3JWIA

Crystal structure analysis of the methyltransferase domain of bacterial-cthen1-cn
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
198
structure length
195
Chain Sequence
NLNQQRLGTVVAVLKSVNAKKVIDLGCGEGNLLSLLLKDKSFEQITGVDVSYSVLERAKDRLKIDRLPEMQRKRISLFQSSLVYRDKRFSGYDAATVIEVIEHLDENRLQAFEKVLFEFTRPQTVIVSTPNKEYNFHYQNLFEGNLRHRFEWTRKEFETWAVKVAEKYGYSVRFLQIGEIDDEFGSPTQMGVFTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyltransferase type 12
publication title Structural and biochemical insights into 2'-O-methylation at the 3'-terminal nucleotide of RNA by Hen1.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Transferase
total genus 65
structure length 195
sequence length 198
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08242 Methyltransf_12 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3jwiA00
3G5LA 5FHRA 4GOOD 3SSMA 1BKYA 1DL5A 5CVDA 2OYRA 4E33A 3M70A 3QOXA 2FRXA 2NP7A 4X60A 3C6KA 3R6TA 2B9EA 2OB2A 3LDFA 1XVAA 4DCMA 2BR4A 3Q7EA 2PXAA 1EG2A 4OQDA 4CKBA 1FPQA 3FPFA 4MQ4A 2B25A 3BZBA 2OKCA 4FZVA 1R74A 3C3PA 5HILA 5JR3A 1FP2A 1L9KA 2O07A 4MWZA 2ZBPA 2PGXA 2JHAA 3U81A 3EVBA 2NYUA 3KQQA 3P8ZA 3GRZA 4KIGA 4KW7A 3DH0A 5E9QA 1JG2A 5FA8A 3ORHA 8MHTA 4LG1A 1G6Q1 2PX4A 3PB3A 3RODA 1ZKDA 1KYWA 1KPIA 1SUSA 2AOXA 2P41A 3MGGA 3FUTA 3T7TA 1SKMA 2YQZA 3KQMA 3EEYA 5HZMA 5EIFA 1JQEA 1JTEA 3UJDA 5GWXA 3BUSA 2OO3A 3HCBA 3QOWA 4DQ0A 2NXCA 3C0KA 2OBFA 4CWAA 4RTOA 4C08A 2R3SA 5LQRA 5FUBA 2C7OA 1R00A 2OPBA 2NXNA 2QM3A 1HNNA 1WXXA 3MERA 5FTWA 5LQJA 3HCEA 3ELDA 4YUVA 2XBMA 2YVLA 3FYDA 1EJ6A 4FR0A 1YFJA 1P1BA 3M6XA 3UZUA 1VL5A 3G2OA 5DM0A 3PX2A 1X1CA 1VIDA 4OA8A 2ZIGA 5K0JA 2PV0A 3GO4A 4LWOA 2ONYA 1I4WA 3GCZA 1EQAA 4H0NA 1O54A 2IBSA 2C7PA 1JG3A 5IKMA 1NW6A 2YX1A 3WSTA 3OU6A 3BWMA 3P9CA 4F84A 1UWVA 1D2GA 5K0CA 4FGZA 3SGLA 5DWQA 2ESRA 5DLYA 2EJTA 4HTFA 3DXZA 3P97A 3PS9A 1KHHA 1JG4A 2Q41A 3C6MA 5HEKA 2HMYB 4PIMA 4DMGA 1G8SA 1QYRA 4YUZA 1D2HA 4EMSA 2FCAA 4FS8A 3HNRA 3M4XA 4HC4A 4KWCA 3TMAA 1JQ3A 3SX0A 2ZULA 3OE4A 5CIYA 3MTEA 2IBTA 3MAGA 4PYIA 2AOUB 2UYOA 1QAOA 3G8BA 4XCXA 4AZTA 2H11A 4PYLA 3KQVA 2AR0A 4EK9A 4YV1A 3FUVA 3OFKA 3FUWA 3I58A 2AVNA 2OB1A 2JHPA 4KIFA 3HP7A 2C7QA 4GOLD 2AZTA 3PFHA 2BZGA 4HGZA 5ICGA 2O0LA 2OZVA 4QQNA 1M0EA 3TFWA 2PT9A 2WA1A 4MHTA 3EVZA 5DSXA 9MHTA 4P7FA 5DM4A 4ER6A 2GS9A 4P7JA 3ID6C 1RI1A 5LQUA 1I1NA 1JQDA 3F4KA 4LECA 3FTEA 4PYQA 3AXTA 4M7RA 1SG9A 2CMGA 5CVUA 4RTPA 1XDSA 2ADMA 1MJFA 5CVVA 2E5WA 4YMHA 2P3OA 2JH8A 2P3QA 5E8RA 4FSXA 4WVLA 2PXXA 5EKXA 1KR5A 3JWJA 4RVHA 1JG1A 2G8NA 4C03A 5H02A 3TM4A 3ERCA 3FTCA 3KQSA 5K8VA 1R6AA 2R6ZA 4RSRA 1U2ZA 5EEHA 3HCFA 1RI2A 2ZFUA 4AZWA 1VBFA 1NT2A 3EVDA 3JWIA 3ME5A 3OU7A 3P9NA 5K0BA 4NECA 1R18A 3G7UA 3UJ6A 3K0BA 2YXDA 5E8JA 2KW5A 2QYOA 3CBGA 5DX0A 4EVIA 5K09A 3A4TA 3EMBA 4PGHA 4BP1A 1FJXA 1RJGA 4C4AA 4RTMA 2XYVA 4YUYA 2CL5A 2AOTA 1G38A 3P2IA 2P1DA 1L1EA 5E1DA 3GXOA 1R8XA 3RIEA 3UJ9A 4CTJA 2VDWA 4YUXA 1G60A 2ZLBA 1JTFA 5F2NA 3KPJA 1ZHFA 3CJRA 2B3TA 2VP3A 4CXMA 2AOWA 2I62A 3DMHA 2QE6A 3TPZA 2PSSA 3KHKA 2YTZA 3AWIA 1INLA 1SUIA 2PBFA 4GQBA 1WG8A 5D1NA 4PONA 1WZNA 5E9JA 2NXEA 1B42A 1VPTA 3PVCA 5DM2A 3P2EA 3R9XB 1P1CA 5FQOA 2K4MA 3NWEA 1YUBA 4M36A 4E2WA 3B7PA 4ER5A 4R6XA 3TR6A 3V8VA 1NV9A 2UYCA 2CMHA 1QZZA 5IH3A 3DXXA 4P7KA 3GRUA 3HCDA 2PWPA 2PX5A 4FSDA 2HV9A 4LWPA 4RTLA 3BWBA 3E7PA 3B3FA 5BW5A 1YB2A 3EVAA 4HH4A 3NMUF 4OBWA 2XVMA 4A6DA 3LKDA 2BM8A 2ZZNA 3A26A 2JH9A 5DTQA 4AZVA 1N7JA 5EGSA 2BM9A 4QPNA 3VC2A 1HMYA 3NW9A 5EMJA 5ICCA 2JJQA 5LR6A 3D2LA 3TKYA 5FCDA 1RI3A 1F38A 5EZQA 3CCFA 1WY7A 4PYKA 4Z2YA 3S68A 1KIAA 1Q0TA 3KU1A 3OU2A 4DCGA 2IH4A 4E31A 4FT4A 2I7CA 2EX4A 5DM1A 3EEOA 1VQ1A 5C0OE 1KPGA 3DP7A 3I9FA 3HVKA 3LECA 4FT2A 2PXCA 3GNLA 5EMMA 5F2OA 3SR4A 3LHDA 4X41A 3SSOA 5E1OA 3EVGA 3B89A 4HGYA 5LQCA 1RJDA 3EPPA 2JG3A 3NVKI 3T0IA 3I5UA 3KQOA 4HSGA 1F3LA 4KDRA 2P8JA 3LL7A 4OBXA 4XUEA 3HTXA 3GIWA 3BKWA 3DLCA 1T43A 2B78A 1G55A 3BXOA 3CJTA 3DMGA 3UJ8A 2IH5A 3GJYA 2G1PA 1ZGAA 1MHTA 4E30A 4GOND 2P7IA 1OR8A 1O9GA 2ZTHA 3V97A 3HEMA 4OQEA 2CKDA 3JWGA 5EKUA 5FWDA 4V0RA 3G2PA 3X0DA 3BKXA 3CJQA 5DRYA 2ZZMA 5EMLA 3KQWA 4IV0A 3UJBA 3VC1A 3SMQA 3M33A 2AOUA 5EC8A 5HIIA 3BGIA 1FBNA 1RJEA 3MTIA 2ERCA 4MTLA 3SXJA 4RVFA 4E70A 3E05A 4PCAA 2G71A 3LDUA 1X19A 3R3HA 2ONZA 4GBED 3REOA 3FUUA 1ORIA 5D1HA 5KVAA 3NJRA 2PVCA 3Q87B 5EEGA 4OX9Y 3ELYA 3DMFA 3NDIA 4PGGA 1BOOA 3GRYA 3NTVA 4M37A 4GEKA 4IV8A 5LSAA 3NVMB 3HA5A 1X1AA 3LKZA 5E9WA 3VSEA 4C07A 1JSXA 2PKWA 5K05A 4RTQA 1H1DA 3EVCA 5EOVA 5KS2A 1TW2A 3LPMA 4P58A 3TKAA 3B3GA 4EQZA 1KPHA 4CKCA 3KQPA 1RI5A 5T64A 5G02A 4YV0A 3E8SA 1ZQ9A 3FZGA 3G89A 3M6UA 5GIPE 4F85A 7MHTA 3PT9A 5GP1A 5K03A 2Z6QA 1RI4A 3UFBA 3KPYA 2PT6A 3B3JA 2IGTA 4QTTB 4RVDA 5EHGA 3OZSA 3M6VA 3OFJA 4OA5A 5E1BA 2YXLA 3QV2A 4Y2HA 1I9GA 4E2YA 3P9KA 2G72A 3MCZA 2G70A 3FYCA 3MHTA 2VDVE 5K0NA 5F2KA 4E2ZA 1XCLA 2EFJA 3PFGA 4RTRA 3BWCA 4U7TB 3MB5A 4B17A 2P35A 3EGEA 2C7RA 3GRVA 2Z6UA 5K0LA 5ICEA 2BH2A 2XYQA 2HR1A 3P2KA 1NKVA 1JR4A 3IEIA 1M6EX 3K6RA 4HG2A 2QRVB 1FP1D 3E23A 3R24A 2WA2A 3HA3A 4QDKA 2FPOA 2XYRA 2PWYA 5BW4A 4PYJA 2AN4A 5M5BA 1X1DA 