3JWIA

Crystal structure analysis of the methyltransferase domain of bacterial-cthen1-cn
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
198
structure length
195
Chain Sequence
NLNQQRLGTVVAVLKSVNAKKVIDLGCGEGNLLSLLLKDKSFEQITGVDVSYSVLERAKDRLKIDRLPEMQRKRISLFQSSLVYRDKRFSGYDAATVIEVIEHLDENRLQAFEKVLFEFTRPQTVIVSTPNKEYNFHYQNLFEGNLRHRFEWTRKEFETWAVKVAEKYGYSVRFLQIGEIDDEFGSPTQMGVFTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biochemical insights into 2'-O-methylation at the 3'-terminal nucleotide of RNA by Hen1.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Transferase
molecule keywords Methyltransferase type 12
total genus 65
structure length 195
sequence length 198
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08242 Methyltransf_12 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3jwiA00
2H00A 2O0LA 5K0JA 2OY0A 3I53A 2VZ9A 4DKJA 2K4MA 3IYLW 1F38A 2CKDA 5CCBA 2XBMA 3S68A 2AN5A 1DL5A 3FUVA 5EIFA 3AXSA 5H02A 4CKCA 5KYGA 3OU2A 4ER0A 2XVAA 1ORIA 1XDSA 3ORHA 4C04A 3CVOA 1X1BA 3DMHA 4NECA 3DLIA 2OBFA 1XCJA 1NW3A 2QM3A 3AXTA 3CKKA 4P7JA 4V0RA 5F2NA 3EEYA 1N7IA 4GOLD 2P7IA 4E31A 4XUDA 3EGEA 4DM3A 5K0BA 3HTXA 3MCTA 4PONA 2PXAA 3KR2A 3HVHA 5DTQA 1SVUA 3T7SA 4P7GA 1ZHFA 4FP9A 1YFJA 1WY7A 4GOOD 2ADMA 1R00A 3LGAA 5ERGB 3I64A 1NW7A 5EMMA 3B3FA 3MERA 4HGYA 4EKGA 5LQNA 1QAMA 2DPMA 1RI4A 4PYQA 2Q41A 5FTWA 3TKAA 1N2XA 2H1RA 5T64A 1SQFA 2KW5A 1G8SA 2PT9A 3R6TA 3KPUA 4X61A 5JUWA 3P9CA 2BR4A 4M36A 4R6XA 5HZMA 4RTSA 1NW6A 3BGVA 4R05A 4O29A 4EVIA 2CWWA 3FTEA 4RTJA 3DXYA 5KQSA 5CIYA 2NXJA 4RSRA 2Z6AA 2JH9A 3EMDA 3LBYA 5EC8A 3QOXA 3KPYA 4FT4A 3LBFA 4F84A 3C6MA 3BXOA 9MHTA 2ZIEA 3VC2A 2NP7A 3NDIA 1SG9A 3PFGA 5B1SA 2PVCA 3M6UA 3HCEA 3GU3A 2OKCA 1VE3A 2VDWA 4ER3A 3CJRA 2IGTA 5EOVA 4OQDA 4E32A 4RTLA 2OPBA 2F8LA 4RX1A 5E1OA 5D1NA 1JTEA 3TMAA 2NYUA 4RVGA 4A6DA 1F3LA 5ICFA 1JTFA 3NVKI 1KHHA 2PSSA 4X60A 4U7PB 2P3OA 1QZZA 3BKWA 2ZBQA 3HCCA 1RI3A 2ZTHA 3GWZA 2ZWVA 3B3JA 5EHGA 4KIGA 2BM9A 5F2OA 4HH4A 3GNLA 3CJTA 1XTPA 1R8XA 5K0FA 1KYWA 2JG3A 3PFHA 3BWBA 3KHKA 2CMGA 5E9JA 3UJCA 2CL5A 4QVGA 3LKZA 3GJYA 5CVDA 1Z3CA 1G6Q1 5K0LA 5E9QA 1ZGAA 5DWQA 5GM2A 5CD1A 1YUBA 3LDGA 3MGGA 2Y1XA 5EZSA 1YZHA 5EMLA 5KQRA 1AQJA 3DXXA 4Z2YA 3P2KA 1FP2A 1RJFA 3KQOA 3MCZA 4PGHA 4E33A 3G2MA 5E8RA 2AOTB 4CKEA 2XYVA 4R8RA 5DLYA 3IEIA 1M6EX 1B42A 2P41A 1DCTA 3G2OA 4E30A 4LECA 3E05A 5DTRA 2DULA 3NJRA 1I1NA 3HVKA 3C3YA 5HIMA 2BR5A 2AS0A 1IM8A 1P39A 3M33A 3PX2A 3MAGA 4DZRA 4YUZA 4MHTA 2ZSUA 4RTOA 4YV0A 2AR0A 1SQGA 3O31A 5FHQA 3SXJA 3NWEA 1FP1D 4HG2A 1L3CA 4IWNA 3TM4A 2YR0A 5CVUA 2B78A 3LL7A 3MTIA 3P2IA 1BC5A 3LHDA 4GC9A 5CVJA 5E8JA 3VSEA 4E2WA 1X1DA 5LQUA 2G70A 3K0BA 4DF3A 4P7FA 4RTKA 4IKPA 2AVDA 3IHTA 2OB1A 3EPPA 2P40A 4PIMA 4DMGA 1L3IA 1MJFA 3A26A 1JG2A 3Q87B 1XVAA 7MHTA 2O05A 5C9ZA 3FTDA 5GIPE 3NTVA 3LECA 1EIZA 4KIFA 1N7JA 3T7TA 5K03A 2AOUA 1JR4A 4MIKA 1G60A 3NMUF 4RTMA 1EAMA 3O4FA 1JQEA 3UZUA 5FQNA 2G8NA 1XXLA 2HWKA 1P1BA 5E2AA 5FA8A 2YXEA 1VIDA 3LSTA 2NNWB 2FPOA 3HNRA 3V97A 1KPHA 2GLUA 1X19A 3KQSA 3ANXA 4POOA 4IV8A 3BT7A 3FUXA 2G72A 2BR3A 4C03A 4JXJA 3G88A 3ELWA 5FWDA 3LCVB 5ICCA 3NVMB 1R8YA 2H11A 5HILA 3FPHA 2YUIA 3EVEA 2V7EA 5EQJB 2PBFA 4LWOA 1VP9A 4PYKA 4CTKA 4PINA 2GS9A 3UBTA 3LDUA 1X1CA 2PWPA 1ZQ9A 4YV1A 4HRAA 1KP9A 1JQDA 1KPGA 5K09A 2OO3A 4QPNA 1VBFA 3KU1A 4KRGA 4R8SA 2IH2A 4PYMA 3G8BA 5EKXA 2ZFUA 3B5IA 4ER7A 3E7PA 4C4AA 2P7HA 3BGIA 5C0OE 3UJDA 1IXKA 4OBWA 1QANA 4HTFB 4HSGA 5DT2A 3SSNA 5EMKA 3DR5A 2JHAA 4ISCA 3TFWA 3A7EA 5HIIA 5T6BA 2PXXA 2B25A 2PY6A 4CTJA 1KIAA 10MHA 2Y1WA 3X0DA 5DXAA 3OZSA 2YQZA 3EGIA 3R24A 3UJ7A 3HCBA 4ER6A 3SMQA 3LCCA 2WK1A 2EJTA 2FYTA 5FQOA 1UWVA 3GRVA 3M4XA 3OE5A 4YMHA 5LQRA 2OXTA 3PX3A 3B7PA 1XJ5A 2V74B 4C07A 2G71A 3KQQA 3EVCA 5DRTA 5E2BA 2PKWA 3UJBA 3ELUA 5E1DA 4RTNA 1INLA 2GB4A 3G8AA 3DH0A 2VP3A 5C1IA 2IP2A 4RWZA 1L9KA 3OCJA 2NXNA 2JHCA 2YVLA 4HGZA 4CXMA 2IBSA 5GOZA 3GO4A 4QVKA 5EIWA 1IY9A 1ZGJA 5FA5A 4QTTB 3U81A 2LD4A 1D2HA 4F86A 3UJ8A 4PGGA 3TRKA 2HR1A 5E1BA 1RI5A 1WXXA 3TM5A 3L8DA 3KR1A 3DMGA 4DQ0A 3KQMA 4XUCA 3RIEA 4GC5A 3T0IA 1VLMA 2ERCA 4YUXA 1RI2A 3E23A 1OR8A 2I62A 3ME5A 4YUWA 2PXCA 1Q0SA 4C06A 3PS9A 4RVFA 3QV2A 5M5BA 5DX8A 1DUSA 3I9FA 5DSXA 2AOUB 3G89A 3UJ6A 1M0EA 1UFKA 4M7RA 4OA5A 5D1HA 1KYZA 4LG1A 1YB2A 1SUIA 4YUVA 2P3QA 2IDJA 5EHIA 3DP7A 1YFLA 3ID6C 5GIOE 4RTQA 2HMYB 3R3HA 4AZVA 3QOWA 1NBIA 3FPEA 3BWCA 5EMJA 4U7TB 1FJXA 2IH5A 1R74A 3GIWA 4CWAA 1BOOA 3A25A 2HTEA 4RV9A 2PJDA 4GOMD 2PT6A 2O06A 4KDRA 4Y30A 5BXYA 2ZCJA 2O07A 3P9NA 5CVVA 3EVDA 3ER8A 2UYQA 4QDKA 3SSMA 3BGDA 4ATNA 1JSZA 2CMHA 2C7OA 3THSA 4M38A 3HCAA 1KR5A 2IIPA 3P71T 1R18A 4MQ4A 2AZTA 5HIJA 4DCGA 3D2LA 5IKMA 3G7UA 4KWCA 3FRHA 3G5TA 4OA8A 2P35A 3KQYA 4RVHA 5E9WA 4PYIA 4QQKA 2GH1A 2R6ZA 4IV0A 3R0QA 2B3TA 3EVFA 5DX0A 5K8VA 3P9KA 3GRUA 2ESRA 3G2PA 3HA5A 2ZWAA 3OZTA 8MHTA 3HVIA 5LR6A 5CUQA 3A27A 4KW7A 4OBXA 3FTFA 1EJ0A 3V8VA 2GPYA 4PYOA 3RW9A 3SSOA 3UA4A 1T43A 2B2CA 2AVNA 3DLCA 3GDHA 5U4XA 3R9XB 3FPFA 1P1CA 1P91A 2OB2A 2E5WA 1M6YA 3EVBA 4BLWA 2B9EA 3OU6A 3UJ9A 1NKVA 2IBTA 3CC8A 3MB5A 3OZRA 3SR4A 3P2EA 2JJQA 