3JWIA

Crystal structure analysis of the methyltransferase domain of bacterial-cthen1-cn
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
198
structure length
195
Chain Sequence
NLNQQRLGTVVAVLKSVNAKKVIDLGCGEGNLLSLLLKDKSFEQITGVDVSYSVLERAKDRLKIDRLPEMQRKRISLFQSSLVYRDKRFSGYDAATVIEVIEHLDENRLQAFEKVLFEFTRPQTVIVSTPNKEYNFHYQNLFEGNLRHRFEWTRKEFETWAVKVAEKYGYSVRFLQIGEIDDEFGSPTQMGVFTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Methyltransferase type 12
publication title Structural and biochemical insights into 2'-O-methylation at the 3'-terminal nucleotide of RNA by Hen1.
pubmed doi rcsb
source organism Clostridium thermocellum
total genus 65
structure length 195
sequence length 198
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08242 Methyltransf_12 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3jwiA00
3HCAA 3HM2A 2PX8A 5U4XA 3OZRA 2LD4A 5EG5A 3A7DA 3MAGA 1QANA 4ATNA 1RI4A 2JHCA 1G8AA 2I9KA 1FBNA 1I9GA 3PT9A 2GAFA 2IP2A 1EJ0A 1YZHA 3JWJA 1SUSA 2CL5A 3ERCA 2QE6A 5EEGA 5EEHA 4IKPA 3TLJA 4FP9A 1UFKA 4GOND 1MJFA 3I58A 4U7PB 3M6WA 4OA8A 5K0GA 2AOTA 4RVHA 1JTFA 1SG9A 4CKBA 4RVDA 3T7RA 2OZVA 2YTZA 2ZIFA 3I64A 1NW6A 3T0IA 4HH4A 3D2LA 1G60A 3BT7A 5LSAA 3ELWA 3FPFA 4JXJA 1IY9A 4FZVA 1XVAA 4M38A 5EOVA 4XUEA 2XVAA 5EPEA 2IH5A 1JG4A 5K8VA 2B78A 3OE4A 5GP1A 3KPYA 1XDZA 5GIOE 2FK7A 2IDJA 1XDSA 1YB2A 3LBYA 1Z3CA 5GM1A 3ANXA 2ZCJA 1FPQA 2P1DA 5GM2A 3VC2A 3G2OA 4DM3A 1JQ3A 2ERCA 3OU6A 3KPWA 3TMAA 1V39A 5DXAA 3CKKA 3UJAA 4YUXA 3REOA 3HP7A 1M6YA 5EHIA 1VP3A 5FHRA 4IWNA 2XBMA 2ZZNA 3RIEA 4PGHA 2P7HA 1AV6A 4PYKA 3G88A 4OBWA 5FWAA 1EQAA 5HILA 1XCJA 3LDUA 1SQFA 5FA8A 3LCUA 2GB4A 1I4WA 2GH1A 1NW8A 1YZ3A 2NXNA 2ZBRA 5C9ZA 4PYQA 3LDGA 3ER8A 4KDCA 3UJBA 1F38A 1QYRA 4RYLA 2B25A 3C6MA 4CKCA 5E8JA 3HEMA 4GEKA 3UZUA 5JUWA 3G5TA 5K0LA 1NW5A 4DCMA 2Z6UA 4RTKA 3HVJA 3EGEA 1AQIA 3FRIA 2C7PA 4GC5A 3HVIA 1FJXA 5FA5A 3CJRA 3HCCA 2CWWA 3QV2A 4C08A 5EZSA 3DULA 2I62A 2HNKA 5CUQA 4PYOA 1FP1D 2EX4A 3FUUA 1YFJA 3C0KA 3HCFA 5E8RA 4BP1A 5LQAA 2AN5A 1O9HA 1ZGJA 3CJQA 3ELYA 3LCCA 3O7WA 5E1BA 4MTLA 1R6AA 2NXEA 3C3PA 3LECA 3HCBA 3GU3A 4QVKA 3TOSA 2A14A 2NP7A 1L3CA 2PV0A 3UJ9A 1BC5A 3VYWA 3S68A 3IYLW 3B89A 5DM1A 5DLYA 5E1DA 4LECA 4HTFA 3EPPA 4PIPA 3TKYA 3UJ8A 3KKZA 4YV2A 3ER9A 3NVKI 1VIDA 3GCZA 4OQDA 5E2BA 3GJYA 3KQVA 5ICEA 1RJGA 9MHTA 2OB1A 4RWZA 3P9NA 4OX9Y 1BOOA 1RI5A 2BR3A 2BR5A 3CVOA 2ZZMA 1INLA 2AN4A 3LHDA 3FRHA 5K0JA 3FTFA 1JSXA 2VDWA 3EVDA 4HC4A 4R05A 3ID6C 2IFTA 4OA5A 3FYDA 1QAQA 1ZGAA 4CWAA 1O9GA 3EVEA 4A6DA 4PIMA 5K0BA 5LQJA 3MTIA 5ICFA 3GRUA 1X19A 5DRTA 2PLWA 2JHPA 5HEKA 4F86A 4PWYA 3JWGA 2N47A 2EJUA 2JJQA 3MTEA 4GUAA 5C0OE 3G2QA 3HVKA 4BLUA 3OZTA 4AUKA 4NECA 1WXXA 3UJ6A 1JSZA 1R18A 2VZ9A 2AN3A 5BW4A 5K05A 2AS0A 2BM8A 1JQEA 2YVLA 3KQWA 4RTRA 5IKMA 3KPJA 1L3IA 2HV9A 3EVCA 4X63A 2EG5A 2VDVE 3SXJA 1KR5A 2AVNA 1RJFA 4F85A 1O54A 3OE5A 3A4TA 3M4XA 1PRYA 4YUYA 2G1PA 1Y8CA 1X1DA 3JWIA 5GWXA 4BLWA 4C06A 1L3BA 3DOUA 3I5UA 3PFHA 3BZBA 1B42A 1Q0TA 3AJDA 4KWCA 3I53A 4CTKA 2OYRA 3O31A 1M0EA 8MHTA 2B2CA 5T64A 3E7PA 3BKWA 1IXKA 2OY0A 3EVBA 3KQSA 2BH2A 5HIIA 3LSTA 5ICGA 1VP9A 3HCDA 4P7KA 5EVJA 4EKIA 2PWPA 5KVAA 4RTJA 4QDKA 5EMJA 2ZVJA 3DLIA 4XUCA 5DM2A 2F8LA 2I6GA 1RJEA 2P35A 4MQ4A 1TW3A 1SKMA 3ELUA 4E2ZA 3LKZA 4A6EA 3EGIA 1U2ZA 1NW3A 1G55A 2IBSA 4UOEA 2JH9A 2AOWA 2ORED 3TR6A 3UWPA 3BXOA 3DUWA 4X1OA 5G02A 5LQUA 4WXHA 2XYQA 5T6BA 1G38A 2OB2A 3PX2A 3V8VA 1KYZA 3UJDA 4ER5A 4RSRA 3FPHA 1FP2A 4R8SA 3UBTA 5CM2Z 4PYMA 4QPPA 5K03A 2B9EA 1D2CA 2YXLA 2ZIGA 3GRRA 2QY6A 5EKXA 3B5IA 4RV9A 10MHA 2BR4A 4HRAA 2HMYB 2FK8A 1D2HA 5KQSA 2H00A 2YQZA 2R6ZA 2V74B 3GDHA 2C7QA 1NT2A 4QVGA 4IV0A 1KPHA 3CJTA 5E9WA 2YR0A 3MCZA 1RI3A 3PX3A 1NE2A 2AOUB 2AR0A 2GLUA 5K01A 3GO4A 1DCTA 2O07A 3AWIA 4HSGA 4YMGA 4M37A 2AOVA 3UA4A 4C04A 5BXYA 3OFKA 3BUSA 5HZMA 4IV8A 5DRYA 5FCDA 3EEYA 3EVZA 3KR1A 2IGTA 4CTJA 3K6RA 3BGIA 4U7TB 3HNRA 1KPIA 2QYOA 5LQKA 5EZQA 3KPVA 5D1HA 1P1CA 1KHHA 3THSA 2Z6AA 4PYNA 2PXCA 4EQZA 3DLCA 4AX8A 5E9JA 3TKAA 4CKEA 3PLAE 4KVZA 2WK1A 2HWKA 3H2BA 5P8WA 4DQ0A 3OZSA 5DTQA 1YF3A 1MHTA 1WG8A 1T43A 2PBFA 5JR3A 2IBTA 2ONYA 7MHTA 1VE3A 1EG2A 3AY0A 4E2WA 3KPUA 3TQSA 3RW9A 3DR5A 4AZVA 2R3SA 3G2PA 1UWVA 1XJ5A 5HIMA 5T67A 3FUXA 4PNEA 1XTPA 3BWMA 3Q7EA 2AZTA 3O4FA 5DTRA 5M5BA 1WS6A 1EIZA 2G70A 4GQBA 4FS8A 4X61A 3PB3A 4FSDA 3ELDA 5DTMA 3JWHA 1H1DA 4M7RA 2NP6A 3QOWA 4E2YA 3A25A 3FPGA 2P8JA 2YXEA 4WVLA 2UYHA 2KW5A 1QAMA 3GNLA 5E1OA 2GPYA 3M33A 1WXWA 3A26A 1ZHFA 3HA3A 2I7CA 2VP3A 2PY6A 3KU1A 2ZTHA 4ISCA 1VL5A 4MWZA 3DMHA 5FUBA 3UJ7A 5CVVA 2OPBA 3P9IA 3IEIA 2ZLBA 1JQDA 1VLMA 5EMKA 3CCFA 3LX6A 4PINA 5DSTA 3GIWA 2XVMA 5ICCA 3R0QA 2AVDA 3GRVA 5EHGA 5LQNA 2ZBQA 4XUDA 5DX0A 3SGLA 4DF3A 2EFJA 3F4KA 2PVCA 3DXZA 3EMBA 1L9KA 2P40A 4GBED 4Z2YA 2V7EA 2FYTA 4RTLA 3DH0A 2OXTA 2QRVB 3FYCA 3PVCA 5F2KA 1YFLA 3E23A 2FPOA 5DXJA 2O0LA 5FULA 4E70A 3UFBA 2O06A 2FCAA 2H11A 3BWYA 4GOMD 2PGXA 5H02A 5KQRA 1P39A 3A7EA 3P2EA 2G71A 3LKDA 4KDRA 1JG3A 3HA7A 3OPNA 1AF7A 3A27A 3P97A 2H1RA 4R8RA 4P7GA 5ERGB 2JG3A 1NV9A 4C03A 3M70A 2C7RA 3HTXA 3KQMA 3HA5A 3FUVA 4GOOD 1N7IA 