4EKIA 2H1RA 2GH1A 2FK8A 4RTJA 2Z6AA 4DKJA 3ELWA 3GRRA 3DR5A 5T6BA 1XTPA 1XDZA 4XUCA 5GOZA 1AQIA 3OZRA 2LD4A 2AN5A 1XDUA 2IDKA 1ORHA 3GDHA 3KR9A 3KQYA 5U4XA 1NW5A 1SQFA 2ZWAA 5FWAA 3MCTA 4QPPA 3FPJA 3HCCA 2ZWVA 3KR1A 4E32A 1NBIA 5CD1A 3KQTA 2OY0A 2GA9A 3HVJA 3I64A 3LCUA 2ZBQA 5CVJA 4X61A 1AF7A 5LQKA 2DULA 5DTRA 5K0FA 5EVJA 1QANA 5MHTA 3FPEA 3LDGA 3T7SA 1X1BA 2AS0A 3G88A 3OCJA 5LQNA 4G56A 4BP3A 4V0QA 3GGDA 1L3IA 2Y1WA 4QDJA 4C06A 2GPYA 2ZVJA 3O31A 5K01A 3CGGA 3EGIA 2JHCA 4R6WA 2P40A 3A7DA 5BXYA 5E2BA 1Y8CA 4R8RA 4A6EA 2FYTA 1SQGA 2P3LA 5EPEA 1TPYA 2Y1XA 1BC5A 5DXJA 1DCTA 4PCLA 3PTAA 4QVGA 1YZ3A 4UOEA 2NXJA 3CKKA 4YMGA 2YUIA 4BLVA 1D2CA 5FQNA 3KKZA 2AOVA 2IPXA 3FRIA 3JWHA 4PWYA 2F8LA 3AY0A 1RJFA 1XJ5A 3ELUA 3IV6A 5EZSA 2A14A 5ICFA 3OZTA 4BLWA 4XUDA 3BWYA 2ZZKA 3G5TA 3LCVB 4CKEA 5DT2A 5DX8A 4R8SA 1UFKA 1TW3A 3DULA 4JXJA 3SVZA 4R05A 3DOUA 3A7EA 4O29A 2OXTA 5GIOE 5C1IA 4AX8A 3UA4A 2ZCJA 5T67A 4FP9A 4ISCA 1VP9A 5GM1A 3A25A 3SSNA 1YF3A 4ZTBA 3LBFA 2GAFA 4ER0A 2O05A 5DRTA 3HA7A 5B1SA 2IDJA 5CCBA 2PJDA 1L3BA 1EAMA 5DXAA 1BHJA 3NWBA 5E1MA 3CVOA 2FK7A 4F86A 3HM2A 5DX1A 2DPMA 1QAMA 5DTMA 1IM8A 4HRAA 4E2XA 2EJUA 2ZW9A 2EG5A 3KPWA 4DM3A 1N2XA 3T7RA 3GU3A 4C04A 2I9KA 3PLAE 3FUXA 4GOMD 4U7PB 3BGDA 3FTDA 3UJCA 3KR0A 3IHTA 3UBTA 2ZIFA 5EIWA 4RYLA 1NW8A 5KQRA 3ANXA 5EG5A 10MHA 3TRKA 2N47A 2AVDA 1AV6A 3FPHA 4X1OA 3PX3A 3LGAA 3AJDA 1KP9A 1VP3A 1WXWA 2QY6A 2ZBRA 4MIKA 4BY9E 3THSA 2HWKA 3G2QA 4KVZA 4Y30A 2V74B 5K0EA 4RX1A 2IH2A 1NBHA 5DPMA 4QVKA 5EQJB 4GUAA 4L7VA 3B5IA 4DF3A 1R8YA 1SVUA 3G2MA 3HCAA 3RW9A 4POOA 2AN3A 2O57A 2BR5A 4KRGA 5CVEA 1YFLA 2YXEA 3DXYA 3KR2A 4YUWA 2PLWA 1XCJA 3DTNA 3A27A 4X63A 3H2BA 3THRA 5KQSA 3O4FA 4RWZA 3NDJA 3P9IA 2BR3A 3DUWA 3HVHA 4K6MA 1UIRA 3TOSA 4DA4A 3EMDA 5FA5A 1V39A 4BLUA 4PYNA 1Z3CA 5HIMA 4PNEA 4GF5A 5CCXA 5CM2Z 3C3YA 3OPNA 2VDUE 3I53A 3LBYA 5EMKA 1NV8A 3FRHA 3HVIA 3BT7A 3EVFA 2B2CA 2QRVA 4QQKA 3OE5A 3TM5A 4HTFB 3MQ2A 1XXLA 1P39A 1PJZA 4DZRA 5LQAA 3BGVA 5KYGA 4IWNA 4RVGA 5FULA 1VLMA 3EVEA 3CC8A 4EKGA 3LSTA 4PIPA 2IIPA 1G8AA 1IXKA 3UJAA 5JUWA 3UWPA 5K0GA 1L3CA 5EHIA 1N7IA 4KDCA 5DSTA 1AQJA 5HFJA 5FADA 5GM2A 3TLJA 1WS6A 4PYOA 1NE2A 3KPVA 2NP6A 1NW3A 2HNKA 1KYZA 5E2AA 3UA3A 2UYHA 1KXZA 4RTSA 1NW7A 3O7WA 2I6GA 3KPUA 4PINA 3R0QA 3UJ7A 2GLUA 2P7HA 2UYQA 5P8WA 3DLIA 3EGVA 4YV2A 2ZSUA 4IKPA 1ZGJA 5ERGB 2VZ9A 3G8AA 1EJ0A 3SM3A 3FTFA 2FHPA 3ER9A 1Q0SA 4GC5A 3AXSA 2PY6A 4PYMA 1O9HA 5HIJA 5HOQA 2CWWA 2V7EA 4RV9A 2GB4A 4ER7A 1ZG3A 2PX2A 1YZHA 2NNWB 5HIKA 1JSZA 2HTEA 3ER8A 2H00A 4M38A 1M6YA 1VE3A 4P7GA 3P71T 2PX8A 4AUKA 4ER3A 2VS1A 2ORED 3M6WA 4WXHA 4AZSA 3GWZA 3IYLW 2IP2A 1DUSA 2YR0A 1QAQA 5CUQA 5FHQA 4RTNA 4RTKA 5C9ZA 3TQSA 1EIZA 4C05A 5GINE 4GC9A 4CTKA 1PRYA 2IFTA 3LX6A 3L8DA 2ZIEA 1IY9A 2O06A 2WK1A 2UZ4A 3FPGA 4QTUB 3VYWA 5BP7A 4ATNA 1P91A 2AOTB 2XVAA 3LCCA
chains in the Genus database with same CATH superfamily
4G4GA 2RC6A 3HRHA 1BH2A 1LA2A 3WV4A 2VYVA 3ND7A 1BKYA 4V2IA 2FMUA 3USES 4E33A 5KJFA 1IMJA 1IXSB 1FY2A 3KJGA 3EWAA 1K88A 1WU8A 4IPTA 3PDJA 5H5JA 3GUYA 4YCDA 4EVRA 3CUSA 4DR5B 4UOZA 1XZFA 3MWKA 3AF4A 2I6UA 4EPVA 5AUQA 1R74A 2VF2A 4O1MA 4A26A 4C0AC 4OFBA 4YQFA 5ICSA 1EHCA 3OEEA 1XTZA 1JLRA 1KEUA 4CVNA 4CF7A 1WULS 2BGNA 4KIGA 3VJRA 4MYRA 4CDRA 3QVUA 1JG2A 1FLDA 4Z8XA 4FYKA 1F14A 1XO1A 1CE8B 1LNQA 3URKA 2D2XA 2CV1A 3ANNA 1HYGA 2CVZA 1Q1GA 4IR7A 4R54A 1XLTA 2E1PA 4DXAA 6REQB 4D9FA 1K5DA 4ND2A 4CWAA 1YCHA 3PI7A 2CUTA 1GSAA 3BICA 1ECCA 4D1YA 4MMXB 4ARIA 1PNTA 2NXNA 1XK7A 2BKVA 2ZSEA 4EYKA 4RJTA 1IE3A 2WYVA 3QMMA 1P0IA 4WZAB 1W0KA 4ZMBA 5AW3A 3FI9A 2P0YA 3KRTA 4JROA 3I01A 5K99A 3H5TA 4FFBA 4HT3B 2IPAB 1MIOB 3PQEA 3VU9A 2V59A 4FDUA 1PJRA 4C3UA 2XCTB 1VL5A 2O1EA 2UUBB 1B0AA 1XR3A 4P3NA 4GZ6A 3U4MA 2BGWA 2BUBA 2AG8A 4LBYA 1KJQA 2CLSA 3GLHB 3ON5A 4I6JA 4NQZA 2J7PD 3AKEA 4RK0A 3SFTA 5IC6A 2FQYA 5AKLA 3SWWA 3MT9A 2ZR7A 1L5QA 3DZKA 3U0VA 3V5NA 1R6DA 2HT6A 4PLWA 4QGAA 2Q7OE 3P9CA 3L07A 4FWIB 1C81A 1O6FA 2V6BA 2WIBA 4J1QA 1EFVA 1J33A 3ZK9A 4NU6A 1GZ4A 2J5XA 3VKFA 1CP2A 3PNYA 1L6RA 1ZOIA 3M9XA 4R0NA 4DMGA 2JIZD 1L5ZA 1I3LA 1UDRA 4R31A 4RZHA 4WK0B 2E4ZA 1CK4A 5ECDA 4YGYA 1HE3A 1E1RD 3OOHA 4G41A 4QUGA 3AEKA 1IBKB 3MLBA 4HC4A 1U7ZA 2EJCA 3IVAA 2O7RA 3K5PA 2OBMA 3OE4A 4M0LA 4IDHA 1SK8A 3CQ9A 3MAGA 5CIYA 4EATA 2CMDA 3AUJB 1JZTA 1Z22A 4LIPD 1LPSA 4JWTA 4ZQBA 3UOWA 4X66B 2TMKA 1JILA 4DLZA 3O1IC 4PSAA 3WLNA 2OD9A 3A11A 4A23A 2F9LA 1AC5A 1GZ6A 2OB1A 3G0GA 4RQBA 4XYGA 5IKOA 3VTAA 4MV6A 3TEJA 5TR9A 1T9CA 1YDMA 4BO5A 1QUEA 3GLGB 1QM5A 4EL0A 1FSFA 1ONNA 2O0LA 5T6MA 2C2XA 2ZBGA 4IUBS 1KDYA 4BP8A 4JV5B 5DSXA 2IZ6A 1V35A 2D0PB 4V0SA 5EJ7A 1I1NA 4GKAA 2FDRA 1H85A 2VTVA 3QF4A 4YDHB 4B31A 5K6RA 4NCKA 1N57A 2GSWA 4JC8A 1AK1A 2VFAA 3FWPA 4N3CA 3DW1X 2Q8QA 4UAGA 1MJFA 3KKPA 3RLFA 2ST1A 4JUIA 2VEDA 5FV4A 4G0MA 2DH6A 4JOSA 4WVLA 1DXOA 1O95D 2XZTA 4UTZA 5EKXA 1H4VB 2FPGA 2WG2A 4NDZA 2QLTA 3JQ6A 4JUBA 4KXUA 3RVPA 1R6AA 4KK3A 2PR7A 2WFZA 1NT2A 3ME5A 1Q16A 5K0BA 4WNAA 1VL2A 3H9CA 3AVTA 1BMDA 2BT4A 5EZYA 4ZI5A 2I7DA 3H99A 4UNPA 5K09A 4CUJA 4EVIA 1U6KA 2ZBVA 4PZDA 3KALA 3V4SA 1J8FA 2GNPA 3EZ9A 2WM9B 