A 4Z2YA 1T4DA 1UKAA 3ANTA 4X71A 2D4AA 1XTVA 1M2JA 3KOUA 4L5BA 1LKZA 3JALB 3IQZA 1XLWA 4RH3A 2OZPA 1VPDA 1SVKA 3RO7A 5ECGC 2KB0A 3RYCA 2BBTA 4QOIA 2WJWA 3LCUA 1HKHA 1AZSC 4FZVA 1JB1A 3PFGA 4WY5A 3WLLA 1VL6A 1TMOA 3HA7A 1LU9A 1G3MA 3X2SA 1T1JA 2WWHA 2MR6A 3GEPA 3IOEA 4JIMA 3NU1A 4U2EA 5DYGA 2O0HA 3E81A 1VHQA 5CPBA 4OL9A 3VU9A 3FYUB 4DT1A 5KMGA 1OYVA 4S0XA 4HDRA 4N01A 1U4NA 1TZCA 3ICVA 4ZEOA 4L8YA 1ZK4A 2J9FA 1OT3A 1NW5A 3EOBI 2W8BA 3DBLB 3FB1A 3RIXA 2PUWA 1IN7A 3RVOA 1QQAA 3H2IA 1D04A 1P5JA 3D2LA 2VKTA 4H3HB 1UQRA 1UXGA 5U9CA 3ZZMA 1ECPA 5ALXA 3IUMA 4YRGA 1TC2A 2W6OA 5ALOA 4KKXB 1XEWY 4DLAA 4Y6GB 3KK0A 3MTEA 4K9NA 4M8IA 4EL5A 5IH3A 5IK2A 4QBFA 2PUEA 3H04A 1YHNA 1MOZA 1GZ7A 3U3DA 5JI2E 1KEZA 1DIGA 2HSDA 2NXJA 2WHXA 4DIFA 3P27A 3KT0A 3E3LA 3L6CA 3PHBE 5KNCA 3I3OA 4PS0A 4Q1BA 1HZZC 2GKOA 3X2FA 2RHBA 4U5XA 3E9YA 3TZEA 2BGUA 3UCFA 3QU7A 3R5SA 2GXAA 1FX1A 4W8OA 2AX4A 1JYFA 1M2NA 8ADHA 4EA7A 4GMDA 1P18A 1W36C 3L6RA 2GA9A 3PUXA 2ZJ7A 4IEFB 5EJ8A 3ORSA 1XUOA 2ASVA 4IR7A 2XVAA 4S0ZA 5FBLB 3VSDA 4F84A 3WSTA 2UZIR 1H6AA 3HMKA 4G37A 3BE8A 1KYZA 2E6UX 3COVA 5FH9A 1QQ6A 4BQFA 3B5JA 4EFKA 1SBHA 1RAGA 5KO2A 3DVSX 4YO7A 3SPXA 1CQZA 1O6GA 4M9ZA 3UGTA 5B4TA 2NV6A 3EYWA 2X5KO 4K6HA 3CLHA 4QU9A 4POAA 2QRJA 1XNQB 4WZBA 4YJ2A 1C0KA 5KDOA 3IIIA 4WKOA 1LK0A 2QTHA 4M8KA 3LIPA 2AOXA 2WU1A 3R6LA 3SXUB 3AXSA 1E64A 4OHKA 1H9BA 2XYGA 2I5PO 1OR8A 1DKLA 2I2CA 3GFTA 2P9YA 3RH0A 5BSGA 3T52A 1NDUA 2K7ZA 2X15A 1BQ4A 3HH8A 1AD2A 3NDJA 4MI1A 1Z5NA 3REFA 2VQEB 5KCMA 2X14A 3HEMA 1H3NA 4CV2A 1ADYA 4UNNA 2BZ0A 2REXB 4N5HX 5FD8A 4HB0A 3PC4A 4UHHA 1U2ZA 1W6UA 1PR2A 1LJUA 4HNTA 4LE0A 2V6JA 4HF7A 2QPTA 3K1AA 1KJNA 1XE3A 3WFIA 2VZLA 3ZK7A 2X3UA 3OZAA 5LCXA 4C4TA 4MUHA 4F5WA 4HYTA 3BIOA 5GJWC 4W4TA 3AP3A 4WNAA 3RHZA 5D51S 4BNMA 1E2LA 2V8BA 3U7JA 3BQ9A 1C3OB 1F5NA 4Y9TA 3D6MA 3O1HB 3E58A 1GUAA 3URMA 1FQWA 1Q3KA 1IY0A 3GGSA 3N0RA 2WTBA 2XPCA 4IRMA 1QTQA 4Z9YA 2V7BA 3U6KA 1MV5A 3C7DB 3PQ2A 1NT2A 1VFPA 1TB4A 1Z0IA 1VLVA 2OK8A 4IF6A 1MB9A 4MA4A 5DP2A 1DXOA 1PQUA 1G21A 5DNAA 3VHRA 3NNDA 4RA9B 5GAJA 5ALQA 2AN4A 2I2BA 4RPCA 3V7FA 4K0KB 3WQRA 1NUPA 1OXSC 4TSFD 1MAUA 3T8YA 1NVMB 3ZHVA 4KGXA 3L8GA 5T3UA 3RUHA 3TAHA 5ALPA 3OF2A 5K0BA 5E1BA 3ZHSA 2PLWA 3JTEA 1NZDA 3HA2A 3A8TA 3FNEA 1VE6A 4IKPA 3DF9A 3OZBA 5FQOA 2OL4A 4YPFA 3LOUA 5F78A 4OJNA 3C15C 4OBEA 3RVBA 5JTUA 3P5SA 4N48A 1VHDA 3DP9A 2BFDA 2D1SA 3MW8A 2V1XA 2QV0A 1YL5A 4P33A 4XRGA 2C9ZA 2JFYA 4QASA 5CIWA 2PBLA 3SDSA 1WV1A 2O3JA 2ZJ6A 3BORA 2J46A 4GW3A 2C9DA 3CONA 2WWWA 4TQGA 5J2TA 4LJRA 5HXAA 1D1PA 5CBPA 1L7RA 1XNRB 3G13A 5TS3A 3K1YA 2A4MA 5K3DA 4IEEA 1NT4A 3AKDA 3AIKA 1SUWA 4LJ4A 3RS3A 5B5SA 3Q3CA 1P29A 4BVEA 2HIMA 1XVIA 2O4UX 3ELBA 1NVBA 1PYGA 4KBFA 4EI8A 4LBYA 1GLVA 5CK4A 2Z8YM 1U8AA 2JLCA 3N7AA 5CJJA 3M33A 4ZQFA 4ED9A 4KIUA 4ZEMA 1JALA 1LNZA 3KVRA 1YQQA 4XIGS 1Y3AA 3RQSA 3V42A 1H0RA 5L3QA 3RFFA 1OV6A 1D0SA 5F9MA 3LZ6A 1BNCA 4ISCA 3H1AA 3U7QA 4A26A 2J07A 1YHYA 4OP2A 4EFDA 4UVGA 1VKOA 4A0FA 1A5BB 1ORDA 1KDRA 1WF3A 1FMFA 3HUUA 3NV9A 1ZOOA 1U3WA 2VKQA 1II8A 2JGNA 4LYAA 5DXJA 1N6IA 2HF7A 2GAJA 2PFKA 4MEJA 3HY6A 4ARSA 5LP6C 4D57A 3WLHA 4P92A 2XUAA 4GKKB 1DBRA 2HD4A 5FADA 4I36A 1JEOA 1EJ6A 3B5EA 3PNVA 1TCAA 3R20A 4C6HA 2FN3A 3LXUX 1X3SA 1Q83A 2PDAA 1Y80A 4MLZA 2H52A 3OQJA 3VX4A 3SHVA 3A9UA 4D80A 4Q7JB 3HJGA 2VK4A 2ZI6A 2ZIGA 3GBSA 3QIVA 4HRYA 