1NSYA

Crystal structure of nh3-dependent nad+ synthetase from bacillus subtilis
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
271
structure length
271
Chain Sequence
SMQEKIMRELHVKPSIDPKQEIEDRVNFLKQYVKKTGAKGFVLGISGGQDSTLAGRLAQLAVESIREEGGDAQFIAVRLPHGTQQDEDDAQLALKFIKPDKSWKFDIKSTVSAFSDQYQQETGDQLTDFNKGNVKARTRMIAQYAIGGQEGLLVLGTDHAAEAVTGFFTKYGDGGADLLPLTGLTKRQGRTLLKELGAPERLYLKEPTADLLDEKPQQSDETELGISYDEIDDYLEGKEVSAKVSEALEKRYSMTEHKRQVPASMFDDWWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD SYNTHETASE
publication title Crystal structure of NH3-dependent NAD+ synthetase from Bacillus subtilis.
pubmed rcsb
molecule tags Lyase
total genus 110
structure length 271
sequence length 271
chains with identical sequence B
ec nomenclature ec 6.3.1.5: NAD(+) synthase.
pdb deposition date 1996-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02540 NAD_synthase NAD synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1nsyA00
1K92A 1T9GR 3G5AA 3IDFA 3MXTA 4EG1A 4U7JA 1YI8A 3E27A 3CVWA 3FG9A 4MW5A 1TEZA 1NSYA 1T9GS 1WZ2A 1MC1A 3SEQA 1KAMA 2Z09A 3ZGZA 3FOCA 1WXGA 4ZT3A 3P0HA 1S4MA 3PXUA 4MUIA 1JZQA 1KH1A 1PFUA 3F3MA 4MQ6A 4ZCTA 1GN8A 5LLTA 4ND7A 4YBRA 3MMXA 1ZUNA 1A8HA 1NUQA 4NZPA 2OQ2A 4KPUA 1QRSA 1EFVA 1WOYA 4YMIA 1JGTA 3I05A 3D6VA 4DNXA 2PIDA 4MAFA 4YP6A 1OD6A 3N2YA 2CT8A 1VLHA 1U0BB 3CLRC 1U3DA 2PG3A 1P7PA 3A4IA 3DLAA 3P0JA 4MW0A 1XNJA 3X1JA 1JECA 1J1ZA 1O6BA 3CVUA 1NYLA 5HUHA 3RHSA 3CLUD 4PBSA 4PBRA 1SURA 1YIDA 2WB2A 3K32A 1PG2A 2G36A 2R5WA 2A4MA 1WXIA 1U3CA 4EG8A 1LW7A 4I6EA 4MWEA 2O8VA 2J08A 3FY4A 3AG5A 3CA8A 3HZRA 1M1ZA 1NP7A 2EL7A 4R2LA 3IVGA 1NUTA 4KR9A 5IJXA 3FWKA 2WQ7A 3HFJA 3LE8A 4MUHA 3RJZA 1I2DA 4WNYA 3IOEA 5BNZA 4ZCQA 3PNYA 3IVXA 5TEVA 3IVCA 3RK0A 1ZH6A 4QBTA 2WSIA 3X1KA 4NATA 4DLPA 1N77A 2QJTA 4DDHA 5J5AA 2IELA 4UZFA 1QRUA 3VGJA 3HL4A 2B7LA 2VTBA 4JFAA 3ILVA 3IH5A 1H3EA 4YP7A 3K9WA 1O94C 2CV2A 1X8XA 4ND6A 3N05A 5TEWA 2D5BA 2C5SA 3Q4GA 4JXXA 1QRTA 2AG6A 3CLUC 1G59A 2QUKA 2PXHA 3FH0A 3INNA 3UY4A 1F4LA 1H3FA 2JANA 3MLAA 2CSXA 4R2MA 2NSYA 2D13A 4PBTA 5F23A 3FIUA 3LCJA 5EKDA 5HG0A 2QJOA 2E18A 3A2KA 2XRZA 3G6KA 3GLVA 1MB9A 4J76A 4GU5A 3UC5A 1PFWA 2Z08A 4G5FA 4ZT5A 4JYZA 1IRXA 2Z3VA 1EJ2A 2J09A 4MW9A 1QNFA 2PZ8A 3PRHA 3FHJA 4MVXA 1OWNA 1T6ZA 4MWDA 3VRHA 3COYA 2BYTA 2H29A 1QTQA 5FO0A 1JIIA 1DNPA 1VL2A 2DPLA 3OP1A 2DLCX 1TYBE 1MRZA 2QUIA 3D6UA 2ZUFA 4MUJA 3TQOA 2CUZA 3L92A 3TZEA 5LM3A 3H97A 2E89A 2QTRA 3HGMA 3SDBA 3QTTA 4OUDB 3OTWA 4YP5A 1KQPA 4HK4A 1RQGA 4ARIA 3NBKA 1WKBA 4QRDA 2QTNA 5J58A 5TS2A 1MAWA 1H1TA 1KQNA 3H9CA 3ZJTA 2A1UB 4HJXA 1IHOA 4DDKA 1XNGA 1KH3A 4L2IB 2EJCA 2CYBA 3AG6A 4MULA 4I6JA 4MWBA 4E1AA 2E21A 2A86A 3UMVA 4DE5A 1QJCA 2O5RA 3N9IA 2E0IA 3GUZA 1V8FA 2A1TS 4HJRA 4MVWA 1JZSA 3JXEA 4TS1A 4WSOA 1N2IA 5DB4A 4AS1A 1Q77A 3UK2A 1O94D 1PFYA 1UFVA 4NDAA 2NZ2A 1N2JA 1R6XA 4CDMA 1Q15A 1KR2A 3C8ZA 1R6TA 1NUSA 2DEUA 1Q11A 1J21A 3ISJA 3A05A 3KT8A 2ZUEA 2J07A 1Q19A 1VBMA 3ZXIA 1JIJA 1WXEA 3H9BA 4G6ZA 3ND6A 4MVYA 1OWLA 1GZUA 3IMGA 4MWCA 1YUNA 4DJAA 1GPMA 2PZBA 4RPIA 2IP1A 3RFFA 2A84A 3N8HA 1NZJA 1J20A 1G8FA 1N2BA 1NURA 1U7XA 3LOQA 3IOCA 1N1DA 4NAUA 4CT0A 2HGZA 2DXIA 4H3SA 1B6TA 3ZJVA 3U1VA 1YIAA 3ND5A 1KAQA 3UOWA 1BS2A 4ZT7A 3AFHA 3KT6A 1GTRA 3IUEA 1O96B 4EG7A 5IHXA 3FNRA 4J75A 4QREA 4P2BA 4A91A 3SYTA 4EG3A 1FFYA 2J5BA 4ARCA 1PG0A 5FNZA 1EUQA 2CYAA 1GAXA 3TZLA 1N78A 1VBNA 5HUJA 3CVXA 3DV2A 4CDNA 2YY5A 3IMEA 1TQ8A 2GKSA 2QTMA 3NV7A 4K03A 3SZ3A 3P52A 1QU2A 1IQRA 2X1LA 4ZT6A 1O95C 1N2HA 1F7VA 1EXDA 3A04A 1O97D 4MVCA 3GMIA 3PNBA 1ZH0A 1M8JA 3ELBA 4Q16A 3CLTD 2I1LA 1NUPA 5H16A 3AKZA 3HV0A 1K97A 1K4MA 1WXHA 1N2OA 4R0NA 5FO1A 3X1MA 1KKUA 1GLNA 3TNJA 3ZXSA 1XJQA 4KR6A 1J1UA 5K0SA 1LI5A 1TYAE 3ZUGA 1OBCA 1TFUA 2DERA 4MUKA 4OUDA 2DETA 2QUJA 1F9AA 3CLSD 1OBHA 1EFPB 1COZA 1U7DA 1D2RA 3AL0C 1O5TA 1VBKA 1WXFA 1TYDE 3CVVA 4L2IA 1NI5A 2BTEA 1GTSA 3FDXA 3COZA 5H7XA 4MUGA 4XFDA 1T6XA 4BWVA 1KP2A 1I6KA 4PY2A 3FETA 1T6YA 5JBNA 4MW1A 4MW7A 1WQ4A 1IH8A 3KT0A 4EG5A 2XRYA 4X0EA 3IODA 1IVSA 2OV4A 2GM3A 3P0IA 2A1TR 2QUHA 2RD2A 1O97C 2H2AA 3MLBA 2A88A 2CYCA 4Q93A 2V0GA 4ZCPA 4JXZA 3PNVA 3CLTC 3SEZA 4EGAA 4F3RA 1WJGA 4KKVA 1QU3A 1JILA 1KP3A 1XNHA 5DEOA 2WQ6A 1N2EA 4MW2A 4KR7A 3SP1A 3Q10A 3RBAA 2PFSA 1JMVA 1PFVA 1M8FA 4MUNA 3H99A 4UZEA 2PZAA 1O95D 2TS1A 2X1MA 4ZCSA 3IMCA 1JEDA 3CVYA 1O0CA 2JA2A 1G8GA 4DDMA 3IUBA 4EG6A 1WY5A 2ZP1A 3CLSC 4MW6A 5KCMA 1MJHA 3Q12A 4CQNA 4OJMX 4GRIA 2X0KA 4ZT4A 1IQUA 4KPUB 1X6VA 1EFVB 1KORA 3DPIA 1O0BA 1J09A 2IJGX 1O96A 1CT9A 5KHAA 1N2GA 1G8HA 2HZ7A 1FYDA 4EG4A 1YULA 2A7XA 1M8KA 1OWPA 3NBAA 3TQIA 2CFOA 2GOYA 4K0RA 4U63A 3HMQA 2CV0A 1NUUA 1Y42X 1ILEA 3L93A 1TYCA 1ZJWA 3AIIA 3COWA 3FI0A 2VXOA 2DR2A 1QQTA 4G5YA 1IQ0A 2YWBA 3QE4A 4AQ7A 1MB2A 1N75A 2QJFA 1YUMA 1F7UA 3H05A 5DK4A 4S1OA 3RK1A 1MOPA 3M5WA 2J4DA 1LI7A 4MUFA 4ZT2A 1MBZA 1KH2A 2V0CA 4U8HA 2AKEA 4XSVA 2YWCA 1K4KA 3SZGA 4HPWA 3G59A 3IOBA 1JIKA 2YXNA 4MW4A 5DASA 1J70A 3KT3A 2RE8A 3MUEA 3KFLA 1JHDA 5LFAA 2AZXA 3VU8A 1KQOA 1OWMA 3ZIUA 1EFPA 3COVA 4EFKA 1JEEA 4F4HA 3TS1A 4NX2A 2VTBB 1N3LA 2X3FA 4MUEA 4NAHA 5J59A 1EE1A 2D54A 5KWVA 1OWOA 1HYBA 2JAXA 4XFJA 3S3TA 1M8PA 3BL5A 1M8GA 1V47A 1I6LA 4MLPA 3CLRD 3CR8A 3ZJUA 1M83A 1MAUA 1I6MA 1EUYA 3ND7A 4ZCRA 5K0TA 2A1UA 4FZJA 5TGTA 2CV1A 1ULHA 1IFXA 1WQ3A 5AHWA 4I6GA 4RUKA 4JZYA 2HMAA 1R6UA 1H3NA 4EF6A 3DO8A 3QTBA 2DUMA