4ETMA 1XDGA 4EP1A 4MUXA 1WBJB 3IKJA 4TVBA 1J0CA 2Z5LA 3KL4A 3PWSA 5AFSA 4NYIR 2Q2OA 3UJ9A 5F7OA 4GM1A 4Q3KA 4B3GA 3SYMA 4QASA 5GOTA 3D7KA 4NAUA 2B3TA 3NBFA 3VYSB 3SYTA 1YV9A 3E0XA 4UHEA 2JLWA 1JP7A 1E94E 1QIMA 2ORIA 4JU8A 1XYYA 1JIKA 3Q1KA 2V55B 3H9BA 4YP6A 3T9CA 5JS7A 1A1VA 2EKBA 4H0CA 4LX0A 4RKYA 5IMSA 4HZUB 3B7PA 4O8CA 2GBIA 3V80A 2KYRA 1H5NA 4J4HA 2IX3A 1YZVA 5TC4A 4X7BA 3LLMA 3VXKA 3N6XA 2B8NA 2R1VA 1CUCA 3BMXA 4H35A 4KUHA 3BF8A 3ZQ6A 1NR1A 2ZJ0A 3C3WA 5AD1A 4FMDF 1V3VA 3PA6A 4B0PA 3LUPA 2BE9A 2J9FB 4IIEA 2I8CA 2ZYHA 1CZOA 2CNWD 4KI7A 1Z37A 5AOVA 5FIUA 3UAGA 5L51A 1ZCJA 3VC2A 4B4OA 3HWSA 4FGLA 3JD1A 4GRIA 5EMJA 3SKYA 4TWBA 5IT0A 3DEHA 3I52A 4ZJYA 3U1TA 1UMDB 4X1YA 3JQEA 1QOQB 1JEEA 1M9NA 2E4AA 3IPRA 1NN1A 3WBKA 2Q8NA 1N1DA 1ND6A 4N1AA 3GJQA 2HFJA 3VTZA 4Q34A 2G36A 5I01A 5INTA 3B82A 4K40A 2DQYA 1YZTA 1GDTA 3W1VA 3EUWA 4TN5A 5JSHA 1CQWA 1OU0A 1UM9A 5EL0A 1DOHA 4ZU6X 3T94A 1WMSA 2FWJA 3AGQA 3UWKA 3P0EA 3W05A 4M8SA 5K8IA 2JKZA 2YJ4A 4QU8A 5CB4A 1SGWA 1ZK0A 3WOHA 3T52A 4WXRA 1Q44A 2O3JA 1P7CA 4J0QA 3B1FA 4PAGA 1S9HA 4RJIA 4P83A 1JTVA 3L9XA 1C7JA 5EQTA 1S5PA 1IJBA 3NXKA 3OUTA 4QUIA 4U4AA 3RPEA 3OVMA 4LYGA 3SKXA 3ZVRA 4QRDA 4W99A 1P17A 1THGA 3PQFA 4C4ZA 1AS3A 3DF7A 2IS1A 1QR2A 2CKDA 2QTWB 1BS1A 3PRJA 3X1XA 3LQYA 4QOIA 1FMLA 1WZIA 2NYVA 5FTLA 2OD7A 2A7XA 2FXVA 2I34A 4X94A 5AI4A 4E51A 4M7PA 4CDGA 1H66A 3CHYA 1XQ1A 1JKJA 1KI7A 4BKRA 1KF0A 1JI3A 3M3DA 3MJ4A 2IV2X 1SOVA 3MSCA 3M6LA 4UUOA 5JAIA 1B15A 1T0IA 1YQGA 2O2EA 3AIMA 4GBED 3R77A 5KYTA 2P4EA 2O2XA 3V8PA 3H2HA 3ELYA 2ZWOA 4P0PB 2XUZA 4D26A 3UMCA 5L45A 2JFYA 5LSAA 1SG6A 3MEQA 1NONA 2VHJA 3OLVA 4PO9A 5EJ5A 1E7RA 2Q3HA 3LOUA 4MX8A 4LXXA 2ZTVA 1TW2A 4EQZA 4WLNA 5DBIA 5EE1A 3ST7A 4DLSA 5TQ2B 3JQFA 4IDAA 4MUMA 3RVMA 4FX5A 4BFXA 3LTEA 1VSBA 4Y0NA 5DDIP 4CLDA 4E3ZA 3I92A 3O4RA 2GWRA 2QVZX 2XQVA 3M34A 5EQFA 5HJ7A 1TLTA 3GBPA 3VSBA 3LT0A 3UAYA 3D6NB 5CTJA 1FS6A 3TZCA 1VECA 3B85A 1OZAA 1DZIA 2FZCA 4MPDA 1ZD3A 3RUHA 4CCSA 4B79A 2R8RA 1UDAA 4Q24A 4YJGB 3ZWMA 1Z7GA 3HUDA 1EDDA 1NOKA 2W00A 2IUEA 1TIPA 2J9RA 3RS0A 2QNIA 1QHYA 3ESYA 2H0AA 1K66A 1ZD4A 2JEYA 2K87A 3GRVA 2FX3A 4YACA 3RHZA 5ICEA 4JYAB 1OH8A 2GVZC 2C2YA 3P2KA 5DK4A 1NKVA 2XXBA 1MW8X 3K6RA 3DL2A 1UDBA 5HYVA 1CNMA 3WL6A 4G0WA 2B69A 2WOJA 3L1JA 4PC7A 2XYRA 3A0RB 5EJ9A 1O03A 3A6EA 2Q07A 2P67A 3W5BA 1IK6A 1GV1A 2A5DA 3GMSA 4NOJA 4BVBA 1IZYA 4W6ZA 5DN9A 1FTWA 3ZCSA 2HA7A 2FSFA 1PZMA 2GTHA 2GF2A 2FRDA 3S2FA 5BWNA 5KTPA 5BWBA 4DSUA 3ZIUA 4XUCA 2ZYWX 3L8EA 3OPVA 1WXFA 5GOZA 4D92A 5KX5A 1I4TD 4D79A 3GDHA 2G0NA 1TQHA 3QUTA 2AEMA 3BD7A 3QTLA 4IJWA 1U8YA 2DY1A 5MGBA 2HIGA 5DCLA 2ZJ5A 1NSYA 4QPPA 2XTNA 1JB1A 2DB3A 4AO7A 3CX3A 8OHMA 3VNAA 5CVJA 1E2FA 1MVOA 3EGXA 4JVMA 1IQUA 2WNIA 3LF1A 4KN9S 1E1QA 3HBJA 4MO2A 5NULA 3ROFA 3U44A 4IG4A 3E9YA 2Y9MB 3IA7A 3OG9A 4KQIA 4YO7A 1WSAA 4KO8A 1VHJA 2VF4X 1NOIA 2ID4A 1CQJB 1LLQA 1SQ6A 5KQGA 3ZJUA 4L3WA 3R41A 3O31A 2VHCA 3CGGA 4DRXB 5EHXA 4FFOA 4DMCA 4KLAA 1FRQA 3L93A 3L8ZA 1WBDA 1E1CB 1E63A 1VYUA 5AXDA 1AXGA 2CD7A 2D2EA 2FSIA 3IMFA 2QD4A 5CTAA 2VHUA 4CM4B 2DM6A 2EARA 4RIEA 3NHSA 1UJ4A 5H68A 4L6CA 1ORRA 3NAQA 5DGCA 2VUIB 4W1QA 5TY0A 4ZK6A 5JWHA 5H3HA 2WJGA 2OFWA 4XR4A 1W2HA 4PWYA 5LBUA 3IKTA 4KXXA 4OQZA 2A30A 3IV6A 3BL8A 3FLAA 1M6NA 1RQ2A 3OZTA 2YZ2A 4X1IB 2XDQA 4P5DA 2VNSA 4IS2A 1U7PA 2QOEA 4QYTA 4RDCA 1E9RA 3DULA 4BNGA 3ND5A 3I45A 3N1UA 4U8HA 2QEQA 3UFXA 3AQ4A 1S9DA 5C8DA 1QHHA 1RRKA 3W2TA 4O4IA 4ZMSA 1TAQA 3ETEA 1IEWA 4IDNA 3O8OA 4MIYA 4RHCA 5GM1A 4DSTA 4X92A 5CYGA 5L7TA 1PKEA 3IESA 4I8DA 4MZXA 1XMSA 2I3ZA 3CG0A 1T3LA 1XTQA 2YN0A 4IHJB 4KH0A 2XODA 2H57A 4Q3CA 3C8DA 4UEKA 1B00A 1DUIA 4KSBA 1UT8A 2QR5A 1KI9A 1VJDA 3CTPA 4UXHA 5DX1A 3VH3A 3ZH9B 3C8ZA 1G8KA 2QM8A 5DN6A 3CNHA 1G20A 2V6JA 1GL3A 4AY2A 5FBVB 4J75A 5HOEA 2E37A 2WQ6A 4KNVA 1TEHA 3LT4A 2X7JA 1PHPA 3AERA 1JIXA 2CE2X 2ZWPA 2IXDA 1E1LA 4L0QA 1G2IA 1SQ5A 1TT5A 1UOEA 2HXSA 4URFA 1OAOC 3PG5A 3OIFA 3VNRA 3IHKA 3INYA 2YYAA 1PJSA 1DKQA 4EB6A 3VZCA 3VR6D 4DNFA 1IWBB 2V5VA 4IZOA 4LXUA 4IIBA 3LT5A 2HMTA 3DZGA 2PMKA 3K1ZA 4MQEA 4YB8A 2V0NA 4BEJA 2V0CA 4KITB 1SCBA 2UVPB 3PC6A 4M8KA 3NORA 1Y7TA 5D7BA 3JYNA 3QENA 2QMHA 4RULA 5AW4A 3U48A 4YAEA 1XF1A 3B38A 3RBVA 1D03A 4AWXA 4O02B 3GP5A 2CZGA 2I7VA 1PO7A 1MJGM 3S2EA 5AVRA 2AZMA 2YXEA 3I1JA 3KR2A 4CM1A 1YFLA 1XCJA 3KBBA 1U0OC 2IZ1A 3THRA 1UT5A 4ENRA 1LF0A 3P9IA 1RXCA 4NICA 2BGMA 1T0HB 4W5QA 3JRNA 3O2SB 2P2YA 1Z3CA 5TF0A 4GSYA 4B34A 4LQDA 4M1QA 1ZOLA 3HZRA 1N2OA 4WW0A 1VYTA 2BY4A 3FDZA 4J0EA 3COWA 1EXVA 4PHGA 2CJWB 1OWMA 1ZH8A 2R8XA 5F21A 5FWYA 2XITA 3NOQA 3SJBA 4LNAA 4QPCA 2JLYA 2PJRA 5IJ0A 4GO1A 4DIMA 4DV3B 3UUWA 4CMEC 2HMAA 2OENG 1D8TA 3EDOA 4NOKA 4BHTA 1IUKA 4PIPA 2EKDA 4KBYA 1PR6A 2IIPA 1CR2A 4LXHA 2WYUA 5FX2A 2MSNA 1USVA 3EMVA 2QTMA 3STVA 3ABIA 4WKOA 3C7KA 1ZW1A 2F59A 3GGGA 4HZGA 4PQRA 5KYKA 1ABEA 1NXQA 2XTAA 2FH5B 4KAAA 4R71A 2A9FA 5DSTA 3KOOA 3THWB 4DDHA 4OHZA 2MHCA 4BNLA 3STUA 3H2IA 4RA6B 3Q7QA 4OMFG 3OCCA 1Y8ZA 1A8SA 2DPXA 5ALMA 2X0NA 3LOQA 4LRSB 1ZCBA 4E5UA 3GRCA 1CY8A 2ECPA 4GX1A 4PINA 3IE1A 3R0QA 4QLBA 1XNRB 1JWAB 3WYAA 3H6GA 4LA4A 4Q18A 3LT1A 4ZYVA 