5MHTA 1HMYA 4LWPA 3G5LA 3P8ZA 4EK9A 1KXZA 3HM2A 2BZGA 1I4WA 2PV0A 3FPGA 3PTAA 3KQVA 3ELYA 5FCDA 1JSXA 1EG2A 2IFTA 1WS6A 2QRVB 3CJQA 3M70A 5FWAA 4AZSA 3THRA 4ER5A 5EVJA 3DULA 3NWBA 3JWJA 4RTRA 2ONYA 1NW8A 2P3LA 1QYRA 2YX1A 5DPMA 5T67A 2PX2A 3LPMA 3C6KA 5BW4A 3GRRA 2VS1A 3AY0A 1VQ1A 1MHTA 1UIRA 2ZZMA 4G56A 2AN4A 4GUAA 5HOQA 3EVZA 3TKYA 4QTUB 5HFJA 4RYLA 4HC4A 5HEKA 3MHTA 5EGSA 1O9GA 2PX8A 3RODA 4YMGA 2EX4A 4P7KA 2HNKA 2QY6A 3JWGA 1G38A 3PLAE 2PX4A 3HA7A 2FK8A 2PLWA 4PYLA 5FADA 5EPEA 2NP6A 3MTEA 2YTZA 1NV8A 3ELDA 2ZIGA 3KR9A 4FSDA 5LQKA 5K0EA 4BP3A 3REOA 3SM3A 1D2GA 3BUSA 3LKDA 5CVEA 3GXOA 1WG8A 4EQZA 3H2BA 4BP1A 4QDJA 3EVAA 5DXJA 4BLVA 5CM2Z 3JWHA 5K0NA 5CCXA 3T7RA 5DX1A 3DXZA 2EG5A 1AQIA 1BHJA 1BKYA 3GRYA 4K6MA 2EJUA 4OX9Y 3EEOA 4FS8A 5LSAA 5JR3A 3CGGA 1FBNA 3HCDA 3O7WA 5G02A 1AF7A 3EVGA 3AJDA 3DOUA 4E70A 4YV2A 3OE4A 1FPQA 2JH8A 4XCXA 1ZKDA 3UJAA 2VDUE 2O57A 2XYQA 5F2KA 3P9IA 4ZTBA 2XYRA 1RI1A 1NE2A 1SKMA 2NXEA 3PB3A 1H1DA 5GWXA 3GRZA 4A6EA 4RTPA 2FRXA 2R3SA 3M6XA 4AUKA 2C7RA 2I9KA 2UYHA 4FGZA 3FYDA 2PGXA 4E2YA 4P58A 3SVZA 5GINE 1I9GA 3AWIA 5DM4A 1XCLA 1TPYA 3BWMA 3HVJA 5DM1A 5ICEA 3KQWA 3B89A 4QQNA 1Y8CA 3LX6A 3SGLA 1PJZA 4DCMA 2GAFA 4FT2A 1ORHA 2N47A 4WVLA 4MWZA 2Z6QA 1V39A 5LQCA 2UZ4A 2FK7A 3VC1A 3JWIA 3HEMA 5DTMA 4H0NA 2UYCA 1WZNA 2ZBRA 3KKZA 2GA9A 5E1MA 2ZBPA 3C0KA 3DTNA 3TOSA 3CBGA 4X63A 3TLJA 4PWYA 3M6VA 1JG4A 2VDVE 1L1EA 3KPJA 3M6WA 1TW3A 1KPIA 4XUEA 3DUWA 3PT9A 5IH3A 1Q0TA 3KPVA 4GBED 1TW2A 5FUBA 4X41A 2AOWA 2Z6UA 3ERCA 5DM0A 3UWPA 5LQAA 2ZZNA 4C08A 1VP3A 4RVDA 1VPTA 2ZW9A 5GM1A 3VYWA 3A7DA 5K01A 4FSXA 1QAQA 3FTCA 2BM8A 3F4KA 1L3BA 3GGDA 4GOND 4EMSA 2ZULA 1O9HA 4BLUA 2AN3A 3TQSA 4X1OA 5K0CA 2IDKA 5EG5A 3FPJA 1VL5A 3BWYA 5KS2A 3EGVA 4WXHA 4EKIA 1D2CA 5P8WA 5HIKA 3OPNA 5FHRA 3SX0A 1XDUA 2I7CA 3HCFA 3HP7A 1JG1A 3WSTA 4M37A 2AOXA 1X1AA 4KDCA 3EMBA 4AZWA 4YUYA 3BZBA 3FUUA 5K05A 3ER9A 1RJGA 4B17A 1PRYA 3DMFA 3FYCA 4PIPA 2PWYA 2QRVA 3PVCA 5EZQA 3FRIA 2AOVA 2WA1A 1EJ6A 4FZVA 2ZLBA 1JQ3A 3BKXA 1G8AA 3KPWA 1YZ3A 3B3GA 3TPZA 4AX8A 2QE6A 4F85A 2PX5A 4C05A 4OQEA 4QPPA 5EEGA 1NW5A 5EKUA 2ONZA 2WA2A 2A14A 3I58A 5KVAA 1G55A 2ORED 5EEHA 2JHPA 4PNEA 5DRYA 1U2ZA 3K6RA 3P97A 5ICGA 2G1PA 1XDZA 1O54A 3NW9A 2QYOA 2XVMA 3CCFA 1JG3A 2ZVJA 1YF3A 1HNNA 1NT2A 4E2XA 3C3PA 3OU7A 2C7PA 1ZG3A 3KQPA 3UA3A 5DSTA 2ZIFA 4MTLA 2UYOA 4L7VA 4PYJA 2YXLA 3FZGA 2IPXA 1RJDA 3TR6A 5BP7A 1EQAA 3IV6A 3MQ2A 4FR0A 4Y2HA 5BW5A 3OFJA 2FCAA 3NDJA 3I5UA 2EFJA 1NBHA 2OZVA 2P1DA 4GQBA 3GCZA 5FULA 1SUSA 3HA3A 4E2ZA 3OFKA 1WXWA 2ZZKA 3FUWA 3LDFA 2IH4A 4GF5A 2OYRA 2NXCA 2C7QA 2FHPA 3Q7EA 2I6GA 3G2QA 3UFBA 3KR0A 2HV9A 2AOTA 3E8SA 3LCUA 4V0QA 1NV9A 2BH2A 4GEKA 4PYNA 4DA4A 4BY9E 5DM2A 4PCLA 1RJEA 4R6WA 5GP1A 4KVZA 5LQJA 4AZTA 1AV6A 3A4TA 4PCAA 4UOEA 3KQTA 4HTFA 4CKBA 2P8JA 1QAOA 1R6AA 3FUTA 5K0GA 2YXDA
chains in the Genus database with same CATH superfamily
4ZDJA 1US8A 1K7FB 3AGPA 4NJOA 2F1RA 2DFNA 3RPEA 2MYUA 3ZIUA 4ARVA 3ZWQA 3BMOB 2OVBA 1SA0B 1LSSA 4YY3B 5D3ZA 1WJGA 1W88B 3JVVA 1NGSA 2X5KO 2ZS8A 1V6AA 1EKXA 3UAYA 1NY6A 3ZCVA 5CW2A 2YYZA 1ORIA 4C0QC 1KAGA 5AK5A 4PN3A 5MN4A 3H1FA 3NBMA 1T5LA 1QJCA 4RE5A 4MKGA 4ALKA 5ICSA 1AJEA 1VA5A 2DJ5A 4K1XA 4CG1A 3NHUA 3X2FA 3WHIA 4MCAA 4E31A 1ML4A 2IYRA 2E4UA 1MQAA 4GR5A 2O8EA 4MUJA 1XDWA 2JDID 3GG2A 3MWLA 2QV7A 2FF7A 3FOCA 4PAWA 4B2PA 4IV5A 2OO5C 1TECE 2ADMA 5H80A 5IWCA 1ADFA 4L75A 1YASA 2ZIXB 3CPSA 2VJBA 4KWEA 3NBUA 3L0ZA 4YRAA 2F4VB 1AN9A 1IBRA 2CV2A 1V35A 3DEZA 4O0MA 5TPWB 3HXLA 3ZUPA 4Z1MA 3MELA 4HPWA 4W63A 4BU0A 3COPA 1C9KA 4ZCLA 4GR4A 4R5MA 4DANA 5KYGA 3I72A 4MLZA 1B0PA 3PPIA 5DYGA 3FTEA 1U0BB 3ICOA 3DFKA 4PG5A 1OX4A 3BIWA 1M8KA 2YVAA 4JVNA 5DZSA 3KTAB 1K6EA 3EMDA 3LBYA 3LBFA 1YJ5A 1L5OA 1OPRA 4WA7A 2YW2A 4BVHA 1W4BA 5B1SA 3RC9A 1FVOA 1WF3A 4QM7A 3VOAA 4BZQA 2YZGA 1JZTA 4FGUA 3B9PA 3L8MA 2VEOA 1ZHHA 3H9BA 3MWJA 4KDEA 1TIPA 1XXHB 2DM6A 4P9NA 5CXXA 5EXTA 3REQA 3VTAA 4UKDA 3WZMA 3D6MA 1CJMA 3SU8A 3VNSA 3KYDB 4IQ0A 3F1KA 1SU4A 2N3ZA 4TWIA 2Z43A 2ZWIA 2ISQA 5T57A 2GBGA 4AJJA 2ZU6A 1IXSB 4KJZA 2PTGA 4X60A 4BB0A 1DKUA 2CLMB 1VKZA 5H0IA 1SC6A 1XTJA 5DYNA 1V3QE 1YCFA 4NULA 4EL5A 1X8JA 2QOEA 2QR2A 3FYUB 1W9MA 3TRIA 2JCGA 1SELA 4LXXA 4MVJI 2X58A 5EI5A 3LNCA 1J09A 4LE0A 2FQWA 5CXSA 1FMCA 4ZAXA 4QVGA 1DJPA 2P77A 4XPIB 1N2IA 2OORA 5T8KA 3RRNA 3IEVA 4TN5A 4KAFA 2OESA 4RDIA 4NOMA 1XZGA 5IXSA 5DYIA 2CCJA 4MP8A 2F90A 2Y9MB 5ILOA 4WOPA 3D4IA 1IDN1 3V2GA 4B6JA 3L9XA 1YZHA 3KLNA 1JKMA 4Z2YA 3KQOA 1TM5E 1MP0A 3CE6A 1Q3KA 3JR3A 2ZE8A 4M76B 3PI6A 4HAVA 4PN7A 1B8NA 1DUIA 2ZS9A 3H7IA 3PFKA 4ITUA 2CCKA 4YB8A 1W7AA 3FZYA 2YRFA 3HBMA 5DHAA 2EYQA 3EH2A 4DMFA 4BKOA 1AIPA 3WWZA 4YUZA 1BXZA 4RA6B 1NVVQ 4E94A 3KD2A 2O4CA 3AL0C 1Q0UA 1TVKA 3ETHA 3H5IA 3HB5X 3MTIA 3VSEA 5CLIA 2WY2D 1M0SA 3P96A 1E2UA 3UV6A 4F91B 3EIQA 2O4UX 3WYBA 3OOWA 2QNIA 2BE7A 3QVSA 3TNYA 1GDTA 1DQRA 2YV3A 3KXKA 2AC2A 1H5UA 2A9OA 2ZJ7A 3KD3A 5FBLB 2FPGB 2WFAA 5LU8A 1I6KA 2ZRNA 4OP3A 2YXNA 4RY9A 5FUVA 3E0XA 2JJYA 1H3FA 2H06A 4GSLA 4LOJA 1L1FA 2I8AA 2AOUA 5DNCA 3H75A 1KXJA 4PLYA 1UJMA 3BVPA 4I8XA 2GPNA 4XARA 3RVQA 4F6CA 1ACJA 1E58A 1T0UA 