chains in the Genus database with same CATH superfamily
2ZTVA 3IV7A 1WBJB 4AKIA 1X8JA 2QVLA 3EISA 1TOAA 3E7DA 1E5VA 2G9UA 2MSWA 4F45A 4Z2AA 2GBFA 5CB8A 1SJ9A 2PS0A 3OICA 1PJAA 3GI1A 1CF4A 2VJPA 4AWAA 2J7KA 3RTDA 2PWAA 2E1RA 4US1R 1GVHA 2Q4DA 5TDHA 5AVUA 1L4YA 1WXGA 2M6RA 5TQ2A 1WPXA 5B3JC 2P11A 4HL6A 1W47A 3HDHA 3OA0A 4AN1A 3NOOA 1JZQA 2IEBA 1Z37A 2WVAA 4R05A 2W58A 2RB4A 1TJ3A 4BE9A 5CDTA 4HEQA 3USCS 3VNRA 1UDCA 2DBVO 1NYTA 5K3CA 4JU8A 4NF2A 2VTEA 4PZYA 1TKCA 1O77A 3KC2A 1A8HA 4LX8A 2H3EA 2I6FA 4MWOA 4B3XA 9GPBA 1YC5A 1KI6A 5A2GA 2YOHA 3WGOA 3HCOA 3TAUA 2JD0A 4MAAA 1VGQA 4ZEOA 2QP4A 4EPXA 2CXNA 3IPYA 3N0VA 1ENPA 4FFNA 4EVQA 4OAPA 3EDRA 4RTJA 3NAGA 4M9QA 1T4CB 1ZP6A 2YHAA 1VJDA 4PWYA 3N5KA 4RKWA 3CZ5A 4YAKA 1HDIA 4O2BB 3N2YA 1YFZA 1U0BB 5DXFA 5JCZA 2PMBA 1A5AB 3ZE6A 4XM1A 4DNOA 3ZLUA 1Q83A 4FEEA 3ICQB 3GRKA 2CNWD 4B9AA 3ZYZA 2YN2A 3MVEA 5BNTA 1CYDA 3FTCA 3NM6B 2VP2A 3GP8A 3DS8A 4DQVA 1K7CA 1QE0A 1RPTA 2DJIA 1C3EA 5EZQA 1CS0A 1UBLS 4IX1A 4O2AF 4QYTA 4V39A 1VIVA 2HT6A 3LZDA 1YIDA 3HDTA 4CG0A 3NWEA 3B38A 3O2QB 4GPZA 1AQ6A 2G17A 3PJDA 4XARA 5FBLB 2R5WA 2PX5A 2Z43A 3FUTA 4N01A 2OB1A 3C3AA 1KK0A 2ZRJA 2QPTA 2FUG1 4WL0A 3TCKA 3MJDA 2WB4A 4Q9DA 1RRKA 1PQ4A 2J08A 1IATA 1KAGA 3HZRA 4D3XA 1X0XA 4QBHA 3D8NA 4EDHA 1T0JB 1AMNA 1PS9A 3ZDCA 3ZD8A 2HR1A 1JB1A 1ULSA 2R1TB 3BCRA 4YAIA 2P9GA 5I7FA 1KY3A 1GG5A 1QDUA 3AZPA 4E5SA 3LKBA 4HQOA 2A9KA 5CFQA 1CY2A 1A0OA 2H7CA 3ABQB 1LBHA 2W22A 4M1SA 5ESXA 4P5EA 4B76A 5IKEA 5K6AA 1ZCBA 1QE3A 4MO9A 5BSHA 4I7EA 1WL8A 1BH2A 2XOEA 2ZRBA 3EQ6A 3G3EA 4TV9A 4R2KA 3G9UA 3U13A 1II8A 3AHCA 4G89A 1GNSA 1HKHA 1Y37A 1NBMD 1X2BA 4BFTA 1ATZA 1ZN8A 2HDWA 2Q1WA 5CIWA 4IUYA 1Q0UA 3C5WP 4XJXA 4XZ3A 2VTBA 3EXHB 1KJ9A 1XJWA 4JJ4A 5A3QA 4QGBA 4YP7A 2B1RA 1Z6ZA 1XK7A 3SIXA 2G0AA 3WO1A 1E2MA 2OBMA 5EJ5A 4HQLA 4KG7A 4X24A 4P84A 3WRXA 1R9MA 4ECAA 1XTVA 5AW2A 2DHQA 4PAMA 4BZPA 4TMFA 1K7XB 1ILWA 1OI2A 1SHLA 3ZHSA 1FMFA 1XD8A 5IAAA 3KKPA 1R4AA 3LU1A 1GNPA 1PL0A 2ISSD 3OT1B 3AI7A 3E22A 3EPKA 4HEJA 4ARAA 1WSAA 3PQ3A 1EK6A 3LX8A 3JWHA 1QIEA 3MTGA 3DMFA 3ONEA 3PI6A 2CXSA 3FA2A 4JX8A 2ZI5A 2VUUA 3IQFA 5ALEA 5IBPA 1AO0A 1U1DA 1E5QA 4R8KA 4TKUB 3A2KA 2YYZA 4LXQA 4J76A 1GTL1 3ANNA 1SD1A 1WCIA 3FNFA 2V1UA 1P33A 5LVAA 4TQ9A 2QG4A 5ULLA 1E0JA 1TKAA 1T4DA 3S6JA 2OESA 3DTNA 4HPJB 2HWWA 4GVLA 5LDGA 1KPGA 3FYUC 4PLGA 2IV3A 4UTPA 1QPBA 4HAVA 4D45A 1W8IA 3MTDA 2WYUA 1CZNA 2GD2A 3NX4A 4IRUB 4F3YA 4URYR 1QB8A 1PDVA 2MWMA 3ZDAA 4JI4B 4H3KB 3CF6R 2IPNA 1QGED 2R7LA 3DG9A 1FW8A 2VWHA 3LI2A 3HNOA 2ZRIA 4FMDF 3KHTA 1P73A 3EOBI 4H77A 1F17A 1DPGA 1LPNA 5U9CA 4AQYB 2HA0A 5DE3A 4N7BA 3PHCA 5EERA 1G0NA 4GMKA 5KO2A 1Z4MA 3O93A 1ND6A 4XWKA 1CZKA 3RTAA 3AR4A 4MS3B 4F11A 4ZAZA 3WRVA 3N07A 2QTRA 2J0SA 3SDBA 1PQUA 4XQEA 4P4UA 3TXYA 2A5GA 4L07A 3QJGA 3UXYA 2FMHA 1N34B 2W8BB 2PY6A 2ZB4A 1TKRA 2W93A 1R1DA 2X15A 3LBNA 5DKFA 2JFHA 4TV9F 4UEQA 1MH1A 1W4LA 4FZ5A 1YOBA 4MIKA 4WI1A 2Q4TA 4ZO8A 1MA3A 5F4ZA 2MT9A 1P2BA 2ZJOA 3DR3A 1TT5A 3PC8A 1Z88A 3RYHA 4LYJA 1E89A 1KDOA 4O2LA 3SS7X 3VX3A 4JB2A 5BY2A 5KVSA 5EHZA 3AHDA 3BXXA 1ZJ6A 3AUAA 4XYGA 3D2BA 3A9WA 4NYMQ 5DHUA 5DMHA 3TGLA 2A33A 3NPMA 2E5WA 4ZXPA 3CCCA 4RTQA 2DFPA 3EMDA 3VZPA 4KGZA 6PFKA 4HJRA 4WSOA 1JZSA 1XZKA 3ME5A 4OHUA 4IZIA 3TB4A 5DX0A 3H1TA 4JEHA 1OZAA 2KWIA 2QWXA 3NUQA 2HPHA 5AKYA 1BXRA 3CKKA 4MNTA 4MPPA 4CDGA 3PVCA 1HYEA 1PX2A 2ZIFA 2YVUA 1IMJA 3LS2A 4QU0A 2BZ0A 4W5HA 1IBCA 1LW6E 1X0VA 4LBZA 2H6EA 4NIMA 5EWMA 4Z7QB 2W2KA 5EUQB 2DB3A 3H1FA 3OZXA 2RARA 3GBSA 4X1IA 2O8CB 1TZ2A 2MR6A 3VZSA 1VIDA 3TZBA 2Z8YA 4NJMA 1B42A 4J7UA 4LPSA 3VR4H 3FOEC 1YRHA 1QF6A 5FI1B 3W6ZA 2WHYA 4JXKA 1SQFA 3R41A 2F8MA 3ROTA 2H2WA 3T41A 3ENQA 1CCWA 1Q21A 2F67A 3CJTA 2MMCA 4P2GA 3LXRA 4KAFA 1XP5A 3OTIA 3TTXA 4DLLA 4NL4H 4CM5A 1GRQA 1XK6A 3SICE 1OI3A 3E9MA 3OIYA 1H66A 3K1ZA 4UDXX 4B33A 4BVKA 1NX6A 4EMUA 3HA3A 5FI5A 3WDKA 1ZGGA 4LYDA 1YIAA 1YZHA 1O6GA 3OEEA 1BJTA 5HFJA 1GO2A 4FFOA 5HDQA 1XEAA 4RVDA 1AKNA 2LDXA 3PFWO 1MIOB 3UKDA 4MA4A 2IBTA 4Z4GA 4YUXA 1D7OA 4R81A 3G2LA 3TLYA 1FDTA 1U8CB 4K9QA 1KQGA 3EPLA 2I4LA 4R41A 1NVMB 3BERA 2WZDA 5KVQA 3SN6A 4MJ7A 4ZVLA 2PZJA 4XEHA 2A57A 4C7KA 1L7OA 3JQAA 5AM0A 1NVDA 1XZQA 3OPYA 1DADA 5FXMA 4RHTA 5K03A 4Q6BA 2ZYVX 3G7SA 1QC5A 3D8BA 4PNZA 1DBRA 3B7WA 3KOYA 4U2FA 3EXG1 221PA 4N76A 3DBLB 3FTQA 3VNSA 4Q1VA 4HLNA 4XM2A 3MTEA 1BVHA 1E9DA 1PCXA 3MWGA 4N8SA 2NXNA 2GJKA 3NVAA 2H85A 3UMMA 1ULBA 2PH7A 1SBQA 4D4HA 1N2HA 3GDWA 2P2NA 4MEBA 1NLYA 8LDHA 2PCJA 2B36A 5JJLA 2AN4A 3TZ6A 1XLTC 1YBHA 3M6IA 5D6NA 3HB7A 1U7TA 2MSLA 3IKLA 4O02B 4DV1B 1CJMA 2AMJA 2JA1A 3RANA 2GLXA 4AJ1A 1Q16A 3VSEA 2VIIA 4A10A 4ZVRA 4B3BA 