4IGKA 3H1BA 1QRRA 1HX7A 2Y0PA 3NWOA 3OOYA 3ZBPA 3EZNA 3IAFA 3F1KA 1EVJA 4Q15A 1H1LB 4DMFA 4HGPA 3X1YA 4I1YA 2BCGY 1Q0RA 4AIIA 2G7MC 3MCUA 4DQKA 2N0SA 1W4ZA 1OB5A 4D98A 1TF5A 2EEPA 4TMZA 1XXHA 1NXPA 3C5VA 4NEQA 4HLCA 4UNQA 3V48A 2WMDA 4N7MA 1WXGA 5A7FA 2IL1A 2Z8YM 3RCBA 2WYHA 1G2PA 2E87A 1ESCA 4IDBA 4L0DA 2CFSA 3EPHA 2E85A 1E1YA 2J31A 2YR0A 4I9NA 3VHXA 3G5MA 3GOHA 3AOEA 4BO6A 4C3OB 2W8BA 1CJCA 1XF9A 2P2SA 3IURA 5HQTA 5JMWA 3E9ZA 1SUFA 1I7NA 1Z26A 2VI5A 3KKKA 4MS4B 1VTKA 1BHO1 3UATA 2O06A 4IJ5A 1XCGB 2JGJA 3LUGA 2WFAA 4NFSA 4ZVRA 1E5LA 2PL1A 2GZMA 4FGUA 2PNJA 1ULSA 2PZEA 2XD4A 3RUIA 3NNNA 1QIGA 2HCJB 1N2IA 1R9NA 1TOAA 3EIUA 4FLMA 2V6FA 3AY3A 3CNBA 3ML1A 2GN2A 2IKQA 3R4VA 4N9QA 4WEOA 3ZNOA 4ZJUA 3RIGA 2REBA 1I7QB 2Y1EA 2SKCA 3Q7EA 3RK1A 1YZYA 2PGNA 5IRCD 1AGPA 3K8QA 1DCMA 1BX0A 1B0ZA 1NUHA 5K5EA 4YY3B 3ZU3A 2YHUA 5HILA 2WHRA 1Z4IA 5FI5A 4RD4A 4BPRA 4CCWA 2X42A 3OZIA 4ZHSA 4PO1A 4XJXA 5ED0A 5KVSA 1XRPA 5DYWA 5FA8A 1V37A 4O8ZA 1K75A 4BU1A 2I6TA 3F6YA 5J4HA 3HUFA 4PRKA 1TK9A 1Y5NA 1KK0A 2GAIA 3FYSA 5D3KA 1E7MA 4PE5B 4KUGA 5KNLA 5BO5A 5F64A 1JTEA 4L76A 2FCRA 3UJDA 1LH0A 4P3XA 2DH5A 3QOWA 4B3TB 2B36A 4TQUS 1D0VA 2JJ2D 1RYYA 3I09A 2C7OA 2VR1A 4DV7B 2O1WA 3KXIA 5LJIA 3ZR4B 1N34B 2ZUUA 2PUAA 1DU4A 1SNYA 5BRJA 2E48A 2Y66A 4JJZA 1IK4A 2XSZD 2VNAA 4MR7B 4XWWA 3EWSA 1LVHA 3OTHA 3ITEA 2BFEB 1P9OA 1Q7TA 3NDRA 2O2ZA 3MXTA 1L1RA 4D0SA 3E27A 1V11B 1EFPA 2OZLB 4J6EA 2BGIA 1YQQA 4JSRA 3QSGA 4HAIA 2G08A 2IYXA 4IQ0A 4EGCB 4KREA 4OIMA 5TDHA 5TPWA 1Q3KA 1LW7A 1NYQA 2GNAA 4HPWA 4EM6A 4DVJA 2EQBA 4DUGA 4U1RA 2ADFA 3HBNA 4Y2RA 3WSTA 1MB0A 1Y1KE 3DYVA 3UJPA 2QD5A 4IHKA 4KBGA 1JDBC 3MT7A 3SOZA 1JQLB 2W6CX 4WXEA 3QXSA 4FM9A 1Y5MA 1KOJA 1VKJA 1EHIA 1P8AA 2VK4A 5AM1A 5AW2A 1NHGA 3OF5A 5AXBA 5LNK1 3PXBA 1Y6FA 5LP6C 1G8SA 4LDRA 4BNTA 1O0BA 2NV2B 3IV7A 4JLDA 3NH9A 4CI9A 3L8MA 1P4RA 1RWBA 4L4YA 3H9GA 3SHWA 3SX0A 1RJWA 5F4BA 5AVKA 1AG9A 3N8KA 1JMVA 2V96A 1RCFA 2JGKA 1G66A 1OTXA 2ZRCA 3I30X 2RBKA 4GXNA 1QHEA 3GAZA 2QS9A 3FUWA 2GBLC 4BAGA 1UIMA 2IXGA 2DKNA 2G0TA 1SZPA 5JS8A 2J3IA 3X1WA 3WGGA 4FI3C 2WWVD 4YRTA 1O96B 1G6HA 2HWXA 2YJ6A 1C7IA 3ID6C 4ZQIA 4D8UA 3ZKWB 4BVGA 4P53A 4DCVA 4QFMA 5C32A 1UWLA 3EXHC 3M4JA 2WSMA 3M5DA 5BMVA 4YIKA 4UU7A 4PX2A 4XD7A 1EK5A 3NTXA 1NY6A 4OI1A 1M2EA 1NZJA 4DCNA 4E5PA 1ZCZA 2PKEA 2ZS8A 1X8JA 2WF9A 1NQWA 4AUNA 3FYUB 1UCFA 1U2ZA 4MHTA 1A82A 1DRVA 3FNHA 4WINA 1ZUHA 1P4AA 1WXEA 2Q45A 4RZIA 3H18A 5ANRB 1Q6YA 1AO3A 2MSWA 1USWA 3O95A 3SFVA 3ZX5A 3FMOB 2ZIWB 5HF6A 1XTUA 4EYEA 5LUAA 3MTJA 2BJHA 1KEEA 1QRTA 3D64A 4FFDA 5H70A 3MA0A 3BK2A 1QH8B 1QF7A 1K3TA 2B4QA 2XYVA 3FHJA 3P0IA 3QK7A 4MW1A 4RMHA 2WLTA 3NHJA 2IYLD 2ID7A 4HMPA 4JN6B 4RL4A 2NPFA 1L1EA 1EVZA 2C57A 2CFCA 3QEMB 1J0BA 4BNNA 4NZOA 4LJRA 4O3MA 1TRHA 2VL7A 3FHLA 3QZUA 4YRQA 4DR7B 4P32A 4EMUA 3UY4A 4RORA 2QE6A 4PANA 4E5NA 4BEVA 5J58A 1YJCA 7AT1A 2PSSA 3LO8A 2M98A 1ZXBA 2WHYA 4UULA 1Z0UA 4NBSA 1BD4A 3UKOA 1UKCA 1N5KA 2ERYA 3CUTA 4FYYA 3HZZA 4H59A 4DHWA 1PT8A 1V26A 1XAIA 4B46A 1P9LA 3F46A 1GPUA 4R6XA 1RT9A 4H7KA 1NV9A 4GR4A 1BU5A 1CE8A 4Z9YA 3F98A 5GONF 3OJFA 2MMCA 5AKHA 3L7CA 3TD6A 1QU3A 4FHCA 3Q3VA 4FSDA 1V9CA 3D8BA 3CISA 1WPXA 1N9ZA 3DFFA 1GZDA 2KQUA 3K8OE 3MW8A 5LZ7A 1GNQA 2PTGA 4YCLA 4HH4A 1FNNA 3E5RA 3W1WA 2GNOA 4RXTA 4QT4A 3JRXA 3DVAB 3VKHA 3RWMB 3AILA 3NW9A 1DADA 1MEJA 3CRNA 3OT5A 4WZAA 5CNIA 3ADKA 4NNOA 4M8LA 5EZQA 2C1XA 1KIAA 1MIOA 4BP9A 2EW2A 4FT4A 2W2LD 3QU9A 5CFQA 2ZI7A 7YASA 5BY2A 3EEOA 4IGAA 2HF9A 3L8GA 4FYXA 3DP7A 3OH8A 4WDQA 4L4SA 3JZAA 3GLHA 4PX3A 3HVKA 4IFTA 4PS0A 1GRNA 1OAAA 1BWRA 3GNLA 3ED1A 4ZVNA 5LU9A 2FSPA 2XE6A 4G63A 3PSAA 5E1OA 4G5FA 4GYYA 1VRWA 3VHLB 3MFQA 4WSOA 5C4IA 4BTLA 1XLWA 1F8XA 4H7HA 2D2VA 3TK1A 4EYGA 2OQ2A 1Y1SA 3FZNA 2XVYA 4U7GA 4XUEA 2V7WA 3UG7A 2AI2A 3PLNA 3DV9A 4YWJA 1KI1A 2Q3JA 1TVMA 3EQZA 3GJ7A 3D8HA 4MWCA 2XRYA 4O2AF 2C2GA 4OQXA 4RLHA 2KPOA 1Z16A 3BIXA 1KZ1A 4MRAA 3CLTC 4W63A 5JNUA 4YDQA 2YOGA 3GFVA 3CE6A 2QXUA 4ND7A 4F4JA 4GOND 1RXVA 1AZWA 1LS1A 2IEAA 3RUCA 4F2HA 4PZYA 5H80A 3JD3A 4LZWA 1HPLA 4G89A 4RZ3A 4R0VA 4ZANA 4W82A 6GPBA 2BWJA 2QUHA 1R8JA 3I32A 3DE1X 4E94A 3C6ZA 3UAZA 8ADHA 4AYWA 4EJ6A 1G8YA 5I9LA 4OHCA 2NT3A 5AI9A 4RVFA 5DP2A 2XMCA 3FCEA 1P4GA 1FSZA 3EZXA 1GVHA 4OJMX 5IKXA 3GLGA 5AI5A 1Y37A 3CM0A 1E0KA 2ZRNA 4Q3OA 2X2EA 4ERXA 4RQTA 2QZPA 4YXWD 5ETJA 1KZGB 4I9FA 2XT9A 3O92A 2HCTA 2I5PO 1KMCA 3TN7A 4F9EA 3BCRA 1F2DA 1WQ1R 1VA4A 2D1SA 2IUTA 3FDJA 3IXLA 3PNKA 1OLUB 2VH1A 3LPMA 4BX9A 3N0RA 1U0JA 3UK6A 1RP1A 5DW3A 4M1WA 1ZA1A 3MOSA 3FZGA 5FTWA 1JS1X 1YBHA 1V7ZA 1Z2NX 2IYUA 3KNZA 4Q39A 5EUQB 1E99A 1L8AA 3RT9A 1DDIA 1RKBA 2A3RA 4XDGA 3GEGA 4E5KA 3FDXA 1PSZA 1U3TA 4RVDA 2N1BA 4MUKA 1NQAO 4FDTA 4BC0A 1VCMA 3TLBA 1SC1A 3K9HA 2J7PA 3DWIA 1UK9A 2EFJA 3MIZA 2HQ1A 2QM0A 3DOOA 1AVTA 1DMSA 4D3XA 1DVRA 4LRTB 4U9IS 2FQXA 2MINB 2NO6A 4YRLA 2FKAA 3SYRA 1UBFA 4ZXFA 4HG2A 1PEKE 1XEAA 4Z99A 1RP7A 2PH7A 1ZJZA 3R24A 4MCHA 5AKZA 2FPOA 1XWIA 1DBWA 3OM8A 2B2XA 4I81A 1R16A 5M5BA 4B3JA 1RLOA 5TMEA 4S2EA 3QLVC 3DLBA 4TPKA 1V8BA 1XPUA 1SKAA 1UPUA 1E1RA 2Q5OA 3OT1B 5JJ5A 4RF3A 4DNPA 2DT5A 1BDBA 1XEWX 2ODWA 2CHFA 