5CVEA 3KQQA 2PWYA 2B3TA 2ZWAA 2PXXA 3G8BA 4XCXA 1NV8A 4QTTB 2CMHA 2K4MA 3DTNA 3NTVA 4PYLA 1XCLA 5FHQA 2AOTB 3DXYA 2AOXA 5DX8A 3EGVA 5IH3A 5KS2A 2OKCA 2FRXA 4ER0A 4RTQA 2FHPA 1G6Q1 1P1BA 4DMGA 4ER6A 2UZ4A 3V97A 2ZBPA 2NNWB 4E31A 2IH4A 3OU7A 4P7FA 4GOLD 4H0NA 3GWZA 3TFWA 2ZW9A 3PS9A 3FTDA 4DA4A 3GGDA 2P7IA 2GS9A 3R24A 4KIFA 5C1IA 3SMQA 5E2AA 4LWOA 3G89A 2BM9A 5EKUA 1R8XA 4P7JA 3AXTA 5KYGA 1DUSA 5LQRA 5LR6A 4Y30A 3E8SA 1M6EX 1NKVA 2ONZA 2XYVA 1SQGA 2O05A 4R6XA 3BWCA 1JG1A 2PX2A 3R3HA 2PJDA 5BP7A 5K0CA 5DPMA 1TW2A 1HNNA 5CCBA 4BY9E 3LDFA 3X0DA 2Z6QA 1JG2A 3CBGA 1R74A 3MCTA 2GA9A 4E33A 1XDUA 3AXSA 3GRYA 3B3FA 5F2OA 3P71T 3VSEA 3PFGA 4QPNA 4POOA 5LQCA 5CD1A 3LPMA 4EMSA 5HFJA 4YV1A 1ORIA 3KQTA 1X1AA 3DMGA 3FUWA 4QQNA 3KQYA 3BGDA 4YMHA 4DKJA 5F2NA 3UJCA 4AZSA 1RI2A 1VBFA 4KRGA 4PCLA 3TM5A 3LBFA 4C07A 3HCEA 3G8AA 3SVZA 3BWBA 4QQKA 2PKWA 5DWQA 3RODA 4CXMA 2ADMA 3LCVB 2P3LA 5EMLA 3C6KA 2JH8A 1EJ6A 5EMMA 3KQPA 4ER7A 2ZFUA 3MB5A 4HG2A 3UA3A 1R8YA 3L8DA 3R6TA 4KIGA 5E1MA 4V0QA 1EAMA 3TM4A 4MHTA 4B17A 2NXJA 1DL5A 3MHTA 4L7VA 3SX0A 5CVUA 1WY7A 3CC8A 2BZGA 1KIAA 3C3YA 4MIKA 1G8SA 1SUIA 3NJRA 4QTUB 4Y2HA 4EVIA 4PYJA 1AQJA 3R9XB 2ZWVA 3U81A 4C4AA 2DULA 5HIKA 5MHTA 4G56A 2OO3A 3QOXA 4DZRA 2CMGA 1ORHA 4HTFB 3TPZA 3GXOA 4AZTA 5FQNA 5DM0A 5DM4A 1BKYA 4PONA 1D2GA 2Q41A 4FR0A 5D1NA 3EVGA 3OCJA 3LGAA 1OR8A 3OU2A 2YXDA 5EQJB 2PX5A 5CVJA 5HIJA 2Y1XA 3KR0A 3M6XA 2VS1A 5BW5A 4RVGA 1RJDA 1QAOA 2AOUA 4QDJA 3CGGA 3EVFA 4YUVA 4YUWA 3IV6A 5K09A 3BGVA 5GOZA 4BP3A 3SSOA 2QM3A 2JHAA 4C05A 2ZZKA 2PX4A 3DP7A 3NDJA 1KYWA 4RTSA 1XXLA 3OFJA 5CVDA 2PT9A 3G5LA 3MQ2A 5EIFA 3P2KA 2ZIEA 1PJZA 2P41A 2ESRA 2WA1A 4EKGA 5CCXA 3DXXA 2IIPA 3T7TA 3BKXA 4LWPA 2UYQA 4PCAA 5K0FA 3FZGA 1ZKDA 2NXCA 4ZTBA 4DCGA 1KPGA 2O57A 3E05A 4OQEA 1X1BA 1P91A 3VC1A 5K0EA 1ZQ9A 4GC9A 1RI1A 1F3LA 1X1CA 3B3GA 4K6MA 3K0BA 3FTCA 1YUBA 3SR4A 2YX1A 3WSTA 4AZWA 4YUZA 4FSXA 3EVAA 2CKDA 5GIPE 2OBFA 1VPTA 3MERA 5FWDA 3Q87B 3TRKA 5FTWA 4PYIA 1NW7A 5E9QA 2PSSA 3NWEA 4FGZA 1KXZA 3SSMA 1QZZA 3HVHA 4RX1A 1HMYA 4FT2A 3B7PA 3MGGA 3SSNA 2DPMA 5DX1A 3P9KA 3EEOA 5CIYA 1Q0SA 1N2XA 2UYOA 1JR4A 4O29A 4OBXA 3P8ZA 5B1SA 1UIRA 1IM8A 4R6WA 2Y1WA 3GRZA 4X41A 3FTEA 3THRA 2NYUA 5FADA 2G72A 4ER3A 2C7OA 2PXAA 1WZNA 3NWBA 3NDIA 2ZSUA 3FPEA 5EC8A 4RTPA 3P9CA 1N7JA 3M6VA 5HOQA 3NMUF 2E5WA 5FQOA 1SVUA 4P58A 2G8NA 5EIWA 4RTNA 3FUTA 4M36A 1L1EA 2YUIA 4FT4A 4KW7A 1VQ1A 2ZULA 3KHKA 3NVMB 4PGGA 3KR2A 4BLVA 4YV0A 3KR9A 1R00A 5DSXA 3DMFA 3P2IA 5DT2A 3LL7A 4RTOA 3M6UA 1NBIA 2HR1A 1BHJA 2EJTA 3EMDA 1NBHA 3B3JA 2UYCA 3G7UA 1ZG3A 3ORHA 2IDKA 4GF5A 4X60A 2IH2A 4EK9A 2PT6A 3PTAA 3G2MA 5EGSA 4E2XA 2XYRA 3SM3A 2WA2A 3ME5A 4E30A 1JTEA 4HGZA 3KQOA 1KP9A 5K0NA 4F84A 2QRVA 1I1NA 2IPXA 1TPYA 2P3QA 3FPJA 4HGYA 4LG1A 4RVFA 4V0RA 3T7SA 4E32A 2VDUE 5GINE 3NW9A 2P3OA 4RTMA 3I9FA 3IHTA 2HTEA
chains in the Genus database with same CATH superfamily
1RRFA 3H5LA 1ECGA 2AQHA 2QVLA 3AHFA 2NZJA 3ZZTA 2HMAA 2Q5HA 3PR2B 4CM9D 3F1KA 4H35A 5H70A 3NHYA 3BHJA 4EPYA 1CP3A 2Z8YM 3B6ZA 1G5TA 1BRTA 1IOVA 3WOHA 1IN8A 5HW0A 5K0SA 1RWPA 1SB9A 4TWAA 5ADVA 5JAQA 1R5NA 1VLHA 2WIJA 3CURA 3G68A 4FP9A 1UFKA 4KE7A 3IFSA 2JRLA 1FPMA 1K7CA 1GEEA 2X7HA 5LLTA 4EFKA 1GU1A 1UPUA 4EW6A 3L7KA 1CUUA 3BK1A 2OZVA 1TMKA 2I66A 2I6FA 3BE5A 4BCBA 5A6SB 1P0PA 2AT1A 1UF9A 2ZRNA 2QW0X 4K2HA 4EBBA 3CVXA 4QU0A 5AW1A 5J4KA 3U6BA 2Z04A 3BHNA 4UARA 1BWQA 4FNOA 3TGWA 2XVAA 1M1YE 3VNSA 4ENSA 1AB5A 4IUCS 2RK4A 1NGSA 5GIOE 4CCSA 3MWEA 4UXIA 1DG1G 2MJLA 1LFAA 3F47A 2WHEA 3UENA 4DNXA 4MRRA 2E4YA 3KPWA 4NCNA 4ZQEA 2AEMA 3UJAA 3B9BA 3LBIA 1GG5A 4BFSA 1FK8A 2IU4A 3H2IA 3SF8A 1O96A 5HILA 4ISBA 4JJAA 3HB9A 1QUFA 2K7ZA 3K6JA 3Q8MA 5L4LA 1PJ2A 3L4EA 3VNVA 3NBFA 3FTQA 4NFSA 1TQ2A 3MRSA 1K7YA 1RRGA 4GPAA 1CZKA 4WBSA 1QR2A 1VKZA 1SOUA 3Q7RA 3ZW8A 3F8WA 4ZAVA 4Q1DA 2WD7A 1V1JA 1CU1A 3NVAA 2FZ4A 4MVXA 1VRCA 4Q34A 4WKPA 3RRJA 3WR5A 1U90A 2WUGA 1GGFA 1WA5A 1YC5A 3G5TA 1NW5A 4RABA 3UGQA 4C0SA 4EMUA 1G3UA 1M1NB 1RXUA 3EW7A 1GQ2A 1Q7CA 1GARA 1I3MA 4JX8A 2J0VA 1NVBA 2HRBA 5B1YA 1XOIA 2YDYA 2QZ9A 4FI3C 4HDNA 4HEA1 1E2NA 3OX4A 2CWWA 2BISA 5A0VA 2A3NA 4IIJF 3ICQB 1Z83A 3AI7A 3DOJA 2WSBA 3IJ5A 3OH8A 4ND6A 4TXMA 2CUZA 5F51A 3UT6A 4D74A 3UA4A 1QIEA 1ZMOA 1E4EA 2D1FA 2ZPTX 4BQRA 1YJXA 4OYLA 2A14A 4PANA 3L6BA 3QYJA 1SURA 1VDZA 1AO3A 4GWGA 2PRIA 4BV8A 1TT5B 1K5DA 1PQUA 1XF1A 2F43A 1W5AA 3V4RA 4AS1A 1FVFA 4UVGA 3MQFA 5JE8A 2ID4A 3BRQA 2WIDA 1P74A 3H5OA 1CY7A 2P9JA 3GT0A 3L8FA 2KYRA 4PG4A 5C31A 4BZQA 3GLQA 4W5WA 1H0KA 1ONNA 1ECJA 3S5JA 2CLSA 4O0LA 3BJZA 3CN9A 3VR0A 4GW3A 2C07A 4PX3A 1LPBB 3WLIA 2IYWA 7YASA 5ITWA 1RT9A 1FTSA 4HC4A 1H85A 1NZJA 2IFTA 1A4XA 4MI9A 4CF5A 1J4AA 3QMPA 1LW6E 3VI3B 1PG5A 4H6PA 3WZMA 2CFOA 3SLKA 3V2UA 2XRYA 4FUQA 5EQDA 1LEHA 1FDTA 3HNOA 1FTYA 1EFVA 3K32A 3IX7A 2JRCA 2EBFX 5DMHA 1WBBA 2AI1A 3D0KA 4ZRMA 1NLZA 1XTBA 4F86A 4YALA 2E89A 4NTZA 3HVKA 3TSOA 3ADPA 5BNIA 4B1FA 4QG3A 5JS8A 3PD1A 2KM1A 2VAVA 5AM3A 3P9XA 1QKIA 3HEBA 1QQAA 6ADHA 1K2VN 3HDGA 4AWXA 3J81A 4TTQA 3W7VA 2DH6A 4EJ6A 3NBMA 5KBYA 3IB6A 4C1BA 4WZAA 3QKSB 2WF5A 2IODA 3M3HA 3TLZA 3AR3A 3VH3A 4ZDJA 2BUCA 