3JWIA

Crystal structure analysis of the methyltransferase domain of bacterial-cthen1-cn
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
198
structure length
195
Chain Sequence
NLNQQRLGTVVAVLKSVNAKKVIDLGCGEGNLLSLLLKDKSFEQITGVDVSYSVLERAKDRLKIDRLPEMQRKRISLFQSSLVYRDKRFSGYDAATVIEVIEHLDENRLQAFEKVLFEFTRPQTVIVSTPNKEYNFHYQNLFEGNLRHRFEWTRKEFETWAVKVAEKYGYSVRFLQIGEIDDEFGSPTQMGVFTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biochemical insights into 2'-O-methylation at the 3'-terminal nucleotide of RNA by Hen1.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Transferase
molecule keywords Methyltransferase type 12
total genus 65
structure length 195
sequence length 198
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08242 Methyltransf_12 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3jwiA00
5LQAA 3HVJA 5CIYA 4KRGA 3BZBA 5E9JA 3NDJA 4KW7A 2P3LA 3MTEA 5EIFA 5C9ZA 5H02A 2OO3A 4DCMA 3DTNA 2NNWB 2B3TA 3IEIA 4HRAA 3KPWA 4RSRA 4QTTB 2JHAA 3CJRA 4EQZA 3MHTA 3SSNA 1Q0TA 3FTCA 1R8XA 3QV2A 4G56A 5EMMA 5FHRA 1U2ZA 1XCLA 5CUQA 3SM3A 2HWKA 4E2YA 5EOVA 5F2NA 4RTPA 2YQZA 4P7GA 3PS9A 3KR9A 4V0RA 2R6ZA 4V0QA 4M38A 1M6EX 3KKZA 4H0NA 5CM2Z 4PIPA 1MJFA 3BKWA 2YXEA 4OBWA 5F2KA 1VBFA 4X60A 3PT9A 3KR1A 2GH1A 4PIMA 4CXMA 5DX1A 3C6MA 4P7JA 3FPFA 4RWZA 2O05A 5EG5A 1L9KA 1NW5A 5GM1A 2OPBA 3SSOA 1HNNA 2AOUA 1ZGJA 2P8JA 3OPNA 4PYIA 3D2LA 4PYNA 4EK9A 5T64A 3LL7A 3KQOA 3G5TA 2DPMA 3TMAA 4PYKA 3JWJA 5E2AA 3GRZA 3TR6A 5FCDA 1IY9A 5EMKA 2FYTA 3EVZA 2A14A 3MCZA 2GS9A 5DLYA 5EC8A 3FUXA 4WXHA 3KQTA 4FS8A 2XVAA 4BLUA 4E30A 3DULA 1XVAA 1WZNA 1G38A 3K0BA 5GOZA 1X1DA 3GO4A 3I53A 2PX8A 3C3PA 2ZZKA 3KQSA 2ZULA 3MAGA 3G2OA 4PONA 3UJDA 3FUUA 2EG5A 2O0LA 4CTJA 3X0DA 4YMGA 3ER9A 1I1NA 1ORHA 2JG3A 1VP3A 1RI2A 4X61A 3UFBA 4YUVA 3NJRA 3R0QA 2CL5A 5HILA 3G8BA 1ZHFA 1INLA 5GWXA 2PGXA 3LCVB 4OA8A 4QQKA 4WVLA 5K0LA 5U4XA 2GPYA 5HIMA 2H00A 1R6AA 3P9IA 4GUAA 2ZVJA 2B2CA 5DTRA 1XCJA 1R8YA 3ELUA 4X1OA 2Z6QA 3KPVA 2XYVA 5HEKA 5CCBA 1WS6A 2BR3A 5EKXA 5EMJA 5K05A 4O29A 2ZWAA 5CD1A 3DLIA 2IDKA 1JG4A 2ZTHA 4RX1A 2P1DA 3GU3A 2O07A 1G8AA 4CKEA 1EQAA 2UYHA 3HTXA 3BUSA 2OBFA 1KYZA 2IBTA 2IP2A 1R18A 3BGDA 2ONYA 3CJTA 1NW3A 3REOA 1NKVA 3OZRA 3TRKA 3R3HA 3QOXA 10MHA 5ICFA 3OCJA 3KHKA 3IHTA 2ZFUA 4RYLA 3NDIA 1WXWA 1ZGAA 3EMBA 2QRVB 4YUYA 1JSZA 1YF3A 1YFLA 2O57A 2AN3A 2FHPA 1JTEA 3HCFA 5C1IA 3PX2A 4RVHA 4DKJA 2F8LA 3PX3A 4OA5A 1R74A 2QM3A 2GLUA 3G7UA 4E2WA 4YUZA 3A26A 3EEOA 4OQDA 1KHHA 1G8SA 1XDZA 3EVFA 5BW4A 1VL5A 2G1PA 2WK1A 2JJQA 1P39A 2H1RA 1ZG3A 2GAFA 4QVGA 3GNLA 3UJ9A 3CVOA 3FYDA 5E8JA 4RTRA 4YV2A 2ZW9A 1NBIA 1SQFA 2BM8A 2OY0A 3FRIA 3M6VA 3RIEA 4PCLA 1WXXA 3O4FA 4K6MA 5E1BA 5KQRA 3KQYA 2V7EA 3R6TA 1KPGA 2FPOA 3HCCA 3MERA 2AOTB 3O7WA 2BZGA 5HIIA 2QYOA 3ME5A 3T7RA 2AS0A 5GIOE 2ERCA 4U7PB 3AJDA 5MHTA 3U81A 2C7PA 3B7PA 2PX4A 3M4XA 4E32A 3FUVA 1O9GA 3IYLW 1F38A 3SMQA 5K0NA 1EJ0A 4F84A 1L3BA 2G70A 2NXNA 3CC8A 1L3CA 3IV6A 3AXTA 1H1DA 5DX8A 4A6DA 4ER7A 4AUKA 5BXYA 2IH5A 3UA4A 3DXYA 3PTAA 1EJ6A 2V74B 4FSXA 4BY9E 1P1CA 5EPEA 3G89A 2XYQA 4YV1A 1QZZA 3FPJA 4CKBA 2XVMA 2VZ9A 5LQCA 4IV8A 3G88A 5C0OE 4BP1A 4PGHA 1TW2A 2AOVA 4LG1A 3JWGA 2VDWA 3Q7EA 3HVIA 1SUSA 5M5BA 3K6RA 5E9WA 2OYRA 4ER3A 3NVMB 1UWVA 2QE6A 2GA9A 5DXJA 4M37A 3EVGA 4QPPA 5K0EA 5T6BA 1KR5A 1NV9A 2NYUA 1G55A 4OX9Y 3S68A 4GEKA 2EFJA 2OB1A 5FWAA 4E33A 2JH8A 2ZBPA 5DX0A 1F3LA 3BGVA 2IPXA 1KYWA 3HCEA 5JR3A 2XBMA 1WG8A 2ZIGA 5CCXA 4ER5A 1DUSA 1KPIA 5K09A 3NWBA 5DM0A 2PWPA 4EKIA 3UJ6A 5LQJA 4HGZA 1ORIA 2PWYA 4BLWA 4IV0A 1AQJA 3ANXA 1DCTA 4PYLA 2ZZMA 2UYQA 3BKXA 3P9CA 4MQ4A 1M0EA 2ORED 1ZKDA 3CGGA 4R6XA 3G2PA 3NMUF 1BOOA 4PNEA 3TM4A 1JG2A 5K03A 3TKAA 2HR1A 3B3GA 3DMHA 2HV9A 3JWHA 2NXJA 4HH4A 3A7DA 3UA3A 5P8WA 4RTJA 5K8VA 1R00A 3JWIA 3H2BA 2IIPA 2JHPA 1P1BA 1UFKA 2Z6AA 3E8SA 3MTIA 5FA5A 3GJYA 2I6GA 3GRYA 5GINE 1OR8A 3ELDA 3BWBA 3HCBA 3UJAA 4GC9A 3TFWA 3LBFA 2AVDA 3EVCA 3GIWA 4KVZA 2FK8A 4DM3A 2CMHA 1X1AA 2PT9A 3KU1A 1YZ3A 1NT2A 2B25A 2Y1XA 3LSTA 3CBGA 2G71A 3OZSA 4XUDA 1D2CA 3BXOA 2OB2A 3P97A 1HMYA 5ICGA 1EIZA 4QVKA 2Z6UA 1I9GA 3BWYA 2OXTA 4ER6A 3LCUA 3SXJA 4C03A 1RI3A 5DM4A 1VP9A 3I58A 5EIWA 3PLAE 1QAOA 1KXZA 1V39A 3P71T 4F86A 2KW5A 1QAQA 1RI1A 4QPNA 4M36A 3UJBA 5LQRA 2QRVA 3KQVA 1RI5A 3SR4A 3R24A 2ZBRA 5ICCA 2R3SA 4KIFA 1L3IA 2B78A 4P7KA 2PSSA 5HIJA 3UJCA 1FBNA 1FP1D 3KPJA 4RVDA 3HA3A 3ID6C 4RTMA 2C7QA 2DULA 2P3QA 2ZWVA 3OFKA 3THSA 4Z2YA 1N7JA 4C06A 5FHQA 5HFJA 2ZIEA 3EVBA 3L8DA 1N7IA 3VC2A 3FUTA 3DP7A 1SUIA 2HMYB 3P8ZA 4C04A 5HIKA 2NP7A 4GOLD 5EMLA 1NE2A 3P9NA 5E9QA 1SKMA 2AOUB 3WSTA 3EMDA 4PGGA 4LWPA 5EEGA 3FRHA 5DSTA 2WA1A 1EAMA 2QY6A 5EHGA 5G02A 3SSMA 2G72A 4MIKA 4HSGA 2ADMA 3GRVA 1BC5A 5FA8A 5DPMA 2C7OA 4FZVA 4KDCA 4XUEA 5K0BA 2VDUE 3T7SA 5EHIA 2PKWA 1AQIA 2AR0A 5E1DA 4E2XA 5GM2A 4EVIA 4DMGA 2CWWA 2P35A 2H11A 4GOMD 3A4TA 3ELYA 4R6WA 1AF7A 4U7TB 5DT2A 1O9HA 4FGZA 5DTMA 4R8RA 5E8RA 4A6EA 2PX5A 3PFGA 5EVJA 3BT7A 5HOQA 1NW6A 1KIAA 4RTLA 3UJ7A 1XJ5A 3HP7A 3A7EA 4KIGA 1ZQ9A 2AN4A 2E5WA 2IBSA 2BR4A 3EPPA 3FZGA 3HVKA 1QYRA 4ISCA 2K4MA 3P2IA 3LDGA 1N2XA 3HA5A 3UZUA 5D1NA 