5K2OA 4QA9A 1NXPA 4G09A 2VPPA 4O6VA 3KT6A 4FYIA 2YMLA 4PCUA 3W1VA 4IV8A 1UXJA 3JTMA 2BOVA 4I55A 4KL8S 4V0MA 4HDKB 2NSDA 2XSZA 5HF6A 3RABA 3ROQA 4ZC1A 3RSHA 2VHZA 4YJ2A 3ELWA 1WCIA 3VC7A 1IVSA 1HX7A 1JLKA 5HILA 1FF9A 1PL0A 3E5MA 4GX0A 1P2BA 3EIWA 4GDMA 4ID3A 2VHJA 4KGVA 1AY0A 4LRUA 3OTWA 3H7AA 2XUOA 1RRMA 4P6VF 1IB6A 2PL5A 2W4MA 1R9NA 2ORVA 3GPIA 1XEWX 4LWOA 4TV8A 1DJNA 3IAXA 3PIIA 2WPNA 5A9RA 3CUTA 3MT7A 2Z8ZA 2HA0A 3PC7A 4DG5A 3NM6B 3DQPA 4HXEB 3BF7A 4QPNA 2RK4A 3K1AB 3RTAA 1N0HA 4JC5A 3EGXA 4RK1A 1NZDA 2XNCA 4RKEA 2E9SA 2D8AA 2EKBA 5AUNB 3J7AC 1G66A 1IXKA 4WL0A 3WDKA 5AICA 3WL4A 5L4SA 4DUZB 4HTFB 1TXGA 2X76A 4MEAA 1G8YA 1KI7A 1V4NA 2JEYA 2XB4A 4GOXA 5EMKA 1ZH2A 1U3UA 1CNMA 4I4TB 5B1HA 3ZWPA 3NETA 2O2ZA 4MKHA 2H7CA 2O7QA 1WVIA 3DLPX 1H69A 4FDUA 2GCOB 3F90A 3IBYA 4M7PA 1UZUA 2HX1A 1M2VB 2P6MA 3EIOA 2WM9B 4H6WA 2A4KA 3W3ZB 4D4HA 4PG7A 1NP7A 4DR1B 3ZVNA 6AT1A 3RRZA 1JHVA 2F9LA 2HXGA 2OAGA 3B7PA 2PN1A 1CQZA 2V74B 5ERYA 3AFNA 3RVJA 3VPAA 5DTEA 4ZJPA 1LPNA 5MGNA 1Z6XA 4K81B 1O95A 1THMA 4QGSA 2I6XA 4MUAA 5HBGA 4GM0A 5CEEA 5IJ0B 4RH3A 3VPXA 1W87A 3I6ZA 3PHJA 3ILXA 4ZOLF 1A4RA 4A26A 1Q1NA 1LPAB 4CXMA 1TYEB 4KXLA 5LQMA 5HQTA 3MGKA 2ZVQX 1LI5A 1J0XO 2VYND 1LZKA 3BGOS 2P2NA 1JLSA 4G1UC 1MOPA 4BNZA 1KMMA 3F73A 1HDXA 3CLUD 2HMTA 3T0IA 2QRKA 3HB0A 1P31A 2EBUA 2VSFA 3F8WA 4P83A 4EJFA 5LLDA 1V47A 4BE9A 3TLYA 1NFRA 3PS9A 3ZUGA 4FFNA 4UQOA 2CNBA 1UFKA 2XUKA 4M7RA 4CKWA 3V7NA 1KYZA 1YB2A 3O95A 4ZMBA 1IEQA 3KWLA 4MI1A 4YUVA 2HU7A 2PH7A 2OXFA 3BH0A 2EARA 5BV0A 3HDHA 3ID6C 1S2MA 4KACA 5CGQB 2DLDA 1NF3A 1FYDA 4RK6A 2GBLA 4IIYA 2ZBEA 1GSOA 1Z83A 2ORYA 2Q8PA 4DLUA 1U04A 5KTOA 2VDPB 2OHJA 3Q8WA 2VTEA 3CSSA 5L7YA 4X93A 1KQNA 4XGRA 5DM70 1WR8A 2O07A 1ORWA 3DTYA 3LX8A 4Z9XA 1GN9A 1NX6A 2O2JA 5CVVA 1DP4A 4NAVA 5FUXA 2VUHB 3OMLA 3D8BA 4XVCA 3Q9UA 4EKDA 4B5LA 4OV6B 3PC3A 4ZOQI 3M3DA 5I8WA 4KWCA 4QLOA 2HLPA 3OE7A 2CFRA 4O2AA 1YNSA 4O2BF 5SY6A 5IT5A 1Z4MA 3DAPA 1CEEA 4RVHA 4G4IA 1ZIOA 1IMJA 2G0NA 2NQTA 3ZU5A 3U31A 3HA5A 4PO3X 2H0QA 2ODEA 3WHLA 5LZ8A 3UHPA 4C1BA 5JADA 1ZUHA 3VTZA 1P9RA 4BNGA 4KQWA 2E82A 1ELOA 4O8ZA 4KNWA 3R3VA 3VU9A 4GMKA 4EHDA 2FZEA 4N39A 4URHA 5AFSA 3EC1A 1YDHA 2B69A 3FPFA 4KGZA 5JWHA 1KP3A 1M6YA 3BTSA 3PD1A 4JWTA 2E87A 5KX5B 3U4DA 1TZKA 4BOYA 3O8CA 3LQKA 4YV7A 3I92A 3TD9A 4R5HA 1YQQA 2PO7A 4I8IA 3OSUA 5AJUA 1ZXXA 2BFAA 4I0WB 1USUA 4JYBA 4ZREA 5LUAA 1CY4A 2PV0A 1H85A 4TXJA 5DOZA 3KQVA 2WM8A 1LJLA 3CO0S 3BEDA 2Y27A 3LPAA 3U39A 1TU3A 3VFDA 1ZUNA 1JFRA 1OJ7A 3R20A 5REQB 3OP1A 5EMHA 4BQIA 2ZI7A 2NG1A 2PZLA 1UBJS 3BMNB 4IF4A 1NW8A 1C3VA 4JYAB 2WJHA 2FWAA 3GRRA 5DHFA 3BRCA 4RV4A 1DAKA 1JR2A 2ZPAA 1B8VA 2A0UA 4JXKA 4KVFA 4JXXA 2QUAA 3SR3A 3CF4A 3EVZA 5JVDB 4PZLA 4CE6A 1FU4A 2RC6A 3WGGA 3EXHA 4EGCB 1AVTA 1U7OA 2HA6A 5HEKA 1BMDA 1IY2A 1CZLA 1OHHA 1A4IA 2HM7A 4NBKA 3TLGA 4GD3Q 4EHLA 2OMKA 3AP1A 2ALJA 4QC2A 3LBNA 1D1PA 1VA4A 2DHRA 1GCUA 5EPEA 5K99A 4W5JA 1WZCA 1NV8A 2R8EA 1EWRA 2XQIA 1H2HA 4JP2A 4NMXB 5FIUA 1MBZA 3LKDA 2AMFA 4H0FA 1QWOA 5AXAA 3STHA 6PFKA 1M10A 4MP6A 3Q8MA 3H2BA 2JFQA 1LTQA 1FC0A 3RCBA 4W7HA 3IQEA 2FZCA 4I36A 2O3SA 5B58C 1Y82A 4G5GA 4BMZA 3F96A 3W5SA 3LY5A 3QEOA 5CX4A 2E6UX 1KDRA 4YJKA 5GONF 4CCYB 3EEOA 1EFDN 4KMSA 3W8EA 3HCDA 4BFVA 3CT4A 2OSVA 4MYSA 3F6EX 1M34E 4HGOA 3TR0A 3UJAA 1C0PA 1CB7A 1XQYA 1YR9A 1A88A 3LOUA 2XYQA 3QX9A 4YEDA 5B1IA 1JZQA 3S27A 1HC7A 2B8EA 1IUNA 1BTOA 3RAPR 3SIWA 4Q3BA 5FB3A 2R3SA 1DXOA 2QM0A 2WTMA 3FNEA 5U1PA 4DN6A 2BONA 2OHXA 1C1DA 4MRVA 2Y0DA 4Q82A 4JI3B 3CEAA 1VKJA 2PGXA 3LA6A 3PGMA 1NNLA 2BBSA 1IJBA 1COZA 4FGZA 3E2MA 3B2EA 3GC6A 2XZPA 3TQCA 5J2UA 1TM7E 3G5MA 1D0IA 1TPYA 4C7OA 4ZPJA 1CT9A 5SZKB 2WI8A 3B89A 1BXGB 4W7IA 4EYGA 1KOGA 2OGTA 4D9CA 1UPTA 2GF9A 2X0RA 3ENNA 3G79A 4LHWA 1GKLA 1GAJA 2XUIA 1NC1A 3LU1A 2E7ZA 4YBRA 5FBHA 4M7OA 2UZ4A 4DB4A 1PGNA 3U1VA 5HMLA 1F8UA 1BSVA 2ZITA 4I50B 1O3YA 4UFOA 4H7EA 4WLFA 4KQEA 4CEIA 3AHJA 3FDZB 3GD7A 4CMCA 3E1KA 5ALWA 2Q2VA 1KY2A 3RIHA 1F2UB 5CPFA 1TQ4A 2R4TA 3KAQA 3TLJA 2XZOA 5JXWA 1O77A 2ZJ6A 5CCDA 3CWQA 4Z1MD 5AVYA 3GARA 4F7WA 1C1XA 2Q0QA 3ABIA 1UC8A 3E0QA 2AJCA 4WZBB 4RLFA 2WYHA 4LHEA 1G291 4OPMA 4QHYA 4J0QA 4ZU1X 2HUNA 3KUCA 5TF4A 1I3LA 3A1UA 1M1ZA 3SHTA 4JL6A 1H6BA 5FPTA 5GM1A 3A7DA 4EB3A 2H18A 2H17A 1T0BA 1H4TA 2Y4NA 1GOTA 4JN6B 4NWIA 1EBUA 1FJHA 4E11A 2JI4A 3ENKA 4KLNA 1WKVA 1DHTA 4I4NA 4PE5B 1VL5A 3BWYA 2J3QA 4M1WA 3ZWMA 1HO3A 5LKRA 4B3TB 2VP6A 2GERA 1ATIA 1GSHA 5ENZA 3ZTYA 1IMOA 3TSOA 3QFFA 2V5AA 2Z1DA 4MKZA 1OW3B 1RU3A 3OPNA 3GVHA 1LY1A 1UKCA 1MR3F 2IA5A 4LY9A 3LCMA 5GVSA 1NPDA 1XK6A 4RK4A 1OXKB 1DKPA 3PUYA 2ZS7A 5H4GA 1M9NA 2QTCA 5BQFA 4C6SA 3H2JA 3C5WP 1P61B 4PBRA 4YGYA 4ZVTA 4FUTA 1C8VB 1HRKA 1V1RA 4AURA 4ID9A 4ODIA 1U7TA 3EB9A 3NIDB 2P9CA 5AI0A 3DTTA 4LY0A 1Q84A 3BHMA 4DG9A 4ND8A 3FB1A 4JEIA 3FCOA 4DRYA 2N1MA 3L43A 2DT8A 4HXFB 4F5EA 3EGDA 1CZRA 2A14A 3NC4A 2R68A 1CZNA 4H59A 3IAAA 2O8NA 4CCSA 5ICGA 3IIJA 5DHQA 2QYOA 1DWUA 1N7HA 4KQKA 3V4LA 1PNOA 2XUJA 3WOHA 2ZJ1A 2FPSA 5EJ7A 4MW5A 5P21A 2HWYA 3BE6A 3A6HA 1CZOA 4X20B 4N12A 4LV8B 4MICA 4E2XA 2R00C 2CV1A 1BEZA 2OP1A 3AWDA 4XQGA 3A6GA 1RYEA 3ZXUB 