1HMPA 2XDAA 3CRMA 4ODIA 1QFZA 4MKFA 1NBOA 3RV3A 4JJ7A 5CG1A 4TMFA 3L0OA 4XQEA 2XRFA 3F3MA 3D7KA 3GFQA 4CEJB 2R6HA 2IY9A 2XMZA 3KYDB 3HBMA 4LSWA 1JHOA 1DDIA 2GZMA 4OKNA 4KQFA 4F56A 3NHBA 3GP8A 2I99A 3EJWA 5G0VA 2CYAA 1YOVA 5LQSA 2O2DA 5A3SA 2RHHA 2HTFA 4JEHA 1Z6PA 1VLLA 2W98A 3GD7A 3HJRA 3ELUA 1VECA 3OLQA 3W9UA 3OKAA 3NS7A 3WP1B 4CZ2A 3DLBA 4GKKB 4MDFA 2BFDA 4RMIA 4TVKA 3Q9NA 1JX6A 2IHVA 1CY2A 1L2TA 1QO0A 4EY7A 3RBAA 1BJRE 3S2GA 4LHSA 1ACJA 2VWQA 2XOKA 1Q11A 2VJBA 2Y1EA 3QPCA 2X9GA 4Z3DA 1OE0A 1WR8A 3VO9A 3R5KA 4HZUA 4A16A 3KUUA 2J08A 4RSRA 3VJRA 2BDTA 3EEFA 4MRPA 3OE1A 3OTQA 3TLCA 4PX9A 4URXR 4CM8A 1A95A 2L18A 3E82A 1DZ3A 1WZIA 5B1EA 2B5WA 3GDHA 5T3YA 3ZE9A 1E9CA 1UOPA 2WFMA 4IMPA 4MCIA 3QKRB 4NENB 3RVQA 4NULA 3HKDA 1XA0A 1RI3A 3VV2A 2HF2A 1C7FA 3RTBA 2FSIA 2QI9F 3WAKA 1DCTA 1T1SA 3AWIA 1Y3FE 2QLLA 2XMBA 3LOQA 3UMBA 1IXYA 2VEOA 1RVDA 2R9VA 3ZJ4A 2V8OA 1U11A 3EEBA 4NCJA 5H68A 3U13A 2OHFA 4NOKA 2IW1A 1EDEA 1NOIA 1SUWA 2JGEA 3L0DA 4JIGA 4MRSA 3THSA 5A6SA 1RC8A 5KNBA 1PTJC 1JDBB 4GGOA 4Y7DA 3SR0A 1LQTA 3F98A 1KGDA 3FMGA 3OQ6A 1HK7A 1MHTA 1FXUA 1H0SA 2PBFA 1UDRA 4DSNA 1AKNA 3ICVA 1HEUA 1VJRA 2X0DA 5BQPA 3L46A 3REGA 4D92A 2HFJA 1EDBA 4BFCA 1USIA 3I1YA 5T67A 5H8WA 3ZOZA 4AYXA 3EGXB 2VQ6A 4P3YA 5D3MB 2EWWA 1MN6A 4OQZA 3PC6A 3R7BA 3WRYA 1WMDA 3HL0A 3P26A 1TFUA 4YREA 1SVOA 2JHFA 2YQ4A 4UTNA 5AVYA 1SKAA 4KO8A 4I55F 1FYWA 1OSNA 4JOQA 3WA6A 3HK2A 2YXEA 3TB4A 5HHTA 4MVJG 1ONSA 2NSDA 3VNAA 1M9NA 2Z4TA 3EVTA 3MJDA 2UZ1A 4G9GA 3LUDA 1SBTA 5K4GA 3GLGB 2IW3A 4DJAA 4DR1B 3ACCA 3NI2A 1VPLA 4I1SA 1D4ZA 5AW9A 4EZEA 1W36B 1VL5A 3SEAA 3WBKA 2BMAA 4BGIA 3PQCA 2P9CA 3LK7A 2LUOA 3PUIA 5CT8A 4KQCA 5L45A 3C6BA 1JIIA 3N8NA 4JA2A 4G5XA 2MHCA 1VLMA 5CFRA 4RZUA 3PHCA 3ORRA 3B1WA 1M1NA 5KVSA 2G63A 4NONA 3GN2A 3PXDA 4RKEA 5YASA 3T7TA 3UXEA 3M82A 1W29A 4QNMA 4EEXA 1MHPA 2K2QB 3SJ7A 2BMWA 4EL5A 1JUDA 2FLVA 2JLCA 4XR4A 5CBPA 2KWIA 1L9KA 1NQOA 4WESB 1EEHA 4HX9A 1WF3A 4U7WA 2OD2A 4OXRA 4EABA 3QPUA 2A9FA 3TTTA 3FYCA 1I4OA 3OJWA 2H4JA 3JR7A 3K20A 4PO9A 2O0LA 3X43A 2CW5A 2I78A 2GM3A 1PZEA 2FLKA 2ICAA 2PZAA 3K5HA 1FDRA 5ECYA 1MH1A 3OE7A 5BNFA 2IWHA 1PR0A 3P97A 3DVSX 1TT5A 2D2VA 3W5BA 4KMOA 4GDMA 2C84A 1VKRA 3BCSA 121PA 1ZIOA 2VHXA 3LW7A 4LF7B 1X87A 3H0EA 1BO6A 5DHFA 2VP9A 2PXXA 3NYIA 1JA9A 3G9QA 3WB2A 1P31A 3F7TA 4P2GA 1GN9A 2K4MA 2LNDA 3AM4A 3HU5A 4D6XA 1FNCA 4DCJA 4ZQIA 3Q9SA 5I47A 1B73A 3DXYA 5SY4A 1U4SA 2DOKA 3D6NB 3D2BA 2C96A 5DNAA 4ER0A 4ESOA 1TC1A 2ONCA 1N36B 4GT1A 1KFJB 1KNXA 1SXJC 1EZ1A 2DWOA 3CYFA 1HDEA 2G6TA 4MA0A 1XRLA 4N8EA 4I1IA 3UXMA 3WL7A 5DHRA 3WNBA 1WB9A 1J2JA 4F38A 5JDCA 1U81A 3ON5A 1F0PA 2E6UX 4LI3X 3I92A 1XD2B 3GY0A 1A1SA 1OZGA 4NDAA 3K31A 4A36A 3KB6A 1V3VA 1Z0UA 1G41A 4X3CA 3RIMA 3O38A 3VDNB 1BEEA 3ENNA 1KI7A 5SV2A 1XMJA 3ZNNA 3RAGA 3PEUA 4Y2XA 4CQMD 2C5BA 1RNLA 1QOQB 3BEOA 1J8FA 1DINA 4B3JA 2Q5FA 1WSBA 3NZEA 2JIDA 3BORA 5DLDA 4Q7QA 5A5DA 2FRDC 4FXPA 4YPFA 2R4TA 3G3EA 2GA9A 4L8VA 3T5DA 3EE6A 1AMUA 3IPLA 3NOOA 1P2UA 2ZJ1A 2HCTA 3LY7A 4N5NA 5AKIA 3B85A 4KOEC 2HQRA 1RLOA 5LQCA 3ZYCA 4OK5A 1ORIA 4C88A 4EO4A 3AUTA 4RA6B 4YO8A 4L02A 1K4KA 4ZYTA 4CEJA 3WGIA 2QV7A 3KYDA 1SD1A 1E18A 1RJ9A 4ZYXA 2WPDA 2XTZA 3RASA 5KOHB 5MF6A 2WTNA 3MMNA 1XCOA 3SHFA 2AG5A 1EFPB 4P6VF 3AG6A 5LQDA 2GEKA 5DWQA 5CXXA 3WLFA 3PDIA 1ODCA 4PN7A 3VYRB 2R7MA 2YY5A 2YS7A 3EUEA 1N2ZA 4DLSA 3ZS9A 3QU7A 4DV4B 2NW6A 3CRVA 1K89A 2B4RO 4OREX 4WTOA 1WXFA 1X70A 2ZFUA 3G1WA 4FSHA 1X74A 2BKAA 4MPPA 3N2YA 4M1MA 3AVYA 2FMIA 1GAWA 1R2QA 1WVGA 3GFGA 1V35A 4B0PA 3IXQA 1QB8A 1XZBA 4M0FA 3VR6D 3VSDA 5KB3A 2XCSB 5B1DA 1KIAA 1AJEA 4W63A 1J7JA 2ENWA 3I6MA 3DDSA 4RPLA 5CFOA 1ZLYA 3T3EA 2FR0A 4RJ2A 4V1CB 4RK1A 3Q6NA 5K8IA 3MTDA 3KTDA 1D2NA 1ZD8A 2I9PA 2QN8A 2CVZA 3FVTA 2XCUA 3F3KA 4M0EA 2KSQA 1YL7A 1QS0A 1ILEA 2J0QA 1HEIA 5F7XA 4WXEA 2HLNA 4OGLA 3FHOA 3G8DA 4NENA 4P1ZA 1JZSA 4DWJA 3UAZA 2D1RA 3IBYA 2HSWA 4RMHA 3IQDB 4PXSA 4RH0A 1T2EA 4GAEA 5FFNA 5GOZA 2GBIA 2F1KA 2QM3A 3LPDA 4B8YA 5AH0A 1WZ2A 3E5HA 3CV3A 2HJ9A 3DGFC 3MN1A 1SUEA 1VYTA 2PT9A 1E2UA 2F90A 4U3JB 4BQEA 2O8EB 2J7PA 3RF6A 4TTSA 4OU5A 4BNFA 4Q82A 2HRZA 1X8LA 4GEGA 1PJTA 3A1WA 3H2HA 2I6UA 1IWOA 3HFRA 2AK2A 2OZKA 4RDHA 1UEIA 4FJ0A 5C8XA 1I4LD 3LUGA 3IVMA 1NTRA 1RJWA 3D6AA 1KK1A 1N6HA 4FSXA 2QT1A 3FWPA 1EX1A 2QVCA 3MERA 3URKA 4DZZA 1FFYA 1P8JA 4G9EA 1EP9A 1FMFA 3GFOA 3C3DA 1P1RA 1RQ2A 3D3NA 4I8IA 2UXBB 5DHUA 4H1TA 3EGXA 3EDRA 3WE7A 1TE2A 4H7FA 5LB2A 3D6MA 3E7DA 3TRJA 5AXDA 3LL4A 4F1KA 2AXQA 1SC3A 1EVIA 2VCHA 3L1UA 5HF9A 5CYGA 3GEGA 5ECGC 3IAFA 1UR5A 4G4JA 4K1XA 3L7CA 4HAOA 4UBMA 1KWKA 1Y1QA 1P4JA 4MK4A 2PQ2A 2DHDA 1NI3A 1MO6A 2HT1A 2PGJA 3D0RA 1PFKA 4I5FA 3VYTB 3B5EA 4ER3A 4R2XA 4LGCA 3GLGA 1DEHA 3DKRA 1PJRA 1IY2A 1XYGA 3M7IA 4G8DA 3BXGA 2FQ1A 4R3NA 3RYFB 5I9LA 3Q2OA 1TB4A 2N1BA 3ZWNA 4BLVA 5F3RA 1X1SA 2QZPA 3NWJA 4CHTA 1J56A 3KR9A 1UQRA 2AG6A 4KZKA 5A6VA 1UH5A 4G4GA 1H6BA 1BHJA 1PV1A 2AI2A 2GEUA 1FX0B 2WMYA 2YNMC 1JDNA 3B3JA 2J5QA 2GYVA 3UMMA 4UDOA 3ZE0B 1G5QA 1W0KD 3G2MA 3G17A 3PSHA 1LPOA 2MSDB 3HDJA 4PQFA 4UVEA 4WESA 3AL3A 4JNKA 2VDKB 5MFZA 3Q8KA 1DHRA 4EW2A 1T5SA 1X39A 4R71A 1DOZA 