2VPQA 4BMVA 4HZUA 3BG5A 3FPCA 3TL3A 5HHTA 2CVHA 2QVYX 3FMGA 3L0SA 4NXMB 1SHTX 3MJSA 4TLDA 5U4XA 5CDYA 3RGGA 4J9UE 1ZQ1A 2PAFA 4EZEA 3JYOA 3ZXIA 3QFTA 2GA9A 1D6MA 5A5FA 1OIVA 2GPWA 2IOFA 3LHSA 1CUGA 2J9FA 1AF7A 3NWPA 4MRSA 3CUUA 4OLFA 1L8XA 1P80A 1IVNA 4JJEA 2ECFA 1P6QA 4TL8A 2IUUA 1A9XB 1Z36A 4KUEA 1Z4MA 1ZINA 4J3NA 4HWOA 1GNPA 1UMDA 3ICOA 2ZS9A 3PXAA 4V0QA 5BOSB 4AS1A 4P35A 4C0XA 1Z38A 3EGIA 3DJYA 3SJZA 3OZEA 2OZEA 1X77A 4L8WB 1U04A 1O95A 3AJRA 3NP7A 5E6RB 4EY8A 4CM9D 1X14A 3W6ZA 2PBRA 4BBZA 3CKKA 2F64A 1NZDA 4PYRA 1P3DA 3OD1A 1OREA 1QMPA 4MVXA 1J8MF 1Y98A 2C92A 4OU4A 4U2KA 2F8LA 4B44A 5C1DA 3WGNA 3GELA 4ZQHA 1CSEE 4QRHA 3B52X 4BB0A 3MUEA 3DVRX 3JAWB 3GCGA 2Q29A 3HXMA 1ICIA 4LOJA 4R1NA 3U4HA 3JQ7B 3W7VA 3WYFA 1P1HA 2ZXEA 4A6XA 1G17A 1JA9A 1HTTA 1YAHA 5GIOE 2JJ8A 2OGWA 4F1WA 2A1TS 4FUTA 3T3IA 3ZIDA 4YT8A 3H5NA 1A97A 4GUDA 3FX2A 4DV5B 4PR0A 3DDUA 1H1TA 3EQ8A 4KQMA 4JBWA 3USZA 5KTNA 3LLVA 2PUFA 3A2MA 4PLGA 1I9CA 4WY2A 2R8OA 2VAVA 4TSKA 2IYRA 4OAOA 5P21A 3IEVA 2IYWA 4H1UA 4HRAA 1FDUA 3ETHA 5EUMA 1O6GA 2IHJA 2RIRA 4EIWA 1Q22A 1DAEA 1GAWA 4HWRA 2R6JA 4MUIA 4V0LA 2OHVA 3J80A 2YYSA 4H7DA 4U7FA 1N2JA 1XDDA 2PYDA 1L7XA 2Q99A 1X8XA 3IHTA 2EL9A 3L0DA 2QRNA 3IOBA 3QLUC 4XQGA 3TUZC 4LMPA 1D6SA 4TMXA 2SNIE 4X3PA 4ITRC 1KETA 1OE0A 2HX1A 3H1TA 3EQ2A 3HDQA 1R4NB 2CNWA 5TQ2A 4KLCA 1JSLA 3D1VA 1G59A 3B5JA 2CLDX 4AB1A 1FNDA 1FEZA 1PP4A 2C0PA 4OB7A 3IP6A 4POOA 4YRGA 4Z0PA 3DKIA 3H3JA 2OBNA 4HQOA 4K9NA 2IE8A 3GJ5A 3EAFA 4OREX 3G5AA 1J0AA 1GZSA 3BIOA 1ZIPA 1NI3A 4Y1GA 2QW8A 1IJKA 4MGZR 1N1MA 4J7UA 4YJGA 5AJUA 4RWZA 4XFDA 4BOYA 1GG2A 1Y4AE 5F1YA 5GVSA 4ZVTA 3D8TA 3HWWA 3K15A 2X40A 1KEVA 2ZWMA 3ZU5A 2IQIA 3H5OA 1NMYA 5CH8A 2KM1A 1AK9A 4IIFA 3RRBA 5CX1B 3S1LA 1E61A 2B6HA 1XUOA 3A9CA 2ZRKA 3TW0A 1PZXA 3DHYA 1EBUA 4I5IA 4L5CA 3BH7A 1TNDA 3RJZA 3AV0B 1BXKA 1HYHA 5LPNA 1D7OA 3KWFA 5JD5A 1L5YA 2H4HA 2JAOA 2L18A 3CCBA 4S1NA 3ZE8A 2ATIA 3JQ9C 4P86A 4Z8YA 1CJVC 2AZXA 5A4AA 1ILEA 1CHDA 1F3OA 1PD0A 1Y6JA 2NG1A 2WIKA 2XZOA 4M60A 1KSGA 3FVTA 2JGEA 2QL9A 2X1VA 1JALA 1WCXA 1ESMA 2Y0DA 4G1EB 1BCSB 1KYZA 1OBHA 4PQEA 7MDHA 1JH9A 4FKMA 5KPJA 3QXCA 4ARCA 2WTXA 2HJ9A 3LI2A 3PC8A 1TUGA 2A0XA 4RIGA 2FPPB 3GJSA 2HWYA 3CLVA 1OC4A 3CTMA 2V65A 5A02A 2VZ9A 4WZZA 1OW3B 1CLUA 1JLSA 2AYXA 3CLSD 3DONA 3HDHA 4Z4CA 1CQJA 4EPXA 2GILA 2VT7A 1Z73A 4RV9A 3DDSA 4DRXA 1M2VB 2FZ5A 3IOCA 4RENA 1THZA 1O6CA 2Q0SA 3LDHA 1E1CA 1IHPA 3V4OA 1JSZA 4N76A 3D5QA 1VKNA 5CW2A 3TTSA 2ZBEA 4CM4A 1PVDA 1HA3A 1YQUA 4HVLA 3SJCA 1KDTA 3M6WA 2ZB8A 4GI1A 3AI2A 1FIUA 1EP1B 1PJ2A 4YRAA 4ZTZB 1QAQA 1LX6A 1SVNA 3OD5A 1UP6A 4KLZA 4Q37A 4X24A 1RABA 5I9SA 4E09A 5IYZB 4X1IA 3M82A 4KEAA 5LLTA 4CR8A 5JSFA 1IY9A 1QP8A 3ZDAA 3FPGA 1V9SA 4ATNA 2VDVE 3CKYA 3LCCA 4O0MA 2QRKA 4IICA 4BBPA 2FEOA 5CP8A 1K6EA 3KYJB 4JLVA 5L7YA 2GN8A 3GNSA 4HXEB 1FDTA 3QHAA 4K0RA 1UXJA 4J1TA 4DCMA 3F97A 1MTOA 2CFRA 1VJ1A 1H23A 3NTRA 1NQVA 4IHJA 3GLKA 5TX7A 4BFUA 3DL0A 3C3PA 4RNDB 4U6QA 1FSGA 5JHHB 1YA8A 5HP4A 3VNUA 1CVIA 1L9KA 2QGZA 1HSOA 3EC2A 3PYLA 1Z29A 1FFEA 2PGXA 4A27A 4DDWA 1AE1A 1V41E 4KPGA 1JJFA 4YRFA 4DA0A 1O94A 2O5VA 3GRZA 4Y6RA 3ZE0B 4ZCSA 4C30A 3Q98A 5FA6A 4DY4A 5ILOA 4KXNA 5TS2A 3O8RA 1W2WB 2CNKA 1QGDA 1RYBA 4LG1A 4M98A 4JUDX 4NKRA 2I4LA 4QOGA 1T5HX 2P41A 2RH9B 3NBZC 1F60A 2RH5A 2EWMA 2ZRGA 4MJ7A 2MU1A 1DC4A 4MTCA 3UXHA 1R0ZA 4TWRA 1PUIA 1NUAA 4ZVSA 4OHXA 3HACA 5KVCA 2RE8A 1VSVA 3LFTA 1JZSA 2UVPA 2IZZA 5EJIA 2O3RA 2GN4A 4BL5A 1EP9A 1WOMA 1RQGA 2H4JA 1UL1X 3Q3IA 4BNZA 2JIOA 2WI8A 3TO5A 2C3MA 2HRQA 3H6HA 4X6LA 4B3IA 3MBKA 2YIMA 3PX2A 1JHRA 2WVAA 2RHCA 1ARZA 5EHNA 1FRVA 1MQ9A 3A4MA 3GEIA 3K9CA 2HMWA 5CXQA 2F1RA 3EBOA 1A88A 3EAGA 4LWOA 2J3DA 3KTFA 4KO4S 1H3FA 1SU6A 4G09A 2A78A 3VUFA 5K9ZA 1VGVA 1NW6A 4TLCA 1IYZA 1DS6A 1FX1A 3SS8A 2ZXUA 4BYMA 3QBDA 3RUFA 1KVRA 2YWCA 3AV3A 3N0WA 2CJWA 2QN9A 3PQ3A 1J2JA 2XQGA 3S4YA 4NBKA 1DQRA 4EI8A 1ZOSA 2XPCA 4XLZA 3ICVA 4FFSA 2ZEJA 3RADC 3NHFA 2KE5A 3OUZA 3ZDYB 4YUZA 4B4UA 5JAPA 1E3EA 1JZQA 1RC8A 4JQZA 5AI8A 3FBGA 3P20A 4HTAA 4EB0A 1XN4A 2BUCA 3ZGLA 3UM9A 3L8YA 3ZHOA 1VKHA 3THWA 5ALXA 2W71A 5KQPA 2ID9A 2GXSA 4AZTA 3K5HA 3IQZA 4RA6A 4WADA 3T8YA 3OICA 1E2KA 4JVSB 4M21A 1YFKA 2VJQA 1HC7A 2XW6A 1OVMA 1HTBA 2CLFB 3IRUA 4IIXA 3FTPA 2DBZA 4MEAA 4B3BA 1FLVA 1E6UA 1KEWA 4Z49A 1B73A 5HZGA 4K6FA 1NJSA 1JQDA 4WL0A 3FTEA 1YS7A 1QHXA 2Q0HA 3MWEB 3VR6A 4J4BA 1H1LA 1J0EA 3ZEIA 1U81A 3VDRA 2PEZA 3LX8A 1E69A 4RDXA 2QG6A 1MMFB 1ZC3A 2A84A 2QVLA 1VIVA 3H1EA 3P32A 3D9QX 4LYAA 1WDLA 1SPXA 1YL5A 2NPIA 4YCSA 2QIPA 3L79A 4OB6A 1G41A 1PFVA 4CTOA 2LE0A 3I0ZA 3MMPA 2RKWA 3VC3A 1CJKC 5EEHA 1QMGA 1TMYA 4YRKA 1TQ2A 3LW7A 1DG9A 5TSDA 2FSGA 4R5MA 3SAJA 3I1IA 4IH1A 5EERA 4BLSA 1BJRE 3G7UA 4HNVA 3CVXA 5EYPB 1TQ6A 4EI2A 2KW5A 5JE8A 3D5TA 4YRBA 3EMBA 4MS4A 2XY4A 4C4AA 4EG1A 1FJXA 4C4XA 5FPHA 5GZ3A 4M76B 5LYYA 1SVOA 2DC1A 4TV8F 2FVXA 1CYEA 2VAXA 2YY6A 4AN0A 3TLZA 2Z5FA 1N7GA 2ZLBA 5HUJA 5K7SA 1TFUA 4MW4A 5B3JC 3GFRA 1LQUA 1UDWA 2A7QA 3E3OA 3VMMA 1EZZA 3GD7A 1K6XA 2W90A 4FNMA 2D2FA 4PONA 3ZBQA 3NT2A 1OXSC 2YJNA 5GV8A 3OQOA 5B3KA 3QXJA 1HBJA 4IJMA 2E55A 2O0KA 5KYNA 3TVTA 2OC9A 3NUQA 