3RW9A 3HCDA 1RJGA 3TOSA 4UOEA 5DSXA 3P2KA 3M70A 4PINA 4ATNA 2N47A 3PB3A 4C05A 2P40A 4PYJA 5GIPE 2IDJA 3GRUA 3UBTA 5FUBA 4FR0A 1NBHA 1KP9A 1L1EA 5LQUA 3EGEA 3GDHA 3DOUA 1JQDA 2ZLBA 3EEYA 2AOXA 3TQSA 4RTQA 4RTNA 3OE4A 3FPGA 2OKCA 4AX8A 3MCTA 5CVJA 5KS2A 3OE5A 2EX4A 3ORHA 8MHTA 3A27A 5FTWA 3THRA 1BHJA 5KQSA 2PXCA 2VDVE 2AOWA 2VP3A 3HCAA 1O54A 3HVHA 4GQBA 4C07A 4E2ZA 3ER8A 2HTEA 2CKDA 4GOND 4RVFA 3HA7A 4OBXA 5E1MA 3SVZA 4PYOA 5FQNA 1VLMA 3G5LA 3FTFA 2BR5A 3M6UA 4LWOA 4AZVA 3OU7A 1UIRA 5JUWA 4AZWA 5EZSA 1JG3A 3Q87B 4FP9A 1Z3CA 3LPMA 2P7IA 3DMGA 4FSDA 4GC5A 3B5IA 4PWYA 1JTFA 5F2OA 4RVGA 4POOA 3ERCA 1NV8A 2BM9A 1XTPA 4ER0A 5BP7A 1XDSA 2AVNA 5EQJB 1Y8CA 3V97A 5KYGA 1D2HA 5E1OA 2Q41A 2ZCJA 4CWAA 1DL5A 1QANA 3KPUA 2P3OA 1X1CA 3GWZA 3LBYA 3BWMA 4KWCA 2I7CA 4Y2HA 3KR2A 3TKYA 2IH4A 3GRRA 2ESRA 3VYWA 2IFTA 5IKMA 2B9EA 2YR0A 3LHDA 3AXSA 3EGVA 3KQMA 4DCGA 2Y1WA 1FJXA 2JH9A 4JXJA 1YUBA 3I64A 2NP6A 1XXLA 1AV6A 4RV9A 4QTUB 4QDJA 2YXDA 2YXLA 4RTSA 1G6Q1 3SX0A 2ZBQA 5ICEA 5FADA 1JQ3A 2PX2A 3KQWA 2GB4A 3M33A 3SGLA 5LQNA 3R9XB 5LSAA 3CKKA 3FPEA 4KDRA 1VE3A 2PY6A 4LECA 1G60A 3FTDA 3TLJA 1PJZA 3B3FA 3LX6A 1MHTA 2IGTA 3NVKI 5CVEA 4RTOA 2YTZA 3DXXA 2P41A 4DZRA 1T43A 3GCZA 3EGIA 1FP2A 3EVEA 3MGGA 1B42A 5EKUA 3LDUA 2UZ4A 1RJFA 2ONZA 4FT2A 3M6WA 3AY0A 3OU2A 3KPYA 3B89A 3V8VA 5DRYA 5K01A 4MHTA 2NXCA 1FPQA 3BWCA 4HC4A 3F4KA 5IH3A 1NW7A 5DXAA 4BLVA 1YFJA 5EGSA 3KQQA 1YZHA 4PYQA 5LQKA 4XCXA 4IWNA 3TM5A 5DM2A 3BGIA 2FRXA 1WY7A 1Q0SA 3HNRA 5D1HA 5EEHA 2EJTA 2AN5A 1TPYA 2XYRA 3PVCA 4R8SA 5CVVA 1YB2A 3FYCA 4B17A 1D2GA 4CKCA 5LR6A 3P2EA 1X1BA 3DXZA 3LECA 1P91A 2WA2A 3MB5A 1JR4A 3GXOA 4YUWA 2PXAA 1RJEA 1EG2A 1VQ1A 2P7HA 2O06A 4OQEA 9MHTA 4E31A 1RJDA 3G2MA 3EVDA 3GGDA 4HTFA 4F85A 3T0IA 1SQGA 3VC1A 3C3YA 1IM8A 4QQNA 5CVUA 2PJDA 2FCAA 5CVDA 4PCAA 2BH2A 2YVLA 3NWEA 1JSXA 5EZQA 4X63A 3UJ8A 4HGYA 4YUXA 4C4AA 3NW9A 2I62A 4GBED 3DH0A 2HNKA 4X41A 3I5UA 4L7VA 3LGAA 4GF5A 1XDUA 3DMFA 4C08A 5DRTA 3OFJA 4MWZA 1JG1A 5DWQA 3P9KA 2PLWA 3A25A 2ZZNA 1SG9A 2EJUA 3CJQA 4HTFB 3C0KA 2CMGA 5E2BA 5FWDA 4EMSA 3AWIA 1TW3A 3ELWA 2ZIFA 2ZSUA 4Y30A 4YV0A 4GOOD 2UYCA 4R05A 7MHTA 1VIDA 1KPHA 3PFHA 4E70A 2NXEA 3QOWA 5DM1A 4ZTBA 4EKGA 4DF3A 2PT6A 4QDKA 4YMHA 4FT4A 1PRYA 5BW5A 3T7TA 2YUIA 5FULA 2PVCA 5T67A 2I9KA 2AZTA 3VSEA 2JHCA 5K0JA 3MQ2A 5K0CA 2VS1A 3LKZA 3KQPA 1SVUA 2AOTA 1JQEA 2PBFA 1X19A 3FPHA 3FUWA 2IH2A 4IKPA 2YX1A 4DA4A 3OZTA 5FQOA 1M6YA 1IXKA 3O31A 4P58A 1NW8A 3I9FA 3DR5A 3LDFA 2G8NA 3TPZA 3LCCA 5KVAA 3NTVA 1QAMA 5ERGB 3OU6A 3HM2A 3E7PA 3LKDA 3FTEA 4PYMA 5GP1A 3M6XA 4HG2A 1BKYA 2PV0A 3KR0A 3DUWA 3RODA 4AZSA 3HEMA 3G2QA 2PXXA 3CCFA 3E05A 3EVAA 5B1SA 3UWPA 2UYOA 4RTKA 4NECA 5DTQA 1RI4A 2C7RA 4AZTA 3DLCA 4XUCA 2LD4A 3C6KA 1I4WA 3E23A 3G8AA 4BP3A 5K0FA 5K0GA 1VPTA 2OZVA 5HZMA 4CTKA 4MTLA 3B3JA 4M7RA 2FK7A 4DQ0A 4P7FA
chains in the Genus database with same CATH superfamily
3F9CA 2OORC 4XD2A 3WJ7A 3NDJA 5KTSA 1MAAA 1QQ5A 2W2QA 4JLJA 5C9ZA 1BD3A 4MWDA 3PG5A 4I08A 4PNZA 4W82A 5GONB 1FLVA 4C0XA 5J43A 1D1TA 2I8LA 3OURA 3LZDA 3S2EA 2ZJ6A 1ZQ1A 3FTPA 2HZBA 2GFIA 3AOGA 4WDRA 3WBBA 4DADA 4M9XA 2JFNA 1RNLA 1GFWA 5HFNA 4DIFA 5E3JA 3SF8B 3HE3A 4DR2B 8ABPA 1RE0A 3QV2A 5EZ5A 2H2FA 3I04M 4Z86A 2UU9B 4O4JA 4RGVA 4AECA 1RP1A 3KR9A 1M66A 1UODA 1MO3A 2HDNB 4V24A 4V0QA 2QZSA 2UVPA 2PX0A 4WUTA 1M6EX 2WTMA 2I6FA 1ZM2A 5LM3A 3NBMA 4OLBA 3AVYA 4WOCA 3PT9A 4IDOA 2GARA 2FQWA 2WG0A 5DX1A 1NUUA 4P0TA 4XVRA 2QTVB 4L72A 5ALSA 4F91B 3PNKA 1NW5A 1SBHA 3NHKA 1NFRA 4NJEA 1C7ZA 1P1HA 2Q3LA 1FLDA 1W87A 4I55F 4K6FA 1SD5A 4RNCA 1SEPA 3GEDA 3N39C 4HPJB 4DR3B 2BZ1A 4TLEA 5K0SA 1MIHA 1NLFA 2ZJ0A 1YFZA 3E7WA 2FOXA 4PYKA 3TR0A 4BMDA 3CPHA 4CG3A 4X8OA 3U4AA 5DV9A 4HVCA 3TR6A 4YMTA 1IL0A 2XBUA 1B0ZA 2DWUA 4XSGA 4QTXA 4ERXA 2LUOA 3IR7A 2W98A 2ZR0A 3RJTA 1OUMA 3UAWA 4BBJA 4L02A 3MS4A 2DBYA 2I2BA 1DVRA 3R6WA 4G6ZA 3GXBA 2MDTA 3ANLA 4YRGA 3PIIA 2NLOA 4O5AA 3HXOA 2YZMA 3DWEX 3RK4A 3K1AA 1Y98A 3NBKA 3NX4A 4HQLA 4TSFD 2VNSA 5KQGA 2Q1TA 1ACMA 3IOEA 3RGWS 8ATCA 2XXAB 1OXTA 1EHYA 1VRCA 2V3VA 3ESCA 5B7NA 1YBMA 3L05A 5JZOA 1X7WA 3I2GA 3U2QA 2GEKA 4S1VA 1NVGA 1JAHA 1U7XA 2OL4A 5JD6A 4LF7B 1C80A 4GQAA 3LTNC 3TNDA 1XNRB 1L4UA 3KZXA 1M75A 2AW3A 4WXPA 3RYIA 2F9LA 3L8EA 2EFEB 3FGOA 1B6SA 4MJXA 1ML4A 4QUGA 5JYEA 1CUGA 3TLMA 3PL5A 4ETIA 3MMPA 1P2FA 1V96A 3VU8A 3ZE8A 5C52B 3RKRA 3GCWA 2CNBA 1GGNA 2OBFA 2CLLB 2RB5A 4QJIA 1YCDA 2IYFA 2GKOA 4GI1A 2ZJ7A 4HZUB 1RHQA 5H9WA 4FC6A 4KIUA 1XPRA 1PG0A 4NXMB 5B3JC 1JF8A 3CKLA 4RK6A 5BN1A 4EFKA 3SQXA 3KHKA 3ZCQA 4NHOA 1SO8A 3GLGA 1H8HA 4ZO4A 1N3BA 1X0XA 1YR3A 3OOYA 5LMCA 2R87A 3K20A 1HA3A 4D42A 3HFRA 2BN4A 2RGCA 2VQDA 2JKYA 2OM2A 2JJ8A 3NWPA 3A28A 3M5DA 2O6HA 1EWQA 5C7OO 2YYYA 4TM8A 3RS7A 3PX3A 3F6EX 1RZRA 1V1MA 2FUNB 4E2WA 3EEOA 5BSHA 4GX2A 3IP9A 1T9BA 5EWJA 1UQTA 2HA2A 1P80A 1GGKA 1UKVY 4AW9A 1ZG3A 3FPKA 5D7NA 1WMSA 4BVKA 2IEGA 2BM8A 4KFSA 4A0GA 1TKRA 2IS4A 2A3RA 1U8CB 1MQAA 1Y4UA 2JW5A 3FDIA 1D1PA 5DVZA 2O3TA 3Q3GE 2H9IA 4NBRA 2WAAA 4AB1A 1CX9B 4Y6PA 1K75A 5IEBA 3FVRA 3M4XA 3IYLW 2E6KA 1HDOA 1Y33E 4PNHA 1J23A 3N2GA 2GXQA 4QUBA 3ZC3A 5ESDA 4BN4A 2JIBA 1A5BB 