1W30A 1KMNA 2ZVDA 3RUDA 4B7CA 3LUFA 4Z1MA 4J91A 3D4OA 5IJ0B 2JARA 1ZM2A 4I4CA 3BE6A 4YX9A 4M9UA 2J33A 1BVHA 4JKYA 3H87A 2CK3D 2RKOA 2DBVO 2FEPA 4J16A 5EG5A 3L7MA 1BWRA 3L8HA 3UKDA 2RHDA 1T9ZA 4FHFA 4RIFA 4WFKA 5EJAA 3DP9A 4KEAA 4X94A 4HLCA 1K5PA 1NLUA 4HK4A 4AKEA 1B3BA 1SCBA 3U3OA 1ODIA 1IL0A 1JHVA 3A6PC 2VRCA 3ZBQA 4OOFA 3TBKA 1EE9A 5BN5A 3IPYA 2K6GA 3HFGA 1UAAA 4F71A 3EZ9A 2ZBDA 4HH4A 4TYWA 3D2LA 1G60A 4CDGA 3VOBA 4CKEB 2O9JA 3U5ZB 4X1IB 3F5SA 1T8UA 1L5HA 3MJCA 3FPFA 1OVGA 2FY8A 1U2PA 2JF0A 4IP0A 3PZRA 1K06A 2WWTA 5EOVA 4C0LA 1RACA 2W2TA 5BV0A 1SG0A 1JFVA 3KPYA 4V1CI 4MVCA 1P1KA 2R1VB 3EUAA 3SOZA 2KE5A 2E4UA 1JEYB 3FPAA 1HTBA 3IP9A 3NM5A 1EHCA 5CFLA 2ZPUA 3QTBA 2IIQA 2QN7A 3D7LA 2CNLA 1N5DA 3W2TA 5DISB 1ACLA 3ZHUA 1ZI9A 1E3LA 3ONFA 4XYLA 1TYBE 4FMDB 5EL0A 4Y9RA 2CV0A 4OBWA 5JS1A 5ES3A 3ECAA 1HE8B 1B16A 3ET4A 4UTRA 2M6RA 3IHWA 2ZRMA 3NHKA 1FNDA 1KRHA 2HPVA 5C9ZA 1RE0A 2H0AA 4GO1A 3C3JA 5CYFA 3IKLA 4JEIA 1BDIA 3PUXA 1DOHA 2B25A 3C6MA 3LRPA 4WXYB 1W7AA 3HZHA 4GYKA 5BWNA 4L28A 5KOHA 2UUCB 2F3QA 1W75A 2R68A 3DOOA 4GEKA 4EG4A 1U28C 1EFPA 4PBTA 3JVVA 2C42A 2P62A 1QHGA 3JY6A 3EGEA 3KT8A 4L8GA 3A6KA 5F76A 2CC2A 3DEJA 4KWTA 1EVEA 3F5MA 4RDXA 2RHJA 1GKKA 4ZREA 3ZCXA 1P81A 4YCSA 3PXXA 4MLZA 2BTOA 4CIXA 4MB0A 2DP4E 4UAGA 1UPXA 4OFXA 2HNKA 1PNQA 1UADA 2Y9MB 5EN4A 5AXCA 2D5BA 3GJ3A 4G0OA 4NK4A 1WJGA 2IBTA 3C3PA 3CRQA 3VUEA 4C6TB 3OJ0A 1QFJA 1T9CA 4ZGBA 4V1CA 1Z6GA 1TLLA 1KEZA 1CVRA 4V2UA 3UJ9A 3WJ2A 4AF6A 4CR7A 5IG2A 1QHNA 1MJGA 1GGKA 3WGVA 2ET6A 5DLYA 5IZCC 2P2DA 3KAPA 4C2UA 4ZI5A 4MWEA 1RZUA 4N7MA 5KPJA 3WMEA 1G64A 4PAGA 1B6SA 2BGKA 3GH1A 3UJPA 1UKCA 4KMRA 2RGRA 3D8BA 4JH0A 3SBEA 3AL0C 2P9GA 3MG9A 3DEYX 8AT1A 4FYXA 1JAZA 2GEDA 5E4YA 2GXQA 2B4TO 3V48A 3N0RA 1GU0A 2W58A 5I8ZA 1E2DA 1TQ6A 1YD7A 4AJHA 4EUEA 4U3JA 2O8EA 4QYIA 1JH8A 4C3UA 1O9GA 4NBKA 1Y3AA 3GDWA 4I0WB 5ECWA 3QI7A 4J9UE 2N0SA 3AJ9A 1UM9A 2UUOA 4FIDA 1AUOA 4X7MA 2IDMA 2X0IA 3JASB 4TV9B 3A3KA 3PNQA 3QYAA 1EWQA 6GPBA 4A15A 3MT7A 3OJOA 3EYAA 5EYPB 3ZJTA 1SBQA 1CVIA 1TM5E 2HU5A 1UK9A 3AF3A 4RD6A 3NHPA 3WWDA 4XPIB 4EHDA 1KDZA 1RXEA 3PHGA 1Z9BA 4H6WA 4H6VA 3KPJA 3GFSA 2WTXA 1KR5A 1EK6A 2CCKA 4N6GA 4YAOA 5AOBA 5BVHB 3NHFA 4MYDA 3AV3A 1II0A 1E1CB 4BJ1A 3JWIA 4V0NA 4C06A 3T9DA 2GJKA 1L4YA 2OLEA 3N6RA 3FKJA 3RLFA 3CKLA 5B5SA 2PDAA 3Q7PA 2VQ3A 3UAGA 5JQWA 2EZ9A 4DTIA 4CTKA 4J4TA 4M1EA 3BF8A 5TE9A 1JLMA 2HK6A 1UZUA 3DYBA 3IBGA 1U0TA 4MAMA 3HCDA 3OF2A 4XOIA 3G1TA 5AUNB 4HGPA 2H5LA 5H5JA 3TOCA 2XB8A 4LAFA 4OI4A 1QCDA 1YK1A 2F8LA 3MUFA 4QBGB 2UYYA 3DKKA 3RYFA 5AVZA 4GI2A 4YPVA 1PL7A 1XROA 5DCYA 4AJ1A 2ZRFA 1AA9A 2YINC 4G3XA 2J6BA 1FX0A 5JV5A 3AESB 3IL2A 4JC4A 1Y5LA 1G55A 4OQMA 1FNBA 3ZV4A 4OAPA 1FYXA 3AI2A 4GNRA 2AR7A 1EWVA 4DUZB 2ZM5A 5DM70 3M5CA 4WXHA 5FTLA 5BUCA 3ZWYA 4W9MC 1JBKA 1EFAA 1QCYA 5A1JA 1KXJA 1OREA 3HXPA 3JWPA 3BXZA 4FEGA 3TZKA 3TLKA 4R3UC 3R0VA 4X7PA 5IJ0A 1X7GA 3SN6A 2TMGA 3KKOA 4OHUA 2ZU0C 3QPAA 5K0TA 1D2HA 3FB1A 1TRKA 2BE7A 2H00A 2VYVD 3CLHA 5DBFA 3WIBA 2V7PA 4P4UA 4F1JA 4X65B 2JD0A 3CJTA 5E0OA 3R4VA 2VSQA 4HQNA 4UEQA 1VPEA 1PNOA 1HO3A 1UBHS 1V37A 2XUKA 3FH0A 2Q1UA 2O07A 2O2HA 1CW2B 3DMRA 3KB8A 3SIXA 2VF2A 4PZZA 3OFKA 1TCAA 2XVXA 2GCEA 2XXJA 3DSRA 3LBNA 4RV4A 5EAIA 3KR1A 3RSLA 3CNQS 3RS7A 1A5SB 2EFCB 4I9NA 4MCHA 3LUCA 1WXEA 1VKOA 1QIJA 3DBRB 5ALTA 5E3HA 2VHEA 4PYRA 4AB1A 1KI2A 4IDBA 3CKYA 3K0CC 4PYNA 4WE3A 4CKEA 4X1IA 2D2EA 4R8LA 2OLKA 3CISA 2ZWOA 1SXQA 3B12A 4P4LA 1YKFA 4FGUA 4HWSA 5B7GA 3N2KA 4HQKA 1PP4A 1PKEA 5ITZB 4L6AA 4O4HB 2R1VA 4Z51A 2IHYA 1JEYA 2AMFA 5HIMA 4YDQA 3UK7A 3EOAI 3Q7EA 2I8AA 5M5BA 5AIBA 2DUUA 3A2LA 3U4CA 1CJUC 2PIAA 4AI6A 2EV9A 3HUUA 1S3SA 3S3TA 2AKEA 1YGYA 3C4VA 3EG9B 1HE1C 4X1YB 8GPBA 5BV8A 4JLBA 1XAIA 3FPGA 4YMSA 1Q1EA 2G5TA 2GFHA 1TA9A 4D02A 3CVVA 1FFSA 1X14A 3E81A 2M98A 5AVWA 4Q4AB 5JARA 2VAPA 2E6KA 3O8BA 4E7PA 3RSSA 2VP3A 4BVHA 4AJNA 4F3YA 3KU1A 1WRBA 4DKXA 4MWZA 1AMOA 5L3RA 2ZBVA 1LLCA 1SUBA 3E1GA 4AIRA 3IEIA 2GNOA 3CCFA 5JSKA 2I76A 3UPUA 1Q3HA 2IXEA 5IBRA 2J9ZB 4CLXA 5EZYB 3C1UA 4YNBA 4LFCB 3AFMA 3N2EA 5JNWA 5JS6A 5DX0A 4DF3A 4O2RA 1BW9B 3EEQA 4F1WA 3ZX4A 5CA1B 2JIZD 3D43A 2B2NA 1SQ5A 2J0UA 3C2QA 3LWZA 5HJ7A 3QTLA 3H9UA 5D8DA 4RHYA 1M1UA 2ZUTA 5KJEA 4N76A 2RD2A 5IC4A 3JQ7A 2F17A 3E23A 2ECQA 1W19A 2ZE8A 3L9XA 4RPHA 1A8IA 1WLYA 2XGSA 4GOMD 4C6TA 3FLEA 3KAJA 1B0UA 1EINA 3IQHX 3QA3E 3CT4A 2OT3B 4PLGA 3CRZA 1OC4A 1AGYA 4IIJA 5ALQA 5KX5B 1XMPA 3BAFA 3P4UA 4TT3D 3TAHA 1FDVA 3F7NA 4LNUB 1IHOA 5WRFA 1WMFA 3MYRA 4TZ6A 4JLKA 1NKTA 1SOAA 5EXTA 1UJ5A 2QNIA 3GPDG 1XMOB 1O5TA 1VLVA 3RROA 1V8PA 3F6RA 2GEJA 2ZEJA 1XCBA 4KQJA 4B6FA 2BL4A 2YMPA 3F5DA 4LHEA 3FOBA 4A23A 2CVQA 3HN7A 4XEHA 3PJGA 4EF5A 2BMEA 3VGJA 2X5JO 3M3PA 3B5JA 2GO1A 2NNWB 4NAVA 3K73O 5CDTA 1RYHA 5FOSA 3LLCA 2QE7D 4TRRA 3TFWA 3BIFA 2R5FA 3SMQA 2IYUA 3QEBZ 2QTGA 4S2UA 3MTBA 3G89A 1DGQA 1KDRA 3PT5A 4TV9A 3F6BX 4FS3A 4ARSA 3KC2A 3T7EA 3PFBA 4CODB 4BNHA 4HL6A 2AFRA 4Y30A 4MW0A 5EYPA 2ONZA 3QEKA 4WAUA 5AMXA 3KKKA 1CT9A 4XPIA 2MMGA 4KE6A 2V3VA 3PNKA 4DMHA 1NAHA 3E58A 4PZUA 1JYSA 3PFFA 4OQ4A 3I30X 3GMDA 4RO0A 4EG5A 3LXMA 5FBLB 2DWPA 2HJSA 2MSEB 