1SHTX 4JJ4A 4BP9A 5AXDA 5KWVA 3PUHA 4P3PA 3ROZA 1FC0A 1A7JA 2PZJA 2XYPA 2DVMA 3UANA 3RFCA 5KNDH 2O2SA 2QGZA 2WIBA 1OTXA 4PC2A 4N82A 5FWDA 2RGYA 3RJZA 4QUJA 1EFPA 1Z6YA 4UM9D 1GA6A 1GZ3A 2P6PA 3AKEA 1TM7E 3REQA 3PQ3A 1V2GA 4RHFA 3QZUA 3DE4X 4JLPA 3E9CA 3HR8A 1Y89A 1G7CA 2P7IA 4UMDA 3ASUA 2QMEA 1Q57A 3BRQA 3URKA 3KQVA 4DDTA 4RTLA 3CVXA 3CNBA 2WYUA 3BK2A 3DKKA 1T9ZA 2OV8A 2Z56A 5K4HA 3I30X 3O4HA 3J7AC 3PX7A 4MW2A 3BXXA 4HBGA 4JXKA 2PBFA 1WXWA 1P33A 2QW8A 4HZGA 3TQHA 4YR9A 5LXTA 1CRQA 1SIUA 3PQEA 1STOA 4Q3DA 3O4VA 4JVOA 5J47A 3FYCA 1IBKB 4KQFA 5FFMA 5IS2A 4J76A 1N1EA 3U37A 3EA4A 5LQDA 3FHLA 1XV5A 2LV8A 4D6XA 4ZQGA 1ATZA 1JKMA 3MTIA 3R5KA 5K5EA 2JVKA 4RSGA 2IEGA 3I6QA 1C9KA 2JJ2D 2ZKLA 3IQHX 1KAEA 3Q7TA 3SZRA 1AKUA 2H1RA 2Z2KA 4M9UA 4R3NA 4H59A 4J0FA 3V8VA 3A9TA 1TT5B 3SYNA 4D43A 1AC5A 2RHOA 3FTDA 1PGPA 2B0CA 2UVPA 3LVQE 3N8KA 4C87A 4DCSA 1MHTA 5B3LA 2DBQA 3ICCA 4DLUA 1ZOPA 1LK5A 1JPUA 1YJBA 1ZD9A 2CCGA 2GETA 2FK8A 3QEJA 4UQOA 1WABA 4RETA 2YZMA 4YUXA 3FTCA 1VKZA 1JU4A 3BGSA 1T5IA 3NOQA 1YUBA 4ZWNA 2FUNB 2VUIB 3WB9A 2VAPA 5LN1A 2PZGA 2X58A 3OX3A 5ER9A 5I7EA 4COOA 1RRVA 2CLFB 4FWBA 3AL0C 4UE6A 4IJ5A 4XGIA 4XM0A 4LDAA 3D4PA 1RXUA 2G77B 4B7XA 1RYYA 4HRXA 2JIZA 3WIUA 1IJFA 2CKDA 3KYDA 4UEWA 5HW0A 2D6FA 4IDBA 3ETJA 3SM9A 2DPYA 1H69A 5LZ9A 1CRLA 5CP8A 1P0CA 1AGPA 3B3GA 5LJLA 1XSEA 2PWZA 1EUCB 3UCEA 1I7NA 3H13A 1UDCA 3P45A 1D2RA 2VLIA 1U7HA 2IL1A 1YIDA 1FRQA 1BHJA 1G1AA 3PFCA 1R2QA 5FEMA 1EA7A 4G9EA 2X23A 1R0BA 4G85A 4X3CA 3TBKA 5HQ3B 2IV2X 4ETIA 3KCNA 3ZHTA 5HF8A 4DMUB 3MERA 1UJ5A 2PLNA 4GWKA 2QRZA 5J5AA 1QGYA 2OCGA 3NORA 3UMVA 2BFEB 3KTAA 1ODTC 3PC8C 3QEMB 2I4NA 4BVHA 1YFJA 4NABA 4UXJA 1KEUA 2YHUA 3EGWA 3OY7A 4GUAA 2GAFA 4S3MA 4RJIA 5EHNA 3I12A 3DNMA 5CT6A 2ZUWA 4AM8A 2V0NA 3I05A 5TMPA 2GF9A 4RH1A 1XMXA 3RS7A 1JDUA 1XTIA 2EFJA 7MDHA 3GJYA 5KEIA 2V74B 4Y67A 3HCCA 1N3IA 1SU7A 4MJ7A 3VBCA 4QVGA 2XUGA 2W42A 1OH5A 2YOFA 3MSXA 1YT5A 4FYJA 4Q9NA 3RVRA 3D5EA 2PZ8A 4EF5A 3EPPA 4X54A 1V26A 4PNHA 4WOKA 1V43A 2YMLA 1BZYA 4MYRA 2QLTA 3VO2A 4NMHA 2X86A 2W58A 4W5QA 3LC7O 3DJYA 4ITVA 1GVHA 2D2VA 3S1SA 3FLBA 4ZFNA 4UQLA 2H4XA 3AR5A 5IVPA 1YFLA 2C3MA 4CL3A 3ANSA 1XLTA 4K6FA 4H6WA 2EIHA 2W70A 1KMNA 3OPQA 3UW3A 1E2HA 1AB5A 4L3VA 3NHJA 1XAIA 3LMKA 3SR0A 1QP4A 1R74A 5BNZA 1QQTA 2A5LA 4BLTA 3ADDA 1UBEA 2DUJA 3AUFA 3TZCA 4DSUA 2J4CA 2PX8A 5JXIA 3DTTA 2MMGA 3OFSA 2YWRA 4LJAA 4W5TA 2NN3C 3B13B 4POOA 3ZV6A 3P9YA 3K15A 4OXQA 1ZNZA 2JANA 2QRVB 2HXSA 3D4LA 3HU1A 4YT2A 3PNKA 5AK6A 3GOHA 4ZPXA 3VUFA 1OAOC 1ZGCA 1LDEA 1SIOA 2K2WA 1WPXA 1HG0A 4PYIA 1F2VA 1XR3A 1OX4B 2PT7A 1A2OA 3EWNA 2GCIA 2BTQA 2M98A 1VE3A 1XBTA 4FGSA 2XDYA 2AN3A 5AXBA 2Z2ZA 4EW1A 5WRFA 3M5DA 4UMVA 1DEHA 2YRXA 1I4DD 3DWFA 4FOSA 2G72A 3ACDA 3KRTA 5TSDA 4A6PA 1PEKE 1KBOA 4DNOA 4YV7A 1JZQA 1JDJA 4FLEA 1G4AE 2IWHA 1DL5A 2ZTVA 2XUJA 1FS4A 1GNTA 1W8IA 3CF6R 4QHTA 3UF0A 1FMLA 2WMDA 2FXVA 4KMOA 3SIRA 1UBLS 4IMRA 3EXHB 1GHTA 3OT5A 4AIIA 5TQVA 1HNXB 3CO5A 2FG5A 1RJWA 2JLAA 1KMMA 1M2GA 3HFRA 4LJ8A 5FAXA 1VIDA 1NR1A 1ODCA 5GV8A 5BV1A 5K8JB 3EYAA 3A4YA 3W3AA 1EP2B 2FSSA 2IP2A 1P81A 2OZLB 1HBJA 1H1LA 3L9XA 1WNTA 3CRQA 4WCFA 3WS7A 4KW7A 4EH1A 4NESA 1E59A 2FWIA 4ZCRA 3JQ8B 4IIDA 2B8TA 3WIOA 4DKXA 3NALA 2CLKB 3MT9A 4PLCA 3DDZX 1O5TA 3KV3O 3QVOA 4JLAA 4UFOA 3HB9A 3A1UA 4L28A 1YZLA 3S44A 3DGFC 3JYHA 4ILEA 2J87A 2C4HA 3L4BC 