3C8UA 1LC3A 1SB8A 1IUOA 3K6JA 4UM9B 5IANA 4YJFB 1U0RA 1OV6A 3C24A 4LQCA 3NTXA 1H6BA 3F74A 5AKJA 2XQFA 4NBVA 3AESB 1EJ6A 3AF4A 3PNQA 1RKVA 1QCDA 3CWQA 1CUJA 3LUCA 3DOFA 1QZZA 5IS2A 2VJPA 3B1YA 1NIJA 1LZLA 1L5WA 5AJZA 3GJ7A 3Q3JB 3UC9A 4BP1A 4L08A 2GZDA 3Q8XB 2VDWA 4I1RA 1PS9A 2AA3A 3Q7EA 2D7CA 3LXUX 3QKSA 4Q9DA 3GJ6A 2IW3A 2VTDA 3K72B 4LJRA 5B4TA 1ZJWA 1NUPA 1UWVA 3O8OB 4C4PA 4X3OA 2NYUA 3CZ4A 1XQ6A 3U7GA 1DLJA 2VF5X 2FZWA 3QIAA 1DQNA 1EK6A 5FBWB 3V4LA 5IZCC 4N3CA 2OGWA 2XTNA 4CDNA 2XBMA 1DHTA 2WVJA 2JDID 2HNBA 1FYVA 4YPFA 4EG8A 4B3TB 1ZITA 2AMYA 1FB5A 3HWX1 1Q2UA 1QO0A 3V48A 5EIXA 1QIJA 3O2JA 2GHQA 4TYYA 3NNSA 4PYLA 5C8YF 2O7SA 3P9CA 3A6GA 3ZOZA 3I72A 3CT6A 3MEQA 1HZZC 2QTCA 2JKZA 1E2NA 1BOOA 2GNPA 2HH9A 1U8EA 1H93A 1Z8FA 2ETXA 4RVSA 5JVDB 3ZHZA 1M5RA 5K03A 2V6GA 1U0BB 4KV7A 3TWOA 3GPCA 4MDEA 3L6EA 1W75A 3MRVA 4RXTA 1R0BA 4B43A 4Z6KA 3KEOA 4Y8VA 2NXJA 4RMIA 3CF0A 4O2AF 2J31A 1MVLA 2GPJA 4Q3LA 1E8NA 3VR3A 4YIHA 1ZYUA 5I4CA 1FP4A 1RWQA 1KFCB 1JFLA 1NYRA 2CMFA 1ORTA 1W0JD 3QV1A 3KKNA 4CF6A 4UTVA 3FPLA 1FTSA 3UJAA 4GC9A 1ZRMA 1MRNA 3LBFA 1S01A 1VKNA 2EP7A 4GYJA 3UH0A 3ZD9A 5I01A 1JWAB 4WY2A 4GM0A 2HMAA 5E4FA 3I9LA 2VUSA 3BTUA 3TXAA 5KPDA 5JYDA 2YMLA 3CBGA 4LHZA 4H3VA 4YMIA 4A2CA 4BAUA 2QM8A 3PNSA 4K0RA 2ZBDA 2VTVA 3LUGA 3NASA 5AKZA 4ALNA 2EBHX 3GLSA 1GRQA 1OLOA 4GMFA 4ER6A 4OQ4A 2JZOA 1IHPA 1YTLA 4C4ZA 5HUHA 1FW8A 4D9BA 1V3TA 1II9A 3DBLB 4PV7A 2FPPA 2ZPAA 5CP8A 4KPGA 3RREA 1F4PA 4OGLA 4DEVA 1DE0A 4Q4AA 5AWFC 1RI5A 1QTRA 5E6UA 1EEXB 2QGNA 3LA6A 3D6VA 4FB5A 4FKZA 1P45A 4R81A 4Q9KA 5F1OA 4K9MA 4JLSA 3A1VA 3N74A 4NX2A 2NUAB 1O8BA 2NO5A 2RAFA 4LXYA 3IUBA 1KQNA 1UJ4A 3ABQB 5D51S 1ODTC 4X91A 5KSOA 3IAAA 1SVWA 4RH0A 4WLUA 1SKMA 3FNHA 4TXLA 2CE7A 2QB5A 1Q6ZA 5M7EA 1SHUX 2EC5A 3DBRA 4DWOA 2OCIA 4RY0A 5F4BA 4PXYA 4EYKA 1VJ1A 1S3IA 2PQ0A 4R9SA 3JD2A 3W8FA 4ZK2A 3HACA 4Y2JA 2EWVA 1JQBA 5FA8A 2R48A 4PTZA 2FOIA 3OOJA 2ZB3A 1RYZA 4XUEA 2VDUE 2CBGA 4XIIA 1IEQA 1ZSYA 2O1EA 1JI0A 2Z6VA 3EPLA 1DAGA 4R6WA 4XVUA 4DYVA 5C51B 4XPZA 4UEJA 4OKSA 3THXB 2PWZA 4PAGA 4KK4A 2QXUA 1G20B 1U6KA 2XHEA 3N1UA 1RPTA 3AI1A 2WIGA 1NW6A 3H1FA 1XA4A 3O83A 3T54A 3P32A 3UJ7A 5GV7A 3A14A 1C7JA 2FP4A 1DBRA 2XUOA 3ZJTA 2PLFA 4B6PA 2FW6A 3QEKA 3HVKA 4BPRA 1CJCA 5GPBA 4F1JA 4DUGA 2XVZA 3PFWO 4DB4A 3LDGA 1IC6A 3RHSA 1XMQB 2H9AA 5KTYA 1Y5LA 3JD4A 3ZS9A 5EI5A 3IAS1 4Z8YA 4A5SA 5JYBA 1W36D 5EUQB 2BOVA 1NUTA 4J2TA 4DNFA 1SUEA 3S1AA 4OO3A 3SBOA 4ZEXA 5EWLA 3SN6A 4C05A 1VMKA 4DAOA 1XNGA 5JISA 3EFBA 2HLDA 1Z4MA 5KYXB 3FB4A 3H0EA 3GJZA 1VBNA 1BMDA 3NHAA 4LKRA 3T9DA 5HOEA 1OBFO 1EH5A 3UMJA 2R11A 4M60A 2E4UA 2AUTA 3B1KA 2A58A 2M6KA 1TNDA 5FTWA 5DYNA 1GAQA 4MMZB 5EE0A 2VJLA 3VX4A 1U0NA 2IHUA 1XXHE 2JZNA 4GQBA 4E14A 1C2TA 1H2HA 2IPAB 1IOWA 4OBXA 4A1OA 3I73A 2YRXA 3PE4A 1EFRD 3SVZA 5T7BA 1FUKA 3KJIA 3FMPB 1NQVA 1M2OA 3MWJA 3PR1A 1R0ZA 2GR9A 3DL4A 2P30A 2AFHE 4YV1A 1VHJA 3EAQA 2XZDA 2AEJA 2ZI9A 4WK0B 2O8NA 3C15C 1ATZA 3I9MA 5ILGA 2EF0A 2HRDA 1H8HD 3E53A 5DHUA 5IW8A 4DSTA 2A0FA 4ZVUA 3VZQA 3VXKA 1L1RA 4IIUA 1HFJA 1TVKB 4ETMA 4GP9A 2Y92A 4DNOA 1BDMA 3KZNA 3ZHTA 4XARA 2QL7A 1MMFB 3I4FA 4M1ZA 3VR4H 5LVAA 4Z3KA 3OE1A 1IM2A 3N3BC 1ISFA 1Z7EA 4OJQA 3S28A 3QQ5A 1DBVO 1WSWA 1U2EA 1WKCA 4LVCA 1FJXA 4DGSA 3D5QA 3BGSA 1CDEA 3FNBA 4RZHA 2OFFA 4RV9A 4XKJA 3S2ZA 4F4DA 1CNMA 1GYQA 7REQA 2IE8A 2ZSDA 3Q2KA 4YCBA 3VZSA 1PD0A 1YL6A 1KEZA 4OL0A 2Z57A 3ENZA 2W70A 1K92A 3QSGA 1LPNA 4BQEA 1PF7E 1SPXA 1IHXA 2C9ZA 3FCSB 3C5WP 3L6BA 1SVSA 2H4ZA 4XB6B 5AVJA 4ZEOA 4XH9B 1JDTA 4O25A 5CT5A 1FU4A 4XYEA 4DV2B 1ODSA 1YVDA 3EVEA 4H18A 4A6PA 3OIVA 4TV8F 2H1WA 1E20A 1W2GA 2AT1A 2JJ1D 3M4ZA 1NSFA 1Q92A 1UBCA 2D5BA 3FROA 2JEOA 5DRYA 3WGYA 4EZBA 2NUPB 3BWCA 1LRKA 2C8LA 4NV1A 4D3FA 5JEDA 3HCRA 1OI3A 4WXYB 3QVTA 2WLTA 3DOCA 3JQ8B 3WGUA 3IUYA 2J4DA 4C22A 4CV1A 3R6GA 2FRXA 2WNHA 1O4VA 3FWPA 3HNRA 4TYPA 1GITA 2G06A 2XYRA 3AF3A 2AHOA 5CVVA 4MH0R 3SY8A 2VZEA 5IU6A 2O2EA 1I5OA 2PJUA 2PRYA 3EQ7A 4DLRA 4MV0A 3P2EA 3PCXA 4IXMA 3E9QA 1K8ZB 4L4ZA 4PZ9A 1F7VA 1QUFA 2VH2A 3R77A 3ANMA 1XN4A 4GKAA 4IMRA 1IAVA 4ZZIA 3KSBC 4GM1A 1ISPA 3RS3A 4BIMA 1PUIA 2FSUA 3Q6IA 1J22A 1ZIPA 1A9SA 2PJZA 4OQZA 1SC9A 2CUKA 1FSFA 3T0IA 3ZI7A 1Y6GA 3MBOA 4DQUA 7YASA 3Q2IA 5IF3A 6Q21A 5BV0A 3LVFO 2DPGA 2XKAA 4X1IB 2JIPA 4W5WA 2DETA 1KY5A 5JRZA 5ALHA 2KYRA 2GBLC 4NR0A 1RDFA 2DHRA 2F1OA 3LPCA 5CMLA 1OX4A 2JRLA 2VT3A 2VJNA 3CH5A 3VPDA 1N6KA 1YQEA 1E99A 3UOGA 3I5UA 4ZDIA 5B55A 2HADA 4IX1A 5D3MA 3GELA 4Y7DA 4I14A 3RS9A 1W4CA 2F1RA 3DMFA 5DRTA 4OGWA 1VLZA 5AXCA 4DLPA 1WWKA 2TSYB 5BUCA 1S8FA 1T9HA 4B47A 1W85A 2QN8A 5CNKA 1I10A 3HI6A 1G8KA 1UC9A 2FPLA 3GRFA 4HUJA 3ELWA 4LRSB 4NFYA 4MGHA 2YY7A 2VPIA 3WO0A 4KIJA 5JMOA 2EEZA 1Y8QB 3MJCA 4JLKA 3F5FA 1D03A 1Q3HA 4RSMA 3U3MA 3JYQA 5IMSA 4D6YA 2JB9A 2I2FA 2V6MA 3ZLVA 1CY2A 3EY4A 1H3EA 2PT6A 2VLIA 1UOQA 2AG6A 1NAHA 2RHLA 4FFPA 3RROA 3WB0A 3QITA 1P62B 1VXRA 2C4UA 2JHCA 3K0EA 4WA7A 1XRJA 4FGSA 3ZD7A 3ICCA 3OC0A 3MRTA 2O1WA 1SVUA 3MSXA 4G0QA 4EFDA 3WMEA 1XU7A 4UXIA 4IKPA 4RMJA 3QFSA 1CZNA 1RJWA 4RV4A 2WYHA 2JLUA 4OQQA 2IXTA 2VQ3A 2YYAA 4N82A 3RU9A 4CNQA 1OSNA 1J8FA 4MCIA 