3X0DA 4J4HA 2I91A 3ZHRA 3IIJA 2WTEA 3ZW9A 2BGGA 3K2IA 1E1CA 2IU6A 3AVUA 3ANTA 4JBNA 1N75A 2B61A 4IDCA 4CMIB 1UWLA 4DCUA 3KWJA 3LPMA 4MAAA 3SLGA 4EMSA 1M34B 4R98A 1K92A 2AN9A 4KYIB 1S6YA 4RSMA 2AJCA 3PXAA 3HBNA 3KP1A 4K9NA 3FOWA 1PVOA 1JMYA 1N1GA 4ALLA 3KKMA 4A8JB 4C07A 1J7KA 1UZMA 1MT0A 3RT9A 4KQMA 4MGEA 2IEDA 4B33A 1PN3A 1U94A 1UKYA 1GDTA 4WFJA 2VBGA 2QDKA 4EECA 1L5WA 2DTXA 2RE8A 4NBRA 3KQPA 3H83A 4L3OA 4BWYA 4ZI3A 1MQSA 2PS1A 1HA3A 1WV1A 2HJHA 2HMSA 3WBBA 2ZK7A 4B2IA 3SP1A 3AESA 3BRWD 3MGCA 3WS7A 1S2IA 3WYGA 3R6WA 4NAUA 2VZ0A 4I9HA 1CUYA 2BZGA 4MIKA 4JQCA 2X40A 1E94E 2VDLB 3KT6A 2GWHA 3L6RA 3HNPA 4QTUB 2NU6B 4Z99A 4F9EA 2NV0A 5BXQC 2AA3A 3KTOA 3AYXB 4LE2A 2UXDB 2H92A 2CYCA 3C14C 3QIVA 5G40A 2CMGA 1TGVA 1NJFA 1T6NA 3BJEA 3FWZA 4DA0A 1DTEA 5ALXA 1K8YB 3ZJYA 1YB6A 1U8UA 3DAPA 1O57A 4L95C 1JLSA 1RBQA 3EVGA 3OU2A 3PQ5A 4I1RA 4P3PA 1Z2EA 1PR2A 3VOTA 1RHQA 3TD2A 2OO5A 2QXTA 2FDCA 1RAFA 4U2DA 4BCDA 1NJ2A 4FVTA 4HATA 3RADC 2VLIA 4Q3EA 2V65A 4AJ4A 2W4IA 3B2EA 2BF4A 3SSOA 4DV5B 2DBRA 3BRCA 3T9EA 4CV1A 1NBMA 2A5FA 4C2AA 3HKEB 4XSVA 5KNBH 4QNRA 1E92A 1PT9A 3IELA 5H83A 3U4DA 2RGUA 4HO1X 4MVJD 3BH6A 4DN6A 1I33A 4J7UA 2YV1A 2VJYA 3DBRA 3H6GA 2FN4A 5J4VA 2DJ5A 3RC3A 5BSHA 3DOCA 4RSGA 4DQKA 4C4YA 3B2QA 4M1YA 4WLFA 4XJSA 5J43A 1PS0A 3BQNB 4YAFA 3QWBA 3ZDQA 1OV4A 4KNVA 4K6MA 3B3GA 2BKXA 4Q9JA 4AN1A 4YPOA 2IDZA 3K9BA 2C58A 4OHPA 2G4CA 4XB2A 4O4HA 5GIPE 3RBVA 2FPWA 4NOMA 3RHSA 4HFMA 4ZOQI 5C5CA 4XVHA 3BTVA 3SFTA 1ZIXA 5CDGA 3FBGA 1HMYA 2X86A 3GBSA 1E9DA 2WYVA 1CJKC 1N6OA 1XJ0A 1E8DA 2XUJA 3CXRA 3NUGA 5LC1A 3SC6A 1Q19A 2Q5OA 3A9TA 5HKAA 1Q0SA 4B3SB 2I1WA 1JR4A 1U1FA 1SM4A 3EG9A 1RM4A 1YNOA 3M8KA 4YBZA 1U2GC 2HK9A 1DG9A 4N47A 4P9NA 2ONJA 1Z08A 2WVGA 3IE1A 5BWOA 4QO8A 2X6QA 1GXSB 1JECA 1OXVA 2PNFA 5KJ1A 1ZD5A 2RG7A 3TPCA 3DB1A 4RTPA 2GRAA 3M6VA 4C7JA 3D4NA 1I3LA 5JMPA 4YDHB 2Z5VA 3PIDA 4YS6A 3NIGB 4I55A 5CA0A 3ACBA 4KE8A 4BASA 3IVRA 1EM8B 4LXTA 4OHWA 3C6XA 3TVTA 4N0DA 1PGOA 1RS0A 3IVCA 5KHLB 3HR8A 1W1IA 3F6CA 5CVCA 5A7HA 5JSQA 2PYDA 5SICE 2PCLA 1NNSA 1ZH4A 5EZYA 4YMUA 3TTSA 3G7UA 1BZYA 8ATCA 2BZ1A 1TEHA 1ENOA 2QGFA 3DDNA 1BW9A 4U7GA 3SYKA 3EDYA 2WWYA 4MO2A 4DR3B 3SZUA 1EX9A 1I13A 5EGSA 4CCYB 4FCTA 4DV7B 1G3QA 5IANA 3O84A 3V2HA 1N2HA 2GR9A 5JYEA 4TTVA 4ZEOA 3U19A 1HDIA 1LRKA 5FV4A 2V55B 2VRBA 3T9BA 2MYPA 1E3SA 5CB0A 2DUJA 4XQCA 3LC7O 2VBIA 1QIGA 4FX5A 3SZGA 1ULUA 1U8EA 1XD8A 1XC7A 2OO7A 5JQGF 5H59A 4QOHA 3L1VA 3MAGA 4P7BA 5JXJA 1EK2A 2I9KA 3D7RA 4KX3A 3PT9A 4UUMA 3WYAA 3BULA 3K70D 1FRZA 3ZGXA 3EZ2A 3L6UA 1JIXA 3JZMA 4HLUC 2E4XA 5EA2A 3KB2A 2D3WA 5K0GA 3R5JA 2IYLD 3L8GA 3DZGA 3R3WA 1JSRA 2PUFA 4E7OA 2FDRA 3MUEA 3HBAA 4EW3A 3E0XA 4KQ2A 1Z0DA 4IY1A 1F8XA 2RGGA 1Y5MA 3PWZA 5AK4A 4RY2A 2EATA 1HRKA 1Q1NA 1IY9A 4IYRA 1XVAA 1KH1A 1TZBA 4YRRA 1O6GA 1UM8A 2R7LA 1Z22A 2ZREA 1U9IC 4MWSA 1BRMA 2OHXA 1N6RA 3OP4A 3PF8A 2VA9A 3T7IA 4NCAA 4B2YA 1NC1A 3L92A 2CGEA 2E87A 3DW3X 2VXYA 5DGCA 3R1IA 4I3GA 4R54A 3CKKA 3RS9A 5A7FA 5CW1A 4U0JA 1MIHA 1SHKA 1Y8QB 4HAWA 4OLJA 4UM9D 2D0IA 4RPJA 5JPCA 1D9ZA 2JLRA 2F55A 2OORC 3A1EA 3KNZA 4K9KA 1DKMA 2B21A 3HPQA 2ODPA 3BMXA 3G7SA 4PR3A 1ADYA 5FA8A 3DC2A 3KTAB 3AEQB 3B2NA 4CMIA 1COZA 4IRXA 1X7DA 1SXHA 2ZRPA 4HGNA 1M34A 4HLQB 3Q8XB 3T3IA 5IJ9A 4BFZA 1CG6A 5TIIA 1OLOA 2VF7A 4KQWA 1POWA 3OUUA 1Z8DA 3PC8C 1SEPA 4YIKA 3WK6A 3N70A 1ETUA 1Y48E 3OQOA 4Y1GA 2P6PA 2PHZA 1RXYA 3AF0A 4W7IA 1F06A 4A8JA 2Q5CA 4LC9A 5AVJA 2RJOA 3HVJA 3VR1A 1FFEA 2CUTA 3HQ4O 1R0LA 2XNKA 4GIBA 2GZAA 4Y2GA 1EWKA 4LX8A 1FFBA 1KMHB 4O2AF 3BS4A 4OHRA 1DFIA 1D09A 4O08A 1Y33E 2Z4SA 3P9SA 1QYIA 4PYOA 5DFAA 2BRUA 3KZXA 5L4NA 4BNWA 3E9ZA 2VUIB 3VR3D 5LQAA 1Y81A 3CJQA 1GRVA 4PXAA 3O7WA 1M1ZA 2MMCA 1J23A 2QL9A 2NXEA 5AJZA 4ZCLA 2NU6A 1ZMXA 1RMTA 2AEEA 4U7HA 4UXJA 3UHPA 1JR6A 4BIMA 4I14A 4LN1A 4RH3A 4MW4A 4PNHA 4RJKA 2XITA 3A11A 4M1OA 3BXHA 4I4NA 1OH7A 4KXNA 4EY8A 2H57A 5EGNA 1TKRA 1DHTA 3EAGA 2J07A 4CKXA 2F3UA 3IP8A 4X8HA 3ZZ1A 5LD2C 1GPAA 1U3TA 3QELB 3JSAA 3GW8A 4WECA 4DFDA 1ENZA 3RFTA 3DDZX 4IOMA 4PIVA 1ISHA 1N8NA 1A8PA 2OR3A 3HKEA 2ZRAA 3MS7A 4UNPA 3FCAA 3U7GA 1Z63A 4IVNA 1LV8A 2AFIE 4HPJB 4XGNA 1GKYA 3AOGA 2DXIA 4PIMA 4BEBA 2CCGA 1E9EA 2DYKA 2OSBA 5ICFA 3UC5A 2GEVA 2MCFA 4F2PA 4AROA 4ZAZA 1QH0A 3HZZA 3DLHA 4GUAA 2PQ6A 1IZZA 1XVIA 3ADOA 4KWIA 4Q1VA 1JSZA 1R18A 3HB0A 3FOCA 2VC2B 4L50A 5JANA 1BKSB 2R00A 3BIOA 3MSXA 1MRNA 821PA 2IX3A 3QEJA 2HYIC 3SXJA 3DS8A 3IMGA 1VG9B 2MSCB 4TTPA 1M2HA 1Y3IA 3ZHQA 1GNQA 4JB8A 1HORA 2V45A 2BHNA 2CNWD 2R2GA 3LT5A 2W2QA 3UC9A 4J0GA 4QYWA 2P90A 4BDTA 1NOKA 1Z0ZA 3HDVA 1M2KA 1ZINA 1KAEA 2Q4DA 2YVAA 5TQ0A 3O31A 4QLBA 3OJEA 4QUIA 4BDSA 2J6HA 3O1JC 1GXSA 4KXWA 1QHIA 5BWCA 1RQRA 3SKYA 3H4VA 3CINA 3ODPA 4HUJA 5J2UB 3AHHA 5EHNA 5F4BA 1KJQA 1R9GA 2OECA 4P80A 4CMEA 4DSAA 3DCNA 5CTJA 3RT7A 5JEEA 3A3PA 4XTCS 4LF9B 1EM8A 1NYQA 1DOAA 2A1UB 3O3MB 1L4EA 1TW3A 4FILA 1SG6A 4JEMA 3RSGA 1S3GA 2AFHE 3V9AA 3A3OA 3LKZA 4KLNA 3TDNA 1NVTA 4J1TA 1M75A 3N2IA 4K88A 4F3RA 4D8XA 4FDMA 4RIHA 1R4NB 2WWIA 2OCYC 5K8TA 3H5VA 3ZGOA 1M8KA 3KJHA 2IIBA 4X1OA 3VTFA 3HPRA 4YRBA 2PMDA 3W2IA 5T6BA 4ABYA 1EKXA 1G18A 1Z6TA 1W581 