4EVRA 3NTVA 1IFXA 3VKVA 1JQ3A 5FKJA 1ZJJA 3AEKA 2IXAA 4CBVA 3HWSA 4RORA 1YZFA 1BN6A 4MZDA 5KKAA 3C3KA 3AX6A 3U4HA 3U4MA 1E3DA 1PZMA 2J3MA 4Q9JA 3VSAA 2F43A 3WNCA 4KR3A 1T6NA 1SK9A 5JS2A 3MRXA 4B71A 2GAAA 3GFFA 3R7AA 1FYXA 4AROA 1S8AA 5TS2A 2GZRA 4IAOA 5JLAA 4TLMB 3GDHA 4X8MA 5DK4A 1KI9A 1OLXB 4D4JA 4LNAA 4MV4A 1GXSA 3TVTA 4D26A 1G18A 2GYYA 1KJIA 4N40A 2O5CA 1OXBB 2OXRA 2O1WA 3RTCA 4JI8B 5SY4A 3KB8A 1LS1A 2E3JA 4E4RA 3NBFA 5D01A 2JVJA 2WSIA 3CISA 4HB4A 2REOA 5ALZA 4UHDA 3H42B 2BFWA 2B20A 2X6TA 1Q0QA 2WD9A 1X1RA 4W9RA 4IIEA 4L5CA 3DB2A 4OPMA 3G5MA 3RSZA 3MCUA 1AUQA 3NBQA 2GEBA 2V7EA 4H3KB 3EUEA 1NASA 4GO1A 4M7PA 4NLLA 5BO5A 4BNDA 2WM8A 3HCOA 5EY5B 1E99A 4KQ9A 4JUIA 4HNGA 5I5GA 4BX9A 1GUFA 4FFDA 2Y27A 1Y3FE 3INRA 4QD3A 2QSUA 1L5MA 3GUHA 3OH8A 4YRMA 4RMIA 1NL3A 3HVRA 4RH0A 3TOVA 4WAUA 4H4DA 4C20A 3HKDB 4UZSA 2AG1A 2W2LD 3AR3A 4WBXC 4URZR 1KWKA 1G16A 1KZ9A 1EH5A 1UOQA 2VL7A 1ONPA 1YS6A 3PNOA 3NYWA 4FFSA 4KACA 4X1IA 5EP2A 1Z0UA 4CMHA 1O96A 1PQYA 2XUQA 3QLTA 4BLWA 3F98A 2GN2A 4P31A 1JH8A 2A9FA 3LUBA 3HKBA 3E3OA 4EGFA 1ECLA 2YZGA 4UOZA 2QI9C 3NHYA 2CXPA 1Z5GA 2PZFA 3WO0A 5JARA 4ND3A 3PR2B 3KT3A 5ISMA 4MI6A 1FF9A 1DINA 1RBZA 2BRUC 4HGRA 4HDKA 4BQQA 4MGIR 3WR5A 1N0VC 1GY8A 1IIBA 1Q21A 1XTPA 2PSSA 2SKDA 2V55B 3TLYA 4JP2A 3IELA 2PJDA 1IXYA 5I9LA 2BFCB 1Z4PX 3BTVA 3KWJA 4MLCA 5CW2A 1QGED 2EZ8A 3ANNA 3OJOA 3TRHA 5JZBA 3IHWA 5KQSA 5FOSA 5FPYA 4HN2A 2YRFA 3UEOA 4UM9B 1PLJA 1M0WA 2ZPAA 1QOZA 1A9RA 3BE4A 1OHHA 4IFEA 4I8DA 3DTNA 3RT1A 2UVQA 3TTTA 4Y98A 1ISGA 1OIVA 4N9WA 4RWEA 4W7HA 2GTIA 4ZI2A 3LD9A 2VJMA 2WMYA 4N41A 4IJMA 1J9ZA 3X1YA 3RHSA 3WGJA 3A4TA 1ZOSA 2M6KA 2UUBB 1B26A 1J39A 3CZQA 2Q5FA 1I2MA 4HXEB 5EIFA 3PNYA 3PHGA 2ZBVA 3P4UA 2FPXA 1ZBDA 1E1KA 2IYYA 4LRUA 2RKWA 1WU8A 3CG0A 2DP4E 2VK8A 5A6SB 3MWKA 2VBGA 1SR8A 2VHYA 1EB8A 1BG6A 4JHLA 2GJ8A 4CT5A 5I8WA 2VJKA 2QJFA 3IR6A 1ZESA 1L8LA 1AS2A 1NX9A 4Q16A 3FCEA 4N0MA 4NMMA 4OMFG 2M6LA 3QGMA 5E6SA 3WMGA 1K8QA 4CCYA 3L8FA 4GP6A 2GAOA 2CT8A 5K03A 2O52A 3M34A 3OO1A 4BB0A 2F9FA 3UYLA 3IUEA 4KV9A 4CF6A 1Y6JA 4UTNA 1O9HA 2WG1A 1RLJA 3EGXB 3FZEA 4KDRA 4XZ3A 4HPXB 4MAAA 1RM5A 4CG3A 4D4IA 3MG9A 3IHLA 1JAIA 4CL8A 4IL5A 1NLYA 2GZ3A 2H5IA 1KDTA 1BMFA 3CEPB 5G4KB 3FJOA 2W2QA 3L79A 3S4YA 5DCUA 1CEEA 2DTDA 1OFVA 2XT6A 2XWBF 5IHPA 5B3JC 4CN8A 1J1UA 3G0CA 4H7KA 3F2IA 1P9OA 1XDDA 4GSLA 3GYGA 4H08A 4UM5A 2XE4A 1U2PA 2P8SA 4G07A 2XMCA 3IIKA 5ER6A 3HBAA 3HKEB 3DSRA 4UMFA 3UG7A 3CUWA 4M1OA 2DCUA 2HL6A 2BKUA 2SECE 3FKQA 5CVCA 2OSVA 3DBRA 4LGMA 2I4OA 1QVRA 3C3CA 3OIDA 1A69A 2W90A 3ST7A 2REQB 4OTZA 5A3RA 2BL4A 3HI6A 2V1UA 2IHJA 4MV7A 2DBVO 4GUDA 3NEAA 3VC2A 2NZUG 5ITSA 1THZA 4K88A 3IBFA 1G0OA 4GDMA 1U99A 3QSGA 3RVPA 4BRUA 1Z29A 3QRWA 1U1DA 2JASA 2QAGA 1UC9A 2F1IA 3OKPA 2CL7X 3VV3A 4D42A 1P8AA 3TR0A 2PVPA 5D6NA 3EBLA 4MS3A 1XQWA 1E1CB 3I92A 1IDN1 1T3LA 3GG9A 3NBXX 1HYQA 1U5AA 3OUTA 4IKEA 4UAVA 5TE9A 5T57A 1TKRA 1T9HA 1DQRA 2I3AA 4XD7D 4BMNA 3AERA 1OB5A 4A16A 1GZSA 3ISJA 1VCHA 4N5IX 4XQ0A 1DKOA 4XR4A 3TD9A 4UNRA 4S1WA 1OA0A 2CK3D 3PEWA 2YDYA 1JEEA 5TIIA 1FY2A 3L8ZA 3DV9A 5KTRA 3UXEA 1Y1SA 4N5NA 1T6ZA 5TPZA 4JJZA 3PTAA 3AY6A 4NCNA 2RAPA 5EEHA 3WIDA 1O54A 5HILA 2AXPA 5TMEA 4CM9D 2GM9A 1YU9A 2QXYA 4M36A 4R2XA 1KOFA 1G1MA 2BKAA 1PR5A 3WSVA 5G0TA 4UUPA 1HNNA 2I71A 2ZJFA 5JS7A 2EZTA 3DFFA 3LPNA 1IHDA 1YE8A 1Y7TA 2O6LA 1C9JA 3IIJA 