1R2QA 1LRKA 1Z6PA 4GPD1 2D5CA 1WUKS 3D7RA 4M8IA 2ODBA 4R0NA 2JAPA 1ZGBA 2O7QA 2HXSA 3DMGA 3LT4A 4N3NA 5FDFA 1JWBB 1D4FA 1US8B 2OK7A 2FR0A 4F93B 2GWHA 2VBCA 3DMYA 2DETA 3K6KA 3QZUA 2O7NA 5D85A 5JCOA 3A3NA 3G89A 3MJCA 5TVGA 2XMBA 3ROMA 3BDIA 2Q1TA 4GR4A 3AZOA 4IG4A 4OKNA 2QL7A 4X8LA 1ZRHA 3WIDA 4DLAA 5KQPA 3SYKA 2X1HA 2Q3JA 3BMNB 5IXSA 5KNBD 5EPUA 2Y1FA 1CUDA 2IIPA 5DLPA 4X61A 2YJZA 3TSAA 1T3HA 1FL9A 5SZIA 1PZXA 2P5SA 1OC4A 4DJEC 5KTTA 4EI2A 3T52A 4O2AB 3OIVA 1DSSG 1KO1A 2QR2A 2Y0PA 3L79A 3CCBA 4KDRA 4LYHA 2ZSFA 5C35A 3LVBA 1ZK2A 3KSRA 3A7DA 1VE9A 1E63A 1X1CA 2NZVG 2WSSD 3KCQA 3QEOA 4EQ6B 2V55B 1UMCA 3HB9A 3RRYA 3IODA 1V71A 3GHHA 3P9RA 2OV4A 3LQFA 3FCSB 3ZGOA 1RI5A 2HPZA 1QHFA 3PNLA 1BE0A 1N25A 1FDIA 2BGMA 2HD4A 3PBKA 5DW0A 3BFKA 5HKBA 5AJYA 1EU1A 2A5DA 1OBFO 3JQBA 1KEVA 3LDGA 4MRSA 2ZTMA 3PFNA 4G4SO 3FNBA 1IONA 1JDUA 1GOTA 4FSXA 4X7BA 2EZ4A 3T0FA 1JYSA 1DTEA 4CT4B 1L5MA 2J3EA 1JQKA 1NHWA 4G63A 2WQ6A 3NCHA 4LF5B 1QTIA 4LRTB 5TQ2B 4JCOA 2BKAA 1JMVA 1GTZA 2BDUA 2QROA 2VQSA 3VR6D 4BQRA 3H99A 1ML4A 4BECA 2GZAA 3KLBA 4PVDA 4ESHA 1I1HA 4M0UA 4FZVA 3ZD6A 3PITA 3MGBA 5BNIA 4LF4B 3NS7A 1HUQA 1RZVA 3N75A 3L3BA 3NHKA 3WMGA 2NP6A 2ZWAA 3TINA 2OG2A 2QZZA 1SG6A 1JEJA 3GO4A 3O3OB 1NUHA 4PXAA 1CY1A 3WGZA 2FQQA 4ARZA 1KI6B 1KYWA 4B32A 4CJXA 3GB9A 2QMHA 2Y27A 1GAWA 2NTEA 4UOEA 1HORA 3GVPA 2W6CX 2VHVA 5CR9A 2WILA 2Y93A 2QSJA 3K6RA 3VYVA 4FCCA 2PL9A 2V4MA 4BLWA 4TWRA 2IUYA 2H51A 4RY8A 3KKMA 5IFLA 1OWPA 5CJJA 1NXXA 2FUG6 2QTLA 3AFMA 3P71T 4JLOA 4RV5A 4U0JA 1BE6A 4G24A 1BJRE 4KIGA 4CPDA 1DELA 3FYDA 2DKFA 1C3XA 4CM9D 1UBKS 3CZCA 3L8FA 5FUVA 2GN6A 2YIMA 5LNK6 5AICA 3BFJA 5CLGA 4TS3A 4PSKA 2HRZA 2H17A 1ZJ5A 4B17A 2IPOA 3DC7A 3GXBA 1QP0A 2IY7A 3BD9A 3U16A 1OOEA 1EGMB 3OCUA 6ABPA 1JHZA 4LJ5A 1II9A 3TLAA 1DEHA 4O8ZA 1NDUA 4O0LA 3H05A 2HF7A 3KVVA 3ZN2A 3HVRA 4TWJA 1PEYA 2EFDB 2ZRFA 4MVJE 2B78A 4AKSA 1JTVA 4J0JA 5BNZA 1C8VB 3GFVA 5IM5A 5BW5A 1Z2OX 5GGYA 4TL8A 4JC5A 1OFIA 1DUVG 1XCMA 1BEZA 2UUOA 2W6ID 3Q41A 4FMDB 4J0IA 2I7CA 4YONB 1OY1A 1G5RA 4BO9A 1ONOA 1PYDA 2HJRA 3QWFA 4Z4HA 1I80A 2XXBA 5SZKB 1TCUA 3RS9A 5K8VA 5E7JA 1SUAA 2FEKA 3GJ4A 3N74A 4ZDKA 1ZSYA 2GBGA 3ORRA 2H4JA 4RTRA 2JLBA 1PO7A 3EFBA 6LDHA 1A5TA 2WPDA 3HYRA 1V6AA 3QW4B 5BQOA 1VJ5A 5EQTA 2W4QA 3HZZA 2AMVA 3OQNA 4ZQEA 3M4JA 4TV9B 4HVCA 1XLWA 1JR4A 4DNQA 1CB0A 2HPVA 2ZYUX 3FPAA 4JX9A 4WAUA 1II8B 1IBLB 2GRUA 1EFPA 2X5XA 3KXLA 1NNSA 3QTLA 4KOEC 2VF4X 3L6CA 3GH1A 3NXSA 4QDJA 1BX3A 2JFWA 4RXMA 4TYMA 4P22A 3TS1A 5BV1A 2QTHA 4JUFA 4D81A 1P4AA 2VTBB 4W5TA 1XAGA 3N1UA 4CF4A 3OLZA 3PPWA 1G9TA 4WBNA 4IDDA 1KWGA 1SXQA 2MR5A 4NHOA 4RK1A 3WNCA 4D99A 2NV0A 2CGEA 1DI0A 4QJBA 1JU4A 1HTWA 5EKSA 1C1YA 1YFJA 1JDNA 3E22B 5T3UA 3QVMA 2P9EA 1YDHA 2IY8A 4IXTA 3EEYA 4RUKA 4PTZA 5TPZA 1MZVA 3THYA 2VDMB 3U37A 2YWEA 5B6JA 5JRDS 1I5RA 1M3SA 2I4IA 1A8SA 1IPHA 4OXYA 5FLXA 3W5BA 5EMLA 3JWIA 2AFRA 3THOA 2PRYA 3G5AA 3IDFA 3H1GA 3Q8XB 5BO5A 1CR2A 1DHTA 1VI2A 3RVNA 1WCIB 2V5AA 3QYAA 1JEQA 1XZGA 3EIXA 1Q0RA 3TW4A 1N7IA 2VSFA 4Z53A 2PD3A 3N28A 3ODGA 1C1XA 5FAKA 3L0ZA 4KXLA 3TPCA 2JDID 2JGLA 5A7FA 2WJIA 1DCFA 1U8ZA 3CRRA 3JZMA 3C16C 4W8HA 2W42A 1GCIA 4YMHA 5JCXA 3K72B 4AUEA 1IOVA 3V4RA 3QM1A 4GBMA 3B2EA 1L5WA 1PS8A 4EEKA 3AX6A 3WR5A 3G5TA 4CTMA 3RGGA 1XU7A 2GXQA 2Q5LA 3OEYA 4K3VA 5J23A 3EW7A 1R6VA 4H7PA 1AM4D 4JEIA 3OQJA 4RJ2A 1TQDA 4CL0A 3QFCA 1WB5A 3EQ8A 1PJ8A 3A4YA 1GKLA 3PUKA 1HLFA 4P38A 3RV4A 3ZGYA 5ADHA 2XUIA 3RIHA 3LUJA 2WOOA 1TT5B 2EW2A 2PLRA 4UNIA 5D7BA 3WSTA 5F7ZA 3H3JA 3GLHE 2DQSA 3H0EA 5EKUA 2QE6A 2A4KA 1DQPA 1RBYA 1XVLA 4EJSC 1TM7E 4YPOA 2W98A 2NVWA 3E2MA 1HT3A 3EGXA 3OZWA 5DM2A 4OH7A 3OY7A 3D5TA 5LUBA 4WBNF 4OCZA 3DKVA 1QNLA 2XR1A 4PBSA 3U6BA 1EFAA 4ZV9A 1SURA 1RJEA 5I9IA 2CEKA 1BXRB 3G8BA 4LJ6A 4MUMA 4OLFA 2BE9A 2W2KB 2Q99A 1YDGA 2NQ8A 5DNEA 2FLKA 3KR1A 4MKXA 4PINA 2DT5A 1U31A 3H1EA 3MTAA 3FPFA 4X1IB 4IV8A 1SUEA 4EUSA 3HVJA 4BQNA 3N2ZB 5EESA 1TEXA 2RAVA 3L7MA 4Y0NA 4NJMB 1M1ZA 1OFUX 2EL7A 4LOAA 1ZCFA 1Z0JA 2EWVA 1O08A 2X14A 3F9RA 3ICEA 1EESA 3HFJA 1U8AA 2FW9A 3QFSA 1Z28A 2FU5C 2PEZA 3GC6A 4TLEA 5DXJA 1A2OA 3U7EB 2A0FA 4YUVA 4C87A 3A9VA 4ZV4A 4Y98A 2WU1A 3MXOA 3QU2A 1T5BA 4I1IA 4XGKA 2R6GA 4Y9DA 3RH0A 1G8AA 1FU8A 4JCCA 4OK5A 4CMIA 2ZB2A 3BAZA 1X1AA 4RU1A 3V3KA 1T2UA 1CEQA 3DW1X 4RSGA 2ERCA 3KELA 3K09C 4WLNA 1AKEA 3ZLVA 4BLTA 3H0KA 1GR0A 2N1BA 1XCLA 1G5PA 1T36B 1P6UA 2EFYA 2C4TA 2GERA 4E2XA 2JLYA 1UUFA 3STVA 5THKA 3U1TA 2AKYA 4M54A 3HL4A 2B2NA 2B7LA 1RXYA 3FI9A 3SJUA 2WC1A 5GQSA 1SAYA 4Q03A 1H3EA 1HDCA 3BSWA 4YV0A 4C1NA 1FVHA 3IVRA 1VMKA 1SOWA 5JH7F 3JQAB 2C83A 4W5OA 1G55A 3OPYB 3S8EA 2LCFA 5BQ3A 2IEDA 4DUGD 3LPNA 2B94A 4XCVA 5KTOA 1W44A 1QC5B 5BV8A 2YICA 2WOJA 2IXDA 2P8JA 3TI9A 2II6A 1UEIA 3Q5GA 2QUKA 3BZBA 4MYTA 5COQA 4A73A 2J9RA 2MU1A 2JEOA 3BQMB 3UY4A 1F4LA 3S0JA 4BN4A 1TZMA 1TJ4A 4L0MA 4BO7A 3GLGE 2RHHA 3CHYA 3I1JA 4TLCA 4EPYA 4MV3A 5KNBH 3A1TA 3I9V1 4UVIA 2K87A 2C7RA 4W6ZA 3R76A 5HG0A 4P0PB 4IBOA 5A0FA 5ITWA 3V55A 4ZA2A 3PEYA 1GTMA 3ZVMA 4RJLA 3H6GA 