3G0IA 5E4YA 4B0OA 2AN1A 4R7TA 4BKUA 3CYFA 1RRVA 1VL2A 2ORYA 4IZ6A 1F4VA 1W0KA 4XX0A 4JQCA 4LCBA 3LPDA 3L79A 3TNJA 2PSHA 2O8CB 3KR0A 1D2MA 2KHZA 2NADA 5JNUA 1SEVA 4MQEB 5CT4A 1E62A 3NAZA 4HVLA 2DEUA 4JI1B 2FSFA 3KKKA 3LHKA 1EGHA 2JD1A 4K9NA 2FJ0A 3EVAA 4UAJA 3T7DA 4BJ1A 3B6KA 1Y3HA 2GZHA 3CHYA 2Z09A 3DVSX 4UUOA 2C4KA 2PGAA 4PFQA 3LF2A 3KAKA 1GA4A 3E23A 4WSOA 2ZRPA 5DLDA 1DP4A 1Q1NA 4ZTUB 2ENWA 3UHOA 2X58A 4HFJA 4HPXB 2BFCA 3QA3E 3KKOA 5DGDA 4CTKA 4OREX 5JECA 2G0NA 1DAHA 1OILA 3NKLA 3DOHA 2VAVA 3FDZA 5EP4A 2WTBA 1ORWA 1BCSA 2Z1MA 3CZQA 3OIDA 3T34A 5J40A 5DYWA 2OCDA 2G82A 4FFBA 4RKEA 3H6GA 4F2HA 4Q7QA 2QTHA 5JAUA 4ZC8A 5FP0A 1JAXA 2QPLA 5T5QA 4YRJA 2J5XA 3RJ5A 1PVVA 3GFBA 1Z13A 1L4HA 4KYVA 2OGUA 1QPGA 1U81A 2C9OA 1JEYA 4G37A 4MVJG 4UZSA 2JGFA 1QTQA 4UNSA 1MXFA 1ZESA 2PV7A 1Q7BA 1DEOA 1FUUA 1Y7PA 4H0NA 4WACA 2PMWB 5JBNA 2YXEA 2FGKA 2PK3A 4EG0A 4IHJB 5IBPA 2PX6A 2IZZA 4P3PA 4PIMA 4TMZA 2ZS7A 3C6MA 1I7SB 3C3DA 4E12A 2MSEB 1O96A 4KXVA 5BWCA 3EQ9A 5IT4A 1I4LD 2YZ7A 4G0OA 5BWNA 4DPMA 1LLUA 3AETB 4M9UA 1DKRA 2BLLA 1YU6A 3M4NA 2C4MA 1NNEA 3W2TA 4EK9A 4M8LA 1CR0A 5CAEA 3DP9A 4D57A 1XO1A 5ALUA 4O4LB 5ENZA 1Z38A 3EIUA 3KXDA 4OHMA 3LFHA 4DUPA 2A8YA 3TPCA 3ZY2A 3GT7A 2FPXA 2W4MA 2P77A 5EC8A 5CA0F 5TMDA 5EQTA 5MN4A 3DULA 4DV5B 3AFNA 3JZAA 2W6NA 3H18A 2FN3A 3GMDA 2RH9B 2BEKA 2ZZKA 2GZMA 2QU7A 3UB2A 5CEJA 1T6NA 2DQ4A 5I9SA 4HNSA 2O3JA 3FD8A 2BMEA 4GPZA 1CUCA 4CM9D 4K3UA 1RJ9A 3D6TB 4JBIA 3WRXC 5H9VA 1QLWA 2B5VA 3DE7X 2OXEA 2RCNA 1W5SA 5HIMA 4KPUB 3C16C 4JXXA 1I0ZA 3LFUA 2X3FA 2A9RA 3WA6A 1C1XA 3LK7A 1TUIA 3G8YA 1T8YA 2NTNA 4PBSA 4V2UA 1AMUA 2IY8A 1ABEA 3EXG1 1Y3DE 1EQAA 2UYHA 1HFKA 1UFOA 1VIYA 1NATA 1UDWA 3QE9Y 4TOIA 4U5QA 1Y1LA 1DAIA 3HJAA 2GRJA 1Z15A 3QVSA 4QSHA 2HQSA 1WZCA 3DE0X 3MJHA 3OSZA 1XTRA 4W8GA 3V1LA 5DI3B 2QRVB 4YUYA 4P5DA 2D4AA 1JSZA 4IS3A 5JIBA 3OAAA 2B1RA 3BG5A 1SXIA 4ZGGA 2H8KA 4BFUA 3FJYA 4JCCA 1U80A 3CRRA 5D85A 1Q5PA 1Q14A 3BSWA 4JSTA 4RVHA 2LXNA 1FLNA 4JJ4A 4W5HA 2RGXA 4TM7A 3D54D 1YBHA 2DBRA 2FUG6 4NBLA 3UMMA 2QM3A 1QZ3A 2GEUA 3NBQA 3ZU2A 3K9BA 1C50A 1X80B 3FKSD 4XOUA 1FYWA 1SMKA 1IAQA 2R84A 3V8MA 2E89A 3H1EA 4DHEA 4YR7A 2VJKA 3F6CA 3JVVA 4AMBA 1T6BY 3UJ9A 1KQOA 1NLZA 1IY2A 4ZGBA 3KB8A 4BXOB 2FRVA 4H4EA 1U98A 3K0AA 4C01A 2X1MA 1SQFA 2VT7A 2NV6A 1GTL1 1J2JA 5HBGA 1LFDB 2BZGA 1QVRA 3GFFA 3ZI0A 5C8DA 5DTIA 1KZ7B 2WYUA 5HKKA 3HPQA 1I7QB 5DYTA 1JVBA 3THOA 4B7UA 4L4UA 4C6SA 4JBNA 2I3AA 2LW7A 3M9WA 3K0SA 1K89A 4F84A 4YJGB 1ZS9A 3K70C 1P7WA 1HNWB 4L9SA 4TYQA 1NVDA 4AUKA 1XEWY 3GP3A 2MSWA 3BEOA 1XQXA 3W4JA 4CE6A 3C43A 4M88A 1A7JA 2B99A 1XDGA 1FYFA 3OMWA 2Z9DA 4DLNA 2VYND 4M7OA 5F2EA 1Z7GA 4AU1A 2V97A 4XWTA 2EKZA 3MFQA 3MXTA 4BZQA 4LHYA 2P6RA 4RD1A 3UBMA 2AXQA 1N5MA 5BMOA 2EIXA 3RSFA 1OBCA 1WPXA 3DHEA 4AURA 5CA0A 4AMVA 2A2ZA 2YFKA 3OZDA 2R4QA 1BGXT 4UHEA 4Z9AA 3UB3A 5LWHA 3A0RB 1A8IA 4RLHA 4J29A 4MIYA 1HO3A 5DOZA 1TFUA 1W6RA 3FDFA 3N07A 3QMVA 4YAEA 5K20A 2V7QA 1PV2A 4NZ9A 5KPJA 2RIRA 2ZJBA 1CVLA 1B6RA 3JQFA 2X4IA 2VHYA 3IMGA 4G0MA 2RH8A 3IULA 3D7KA 2Q8QA 4L6IA 4O4HB 2Z5LA 4XRRA 2N42A 4UPEA 5AHOA 3ELBA 3I42A 4G0NA 2L18A 5I7EA 1S6YA 3TZEA 3LG2A 3LUBA 2L69A 3HZOA 2J4FA 4DLXA 2A1TS 3DVQX 3NMUF 3PLNA 5BYKA 2DRIA 4EYSA 2ACVA 3QPCA 4CKCB 2D5IA 3KZMA 4MPDA 4Q4JA 4HTAA 4F4CA 3PJGA 3UHPA 5BSFA 3F67A 4LMBA 3N76A 1COWD 2R7KA 1E9VA 4QJ3A 3TUIC 4PSCA 2O48X 4MR9A 4FDAA 3H5AA 4RLQA 4O8ZA 2VP0A 3R5JA 4WV3A 3MRXA 2F8SA 2IC5A 4KQFA 2VHJA 3V8BA 4CYMA 3T7IA 2B4TO 2OBLA 4M7WA 3WSWA 5JOQA 1ZR2A 2GJKA 3GJRA 2PX3A 4BOYA 1XTTA 3GHYA 4WFJA 3SR3A 4ZD6A 4QHTA 2YZ2A 1M8FA 5DDIP 3DHNA 1XPUA 1WOYA 1A77A 3AH8A 4Y2RA 1T9ZA 1K6MA 2ZWMA 3BMQB 3KZOA 1DCFA 4R9UC 1YE3A 1Q7CA 2GOYA 1I9GA 3ET4A 1B76A 4Q9AA 1OXKB 1O6ZA 1SGWA 4OX9B 4MUBA 1VP9A 3V4FA 3P9ZA 3VYSB 1P4SA 2IOQA 2YIDA 4ENWA 1NVVR 2DWCA 2ZU0C 3SQOA 1TKCA 1X8LA 3L4KA 1M7HA 5KBYA 1AQYA 4Z1OA 3OFSA 5ICCA 1OCEA 3UJCA 3WB2A 4E5YA 2R97A 4MW9A 3ROEA 3ZDEA 1ZEJA 4ACAA 1X7WB 2YJNA 3LPLA 4W63A 4FWTA 4PXAA 4Z2YA 3R7WB 1A1SA 1X80A 1N7IA 1TA0A 3T5MA 3V7YA 2O23A 4I4TA 3JVEA 1A27A 2IU3A 3TTWA 3WOHA 1YMUA 4OHUA 4MUGA 2P62A 3GVXA 3U31A 1R0SA 1FTNA 3WLPA 4E13A 2UUAB 2HCBA 1CZOA 4LJLA 1TGVA 5KVQA 2CLMB 1VCOA 2QY6A 3OKCA 1C9DB 2FP4B 2GKSA 3FNEA 2WJYA 1VCNA 3CEMA 4U7HA 1NXWA 1QHIA 1UXGA 3I52A 5DP2A 3TIFA 3HXKA 3NHMA 5EFZA 4XWAA 1WNFA 4HAWA 1PQWA 4XWYA 1ULHA 3TXYA 1C30B 1VRVA 3S1AB 5GJWC 1UXIA 2WIFA 1H2RS 4RD4A 3D02A 1Q7EA 4KFTA 4D44A 5LJIA 5JCPA 4MRAA 1J8YF 3V8QA 4DIEA 4IMPA 5TS2A 2A1UA 5AKXA 3WMGA 1AC5A 1G21E 1O08A 4RD2A 1K0UA 2NU8A 5B4VA 4LVUA 5LQDA 2DBZA 4G1MB 3K5HA 5DFAA 1XJ5A 1YSCA 2VI5A 4F6LA 4HN2A 1WCIA 1L8OA 3ROTA 3ITNA 3PUVA 4DDHA 2H54A 1QXSA 1EA7A 4G0XA 2VAMA 1E7QA 3R5TA 2DJIA 1R0XA 3I2FA 3KT3A 1Z6QA 3PHHA 3KDSE 3OCVA 3QK7A 4WLNA 2FZKA 3CGWA 3UZUA 3GLGE 2BBTA 2QV0A 5GONF 2FQ1A 3N8HA 1WQ1R 5J59A 1IMJA 4DLKA 3R7FA 1GPUA 2EFGA 3O1HB 3S8MA 2EBUA 1X9HA 2IDJA 3SJAA 3WWEA 3ZBUA 5B12A 1B74A 3MXOA 3DVAB 4JBYA 3W2HA 1B6TA 3PWTA 3COSA 1IMOA 2JGRA 5AO9A 5TX7A 3G9TA 4FMCB 3C5VA 3PC8A 3U5TA 3PHGA 3DLAA 3GVCA 4NDAA 3K2IA 5DNAA 5KS2A 1VG9B 2KBEA 2XUIA 1HYBA 2EX4A 2WI8A 4R83A 3FKJA 