7AT1A 1KO5A 3DMTC 5J4YA 2QNRA 4M1KA 1R18A 2AKYA 4RIFA 2JNWA 1G8KA 1KYXA 2F1RA 2WTMA 4QOSA 3UXMA 3DTVA 5ICMA 2FF5A 1UC8A 3PUYA 4MUXA 1PWYE 3JX9A 2FVXA 2OUKA 1CR2A 4QA9A 2O1EA 3B3FA 3GUCA 4OK6A 3L93A 1F06A 4JVSB 2RC5A 1L7DA 4NV0A 1Z74A 2QNIA 3H9UA 1SVMA 5AJTA 2G6TA 4AJHA 3ZCQA 4BKQA 4R84A 3TL2A 3ZQUA 2LIPA 3MBOA 5AKLA 3WNDA 5KTOA 1LUAA 4OIFA 1YULA 1Z2AA 4NDAA 2XCOA 1SBCA 3T95A 3V1MA 3W6UA 5AW4A 2CE2X 1OREA 1V16B 4LRWA 4P8RA 1XTSA 1DCFA 1HL3A 1TRHA 1X42A 5EI5A 3V6MA 2I2FA 2MIIA 2X40A 1R9GA 3PQ4A 3R3JA 4LXIA 4DYVA 1S96A 5MGNA 3UAOA 1RRFA 3GPBA 4KO2S 5CA1F 4CR6A 2ZYSA 1NLZA 5I9NA 3T5CA 3JVEA 4R0VA 5AK4A 4G25A 5KKNB 4KRFA 3QPUA 3TG2A 1K7XB 1ICIA 1UZMA 3A0RB 1O95C 1C4KA 1T5SA 4U2BA 1C0IA 2ZIVB 2W98A 1RBQA 2H29A 1NSFA 3Q3VA 1VG9B 1H1TA 3E7WA 3JY6A 3HDQA 4G4GA 5D8DA 4WH0A 3I9V6 5AW5A 1KE2A 4JT2A 3RYIB 2VEOA 1VCOA 4DGQA 3EH2A 4DY6A 4HLQB 2VJLA 4B74A 1VE7A 2KX7A 3ZIUA 3T3IA 3VNAA 1F14A 4HUQB 4NNPA 2G08A 3S5UA 3G59A 3ZGYA 2EP5A 1NQAO 1UT8A 1ZNQO 2ODEA 1SKAA 3D8HA 8ATCA 3ZBTA 3GCWA 3QITA 2NPOA 5IULC 3K8QA 2R1TB 3D64A 4NAHA 2B1IA 5FBRB 2FWMX 4DSTA 3ORQA 3TTSA 2VK1A 4B09A 3ENNA 4E2FA 3ZE0B 1Y8QA 4OYYA 5DF1A 1VMAA 3GFQA 3OCWA 3NVAA 5IKMA 1M2OA 2Q21A 4P3YA 4ZP1A 2GX6A 4YRRA 2PL9A 4L74A 3HP4A 4G1MB 4J7CA 1ZMBA 3KOWA 1RRMA 1C1YA 1IM5A 4I19A 1NRWA 4EB6A 1JHAA 1YQUA 1A8QA 4OLBA 4HTAA 4YMUA 2D5IA 3HJTA 4G26A 1UKBA 2QPOA 1XDGA 5AI0A 3CSDA 3SY8A 3GVPA 3L6BA 3AMVA 4TQ9A 2A9KA 1KI6B 2QJOA 3T3HA 4TXJA 5LR6A 3SQMA 5JNLA 1BQEA 1JPJA 3LRPA 2CB0A 4PXAA 2B4KA 1C3LA 2MDTA 2BGJA 1E94E 2VT2A 5DISB 4ZRDA 3HGTA 4R3WA 3G0DA 3RG2A 1KE1A 4RLQA 4C5BA 1KEEA 4YI3A 4BFTA 1ZAYA 5LQJA 3FOBA 4URXR 4MW1A 3ELDA 1UFKA 2XYVA 1E62A 3UWPA 4I3GA 5EJ6A 2JLWA 1IUNA 4EGCB 4I3FA 2TMKA 3EHEA 4EJ6A 4UKDA 2XRMA 2HA3A 2ZVQX 4JFAA 1X80B 2YWDA 3Q0IA 1HI9A 1OA1A 5TEWA 3UPTA 3KB1A 4R1LA 5G3ZA 3C45A 1J8QA 3N58A 1BHQ1 1HM5A 2AJBA 4GWGA 2PXHA 1UWLA 2KPOA 4C0BA 2C2XA 5EIAA 4D9CA 3ZNNA 3SP1A 4MITA 1GAWA 2BEJA 5B55A 1ZD2P 2O3TA 2EP8A 1EZ4A 1DIBA 3IQIX 4H9GA 1HETA 4C43A 4BS9A 4GRAA 1I1OA 1G17A 1HO3A 2YCBA 4OGLA 3ZJ4A 3NKLA 5DCLA 1RLMA 1T4BA 4BO5A 5DX8A 1QF9A 1DC5A 4CMAA 4L08A 1P9WA 3R9IA 3C3MA 2K6GA 2G83A 4OXNA 2WTXA 1YQ9A 1VI6A 2QROA 5TR9A 1JP7A 3NMUF 2CVQA 3MLAA 2Z3ZA 3GEMA 3BF8A 1V1JA 1XZEA 1EX1A 3GQVA 2FVYA 2YTZA 3FRHA 2CF6A 4YQZA 3U44B 2OM6A 4TM8A 4KTVE 5DHAA 5H7XA 1EYZA 3CT6A 1TZMA 3R3HA 3RFTA 1PLKA 1QGUA 3KOZA 5DTQA 4J0HA 3SEAA 5K8IA 3RLIA 2H3HA 1JXMA 1TZBA 1VXRA 4AJ2A 5ALKA 3CJTA 1Y34E 3H65A 3IH5A 3PPIA 4N18A 4DMFA 1QIMA 2FHSA 4QBKA 4J7XA 2JHGA 1GPDG 1JPVA 3MGKA 4XX0A 2ZYGA 2YCLA 4JS0A 5HZKA 1DXYA 1DDOA 2VDLB 2H5JA 2VYVA 3KJGA 2A3NA 4JOBA 3M9LA 1MVOA 4HNRA 4KXMA 1YRQA 3DL4A 1GIAA 4O4HF 2H2FA 1CYEA 5LQCA 2ZYUX 1ZINA 2HV9A 3WBBA 2J9YB 4FP9A 3I01A 3NM6B 2NUAA 4J07A 2WSBA 4LGVA 4EEKA 4WBNA 3ZGXA 3SMQA 5J58A 4O3FA 1TW3A 5D5QA 1KAGA 2CLMB 1I5EA 1UEJA 2BC9A 3A9SA 4ON9A 4Y1EA 5LMUB 3AJ8A 4MPRA 5AI5A 2FEAA 4G9BA 4XWWA 3EC2A 2OG1A 3GFVA 1QKIA 2E2WA 2G80A 4JEMA 3ZJVA 4J3NA 3T5TA 2C61A 3DZBA 4NCKA 3EVNA 1WY5A 3M3DA 1LQTA 1FRVA 2J0UA 4I4TA 3QUAA 1SXGA 4L75A 4AG6A 4G0VA 1HQCA 3MT7A 3KPVA 3UJHA 1ECBA 2PL5A 5EQFA 4R31A 2FNAA 1A71A 4O8ZA 4GPIB 4MW7A 3RC7A 6REQB 4S1VA 3IKLA 2FDXA 2WJAA 4J0IA 4RKRA 3KR1A 1H2FA 1CJVC 4ZKDA 4JA0A 1OFUX 4E2XA 2QZ9A 1SKUA 4DLNA 3PIRA 3FVWA 4W6QA 5JNUA 5P8WA 3I2KA 3JQPA 1Z4IA 1KNQA 