1SIWA 4RD0A 3LBYA 5B4TA 1KERA 1ZFNA 4H0CA 2OY0A 5HJ5A 1EJ6A 1U1FA 4JYZA 1J2JA 4A2QA 2R8EA 3I28A 5B5SA 1HURA 2VN8A 3B9RA 3DT9A 3G68A 2PXCA 2GVZC 2AZ4A 1JU9A 1K8QA 2I6UA 4MRAA 3RWBA 3O8NA 3E9RA 3RB8A 3PUYA 5TMBA 2Q3DA 1YBFA 3HXMA 1ZMOA 2XMSA 1EB8A 4MCIA 1YQ9A 4BIIA 5JC8A 3I23A 2XZTA 3OI7A 2R4QA 2PN1A 4W1SA 1MRZA 3EN0A 3EEBA 5HKKA 5HKLA 3TQOA 4F5EA 1C9EA 1FS4A 3UMSA 4CODB 5LM3A 1OXTA 1OAAA 1PYGA 5JBQA 1ZJZA 2D4AA 3OZEA 3ZVKA 5DGDA 4D82A 3WL3A 2WIFA 1SGWA 3H6KA 4Z1OA 4ZCMA 1GUAA 3AVPA 1RWNA 3HJCA 4DIKA 4YAFA 4BUJA 4X8MA 2RAFA 2AMLA 1UK7A 3C4VA 3VR6H 1UBUS 3HU3A 2WYHA 4DDKA 4O33A 4F8YA 2QTAA 2PV0A 1W5BA 4DR6B 2ZRQA 1PZMA 3SSOA 3QKUA 3KKNA 2GDZA 4AF8A 4C30A 4BL5A 1RAEA 5B1DA 3UWPA 1ISGA 5CVCA 3UGTA 1EWKA 3NPAA 4XR4A 4L27A 4PSAA 2WJVA 2OTCA 3KOZA 4OMFG 3UANA 4NH4A 1T8RA 3K9HA 4S3MA 4RZIA 4GM1A 5EJ8A 2OAQ1 1RI2A 1B0AA 4BNIA 1EAMA 4CDMA 5INTA 1OR8A 2NXWA 4EAQA 3L7KA 5FBVB 2JGEA 4TT8A 1C2YA 2Z2JA 4LE2A 5I48A 4KN9S 2CFTA 1FSFA 3V7UA 1FQOA 4HDMA 2F9LA 3KLNA 5JCJA 3REOA 1WY7A 3UAZA 2TRSB 4OI2A 2RBEA 1DG9A 3W6UA 3TW0A 3CGWA 1KI9A 3RW9A 4DYDA 2FPOA 3DTTA 1RM0A 1V5GA 3AF5A 4MWCA 4TSRA 3S4YA 1UMKA 4BMZA 1W36C 1MHTA 3ESAA 3P27A 1Q3TA 1WXWA 1P74A 1M10A 1QRRA 4KO2S 1JR3E 2HQSA 4KWCA 4UHJA 3VR3A 4RF5A 4DG5A 4EKNB 1QGAA 5AJVB 1E0DA 3SQMA 4X54A 4QXRA 4EM6A 4YS6A 2GCGA 3DB1A 3ZVRA 3MS7A 2OZLA 4LYGA 3QUAA 4POAA 1EE2A 1PWZA 2WTNA 1JG7A 1I10A 3OUZA 1J7JA 1I24A 2R44A 1NIPA 3MGGA 3VUFA 4B3IA 5DSTA 2P6RA 1BS2A 1JR6A 1WB4A 2F1HA 3H4VA 3E84A 2NIPA 2FFQA 5HCUA 4DJ5X 3BSFA 3L8MA 3U5TA 2RJOA 5AIAA 4DHWA 1RHRA 1GTRA 1GQQA 2Q5IA 3D9QX 2XIQA 3K8OE 1NDHA 1T10A 2B83A 2N3ZA 3KDPA 4LWPA 2CFRA 3BFPA 3CISA 1IULA 4M37A 3WMEA 4WA7A 2Y6UA 1T4MA 1TO2E 1VMDA 5IARA 3VR2A 1DAHA 2B4YA 1I8TA 4CL3A 4K5QA 3H2JA 2V65A 1DV1A 4HQKA 3DFMA 1VSVA 4BLQA 4ARCA 4Q7LA 2Y71A 3UFBA 2BY4A 4ZJZA 1QH1A 1IHPA 1YRLA 4E4YA 4GICA 4JMPA 1V95A 4HH4A 1SUFA 4FEYA 1E9AA 4TTJA 3EAGA 2EFHB 3HM2A 5K5EA 4ITRC 4AYWA 1UJBA 3CUKA 1NVAA 3AKCA 3MCUA 2A9JA 1G9SA 4A36A 4NS4A 1SA0A 1O95C 4XIIA 2TECE 4ZT6A 5FRDA 3NT4A 3SQNA 3TIVA 3BMXA 5LB4A 3VR4A 3WRYA 4EFMA 2JFFA 3CUTA 4I1VA 1XJ0A 3VYTB 4DSAA 5K4HA 4C2TA 3RC2A 1L9XA 1P7WA 1X42A 4V03A 2R86A 1YZVA 3W5HA 3ZTWA 5TC4A 5CJPA 3IMFA 3EGIA 1U5AA 4NNOA 4CGZA 1JA0A 1KY2A 4IOKA 4UMDA 2ZIVB 3KAKA 1E2HA 1TYAE 3M9XA 4IOMA 5C1IA 3DLHA 3VR5D 1RXSA 3VPCA 3AM1A 2GM9A 3BE4A 5HYVA 2Z2IA 3HJAA 1USGA 4C6TA 4BGDA 2YXPX 2X8BA 3ZDXB 1WTCA 2EX1A 2HCJB 2ZAGA 3SHOA 5AVVA 1JLRA 1H5UA 1TMYA 2XTZA 2ZB7A 2IYNA 1ODCA 3B3GA 2P1DA 2R6AA 1EFPB 3HLYA 2RCNA 1NU8A 2Z04A 3QH4A 4J91A 2R11A 4CFZA 4V1CA 4HX2A 1MQ9A 1TT7A 2DP4E 2EC5A 3OZTA 5B3JA 1AQNA 1KZ4A 5DZSA 3PUHA 3TXXA 5IDVA 3M4XA 1F20A 2P91A 3CINA 4WBNB 4HD8A 2WY2D 3WL7A 2Y4NA 4XFDA 4PLYA 2Q4EA 3ITEA 5JSYA 2JIQA 1M73E 4ZEMA 1UQUA 1RQLA 1L5SA 4X1OA 4YACA 3VMFA 3FCUB 2GZHA 3N3AC 3O2JA 3FJ1A 4OXXA 4QXAA 2BTQA 2Q5HA 4H15A 4ROSA 2F3TA 2XKJE 3P0IA 1QG4A 1KBOA 2RD2A 4LXIA 5SICE 4DMCA 2C3UA 4DB2A 4R8VA 2VP3A 4M1ZA 1OZHA 2D7CA 5D86A 3LIIA 5T8KC 2GYYA 1AF4A 4INZA 4N5LA 4PG8A 2I3ZA 1DWUA 1JEQB 2X22A 3NRCA 3HYCA 4EGAA 3TN7A 16PKA 1DXQA 1UKVY 3EODA 1ECJA 1MLDA 1PNOA 4W4TA 5DRTA 1SIOA 4RF2A 1JKFA 1IEVA 2K7ZA 4MLDA 3Q10A 3HSYA 1FFEA 1LNZA 4DSZA 1Q12A 4KODA 1I9CA 1G21A 1QFSA 1WG8A 2ZWOA 3MB8A 1AGXA 1BGXT 2I66A 4O4LA 1XPRA 1TIBA 4IZOA 2V0NA 2WHPA 3ZJYA 3OPVA 4O29A 1E3JA 5ILOA 3HJUA 4JQOA 1ZN7A 5AJXA 3B52X 4EHHA 2ZM6B 1AQJA 1C0KA 1D2EA 4W99A 3CTPA 2JNWA 1BE8A 4GRIA 3LKVA 1Y4DE 1FUKA 1U81A 1R9NA 3CWZA 4TV8A 2PGNA 1L6RA 1RADA 2ISQA 4DQDA 3KVNA 3D7SA 5JAZA 4X71A 5JW6A 4CR8A 1I7QB 4QLOA 1NU6A 1U2DC 3DP9A 4JI3B 4BLRA 3NJ4A 5AM4A 5KKCA 1I2BA 4D8VA 5C3MA 3BJMA 5CFRA 3F6RA 4O2RA 1SBNE 2AG5A 3C8DA 4WX2B 1T8SA 4EYQA 5CAEB 1VGVA 1OTHA 1E5LA 1NJFA 2HV9A 3H2GA 3EY4A 4D0SA 4GQIA 5F3DA 3GP5A 4DTIA 5K3OA 1HG0A 3ZIDA 3E03A 1JALA 3L8CA 3EGXB 1DX6A 4X6LA 1ZIPA 3VVCA 4V02A 4EOGA 3WLRA 1EWTA 3L93A 5SZHB 4ZMSA 4TXJA 3ZBUA 1BWQA 2X9LA 3VSDA 3HC7A 4DRYA 2AXPA 1R10A 3Q7QA 2JLVA 4QUBA 2O8NA 3UOGA 1L5GB 3UMFA 1U5BB 3R0XA 2NAFA 3CZAA 3OJXA 3QE4A 3U56A 5KSWB 4DCUA 3O4IA 4P53A 4NPAA 1GDHA 4WN9B 3U6KA 3PQ6A 5EWJB 4X66B 1F6DA 2XF2A 4QBGB 4S05A 3LBAA 4KX5A 1ST3A 2CNWA 3EIQA 4WVFA 1CJKC 2HSJA 5ENDA 1U2TA 2EKBA 2J4DA 4FPXA 4P32A 4P81A 1W5SA 4Y9SA 3WOVA 3IAAA 1U65A 1E2FA 2EEZA 1K68A 1PGNA 1WW2A 2WWFA 1W0JD 4XKJA 4NC9A 1UEJA 1VKNA 5I4IA 2XUDA 1A2BA 3EMKA 4TXMA 5JADA 1ZOLA 1D1SA 3AF4A 3FZGA 2VAMA 3L0SA 4S1WA 1TFRA 1G7CA 2JJYA 2B34A 2YC2C 4CMIB 2J3DA 4WIAA 3RC1A 3I2FA 1B14A 3SZLA 4K9LA 3P97A 3PT9A 4MJLA 4MGKR 5DNDA 5LMNB 3ELYA 1EYZA 1GZ7A 2EBHX 4XAQA 4F86A 1FP4B 4O4LF 3C3XA 2YMQA 4ITVA 2NU9A 5JAPA 3WIBA 4LRUA 3FYUA 2CWWA 3ENKA 4R31A 1LPOA 4FHZA 5E6UA 5CXUA 2OORC 4ZYZA 1II0A 1X7DA 3I9V6 3PK0A 3D7MA 4K86A 5JAIA 3LKZA 1TF2A 3H04A 2FFHA 2Y8EA 3FNGA 2D54A 3ZD7A 2C5BA 2WNHA 4TV8F 1LVGA 1OLUA 2R6CA 4W82A 4CKEA 3S3TA 1TUIA 3ZV4A 4AG6A 5ELXA 5GGXA 4M55A 4HDNA 2EZTA 2GJSA 2J9FA 3ANSA 3B85A 3VJRA 1NBMA 1H0KA 4AY2A 1M2EA 2X77A 3LC1O 4IHQA 4LVUA 3KYBA 4BZXA 