3RVKA 2I7VA 1C0EA 1EQAA 4JP3A 1V7PC 5AM1A 3KLBA 4Y2HA 3OVMA 1Z8FA 3GGOA 5FBWB 3VR5H 3WSWA 4GNKA 1XMOB 1CDOA 1P74A 2QAIA 2C31A 3DMTC 1YIDA 2GD1O 1G64A 3HUTA 3LOQA 3W0LB 4D4LA 3FUWA 5JASA 1NF9A 3BK1A 4HXGA 1X92A 4WJKB 4GLFA 1XKXA 1ZY2A 2PQ6A 3ETJA 5JAMA 4BNKA 1MB9A 2G63A 1Z2PX 2DQSA 3FETA 3L05A 3A1CA 4FC7A 4FFOA 4RHUA 4TKLA 2AGVA 5TEVA 1NRIA 1MJHA 2QG4A 2QX9A 4OFZA 4H16A 1K75A 1NKSA 3VO8A 2C0PA 3UXYA 1X42A 4Y7DA 1U0EA 3AW9A 1U2DA 4FFLA 3NYQA 5KBYA 1R0SA 2H4ZA 1XNRB 5ALUA 2SBTA 2EQAA 3RARA 3UG6A 1ZVJA 4EB0A 5JSHA 3H9QA 1QGYA 3KQTA 2CK3D 4TSRA 4BMOB 1NJSA 1O6GA 4Y67A 3OZDA 1CUEA 2O0LA 3AUTA 4ME6A 2V65A 4ALNA 4PX9A 2NX2A 4XAQA 1U2DC 3O9VA 1EXVA 3L5OA 1OKKA 1LGYA 1EAYA 5JAUA 4RFLA 2CJFA 5DI3A 3QSGA 4E1AA 3F2IA 3OEED 4FS3A 4FUQA 1XDSA 5LWHA 2QVGA 1Y9ZA 3M49A 2ATVA 1FDIA 2QM3A 5TARA 1A7UA 1XEFA 2W8BB 3AM4A 3AF1A 1M2FA 5AJVB 4JZYA 1WMDA 2ZRJA 5BVGB 4I4TF 2QN3A 1N9ZA 1OWPA 1GNTA 5FP0A 5FFNA 1IN5A 1J23A 1GPJA 3LPDA 3VMFA 1JVNA 1J0DA 4Q3NA 1ZHFA 3IEKA 4M0DA 1IOVA 4X94A 3ZJ4A 3OETA 3GCWA 1G3IA 2GCEA 3T38A 2WM3A 3KXDA 4RDHA 3RUAA 3MOSA 1KYQA 3ZCTA 3IT0A 2JZNA 4LDNA 4ROTA 2ZQ5A 2C4HA 1IE3A 3BMQA 2E6KA 3H5LA 3SEZA 2Q6VA 3NBZC 4RTSA 3DL0A 5M7EA 3PNBA 3U3KA 3TIXB 5IT4A 1ZESA 1OLUA 3STXA 1J9GA 4Y1RB 1PT9A 5CJPA 1Q11A 3DFIA 4RGBA 3L1VA 2P6PA 3NVDA 5UKDA 1C3EA 2OAQ1 3W06A 1T9BA 4M8KA 5EC8A 1W2WB 1FTWA 1XD8A 1HXHA 4R3WA 1TEZA 2NTVA 1R5NA 2HU8A 3PUWA 1BCSA 1SBIA 2SCUA 3HXMA 3WRYA 4M60A 5BUZA 1NDHA 1VMDA 5KTTA 1TCUA 3PHIA 3S40A 1HDRA 3IC5A 2RMKA 4P4NA 4WY5A 3ROFA 4A8TA 4NG4A 1Q1AA 4ALMA 4BAGA 4N48A 3FI9A 2YBEA 1DBRA 3EDRA 3W77A 5DV9A 3I2JA 1DAHA 1HG0A 1QF9A 2HJ9A 1T9ZA 3F46A 2IU0A 4DMUB 1V45E 4MYUA 5KCMA 3T0GA 3JY6A 2P9EA 3BDIA 4FQ5A 1P17A 4IG4A 1UMCB 2NTYC 4QGGA 5EIBC 3R7NA 3T4EA 4I08A 4NATA 4J0KA 4YN3A 4UE6A 2P3OA 2BDEA 1I4DD 2D2EA 2EZTA 5JZSA 3BWXA 3HEAA 3GWZA 1ODCA 1SVWA 2ZSFA 4OY3A 5JRZA 1X7ZA 1U28A 2Q5LA 5DGIA 5IKPA 2R6GA 1F6DA 3SHVA 3TAHA 1MORA 4RPHA 1KZ7B 4ALJA 4DREA 2ZI6A 3HXKA 2IZ1A 2BF4A 3A1WA 5A0FA 2R7AA 3RNLA 5F33A 2PRSA 1HBJA 3BXHA 4PLZA 3AUUA 4F8EA 3ZTTA 4FD2A 3W4KA 1ZLYA 1UKYA 4WY2A 2WIGA 1AQLA 1ZNQO 2DFPA 2HY7A 1VHQA 3PQFA 4I81A 3AYZB 1BU8A 5EJIA 3ANNA 1NXWA 5JNRA 3FZNA 3CX7A 2V3VA 1E2KA 3OCCA 4YAJA 1KOJA 2RK6A 3HSYA 3OZCA 2DWQA 4IGKA 1T25A 4CKEA 3V32A 1SU7A 2ZJ4A 1GZ7A 5DFAA 3U37A 3UM9A 1SK9A 4R8KA 1MFPA 3EWSA 3WIBA 3HVKA 4B3JA 4D98A 1A77A 4BNYA 5A0VA 1N2CB 1JB9A 5KPJA 3VJKA 2FQ1A 1PL6A 2FY8A 4QARA 3HKEA 3PNLA 4IUCS 3E7DA 4RTOA 5DI9A 4DBZA 3IFSA 3COWA 2XUQA 4M46A 4HG2A 4MJ7A 5BV7A 1O4WA 2YR0A 5CVUA 1EXWA 1GNPA 2B5OA 3K0FA 1MAAA 2CDAA 1XLUA 4XX0A 5AI9A 2VWGA 2ZUSA 2VDKB 2X0JA 3BE5A 3N2EA 5CLJA 2CVOA 3U2QA 1MJFA 4K2HA 1ZVQA 5AK6A 3V1MA 3T7EA 2CLHB 3VTFA 3RH0A 2BCJQ 1TAQA 4PM4A 4GPTA 4C3OB 3NP7A 1QQAA 3MMPA 3COZA 3AF3A 3L8HA 1R16A 3N8IA 2WHPB 4EJ6A 1G60A 2PEZA 5JY6A 5HFNA 4Y2JA 4MPDA 1JQEA 3UZUA 4UHCA 1NVMB 2HWKA 5CEJA 4HMOA 2UVPB 3BN3A 4MVWA 1WMEA 3A4NA 3Q6IA 4YRFA 3K71B 5KCZA 5JCXA 3PKZA 4AJEA 2FW1A 4TS3A 4C0WA 4ZEMA 1YQEA 3MS2A 4KWHA 3L1IA 5IBPA 1O94A 3AHGA 3AVQA 4I6GA 5ANRB 2XEDA 4JZKA 3DBRB 3R3JA 2BSAA 4JP5A 4RD2A 4KYVA 4PR0A 2CLFB 3AB7A 5B6JA 2EFHB 4CUZA 1A9PA 4S12A 2OZEA 4B87A 5AVKA 1BG6A 1JKFA 3QYJA 3VR4H 4C22A 1GUYA 1SHUX 1OB2A 2IYNA 2GS9A 3HY6A 1JEQB 4MWBA 1H05A 3D8SA 4LZWA 2WSSD 1KORA 1D9ZA 2IIVA 4N0PA 4B2IA 1FA9A 3C48A 1PR9A 2RC5A 1TYDE 3FTQA 3PE4A 4YMUA 4J16C 2OVFA 2IZZA 1IC6A 1I7PA 3PPVA 3JQ9A 4ERNA 2RD2A 4NHOA 4NZNA 4E07A 4L95C 2OCLA 2PJZA 3T4XA 2C1XA 1MEJA 2BUCA 1UP7A 1NYQA 4Q4AB 3A7EA 3RBXA 4IL5A 2GN1A 4LPKA 3SDZA 4ASUD 2ZUDA 1RYNA 3OZSA 5AT1A 2YHIA 4EQ6B 3UJ7A 2QX4A 1KMCA 4K6GA 2DWPA 1VBNA 2O50A 1KO8A 1KDYA 4CM9D 3G68A 1GUDA 1O58A 2NU9B 4C5CA 2C2GA 3DMRA 3IODA 2XTAA 5DNWA 1EBBA 4P4UA 1KE1A 1ONOA 5EQFA 1A5BB 2ZJ8A 3LHFA 3MWKA 4YX9A 3J80A 3KQUA 4IH1A 1E4VA 3G5UA 3AI7A 5A7HA 3IVGA 5ENDA 1J0AA 3PNVA 1XXHA 5EE5B 3REQB 4HB4A 3NATA 3DH0A 4TPKA 3AV0B 1P0FA 3LUFA 2NTNA 3EHEA 5ECWA 2JEZA 4ARZB 1YO6A 3R74A 1CJUC 1XJWA 4QTTB 1JJIA 821PA 2FSIA 1MG5A 3OQNA 1W75A 3IP7A 3V8PA 4YV1A 2WP8J 4MWOA 2YMPA 3FOWA 3Q5GA 4HN9A 3KUXA 2DKFA 3F67A 1JIUA 1JKJB 3SC2B 2DXIA 4QWMA 2X2FA 4L8YA 5FOUA 3DZBA 5EFZA 1ZD1A 5BW6B 2IYQA 3KEQA 1Z13A 4GKBA 1CNFA 2FGJA 3N2KB 4EX7A 1T3GA 3I52A 1B0AA 3DV0B 1JDPA 4P8RA 1QIGA 4BBJA 4KI7A 1G59A 2P4QA 2IOYA 3BILA 5LQSA 2O0HA 3ANMA 3TTYA 1LJ8A 2NZJA 2X0KA 4J9VA 5D51S 1ZNXA 1JHPA 2VAXA 5TPWA 4BGVA 3ONVA 4HWKA 4UTPA 5C37A 4XGIA 3CS3A 1E0DA 1Y6JA 3DDZX 3K6JA 3OZBA 4QDKA 1R0XA 3COSA 4B1FA 2GJ9A 1L8LA 2GUGA 1REQB 2GYVA 4PPFA 4XJTA 2MCFA 2BHSA 3H3FA 3B53X 3DKKA 1UL1X 2AQKA 1N2HA 3AR7A 1G5RA 3NUGA 4H3HB 2FN3A 3D0RA 4J7UA 1XVUA 4Q7LA 4RO0A 3WLNA 4NDAA 1FFXA 4FWTA 4FX2A 4JNKA 4LAFA 2COUA 4OH1A 4LV6A 1K92A 1UUFA 3CUEF 1VMEA 3FG9A 1K3FA 3VU3A 5TLSA 2DHEA 9LDTA 4FLMA 3MHPA 1TTTA 4ZYZA 2WW8A 1E9RA 4OQNA 1TM3E 4OXRA 3WJ7A 3ST7A 1L7QA 1C9NA 3SDBA 5DK4A 2A5JA 2R2AA 4BFUA 1J2EA 3EVBA 1VE9A 1URPA 4KN5A 1TYCA 4CZ2A 4DWWA 2WAAA 4LBVA 3I28A 2R48A 5B64A 2C4MA 5FO0A 2ACWA 3HKEB 1I5RA 3EOAI 3TSZA 1KC3A 1RYMA 3FLEA 3VR4A 1XQ9A 4ZO9A 3BD7A 4MW0A 3UTCA 3WIVA 1EG2A 1GITA 5FWAA 3PUHA 