5DK4A 3RBVA 3WYEA 4K87A 3KCNA 3GARA 3IVAA 4YJ2F 3BF8A 4GOND 3QY0A 1VKZA 4P6VF 4EENA 1NLMA 1UKBA 1EXMA 1E1QA 3T61A 3O74A 4BAGA 4LWOA 5ELXA 4FEGA 4I55B 2WTUA 1VTKA 1UIRA 3A1TA 3B9BA 5IDXA 2P2YA 1NNLA 3JZMA 4MRMA 2FWIA 4BV8A 4G4SO 4NYMQ 4RVGA 2TS1A 1QYDA 3RTAA 3PXDA 3WG9A 1GR0A 5EQJB 5A4FS 4Q16A 3OPMA 5AM0A 1E2GA 1O5TA 2QRNA 2P90A 2RK4A 2M98A 1IBLB 1KBQA 1GL3A 3RC8A 4IJQA 4J0JA 1N8TA 3E58A 2LZ0A 3QNWA 5JS7A 1ZZGA 3K3PA 2GF0A 4RAOA 3SHWA 2LKDA 2RHHA 3NI2A 3EJWA 3NOVA 3JQRA 3GMSA 1QOZA 3BDIA 1DAPA 2NQ8A 2I99A 1QH9A 2YR0A 3EEIA 4G5FA 2HXGA 1TTQB 2Y1WA 2ZGVA 4CQLA 3NV9A 2BKLA 4K46A 2NP6A 2YXPX 3BOSA 1QIIA 2JHFA 2ZBQA 1PX2A 3QVLA 2Z4RA 4GVPA 4ZVLA 2B0CA 1QB7A 3CKKA 3ZQKA 3DT6A 4MIEA 1V4VA 2E5LB 1V4NA 2O8BA 2BI4A 1HDXA 2CLEB 1PJZA 3JAWA 1T8TA 1KYIA 3K5WA 2AMVA 3T15A 4D0NA 1IRIA 1G8HA 2WUGA 2AHRA 2NAFA 2N3ZA 4QBGB 2GBCA 1T43A 1KJ9A 1WPRA 2WU0A 4NS4A 3IV7A 1M2JA 4Z99A 1OX6A 2UUOA 2V1UA 5SY4A 1RJFA 4G5YA 3WDKA 4FQ5A 1NQWA 1ZMTA 4D4MA 2OQRA 3ONEA 3W3AD 4F21A 5EE5B 3T5BA 1HQCA 4CPDA 5FEUA 4W8OA 3QHAA 3T8YA 5BWBA 1F60A 1OYWA 2QN7A 1NN0A 4QJBA 4XCXA 3TM5A 4KKXB 3RF7A 1XD2A 5DM2A 4OQYA 4TMKA 3FJ1A 3WKAA 5EEHA 1SKYE 4BGIA 5LA6F 2A94A 4JUAA 4R8SA 4DSNA 3MK31 1NASA 2EFYA 1FDWA 3DMTA 3JALA 1LK7A 3VR0A 4F8YA 3VGJA 3UAYA 3DXZA 2XY4A 4EL0A 1V5WA 2WP0A 4GAEA 3Q41A 4OPMA 4UUPA 3I5XA 4W5QA 4PC7A 5F5XA 1M2HA 1USUA 5A3VA 4MR7B 1XLVA 3L0OA 3OPYB 2J0UB 5FFFA 3NBAA 2O5EA 4D3YA 3MIZA 2ZAMA 1K7EB 1OASA 4LVNA 5GVRA 2HJRA 3IH5A 1N6HA 4P4TA 2BM0A 5A06A 2Q29A 3K70D 5JH7F 3DAHA 4LXHA 3SXUB 1M76A 2WG2A 5DYGA 5THXA 1WEKA 3UJ8A 4QPDA 2YCBA 4ZYTA 1XHFA 4ZT6A 4I66A 5IJ9A 3LH5A 3DH0A 1O2DA 2F62A 3DKKA 4IF6A 1K86A 5K99A 3EG9B 1WU7A 1P60A 2VZ8A 3JQBC 1FVHA 2WIKA 1R1DA 2W2MA 4MWZA 4DW8A 3O9MA 4D0SA 4ABTA 4BE7B 2W6PA 4MV4A 2H5EA 3NDPA 5GMOA 4M2LA 2QAJA 2XDQB 3B82A 4HEHA 4K8OA 3UXYA 5I5EA 4PPGA 4UMVA 1TW3A 1V4BA 3T9EA 3RQIA 3MOIA 2VRCD 1ZOOA 1N2CA 2CXSA 5K3AA 1XPOA 4PAWA 3WIUA 3GN1A 3UAZA 2FQXA 1Z25A 3VI4B 3JALB 1HRDA 4NK5A 3T3EA 2OV3A 3LC0A 3NM6B 2BMFA 5F51A 1AUQA 2XKBA 4BDSA 2CHQA 4Q3DA 2I9KA 1I0LA 1N2SA 1X3SA 1YAJA 1Z47A 4MB2A 1OV4A 2XV1A 5K0CA 4JB0A 2CJXA 3MJEA 4WKOA 3P96A 2IH2A 4BNDA 3MCVA 1U6IA 1YGYA 2Z83A 1YDWA 4BNZA 3FVWA 4MCAA 4JBLA 3I2HA 2IX3A 2EQ5A 4ZEMA 5A4AA 4ND6A 1FQJA 4NMWA 2A9PA 4BGDA 4P58A 1AKRA 2GYYA 1KMQA 3DR5A 2G8NA 4GXTA 1XAHA 5HM6A 4L9AA 4ZZ3A 5KU1A 3EXG2 1QAMA 4RJIA 4XSHA 1A4UA 1XV5A 3FXAA 5IKXA 4I5EA 1Z16A 3RYFB 1OBVA 4NCNA 3FTEA 4PYMA 5ESRA 1ENZA 3OJOA 2DQYA 1GFIA 4Z0TA 3ZCRA 5KTOA 3KLNA 2AI1A 5SV2A 2WM2A 1JT9A 3HEMA 2PXXA 3GQBB 3LSYA 1GJRA 4YMVA 1DWOA 1VLVA 2Y4OA 3N5KA 4NABA 2ZYDA 4DNXA 1XRLA 1LLQA 1ZXXA 3MPUA 4WHMA 5KHLB 4Z5XA 3MLBA 1ICEA 3B3JA 3QYPA 2R66A 3ORFA 1WB9A 3TQHA 2E21A 2AFIB 5KZMB 3MQ4A 2IHZA 2Q3HA 2HY7A 2JFOA 4ZZ0A 3PGXA 1XZCA 3RARA 3EZXA 3W1EA 4EW3A 3GA7A 1HE2A 3NPAA 4TL6A 3ASVA 4ARCA 2NNWB 2OAEA 1M6HA 2GBGA 3FOAA 4RSRA 4HNTA 4NJEB 1PWHA 4ED9A 3A58B 3L1KA 3AZQA 4F97A 4P9NA 4MWGA 5CLIA 2B94A 2WWGA 1C7EA 2BGIA 1L7DA 4L9RA 1I4TD 1P0PA 1ZXBA 2H4HA 2YQZA 1IN5A 3PS9A 4MYTA 4R3UC 4A8JC 2RG7A 4K5QA 3HDGA 3PQ7A 4N5HX 4CM5A 2XB2A 1Q0RA 4XYBA 3L0IB 3UT6A 3IJEB 3FWHA 4YVFA 5KKCA 4J7XA 3VI3B 2G9ZA 4N8DA 1Z2OX 1YKSA 2C1XA 1H6AA 4OI0A 1FFYA 1SUAA 4BFXA 5CA1F 2ZM6B 4KPYA 4RWZA 3O8QB 5E6SB 4OF4A 3C8MA 2X6QA 1E3TA 4RO0A 3SC2B 2ROQA 3O2SB 4AZ0A 2GCEA 4TLMB 1B2LA 5TT1A 1P18A 1Z0UA 2AGVA 4EH1A 2GJ9A 3EA4A 2BKEA 5AM1A 2VEOA 2NU8B 3ZQUA 2A0UA 3G7NA 3D2LA 5L7WA 5AHKA 5LP6F 3KFXA 1WUKS 3LL7A 5M2QA 3U56A 3WBJA 3ZGXA 2F3UA 4TLLB 3CY6A 2ID4A 3JWJA 3NPMA 1SA0A 1J8MF 4FD3A 2APJA 4G84A 3ZH2A 4GEGA 4CCYA 4M0CA 1Q77A 1UC4B 1BRTA 2EW8A 3KJGA 4B82A 3BXPA 2A14A 4F04A 1DMSA 1TLLA 1KI6B 1RZVA 3U7QB 2CGEA 1EAYA 2RGDA 4HMPA 1USKA 4WLOA 1XCPA 2XEXA 3JVIA 4K9PA 4FKMA 5BNWA 3G6KA 5I9LA 2EG5A 1DDGA 1TKBA 1WU8A 2HMWA 4F2PA 5TPZD 3GLTA 4DR5B 2ZZMA 5F9FA 2HHJA 1VP3A 2H0AA 4FFDA 5LKRA 4R1QA 1GGEA 1AUXA 3RG2A 5KX5B 3KOXA 4O4LA 1HE4A 3QU4A 5D3QA 1INLA 2ZRNA 3CPJB 2PGXA 3LLMA 4N9QA 5EJ5A 3LCVB 1XIVA 1UJ5A 2J85A 3BF7A 1XEXB 2GPYA 4IIDA 1R6AA 1EUYA 2JCVA 3TAHA 4EMUA 4IFBA 1B15A 1DAEA 2GBIA 3K2BA 5KYYB 2H59A 2Z6QA 3WGKA 1QVVA 2CLCX 4TTRA 4WLEA 4WADA 4BQQA 4I2VA 4EA7A 5F52A 3DKPA 3DYIA 5BYJA 1NFFA 2DSNA 3DEJA 4BN5A 4MWEA 4JLOA 2F59A 4N4AA 3ZWWA 3X1KA 5IYZA 1AN9A 2VNJA 4FTWA 4US2R 3X1WA 4KQ2A 4G8CA 4KMSA 1AKVA 4PZUA 5EINA 5H5JA 4IMJB 5KOJB 2X2FA 1KFBB 1WDLA 1Z88A 1Z6YA 3RVPA 3DHVA 5AVXA 1GN8A 4ZAGA 2D54A 4W5JA 4BHTA 2JPDA 1VG1A 5HS6A 2XCIA 4BZWA 1A0OA 2RHJA 1UXJA 2VRWA 5IXYA 1JEJA 2G6BA 1PE0A 1QLHA 5BYBA 3VU1A 2R1VB 3ECSA 1UKZA 3UV7A 2YYSA 5CB4B 1QVWA 1Y82A 2I2AA 2OAP1 3F0TA 3K9HA 3MWKA 4HGOA 1G8SA 1QYXA 2VWHA 2YL2A 4HQ0A 4RZUA 4WNAA 3UANA 1JR6A 4K2HA 3WYFA 5JNLA 3SQNA 5B1YA 2VNHA 1V11B 3VMMA 4QGFA 3PRHA 5JSHA 1K3UB 4MKFA 4XDYA 2HTFA 4B3FX 4C4TA 4URVR 3H4VA 4HBGA 1F0PA 5K09A 3R6TA 4GKJB 5I7AA 4BRSA 5FBZA 3CIOA 2ZG6A 3N2KA 4XM1A 4Y0VA 3ET5A 1G63A 1LLCA 2VPTA 1MEEA 3ABZA 3H8SA 3JATB 4YPVA 3D3EA 4XWGA 1SKBA 1FRQA 3U1BA 1T9GR 4YQFA 1CQXA 4RVUA 5TJHA 1QH0A 3FKSA 3DFIA 4LC9A 1FBTA 3BWEA 4URWR 1HL7A 4P80A 3IJRA 5AJVB 1RZUA 3T5CA 4JENA 