3NBMA 3WLEA 4HQ0A 4HYEA 4PTZA 2ETXA 2XIQA 2WTNA 3K0AB 4WPGA 3GYGA 4LWPA 2P0EA 3E84A 4EA8A 1SKYB 2NTYC 3OHMA 4MQFB 3B3FA 1QJ4A 5DGHA 3FZYA 1RYZA 3QX8A 4GBMA 3LKDA 1FYDA 4B8ZA 4YXFA 1PFWA 2B5OA 2QMYA 3E3MA 4G86A 3R8CA 1ADYA 2DVMA 4QGSA 1CDEA 2K6GA 1HMYA 4PO3X 3UMYA 3ZE9A 3QPDA 4GPZA 5HNKA 1F38A 1ISSA 1G5QA 2FOIA 4MR7A 3OX2A 4Q9NA 1ATZA 1DWOA 2NO4A 1Y42X 2Q5LA 2RI0A 3DDOA 2JRLA 2BFEA 3JQBA 3N6VA 3WHPA 4CE6A 4BVKA 1R6UA 5ITVA 3HUUA 1BXGB 1V11A 4LOAA 2OZLA 1GSOA 4NQRA 2C9YA 4O4JB 5TEWA 4ZVLA 4B4KA 2CVOA 2IUSA 5EIOA 1SCNE 3DAHA 4U9UA 3WGZA 1ADBA 3HI4A 3OEHD 3B51X 1ONOA 4EEXA 4V03A 1P75A 3EVGA 3AVYA 4F3TA 4NFHA 4BECA 1RJDA 2ZYIA 3WZLA 3RRMA 4ZYYA 3EY9A 5T5QA 1CQIB 4YAJA 3TTXA 5L6MB 1VMIA 1MAAA 1XAJA 2C8JA 2LTAA 2VP9A 3OFND 1YNOA 3QBTA 2WJYA 4LN1A 4JI1B 3L02A 5IW8A 3IP1A 2OL4A 4FYHA 4LAFA 1YHNA 5IAKA 1PJ8A 3DKPA 2IV7A 2ZUBA 4JR1A 4QKQA 2RIPA 1XTSA 2ZTHA 3LC2O 3V97A 2H4FA 4HX2A 1SQ0A 2UYGA 4BJHB 1H2ZA 1XZLA 4HAUA 1FW8A 2FWAA 5EMLA 4D5EA 3EDRA 2EBUA 1VYVA 1ZGBA 1WF3A 3HO6A 4HWTA 3BGIA 3OZAA 2HPZA 1CJUC 1NKSA 3OLWA 3CGWA 5LQDA 2V7QD 3PUWA 1G8JA 4CTMA 4D4KA 1XQ6A 1IONA 3BHJA 4QGGA 1NBWB 4XB1A 2PVCA 2C2ZA 3IVMA 3Q40A 4BVEA 1AGYA 2Q3BA 3UAWA 1O96A 2O2GA 2Q4TA 3D3KA 1V1JA 4XJVA 1ZH2A 4P0TA 1AMUA 2GGSA 4C07A 1OH7A 2PKWA 3HBFA 3I23A 3IODA 4UEJA 4YRDA 2JJ2A 3ZKWA 4BS9A 4IGFA 4V39A 1DIHA 4N3GA 2FSHA 5HKBA 3TSYA 3KSUA 1LBTA 5IBRA 5SYNA 1UFRA 4YV0A 5BT8A 3H2ZA 1W1IA 4BXOB 4WKGA 3E1SA 1B23P 2XSZA 3A9VA 4OM8A 4ZC1A 1W7AA 3CO5A 3S8EA 3G8YA 2QTBA 2LP4Y 1ZNQO 1B93A 3FYUA 1G5HA 2OORC 3IMGA 4KMOA 4E5VA 1TAUA 5GJWC 3TUJC 4A73A 2XNCA 1FUYB 2V7PA 1VPLA 3SIPA 1PN3A 5HGJA 5KJ6A 3FCYA 3F5QA 2IYYA 1JDUA 2G70A 4D81A 2GBFA 4KGDA 2GUGA 1QV9A 4PZZA 1I01A 1Q0UA 4YJFB 3A04A 2FMKA 1QH8A 4LJSA 2PG3A 3IOMA 3UUFA 3I76A 4XKJA 4CMCA 2QQ0A 2AWOA 3RYTC 4ARVA 3B2NA 3I73A 3KEOA 4FDLA 1FFHA 1BTOA 3DZJA 3QEMA 4Y98A 1TM2A 1I30A 2I54A 4IOKA 1ONBA 3L40A 1GGFA 2IC5A 2D7DA 3HA3A 4S04A 2VCEA 1MA3A 5IM4F 2YY7A 3FCCA 3MNFA 1OCEA 5TQVA 1MAVA 1U7DA 2GJKA 1KZHA 1VBKA 3R7SA 2EDCA 1YQ9A 4Y1EA 1JEJA 3EEFA 1C8LA 4YRCA 3B6MA 4HQKA 2HJWA 2H5LA 2JI6A 2MDTA 4NYMQ 2VDOB 4U7HA 5EJ4A 5KNDH 1PDWA 1XL0A 2EAUA 2VYCA 4M1EA 4O2AB 1D1TA 1JNYA 4I1SA 4I8XA 4TL6A 4UMFA 3SHVA 3W5VA 3AHHA 1CZHA 1RPAA 2OY0A 2W6NA 3HVJA 3HZOA 3SEQA 4E4TA 1BX1A 3HS3A 2O8BB 3ZY3A 5JDCA 4D45A 1DAKA 2IHTA 3DLAA 3NALA 3H83A 4I9HA 4UTNA 1I51A 1H94A 3DVAA 4Q47A 4UVGA 4QEKA 1X39A 3OZXA 3LDGA 2B8EA 4JJ7A 1GDDA 2N9UA 3ASVA 5LZ8A 4C4PA 5C7OO 4G56A 4WMLA 1E9AA 2Y1WA 2I67A 1G42A 4Y9TA 3WYNA 1MJHA 1QHFA 2I1LA 2I4TA 5AHRA 2OA0A 1QPBA 4JJAA 2ZM6B 3T95A 3F1LA 1S8FA 1NVXQ 5EPEA 4OHOA 5IZCC 4JI4B 1BC5A 1DCTA 4KHPB 1J22A 5MDHA 2PUCA 3I01M 5TVKA 2RJOA 1HEUA 1P74A 1XMIA 2IPXA 3TR5A 3OZCA 3O0TA 4BVHA 5IVKA 4I66A 3VH1A 3NYWA 1Z3IX 1A77A 5IDYA 2A14A 1RAFA 4N3AA 4XUDA 1RSZA 1UFVA 1PT9A 1ELOA 5PGMA 5B6IA 3EDQA 3ZVMA 2VBCA 4JLOA 4G0XA 1TVCA 4JBXA 2XLBA 1GAXA 4XH9B 2XB4A 1KFJB 2MSKA 4FINA 4XQ0A 3KZVA 2G40A 5HJ2A 3OJ0A 4M1TA 1R0BA 3LTNC 1EGQA 3H65A 2ZCJA 3RNOA 1C50A 1U94A 3WDSA 3TTUA 5JPCA 3NDBB 2CY0A 2QTNA 1T5IA 2XYPA 3GEMA 2O05A 5EN4A 5TJ9A 5B1SA 4CNQA 4W5NA 3H9EO 2VBGA 3I6YA 4HDKB 4LX8A 5IMBA 4JP2A 4BE7B 2TSYB 1FUEA 1H2AS 2QRJA 1DX9A 4PFSA 4QGBA 4D8WA 2AGVA 1DRKA 3ZX4A 3B20A 2PVSA 5E6SB 1YR2A 4BO0A 3WKEA 4DMLA 3FOAA 4JLBA 1DG1G 1J97A 1Z75A 4LFCB 5HFAA 2ISCA 2ZU0C 3UJCA 3WLIA 3KR0A 2X2PA 3PYMA 2L82A 4GD3Q 4JMLA 4UBMA 5SY9A 4JVNA 4DG9A 5SY4A 4YAKA 2PKXA 3OF3A 2JH3A 3GJ0A 5BN5A 2I03A 2Q0QA 2QMQA 6REQA 2J5KA 2W83A 3NLLA 4RKRA 1OLUA 3A3YA 4N40A 4E1VA 3PFNA 1QK5A 4MIKA 2O23A 3BWEA 3ANYB 3OCUA 1GM5A 1KA9H 1KYQA 1XZNA 2ZUVA 4QVKA 5CXSA 4U2CA 5AVQA 1Z6GA 1T4MA 2G04A 3TQFA 2AN3A 2UZ3A 2QMEA 2W2LA 3DGFC 5CVEA 3PEEA 2O1SA 3V7UA 2BP7B 1BDIA 1W87A 2IIBA 2XGOA 1Y63A 2BR3A 2D3WA 1U2DA 1B6SA 2CKMA 2PFKA 3UGKA 2X41A 2ZB4A 3MC1A 4PPQA 3GC6A 2DT8A 1NN3A 2MINA 3ZXUB 4G37A 5K8LA 1BVHA 1QVZA 2D54A 4ZZ2A 3DO6A 2I1VB 1F2VA 1N2CE 1C4OA 2Q27A 4F12A 1QWSA 3TM5A 4EOGA 4A15A 1HYQA 4AY6A 4Z53A 1YACA 2JLBA 1NM5A 3GV0A 4G81A 4KQHA 4N01A 3WGLA 4KFUA 2GN6A 3QLJA 1R9JA 1D8AA 1M1XB 3DZ8A 3M5WA 4ALMA 4CL2A 2LRHA 3THYA 3PTZA 5JZVA 5CK4A 1UP4A 1IDOA 4LSWA 4FBMA 4NU0A 4PHHA 4FN4A 4F93B 2DX7A 3OT1A 5K0GA 1ZA2A 2F6RA 1EP3B 4GYJA 4KDCA 4MRNA 1GR1A 4PG8A 2JJMA 5HFJA 3KIPA 2PZ8A 4UMVA 1KE2A 3BJZA 3UVEA 4N47A 3BULA 3WX0A 3ZTTA 3ZHUA 4C4TA 1Q11A 4ZEMA 3ZHVA 3BK7A 3HKDB 2P2CA 1KXZA 1OI4A 5J2UF 4MVJF 2RAPA 3QFHA 1UOPA 4MI3A 1XPRA 2WEKA 3IAS6 3OZWA 2VQDA 1JJIA 1ZGJA 3QE4A 2NVWA 4YXWA 1F8YA 1A9XA 1T8RA 4HEA6 5HF8A 3KSMA 5A4KA 2D7CA 2HRCA 1LPNA 3ZLJA 2HBQA 2CWWA 1TCVA 5BOSA 1W5TA 1OLSB 5DT9A 2YWEA 4R9NA 4Q4LA 1I7PA 2FW0A 1DBSA 4B5KA 2HTEA 1SB9A 4G5YA 1E7WA 4PZCA 4OEHA 1OBOA 5EKDA 5E6RA 4H4EA 2NSLA 3CMCO 5EWJB 4L5JA 5TGTA 1GO2A 3TX2A 1JFTA 4UHBA 3OM9A 4WXHA 2E9SA 2R86A 4ALJA 2WT8A 2ZYAA 1WCWA 4YHHB 4DG5A 1MO4A 1AHPA 1E2UA 1XDBA 3MJVA 2G9NA 5K8JB 1J5PA 1LTKA 3TW4A 4C05A 3HSYA 4ZI3A 2H4ZA 1QIDA 1QG4A 2GESA 3HJGA 3JAWA 5FUMA 2ZIEA 2QT1A 1ZJWA 2GM4A 3C1AA 3W5AA 2WOOA 3JQ7A 2WM3A 3AZOA 5HKKD 3RVOA 1SRQA 4Y6LA 3PP8A 3ZIAD 1E3QA 2NQ8A 1DL5A 1KU0A 3PA8A 