4BFLA 1WZ2A 1NXSA 1PGQA 2ONYA 3VJRA 2P5SA 1D6MA 3A6DA 4EKYA 2CL7X 3RIXA 1MABB 1Z0KA 3V6LA 1E1QD 4AO8A 4BE7B 3L0CA 1BVUA 1AS3A 2AZ4A 1RHMA 4GYKA 1P3DA 4D0NA 3P4XA 5F2EA 1CY7A 4HC4A 3GWGA 1ZMRA 4HDRB 4MLCA 2JGFA 2PX8A 3R09A 1AGNA 4OHMA 4REQA 3RG2A 3YASA 1G38A 3A1VA 1IN4A 2H1CA 2QSZA 3NRCA 4KAXA 5CIQA 2CHVA 2NP6A 3B9BA 5C7IO 1I80A 2YTZA 3H1BA 4TLCA 2A35A 1QZ3A 1GQOA 4FTWA 2H4JA 4KCGA 2A9JA 3HYNA 3SJBA 3LDHA 3G59A 1FTYA 3FNHA 1HOTA 1ZBQA 2P2SA 4BLVA 2LDXA 1K2WA 1VYVA 4DCVA 2OL4A 2IVFA 4CTNA 3GJ6A 4EJSC 4F38A 2IDMA 1AQIA 3SSAA 1IZ0A 4OD0A 5A9TA 4QUIA 4EW2A 5JSQA 3LPCA 1JLRA 3H8JA 3ONDA 1PJLA 3UYLA 2XD4A 1EDOA 1AK2A 3D6FA 4JK3A 3ECSA 4II7A 4K3UA 3TQTA 4E70A 2BFBA 1NOJA 3F6PA 4BGEA 1S3GA 2VRBA 2I76A 1O0CA 1OUMA 1G6KA 3TEMA 3W9YA 1OCEA 2Q4BA 1Z08A 3D1JA 4B4DA 4PNHA 4RPCA 1GA4A 3OQVA 3MXOA 1LXCA 2R8YA 4MNTA 3IURA 1RBZA 2C0QA 1MGOA 2IE0A 3OJWA 4BNTA 1FEZA 3N3BC 1VKRA 4L4UA 2P9QA 3AWIA 3I8SA 1QPBA 4OB8A 1GYRA 1I7LA 4RLQA 1CUGA 3F9CA 1ZXLA 1MEEA 1R27A 4FW8A 4LOAA 4O0LA 1D4ZA 3D7RA 3DL2A 2VJYA 4N3NA 5EIBD 2GAFA 4ZT7A 2NAFA 3HFSA 1D2RA 1OLUB 4L4ZA 2OILA 5LKAA 2UYCA 2IUTA 4CEIB 2J4FA 3WRYC 5E1MA 5K6AA 4IGEA 2BM0A 3TS1A 1Y1QA 1I4LD 3AYXB 3B1XA 5EXDA 3RNOA 2J9GA 1R6UA 1QHHA 2VT2A 2NUBA 2Q1YA 2ZJYA 3PGXA 3QHQA 4X63A 4IWYA 4XEUA 1D4AA 4I9UA 5EQTA 3UAZA 3UO8B 4E4TA 3KHUA 3EUWA 3FMOB 1DRKA 3LPLA 4LI0A 2NTEA 5FUBA 3K4PA 4OQXA 5HQ3B 1CS4C 3UWPA 1KSFX 1JALA 1UOQA 2UUPA 3H0KA 4MKFA 1KY3A 4C08A 4F97A 2X5NA 5ECDA 5C7LO 3FPSA 4DV6B 3VYWA 2VR1A 2ECPA 2XKBA 2DE0X 1T9GS 4I9FA 1QAQA 4L4SA 4TV9B 2BM8A 3RV3A 3RC2A 4JDUA 2HK8A 4NBTA 1V0JA 3PNOA 5CFZA 1E69A 1RWMA 3AONB 2O8BB 1E2PA 1FS5A 4CFZA 5IJ9A 2ENWA 3GV0A 2VXCA 3M0EA 1Z3IX 1JNYA 5SY9A 2HDOA 2X9GA 3ROZA 1RCTE 4UM8B 2AF4C 4WXHA 4CDGA 5FDFA 3L4SO 5GONA 3DBHB 3V8MA 1CUFA 2B4KA 5IAAA 1GKKA 1R6TA 4OGKA 2M98A 4MR9A 2I65A 4ALIA 2FX2A 2RHMA 1X1AA 3NTQA 2OPHA 4YUYA 2OP0A 4WWHA 3BZBA 4TM7A 2FPIA 3CT6A 5EWJB 3W5UA 4BJ1A 4B2LA 2ZUEA 2ACEA 3OC6A 2EDCA 4CEJA 3B3GA 5EZYA 2GAJA 2QE6A 5LLTA 3V34A 1XEXA 2IHYA 1V5EA 5AM2A 1XQ1A 3ITDA 5IH7A 5EWLA 2EC5A 1G41A 1CDEA 1K7EB 2LKDA 2V4MA 3DV2A 5IABA 4UUNA 2CEAA 3M6FA 3O3CA 3CUYA 1JHXA 1UBTS 2ZB7A 4B09A 2VF4X 2EZ4A 4NYJQ 4C2BA 5BQ3A 2UV8A 5KNCA 3HG7A 4ZYTA 1V26A 1VHTA 4ND3A 3UA3A 1YQWA 1JFFA 2Z5GA 1T0HB 3AHHA 3PL5A 3JPYA 5JBIA 1CRLA 2HGZA 2XGMA 3PHCA 5CFQA 3FA2A 4MV5A 3SC4A 3MQ2A 1RM3A 3JD4A 1V25A 1HYBA 4IKOA 4LSMA 4A0RA 1VIVA 5AWFC 4NCAA 3TLCA 1Z75A 4XSVA 1JEDA 2GCNA 4YCJA 4YPFA 3LWBA 3SI7A 3HDTA 1JJAA 1TMGE 3D7NA 3L92A 1GVHA 3JATA 1DO2A 3AFGA 2FV8A 2PSFA 5JS8A 4D8UA 3C3MA 3T12A 2W6JD 4BX0A 2C7QA 1TDJA 1SIBE 4TT3D 4HKTA 3LBAA 4MGIR 2XD9A 1XI2A 1MIHA 3IIIA 1ZM2A 4ICIA 2JPDA 3RFCA 3QX7A 1UOEA 4NV3A 1RBQA 2AE2A 4QLAA 3AEQB 5TQ0B 2GKGA 4RYDA 2D1SA 4YASA 2GASA 2W2OA 4B4VA 5KREA 1EUDA 1OXXK 4ENVA 4G25A 4HAUA 1U3FA 1J06A 1G5HA 3I0MA 3V1UA 1PNRA 3HCOA 2HXSA 1PZEA 3CRZA 3SK0A 1G20E 4CM8B 5AOBA 5CFRA 2P1ZA 3KHSA 5LA6F 1HETA 2NPIA 2WINI 3PITA 4LBYA 4Y2VA 2AE1A 3VXKA 1RLIA 3RU2A 2C97A 4JVLA 4BRZA 5I8PA 3I04A 1G9XA 2JRLA 3PNSA 2XE6A 2X2EA 1DINA 1B76A 4MAMA 5TXGA 1X7YB 2PWAA 3PT5A 3CVYA 3T41A 3B1ZA 4EWLA 5A4IS 2VJMA 2I2FA 1VOTA 3MCTA 4PONA 4LXHA 1V41E 1XE3A 3RT1A 3W8RA 2F3TA 2C7BA 5JZMA 4I4IA 3CEMA 3KTAA 1TGYA 4OK6A 3LFTA 1NOIA 4OH7A 3G6WA 3OM9A 4PZDA 4RVUA 4XRGA 5CG1A 3HXOA 2G4LA 3V7FA 1E89A 3R6GA 1NJ2A 3AILA 4GZLA 4AK9A 3FCEA 4BZZA 1RI4A 3A1FA 2C5SA 1VCIA 2B99A 4O4IB 2RBGA 1KFCB 2Y76A 1GRNA 2HZBA 4GKVA 3EX7C 4CKCB 2NYAA 1NA5A 4LYEA 4JJ6A 5B58T 4ZVRA 3T3EA 1NY5A 4Y0VA 1R64A 1N5JA 2G8LA 3BGVA 2I3GA 4AJIA 2NZWA 3RGGA 4QLBA 3LIIA 4ZK6A 4XM1A 1C1HA 1AUPA 1H6CA 2VP2A 3K1YA 2W6CX 1CZUA 3QPUA 2HHJA 1KYYA 2ZYAA 4M0UA 3ZD8A 5AUQA 4KNYA 1Y6GA 2CVHA 2WMOB 4ZI7B 4AU1A 1GUFA 3I05A 1X3LA 4WNYA 5IUKC 2NP7A 1QM5A 5EIHA 2AW3A 1WQ3A 3L7CA 4DUPA 5AVOA 3M6UA 3L4KA 1UWCA 3GU3A 4Y2UA 1E3TA 3TNJA 2HEGA 4X54A 2G9UA 1B6TA 2Y1DA 3ZHOA 2W48A 3I2IA 4BLOA 2ZKLA 3RJTA 3TOZA 1A7JA 4HZGA 1TX4B 1N6OA 1ML3A 3M89A 1MW9X 3JALA 2I1VB 1T9DA 2NYUA 3UT5A 2HKIA 3FKJA 1Z39A 4QVIA 1ZM7A 5H9WA 1U0FA 1SKQA 2WF7A 3DB2A 2PSSA 2YIVX 3A4LA 2EX1A 4N3BA 1SZPA 4WXEA 4PPYA 2XAAA 2BP7B 2QE7D 3CPEA 1WBDA 4ENPA 2GQ0A 1N5MA 1Z74A 1MO6A 2QTAA 3AH8A 1G2IA 1NVXQ 4F4IA 1CDDA 5THKA 2CL5A 3LUBA 2P3SA 4GI5A 2EIXA 1IOZA 4H7KA 1YUNA 3UUGA 4HZUA 1OI7A 3GJYA 1HZJA 3ZWOA 3DMYA 4L5AA 1F9AA 1SIOA 2PGNA 3GJ5A 1TCBA 2K2WA 1TF2A 1G4AE 2D7CA 3NYRA 2CLIB 1P3Y1 2RHRA 2VNJA 2Y1XA 3ESCA 4C0SA 4WFIA 1Y8AA 4QGFA 4NZPA 3P2KA 1FP2A 3DOFA 3R3YA 4GOJA 4K86A 3ZE2B 4E33A 2Z9DA 1ZITA 1J2YA 3UANA 1M33A 3FVWA 4BQOA 5B3LA 2IBMA 4QXQA 2CHUA 3T54A 3D81A 4XCVA 3O3MB 4PO1A 4EHIA 1GPWB 4UEJA 3FYUA 5DTRA 5IHXA 1PEAA 1H2EA 5TF0A 3W7AA 5A4FS 2BR5A 2AS0A 2EOAA 4RABA 3EPKA 4Z51A 2D1FA 1VDZA 5I9IA 1P2DA 1DIBA 2B35A 1OILA 3LLVA 3AG6A 1SG6A 1DXYA 1DBIA 4PQEA 2JD2A 3OQPA 1OWMA 1L5YA 5DWDA 1BC5A 4EENA 4OGWA 1QQTA 4M1EA 4KFUA 4LCJA 2GOYA 2EFYA 2SHKA 3X1KA 4DLPA 4JS0A 2NSHA 4L50A 4EG3A 3K9HA 2EP8A 4LXYA 4NHEA 4D43A 3MUNA 2GFHA 4OAOA 7MHTA 5C8YF 2PJUA 2DSNA 3ZW7A 4AN0A 3QWAA 3QKUA 4OHOA 3EYAA 2QRUA 4ZYWA 2OCAA 3PQ7A 1PKXA 2WE7A 2B61A 1XVIA 