3WQSB 2BFPA 2D0OB 3BXXA 1HI9A 3HU5A 1Z0KA 4NZYA 4ZYLA 1OIVA 2YVQA 3FIUA 2XMZA 3CFYA 4LGMA 2QTLA 1IEXA 3QYFA 4N6NA 3V4ZA 3VR5H 1MG5A 2V9ZA 3ZU3A 1NQUA 4DKXA 1H4VB 1G5QA 4FFOA 4N3AA 2GM4A 4PSUA 3GJ3A 4IV8A 1PVDA 5KC9A 4KR3A 3ZXYA 3A4NA 5FOQA 2GD1O 1C0KA 3L46A 4JD5A 1GKIA 3DYBA 3TVDA 2FR1A 4ISBA 4NJMB 4EGCB 2GEVA 2XJ9A 2RGNA 2YV1A 3AINA 3NYQA 4ER3A 4Q9JA 5K5EA 5DXJA 3WFZA 4REMA 4LTNA 3NT4A 1EUDA 1M34E 2W11A 1JU3A 1QG0A 3TEMA 5M04A 5JCOA 2QD5A 4E33A 4KQIA 1RACA 3I6YA 1J90A 4L7QA 4UBKA 4IDEA 2NGRA 4K6KA 4EF6A 3RVQA 2ORIA 4EHIA 4M1YA 1R4NB 1UBLS 4TUYF 3RDPA 4EHNA 2NVWA 5E7MA 3OUTA 3VJMA 4BMPB 2BJWA 3DTVA 1U9ZA 4WY5A 1KK3A 4B6JA 1ZKDA 1KZYC 1DV2A 4MEBA 5L6MB 1S2IA 1J9ZA 4AO8A 4A26A 2DCMA 1R6UA 1JECA 4MVCA 5EZYA 3IBSA 3DMHA 4DPKA 2QVYX 4RF2A 5B36A 1E1QD 1NULA 2Q0QA 1SCUA 2A5LA 3MF4A 2BI8A 1XNHA 2J45A 3A7DA 5AD1A 1ADBA 1DWPA 2V7QD 3KYDB 2JVIA 1BDJA 4CMGA 2C00A 2MSLA 1P1BA 1T5IA 2Y2UA 1E0KA 2IRWA 5CB6A 3HFSA 1BE1A 4G07A 5KCZA 4BE9A 3DEZA 2CD9A 4CEJB 5ALTA 2F43B 4FMDB 4BBAA 1OJ7A 1F8YA 1SU8A 2CK3D 5DHRA 3VVCA 4D74A 4N3NA 5FPYA 2H7CA 3TQFA 2PUWA 2YQ4A 4EFLA 1BJTA 3CO5A 4BNYA 4RADA 1RHJA 7GPBA 1XMSA 1T8UA 4ALMA 4BJ5A 2VK2A 2NZUG 3ZDZB 3E8XA 3N6VA 4QFCA 5AW3A 4J3JA 4C0SA 4LFBB 3LCUA 1TQHA 4K2AA 3SXJA 1COWA 3R0IA 1NMXA 5KYWA 1RMQA 2Z8YA 2AMLA 3AVTA 4Y0AA 2J7KA 2Q8PA 1W25A 4JBXA 5J4KA 4UDYX 1QK5A 1JMKC 3WV4A 3QXGA 1CRZA 2HF7A 1R27A 2D62A 3CO0S 1PKEA 1Q1BA 2AH5A 1JKMA 2P6UA 4UM5A 3HXTA 1TZBA 4WBNF 1R0CA 3EDYA 3ETLA 1CW2B 4TS3A 4DMHA 2FFJA 1KAEA 1NR7A 5AHXA 3KPJA 1ZVJA 3E2PA 4CCWA 5C2JB 1A71A 3FN4A 1PR4A 2QT0A 3N87A 4X1KB 2BSQA 2BEVA 4C7OB 1K08A 2Z43A 3AF6A 2VBCA 4OYYA 4RXMA 4WCFA 2IVZA 2DTDA 4ZA2A 2PWAA 5EMNA 4HUTA 2QZ4A 4ENQA 3LWBA 1TEHA 3WMRA 4ROTA 4Y1EA 3RHFA 3CVYA 4LZOA 5DSTA 2Q4DA 3R4CA 1EAMA 1S2OA 2B1QA 1M1NB 3IR5A 4M87A 3COYA 1GOTA 3W05A 1W36C 2BHNA 3TFQA 4M0KA 2Y6VA 5F76A 3L92A 3PCRB 2JI6A 2PD6A 1U1GA 1WLSA 3GGOA 4NFLA 2IHJA 1NAIA 4FS3A 4IR7A 3IAM6 1RWKA 4FOSA 4LZZA 2XT0A 4MLPA 1WXFA 3BERA 2VNAA 3KVOA 3QVMA 2F17A 3DONA 5CAEB 1U8AA 2MWMA 1R6XA 1RLMA 4KMRA 4KU4A 4LK3A 3STVA 5AW0A 3KQUA 2FEKA 1UJ2A 4A2PA 4QOHA 1A9QA 1TT7A 4H4DA 1H2YA 3OZFA 4HQ6A 3IQWA 2CN1A 3KJNA 1SUCA 1KERA 3ANTA 3HL4A 3PUYA 4M99A 3E4CA 5EE3A 3RS0A 2QL6A 2B36A 2PRIA 3AR6A 2J1LA 3RE1A 5JSQA 1K2WA 1TC2A 1M2OB 3QMWA 5KAPA 5KTTA 2BFEA 1R9JA 2IPLA 1KY3A 3QNMA 4Q24A 4TTIA 5FORA 1XL1A 1W8IA 3TOXA 4EHHA 4JEIA 4UOEA 5KVCA 1DADA 1O6CA 4KGZA 3ZI4A 3KSRA 4JASB 2C4TA 4N0PA 4ND3A 1GUYA 4YJ3A 1QCCA 2YS7A 3GLHA 4PYJA 3GRUA 5DNCA 4RLSA 2H8GA 2LCIA 4GYKA 1FMTA 2Q1XA 1PGOA 3EGEA 1DBIA 1O94D 1D0IA 4GPTA 4MJ3A 2VDMB 1VPVA 4RTNA 3C39A 3TL6A 1Q1ZA 2OKCA 1SQ5A 1HQYE 3E35A 2QW1A 2XOEA 3BILA 4G89A 4HWSA 5CFZA 3RAGA 1E6EA 3ORHA 4BUJA 5F78A 3G0CA 2IUSA 4UEOA 4CQNA 1YRYE 5LIRA 1ZLXA 3ZV4A 1KAMA 2VJMA 1JAYA 4P3OA 1EWTA 1US8B 4DJFC 1YOVB 5KU7A 2XF8A 3K1JA 4UBLA 3KYCA 2E4ZA 4NPAA 3CZMA 4TMXA 1V1RB 1DBQA 1CZRA 1KZHA 2HNAA 1WW8A 3LBAA 2H1OA 1ORRA 1YFKA 3EGXA 4B6OA 1TZJA 3N7TA 4BRZA 1ZN8A 1XVUA 4K3VA 2JAHA 1QGUA 1S3SA 4PSVA 4BFCA 1WUJS 2UYYA 3E48A 3BCSA 3M3DA 4E5PA 1EP1B 1PN3A 1X1CA 1Z73A 2J9FA 2BEVB 2VDNB 3BCUA 3F3SA 4KWCA 5E2IA 4C7OA 3BQMB 4BV2A 3VYWA 4PICA 3UQZA 5TGZA 3I76A 3T5GA 2B9EA 3HKBA 4DQXA 3JYHA 4EW6A 1DC8A 1GWNA 2FW0A 3KQMA 3SSAA 1VHLA 5AI5A 5FT9A 2EQBA 4QG7A 1UMCA 4YXFA 4HNHA 1E1YA 3M5PA 4GSYA 2OSBA 1AE1A 1CJKC 1U1FA 2XVYA 3JYOA 4L8WB 4EIWA 4H1UA 4RK4A 4N48A 2QTFA 1F6BA 4HX2A 3GPLA 3ITDA 5G3YA 1JJIA 3AOEC 3R9XB 2REXB 1AZTA 4LDAA 4B9AA 1K97A 4YWJA 3T3IA 4HWTA 5GZ6A 3HVRA 2PE5A 5KYUA 4KC0A 4U2GA 5L3VA 3NVKI 1RHMA 2NSJA 2VIIA 1C81A 4G9BA 4RL6A 4A0RA 2A88A 1K1EA 1B42A 3H99A 2D0IA 3LPNA 2CNNA 2JJMA 3STWA 3H11A 3AK4A 3LC1O 1HLDA 5K01A 1P17A 3DMRA 4N12A 1NMQA 4TZKA 1JAIA 2P67A 5IH3A 1HYGA 1PIWA 4D9KA 4UCFA 5C81A 2BY4A 1HE1C 3GNTA 4GMXA 4R8MA 5H3LA 1UKCA 5DNDA 3ZCUA 1AQNA 1F0YA 5BQ5A 3Q2OA 1V16B 1KAQA 3GLFB 1E2QA 1E5QA 1JDBB 2OHHA 2PAAA 5EXPA 5BT9A 2QQEA 1Y9ZA 2BEWA 1AU9A 1D2GA 2V8BA 5T8KC 2BFBB 3HU2A 1NRJB 1U5BB 3U4IA 4I7EA 5LN1A 2PZ8A 5GV8A 3RIXA 2EYQA 2X13A 4RE5A 3L7JA 3LECA 1XMXA 1L6IA 3CZPA 3AM1A 4CM6A 4N9WA 5J9FA 1WMFA 4WZZA 1QKIA 3IO3A 4ZU6X 3U80A 4C3ZA 4F85A 5HUQA 3C98A 9MHTA 1QRDA 4IEEA 5EPOA 4ZEVA 3ZVMA 5IVDA 5ADHA 1ZR4A 4B6SA 2C2YA 4LXQA 3SIXA 5CVTA 3PGJA 7MDHA 2HLPA 4NYJR 2LWIA 3CT4A 1W19A 3U0BA 1D6SA 1H2BA 1SOVA 3A9TA 4ZXPA 1XWWA 3TZLA 3AJEA 1TAUA 2IYOA 4UVGA 1YRBA 3AIMA 4G86A 4R7ZA 3RWMB 5E3HA 1ZNQO 4GZ5A 3P9KA 3X1ZA 3M82A 4JI0B 5ESWA 3CJQA 4P5PA 1JU9A 3LV8A 2NUPA 1DAFA 2CB0A 2OGSA 3IDAA 3BJRA 4Q9NA 5FWDA 1YC2A 2JNWA 3FHOA 7MHTA 3R7NA 4R05A 4TKVB 4ZI3A 1Q0LA 1T9DA 5IABA 5ALJA 5DLQC 1SG0A 1MORA 16PKA 5KJEA 4WCFC 1YS4A 4TVKA 3R7LA 3L18A 1S1CA 5FXMA 4R98A 2IHBA 4Q3OA 2GM3A 3UM9A 2I54A 3EIEA 4LF9B 4QRIA 1MH9A 2J3DA 4R2HA 3GLFE 3EPHA 5FUVA 3AIOA 2CL0X 3JPYA 2J3IA 1V5EA 3OHPA 2YX1A 3U7EB 3JQFC 3SP1A 5CB8A 1XCGB 1YJAA 1ZJJA 3TG8A 1ZCAA 5BQXA 2W42A 4JR0A 1A4IA 2A5GA 4ZAYA 3QP9A 5HVNA 1J6UA 4UNQA 1XRNA 2CFIA 5F3RA 4M1TA 4OL9A 3ZWBA 4AMZA 1MZPA 1LX6A 1Q7TA 4D1YA 3FTNA 4N3GA 4BVFA 3OTWA 4R9NA 2I6SA 5LMUB 4AC9A 1GG8A 2LKCA 1J07A 