1JHOA 4XUGB 3QOXA 4LWQA 3R3ZA 1VZ2A 2BN4A 2OZKA 2QYSA 2YJGA 4GS5A 5KHOC 1A9RA 3GT7A 2B9EA 1YCFA 3EXIB 4V2UA 1TFRA 3E82A 5AJTA 5GJCA 2BMEA 3UO8B 3ZD9A 5C8XA 1EZ4A 2B8JA 4MQ4A 3BMNB 1EDOA 4D4IA 4ETIA 1HT1E 3QEAZ 4XSHA 3FOZA 1GVNB 5JR3A 1SKBA 1T9GR 2FPSA 2C61A 2QI9C 3K2QA 1V5EA 2RK3A 4JS0A 2ZBPA 4UNNA 1RYEA 3LHFA 1GA1A 3T9DA 4LV8B 5EPOA 3LP8A 2X0RA 2OZPA 5JD6A 1ZMOA 1RNLA 2EP7A 3G2LA 2OSVA 1O7JA 1YQEA 1QB7A 4ZHQB 3A9UA 4DBVO 1BFKA 1XQVA 3X2FA 4OSPA 4TTQA 2HADA 5EIFA 3HB0A 4C20A 1RZRA 4DG8A 1F4VA 4DQ0A 1PJLA 4F06A 1FDRA 2OP0A 3WWOA 3LZ6A 2R3SA 1GDHA 1T0JB 4KZPA 5ARDA 5C1PA 2HV8A 1R4NA 1XTBA 4A0GA 2DTEA 2G5PA 5FBHA 1KJZA 1W1UA 3FOBA 3F4BA 3MERA 5ALPA 5F9MA 3LNTA 1IQPA 1IZ9A 2R87A 4QBKA 4Q3DA 5FR1A 1ECJA 4EUNA 1GG8A 3H8JA 4UARA 3DEFA 1JQ5A 2AC4A 4YTEA 4HB0A 4HJRA 2D74A 1IH8A 3FPSA 4L0MA 3OIUA 2WB2A 1HWYA 4CM9A 2ETVA 2ONYA 1CUEA 4GLFA 5AK4A 3WHLA 3LWZA 1T9BA 3QXXA 4S0XA 1JLMA 1NXVA 3IIEA 1NN0A 1UKZA 4UAUA 2Q3FA 4F2GA 3PNLA 2Q7DA 2ZBDA 3R8XA 3WG9A 5B7GA 1EUYA 1GYRA 4DDVA 1MB3A 3LGXA 1SD5A 5GMOA 1JA1A 2G1KA 4FGZA 5LA6F 4XWOA 5CX1A 4GMKA 2QJTA 4WK6A 3PICA 3RB8A 3QLEA 4LJLA 3FKJA 4HFJA 2W70A 2W11A 5LDHA 2H29A 3W2FA 3KUUA 4AJIA 1ESZA 1TADA 1UBEA 3A1FA 4Y2UA 4JFAA 3A36A 3RS9A 4S35A 1N8KA 1T4DA 3FETA 3O4VA 3JRWA 4PX5A 1EVLA 3W6PA 4FOLA 4KXQA 5TB5A 1KK1A 2NO9A 1U7TA 1N9GB 1QGAA 1F0NA 3J7TA 3DEZA 2FZGA 4F4CA 1FPMA 3KJQA 4DRZA 2QVXX 2AMVA 1BCSA 2EKPA 2JHPA 1JJ7A 3PVZA 3J81k 3W9BA 3O82A 3WYDA 4JENA 4BQIA 2FPPA 2HEGA 1SC6A 2R2AA 2WAYA 2XKBA 3DE6X 2MT9A 3FR8A 4PRZA 4EW3A 2Q6KA 4P38A 2ZI3A 4XE5A 1DGQA 3UANA 1FU8A 2I7XA 5HPYB 1SQSA 4C0LA 4B45A 1ODIA 2VXBA 3L6EA 4OQLA 2Q9CA 4UM9D 3WGYA 2WF8A 5SV2A 4BZZA 2Q1WA 1M2VA 5A04A 3VKUA 4R51A 3K94A 4DLRA 1M1YB 2PXXA 3DP9A 3CVJA 3P0HA 5AKEA 2MSLA 1DT5A 2XGSA 1M2WA 1A04A 1DHRA 1Y4ZA 3H2YA 3HCFA 3LT2A 5K6TA 1QFXA 2A5JA 4W9MC 1NBAA 1NC1A 1NF3A 2WMOB 1VBNA 2ZPAA 2CDAA 3DHWC 1N25A 5IYZA 2MOKA 4F38A 2A33A 2NTNA 1PZFA 1F51E 2QN7A 2OK8A 1PQWA 3MRSA 3W2GA 1G5FA 4HQLA 6LDHA 1UJBA 2NZXA 1GKUB 1Y6QA 5FI1B 2OTCA 4CTJA 4MLDA 3GXOA 3UHOA 1T26A 1KC3A 2GAJA 2YZ7A 4X0EA 3SEFA 3UPUA 4EGFA 1G60A 3AFGA 5DH9A 1VJTA 2BDUA 2C59A 3KPJA 4NP6A 1ODCA 2H17A 3IDFA 4B71A 1JVSA 5T3UA 3QVKA 2FWMX 2C8LA 2BKAA 1P18A 3ZWPA 3CW8X 2EW1A 4KQJA 2J0SA 2GARA 1WZNA 4F45A 1I6WA 5B1HA 1C41A 5B30A 4UZEA 1J7KA 3CZRA 4XX1A 3AJ9A 4QC2A 5EY5B 1RMQA 5G1OA 4I6GA 4B75A 1VI6A 4G9BA 4NV0A 5BYJA 1HOTA 5L40A 1EAYA 2Q4DA 3H1AA 4G4JA 4N48A 2QRMA 2GBPA 2PLAA 4RPLA 3VR5H 2JI7A 1FMFA 4UUQA 1ZVQA 3HDYA 1V8FA 1DI0A 4X6UA 1IUOA 1AUPA 4BLRA 3K9WA 2J0UB 3IBYA 5LR6A 3PWZA 1MRZA 1FXWF 3D2LA 5CM9C 4DC9A 4YFVA 4KFRA 2QZ4A 4UM9B 1ZWLA 4PCUA 4XIFA 1B3RA 2ROQA 3ZGOA 1A7AA 2BGLA 1AKRA 4MA4A 1VQ1A 3MFYA 1OB2A 1SVWA 1YRHA 2PX6A 5ES3A 3UCFA 1YFZA 2POCA 5L95A 1JR3D 2HCFA 3AG5A 2PMDA 2RHBA 4I55B 2Y8EA 4EY6A 1PDVA 1JIJA 3GT3A 1NKTA 3UB3A 5I7HA 3M49A 5CH3A 5F2OA 3WDKA 4QG3A 4OUDB 1PD1A 1N2HA 2Y77A 2PL9A 2VBFA 5ALHA 5DOZA 4E1BA 5LQCA 1SKQA 1G4AE 5JCXA 4AJPA 3PKJA 1U9IA 2IJGX 2V98A 4IMJB 3G5UA 1ADFA 4IVQA 4JCCA 1XZHA 2FSUA 1P5RA 2ZBUA 3PHHA 2FMXA 4YMIA 5GZ6A 4MQLA 5KYWB 4LVOA 1F2UB 1NVEA 3NM4A 4ZI7F 1O9GA 4GX0A 3SY8A 3VRHA 3QNUA 1YWGO 4BKUA 2AZ4A 3ABZA 4B87A 1EINA 3WSVA 1JHUA 3H2JA 4UNIA 1SB8A 2KSQA 3BBLA 3HB4X 3W9SA 1RJEA 4ZCRA 3FMIA 4JYBA 1SCQA 1U2GC 1NT4A 4KRYA 1RWOA 4PHCA 4DYHA 4CEIB 1KJIA 4PCAA 4AJEA 4DV2B 3QU7A 3GQVA 1K2VN 1ZD5A 4UXIA 5KVAA 4IFIA 4L4UA 2C2HA 2JL1A 1BSVA 2JCGA 4DEYA 2H7YA 1C80A 5IT4A 3NVMB 5I4CA 5KPDA 2I3AA 3PIDA 1T9KA 3B1ZA 4K9DA 3MWEA 1H1DA 3DAGA 4D99A 5B64A 3BHMA 3AVXA 1BXZA 3N9IA 1QOPB 2X9QA 4QPZA 1UPCA 5T64A 3LVBA 3ICQB 4WVFA 2J3KA 2EBWA 2JARA 2GRAA 1EE9A 4KQXA 1EUCB 5GIPE 2E4YA 2VUTA 4TKLA 2GPJA 4CDMA 5CB0A 4EHJA 5EFOA 3KPYA 1EK1A 1LF5A 2CYAA 3DO5A 1II0A 4EX7A 5CLFA 2XRZA 1ADCA 4RELA 3WNBA 4IS3A 3JAKB 4DQLA 2PSFA 5E4JA 3P9PA 3QFCA 2YXLA 2Y3IA 3K2IA 4GGPA 5EJEA 5I4BA 2BHNA 1UBSB 2Y92A 3MJRA 1T34A 1GN9A 1KS9A 3FYCA 3HNOA 2EZUA 5EYPA 2NGRA 3VQTA 3O4GA 1XVLA 1Q0QA 3BWCA 2B4YA 2IYEA 2R4UA 4QJIA 4D3DA 5FLXA 4QA9A 4RD3A 3KAQA 2Z6UA 3IL2A 2NVBA 2FF7A 1Y4DE 4P31A 2FP3A 3WISA 5C5DA 3NHLA 4Q7LA 3V2GA 4COOA 4EY5A 1Z4OA 4QT0A 2V7TA 4CFYA 1JDBB 4GH5A 1XTRA 2VYND 4N5MA 2IYFA 1Z62A 3O26A 3PUZA 3HYTA 4XSVA 4QDKA 5KNCH 4NJMB 1NVUQ 1LC0A 5JNSA 2XMGA 3O4IA 3V1KA 5BW4A 4L6AA 2PMEA 1ESEA 4RVCA 3ZYZA 5KSPA 4B32A 5LP6B 2QU8A 1P3JA 2H1RA 4ZCLA 4PQGA 4EKIA 5AM2A 5KTRA 3DV0B 3A58B 3GRRA 4BMOB 3JASB 2HGZA 4FJ1A 5ALKA 1KDPA 4BO9A 3RYCB 1GL6A 5IG2A 4PLHA 3SXUB 4EY3A 1U8ZA 5H3LA 4EF4A 1WUYA 3KR9A 3MCWA 4XYMA 3VTKA 1AHHA 2R8BA 3MCTA 2Q6LA 1CETA 4FGKA 3ITDA 3K0AA 2I22A 3TH5A 2RH4A 2BH9A 4LXTA 2G80A 4MQFA 4Q6BA 1W4BA 4Q9KA 5F51A 3WI7A 5BYBA 1YR8A 2DBRA 1CWUA 4WXPA 1K7CA 1X87A 2YV4A 4ETWA 2IIVA 5DTRA 1KSFX 4ND5A 1OZGA 4WLUA 2E4VA 4XYEA 1KDRA 2R6AA 1M73E 3ZOKA 3ICCA 4ZZ0A 4NR0A 421PA 1FVOA 1UOOA 3G88A 1KL7A 3AQIA 4RTSA 3BORA 2W2PA 3EXHB 5DNEA 5ALQA 3MPUA 1KK2A 4NIMA 3KKMA 4P5PA 3V4FA 2Y99A 4PU0A 4M22A 1MO6A 4R8RA 1BXGA 2G25A 1LC3A 1RYDA 2PX3A 4O4JA 3OIWA 3IDAA 2OEPA 3TIXB 2IV3A 4RE6A 4RH0A 2CGEA 4LOIA 4O0LA 2D1RA 1MEOA 2SKEA 1NPTO 4L57A 