2IF2A 2EWWA 2H5LA 3F74A 3L7OA 4N5NA 4GBED 4QFBA 4FHDA 1CQZA 1E1DA 3QMVA 1Q44A 1NY5A 2JD1A 5JRJA 3SHFA 5EJ6A 1SXGA 1XTSA 5BUCA 4AB1A 2BGJA 1Z6QA 1J8MF 1PP4A 4HFRA 1W1IA 2ENWA 1H2WA 2VYQA 3ANMA 2BFAA 3LUKA 4M9UA 5F7JA 1ZI9A 3OZUA 2DRIA 2ALJA 4FKBA 2RG7A 1B0PA 3E9ZA 3I6QA 3M6AA 4GPAA 3L7AA 1MC1A 5GJCA 2CFCA 1RP7A 2NYAA 1MJFA 2CXXA 1Z6AA 2VJNA 1C7FA 4MA5A 4WKPA 4BCBA 4OLJA 1JJ7A 3I04A 4ARUA 2WD8A 2HU2A 1WTAA 1Q84A 2PKXA 2DKNA 1D2GA 2F59A 2M98A 3DDCA 3EG5A 3I6IA 2EWMA 1PFUA 3IDZA 4GEGA 4LRQA 2EF1A 1QFXA 1GN8A 1I1NA 2XCUA 3WKEA 5KINB 5BYAA 2ZSIA 5C80A 3M81A 5GOZA 3MSCA 1LRLA 1VMIA 3EJ6A 4U6NA 2WJAA 4JNKA 4RC9A 5FOXA 2RHOA 4KTVE 1HM5A 2DWQA 1IY0A 1WD5A 3FYSA 2V9CA 3QBEA 5C32A 5JNRA 4DEYA 4QATA 1N5DA 5M3BA 3SFTA 4IFEA 3PIDA 2QMUA 4XUGB 3OWOA 5JXWA 1YI0A 5AYVA 1XTBA 4B5KA 1CNEA 4QUJA 3TM4A 3O0DA 1OD6A 3TE7A 5F35A 2BKUA 2D3WA 3JVUA 4X8OA 5AJHA 5AW0A 2BZGA 2H4WA 1YA6A 4RTKA 2TMYA 4PYRA 2J0QA 1RLMA 4WTOA 4JT8A 2RBGA 4K7JA 1EEHA 4NV0A 1BKSB 4OATA 1AHNA 4FZ3A 2FP3A 3Q88A 1XNJA 4KMOA 5B4VA 3T7DA 2OMEA 3WLFA 5HUHA 1ADYA 4LRSB 4Z4QA 3TZKA 1Y8AA 4WFJA 3KAJA 2IYLD 2B6NA 2P9HA 3QLTA 1KMQA 4N49A 3U9TA 4OREX 5M7EA 1D6JA 4OI0A 2PFGA 2QR3A 1NQUA 5CW2A 4M88A 2C3PA 3WGKA 3B1KA 4E22A 1K3FA 1HE2A 4TYQA 4PPGA 2P6NA 3H16A 2K7FA 1FK8A 1SUIA 2P2YA 1LW7A 3QFFA 4JOCA 2XUFA 3T35A 3CA8A 4KXWA 3ESBA 3LTEA 2CVQA 1U3FA 1ZKMA 3B70A 3RRMA 4NDNE 1VZ2A 3DXZA 4I8XA 2ZYHA 2VRCA 4ZTUB 2PL5A 2VZ8A 1EK2A 2XYHA 3IBTA 4Z49A 1CUWA 3IVCA 3GQVA 3H7AA 4D9FA 1ZM3A 3LOPA 4F2DA 4YMGA 4M0MA 3PKJA 3B6EA 1DXOA 4OFWA 3ZW7A 2OZLB 4DG9A 4K9OA 4U9IS 5G0TA 2I2XB 1Z15A 1D5WA 4HNSA 1QGDA 3AR9A 2QXUA 5GM1A 2G82A 1YDFA 1H4QA 1XKLA 4C5AA 3NLLA 2E55A 2WBLC 3VVBA 4DDHA 1QR2A 1WBBA 1UXKA 2GEKA 4WJKB 2JI7A 2UU9B 2A2ZA 3QFRA 4O63O 3O73A 4EYEA 2QIOA 5FLYA 5JNUA 3SKYA 1XPUA 1E6EA 4DIMA 3OF3A 2PJDA 3IV9A 2A67A 2ZE6A 1Z13A 1KVTA 2XQJA 4NY1A 2H07A 5FUMA 5IKPA 2EG9A 3B53X 3EQZA 4Y0VA 3U4AA 3VR5H 5LMCA 1T1GA 5I9SA 4OYLA 4RESA 3EARA 4Q3DA 3PC4A 3ZHTA 1PJLA 3RFUA 5JXHA 1KOJA 1QH1B 2VJQA 4RKYA 3LWNA 1N6KA 1KBZA 4IKOA 4TWBA 5AD1A 4MKZA 1XZJA 4TMWA 1ATIA 2VZEA 4AO8A 4GFDA 3R3UA 2WMNB 4MVJD 1R15A 3IESA 1Z5OA 4NQZA 3T54A 1N3IA 1P0IA 1HFKA 4IY1A 4C03A 1NN5A 3WLSA 1QHGA 3NHFA 4AMVA 4B44A 1R00A 2ILTA 4PZLA 4JOSA 5LL6P 1SA0B 4YNBA 4TZTA 1IN5A 3C7DB 1PFWA 2FPGB 4L4XA 1JHAA 2QGNA 1D4OA 3PJEA 5FBRB 2F7SA 4C7VA 1QPGA 3JYPA 1QKJA 5E38A 1SG0A 2X9NA 2FPIA 5F1OA 1V5IA 4O4HA 4BEWA 2A1IA 3FROA 3PRHA 2GN0A 4R6XA 4BHTA 3FHJA 4CM7A 2VYCA 3SVTA 3D4LA 4IILA 5FL3A 2Y0BA 1T6ZA 1X3LA 3EZXA 3SX4A 4YJ3F 2IS2A 1NHGA 2IIQA 2R1UA 5TSDA 1GSHA 1PJ3A 3NM4A 4LXYA 1Z33A 5L7TA 2ZITA 1H9BA 1E7QA 3ZLJA 4H0FA 4IIXA 3BH7A 1B6RA 2QUIA 1U9JA 4NEHB 2XMRA 2QBYA 2CXQA 4C6TB 1A5ZA 3H97A 4GYJA 2QRPA 5AXCA 4QPDA 2VFAA 4HBGA 3JQEA 2IKSA 3DMPA 1LJ8A 5I9LA 4M0LA 3F6PA 1L4BA 3W2TA 1WKBA 4PYMA 3F67A 3UMRA 1D4AA 1H1TA 3QEJA 2WW8A 2AFHE 3TJMA 3UA3A 3FSGD 1B3RA 1SH7A 1JDVA 2PMWB 1VPVA 3A1UA 2CVFA 1C3JA 4RTMA 4DR5B 2GPWA 3VSBA 5CITA 1LBIA 3PEEA 4XD2A 3SWWA 4LK3A 1QJCA 3ZCQA 2C82A 2GZ3A 1SKMA 4RH1A 1ULZA 4TS1A 2Q2OA 4WZBA 3NWPA 4R1TA 3E18A 3PQ5A 5KNBA 3LIPA 4HYTA 4PHGA 1XU4A 3BMQA 1Y3IA 2BTQB 1O94D 1PFYA 3BD8A 3GDGA 3T3GA 1O4WA 4J0GA 4RJTA 5F1PA 3Q0EA 4KN5A 1DKUA 2XJ4A 4D9EA 3LX5A 3P5BA 4FYYA 4P9NA 1PDWA 3D3NA 4WDQA 4ALKA 2J9XB 2I8LA 1F0PA 2O1EA 2IA5A 3PWTA 1PGOA 3OZCA 1IOWA 2RSLA 1THMA 1UT6A 3CTMA 4PN7A 3LQYA 4D3DA 4RK5A 1AV7A 1QHNA 3VR0A 3HCPA 1WXEA 1AZTA 2N42A 3DE6X 2WDZA 1SVLA 2JCGA 2H06A 2WSSA 1IJKA 1OWLA 2ZR7A 4J3JA 4B8ZA 5LMUB 3K4HA 1EFUA 3AVVA 3G2PA 4HPXB 2NZXA 1FXSA 1NZFA 2RI6A 4UTXA 5KQRA 1NURA 4JI5B 1U7XA 2W8ZA 2HAEA 4A8TA 4W5RA 5K8TA 2JFXA 3HO8A 3IOCA 1G21B 3DWIA 2F1OA 3D3EA 1KRHA 4O4HF 1SG9A 2PSFA 4O4LB 5BWLA 2WR8A 4FM9A 2DXIA 4ZWNA 2WHPB 3KAPA 5DGIA 3WTCA 1JDBB 4J7XA 3GWZA 3LWZA 1VB5A 1H69A 3N8GA 4QU9A 5JPCA 4X6YA 3F5MA 3LLVA 1U2PA 4FZRA 2EP8A 1L5QA 3R5KA 2YNMC 4TV8B 1NLFA 2PHZA 2CDCA 3E82A 3VR6A 2OVFA 5FEMA 4C14A 3FUCA 1MVNA 1WRBA 3PE3A 1UPXA 5K0NA 2GJAA 2HJ9A 3F0TA 3U4QA 2JD2A 1U2EA 4Q3AA 3LPAA 1DHRA 3SDZA 1YB7A 1TTPB 3ZQKA 4Z4EA 3DPSA 4MUYA 3EPJA 5KDLA 2GRAA 3OECA 3KUXA 1P9RA 3DVRX 5H83A 3BEDA 4TYWA 4E5DA 2YCBA 4ZJUA 1DJMA 1C4KA 1IIBA 1LDGA 5G1OA 3EGWA 3O3CA 4FINA 1P62B 1UDXA 5C1DA 3MWDA 3H2IA 1E4YA 3DE3X 4LSGA 1VL1A 1SCQA 4XVHA 3DZGA 5F4BA 1Z26A 3R0VA 4ROTA 4UU1A 2Q3HA 3VDQA 5LIPA 2QY9A 4AT1A 4K03A 1KTIA 5EZSA 4OQ4A 1MW8X 3IQEA 1WNFA 5CIQA 2Y1EA 4Y67A 3VNQA 4D4JA 1OGJA 1SKAA 4CM9A 5AVYA 2IZ1A 2V03A 4F5WA 2Q1SA 1TUGA 4Y8VA 2DBZA 1PSWA 4KR0A 1XZCA 5P21A 3SPXA 5KQLA 4ZTZB 1X74A 2QD2A 3OCCA 1PNRA 4OHPA 4NXNB 3STUA 2BI4A 3O3MB 2A78A 1SKBA 4I9UA 4AMGA 3KZVA 4EABA 1C4WA 2X2FA 3MCZA 3O90A 5DGHA 5CLHA 1EG7A 2C97A 2EFCB 2WF5A 1N2OA 2PKWA 3DBOB 2H1CA 1GWNA 3HYNA 3EGVA 4LYYA 4H7FA 1SCAA 4EG0A 2OMKA 4J9VA 4DPLA 3C14C 2O07A 3KZNA 4DLNA 4RL6A 1SU8A 5GZ6A 5TQ0A 1GCGA 1Z07A 1HOTA 1QSGA 2W6IA 2QUJA 2EW8A 5JALA 4Y18A 1IQPA 2NU9B 1COZA 1RJ9A 1V6SA 2OP0A 3FYUB 1C4OA 4BFZA 1NMXA 1OV6A 5DNYB 5E6UB 4E14A 