1DSSG 1F20A 2P2ZA 2G1KA 4J76A 4P4SA 4U00A 4BLTA 4DRXA 3P2JA 5CNMA 5IVPA 5K8IA 5KMGA 3BBLA 4BP3A 1JHYA 3AMVA 5K0GA 1D3AA 3C2QA 4EVQA 1E5DA 4IL5A 4YXWD 4F72A 3VPHA 3DPSA 1J5XA 1VYHA 2A0KA 2WKPA 3HYTA 3EZ7A 3IBCA 1J21A 5F21A 1MHPA 5G0UA 3ZZNA 4DQLA 5LQAA 4FOPA 1YTUA 1IN1A 2C4NA 3OA0A 2WF7A 5B6IA 1C9KA 1WSDA 1ZUNA 4DCMA 3O8RA 1W9HA 1T4DA 3IE2A 1LY1A 2GZ3A 1OGJA 2LTAA 4MYDA 4W8HA 4C21A 4F60A 3LIPA 3K7EA 5KVSA 1T1RA 4BL5A 4URXR 2G9NA 2FWAA 1NDUA 1OMOA 1XEWX 4M1QA 3VSAA 2XAAA 3RBZA 4B79A 4DA8A 1R8XA 4G8BA 3HCNA 1HTWA 4XQ9A 5CUQA 1IZ0A 1C3EA 2HWKA 4M4SA 1KOLA 3H0KA 4PLZA 3X44A 3ZWCA 4KQ9A 4CDMA 6YASA 8LDHA 3ZUGA 1B8OA 1VKRA 1Y9JA 4IV5A 2RE8A 4ZYWA 5AK3A 2AJLI 5F2KA 2BHRA 1KKMA 1PL6A 1DEKA 4J49A 2DUMA 2FH5B 3DAFA 4YAWA 3F96A 3OF2A 1WW3A 5DMXA 4EI2A 4DSUA 3E6AA 4EQ6A 1KI6A 2VK8A 1SXJB 4E4TA 1AKEA 4R84A 1Q50A 4Q7JB 5D3KA 4BMXA 2Z95A 5JJ5A 3GJQA 4LV6A 1BA3A 4RXUA 1PP4A 4TVBA 3WVNA 1HYHA 3BN3A 5AI6A 2BRUA 3GDWA 2SBTA 4JOQA 4BV3A 1FVXA 1MOZA 3FDZB 5B3LA 1PGQA 4MI3A 4BMSA 4AY3A 1KNXA 3KV3O 2ZXUA 2P9TA 1E9SA 4KQEA 2GESA 4UPDA 1M33A 3FUXA 2BMAA 3AM4A 1QZXA 3CLTD 4WXHA 2QPAA 1KBZA 2YV4A 5AVKA 5A6SA 1N6IA 1PI3A 2IP1A 1R8SA 2BP7B 2VH1A 4XDHA 1SCDA 2XYHA 2J9YB 3EH2A 3TMKA 2BHSA 3KOOA 3LQ4A 3EARA 5KNDH 1MB4A 1WQ4A 1G20A 3RRBA 3TJRA 2F6RA 1B43A 1ODIA 1RI2A 3IILA 4MPPA 2PBRA 3M6MD 2B4KA 3MAJA 1QQ6A 4C6TA 2RGUA 3BGWA 3CU5A 1FNSA 1FMCA 2YVUA 3DTVD 1CD5A 3PSAA 5MFZA 2DZDA 4DT1A 5ICSA 4RIGA 3SQLA 2BTEA 2IEZA 4OAOA 4GUAA 4K9OA 3FLEA 2ZVJA 2W6JA 1EFUA 3LC2O 5JFTA 4JEHA 2V9CA 4DBVO 1OH6A 4II2A 2BUBA 3C5EA 4FX2A 5HEKA 4BU1A 2A4KA 2ZWAA 2COUA 3B78A 4A9AA 4JJFA 2HU7A 3A11A 2E4VA 1FRFS 1GQSA 1NVKA 3C7AA 5IAOA 4K40A 2CUZA 1KZ6A 1XL0A 2PD3A 3H83A 1STOA 3JWPA 5DBOA 4ML3A 2IXAA 2O8FA 2PL1A 2IBTA 2HF8A 3HJRA 4IJ6A 2XNDD 2F1IA 3F71A 1N1EA 3QOXA 5ICFA 5BWMA 4YP0A 4GXRA 5CDYA 1P1JA 4O2BA 3IHLA 3OF3A 5ED0A 3BCRA 3TEJA 1E79D 1O7JA 3HKDA 2H85A 2GJSA 3G7UA 1KU0A 1YC5A 1X2EA 2GLUA 2YJ5A 3A26A 5EQFA 3QM1A 1KHHA 5FUQA 1P4JA 1JB9A 2QY9A 2Q0SA 1HBJA 2OBNA 2OV2A 4WZ6A 2JI7A 2O1XA 2QUHA 4RFSB 3L82B 1P5HA 3EW9A 4K1LA 4FE4A 4QA9A 3E9NA 5LZ7A 3TSAA 1LPOA 4GOXA 4NTZA 3ANNA 1S1MA 3MWEA 4ASUD 3GEMA 3RAEC 4RKQA 1WXXA 3EXEB 5E1BA 3KFLA 3OEWA 1WQ3A 3O7WA 4Y1FA 1PTJC 3NVDA 5BV2P 1IEWA 3AB3A 1VSQA 1N2GA 1L7VC 3U81A 1EDOA 1J0CA 1O9GA 2WUVA 4IWXA 1ZW6A 4MI9A 5FTNA 3ZDFA 3L4JA 2JBHA 5JCJA 5H8WA 3WGOA 2C0CA 2GVZC 4MZDA 1J0BA 5FL7A 1I6MA 1BD4A 2NPOA 4IZOA 2SKCA 4ONEA 3LX5A 2FUCA 3VC3A 5DX8A 4XYGA 3R3VA 2I0FA 3N86A 2WPDD 2IX9A 3MD0A 5FJJA 4EO9A 2BKAA 2I3BA 5ER9A 1V6CA 4QOFA 2CWDA 3H2JA 1Q1QA 5B6PA 4JYPA 2OMEA 2RKOA 4MPRA 3DA8A 3Q9UA 4CKBA 4ETNA 3QUCA 5HWSA 1JGTA 4ZHQB 3VA7A 3DZJA 4R51A 2BI7A 1EPUA 2XGGA 1JA1A 1JB1A 1I3LA 4KYTA 3B1WA 5D6NA 1NF3A 1VE6A 4CU5A 2XXJA 3DL0A 2JFYA 3NIGB 3O8OA 3O8CA 5CH3A 4LKOA 1LS1A 1G6OA 3BJEA 3A1UA 4B8WA 1X77A 3L0CA 4U0KA 1KAHA 3QBDA 4QYXA 1H1TA 1Y4AE 5TNXA 4OX9Y 1T0UA 4QGGA 4FZ5A 1S89A 3WHKA 4YBRA 2A59A 1JH8A 3N8IA 4WUVA 4DVJA 3KOZA 3SEFA 4J0GA 3P9RA 1FDRA 2POQX 2E2WA 4ER5A 1V8FA 1XALA 1W94A 2NQTA 4KLNA 2QROA 2BAGA 2C2MA 1JZQA 1L6RA 1TC1A 2Z4SA 4OM8A 1TQ6A 2FA9A 4KR6A 1JFVA 5TQ0A 1OROA 4AP6A 1GPBA 1FFGA 3RNLA 4MLCA 4HQKA 4GR5A 5TF4A 3W8DA 5CFMA 3TCNA 5ENDA 2P9FA 1L5HB 3H75A 2X76A 4BKPA 1GZ4A 1U9CA 2ZR7A 1N4DA 2HBRA 2WMDA 1CWUA 1RBZA 4CMEC 4DB2A 3ULKA 2J3HA 2NAPA 4TT3A 5BSUA 3T3DA 5LNK1 2G1JA 2V55B 4OFBA 3NFRA 2WTXA 2PNFA 1DKNA 4CKEB 4H7JA 1U9YA 1PJ3A 4I81A 1DELA 4O8CA 1G5HA 2WR8A 5AOVA 2IIPA 3L0YA 1E0DA 1I3MA 3R6LA 2I6GA 4UUQA 3SNHA 1T2UA 4D96A 2WABA 4I4TF 4JJAA 4B09A 3DZFA 4PX5A 4WOPA 1B0PA 3TZHA 1U3UA 1A97A 2HJSA 3DOIA 1BW9A 1MJ5A 1U8TA 2HK8A 4QXOA 4BNJA 2CMHA 1BFDA 3FH0A 4KUEA 4ARUA 2VUTA 4I8XA 4D56A 1Y1PA 4QSMA 1KJYA 4FILA 2WNSA 2HFJA 3ER6A 4V38A 2QXTA 4A2WA 3BWYA 2OXTA 4DPLA 1H3FA 1M2EA 4QBKA 5IJWA 3KK0A 3OEED 4NNPA 3T3OA 1U0JA 4KI7A 2IIVA 5ES3A 4ILKA 1AMOA 4P0QB 3PGVA 4P7BA 1WVGA 3EUAA 4ACBA 2MMGA 3BB1A 3FAZA 5COQA 4H7FA 1IOZA 3BE6A 1HK7A 3ECCA 3G2HA 1JHXA 4P5EA 4ZYYA 4N0EA 5KSYA 4K9QA 1LBIA 1ZI9A 1IULA 4ZO9A 2A7QA 2VDQB 2ZWVA 3L6CA 4KUGA 4C06A 2VC2B 3OCUA 4DWVA 3IVXA 1OT5A 5FO0A 3DP7A 1SJ9A 2Z1NA 5HIKA 3ADKA 3AGPA 3UAOA 1D09A 2XQJA 2FPMA 1A50B 1C9EA 2DLNA 3S2YA 3ZWVA 3HTXA 4TWAA 3V34A 5GGYA 4ESOA 1G2IA 4U39A 1PZEA 4XVQA 1OFUA 3CCCA 3H97A 4XRGA 5IJZA 1QIDA 3RYIB 5FD8A 4I50A 2G72A 3CX7A 1MKYA 3U17A 5AW2A 1N5LA 4JUFA 4LJ6A 1AX9A 5DF1A 3BMNB 1SBNE 3WKCA 2VCHA 5K6RA 3SE0A 2FKNA 3HWRA 4A16A 2YJ6A 2ODPA 4NARA 1LV7A 4E03A 4FB4A 2AR0A 4DR4B 4LWZA 3FWKA 2WWFA 4XM0A 4DR6B 1JL3A 4LF6B 5EJEA 3WGVA 4TSRA 5HQ3A 4DMCA 4QRHA 1AQ6A 1ICIA 1XFAA 3QKIA 1G8MA 4R8RA 5EVJA 1J2UA 1OHHA 3AUJB 3IESA 4Q1AA 1GNTA 2FPIB 2CLSA 3H5VA 1VMDA 2DQSA 4P3XA 4UMDA 5AJTA 5P21A 5REQB 3UXHA 1QQBA 1ECFA 2E5WA 4PLVA 1H2XA 2GO1A 1YHZA 1SVKA 3JS5A 1NBME 2NYVA 2OZPA 4GGOA 4XFKA 4Q9HA 3O8QA 4OMCA 3AJRA 5LIPA 4I5FA 3JZDA 5IDYA 4HLCA 3TSYA 2H3EA 3IJ5A 4LJSA 3UCFA 4E1VA 3U3XA 2PQMA 4F5YA 5DCLA 1FUEA 4JL5A 1ZP6A 2R6AA 2FE1A 3U3ZA 4CMIA 3PB3A 2FSIA 2P6OA 1XG5A 1G66A 3EXIA 5IFLA 2HT6A 3SHQA 4EUKA 2GM5A 5C1DA 2YZNA 2RGRA 4RPCA 4E5UA 1L1EA 2JFWA 1VE1A 