1S9HA 1P1BA 5E2AA 4C7XA 3WBBA 1Z8NA 6GPBA 1C7ZA 1S1MA 4NJEB 5T4HA 5LU9A 2ZYIA 4NC9A 2K2QB 1I2BA 1PFYA 2W6QA 3W05A 1NBMD 1N75A 3AG5A 3TE6A 5L8VA 1QS0A 4CDNA 4E09A 2VSYA 5CA0F 2R1VB 1UDXA 4YRDA 4Z54A 2G5GX 2C3OA 4KQFA 2OHVA 2GZHA 3K5IA 4Q34A 1SUWA 4HFNA 4UTOA 4V39A 3DHEA 2O3QA 2I2WA 4CM4B 5IAEA 1Q7TA 3PUJA 3N28A 4B75A 5M3BA 3VYSB 1WUIS 2Q8QA 1E63A 4QUDA 4X00A 5HBRA 3NTRA 2CNWD 3IKJA 4R4JA 4YA6A 4RJTA 5EHZA 2Q27A 3URKA 3IP5A 4EHJA 4QTXA 4WOJA 4QM6A 2EWMA 4FYVA 1NUSA 3G8BA 2XCSB 3W2FA 2EKDA 3B5IA 1TJPB 3S55A 5LYJF 3WE7A 4H9GA 2QD5A 1N77A 2R6R1 3DWIA 1XQVA 4OBWA 1MQ8B 2O1SA 3ZZ1A 2HRRA 1LPPA 3I2GA 1BQEA 3DBIA 5F1KA 3BIFA 1JZSA 4HQOA 3PP8A 2FN7A 2O2GA 4KOEC 1E3LA 3V2IA 1Q1ZA 4OBEA 1PD1A 3BK2A 5HCUA 4BJ3A 2BFWA 5LDHA 4UXHA 3ROEA 2UUBB 5LBTA 1JV2B 2IGBA 3MAJA 2VJDA 2OV1A 3GRVA 1V6SA 1NU6A 3M4XA 4CDMA 4ZZIA 2Z5VA 1LLQA 4INPA 1XJ5A 5HQJA 2G71A 2AQIA 1DIRA 3IBFA 3RS7A 1JFTA 5E2BA 3MGCA 4RZ3A 5A9SA 1M74A 2O8FB 1YXMA 3I8XA 2O8CB 2ODTX 4Z7JA 4Y6GB 3GOQA 3LC0A 3Q3CA 3IBTA 3A8TA 1I8TA 3IQGX 1N32B 3FX2A 1JDBC 2IP2A 2IY8A 3D5TA 2Z1MA 3A4VA 3KJXA 3LIPA 4FLFA 4M0LA 3AM1A 4TL9A 3GO4A 3OZVA 3IP3A 2C84A 2HQBA 2JAHA 1Q77A 5ITZA 5DI3B 5JJLA 2OK7A 1FS4A 4PGGA 3SHFA 4BB9A 1CUHA 3GQVA 3Q7PA 3PU6A 4PHCA 2CBXA 1HDYA 2Z4SA 3UCXA 4W1PA 1OH8A 1XVTA 3HACA 3O4HA 2RJNA 4EHFA 3G17A 4PXAA 5E6UA 4DUGA 2QR5A 5AUPB 2V7XA 2VHQA 1TF7A 1E5VA 3GEHA 1N6LA 4O1MA 4BQSA 3B78A 4U9HS 1ZWKA 4MV9A 5ALVA 1NUQA 2RE8A 3DDSA 5ESRA 1RCFA 4LDQA 3O8QA 1NAHA 1TADA 4C7BA 1SCNE 1G1MA 4C4YA 5I4CA 5HYVA 4U7TB 4FMCB 4K9DA 2CJXA 3BH6A 3A25A 4UVIA 1TUGA 2PJDA 3BTUA 2ZCJA 3HNOA 1E1CB 2PZFA 5HF8A 2AN9A 2QU8A 3A36A 2X7JA 3HDJA 1UDBA 1HV8A 2I2BA 4PSKA 2VI5A 2ZB4A 4JU8A 4C0JA 2HL6A 2JATA 3MMZA 5I4IA 1H3EA 1CLEA 4ZQHA 4DNXA 4OFBA 2CZGA 3QEJA 4BMNA 1B2RA 5I5EA 3A9VA 3PLNA 1CUWA 3OAAA 3GRFA 4NENA 4FHDA 1PWXA 4MS4B 1IK4A 3AKYA 3M1AA 1F1BA 4QXOA 1UINA 3G23A 4H6PA 4ZCSA 1VG9B 4UUPA 3WMFA 2YDXA 4UD6A 4EX6A 3IO5A 5KEIA 3R3XA 1JJFA 3MWYW 3KBBA 1P1CA 3GW8A 4M8LA 4QU9A 1YR1A 2B4YA 5COQA 5B3AA 4GI1A 1LDMA 1Q0ZA 2TS1A 2ZI5A 4Q19A 3EDYA 5AKZA 1O1YA 1TOAA 4HVAA 3MB5A 1X7YA 4YAUA 2IBTA 3P2EA 4NK4A 3C1TA 2VSNA 3UAWA 1TU4A 2WR8A 4KXNA 3GGGA 5F5NA 2WIDA 4JIGA 4CQLA 1LI4A 2YRXA 1M6NA 1DC4A 2E4WA 4C9BA 5HM6A 2A7XA 4BFWA 2PJRA 3AVWA 1JSXA 5KO2A 2I34A 2XW6A 1AGYA 3IPRA 2HIHA 4UJ5A 3PIRA 1M0TA 3JWJA 1XZJA 5JMOA 1IB0A 2VNSA 4IVPA 1LTHR 4F6RA 3GNQA 4U8HA 2P3LA 2NWQA 2ONKA 4B4KA 1KARA 2VRWA 1VCNA 4LHZA 3CLRC 1FU7A 2QGZA 1MX9A 2WJ4A 2VS1A 4L6IA 2XUGA 1ZI9A 5AH0A 2CNDA 4GUAA 1YMUA 3INGA 1N36B 4BBPA 2RGEA 2KPOA 5KNCH 1J24A 1EESA 2FAXA 4ML3A 2D1YA 3GFQA 4KFRA 4RF3A 1KK2A 4RJJA 1G4UR 2C2MA 2L82A 3RANA 3ZDAA 2VJOA 4KGDA 1RLTA 1IPHA 3L7OA 4NRDA 2AG0A 2G9NA 2PMWB 1MO5A 2ISSD 3GELA 3ZTWA 3F7MA 1YQDA 5NULA 3NFRA 1CD5A 3UGQA 5AIBA 4XWAA 4KE7A 1C0IA 2X4IA 2IX9A 8ATCA 2EG5A 3NTXA 3OX2A 1K8YB 4ZXFA 2OHIA 3UTDA 1IWOA 2ZJBA 3EZYA 3UOGA 3D64A 1DBPA 2HRZA 3OTHA 5KKAA 1U3GA 2CD7A 4KQGA 2VWQA 3K8ZA 4IFEA 3K0AB 2PCJA 2QW1A 4DILA 5TSDA 5IULC 2PLAA 4Q4CA 5A1JA 2XI4A 1PJQA 3MWEB 3MBOA 3QBEA 3IQIX 1UJCA 1AUVA 4GBGA 3FR7A 4LIPD 3A1DA 4IIXA 1W36B 2FSVC 4G0QA 3R0ZA 2Q7DA 4CI9A 1DJMA 2C61A 2R6DA 4Y2GA 1BN6A 2Z2ZA 3LX6A 1Q14A 4R1QA 4DCMA 1ORHA 4WPGA 4WVLA 3RVPA 2D2FA 1UEIA 1H2XA 2P0YA 2FK7A 1A7AA 2W8BA 3HMQA 5IARA 2Z6QA 3T5DA 1Y9EA 3RC1A 3T5BA 2BBOA 3QPVA 2W93A 5BSUA 3C0KA 3DLHA 3PYMA 4GWLA 3ZV4A 1NYLA 1FDVA 4QAJA 1DQPA 5A7GA 1QDEA 2NZYA 3HVRA 1TW2A 1WA5A 2PDAA 3C45A 3Q98A 1RAIA 2EIHA 2QD3A 5FPQA 3H87A 1R3UA 4HEHA 1FFGA 5BO5A 4FZ3A 2P91A 1W52X 3GFVA 5K01A 4GVLA 1GARA 3DWEX 1FQKA 4FFBA 4W99A 4EO4A 3DAGA 4K05A 1AURA 4PZAA 4P86A 1LVHA 3TCKA 1U31A 1QGUB 4HV4A 4HUQB 3WX0A 4I5IA 3UWDA 1ZCJA 1WVGA 4Q37A 5INTA 4C6TA 4W6QA 5LBUA 2FEPA 3ZHUA 3KZVA 4MR9B 3ZD9A 4EG8A 3QWFA 4EELA 3USES 4I6JA 2AOXA 3LV8A 3DOCA 3KLPX 1GN8A 3A4MA 4YHBA 2IZ0A 3CUWA 4KFTA 4Q9NA 5CTAA 4DLSA 5F5LA 4IH4A 3FRIA 2BMJA 3G8YA 1MGPA 2WG1A 1E9CA 3JYHA 5JI2E 1RW4A 2FN4A 1VJ1A 4IICA 4X84A 3JQRA 5EKUA 5GQSA 4ZJYA 4DTIA 1UBLS 1Z62A 2IK8A 5DRYA 4RPJA 4JENA 4MHSA 3EODA 3G9XA 3M9XA 5K4GA 3BXEA 2IY9A 5D2CA 7YASA 2O2IA 3JRNA 4JODA 3ZCSA 2APJA 5KOHA 4KXXA 1OAOC 3V3KA 2UYOA 4FMCF 3D3WA 3PXBA 2GXUA 4UEOA 1I9CA 2ODQA 1EGVB 2BEWA 3GNSA 4QQRA 5HDQA 3A6PC 4QOJA 2C42A 2CXNA 4MSUA 3OFJA 1SBNE 3T34A 1T8YA 5HJ2A 1RDFA 3UG7A 3F97A 1EUQA 4Z4QA 1N78A 1SUSA 5AVUA 1KF0A 1OMOA 2MYNA 2ZI9A 2IPAB 1GFSA 4F2PA 1VIMA 5AW3A 2R84A 4M9XA 4Q1VA 4TLMB 2O3UA 3NALA 5DNYB 1RPAA 4H3SA 4M88A 2IHUA 3NH9A 1NLFA 3QNUA 4M7WA 4U5XA 1EP3B 4FEYA 2ZUBA 3USZA 2WIFA 4ND2A 3WC4A 1K5GA 3ETCA 4ZJZA 1WOYA 3PDIB 1OH7A 1D07A 4DLWA 1SUAA 3DM5A 3IKVA 1ESZA 1XRNA 4UMEA 3U1TA 1WP4A 1GAXA 2VT7A 3ZKWB 1TZCA 2NXWA 1M1NB 5E6RB 3EMKA 1SBTA 1SRQA 3PG5A 5GTDA 3O5AA 4CM3A 3I5XA 1LRLA 1T10A 3OEHD 1X1BA 2WTXA 2IV7A 4I50A 2C4WA 3ITEA 1SUDA 3OKAA 1XJ0A 3CKKA 3CUKA 4TVKA 3O8DA 3GGPA 2QUZA 1Z26A 1RP7A 2R62A 4OHXA 4PAGA 4U5QA 1X3SA 1W0KA 2FJ0A 3VKWA 4DT1B 5CK4A 1PX2A 4F4CA 3A14A 5T6MA 4AN4A 4J49A 4GOKA 2P65A 1U1GA 2A78A 2AMVA 2ZSIA 4PC1A 2JIBA 4HTAA 2Z30A 4FGSA 4NDNE 2CXTA 4RCYA 2HYIC 5EMMA 2ZIZA 1IU9A 