1U02A 2YZKA 3MQ4A 3RSQA 1DIBA 1P6QA 1IU9A 4DDVA 3GGCA 4CMCA 5J1SB 1Q0PA 2P69A 1PI3A 3S2IA 1G4AE 2IXAA 2RC5A 3G9TA 1PR3A 1UEXC 1TK9A 1OLUB 4XEUA 5ESWA 4CKEB 1FFCA 4ZI7A 5H7XA 1ZMTA 2V3VA 2L0XA 3F9IA 2BMAA 3IELA 1UJNA 4K6MA 4RSHA 4ALMA 2M6LA 5EE0A 1VXOA 1KYYA 1SVWA 4HDNB 2L19A 3CE9A 2ZSAA 4G5OA 1PWYE 3D4PA 4OMCA 3S2UA 4WK2B 3IAS1 3UJHA 4A7PA 2LIVA 2WFZA 1E1KA 4OGFA 4DCNA 2GXUA 1Z8DA 2IHKA 1WDLA 3NRBA 3NUGA 2XB2A 4L5YA 2G83A 2GO1A 3TWOA 3QVGA 1BHSA 1ECGA 1JG2A 2A1TR 2GM3A 2YHIA 2AW5A 1OXVA 3TZQA 2OYRA 4WY2A 4EMTA 2H2AA 3OHPA 4JBWA 3RGWS 2GBLC 5E1MA 3E3LA 1SUBA 5DEIA 4QUEA 1WKVA 4LXGA 2JCBA 3SU8A 2A0XA 4LWOA 5KYUA 2C59A 5U1PA 2D0PB 3FOZA 4MA0A 3PQEA 3QVXA 2NZYA 4GP7A 3KG2A 1JILA 1VE5A 5G4KA 1XNHA 2D1FA 5EJ9A 2CL0X 2GK3A 4HAZA 3FMFA 4Q3OA 1Z0KA 2IEIA 3LQ4A 3RIGA 3OA2A 4ALNA 4AECA 4YMLA 3L46A 2WHRA 3NCTA 3ORSA 3N8IA 2HV8A 4GKAA 2WWWA 4MUNA 5EUCA 5EXDA 4DA9A 3GEHA 2B4KA 3Q3HA 4J3NA 4II2A 4DCTA 2V58A 4ISCA 2FEAA 4EGJA 1GYRA 1UPCA 1C1DA 1O0CA 2ONKA 3A1SA 1I2AA 3U9SA 4CIDA 2FJUA 3GP3A 4CMKA 4RMJA 4G65A 4CR6A 1BC5A 1KZGB 3DDOA 4IGEA 1XHLA 4MW6A 1CUIA 5KSYA 2B8WA 2RDMA 4P34A 1KU6A 2ASVA 2X5JO 5KSZA 2A94A 5KTMA 2IPXA 2HREA 2Q6LA 3HZHA 4C4XA 2RAPA 3ET5A 2JDIA 4G9BA 1O0BA 1J09A 2IJGX 2L82A 3INGA 2ONCA 4U8GA 1IK4A 4CV3A 1Z4OA 3LLUA 4LHSA 2XNSA 3TDMA 4RHEA 2EBWA 4KYTA 3VPXA 2O2HA 1YI1A 3CM0A 3OM0A 2ZI9A 1Q1NA 2GGSA 3K09A 4TL9A 3T0GA 3MELA 1NUUA 1Z5PA 5BNFA 4XWOA 2GCNA 4A8JC 1BKYA 2XZOA 1EFTA 3LNCA 3SVZA 2CXPA 2FWBA 4ZI7F 1Y4SA 4C4OA 3ZCRA 4J4HA 4B0OA 2G5CA 2ZYSA 2YWBA 1YQTA 3DBHA 3HZOA 3PLAE 5FWYA 2AJCA 3OPQA 2ADMA 2XEXA 2OCGA 1ENZA 1MT3A 1YUMA 3B48A 1JJBA 3K0FB 3MS4A 5DK4A 1CNMA 2TSYB 3FAZA 5EMHA 1P4JA 2NN3C 1AS3A 3C39A 1ENOA 3NDJA 2Q0HA 1V3UA 3BBLA 3H5NA 4Q12A 4FN4A 4UUQA 1V7QA 4YJ3B 5GVSA 5FTWA 4IIFA 3AT1A 4E32A 5FLEX 3V2GA 3GUCA 1DV2A 4YLYA 2BM1A 4AD8A 3MT7A 3IO5A 3FUUA 4NZOA 5D00A 5BSMA 2E6UX 4DMUB 5BW8A 4I55A 4AURA 1HSOA 1RACA 5IXYA 2IYPA 5FOVA 4IIHA 1R4NA 3EZLA 3KT3A 1TF5A 2YHSA 4P0QB 5FR2A 3MAJA 2P65A 1XTKA 1RYEA 3M3PA 4DQ0A 3GA5A 4HAOA 1I2ZA 1NJSA 2IHBA 1ARZA 2XUJA 2C3MA 3AP3A 3WGHA 5CNMA 4EARA 3DKIA 5EYPA 1SOAA 4P80A 2FUNB 4EFKA 3VU0A 5LJLA 1J97A 3MJVA 3T3PB 1M6EX 4F4HA 3ADBA 3DULA 3K9BA 4RCVA 3ULKA 1WNTA 1ZCZA 4UFOA 2Y77A 3T5DA 3A10A 1O0SA 1T9BA 3O2NA 3VHQA 3IHKA 2AHRA 1XNRB 2VUTA 2C8VA 5JJIA 5BN3B 1WVMA 4ZTBA 1TUBB 3DVAA 3WAJA 3IFSA 2Q29A 3ETHA 3DFIA 3O1JC 4PXSA 1UAGA 4KXYA 2DWCA 5CEJA 4H3VA 4L7QA 4Y9UA 4IP0A 4TT3D 2X0FA 3VJLA 1ZSNA 4M22A 1TQ4A 2QSUA 1RC8A 1Z8NA 4OH1A 4EFNA 1HRKA 1U3WA 1G6HA 2AUTA 2FK7A 4G36A 4JZYA 1Y5NA 4EI8A 1G4HA 2FF5A 4YT4A 4QJ4A 4ETIA 2NUPA 1F8GA 4GLLA 4NNJA 3ZWYA 4DXAA 4CIBA 1QHXA 4HQRA 4RANA 2BLLA 2ZTUA 3L41A 4G0QA 1K92A 4NARA 3I2KA 3BDAA 4DUGA 1P80A 3ISTA 3M1IA 1SO8A 1QHSA 5LWHA 1H85A 2IH5A 1UBEA 4RGBA 5F2OA 1A4UA 3FB1A 5AQEA 3QQ5A 4UUOA 3GLIB 4EKYA 5GV8A 2B21A 3SJZA 2AR9A 4O4HB 5F73A 4U7DA 1GNTA 4L73A 2D62A 2VP0A 2O2GA 4E7PA 3F71A 3RODA 3KOUA 5BRAA 8OHMA 2QQFA 2OO7A 2I54A 4D74A 3PWKA 4GI7A 3THWA 3VC2A 3VGPA 2WSMA 3HDYA 1E7SA 2QHXA 3NHWA 3WWPA 4DM3A 1F5NA 1Q7GA 2BELA 4MYUA 2Z6AA 2FR8C 2SKEA 4M8NE 5IWAB 2CFIA 2AI2A 1S01A 1I14A 1PL6A 4I55F 1WU7A 3N6XA 4E5MA 2QBYB 1WVGA 2VPXA 2WNSA 1KJYA 4BNTA 4BRZA 1V1MA 4P54A 2ZXEA 1CDOA 2Q2WA 4WLOA 1X1BA 2QRZA 4AZVA 1HX7A 1DKMA 2L2QA 1DKNA 4GPTA 4YREA 3ZR4B 5HIMA 4MYRA 3EVDA 3RKSA 1HNNA 3FDFA 3GRCA 4DCOA 3A6GA 1JSLA 3R5XA 5CRIA 2CHEA 4BNDA 5LP1A 4DR7B 3T38A 1GQOA 2OAGA 2OFPA 4HUTA 1LTHR 3HN6A 1OF1A 2OD7A 1K8YB 5I6DA 3CUWA 1E2EA 4FMPA 2IVFA 4O3FA 3SC2A 3P0JA 1PUXA 4KO1S 3K4PA 3U17A 3OKCA 4FSDA 4NBUA 1QCDA 5FORA 1PL7A 3LFTA 2XHEA 1CW2B 3WKBA 1B4DA 4WZBB 3WJAA 4CKBA 1EVYA 3OHMA 2CJXA 1MVOA 1GZ6A 3CLUD 1Z4KA 4V0RA 3BMQB 4G01B 3V8NA 3ONDA 3OC0A 2BMEA 2HHHB 3DYBA 2GJ9A 2NUAA 5K01A 1EFDN 1PG2A 5CW1A 5EE1A 5SY9A 2VWGA 3ORHA 1IVYA 1Q0LA 5IBRA 4CMGA 3WVNA 3H2HA 1L4GA 2FE4A 1E2UA 1CEEA 1Y8CA 4MIYA 1EH5A 3NTRA 2QL5A 1XHFA 5ED4A 2W6QA 1MD9A 3TLJA 3GLSA 4FFLA 3FHOA 3M6VA 1LF5A 1VL5A 1REQA 4D8YA 1NTRA 1YB1A 1GPH1 3NP7A 3O91A 4XSHA 5IJ0A 4R54A 1E3LA 3RJZA 1U5CA 3LSYA 5EPEA 2P6MA 4ZMBA 3EE6A 2YWRA 2O2ZA 3PNYA 3TNDA 2W9XA 2TMDA 4O1IA 3RKUA 3H9QA 3RK0A 2NNLD 4L5AA 4DIUA 2ZAYA 2NZWA 3ECSA 1PZHA 1KJZA 2AR7A 4LN1A 2V96A 2ZJ0A 1N77A 4HWOA 1N5JA 4LIPD 4NENA 2RHRA 2YUTA 1AKYA 3VZBA 3A3YA 1F2UA 4YAOA 2Q3LA 1DTSA 1XDZA 1ZDMA 4JSYA 2PS3A 2R62A 3H5IA 4X00A 4B3MB 3D02A 1RIIA 4N7JA 3SE7A 1TZCA 4OHKA 1E60A 3DFFA 3ONFA 4GP6A 2E4ZA 1E2DA 3JQ8A 1VLLA 2J3MA 3Q4GA 3OOJA 1UODA 1IXRC 2AF4C 1V0JA 1EVZA 3CLUC 3EXIA 2QT0A 3B7GA 2XVXA 2RG1A 1UBHS 4L50A 1CJBA 3R6DA 5AJUA 3T5CA 2UZAA 3INNA 2ID4A 2R00A 3MWDB 3UUGA 4X3CA 3HKEA 3KKZA 3WWDA 4EI7A 4G0OA 1R6AA 1E6CA 621PA 5KC9A 2W6PA 1JRLA 2PX4A 2XMQA 4HGNA 4KQCA 4PFQA 3PXEA 1ECLA 1SHTX 2OOKA 4JVNA 2XRZA 2ARKA 3OTHA 3LHIA 4Q9LA 3AESA 1QZXA 4KZKA 3SGLA 5AKJA 2AFVA 4M0FA 3TSCA 1Q2UA 3MIZA 2Z3VA 1AGRA 4B80A 3D4BA 2O50A 1MRSA 2C8KA 2J09A 4IWNA 4MV1A 5LKAA 1C50A 1E1LA 1G5TA 1X7HA 2WYWA 3SZUA 2C7PA 1QH0A 3SNHA 2I3GA 