4PC7A 4TPKA 4QSMA 3UC5A 1CNEA 1Z39A 2QT9A 3Q7RA 1AS0A 3IODA 3BAFA 2H11A 4LMBA 4QGHA 3VGJA 2HUNA 3CWCA 1J07A 3IDOA 4W5NA 4C0AC 4MNTA 1N3YA 1F48A 3COWA 4NR0A 2IPXA 4RJLA 3RT7A 1IVNA 1KJQA 1J06A 3BSSA 5AD1A 2ESRA 1VPLA 1ZIDA 3AEXA 2FUG6 5AJYA 1C9YA 3TW0A 3AESB 2TSYB 3VKHA 4F6RA 1UK7A 3MAGA 1EFVA 3VGPA 1FQKA 1LDNA 2CUTA 3VOTA 2JLUA 2BHTA 3M6UA 1E20A 1H42A 4JOSA 4CKWA 1UAAA 1W46A 3BHMA 1GGFA 1E7WA 1R8JA 2C3PA 3O95A 3W2HA 4F4CA 3N8IA 4GX1A 2QL6A 4I2VA 2R8YA 4RXTA 4RDCA 5DH9A 4ZEXA 1M54A 2R47A 4PSKA 3HB4X 3LXXA 4HMQA 3O0TA 4WY2A 1QRSA 5C0OE 5LOVA 3H1GA 4TL6A 2CEKA 2C7OA 2I9KA 2XEXA 1TLFA 3T0FA 4BO9A 1J22A 2VH2A 1Z4JA 1IN6A 1QV7A 1I0LA 1PR3A 3KT6A 2J3EA 3KV1A 1CUZA 5HFNA 3GLIA 4KO8A 4O2AF 3NHUA 2VPQA 4DDWA 1ZUD1 1IVSA 2B94A 5CAEA 3MOIA 1JDZA 1SXJC 3LDAA 1RHUA 3KSZO 5AO9A 4EB3A 1IJKA 3K73O 3HJHA 3G8DA 2WF9A 3OAAA 1AF7A 4J1NA 4MVYA 5HDQA 3W6OA 5DX0A 1YA4A 3IAS1 4HRAA 4W7IA 4GD3Q 3KJHA 4MR7A 1XL0A 2ZREA 4O0MA 2ZRCA 3UW1A 4C06A 3S2GA 1U8EA 5IWCA 5KWEA 1H8HD 2IHBA 4KAXA 3A2KA 3OOSA 3ZCSA 3G2MA 4IIJA 4P81A 1QH9A 1FEZA 1D1QA 1KS2A 3I2GA 4V1CI 3FUTA 3U61B 2H2DA 1H2XA 2QD1A 4WMLA 4EFNA 4WLEA 4EHDA 5IN4A 2C77A 1AQLA 4RZQA 1A9YA 5JMPA 3A4IA 2XSZA 3PNQA 4XUGB 4RZUA 4FKMA 3CTPA 3L0YA 5CA1B 4M1ZA 2VBCA 4RK6A 2PPLA 1DIOB 3CH4B 3I9JA 4FQ5A 3VDQA 3A4MA 5CA0F 1N2XA 2RCNA 5DVZA 1VCIA 2IYFA 3WMWA 4Q4JB 5LMNB 4B4VA 2X8AA 4YUAA 1PI3A 1X92A 4FFVA 4UUQA 5C9ZA 1RIFA 1NPYA 2RGDA 3BXFA 4PONA 4HNUA 1ZJ4A 3MWDA 2X2EA 4JUCA 1HL7A 4CV1A 3AQIA 4PAQA 5L6MB 4NECA 1V5WA 2WWYA 4NCHA 1P6UA 4YAEA 4MQBA 3D4OA 5E6RB 5F77A 3F9CA 1Z7GA 4Z3OA 2R1VB 1NJSA 1B6SA 2XF2A 1LVUA 1K6MA 4OGGA 1W48A 1T0HB 1EVEA 1SB9A 2CVPA 3GFGA 5K3FA 1Y6FA 2Q9CA 3LI2A 3BFJA 1OSNA 2GPBA 1RHKA 3QXSA 1CY1A 4ZT2A 4URYR 4F4JA 1GYQA 2ZTUA 3AW8A 3D31A 4IOJA 2C2YA 3LT4A 4OHWA 2DFDA 3TH5A 3W8DA 1M0SA 2CUNA 3DBIA 3P97A 5KYYB 3A05A 2QSZA 5I4CA 1FDIA 1P45A 1YAJA 1I7PA 2F8MA 4QT4A 3KZOA 3SZOA 3FKSA 1U7OA 2OV4A 5E3HA 4C4YA 4CMJA 2H7YA 1DEKA 5AXCA 1CB7A 3OT1B 2GJ9A 4HNAA 2A9OA 1PJ8A 1CNMA 4CM6A 4PHGA 3JYLA 3HADA 3KD2A 4HDSA 1MAHA 1K7SN 5AVJA 1IZZA 2P1DA 5AM3A 4CETA 1Z3IX 3BD6A 1Z16A 2PS1A 1S4QA 4IXTA 4EA9A 1WW3A 2JCBA 1T9CA 3C97A 2I2WA 4KGVA 3A27A 4MPTA 4H31A 2C2OA 3FLMA 2BBWA 5ENDA 1L7BA 1KIMA 2H4YA 4R8SA 3O1IC 2Q7OE 3O2NA 4M1MA 3T54A 4S04A 3DWGA 1KFJB 5JY6A 2X0EA 5JJBA 4L76A 1CY2A 3QU9A 4PGHA 1X38A 1WAMA 4ERNA 1WXGA 3Q0TA 1X1AA 1J7JA 1PTJC 1LPAB 4BX8A 2ZIXB 1DVRA 4WJKB 2CEAA 3L0OA 1CPYA 3MTGA 5F76A 1SNYA 3EFOB 1R4NA 1XYGA 1V0JA 1VQ1A 4MI3A 4JSYA 3SNKA 2GCEA 3ILVA 1WOYA 3ZC3A 4LRTB 4DDKA 1Y0BA 2CYBA 3OTIA 1NKTA 4HH0A 2J59A 3AVXA 3QPVA 4FQ8A 3VOSA 1NVFA 2RAFA 4OQYA 2R44A 4LDZA 2VT6A 1L5SA 1R8XA 2BW0A 5DWQA 2Q5EA 1RYDA 1WRBA 2JFHA 3N6VA 4GYWA 4S05A 1GT91 2C97A 2G04A 3K0CA 1GZ6A 3RFVA 1O8BA 3JQGA 4EGQA 3CWZA 2A9PA 1IOWA 2HRZA 2VTVA 2EW1A 1H1DA 1Z2CA 2CMKA 4MMYB 4WY8A 2A84A 5JHGB 5LYJF 3TG8A 2Q1TA 2JCYA 3GLHA 4IH9A 4KPFC 2PANA 3GMTA 4V0SA 4AN1A 2FETA 1SXIA 5E7JA 4UHBA 3RYHB 1YCFA 1G8FA 2XQVA 4YMIA 4GAEA 4A27A 1CETA 3DDUA 5J4LA 4LDQA 1QYWA 3JQ6A 3LS2A 1QLJA 1YJ5A 2E37A 2XOKA 3MCTA 5EGNA 5BW6B 3LUCA 3H0KA 4XFJA 4V1CB 3LV8A 1IHXA 1N2EA 2J7PD 3CBGA 3LC1O 4NOLA 3JYNA 2XMZA 4QO7A 3DO8A 1NI5A 1F2UB 1XN1A 3E7PA 5F7ZA 5H3LA 1J21A 3V8RA 1JIIA 4JMLA 1HLGA 1WCIB 3KQOA 5AQEA 4BLUA 2I7XA 2RGEA 1FP2A 2FPOA 2WWGA 3PRHA 4DLVA 4O4HB 1YV9A 