3H11B 4J49A 3ROEA 2Q6VA 2V0NA 2PLAA 1QH8B 2YYSA 4IDDA 1X9GA 1HY3A 3G2IA 3T5TA 6REQB 2CBGA 2IHUA 4GD3Q 4X97A 5LU9A 2IF2A 2BR4A 1P61B 3HKCB 4CF4A 3OY2A 2IYNA 2GK3A 4ZQFA 5FLXA 4MKHA 2YQZA 1TUBB 3IB3A 1FW8A 4ML3A 4DSUA 1NX6A 3T12A 2QP4A 3ABZA 4M9QA 1JILA 3Q5EA 2OXFA 2AR0A 2VJCA 2FSSA 2C2HA 1K6IA 1WXIA 4U9IS 3ZLJA 3C3AA 4IHKA 3EVZA 1HE4A 1QVWA 5DHQA 1NQVA 3RNOA 2O8DA 3HNRA 1EI9A 5ALNA 2YJGA 1C7IA 4KR9A 4D45A 2ZTVA 4YRDA 1OKKD 3U4AA 5B2FA 1QE3A 3FNEA 3OAAA 4EHJA 3R3VA 4XWTA 3VPXA 1YUNA 1WW8A 2DRIA 3R5SA 4YAWA 5LB4A 3T3GA 4BXOB 3KWLA 4TYPA 4WI1A 1ZD1A 1CUAA 2VSXA 2B2XA 3K16A 1J8QA 1KC3A 5FI1B 4CIWA 1E2PA 4Q1BA 2GVNA 3WGGA 1T43A 1ZSVA 3M5PA 3U1TA 3ZVRA 1A96A 3HYSA 3NBXX 5CX4A 4FDLA 4IQGA 4IGEA 2NU9B 4AF8A 5C2JB 3RTDA 1Q16A 4YAGA 1P5FA 2V7XA 4IJKA 3UB2A 3DE4X 2X8BA 3CUTA 2Z8XA 4UAVA 4BFXA 3ZVNA 5KTRA 3LXRA 2IHNA 4FEYA 1LBTA 1GLNA 1R88A 3JZDA 3LAWA 5FTJA 2RHBA 4YAIA 5ALVA 5HIAA 2C88A 1DC3A 2G70A 2WR8A 1DP4A 1Y8QA 4OEHA 5C4MA 3GUCA 1Y8ZA 1TA4A 3NGMA 4I8XA 1AHPA 1E3IA 2ODNA 1CZUA 1Y98A 1H9AA 4P3OA 2VDNB 2Y71A 4RD1A 4PSVA 4FFOA 2HA4A 2NP6A 4Q48A 3F9CA 5EXSA 2IPNA 4OIFA 1AZTA 2VDWB 3A25A 3CRNA 4OUDB 3KTAA 4BFUA 1WBDA 1T2AA 3AEQA 3P19A 3MJ4A 5LBUA 4ETNA 2Y1FA 5DYTA 4QJ4A 3ZG6A 1N9KA 3WHLA 3EZFA 3B6IA 5GZ6A 3O8CA 1US8B 4JI4B 1DAHA 2ZVPX 1JN0A 3B20A 3MXTA 1E98A 1XRSB 2A0FA 2WW8A 4G37A 4PLYA 3UK0A 1I0LA 3L1KA 1DXQA 2PA3A 2X8AA 3I3OA 3KSRA 3PUWA 1GTZA 3R3YA 3S27A 3WNDA 1ZC3A 1HF3A 2C83A 3FXAA 1LVUA 2X0JA 4K28A 4LJKA 4PQEA 1G8FA 1U7DA 2ZBQA 4KFUA 1JE1A 4BNGA 4FMCF 1XP8A 1P17A 3A4LA 3ZXXA 4B5LA 1O6FA 3IQGX 1FU8A 1KMHA 5EXEA 5C7LO 5F3DA 4XWKA 3KJQA 2ZUCA 1X80A 2C98A 2PR7A 3C8UA 3M9LA 3OT1B 2V7EA 5F5NA 1LPAB 1R4MB 4DADA 3O4GA 4MITA 1SZCA 2OXTA 2OKGA 4RTLA 1IWBB 2PUJA 4JU9A 2ZG6A 3L1HA 5A3JA 4IUYA 1L7RA 2JFPA 4FFSA 1BFKA 1I2CA 1FFXB 2WI8A 3D6JA 1KO7A 2CSXA 3VU9A 3GJ5A 3OFNA 1SZDA 4FYYA 4W8HA 4UC0A 1D2AA 4WJLA 2V5UA 3EWAA 1VHQA 3D8SA 3GEEA 2OEPA 2P27A 2RAVA 3K09C 1TYCA 3O21A 2M1ZA 1XZDA 1WMSA 3OOEA 2B3TA 4UHCA 5BR4A 3FM9A 3IEMA 2ASEA 3ANSA 4Q66C 1PWHA 4QTTB 4YASA 5EUBA 1CJCA 5H7XA 4CKWA 2VPQA 1TAHA 2GKSA 3LDHA 5AUQA 5TB5A 2QS9A 5I7UA 3JQFA 1HDYA 3TX2A 3ZY2A 4BVEA 1IBLB 5J9FA 3TLAA 1X1RA 1E7QA 2Q3HA 1D5CA 4H0NA 4IXWA 2ZW9A 3R6DA 3FTDA 3S2SA 1SN7A 2J9XB 2P6OA 1YBMA 2HMWA 2P7IA 2WSMA 3OIGA 3OEHD 4KIFA 2HLPA 4RPKA 4X24A 1ZN8A 3RVBA 1H8ED 3IEVA 2WTUA 1JQJC 1P5JA 1Y1KE 4ZU3A 4P0QB 1GKLA 2IUSA 1CRPA 1ZN7A 1JZTA 2B3DA 2RIPA 3IEXA 5CM8B 3HJUA 2XYVA 3BE8A 1IQRA 3FYHA 3E84A 3I0NA 3DBVO 1T2DA 3IJPA 3O8QB 1Z13A 5HCUA 3VU1A 2FHSA 4DCTA 2R65A 1WUJS 1U0FA 2QUKA 5C3UA 1Q1ZA 2FSPA 3G8CA 1RQLA 4JFAA 4NBWA 2O3TA 1J0XO 3OM0A 4MTCA 4X93A 4KU4A 4BC0A 4J3JA 4DCCA 3QQ5A 4OB8A 4PNPA 5AW7A 1NC3A 2WQZA 3F8SA 3P2JA 1NONA 2R85A 3I3SR 4AKHA 4PHFA 4OXXA 4P82A 3JZFA 3OX2A 1E99A 1DSSG 3AFHA 5E7IA 3VC7A 2ZUUA 4XE5A 5A4AA 4NCIA 4AICA 1IUNA 2BEWB 5TMPA 4QQNA 3IEUA 4MLCA 4B3MB 3CO0S 3UUGA 3U62A 1NI4B 1USVA 1Z4OA 3KL2A 4LOJA 4QUEA 2OC9A 2WEKA 4AZSA 4B2PA 1VBFA 3UMGA 5J2UA 3W5HA 2WWWA 1PBTA 2XMRA 3HCEA 1U1EA 5LUBA 3LY9A 3R3XA 1IBRA 3KEMA 5DP1A 1IZ7A 1S02A 4G63A 2PFSA 2J5KA 4DLYA 2ZT7A 1TJ4A 2NMVA 4QODA 1QV9A 4C2TA 1LZLA 1XL1A 4G0NA 2GSDA 1JEEA 4BKMA 4TRMA 1D07A 1NLFA 3IV7A 1ZJ6A 2VDRB 3UKJA 1R4NA 3EQ6A 4DR2B 1UXGA 4R1QA 1CEEA 5TMBA 1YZQA 2PG3A 1ARZA 1HE3A 1UBMS 2H7YA 3DFZA 3JYNA 2Z8ZA 3E3AA 5IPFA 2CDBA 3ZI7A 4UE3S 4E6EA 3H42B 3H11A 3VMMA 3MS2A 1PZXA 1QH8A 5A9TA 6REQA 1AN0A 3ECCA 1J0BA 3PNLA 3I6QA 1JAHA 4HTFB 4R2MA 3VHXA 1L7MA 1X6VA 1L5SA 2DFVA 1T4GA 1ZS9A 3HKCA 4PONA 5D1NA 3V3KA 4NICA 3S55A 1NMSA 1CEXA 1PT6A 2PX5A 5HIJA 5LXTF 2JLVA 4DLPA 1QAOA 3AR2A 3DD1A 4ZO4A 3LBHA 2CLFB 2JJ8A 3A32A 2DLCX 3S1LA 5LZ9A 3F9IA 3QVXA 5A7GA 4ALJA 1MO2A 3KKEA 2IOYA 1ZK0A 4RY0A 1JFTA 2VOEA 1HURA 2CMKA 1IZYA 4CT5A 3W6ZA 3E9EA 3R74A 1KVRA 2BGLA 3RRMA 4BJHB 2Y66A 3WMXA 4F11A 3Q41A 1YB5A 1UBRS 1I32A 3B7WA 1A3CA 3D64A 4G0YA 4UFNA 5DULA 4D2IA 4PCAA 4RE5A 5I4KA 3FZGA 4BXOA 1T3LA 2YWEA 1DQRA 4MUKA 1G5FA 4K8OA 1TMOA 5IABA 2R5NA 3BQMB 4G5RA 4IVPA 4W8OA 3AQIA 5I9NA 1ZQ9A 3LBAA 4F45A 2ZI4A 2XE6A 3QVWA 2X0EA 3RK4A 1GKIA 2NU9A 3UWMA 1UBJS 4G4SP 4HN4B 3LQYA 4ZV9A 4JZKA 3A31A 1T3GA 2BM1A 3C8ZA 4PRKA 1OI7A 2QMQA 3KD3A 3NWEA 1R50A 2JFUA 3B7GA 5ETJA 4XPZA 1E60A 1SD2A 2O2YA 5REQB 4M0UA 3VRHA 4I1OA 5ARBA 3AVTA 1N2XA 5D5PA 4DWWA 1T0IA 4I66A 1CNFA 2FWIA 4QBTA 4OUDA 4OLAA 5T4BA 3H3XA 5KSOA 1UDBA 4GWKA 4XX1A 4AK9A 2JKVA 1MJNA 3TYXA 2G8NA 1US8A 4RKFA 3GOHA 1ADBA 4PGGA 3KHKA 1FYEA 1S5PA 3BMQB 3KXIA 3TGPA 2NG1A 1NQ5A 4CIBA 1RYNA 2W11A 3M6UA 2VR1A 2Q99A 3M1AA 2H7XA 2X1HA 3BPSA 3MQ4A 1XZMA 3CUEF 3KDPA 3OVMA 4JP1A 4TLAA 4OHZA 3R3JA 3FKSA 1WPRA 1B0PA 1MC4A 1NZDA 1CWUA 1WHTB 3HXKA 4GF5A 4DRXB 2COKA 2JFQA 1YRQA 3CX4A 3NYQA 1Y1RA 5L7YA 3U60B 2F67A 2OHOA 5IEBA 1A0OA 4PG8A 3OT1A 3O93A 1JQLB 2B8TA 1NRWA 1OXSC 3EIUA 4GPTA 1NPYA 4QEDA 3RTEA 4B6GA 1KP9A 4MUXA 5K0NA 4HSEA 2HQ1A 3FPJA 5KEIA 1WD5A 3PU6A 4M60A 3ZGLA 4IL5A 1P7WA 2NV6A 4TSFA 4DR4B 3L8MA 1CR6A 1L7QA 1RCFA 1FFXA 1AGPA 1V1MA 2FSVC 1OBFO 2I2DA 3RU2A 3TW6A 1PFYA 1TZJA 3HCAA 1UJMA 2IYRA 3NIFB 4MPTA 4EA9A 4Q9DA 2BJHA 2BGNA 3NAZA 2FPUA 