3LLMA 4JEUA 1FPQA 1OVGA 2W83A 1HH4A 4RPLA 2XZDA 1HDYA 3UWKA 2WM2A 2ORED 2H29A 4I1RA 4GPBA 2FHSA 2OL4A 1I4WA 3Q8WA 1HE8B 4GI1A 2QT1A 1DNPA 3T9CA 3MWKA 2DPLA 2QX9A 1E64A 2ATIA 4HNQA 4YRNA 4DIBA 4C89A 3TLXA 5AOCA 2FSSA 2IDJA 4BMNA 1FLDA 2P41A 3FZQA 3SLGA 4A9AA 4BVFA 4P7FA 5F78A 1MO4A 1T8PA 1DGQA 2YZ7A 5TQ0B 4Z2YA 3RR2A 1CXZA 3JV7A 4JENA 3VPAA 3OTWA 4G9GA 4E2FA 1Z35A 3L49A 2UZ3A 1G42A 4IAOA 3OWXA 1LXCA 1RJ9B 2XKKA 3A70A 3HA5A 3PFGA 4ZVOA 1VCHA 4BQOA 4QM6A 3RFTA 2Y1OA 3BMOA 4UTNA 1OTXA 3M7IA 1G20A 4PLZA 3WNZA 2W43A 4RJIA 3FCXA 4MKRA 1KYXA 1T5HX 3VR5A 3CY6A 5IABA 3CEAA 3RSOA 4I6JA 3QPAA 2CLMB 1QFMA 4JUBA 3UMVA 2CJWA 4YCCA 4JGBA 1BAPA 4K9KA 2AYXA 4ZI7B 5HOQA 3NTUA 2FP4A 2E0IA 2QYHA 5BMVA 2H18A 5J2TA 3VJMA 2A1TS 2RMKA 3KQHA 2AN1A 1P1FA 2BFPA 2J9ZB 2WVJA 5DB4A 3I30X 3K0AA 3K2IA 1Q77A 2VF5X 3CEJA 5BQ5A 1JLKA 5C8XA 1UINA 4GP9A 4IVPA 3DDHA 4QQ8A 3TGPA 4MHTA 2GN1A 2HI0A 4DQLA 3U62A 4F91B 2I99A 1U2DA 3QVGB 3CN7A 2O5EA 2YHIB 4JKIA 4FE3A 2ADOA 2BV3A 4C4SA 3DGFC 4GYYA 2JBWA 4YMSA 2IFTA 3HDVA 1KYZA 1QG6A 3K2BA 4D57A 721PA 3HH8A 3FOFC 1DRJA 1JVBA 4GGMX 3CLVA 1XAHA 2FMUA 1TUEA 4IFIA 2A0KA 1ZN9A 1Q19A 5KYUB 3KLPX 1LDYA 4FR5A 2PX3A 4CR7A 1C80A 1OFUA 3AUJB 3K35A 2GHRA 1EMDA 5G4KB 3UG6A 4DJAA 4ZEVA 2IKQA 4YGYA 2XQGA 3IRUA 4RPIA 4E12A 2OD2A 3F6YA 5CJ2A 3AVYA 3AJAA 1NZJA 1P7ZA 4YUAA 1N2BA 1YR2A 1R27A 3O82A 2BGGA 1M2FA 1RHJA 2OO3A 1Y6ZA 3THSA 4DLTA 4ZYWA 2HPAA 3FCCA 1C1DB 1MAAA 4X1KA 2PWYA 2VNIA 2YS6A 3DOEA 2ZJ5A 3GGJA 4H7KA 4KDCA 4P3PA 5CB6A 1HMYA 3GWGA 2QRGA 2VG8A 1NQ5A 1NL3A 1Q5PA 1KO8A 2R97A 3LT0A 4JBIA 1ZUIA 4RPJA 2I6SA 3BJIC 1LX6A 1U0GA 2I7VA 3DL7A 1HDXA 1UXOA 1X19A 2VYND 2EAUA 3KVOA 4JUCA 2IYAA 4HDKA 4NEGA 4EG7A 5ALSA 3F5QA 2QTWB 2C9OA 4L9RA 3BWCA 2BM8A 2HL6A 4OQYA 2YHUA 3E81A 1DAGA 2FQWA 3HP4A 5CGZA 3T7EA 1SVSA 1PR5A 1SHZA 2HWKA 5DBHX 2ACKA 2LKDA 2A9OA 1PG0A 4IEEA 2DJ5A 5ENZA 2NU8A 5HS4A 2GVNA 2E4VA 3HDJA 3TZLA 3NDRA 1FP6A 5DNCA 2VA9A 1E8NA 5BSFA 1N78A 2ZQYA 1QXSA 3ER9A 1EXMA 2H1FA 3DV2A 3ZXYA 5AUNB 2VZ0A 4N6OA 2OORA 2B98A 4WZZA 3DKPA 5J2TF 3SXPA 5BMVF 1M66A 3DBHB 3E23A 4O4JA 1UK8A 3LUDA 5FWYB 3BICA 4OYRA 1NXWA 1NQXA 2DFDA 3OJEA 5K20A 4MYHA 1NRJB 2AI1A 3F90A 1QV6A 4JYCA 1Z2DA 3B9BA 1DAMA 4D0NA 1OPXA 5A02A 2B7CA 4R0MA 2CHFA 4IUCS 1CULC 2ZQ5A 1ZO8A 1Z22A 3DEFA 4FT2A 1JG6A 1UJMA 5IHPA 1TVMA 3IDQA 4DB4A 3QKIA 5H16A 2C9CA 4GYKA 2HRBA 2HJVA 3I64A 2X9VA 3N8DA 4I55B 2FB9A 2NV2B 3C1AA 3L6RA 4FQ8A 1VDMA 4NBRA 4CF7A 5H81A 1GNVA 3R7WA 3G2KA 1DZIA 4LNAA 3ZY4A 2ISCA 3H2SA 3DZKA 2N75A 2JJ2D 3SIPA 5ALVA 2AE1A 2R2AA 1CZRA 5G3YA 2HDHA 2D5IA 4I9GA 4WFIA 4FE7A 5ERGB 1ZI8A 2FOLA 2HQ1A 4UBIA 1NJ6A 1BDHA 4C7JA 5EYPB 1W0JA 4UQPA 3PVSA 1F1BA 1UJ5A 3I37X 4G26A 1LDBA 4QXPA 3GW8A 1WMEA 1J7KA 4M89A 2ZSBA 3GLTA 2ATXA 4B40A 2MCFA 3IB6A 2WYIA 1NXVA 1OLSA 5L8VA 3DVAB 4MUGA 1S1CA 3IA2A 1U9ZA 3F7TA 1IAQA 3W8FA 4AP6A 2JARA 3G1WA 2PT9A 4CDRA 4M60A 4N6NA 4FILA 4XUDA 3TTWA 1Y3BE 1DG3A 2OFOA 4P36A 3VZRA 5BVGA 2ZBFA 3K4QA 2JVIA 2SHKA 4JI8B 4GM4A 3RAGA 1RIFA 1T6YA 1Z68A 3M1AA 4MDHA 4RMIA 1QRDA 1N8NA 3NW9A 5L53A 2NAPA 1KEEA 3SYLA 2Y3IA 3U4HA 1P4SA 2NUPB 2P9BA 3PFBA 3IOMA 4MDYA 5CT6A 3U0VA 1XRLA 4ZEXA 3C41J 1XZDA 3L0BA 4QEZA 2PMEA 4UTVA 2YQ5A 1RXIA 3CC8A 5KU7A 3HO1A 4IS2A 3TQHA 2QTFA 1THGA 3QNWA 3TD6A 2D4HA 5AWFC 4IHJA 1AO3A 2G40A 2HIHA 4OK3A 1SULA 1G3UA 1LZKA 2AL7A 2Q8PA 5DW3A 1ACLA 5HK9A 2ZJ4A 2XLBA 3EGCA 1Y9EA 5COAA 3U2QA 3PUVA 4BV8A 2V5VA 1XXHA 3PX7A 1N2EA 3K6SB 5AT1A 2DECA 4EYGA 3QMPA 3HGQA 2PFSA 2Q07A 1BG6A 3R75A 5A7HA 4FB5A 2PLNA 4Q66C 2Z3ZA 4R9NA 2PUDA 4K6KA 2WABA 2FW0A 3SZRA 1FS5A 9ATCA 1TJPB 3NB0A 1FJHA 3JSXA 4R1OA 3WK6A 1L8XA 1S1MA 2XHZA 4OD0A 5EFZA 3WA7A 1G7TA 4H4EA 2YWJA 1KAEA 1T9CA 2UVQA 4FOPA 3DV0A 2HSEA 4B1FA 1XVAA 2G4CA 2MYPA 3ER8A 2OHXA 3Q8KA 2QLLA 2OLEA 4TWZA 4QOGA 2XD9A 3VHLB 1W36B 2YVKA 3BJRA 5GPBA 1MEEA 1T8YA 1CIVA 1JI3A 3HSKA 1ZU5A 1N2GA 1LBSA 4I08A 4QX6A 5DPMA 3TIXB 4BNDB 1IZ0A 5D01A 1E9VA 4B79A 5LIRA 1YULA 4PNEA 3RVPA 3T7IA 1Z29A 3F2VA 2CXRA 3SY8A 4RD6A 2FZKA 4LMBA 3NKVA 3KQSA 1S9DA 4JI1B 3SC2B 3J7AC 3LZ6A 3H1AA 5FT9A 4C2AA 2COEA 1Z18A 4BNXA 2CE2X 2VEDA 4HUJA 4ESVA 3U3XA 1ZJWA 3OE4A 1JF8A 4CKBB 2OBNA 3VSCA 3OO0A 3GBPA 3F4LA 4Q82A 1DO8A 1EDDA 3ERCA 4Q15A 5EP2A 4TZ6A 3K0KA 4G5YA 1TM4E 5AKZA 5J63A 5LZ9A 1K7EB 3FF4A 1QH8A 3Q1LA 2X7XA 3LO8A 3SQLA 4ZAGA 1U8TA 2HK8A 3LY9A 2XWJI 3IQXA 2PUTA 1C7IA 2E6KA 3KKKA 4A26A 4BGVA 2JI4A 3HDQA 2OAP1 1REQB 2DCMA 2WQZA 4QBKA 3QMWA 5IJ0B 1RI4A 1M2WA 2Z98A 2BCEA 3OY2A 1ZQ1A 5JISA 2B37A 2NO1A 2M2IA 4FCWA 3N7AA 1BDJA 2VBFA 1JJAA 1L8QA 1GPLA 4X84A 3UPTA 1AMUA 3DF9A 4LJSA 2IX9A 2PKRA 5DASA 2V7QD 2C00A 1KP9A 4UCXA 1ZL0A 2RGXA 4XGNA 1Z12A 3JS5A 1MX5A 4UBOA 5DTEA 3HXPA 2JI9A 4G8CA 4GNKA 3RAPR 4NK5A 1Q17A 2C2OA 1TW2A 3EG9A 2ZVPX 3GL9A 1E92A 2Y1KA 2FQ1A 4J1TC 4AZTA 4TTTS 5EIWA 1TPZA 4PLPA 3NIFB 1EVLA 2QVGA 4RBNA 4DA4A 1F2UB 5EP1A 4DNPA 4Y2XA 3N2GA 5A0TA 2I4OA 4D9KA 2C5EA 1Y9ZA 4X7MA 4L4ZA 5DCUA 3O38A 5EI5A 5J5VA 4DC0A 2IYQA 3WK7A 1BU8A 2G6BA 4R2JA 2XTMA 3QBVA 1K88A 2EDAA 3E3NA 