4M8NE 4DZTA 1R12A 2AL7A 3N2GB 1KEKA 1LLUA 5CVCA 1CQIA 3R20A 4G36A 4Q21A 3V7YA 2WIFA 3M1IA 3WJAA 4BIIA 5HW0A 3BERA 4MW9A 1H3EA 1VJ0A 1WXHA 2RGGA 4DAEA 1AOXA 3CLTD 2OHXA 4Z7JA 1QS0B 1HLFA 3PXXA 4YAFA 2NVUB 5HM8A 3RTBA 1UKBA 2VP5A 5KDOA 4WD3A 4BTEA 2POQX 3GN2A 2A4MA 2WUWE 3U62A 3IAUA 1D3AA 4A03A 1CUHA 1XP5A 3IQEA 3NWBA 4W8HA 3WIVA 3D7LA 1DEAA 1NYRA 2YRXA 3R3XA 4UBJA 3AF2A 3WB0A 3GJ4A 3S28A 1EFHA 4J0JA 1VXRA 3AI7A 2A6PA 4L02A 4X00A 3T7RA 3GX1A 1Z28A 2VA9A 1IZ7A 3RAFC 1AU9A 2XMBA 3C39A 2H65A 5HCIA 4CEHB 4J16A 2RHOA 2ZIFA 6NULA 5K3AA 1QTIA 2BCJQ 1SXJE 1JBQA 1EX7A 3PFCA 3QWFA 3UB2A 4E0BA 4X1OA 3BM5A 3LGAA 5LXTF 2PL3A 1D2MA 1J5EB 4O5AA 4BX0A 4JGGA 2P0AA 5CT9A 1XWFA 5EP1A 1YB4A 4FYVA 4B2IA 4BXOA 1BCRB 1V3UA 5H16A 1R50A 3PEFA 1YDGA 4EEZA 4BNUA 2ZDHA 3IQDB 1AHNA 4KR9A 2OFXA 1UK8A 4NRDA 4X93A 2IS4A 1R6XA 4LRXA 2QUIA 4CM8B 1T2NA 4K3UA 1Y3AA 3H2BA 1L4HA 2PX0A 4G3XA 2HQRA 1B6GA 1OGJA 4DA4A 2IXFA 4AJOA 3Q7TA 2Q28A 3DFUA 5DM70 3EMDA 3OEHA 4UVDA 3C3JA 2G4VA 1QORA 4YJFA 3EZGA 4WZBB 4QAJA 5KHAA 5JADA 5JSZB 1QYWA 4YAIA 2OQIA 1JAIA 4I9UA 3WKAA 4E4YA 1QV6A 1G3MA 2BMWA 3LH5A 2HA4A 5BQXA 3OFNA 4MP3A 2XF8A 4G84A 4EABA 4F92B 1PJZA 4DNOA 3UTCA 2D5IA 1E6CA 3VBEA 3CC8A 2AFIB 5EP3A 1NF2A 4UM8B 4Z2AA 3H4VA 1KI2A 2GAAA 1T1SA 1HL3A 1IXKA 2VT2A 1O08A 1E2LA 1U28C 1TJNA 2ZG6A 3LWDA 3LKVA 1WSWA 2O2IA 1VHTA 4K0KB 1EDBA 3NKVA 1I32A 1H4QA 2HB6A 4QU9A 3EN0A 5FBZA 4O2AA 1HK7A 2NU8B 2CJPA 4P2BA 3TLJA 4A2QA 2JJYA 1FDOA 2CCJA 3BMOB 4PYOA 4HXFB 1NW3A 2HNKA 2I1WA 1SOMA 1T9ZA 1RWVA 1VC2A 2PH5A 1NVAA 2QR2A 2V7QA 2VDJA 3L1VA 4FNAA 2O8BA 2G1UA 2P7HA 2YYYA 4FXOA 2Z0MA 2ZIXB 3FKQA 2IUFA 1EX1A 1UBHS 4ROTA 4TL7A 2ZRHA 2C4TA 4LI3X 4L07A 4WJZA 4XWTA 1NVMB 1XTKA 3ZI0A 3BE4A 5LKRA 5JECA 1H9AA 4GC5A 3PSHA 4MCIA 1YH3A 1Q77A 5D3ZA 2P4HX 1E5VA 3N75A 3VNVA 3HDJA 3HGTA 1KVSA 4AZ0B 5ITSA 4NY1A 4QU5A 4OLAA 1MOPA 4H6VA 1L8OA 4AYXA 2XCQA 5L7WA 4NPHA 2DR2A 5CLQA 1YB7A 1QVVA 4TSFA 1BFDA 3WK4A 3HB5X 1NW9B 1ULTA 4IO0A 4XGNA 4B6OA 4EF6A 5CITA 3OO0A 2FDXA 5CFRA 1B26A 1C2TA 4LRUA 4J0KA 4F4DA 1HLGA 4FFLA 1II8B 1DO8A 4QOEA 2DUJA 5DIZA 4DJJA 3ACBA 5BP7A 4PG5A 4MVJE 1RLMA 3KUDA 1RBMA 4OHFA 4RPCA 2YOFA 1FX0B 2ENWA 3QJ5A 4HH1A 2WFMA 2BKLA 4P4TA 4FCCA 4IG9A 1JYSA 2IHBA 3IBGA 1OA0A 1Y7IA 1T2EA 2A58A 4FNGA 4MR8B 4BPBA 1BA3A 3WRWA 3DYIA 4HDKA 2B37A 3B8EA 3IMKA 5A3JA 4RCZA 1ZBDA 4JBHA 4QX6A 3CPEA 5FOSA 1C3LA 1GRVA 2BFDB 1RW4A 4KW7A 5CW1A 1CDOA 3NASA 2BEWB 4Z0HO 4YAUA 5E6SA 3RIHA 2DHQA 1E1NA 4JL8A 1DO0A 1YVUA 5I3ZA 4TZ6A 4OX9B 1ACJA 3GPDG 3FR7A 1MA0A 3WRYC 4BLQA 1GU7A 2IEBA 2OGUA 5JRZA 4DR2B 4LDNA 4C76A 3OPYI 5LQRA 3GGPA 3IQXA 1IRIA 4GP9A 1TTPB 2KHZA 1OI2A 5A71A 4LKRA 4ZYZA 3ICEA 3LX5A 3H19A 4YPVA 4OM7A 4X65B 1BNCA 1GA4A 3K35A 4S1OA 5F5LA 1SXPA 4GQAA 1ZOPA 2IU0A 3ENKA 3H3FA 3GG2A 1NQXA 3T3DA 4QNNA 3M6XA 2FWPA 4FB4A 2Q2NA 5DM0A 3IMCA 3HO1A 1Z6QA 1YB1A 4Q4CA 1WXQA 3FFWA 2EIXA 3GZ4A 2I2AA 3IP7A 1A4XA 1XB2A 2AEJA 2BP7A 1MO2A 3TRDA 5G0TA 2Q0XA 1BJTA 3C45A 4QOSA 4FCVA 1QFZA 5H82A 5JYDA 2VHXA 2C7PA 1EEHA 1ZHHA 1OWNA 1BG6A 3ISVA 3AHJA 3OPYB 4HDNB 2QTVB 2QTZA 2XUOA 3K05A 4TZKA 4N41A 1Z12A 3NBXX 3ZE2B 1UEIA 4TN1A 2R1ZA 2Z2ZA 3UJNA 3UW3A 3SGLA 2O6LA 4QUHA 4BN0A 1JYFA 3RVRA 1QF9A 4K86A 5J23A 3NT4A 5HEKA 4MB6A 1U4NA 3GLIA 4K9SA 4MWOA 2HKIA 2O7NA 3K5WA 4ARUA 4M0DA 1KYXA 1ZY2A 4LTDA 5L4SA 4Z4GA 5KCMA 4YP5A 1GPJA 4URVR 2RK4A 3IQIX 5FLEX 3HKEB 5THXA 3SLKA 2X23A 4ZVMA 3ESRA 5IM5A 2O8DA 3MTEA 1WPRA 1U0FA 5KNDD 4MYUA 4ZQEA 2RFLA 1VHDA 1N0UA 1L5HB 4P4NA 1E5XA 2HSGA 3OFKA 1DPGA 1CVLA 1JIIA 3GG9A 1YU6A 1GT91 4INJA 2OGSA 1ZIOA 2BZGA 2R84A 4Y2SA 2HLNA 3EIHA 3L82B 4Q0MA 1BWQA 1C7RA 3HQ4O 4R1UA 2BEJA 4BRSA 3LA8A 5HZHA 2BIFA 3NNSA 1R88A 3R1IA 4DMUB 3KZCA 3R74A 3GUVA 1H2WA 2H1WA 721PA 1U2RA 3DFIA 2NO7A 1IPEA 1SBQA 2ACKA 1T6ZA 2E5WA 1OLSA 2Q50A 1H5UA 4XI9A 4CKYA 9GPBA 2Q5FA 2RMKA 3D3EA 2VJAA 1V47A 3MGCA 1WMEA 3PL5A 4JP3A 2BFOA 3JSXA 3AR8A 5TPZD 4HWGA 1ZI6A 3CNNA 3I3SR 3IT1A 4B6GA 5EWJA 5K8VA 4HH3C 2R6ZA 4BDTA 1DAGA 1E7SA 3TI9A 1ULBA 5JEEA 1Y1PA 3AM5A 3C5HA 3GJ6A 4H3HB 3PNSA 3QVVA 2D7JA 4LJ9A 5DX0A 4TVSA 4L4XA 4LMBA 3RF6A 1UQRA 5JANA 4NNPA 2GM9A 5KWEA 5D5HA 2BHRA 1ANKA 4EI9A 4UCWA 5EUCA 3K7EA 4GHWA 2DWCA 1Y3IA 4QUJA 1KGSA 3U4GA 4P3KA 3E9RA 4FCWA 5D84A 1JUDA 5K3FB 3EXIA 3DDHA 2GERA 4BUJA 3BMNA 3QW4B 3AWIA 5AMXA 2JFVA 5E9JA 3RR2A 3R7DA 3SR0A 1TM3E 1CRWG 2GHIA 5CURA 3RNLA 2Q6TA 3WDMA 1GQSA 2QZ9A 4HHEA 2AMYA 4HN9A 2C20A 5A7HA 2RAUA 1MC8A 2CNLA 2GPSA 3IUPA 3P2EA 5DHTA 3NWEA 1XU4A 3NHUA 1AQLA 5CLJA 4IXTA 2GZDA 4XGQA 2NZJA 2WKRA 2X5NA 3W5JA 3AB7A 4PCVA 1UPFA 4ZHQA 1PJCA 1DKMA 3DW3X 3DEYX 4IGIA 4XWGA 5CXXA 2WTAA 4LSGA 2GA8A 2ZETA 3T1YB 1PLLA 3D8UA 4B7AA 5BSHA 2PUWA 2W93A 3HJHA 2JEZA 4RA9B 3SIXA 1E2HA 2IPMA 2BI7A 2WT4A 4DSAA 1TE2A 2ZCUA 3AKYA 4R3NA 5COAA 4X85A 4KR0A 4RESA 4I50F 2PA3A 3AB8A 4LXQA 4OKIA 3ZY6A 2C3UA 3I9OA 4DDKA 3R3YA 1QRUA 1IPHA 3LZDA 3OU2A 1KQGA 1TCBA 3GRKA 4A36A 3ASZA 2I7CA 3K1AB 3WE7A 1WDTA 1KPGA 3LC7O 1W88B 4UEOA 3R75A 2H4WA 3LECA 1F48A 1KJ8A 1L7MA 2ZUCA 1JEQB 2PN1A 3HI6A 2I4NA 2QF7A 1FFYA 3NI2A 4GM0A 5AVUA 5JNRA 3S81A 3RVDA 2R6FA 2X8JB 1OZHA 4JXKA 4AFNA 3KX2A 5F9FA 1DXYA