3DFMA 1S2OA 3CW9A 4Q16A 3SC6A 3O7MA 4BKMA 2X9LA 3NTLA 3COYA 1J49A 1D2AA 5AHOA 2VG8A 1WB4A 3QELB 1CJVC 2VXOA 4DCTA 3DD1A 4BX9A 1BDJA 1WB6A 3G0DA 3V4RA 1WHTB 2NYRA 4ITRC 3IAFA 3DJYA 4R05A 5BVHB 1GKUB 5IM4A 2J3HA 1H8HA 2GDZA 2BELA 4XDHA 3A6KA 2FA9A 5ILGA 1Z28A 2JH9A 5LCXA 3TZ6A 4YCSA 3U60B 3VR1A 2GETA 3QHPA 2PGLA 3HDYA 3TVYA 3ZQUA 1P1JA 1UDRA 3BWVA 3INNA 3M2TA 5CTJA 1RWOA 4KQJA 3WTCA 4E22A 4KR7A 3R0VA 2ORWA 3IILA 1QU3A 3KB2A 4TYYA 1O94C 2PMDA 4FOLA 3IAM6 4MAFA 4YAFA 3ADCA 3MGAA 5ALNA 5CNMA 1EK6A 2DKOA 3DDUA 3TXXA 1LTKA 5I7WA 4WJLA 3R4CA 3HJAA 4G4GA 1BE0A 1JNXX 1U0LA 1BWRA 2JFWA 1YE5A 2WWFA 2PE5A 4QOGA 2C8KA 3RUDA 3O0DA 3THYB 4CR6A 1GQRA 4XQ0A 3HCCA 4QGHA 1RI3A 4EGJA 7REQB 2M32A 3DZJA 3L07A 3OTOB 1CNEA 4OI0A 5CMLA 5H16A 4AMYA 5HPYB 3BQ9A 1QYDA 4Q4DA 4GU5A 3DOIA 1T2VA 4W5QA 4FZJA 3EQ6A 1ZHOA 3QU7A 4WKGA 3WK8A 5AR1A 3VKHA 5CT5A 3UKOA 3AB3A 3HYLA 4RIFA 3KZXA 3H9GA 4RL4A 2OGUA 3QEKA 5CVDA 1P1IA 2A0YA 2ZDGA 1K08A 5E9QA 2C59A 5CJJA 1POXA 1R0CA 4H1WA 1A7KA 1QGUA 3H3XA 3RO7A 4ZN6A 1K6JA 3CH4B 3BHNA 3ZHSA 2J33A 2QP3A 1P18A 4BFSA 3W5BA 5G0WA 3VYVA 1OXVA 3LDGA 4JJKA 2DPYA 3V4OA 3BFJA 2WFLA 4HWTA 1H42A 4FXPA 4JOQA 4HNGA 4UEKA 5K4AA 4FKMA 1V6CA 3TD2A 3KSAC 1GPH1 4UMVA 4UHHA 1J5PA 3MEQA 4J91A 1ICIA 2P41A 1Q2UA 1KGDA 4ECAA 1W35A 3BSYA 3K30A 1Y37A 1ULSA 2B7CA 2IYLD 2DEUA 1KFEB 4B71A 3W2EA 1RQ2A 5IJ0A 2I7XA 2N46A 1YVUA 3N2IA 4L6AA 1J7KA 4R68A 4A9AA 4YV0A 1G3RA 1E0AA 2AF3C 2I3AA 3TNDA 4CLDA 5CFNA 3UK6A 3E3LA 3PWTA 2GZ3A 2VDWB 3CW8X 4TN1A 2RGRA 1A96A 2W2PA 2LPMA 3EG5A 5BR4A 3FNGA 4YP9A 1I14A 1XRSB 3KJNA 3ZCXA 1DWQA 1EHCA 2CKMA 5K8TA 2J0UB 1KJ9A 3EPPA 3N6RA 4PFQA 3VU9B 1PGOA 4RZ2A 4EA6A 1JKJA 4OOFA 4IDOA 4RK5A 2MDTA 3WWPA 3VHXA 3U7EB 2C5EA 4FFVA 4TZTA 3IO3A 1N7JA 4E7PA 1FX0B 3AJEA 3TXAA 3JAKA 3OEEA 4CQLB 2IOFK 4ENQA 3S44A 1RAGA 4P84A 3GJ7A 5C5DA 2ZJ5A 5H4HA 1A95A 1ZA2A 1ZD8A 3HO6A 3WTBA 5HP4A 2KE5A 4NABA 4RH1A 2ZSJA 3O91A 3ANXA 3E1SA 1NM5C 5CH8A 1DEAA 3FUXA 4ZVPA 2A5YB 3JQEA 3LZDA 2A0WA 4C4XA 1OU4A 4FM9A 1JT9A 5ARDA 4DXDA 2CK3A 5FWDA 1LPOA 4PW0A 3FCAA 1GD1O 4K03A 3TLZA 4P33A 4DL9A 1XNQB 1FXWA 1PQWA 3QBTA 4I5GA 4XFJA 3AJAA 3JQFA 4EPYA 3K73O 2QBYB 7ADHA 3RSQA 2EJBA 3GEIA 3A4YA 3THXB 4V3BA 1MOZA 1DQNA 5IBRA 4WXRA 4LJ9A 4UHEA 3N0TA 2QJFA 3OQOA 4MDYA 4O4IF 1VHLA 2IHJA 1F8GA 1U2EA 2IUSA 3O3NB 4FNGA 1BX0A 4R8SA 4EF4A 1AGRA 2IZ5A 1DNPA 3KETA 2ZFUA 3A1SA 1AUQA 4H7HA 1MENA 2AW5A 2Q6LA 2R1ZA 1E3WA 3D2AA 3H2SA 4MW9A 3ZH9B 4H1UA 3S7ZA 1FRVA 1LCIA 2X0NA 3UMYA 1K97A 3DR5A 4S04A 2WVJA 5K1ZA 3IVCA 3RFXA 3TNFA 1M6HA 4BS9A 4JBNA 1T1GA 10MHA 3PQEA 1GL9B 3QVKA 3LUHA 4BV3A 2Z2XA 1RWPA 1J2TA 2JBAB 3IUNA 5ELXA 2Y67A 1FTSA 2NVUA 4IF6A 2I4NA 5LWQA 2H1OA 1PFKA 1VHDA 2FQYA 5IUNC 2YJNA 3AUFA 1AA9A 2Q46A 4E5SA 1XEWY 3O84A 4FZ5A 4WGFA 4DA0A 5C1PA 3WRXA 3PPXA 2W83A 1JMKC 4G67A 4N76A 1RD4A 3KL4A 4Q1BA 3ELUA 5BMVB 2IIQA 2ASVA 1IZ9A 1L5QA 1T5SA 3CU5A 3EJWA 4MS3B 4OGFA 3P2JA 3ODGA 3K0KA 1QNFA 2VHEA 1X39A 3O6VA 4HJRA 3OF3A 3ZBTA 1ZGJA 5A4DA 4EY3A 4BKRA 1RXSA 3RS2A 2XNDD 1SM4A 4BCDA 1UZNA 1OVMA 2WE8A 1UPFA 4BQNA 4F86A 5JYEA 1OV4A 1SWWA 3KR1A 1ZN2A 3IEXA 3KFXA 4F4FA 5MF6A 1NVVR 1S2NA 3MJTA 4QDUA 3X1DA 4QFMA 1MX1A 1BD4A 2W6ZA 1Q0SA 5M5BA 3NHBA 5EL0A 4U1RA 4JR2A 2GBLC 4LMBA 5DSXA 1XTTA 5G0TA 2QMYA 3UT0A 1T9KA 3ANLA 1GU1A 4ZVMA 5GONB 2W00A 3IPXA 4URFA 3WVNA 3NWPA 5L3QB 2HRQA 3TAXA 3M1LA 3JZAA 2XXJA 3JQPA 4K9MA 1LQUA 4YMSA 2J3DA 3ZVLA 4YT2A 4J6FA 2BMAA 3VJMA 5G53C 3CRQA 1A8HA 4AKHA 4EFLA 4JT8A 4JB0A 1F2TA 1C2YA 1PNQA 1XN1A 2QQGA 3V8BA 4EPVA 4L2IA 4TTJA 2BISA 3KEFA 4GX5A 3ER8A 3SC3A 2Z2KA 4ATNA 2QMHA 1NI5A 1H3NA 4L9WA 3WJAA 1O96B 4ZQGA 3EDMA 3NRJA 4ZAZA 4ZCTA 4DNQA 1M83A 1FJ2A 1VXOA 2HWUA 5I7RA 3SYKA 4GIBA 4LOLA 3K5WA 3PC6A 1LBHA 4P1ZA 3B6MA 4I1PA 1Y3CE 2P35A 1LPBB 3IT1A 4AWXA 2HRDA 4IV0A 3R0QA 1A72A 3HGMA 3H1TA 3GRUA 3PUKA 1C1DB 2WVHA 2Y0PA 3F5FA 3NLLA 4QXMA 4XFKA 2PZJA 3S2YA 1S2GA 3T9DA 3W7VA 3HB4X 4V0LA 4TUYA 4IJQA 3SM9A 1G5FA 1QO0D 4NMLA 3JALB 2AVNA 3C3BA 2GAAA 4OXQA 3B5JA 4ZFNA 4PTYA 3BB1A 2C5AA 5G4KA 3WDMA 4AS3A 2F48A 2I7DA 2YIDA 4RY0A 4YLEA 1QQ6A 3RJMA 3NTUA 4B5KA 4LJ5A 1QHEA 4CV1A 3IQFA 2IQIA 3WAKA 3MRVA 1ZR4A 1VL6A 1DIAA 1J9ZA 4M1SA 3AHCA 4R8LA 3VR4D 4ZJUA 1PEKE 1ZN8A 1E8MA 2AC7A 3PTAA 2HLHA 3HRHA 3OJ0A 2R44A 4PPNA 2K87A 1XCGB 3PC4A 2IFTA 1NLUA 4CM7A 4RFSA 5SYMA 2ZREA 1OBOA 1VPEA 3Q6MA 1KK0A 4KREA 4XPIA 3MM4A 4US0R 3QXXA 3TZCA 5AM5A 4F3YA 1T3ZA 2GJ4A 1VSUA 3IVMA 4RMGA 3U3JA 1ORDA 1NRXA 4NF2A 1N6PA 1U63A 3HY3A 2C96A 1L4EA 4Y6SA 2Q1WA 4GE0A 4MXDA 2YRWA 4NBVA 4YNBA 2C4TA 1M2EA 4ND5A 1AQUA 2RH9B 4QPCA 3NJ4A 4NJMB 1JFFB 3KTFA 1IUKA 3TSYA 2R1UA 3T06B 1HFEL 2FK8A 1EK2A 4UJ3A 4JHXA 2D74A 4AVYA 4KKVA 4EVQA 4D4KA 2B1JA 3OPQA 3HBJA 3K31A 1D2GA 1FSFA 3OJFA 2C9CA 3ESRA 4KXMA 4MO9A 4U2FA 1OFUA 3UJPA 4MDEA 1JR3E 2IKSA 4WUVA 4KAAA 2FWNA 4AC9A 4DC0A 4LTMA 3TTXA 5A06A 4EJ2A 4LVNA 1TD9A 2LE0A 3Q7TA 4GYJA 4ZOAA 3M6LA 4BWFB 1KO4A 2ZTVA 5MN6A 1T35A 1YMQA 1T5HX 2ROQA 1GLGA 2EJUA 4GMHA 1RACA 5KTKA 1SCKA 4RJKA 4FYPA 4DJFC 1RBMA 1SWVA 4RGQA 5IRCD 2QL9A 1AF7A 1A8QA 1V16A 4Z4HA 2KQUA 5BSGA 2F1OA 5H68A 3VH4A 2H1WA 5IVPA 3C39A 1OWOA 4U7HA 2XLCA 4OP2A 