5G1NA 3GDHA 2B69A 2ZLBA 5EHXA 2YW9A 3L1IA 1ZK2A 4RQAA 2O1SA 1ZU5A 3EF0A 1PJ8A 2W5UA 1ZMRA 4MQEA 3QKRB 4FMCF 3KCQA 3CLTC 4X1YB 2CC2A 5JXWA 4HD8A 4KDFA 5ALRA 4KQ6A 3GAAA 4IIGA 2IOFK 2ZITA 4XSVA 5FQNA 6ABPA 5G4KA 1YNOA 4ODIA 4NH4A 2ZVQX 1A9ZA 4GNRA 3M6UA 4A1FA 1HFEL 3FTFA 4LZNA 5G0WA 1ZH2A 4OOEA 1NQTA 1C3JA 4KL8S 1HT2E 3S2FA 5GVSA 3B5IA 4K6HA 5F2OA 1NV8A 2CXTA 2FPPB 3O38A 2Q3BA 1PR5A 4YAUA 5KCMA 1XDSA 4IVRA 1IXRC 1TADA 4W5TA 3GZTB 5TARA 3AHEA 3V97A 2VSYA 4I1SA 2HPHA 1YRHA 2C5FA 3E2IA 5LMNB 2HBZA 2NT3A 2OV4A 2NO1A 5G0TA 3EHEA 1DAMA 1CIVA 2NO4A 2FSVC 1ODKA 3OCYA 4MCJA 5DNYB 4DQVA 4ZJYA 4Y9SA 4PQRA 3L7MA 5A4IS 3VQTA 4TROA 2EX0A 4X45A 5PGMA 4UAVA 4YCMA 2X8WA 4BE4A 3MCAA 4WFKA 4MHOA 4XGIA 3TSCA 1SFRA 1QF6A 1GLVA 1TVEA 4EGAA 5A1JA 3DBVO 1YS9A 3I6QA 4EJSC 3BMCA 2PMDA 4ADSG 3I6ZA 3MUEA 3AHFA 4AKSA 1ZCFA 2FFHA 1UR5A 3BXZA 4TT8A 4U7GA 2OHFA 4MV6A 5EIOA 4DYDA 4CT5A 3WL3A 4ZJPA 1T3HA 3HN2A 4D9IA 3KE9A 3JQ9C 3IIMA 3ITEA 1NVWQ 4V0OA 3ZZ0A 1V9CA 1VC2A 2A92A 3DGFC 4O4HF 5BQFA 2PPLA 2RHMA 1E3LA 3D4BA 4BLVA 4S0ZA 4CZ2A 1OTXA 1YZHA 3DFZA 3OZVA 3T9CA 4BZPA 3O9ZA 1SQ0A 2ZYGA 3FX2A 1KEUA 3GPDG 2HK9A 5E6RB 1ID1A 1VMAA 2BCGY 1M34B 2XAUA 3HUDA 2CHUA 4RD0A 3VNRA 1Y8ZA 3CX8A 3EG9A 3W5HA 4ZU3A 4S2EA 4URHA 3HMKA 3SYMA 3WJ1A 4EBBA 3ILXA 5AVVA 4N6GA 4TXNA 2NMVA 3DOEA 3AJ8A 2XT6A 4H60A 3T7EA 1SCAA 3QELB 1SIWA 2OLJA 1YCFA 3EASA 4UBJA 1B16A 4D5GA 2YASA 1L5LA 4KAFA 5ECYA 3N2GB 1JLSA 1RJEA 3MAAC 3QFHA 1BGVA 1WM1A 2JFPA 3DE1X 5FBQB 3C6YA 4E31A 3NONA 3IAEA 3P4UA 4EWLA 1GD1O 5A3JA 2XI4A 5HMLA 1M9NA 3VC1A 1QVAA 1RYFA 2V6JA 4IDNA 4QQNA 1NSYA 3TIGA 4ARVA 5CDTA 3AESA 2PNJA 5FNVB 3JARB 4NWIA 3DW1X 2Z5VA 1LDEA 3X43A 1JIJA 1N0IA 2HA6A 2JIZD 6GPBA 4E1BA 2I62A 1N5DA 3DAYA 1SIUA 3MJFA 2F3TA 3DLBA 1A8SA 2C7GA 4DCNA 5LA6A 3CLUD 3O4HA 4B4UA 4MOWA 3NO4A 3QY9A 5C3UA 2C84A 4CKZA 6NULA 4HT3B 3LP6A 3OPVA 4NG4A 2PGJA 4RYDA 1E9BA 1XR3A 2ZIUB 1OIWA 2R65A 5EE1A 4EMSA 3WJAA 2WVGA 3AWIA 3HSKA 3ZBQA 4S05A 1QBGA 3E3OA 3U7HB 5HGXA 3BRSA 4KR9A 5ALKA 3SQMA 2FVYA 3LDAA 2YZKA 3ZDBA 3A3OA 4N41A 2XPCA 2RJOA 4Y9UA 2O14A 4YMHA 2DTXA 3M1YA 4HDMA 5IC4A 3LL4A 2DFVA 3N6RA 2PVCA 2I6QA 5T67A 4JLDA 3OQHA 4BLQA 4NMLA 1PLKA 2IPNA 2FDXA 2H4JA 3RJZA 4INJA 4XGQA 1CRQA 4PO8A 3AOEA 1QH1A 5K2OA 2W71A 1CZLA 1X1EA 5F64A 1V7CA 4Y6LA 5DBIA 4R1LA 3RUCA 4FR2A 3L0DA 4AJNA 5ALGA 4Z4EA 5F1PA 5EN4A 4A82A 2JGIA 1QIMA 3C4JA 3PLRA 3SFVA 3I9FA 5AIAA 3NHPA 3G6WA 3RGGA 4C78A 3K9WA 2WAOA 1YRLA 3RFVA 3ZDYB 5B2EA 2ZRIA 3NBXX 4PTYA 4U9IS 4MVJP 5LBIA 1YCHA 4Q7MB 4D99A 4MS1B 4LRYA 3QEOA 5G41A 3QXSA 4FW9A 1II8A 4OHXA 5GP1A 1ZGCA 4ZOLB 1X94A 1AOXA 1W0CA 4JIMA 1TEVA 3IDFA 4U9HS 1CFJA 4BTLA 4C2TA 2FTKE 4HFRA 1SUBA 2Q1WA 3E05A 4RZ3A 5JMPA 1A8PA 1VYTA 1L7RA 5DTQA 1ZX1A 2B9VA 4UVHA 1NXOA 1MX1A 3DLCA 3WKEA 5HPYB 3F8WA 4UVEA 3UHAA 3FPCA 3WICA 2ZCVA 2CHVA 2F4NA 2E55A 1ACLA 2I7XA 4TLDA 1Q91A 4DQ0A 1PNQA 2XWPA 5ALFA 4FGUA 5C37A 1U1DA 5A3QA 2F3QA 4P53A 5E9JA 4FYYA 3MTEA 4RIFA 1DO2A 1RSZA 3WNVA 2D6FA 1CLEA 2FGJA 1GQYA 1CLUA 2NU9B 1S2LA 3MQFA 5HCUA 4HRAA 1NRWA 4QTTB 2HCTA 4LYYA 4MQBA 4TXMA 1KY2A 4D92A 3TX6A 1YVRA 4IFTA 4WGFA 1L8AA 5AJUA 3N9IA 4HQFA 1TXGA 2MU1A 3PEEA 4IDAA 1IY0A 3J81k 3IAS6 3AGQA 1H9BA 2ZTVA 3AQIA 4DC9A 5A3RA 5B3JA 5EJ6A 4AY2A 3FY4A 2GD2A 5TIIA 3IOMA 2GCPA 1CHNA 2B4RO 4IX9A 4IFEA 3PDJA 4IKOA 2H1FA 1YJBA 3OMXA 5EKTA 1JBQA 1PFQA 2QTZA 2CLFB 1PWYE 1V1RA 1PUJA 2J6HA 3HY6A 3WTBA 1RZRD 3D8BA 2ZJ4A 3EXFA 4HAXA 2YRWA 4JDPA 4PYIA 4EY4A 1T0PA 4XQEA 2KE5A 1EFVB 2PMEA 1EBUA 1X8JA 3PRYA 2QD2A 1A2OA 4P93A 3TR5A 1DRWA 2XADA 4I3FA 2DFDA 1AURA 2Q9AA 4KQJA 2GSWA 4F8JA 3EVZA 3CW2A 3MCZA 2G63A 4LC0A 3ZG6A 4UARA 4AJ9A 4AROA 4D4HA 5CDHA 2SKDA 1UEIA 3ZV5A 1U1CA 5AHRA 5IYZF 3K1YA 3K0BA 3DZGA 5K6TA 1MCZA 3ZGOA 4S1PA 3KQSA 2MYPA 5BNZA 2J30A 2AF3C 2Y2VA 3FNIA 4FYVA 3ER9A 1EZ4A 1I1NA 2Q1UA 2JG3A 5E0KB 5I4BA 2WD9A 1Z2AA 1KRWA 4MNTA 1U7HA 4B40A 2O2YA 4MUAA 3OA2A 2FZGA 3K8ZA 5DMHA 1TM2A 4J1SA 4I3HA 1CZKA 4CM3A 4M1WA 4M9ZA 4HKTA 3MFYA 2RHWA 4FDVA 4BX9A 4OHWA 2CFCA 1NJGA 2HLDD 2N46A 3GJTA 2ZI6A 2JD2A 2X9QA 4FR5A 3WHLA 1YK0A 2QE7D 3LT1A 4HO1X 5TPWB 4W99A 3HMQA 2P65A 5HQJA 2AC2A 3PFCA 4F2GA 4F92B 1G59A 1VIAA 3DT8A 3KXLA 1JR3E 4MTCA 4R2XA 1CZHA 1YOBA 2C3PA 3LA8A 1U1EA 2GT1A 2IP2A 3IP6A 4PFKA 4ZDJA 4ON9A 2VXBA 1NVMB 1OZGA 3OZRA 1XZAA 1ZGZA 1UMBB 4JKYA 4KH0A 1JEAA 2QV7A 5ALPA 3R75A 3FOFC 4XPIA 2QMHA 4D5EA 1UPTA 2FZ4A 3H2IA 4QYWA 3ZGNA 2ILVA 2ZRHA 3GEBA 3BJZA 4UASA 1NE7A 3DLTA 5JNTA 4LGYA 3AUFA 2IHYA 4QDUA 4YFYA 3ZGLA 1E3MA 1C0EA 3DVLA 3H3FA 1BWQA 4WASA 1W44A 1VSVA 2OQ2A 4XM2A 3GAMA 5G3ZA 4NEHB 4YUZA 3W2IA 1FU7A 2C94A 3PUWA 4HH0A 3DM9B 3I4LA 3V1YA 2HLNA 1CQJB 4PAQA 1G1MA 4M22A 2JJQA 2R6HA 5IAKA 5L51A 1P7CA 3HUUA 4JITA 1UEXC 1BH2A 2DAPA 2W6OA 4RE6A 3T7CA 4CTOA 2I7TA 1K8XB 1FSZA 1TOAA 2B1IA 1JYFA 1KETA 1NBIA 1ULSA 4D7AA 2W8ZA 4U2FA 3NRJA 3WS7A 3CRW1 4HB3A 4IJ5A 3S1LA 3A37A 1WUYA 4I1VA 4MXDA 3J7TA 4NH0A 4YTEA 1TEXA 2XCTB 3T7RA 3L06A 1J9GA 3RFXA 3P0HA 4HNUA 1K3TA 1SBTA 4E32A 1Z62A 2X19A 4NYMR 3V42A 3RTDA 4NY1A 2W22A 3WADA 4UTRA 5DW0A 1VL8A 5BN5B 3LX4A 3DNFA 4JT8A 3I61A 4J0EA 4JGBA 4PZDA 1GA1A 1L3BA 4TWZA 5D5PA 3RUEA