2PX8A 2DFTA 2H31A 2ZYIA 1FDIA 2WU4A 1NN5A 3N2NA 2CXNA 3OZRA 4OQPA 4F7WA 1GL7A 1GLVA 1J07A 4L5BA 2JHCA 3VPCA 4DDUA 1TGYA 1Y5RA 3K4HA 5BR8B 4J0QA 5BSVA 3AU9A 3BRSA 1YZFA 1OBCA 2Y99A 2LPMA 2HA2A 2IZ6A 2XUDA 7ADHA 1JTFA 2Q0HA 1UBOS 3QE2A 2R1ZA 3NTOA 3FNIA 4MDYA 3BCHA 1NW6A 1P45A 2X2FA 1ZM9A 5IT0A 2H2FA 1U7XA 2IL1A 5DNYB 4JI2B 1A4IA 4IQFA 5HJEA 2MYUA 5MDHA 4JCOA 1U0BB 4Y7CA 1OA1A 2NYAA 1J5XA 3C39A 3LVFO 1H94A 3OQBA 3F1LA 2PSFA 1T9KA 1O5IA 1X7WB 5CR9A 2C8KA 3FDZB 5BYJA 5IHPA 4URVR 1OB2A 2FK7A 4GE0A 2IIVA 1EVLA 3CX6A 2ZB3A 1W4ZA 2JJ2D 1RCTE 3O8QA 1SRRA 3TG2A 4YECA 1KSGA 3OZWA 4CG0A 1QH1B 4BMVA 3R7NA 2LTAA 4HZIA 1D6SA 3HP7A 4DTCA 3UYLA 4BNLA 4D9JA 3NGXA 3FNQA 4K6GA 4PGHA 3T4UA 4MP8A 4Q7KA 5FWAA 3R7LA 3SM9A 4YV7A 2JGNA 3KXLA 4BX2A 1M0TA 4QXOA 2AJ8A 1W44A 1Y7IA 1WUYA 2OAEA 4QTZA 1NW8A 1YZ3A 2ZBRA 2DE0X 2BEWA 3I2FA 4I50F 4JVMA 5CVTA 2F8MA 4Y6PA 5CCEA 3IDAA 2QOEA 2EJVA 4X8OA 4UXHA 1NI4A 1RAHA 2FJPA 4EJMA 4C0HA 5LYJB 4M1ZA 1SXIA 1V9SA 4N3NA 3BM5A 2AQKA 4DWOA 3AVVA 1LK7A 1Y7LA 4IHJB 1C9JA 3ONNA 4MQEB 1CD5A 1IE3A 4IMJB 4A6PA 3O8LA 3LNTA 4KI0A 2YHBA 2A9RA 1HDCA 1NYRA 2HJVA 2RG1A 2B82A 5ESRA 4ZI7F 5C1DA 2PPLA 3AUKA 1RKQA 3AI1A 3MGKA 5DTIA 4GKBA 3C0KA 5KVVA 1EXWA 4O8CA 3H04A 3V1KA 3ZN2A 5J58A 1ZGJA 3I83A 4KGZA 3GLHE 4MTLA 1YJAA 1WU7A 1QO0D 2PV0A 4TWZA 3QIAA 3T34A 5SY9A 3B89A 4E3WA 4BU1A 2XOKD 4HTFA 3G23A 4RK7A 3W3AA 1PSWA 1CRZA 2HBZA 4K03A 2VJDA 1F12A 3U9LA 3VKFA 2Q4OA 5H9VA 1E2QA 3X1XA 3KOXA 4BNNA 4F0JA 2SCUB 1NQXA 2DETA 1QU3A 1MG5A 3LF2A 4JQSA 2CUNA 2ETVA 4B7XA 5IAOA 4LY0A 2XB4A 1PSDA 2I3GA 4PBSA 4BGDA 2OM2A 3H9JA 1XPRA 2O8BB 5AWFC 4GZ5A 2EEPA 1KI6B 2WD8A 3EVEA 3FHTA 3VAAA 4W7SA 4FYMA 3ESDA 3FMIA 4LRQA 3NEAA 3Q1LA 3VPDA 4Z3KA 5BMOA 1BFUA 1X19A 1XLTA 2PWZA 3IPAA 2P11A 1IHPA 2WDPA 3HHEA 4N01A 4NH4A 4MUMA 3KUDA 1LJUA 4H1VA 4IKOA 1BA2A 3W2HA 1OI4A 3U39A 1Z12A 1H65A 5JZ9A 4AUKA 2X4IA 5KNBD 4JLDA 1HLGA 1V6AA 3IQIX 2AN3A 4Q9IA 3ZD8A 4XX0B 4DA7A 3I6YA 2GCGA 5C7IO 4X63A 1XN4A 3LPLA 5CB4B 4H9GA 3V9PA 2E48A 3VGPA 5CLFA 2L0XA 4RK4A 2C7VA 1HZJA 2FUEA 3ESAA 5REQA 1P29A 2APJA 3F0TA 3TNFA 1Y8CA 4BO1A 1IBCA 1U3VA 4CEIA 3VH1A 1JL3A 4F4CA 4KXUA 1W4RA 2F7SA 4GR4A 4I5GA 1QLWA 4M1SA 5F33A 1Q0TA 3QWIA 1NWHA 1NM5A 4NBVA 2EQ5A 5E7MA 4IIDA 3W9YA 3WGMA 3EFBA 4DLBA 3TCNA 2QA5A 1XYVA 3KQSA 4IWXA 3ZXUB 1WLSA 3G49A 1NRIA 2W83A 1MW8X 4RTJA 3MWYW 3WLJA 1QG6A 3CE9A 5FLYA 2JI8A 3BMQA 3DUFB 1O4WA 2XQFA 4R2HA 3AKDA 3P27A 4GUDA 5AXBA 4DDHA 2EP7A 5L95A 1Y6RA 3CFYA 4LXHA 4QD3A 5AM2A 2QRQA 1TO6A 3EGIA 1C0LA 4EB6B 2JFNA 4CQNA 1WHTA 4DM4A 5FOQA 4DRXA 1P0FA 2AOWA 4ZODA 3W5SA 3QLUC 1GCIA 2ZSHA 3BXOA 1NUUA 2PVPA 4QOIA 2CVOA 5DGDA 1B74A 4RJTA 2HJGA 1MNQA 3B48A 1RWQA 3DFIA 2A86A 5DF1A 1K2WA 4ZOCA 3AR7A 4PYMA 1JBEA 5H4GA 1B6GA 3Q3CA 4H1UA 1NVEA 4G0ZA 4MWBA 1XZJA 2WICA 1E69A 3CF2A 1TM4E 6NULA 3TBFA 4E5UA 3EIEA 2V98A 3AB7A 1L5YA 4BJ6A 1XSEA 3KTFA 4UUNA 5HVNA 3K72B 1K6JA 3OE7D 3I6ZA 1YU9A 1HX7A 3TQFA 4DQVA 2ZB7A 1U1DA 5JQGA 2RCNA 1O8BA 2G28A 3PXUA 3K1AB 2OOKA 3K6RA 3BGIA 3PPWA 5AIAA 1E32A 1KH2A 4RJJA 3NU1A 1RZRA 5TV2A 3ZNOA 5AO9A 4JMPA 4AX8A 4M76B 1TZ2A 5KQMA 2BFEA 3NXKA 5T8KA 3RT1A 4F4HA 1SVIA 3S8EA 1AH2A 2BEJA 3GG2A 2O3JA 2RMKA 3M6LA 4IIFA 7MHTA 3FDZA 4UNIA 3TQSA 3TZLA 1DS6A 2CDRA 1JPJA 1A9ZA 4ARZB 2DB3A 4GBGA 1O94C 4DLLA 1QH1A 5LWQA 2AZTA 1WP4A 1QVZA 2GFIA 1PGQA 2RC5A 2GESA 4BMXA 1C29B 1IVYA 1BHO1 1XKLA 1Z4NA 1W59A 2QVZX 2EFDB 3I72A 2G9UA 5C8ZA 1H1DA 3E22B 4TQ9A 1E63A 4L2IB 2TSYB 4EX6A 3P0RA 4JB2A 3O8OB 1YZVA 2Q3CA 3MM4A 2UYHA 2EX1A 5PGMA 3GNLA 1LC0A 2JEYA 1DZIA 1R8JA 1X2BA 1C3EA 1WXWA 3A26A 3GLTA 4B9EA 2A3RA 2YWJA 4OHCA 4CFZA 1H69A 2CLMB 3OT5A 1TVEA 4JJEA 4OHKA 5LYJA 5I7HA 1J0EA 1L4GA 3COZA 3P9IA 2B83A 4AU1A 1HNZB 1EA7A 5AUPB 2YMLA 3ASVA 3EK2A 1GTVA 4BQSA 2Q4TA 5KYUA 1M73E 1RHJA 4MQEA 2WPDD 3PQ3A 5JLAA 4L72A 2PVCA 3DZIA 1RWKA 2YCLA 4CLHA 3V7FA 1VG0B 2BFCB 1J21A 1TUGA 3GLFE 3CPEA 1A1VA 2FPOA 4A2PA 5CU7A 3V4PB 3GGPA 1ZX1A 1DC6A 2PH7A 5AVXA 3RVDA 2YRWA 2R87A 4UHJA 1HTWA 1VJDA 3I73A 2OPHA 5KWSA 2EZUA 5CMLA 2C5FA 4QECA 2PMFA 2CXPA 4C76A 2P79A 3KSBC 1UMDA 2OQ2A 3VSAA 1C8BA 3KV1A 1PTKA 4KFRA 3SZRA 3TBHA 5FYDA 1VIAA 4QRIA 1TIPA 1HUQA 4I4TF 4JENA 3QWFA 1PNTA 1XLWA 2QVYX 2B6NA 3G8BA 4AP9A 1H93A 4FGLA 4RH1A 4AMYA 1GM5A 1YI8A 3WKDA 2SCUA 2R48A 3O2QB 2VEDA 2OENG 3DTNA 1R10A 1VKNA 1RQNA 3HCWA 3N87A 2EL9A 4GR9A 4OP2A 2Q4BA 2FZVA 3VDXA 5BPFA 1IXRC 1VI5A 2G76A 4B4DA 3IJEB 3UOGA 4ER6A 1Q5PA 2QTBA 2ID9A 1W1UA 2H8KA 4QICA 5GPBA 2BBOA 2FPPB 2O8BA 1SOVA 2A6PA 4FLFA 4FOOA 3IJRA 4DA4A 2YXNA 3MLAA 5LYYA 4QPZA 1L4FA 1XU7A 2PKRA 2Z83A 3IUEA 1A9PA 2FF7A 1IK6A 1YAJA 4TVOA 1U7OA 2J7PD 3I5YA 3S44A 4QDOA 3SHOA 1NUTA 1I51A 1ZP6A 1MAWA 5F78A 2WWVD 2AJTA 2FUKA 2Y27A 1YB7A 2P0YA 3LHIA 1E9BA 1OTXA 3QUQA 4FW9A 3SS9X 2PV7A 5K3SA 1FVHA 5A4DA 2FMFA 4XX0A 1P72A 4YJ2B 3LTNC 1PVVA 1U3UA 5CB4A 2W2VA 3MCUA 3KKPA 4YP1A 1KO1A 3AUAA 4D41A 1CK4A 4HUQA 5EP4A 3RWBA 1GZDA 1PDVA 1KJIA 1UK6A 1ULBA 2WZQA 5F9MA 3R8XA 5JI3E 5MGNA 3DHWC 4DANA 3OOWA 1NVAA 3WV4A 5FI3A 3T95A 1YMVA 3AHCA 3V46A 3BDAA 4YV1A 4E5MA 3CLTD 4IXDA 3KQNA 2ANBA 4V38A 1EUYA 1XA3A 3ZV5A 1RLMA 1YA8A 4CKCB 3PFWO 4QZVA 