1N2JA 4JGBA 1FNSA 3KZKA 3TKYA 4EPRA 3LUDA 1DMRA 4U7TB 3I9OA 3PJRA 3TLCA 1QGZA 4J1TA 1RMYA 5JD3A 3UZUA 2Y0PA 3PQCA 5A2GA 2C8VA 4RTJA 1WXXA 2XTMA 5HMMA 3ZUGA 1PL8A 3CZAA 3VTKA 4W1PA 2LCIA 3CLSD 3ILXA 1PWHA 5HUQA 2DPXA 4MDEA 5KSYA 1TM5E 2GO1A 3KAKA 1QMPA 1C3XA 2GK7A 4UDYX 5D5HA 2I3BA 3JYQA 3CZ5A 2IITA 1JIXA 2X5NA 5D00A 4A36A 1XZCA 3HWX1 2W2NA 2P90A 1ZN7A 4JB3A 4TXNA 2XQKA 3T9DA 4L85A 5E6UB 4C1NA 3RRXA 4L6IA 4XDYA 5F33A 2F64A 2WQZA 4WNYA 2NACA 3KDSE 2EGUA 5JO9A 4DLSA 5BW8A 2DZDA 1I6MA 2GJSA 4UBIA 1YZUA 4X90A 4QTTB 1PSDA 2FOXA 2M32A 4G81A 2ZWIA 2O7VA 5EE1A 4BEWA 2QUBA 1SVLA 3WY9A 4NFHA 4LJ7A 3BXPA 1VZ2A 4ZVQA 3PR3A 3RVSA 4ZC1A 2F1JA 4A23A 5BORA 5IK2D 4Q3EA 2HU2A 1XPOA 4PZZA 3DMGA 4TKVB 4ZZ3A 5KYWB 3EF0A 5DM1A 1ZVJA 3TL3A 2B8JA 2VUHB 3A9WA 3TTWA 5IC4A 5KNCD 1F8YA 3OJFA 3LPLA 1D4ZA 5KJCA 4TMXA 2QN1A 3DQPA 3PE3A 3R6GA 4C3UA 3G2PA 1B14A 1JHPA 1C7RA 2ZJBA 3K2IA 1QYIA 3K9NA 4R81A 1XL1A 1EP1B 1D2AA 1W6RA 2FEPA 3AFIA 1UOPA 3MFQA 3GLGB 2ORIA 4RTSA 1JEYA 3DKVA 3IBYA 1MT3A 5CFMA 1OU0A 4CEHA 2FY8A 2AJLI 3INTA 3A3YA 1YL6A 2NYRA 1M8KA 2WP0A 3AGPA 4MUNA 2OYCA 4I81A 2IZ7A 3QFFA 4KK4A 2R4UA 3OJ0A 3TLAA 1E2QA 2QTBA 1SWVA 2YZKA 1U2DC 1S2OA 4OH1A 3THXB 1EFUA 3R2JA 1OI2A 5JVDA 2F6RA 1Z0JA 4C7OB 2ZVDA 3GVIA 2W7TA 2Z8XA 5HYVA 4FE7A 3N2EA 2Z3WA 4O2AB 3UO8B 4CLDA 5AKZA 1OZHA 5E4FA 1ZJ5A 5IVIA 5JAOA 5KOJA 3PDJA 4L6CA 5IVDA 1EXDA 3AVWA 3PDCA 2R7LA 1KI1A 1W5SA 2ZTLA 2RK4A 4JDPA 3L5OA 3GGCA 4FXOA 1SCNE 2J3KA 3LY9A 4R1QA 4DQDA 3DDHA 4GX0A 3DLHA 1EK1A 2LDBA 3JWGA 2MYUA 4M88A 4B5KA 1OFIA 2EWVA 3FSGA 2HEGA 4C2BA 2GH1A 3PA6A 2JB9A 5JBIA 2JHPA 4X94A 4L50A 5FOTA 4BMPB 1WUYA 4BKPA 3C5EA 3CLRC 2QQ5A 1MORA 3GLSA 4I9GA 1UM9A 3IOBA 1CQIB 1B43A 1DBSA 1DSSG 2H1FA 4BHTA 1EVIA 1XEFA 3U56A 3L18A 1JLSA 1M1YE 1WKVA 1W73A 4TTIA 1RZUA 1JLLB 2I3GA 4PE5B 3RUPA 5KX5F 1KFKB 1NVUQ 1TEVA 2KLBA 4QPNA 4EHFA 4IX1A 5T5QA 4JZYA 4IUYA 3UMSA 1O97C 5CA0B 1ECJA 2NSYA 3LA8A 1UF9A 3O73A 3AETA 4MQFA 4ZAWA 5JD4A 1YC2A 3ZNOA 1TTTA 4CT4B 5DDIP 3TNFA 3E1GA 3TCKA 1M8JA 4NFSA 2ZRGA 4N7BA 4W9NA 4Z1OA 1TZKA 1T1EA 2EJUA 4YJ2F 3EG9A 3D2AA 3A3NA 1FTQA 2GJ4A 2NU8A 6ADHA 1XDSA 4Z3KA 3OJEA 1EIWA 3BMCA 4N3AA 5ARCA 1BGXT 3QE9Y 4WHMA 2IV3A 2LWIA 5TMBA 2AL7A 5AJHA 4BGDA 1PZXA 1XWFA 1BU8A 3ZDXB 2JLZA 2EKZA 5K3AA 3K0SA 1PBTA 3FVVA 4IQGA 3SVLA 4ATNA 3OQMA 3QX9A 2IX9A 2PH1A 1PG2A 2I7TA 3U1BA 3AM1A 2PMFA 3LQRA 4HWPA 4ND2A 4YRNA 4WQMA 1CJTC 3UB4A 2I6TA 2GHIA 2MINB 4I1RA 4DQKA 3OZXA 3FUCA 4WV3A 2XGSA 3DDCA 2Q0XA 1FJXA 2JIPA 3CLKA 2FSPA 5ITZA 4O4IA 3JQ9C 1SVWA 4PAGA 4LZOA 2I7CA 4IS3A 3SC6A 3CU5A 4E15A 2QHXA 3SDBA 4PRLA 1TVCA 2NM0A 2XODA 3FMFA 4MMZB 4P7KA 3V46A 2IVFA 3RRMA 5A4DA 2XXAA 4CM4B 1YQGA 2PWPA 1XMJA 3VZPA 1UMKA 1GPUA 2Q5JA 4F96A 4XTRA 2JFWA 5L40A 3Q8LA 3I73A 4UHCA 3QPDA 4YRKA 1RI3A 1UFOA 2RGUA 5DXAA 3DNFA 3KSDO 1E6CA 3OVMA 2XDQB 4PZEA 4G8CA 5AKHA 3ZGOA 3INYA 1ZCAA 2BPOA 3HLTA 4G8JA 2FZEA 5KI6A 5DYTA 1DJLA 2ZBRA 1ZMTA 4L0DA 3OMXA 1JZSA 3ELUA 1ES9A 3BMNA 1E6WA 1OYWA 1SPBS 3DLIA 3OOJA 3Q8WA 2C9CA 2RI6A 5KWSA 1WU7A 3CLUD 1JQAA 1ADJA 3LIIA 2YIDA 1HDOA 1RRGA 1MGOA 3WRYA 4E03A 3A10A 4Z0TA 1FUEA 4AZ3A 3ITEA 2J6HA 3X43A 4IDNA 1A04A 3SIWA 4EO4A 1PZEA 2Z6VA 1J0DA 1E3WB 1A8UA 1B93A 1CUAA 3TEJA 3UMGA 5EMNA 3HJCA 3HGMA 4QOEA 5DLPA 1K1EA 4JJIA 1ONBA 4GU5A 3V9PA 1HNZB 1JQLB 2PGLA 3IQWA 4CXMA 4HBZA 4BNWA 2HFKA 3HXQA 3GJ6A 1LRJA 1HT1E 5C81A 