1NBEA 1WSAA 4KPUB 5EJFA 4DRXB 4M1QA 4PG8A 2I8LA 2UAGA 2GN0A 4PXYA 1Z0IA 2XITA 4F3NA 3OICA 1G7CA 3N2GB 2R8BA 4PHGA 2QQ5A 4QASA 1PS9A 1F5SA 2II6A 5A3SA 3B52X 4NFYA 4EEXA 2AH5A 1BE1A 1V11B 2ID4A 5J4KA 4QQNA 3B82A 1Y8CA 3K1JA 1K4KA 2MSDB 4B44A 4BV9A 4FT2A 4Q9JA 3FJ1A 3MZ0A 1O96A 4DV2B 1PGPA 3IULA 4GXNA 1Y4ZA 2W2NA 1K3TA 4A15A 1KMHB 1XA4A 2WMYA 4Q18A 1Z0AA 1FP4A 1SU6A 1KU6A 1KSHA 3GZJA 1AB5A 4RK0A 1QH8B 4F2GA 1NVBA 5HJ7A 2W2LD 1P80A 2EW8A 1DXQA 2FMKA 1VBKA 1XG5A 3PWSA 1BMFA 4PX5A 5HZGA 3KPVA 4GBED 5DBIA 1Z6AA 2WSBA 4LRXA 4D92A 1XO1A 3WI7A 5AW4A 4HDNB 2PNFA 2G17A 4AWAA 3P45A 1FLNA 2HT1A 1U3CA 2XR1A 3WGMA 2RHOA 3O4VA 2DWCA 1IHXA 1KNXA 1SKAA 1V7QA 1YC5A 2OLJA 3JQAD 4HO1X 1XPRA 5FEMA 3I04M 1PZMA 2X2OA 3QQPA 2IYEA 1SVIA 1ZMOA 4I5FA 3D0OA 3GGDA 4R1TA 1E1YA 2WJWA 4MPTA 3RVOA 4IQGA 5AK3A 1Q7CA 2F43B 3KNZA 5F4BA 4FONA 3N8NA 2R66A 2I5PO 4N5IX 5EE1A 2OC9A 1R4ZA 2VQFB 3LLMA 3SXPA 1Z36A 1UMCA 2AFIA 3NAMA 4AF8A 1EINA 1J25A 4ZV4A 3KTDA 3UMCA 4O5OA 3AR8A 1TVMA 3LW7A 4YQYA 1WSWA 4IMPA 4BASA 1CVLA 2Q2QA 4RF5A 1TA4A 1RJGA 1IYZA 5ALIA 1JI3A 1PRYA 3I6IA 3ISJA 4YT5A 2WMDA 1T29A 3PVCA 3I62A 1QX3A 3DEAA 3WGOA 4AROA 3TPZA 4MLDA 5CB4F 2BRUA 3K7EA 3SWWA 4OL0A 1TVEA 1PR2A 4BUZA 4DQXA 1Z2EA 4H18A 4IDDA 4TTRA 1XP5A 2I2CA 4TZKA 2CVPA 3B3AA 4K7JA 1RNLA 1D04A 1RWNA 4U63A 3UQYS 4PFKA 2BUAA 4RANA 3SQDA 3ZZMA 3CCFA 1OHHD 1E4YA 3E70C 3LX4A 4IDNA 4OXNA 3EQ8A 3K8QA 4PLCA 3TDKA 1AHIA 3OU7A 2ACKA 3QYFA 1GFWA 1OWLA 2R5WA 3FTPA 1U4OA 1XSEA 1P29A 4LWQA 5AM0A 3NEAA 3KEGA 4YH1A 2XMBA 1H8HD 4FR0A 4E3WA 4HVTA 4O63O 3Q8XB 2FCAA 2QS9A 4MX8A 5H7XA 2P1DA 4TROA 1YHNA 5AO9A 5EXEA 4TVOA 1T8UA 4JU9A 2F67A 3KDPA 4B48A 4G8BA 1TEVA 5SYAA 1W36D 3S2EA 1RHRA 1U02A 4HDSA 1NQ5A 5EUMA 5KNDD 3G2LA 2JI9A 2GZ2A 3LCUA 3LT2A 4LNAA 2PBRA 4PVDA 3IEMA 2VNKA 1QGED 4M6WB 5FKJA 1NATA 2KBEA 3LW8A 2HF7A 1IH8A 5D00A 1XV5A 1DWOA 3OFSA 2E18A 3H0CA 5DCWA 3STVA 3ZZNA 5AW1A 2BTEA 3I01A 2QUIA 1Z9BA 3GFRA 4UDNA 2K5UA 1MN6A 1M7HA 1WQ4A 4YT4A 5A5DA 3UAXA 1NZJA 1KJ8A 4ZHQF 4DR7B 2YXDA 1XFAA 2Q1UA 1ES9A 3ZJVA 1A1SA 1DDOA 5J59A 4NOJA 1HQYE 1PJ3A 5EIFA 3FUVA 5AXBA 1KBOA 1ESNA 2HSEA 3AHDA 4OP1A 4V0KA 6REQA 3OOEA 4EA8A 3WRWA 1JMYA 2PHZA 1JT2A 5EMNA 1OFIA 3T15A 5IEJA 4U2GA 3S1LA 1V8BA 2HDWA 1CRZA 4V0RA 2JKZA 2OAP1 1FNDA 4GMDA 4GWGA 4D42A 3ZN2A 3RDPA 1CXZA 2B4TO 2C8VA 1JWAB 3FYHA 5G3ZA 4RXMA 5LYYA 4B33A 4UVHA 3T7SA 3LXRA 1TVKB 3SEAA 1JAZA 1DZIA 1PT6A 4QYSA 5F21A 5HF9A 3ZU4A 3FMIA 1P9OA 1RRPA 1BYUA 1YB4A 2UZAA 2DPMA 1AC5A 1ZK3A 5IFKA 3W5AA 4PBSA 4BP9A 1N2XA 2DZDA 4QELA 1N3BA 5D3KA 1GRVA 4IY1A 4P31A 5LNK1 3ZD6A 4M36A 3SEFA 4B45A 5HUHA 1JKXA 3K9BA 2SNIE 1RAHA 4KPEC 2JFBA 2AJTA 1V96A 1V7ZA 1CLUA 3DXYA 4OHYA 2VWHA 5CIYA 1YC2A 2OV8A 1BXRB 2WTNA 3DZDA 4D3DA 4F93B 3KCNA 4NV1A 4BBAA 3AF2A 3L8GA 2GM3A 2Y71A 1P6QA 3ET5A 4DV0B 2J5XA 1AUOA 3H86A 1V95A 2GPWA 2KS6A 3HCEA 4AICA 1E1DA 1QHXA 4WNCA 3JQ8A 4F92B 2IGTA 3LP5A 1PBNA 4OKNA 4DQLA 5LNK6 1LJUA 3CKMA 3IUPA 1J21A 1G6OA 9GPBA 3QUSA 3LWDA 2V6FA 2XNSA 3LQ4A 3UATA 4DFDA 4RVGA 2EF1A 1Z45A 2RGNA 2ZB8A 4XVQA 5JMTA 3FF1A 4EITA 1PG5A 1SN7A 2Z5LA 4WSOA 1V43A 3A2KA 3THYA 4X3PA 3OJXA 2B37A 4IQFA 5TGTA 1EK1A 2DR2A 4PSAA 4TKUB 3S29A 2ZWVA 4L7QA 1V71A 4KIGA 1RWKA 1FX1A 2QZJA 4CIVA 1SEVA 1XTPA 3RFFA 4HPXB 4LJ6A 1YWGO 4D96A 1N92A 2AFHB 1KERA 1W5EA 2WOOA 3DOOA 3DWFA 5CDGA 1F2DA 1XEAA 2FFRA 4DZZA 3GEDA 3RSLA 2GPTA 2RGBA 3VR6A 2EKQA 5KDOA 3IT3A 4INZA 4XJXA 3A05A 1ODKA 1OJLA 2R79A 2HMWA 1U9IA 2ZDHA 4WAUA 1GGVA 3G85A 4YJHA 3ZY6A 5GM2A 1UXGA 4E12A 2CNOA 4Z2AA 3GDGA 3DV9A 3TTSA 1ZLXA 3GUCA 3QVWA 4R84A 1XL0A 2DH5A 2AOTB 3WMRA 4Q3AA 1QJ4A 1VFNA 2QPAA 4J1SA 3V4ZA 4N0QA 3GYBA 3FHCB 5KB3A 1XZKA 4B3RB 3RTGA 4FCVA 4UNNA 3ZDCA 1U1DA 1VFPA 1ECFA 2OHOA 4ZIRB 4UZSA 3M33A 3EZLA 4ECEA 4MWCA 3S81A 4JV5B 4Q9KA 3OPVA 4C14A 1VBMA 4P4SB 4ZODA 4DA7A 3P2IA 3DKRA 3K1AA 2OFXA 2VBCA 3O1HB 4E2WA 3LRPA 3UF0A 2D5BA 2WUWE 2FLWA 1JVBA 4ARZA 2QSUA 2FVXA 3HO1A 4G0ZA 4TLEA 3WLIA 1B41A 1L4HA 5A02A 1Y6RA 4MQFA 3C5EA 1DCFA 2YHUA 5C8DA 2BKVA 1L3IA 2GM4A 2CGEA 1PFVA 2O7SA 2JAPA 3FPAA 2OXEA 1K3UB 4C0LA 3RRJA 1GU7A 1QK5A 3BA6A 5DBFA 1KTIA 4DV1B 3LECA 3SMVA 5ECYA 4NENB 4YC7A 3Q7RA 3FJYA 3T3NA 2XGGA 2G8NA 4HS9A 3E82A 4INOA 2GBCA 4YCBA 2YXEA 1VIDA 4TT3A 3D8RA 2IYSA 5AVJA 4AJ1A 1Y33E 1KEUA 3E84A 3X2EA 3KQHA 4G84A 1U2GA 4UEQA 1W2HA 1PT8A 4XYEA 4JP1A 5IN5A 1C3XA 4LISA 1K86A 4GBMA 1BGWA 1RRGA 4R7ZA 5ICCA 1Z2AA 3CLRD 5FOXA 1YS1X 1VJDA 2XGSA 4G0XA 1K7XB 1OBHA 5I8ZA 3TI7A 2AT1A 3HM9A 4WZAA 3W5HA 4EA7A 3QQ5A 1I6WA 4HAWA 2GPAA 1SVKA 3CO5A 5GJWC 1XPOA 2OZLB 4QDZA 1PNVA 4GRAA 4CTKA 5AOAA 3PR1A 4RAOA 4OMUA 3GCGA 4JYZA 1ZH0A 3EQ7A 3LDUA 3QUQA 4FMDF 3B38A 4K26A 3OIGA 3BIOA 4HCJA 3HMKA 1U0SY 2G4CA 3JARB 3M4YA 1D1SA 4KRGA 4LHYA 1SULA 4MUHA 4ZARA 3WY9A 4LX8A 4DA9A 3VBEA 4N54A 1Y7TA 5B2ZA 2CMDA 3E7PA 4MVJM 1WW2A 3O47A 2PSJA 3UJDA 3VH1A 5AOVA 4JI6B 3EN0A 4F9GA 5KHAA 3JQAB 4IDBA 3L41A 1XQWA 3VR6H 2X9VA 3DF9A 3TL2A 3QY9A 3I4LA 4LJ8A 4MW1A 1C4KA 4Y6QA 3R9IA 3TB6A 3P0IA 4DUYB 3AO0B 3KQNA 1YRLA 3IV9A 4TV8B 2Y1EA 1OLXB 3L4BC 3I3OA 1MOSA 3U61B 1T5IA 5IAKA 4TRJA 4C4TA 3WGIA 1KRXA 4UNSA 2DYKA 3V1YA 5CDTA 1IXYA 3PX3A