2B1QA 1WOYA 3G8AA 4JSRA 4C30A 1T2NA 2B1GA 3BB1A 3D8RA 4OPMA 3ZLVA 5U9CA 1YDEA 3LCVB 2P3LA 3GYGA 3A1DA 1KZ4A 1TMGE 2HA5A 2GA8A 2OD9A 2EWVA 2QP3A 1RFLA 3IERA 3KVVA 1VKJA 3LX5A 4HDAA 4ER7A 1DRUA 1QOPB 1VHLA 2GN6A 5P21A 3T54A 4YUYA 4AKTA 1W36D 5E1MA 1GVHA 1V96A 1ZNWA 4LMRA 3L6CA 1DL5A 1TJ5A 5KNCA 1KK3A 1YR8A 3NOQA 1KY4A 2R84A 4NHEA 5ANRB 3OESA 3T7JA 2EYUA 1PJAA 1V4BA 4IXMA 4EG3A 1GTRA 1ZN9A 2H3EA 4GRDA 2AEJA 1XRRA 3JQBA 4BMSA 1K9VF 1GN8A 1T2CA 2HPZA 3QOXA 5C37A 1ZFNA 3HG7A 1KEPA 3OZIA 4WBNF 5CX1B 3M34A 1HBJA 3H7IA 1NF8A 1OHHA 3NGLA 4ZOAA 2JAPA 4XXHA 1WMEA 2CBZA 3FR8A 1D2GA 3WWEA 1OJ7A 3IEKA 3OO1A 5FIUA 1GZ4A 1GQOA 2PH5A 1U2SA 4G89A 1SY7A 3TEJA 2C5AA 4ERXA 1QF6A 3D5TA 4Z1MD 5DXFA 1OAKA 1OX5A 3BD6A 4L16A 3RB8A 3EVFA 4I2NA 4GLLA 1YJBA 3U9TA 1ABEA 3R40A 1C0IA 3ROZA 1J24A 3BJIC 2JHAA 4GLBA 2QPAA 4JITA 3TS1A 2PX4A 3QENA 3ZE6A 4KR3A 1V3UA 2XZLA 4B74A 2ACWA 4CU5A 3K1AA 2ZAMA 5FO0A 1R12A 3G5LA 2Y0PA 4FGKA 3SQOA 2GF9A 4D82A 1PJZA 1NXPA 1O95A 2C4WA 2GN0A 2I2XB 2Y76A 1W4LA 3E03A 3DXXA 2IHBA 4LS3A 2BC9A 1FYVA 1BDHA 2I3AA 1EWYA 2UYQA 2VRCD 2V6JA 5FYQA 1GD1O 1ZKDA 5L3ZA 4CU2A 4CM9A 3OFSA 1W46A 3L3BA 4BTEA 4FB4A 4ZTZB 1I7SB 2X3UA 3C7TA 4NLLA 1XPUA 3FTCA 2ADFA 2YX1A 3AW8A 2CKDA 3QI2A 2IS6A 5JZVA 5BV2P 4ARZA 3TJZA 4YJFB 2Y1GA 3K8QA 2NSLA 1XD9A 3JQDA 3RRYA 1U5BA 3WGLA 1K63A 1ZI6A 1Q77A 1KZYC 1JNYA 3HVHA 4G2NA 4MYHA 4U5XA 3ZZUA 5A9RA 2FUNB 3EW9A 5ICMA 2UKDA 2HW8A 2FEAA 1Q0RA 3EDQA 4X8MA 3FDJA 2YV2A 3FFXA 3OA0A 3WNVA 3E22A 3GMSA 1MOPA 3NDBB 3DQQA 4L2IA 3EH2A 4Q3DA 4ROSA 5EJGA 5FFFA 4M7PA 3KLBA 2D3TA 3OQVA 1Z8NA 4IJUA 5I7AA 3PIIA 1C30B 4LSZA 1BN6A 5F1OA 4NNOA 1E6KA 4EDFA 5ADUS 5I7SA 2H0QA 5HOQA 4IQ4A 3PGA1 2PZGA 4RTNA 1G21E 3TSCA 5H3LA 1GA4A 3OHMA 2BAGA 3CH4B 4LJ7A 2RAUA 4HZGA 3HBJA 4JL6A 5TPWA 4BLSA 4BQPA 3ZVMA 4QFMA 5CAEB 5JNRA 3P2IA 5C5IA 2FP4B 1GZSA 5EHQA 4BP9A 5B3JC 5KSZA 3K0FB 4D0LB 4NBUA 2QSZA 5GAJA 1DUVG 1T5DX 2BPOA 3I32A 2Z5LA 3V8MA 2A57A 3WRYC 5THKA 5K7SA 2PT6A 3C5EA 2YHUA 3H17A 2PEYA 3WKCA 3QF4B 3WLRA 1E79A 2QIOA 3TTXA 4HB3A 1TK2A 4MGKR 1IIBA 2FN8A 1A5TA 3THWB 4COKA 1Y6QA 1YR3A 1DT3A 1QFSA 1V7QA 3GVXA 4XIGS 1DQYA 3ZGVA 4QHSA 2VT2A 4C4OA 1YMUA 1BG6A 4FGJA 1NV9A 3QBVA 3QXXA 4O2LA 4UM7A 3KLNA 1YQXA 3OCUA 3BMOB 3PVSA 1WULS 3R7WB 1NVMB 1JHYA 3GK3A 4HYEA 4MJ7A 4MS3A 4DQUA 2X7XA 3OIDA 2J9RA 4I2VA 4D79A 2VK8A 3OWHA 1JYEA 3EA5A 5JS2A 3G59A 1RI4A 2X1VA 3V7NA 3RAPR 1UPTA 1PJBA 2FJUA 4L8LA 1EJ0A 3T4PA 4DLUA 2FE4A 4XSGA 1JW9B 1A4UA 1FSGA 1TT7A 4J7AA 1RWVA 3JQRA 5HMLA 3SC2B 3QUSA 2PSDA 3H8JA 4C7OA 1SG9A 3ZCQA 3C1AA 4CKBA 5H9WA 4D0RA 3HUTA 3VBCA 2XE4A 1BJTA 1L7PA 2A58A 4R2IA 3P0IA 4L6CA 1IHXA 2QN9A 4EPRA 1LBEA 4BKQA 3TUZC 1LNQA 5LLDA 4OAQA 1JWLA 1ADFA 5KMGB 5A62A 4U63A 5EPEA 4IEIA 1EK5A 2BGRA 3VVLA 1N5IA 2H52A 1XVTA 1EFKA 2GD6A 4FFNA 4Z4IA 2NZVG 3QXJA 1T5BA 1GQSA 2BFBB 4I1PA 5TQ2B 1JFRA 2QB5A 3L7LA 1QWSA 2FN9A 1V2HE 1C50A 1EFCA 4LBYA 1HFWA 1RXSA 1WQ3A 3A4IA 5EHIA 4E31A 4DB2A 5ELMA 5INTA 2O8FA 2QQFA 3H9BA 3E2IA 3RIEA 3ZHBA 5B64A 1AV6A 3NRJA 4YRZA 1EQAA 1VE6A 2EKQA 4QU8A 3UJ3X 4GBMA 3Q3GE 2O1EA 1E59A 4LJ6A 3TFQA 5F7ZA 1OMOA 5JVDB 5D3ZA 4ENVA 4LJRA 1OFTA 4R41A 4HXFB 3ENKA 3EF0A 3R5HA 1E2IA 4KDCA 2ARKA 2FW6A 3PA6A 2EFYA 3R3ZA 4FBMA 4CKCA 2FSFA 3L0PA 5IVKA 2NUTB 1DELA 3LOUA 1KH3A 4TS4A 1N9GA 3KX2A 5C7OO 2XUZA 4MLPA 2O1WA 1ZJ4A 3HGTA 4RTKA 4QATA 2G1AA 3LO5A 1VYVA 2PGLA 5BW6B 3SX4A 4LDNA 5ITSA 3VKUA 2XI4A 3HVIA 3K9LA 1W5EA 1UKAA 2FX5A 4ILKA 2CL6X 3VR2A 4B43A 4YV0A 1OGIA 1EXNA 2BGMA 2M2IA 2L2QA 5L9AA 1NJSA 1ONPA 3DAOA 1M2NA 3IKJA 5IYZB 3CVYA 2V6IA 3VPSA 2J4FA 1E89A 3SQWA 3H2SA 4R9NA 1QO7A 2OBMA 3K1YA 4AO8A 4YRIA 5KOIA 1YA6A 3GFBA 1Y0BA 1KY5A 2WPNA 4FFBB 3A9RA 3F7MA 4YCBA 4RLHA 5DO9A 1YCFA 4CFYA 5CX1A 3KKZA 4XH9B 4NZMA 4OSOA 4OUKX 3QHAA 2GHTA 3KVNA 4UEKA 1QRDA 3IE2A 1IEXA 4XUGB 3RVPA 1J1UA 1QGAA 4FPXA 1W76A 1RAEA 2BZ0A 3PDJA 1U02A 1Y80A 2BR5A 4D9BA 3ZLTA 3MBIA 3PUYA 4L27A 4LRYA 5JCOA 4DUGA 5HSGA 2H4HA 1XZIA 2D62A 2YXPX 3TG8A 3OIVA 4RQUA 1NVKA 5K0JA 1T0UA 5KYWB 3IC5A 2G5CA 1CZRA 4P5DA 3JD4A 4ESVA 4K7JA 5KWIA 5JSZB 4E1VA 1EFUA 2HI0A 2F4VB 3COVA 2PIDA 3RIGA 4FCCA 3N07A 2Q8PA 3A1UA 1DJOA 4NYIQ 3GRUA 1OX4A 1TD1A 5DRTA 3NEJA 5IMSA 2JHPA 1I01A 4S1OA 5K3BA 1DRKA 4BFWA 4B3GA 1ZGGA 1TU3A 5AW4A 2E5LB 1GDDA 4LF4B 1WXXA 3UJ6A 4JQZA 3ZXIA 3MAJA 5DI3B 5FFMA 1AHNA 4ZAXA 1J0CA 2YVLA 3FVVA 4FQ7A 4RTRA 3N76A 5IKMA 2XKKA 3J7AC 1SB8A 2HV9A 1KYXA 13PKA 1RJFA 2HHAA 4KAAA 3OE5A 2XQJA 5FOXA 1SU8A 1AGRA 4DIOA 2C7BA 1M67A 1XTKA 4GWLA 4JBHA 1DCKA 1FU7A 5EJFA 2ZWMA 3PFHA 4EVSA 1JALA 1LX6A 2WTBA 1JDBC 1QIFA 1Z45A 2DPXA 3TZ6A 3VVBA 1KL7A 4Y9DA 4PG6A 3I5AA 3QOFA 1G19A 3KRTA 2G8LA 3VPFA 3BQ9A 4Y6LA 3BKWA 3EDCA 1C30A 1DC8A 5ALWA 1DKUA 5HKOA 3V1NA 5HIIA 1WCWA 3O47A 2PWPA 2OV8A 3UATA 3TTUA 3TNDA 2CLDX 4FDUA 1O6BA 2DPYA 1UC4B 4L7QA 2IV3A 4D4IA 4XAQA 2ZJ0A 3NCTA 4ZZ0A 4OYYA 4UCWA 5CAEA 4RZHA 2FP4A 3CLTC 2A5LA 3L82B 5F7OA 3NKLA 3K0FA 5M29A 1XNHA 3LQ4A 1Y9DA 3LE8A 2TMDA 3UVEA 1BU5A 1EGHA 4BZZA 2IBSA 4JLUA 1H2XA 3GDGA 3GLFB 3QF4A 4HFRA 1N2SA 3MRVA 3O9MA 4NOJA 4RNCA 2JFVA 3ZY3A 3AUXA 3THWA 3MCWA 2XEDA 1ZVQA 2YJ3A 2H5EA 4RVUA 1XL0A 4RZSA 3BYZA