3ER8A 4BO4A 1GV0A 1GUBA 2Y4NA 1TPZA 3GX1A 3WL7A 5J2TF 5C1BA 2BUAA 5A62A 1KDZA 2VYCA 5JCXA 2Y1CA 4JLOA 2HCBA 3ZW7A 4U7GA 5LYJB 2PO5A 5JRZA 2VDQB 1W4AA 5HM6A 1BVYF 2C4TA 2HKIA 3NPAA 4FTWA 3T3PB 5EHQA 5KTMA 3NR2A 3LFTA 2C5FA 5LA6A 2CV0A 3LH5A 4HQ0A 5ICFA 2R96A 3LL4A 1ORRA 2YHAA 4NXNB 3CRMA 3VR6H 1PQPA 1N2HA 1FQJA 2AOUA 2DQSA 4TKZA 3GIDA 1HH4A 5FNVA 4WXEA 4MULA 2AC7A 4IWYA 2FEWB 1XVAA 1CV2A 1GGHA 4BVLA 3B2EA 4OOEA 4PGMA 3RKRA 4DM3A 5IRCD 5C1PA 3BL6A 3CYFA 4LGCA 1SO8A 3CRVA 3GPIA 5IU6A 2Q62A 5CLLA 4X1KA 4Q9IA 4QUAA 2H92A 2HCTA 1E9BA 3A25A 3HJAA 3HPQA 3JAKB 4U6QA 4XRRA 4A73A 2P9CA 2G76A 5F2NA 2ZJAA 2DFVA 1J2UA 4D3ZA 4D74A 5KTKA 3P4XA 2YDXA 3LX5A 4LMPA 2IY7A 4OQ4A 4IHJA 1L5VA 3FCAA 3T3OA 1CEXA 4P0QB 4B3JA 3P9CA 2I03A 4BE4A 4BQIA 5K8TA 3DFUA 4HTFA 5AJWA 4BCCA 2NO1A 5A02A 2Q4DA 4TS4A 1WO8A 1XCMA 4GMXA 4EKGA 1ZVKA 1U8XX 3GLGE 2Y9MB 4DJFC 4YGXB 3U48A 2QD2A 4I1VA 4E46A 4WE3A 2JKZA 3B2NA 1DAOA 2FEMA 3ZU3A 1N34B 5JYEA 2WZDA 2ODQA 1FFGA 5JXGA 1GDTA 2XVMA 3SLGA 2WBLC 3KQTA 2ZRHA 4DILA 1Z4QA 1GAEO 2HLDA 4ZAZA 5C3UA 3IBTA 2EU8A 4QOFA 1ZRNA 2YJ5A 1NU6A 4RPKA 5AMXA 2JS7A 1A9QA 3FYTA 3DXZA 3ELWA 5CM2Z 1EGQA 1A2QA 3ZLBA 3KYCB 1DTWB 1T91A 4HC4A 2BDEA 5DNCA 1YXMA 3P0FA 1IRXA 5DNWA 3OO0A 1ULHA 2QG9A 3VU1A 4UVEA 2ZTMA 3EXFA 5FTNA 4UD6A 1MA0A 2BN4A 5JXJA 5AI6A 1MC4A 1VL5A 2E4VA 3AFHA 2BHNA 5LXTF 1Q0ZA 2JIZD 2OLKA 5JT1A 4TKMA 1S8FA 5F3WB 4DV5B 3AHIA 3MQ2A 4LCJA 4XPIA 4A03A 3L02A 5K6AC 1YE5A 3RYCB 4S1TA 1S02A 2ACVA 1TI7A 4NDZA 4YCCA 2C31A 2LR0A 3O9ZA 3BVPA 3S28A 1CK4A 3ZBUA 3LVFO 2YZ7A 2V7QA 3UA4A 2H1IA 3QBEA 3EY9A 3H2SA 1OI3A 2JI4A 2QD3A 5ALSA 3KETA 4HNHA 4DA8A 5KVSA 1KFBB 5FPTA 1BCSA 3VU9B 3A37A 4HGQA 4EUEA 4DT1B 5KMGB 1OTYA 3HYNA 2ZROA 3MUNA 1NULA 1P4AA 3ESDA 3NJ8A 4HDRB 2V3VA 1D5WA 5IBPA 4H1VA 4IW3B 4D9NA 4UFPA 4FYXA 1M1UA 1W1UA 2SNIE 3SAJA 3IJEB 4BO7A 1O94A 5FO1A 1ZMOA 3CUSA 1TAQA 4EJFA 1G5TA 4D7AA 4JC8A 3VC1A 3WLPA 4GZ6A 2I33A 4FZ3A 4ZTZB 2ID9A 2IYLD 3PHIA 1KEWA 1UQTA 4KLAA 4ZIRA 9LDTA 1D3AA 3L1IA 2I1WA 1H94A 2JGAA 1BCRA 4F06A 5AW7A 2UXDB 1PE0A 2H63A 2HUPA 3GJQA 1Y37A 2CL0X 1UJMA 3DFKA 5FL3A 3ZH9B 2VOEA 1AKNA 5JWRA 4ZRMA 1RAFA 4M21A 3WGMA 4RACA 4X93A 1HT3A 3DB1A 4ONEA 4JHXA 4NSNA 3PPYA 2EJVA 4XARA 1ZEJA 5J40A 1HLPA 3E9RA 1RQ7A 1SOUA 5F73A 4FYWA 4KQ1A 3LY5A 3BL8A 3ESXA 1VG8A 4XEHA 3HDTA 2QEQA 2B21A 1TYDE 1T6XA 1X7DA 1OWOA 2I29A 421PA 4IJKA 5A9TA 5I7OA 5ANRB 3OA0A 2P9FA 2UYGA 4CIWA 4BN5A 5KX5B 3U7EB 3R3XA 2IS2A 2ZUFA 4PLHA 1ZJZA 4BQEA 4MKGA 3SKYA 1ZIPA 2BGRA 3WDLA 3AM4A 2VJAA 2PXXA 4LC1A 4G01B 3GUYA 4PF1A 4KITB 2HV8A 5FWXA 3ZGZA 3ZH2A 1DBPA 2YQ5A 4CDNA 5EA2A 2WWRA 1A50B 4G23A 4Y2YA 3DVLA 4PC6A 4WZBB 2PX3A 4YJ2B 5AOAA 1ABBA 1IBRA 2ZBFA 2V7GA 4Y2SA 1AU9A 3LC2O 2FPKA 5DI3A 4LYEA 1QHFA 4R7GA 2OAQ1 1FUUA 3CN9A 1B42A 2HSJA 1T9GS 4HG2A 2GQ0A 2HH9A 3OCJA 4LQ4A 2QD5A 3T0GA 5A2QA 4ND8A 3M1YA 4LYFA 4ZZ0A 1LTHR 4HD8A 1M8FA 2ZSKA 2UKDA 3SZUA 2G28A 3Q9NA 5CW1A 2PS3A 1VHJA 2Y1GA 5CHYA 1FYFA 4TTQA 4WNCA 3ETNA 3TIGA 3O0DA 4TSKA 2AQIA 5DE3A 1PT9A 4OYHA 5DGXA 4IOMA 5EZSA 1OC4A 1YR1A 3TEMA 4JIGA 4BFUA 1DV2A 2ZT8A 3EVDA 3K1AB 3X1ZA 4OATA 1F8XA 4XTCS 2H2IA 2E48A 2XOXA 2WNHA 1G8HA 3OIVA 3PTZA 3K70D 2P5TB 3FETA 1OXVA 5G3YA 4YJDA 1GFIA 2G0NA 1JE1A 2WYWA 3O7WA 3W3AD 3ZE6A 1L5HA 4WNAB 4X64B 4IVQA 1OROA 2VOJA 4RHYA 1IBLB 4DV7B 1KRWA 5GGYA 2VO1A 3FR8A 1SQ5A 4J2OA 1A3CA 2W93A 3ESZA 4QDXA 4TLDA 3NHAA 3TVYA 3DYIA 4BTVA 4DQUA 5AESA 1IZ7A 1C2YA 3C5VA 3C48A 3D3JA 1EWQA 4IIUA 5A04A 4EX6A 5EFZA 4L5AA 2V58A 4B3RB 1G21B 3GH3A 1P1IA 5AKKA 5C3MA 3HBJA 2ZSAA 4UVIA 3G79A 3OUUA 3RK0A 1Y5NA 4QXMA 1FZTA 1KDPA 4YX9A 2J3HA 4OY3A 3HN2A 5JSUA 3HJNA 1Q0TA 3NNNA 4RD2A 2NZ2A 3PWKA 4BFSA 4EY5A 2GDJA 4JC4A 1HFKA 2EFGA 2VHCA 3K9FC 3D8BA 2IBSA 1AO3A 2IPLA 3H5AA 4HEHA 1KEVA 3S7TA 1E1YA 2O0JA 2P2YA 1YI1A 3K1TA 3KOXA 4PLGA 1FLVA 1Z6XA 2HMTA 1P31A 2ORED 3DEFA 1ENZA 1QZUA 2BGKA 3LECA 4BB6A 3AR6A 4RESA 1ZGBA 2PA3A 2IDMA 5G4LA 2BJHA 3GEDA 3KSUA 4ZMBA 2OZKA 2I78A 5C4GB 5LDGA 1G5PA 5J2TB 4K9PA 1SZDA 3OY2A 2Y2UA 4WN3A 3DLBA 3VAYA 2NG1A 3UT5A 1DKRA 4BLVA 3RSLA 4F7WA 4AB1A 1FFHA 2LRHA 4AQDA 4RMNA 2IOFA 5JCJD 1GTVA 1EUZA 4W1RA 2HI0A 2ZYHA 5D87A 3WV4A 6ABPA 1ICEA 2RMKA 3X1KA 3U40A 1QG0A 2NO6A 2W2OA 3IGFA 1DLJA 5M04A 3IEIA 3R0QA 3U80A 3FUVA 3N07A 5AM4A 3RSSA 1E9AA 1JI0A 1IQRA 2IK8A 4PTYA 5EMHA 1DRWA 1QHEA 2Z8ZA 4IWNA 3TI9A 1E5QA 4KNWA 1G38A 4ARIA 2GCPA 4QRDA 5L3QB 3CVWA 2D74A 2V9PA 4E09A 3U7QB 1LV7A 3KSBC 5KYXA 4DG8A 3PUZA 2PAFA 1G8GA 3HQ4O 3MFYA 1PUJA 2PUVA 1ZFNA 4R9SA 1PDVA 5K0SA 5JTTA 4GVLA 1ECCA 5IXSA 1II8B 1YU6A 1XU7A 3KAJA 5EXPA 1UEIA 3LUFA 4ZA2A 1RP1A 1CYDA 2QZSA 1K68A 3W5CA 4HADA 4C76A 1SQSA 2VR1A 3TQCA 2J9GA 4CE6A 1GN9A 3I01M 2A30A 3DVAA 2PUCA 2WF8A 1Y1PA 1BXZA 4DCJA 5FUBA 1HQDA 3L7AA 2G40A 1P0IA 3JQFA 3D3QA 4DR3B 1WBBA 1U94A 5TY0A 5F9FA 3F5SA 1T8PA 3LM8A 4MVJA 5L4NA 4LIPD 3OD5A 3ZJ5A 1V39A 1RPJA 2BONA 1WVGA 2OQRA 4Y6RA 2K4MA 4MUAA 1XB2A 2H8KA 4RHUA 1PJTA 4R41A 5EXDA 4TYYA 1EFPB 1C2TA 3R23A 3DC2A 5C1IA 3T41A 1SBTA 5IVKA 3REQB 3LZCA 1OHHD 2VJOA 3HVUA 1UZUA 2CDNA 4XYBA 3V1NA 1NNUA 4DLPA 2AH5A 1FBNA 2J4DA 3E2IA 1N5KA 2NZVG 2DPHA 1OFHA 2BIFA 4BYGA 3SLKA 4E4TA 3BWMA 4OJYA 5J5CA 5B7NA 2I4IA 4LW8A 2LTAA 4O8CA 4GVPA 4QTZA 2HX1A 2QQFA 2XNKA 4LWQA 3UJAA 1C1DA 1UBTS 3KHUA 1U0TA 1NDHA 3PB3A 4NRDA 4FB4A 2Q9BA 4BIIA 5LXTB 5D3QA 4Y1FA 4RTNA 2J5XA 5ILQA 5K0GA 2D1TA 2YV2A 1YBMA 3K32A 2ZJYA 2NZ8A 3SDZA 5C31A 2G63A 4D44A 1HDGO 3PEFA 2BMWA 2O4CA 1D4FA 1F6DA 3OP1A 1U28A 1Y5MA 2WJZB 4J90A 2IRWA 3PIDA 2IWRA 3PQ6A 1HYHA 1O8CA 5EUMA 3GJRA 4MR9A 1G42A 1TUBA 1XRQA 2HNBA 1RT9A 4JLVA 2UVPB 2Y0EA 5IJXA 3VSBA 3W8NA 4B6QA 4QG3A 2XLCA 3C8HA 1VSVA 3GUUA 1OH8A 3FGNA 2MSCB 3GZTB 2MYTA 3HLYA 1BMFD 3FCXA 1F8GA 4OQXA 5G53C 1RAEA 1GV1A 4BGIA 4ZCIA 3BGDA 1SQ0A 2FA9A 2YUIA 4ODIA 3D6NB 5K2MA 1YJAA 3V1TC 3B36A 3HDVA 1ESEA 5T6BA 2FFHA 1JKJA 2ZR0A 5IT4A 5BQPA 4BO1A 4JB8A 221PA 3NYIA 5KTTA 2CFTA 3NBZC 1ZKDA 4WZBE 2W4IA 3DKRA 5FFNA 3LCVB 4CYMA 2ABWA 3BHNA 2OTCA 3KTDA 4WFJA 1ZP6A 1QUEA 3C3DA 4MUKA 5C8YA 3WJ7A 3FGZA 4YRBA 4N7MA 4OI2A 1JJVA 4NJMA 1KL7A 5TMDA 2ZDGA 3NC0C 4RXUA 3WV5A 3JARA 4O2BA 1N5MA 1ZIXA 4YV2A 3F4LA 2ZJ3A 5C5EA 1US8A 4KVFA 4MQ4A 4H3SA 1BHSA 3EVEA 2J9XB 4FS8A 3U3RA 1G291 3BWCA 3FZQA 3UUGA 1RKUA 4WINA 3EQZA 2FMHA 1DS6A 2CXTA 3KTFA 3W9SA 1TMKA 2R0QC 4JAVC 4RNDB 2ZWMA 4TZTA 5BT9A 1R4ZA 4BJ6A 1WHSA 3UIEA 1JU9A 3ZOKA 2IFTA 2FE4A 3HDYA 2Y1WA 4YB8A 1E5DA 1Z22A 4ID3A 1DC6A 5FQNA 2XT9A 4KN5A 1CLUA 3ROPA 2VPTA 4CQJA 2CV1A 1YMVA 2QR5A 3FMOB 3ZDFA 4DABA 2GM4A 1TLLA 4F5YA 5HOQA 2NNWB 3WAKA 1JVNA 1SVIA 3GLVA 4GI3A 1ZSNA 5CCXA 3PNSA 1MAWA 3T1VA 2VQFB 4ZAVA 1JHDA 4WLUA 3CPSA 3OFJA 1V9LA 4LGYA 3T4UA 3ZWNA 3ZWXA 3S2UA 2F00A 4CMGA 4AWAA 5A5DA 3L3BA 4WZZA 4E5SA 2A0KA 3DD1A 1Z0KA 4GOKA 3HCNA