3K73O 4PLCA 5T4EA 4J4TA 3Q0TA 1JQ3A 3JQ8B 1OA0A 1YVDA 2CJFA 1AGYA 1E77A 1VG8A 4IVRA 4HXGA 4XH9B 1M83A 1I6MA 4ZVTA 3EXIB 3SMQA 4LSWA 2O3QA 1N5OX 4AXBA 4AJOA 3O1HB 4CT5A 1EQAA 3HKEB 2GPBA 3UBTA 4C1BA 2JJMA 2QN1A 4G2TA 3DONA 5CK4A 5TS3A 1CUCA 1EDZA 4IDGA 1EBFA 1WDKA 4WXRA 2GHTA 5T4FA 2V7XA 2VJBA 4W9MC 3CVWA 3AESB 4JT2A 3GUUA 3RUPA 3V4VB 3HUFA 1OH7A 1CPYA 4GW3A 4D4IA 1DJLA 1HO3A 4FXPA 3VR1A 1WXQA 3WLNA 2XZLA 1SWWA 4MVJA 4CG1A 3P0HA 1MABA 3IKTA 3E4DA 4FFVA 4ODIA 2PLFA 3N53A 4YO7A 5B7PA 2OHJA 1RI3A 2Q5QA 2BMJA 2ATVA 3ZKWB 3ICWA 3F3MA 2MOKA 1YKFA 4BQIA 3BWBA 1I0ZA 4LF9B 2XB4A 4PVCA 1V1RA 4UEKA 3DLCA 4I66A 2RK6A 2C5AA 4B4WA 3T3HA 4EYKA 1UWVA 3U4DA 5ED0A 5JIBA 3WO0A 4G4SP 4KPUA 2ZQZA 1H9AA 4KO3S 3FHLA 1L3CA 4ZZ2A 4QUKA 2WT8A 1OLXA 5EXPA 5JXJA 2JPDA 4YUWA 3PEVA 2G5TA 3G5UA 3BMOB 1R64A 1AT1A 3RS0A 4KI0A 1G20B 4AO7A 2ZJAA 2C77A 1QLWA 5JNWA 2JGMA 4EENA 2UYYA 2E4YA 1GGMA 5PNTA 4ED9A 4KK3A 2I03A 4LVNA 4FD2A 1QFYA 2RB5A 1U6JA 2IHTA 2ZRCA 3H11A 4Z0TA 4HATA 4B3CA 4L72A 4TVSA 2FP4B 4J49A 1VJRA 2FI1A 4FOSA 3X1WA 4F0JA 5BMVB 5J2TB 3B5JA 3W9SA 3L84A 2ZJ3A 3K0AB 1QYRA 4QYMA 1W5AA 5JOQA 3MWEB 5JBIA 4KLNA 1HETA 2I3DA 4QUDA 1OVMA 3FSGA 3GD5A 4GAEA 2BDTA 5AHKA 3V8BA 2Q6KA 3K5IA 1OW3B 3P9NA 2PUBA 1MB3A 3MFYA 1CK4A 1NW9B 1FRQA 2G36A 1JHRA 3EY9A 2CMHA 1UKAA 2A4MA 3QVLA 3ZWVA 3PDHA 4FGUA 2UZ0A 4JKOA 2J33A 4F71A 2BFFA 3IUSA 2IDKA 4BNNA 3TOCA 3B5IA 2OCPA 3EDOA 2XA1A 2ZBVA 3HU5A 3V6MA 1O94A 2JJ1D 1BCRA 1LDNA 2QGFA 4EQZA 4LWZA 2YFYA 4D3ZA 4ZYLA 3JWJA 3NGMA 2Y68A 1J8YF 1DMRA 1W5TA 3MOIA 2IS4A 4XPZA 4DBVO 3DA8A 2XUZA 4I9HA 5AKLA 4PRZA 5GJWC 5E3JA 3X1KA 4MVJF 1FDRA 2VQ6A 5DHPA 5FUBA 2OGUA 3BWMA 3AJ8A 4DMKA 5HKOA 1T5DX 4LDNA 1SHJA 1UBFA 3KO8A 4WZ6A 4X1KB 1K9SA 4KPYA 1MZPA 1OHHD 3L5OA 3ZE0B 1SBHA 1TMGE 1W25A 2R65A 2RGDA 3JQ9C 3H19A 4KSBA 1ZM2A 1S2LA 4CM6A 5CYFA 4DARA 1WW8A 2OV2A 1JH9A 3QUCA 4HQ6A 5BSWA 2PYDA 2WIAA 3I1IA 1DOAA 2HMWA 3TMAA 1U8XX 2OHOA 1BOFA 3F96A 2ZJ8A 3PLRA 4HDKB 3QFTA 1AE1A 5H5JA 2XT9A 3U7IA 4A1OA 1P44A 1YFLA 1KI1A 3DZFA 5LQNA 5LA6A 1OXUA 2CB9A 2AC7A 3NH6A 1FFSA 1GNRA 1GZSA 1P45A 3DC2A 2EXXA 1ZM4A 3L4EA 4EW1A 3RC3A 5A1JA 4CYMA 1CHDA 2HSWA 2V9ZA 2QW8A 4E4TA 3GMSA 3ZY2A 1KMNA 1AXRA 1TRHA 2BWJA 1FLAA 2AG6A 3NNSA 2Z57A 4P31A 5K2MA 4LOHA 2NU8B 1KS2A 3PDIA 2NV6A 2OCAA 4I4NA 4QAQA 1Z7YA 3GEGA 1STOA 5F21A 5BR7A 5DBOA 3SBOA 4NBWA 2OP1A 3T7AA 5ABPA 4O4JB 1R6BX 3ZDBA 5TXGA 3KJGA 1A7UA 2IQIA 1OX4A 2W7TA 4FHGA 4MGIR 2EQBA 1JYFA 2BI8A 1OT5A 5EHGA 4ZAFA 1IRXA 3I01M 3KSAC 1FYVA 2CBGA 4LVOA 3BXFA 1XQYA 4NWIA 2JFPA 1LEHA 5BMOA 1ZICA 3D6MA 3ZK7A 2GNAA 3BG5A 3QEKA 4IS3A 4Q9KA 5HKAA 1PU2A 2DFLA 4C3UA 3VRHA 1RS0A 4MQMA 5I7HA 2JCYA 5MN6A 3AQ4A 4IWXA 2X8AA 4K1LA 2JLQA 1T1JA 2H1IA 3EOAI 3H5LA 3N86A 3R7WB 2SECE 1GGNA 2Q6OA 2VPIA 1L5NA 4GXNA 4PLTA 4DDTA 2H8GA 4M8LA 5JS6A 3AF3A 2VPQA 4INPA 2APJA 2EEPA 2PMKA 4R7TA 3G2JA 4A0HA 2Q49A 1R0CA 4FK8A 5H1YA 5LOVF 1MPXA 4J94A 2O20A 1XMVA 1MPTA 4KBGA 2V7UA 4YRSA 4YJKA 3V46A 1TLFA 3VNAA 4KK4A 2QD4A 2ZB8A 1C41A 5BT9A 2PVSA 4KQKA 4C0QC 1VJCA 3CCFA 2BF4A 1G8PA 4UNQA 4DREA 2WICA 5JZSA 1QDLB 1HRDA 3G2MA 3GCWA 4DPKA 3U0BA 1KXZA 5KNCD 3K71B 1RCTE 4XWTA 2VVTA 1F9EA 5JI2E 3FX2A 1U8YA 1BVUA 3BULA 5LA6F 3BRCA 1IDN1 5BUZA 3EPHA 4B3JA 3VH3A 2H9YA 5BVGB 2FW8A 2I4MA 3SXUA 1M67A 1OB2A 1LK0A 1E1RD 3EGEA 4NDAA 1KEEB 1V35A 2I65A 2GESA 1Z0UA 2GPAA 2IXFA 5HJ7A 1UFKA 2CHUA 3K3PA 1SNYA 1VHWA 2WJ4A 2YZGA 1PNTA 3KOOA 3GLGA 4RX1A 1SXJE 4LKOA 5SY6A 4DLBA 1SCBA 1HLPA 2DEUA 1ZESA 1P2SA 5A9TA 3TLBA 4NP6A 2ZUEA 5G0VA 4AK9A 4BDSA 3VHXA 3DAFA 4BU0A 4DA6A 3GJ8A 1V43A 2DC1A 4G3XA 4A8JA 2WU4A 1ZUNB 4EF5A 4I1PA 3WYAA 4OQMA 1XXHB 1KETA 4DWOA 3WNVA 3WYCA 3K6JA 1SM4A 2G9VA 2IP1A 3CLKA 3GPDG 3ROGA 3RJTA 3B12A 4KMRA 3TXAA 3GPLA 1G8FA 1OASA 2NNWB 1JIUA 1SC4A 3OEHA 3STTA 3UAGA 4EHBA 2VWQA 5JHHB 3FN4A 4IMIB 3FOAA 1B6TA 1W52X 5EY5B 1UJCA 1P3Y1 1P2DA 3JVDA 4UD6A 3T7CA 2QZ4A 3WMWA 5LN1A 1ODLA 4I1SA 3BWXA 3DV0B 3W2FA 5IXJA 3BHNA 3KBBA 4X60A 3L18A 3SJAA 2FPWA 3TTTA 1SCJA 1NQAO 1A50B 2Y76A 5H68A 3NV9A 4REOA 1KFCB 4BIMA 3D6HA 3IQGX 1LBEA 1KK3A 3R6LA 1H42A 1VL6A 3R8XA 1M0WA 3ZY6A 1JSRA 5ALWA 2P90A 3E48A 5HJ2A 2VUIB 3J80A 3OQVA 1XRJA 1B73A 1NBHA 3NTVA 5CA1F 1BU5A 3CRZA 5FR1A 4AF7A 2ODAA 4CG2A 3RIEA 3PTLA 4CLHA 3LP6A 5DSZA 4ZHQA 4QT0A 5GIPE 3ROKA 4C4PA 1J0BA 2FWAA 4CDNA 5LZ2A 1SOMA 2QNRA 1UAAA 3TKYA 4PZEA 1FBTA 3MJTA 4KYIB 5IVDA 4EKEA 1QU2A 2VJKA 4RLHA 3NWJA 4N9WA 3ZG6A 3QPDA 4QGAA 1DBPA 1V7CA 1BDBA 1QYXA 2VBGA 2RGWA 1FYFA 4Q21A 3T4UA 3A04A 2AMYA 2X3UA 3KWFA 3LM8A 3PNBA 3M9WA 2DUNA 3WLEA 4UVGA 4M38A 1IIRA 1TA4A 1F8FA 3NC4A 2XKAA 2X3YA 1YE3A 4DYVA 4XYLA 3AOEC 3KP1A 4PNPA 1HDGO 3H87A 4ZK2A 1CVRA 1RWBA 2GDJA 4M9SA 3TNFA 1CKEA 1KVRA 4BFLA 3DL0A 4D98A 2RAUA 3JWPA 4HGZA 5KHLB 1ISSA 3LBHA 2BFBA 2FTKE 5IS2A 2PE5A 4M1KA 1IEQA 2WAMA 2ZS9A 3EHEA 2F90A 1TFUA 2ZI6A 3IIJA 3I5UA 1ODJA 4ZYVA 4L78A 4PLWA 2P5UA 5GP1A 2CDRA 3G6WA 1U6KA 1U90A 1R3UA 3EG9B 3D4OA 1QX4A 3LUFA 1ICEA 2NXJA 2EOAA 1OBHA 2X23A 4KC0A 5E3HA 4CI0B 5BR4A 4N48A 3NAMA 2QOEA 5AW6A 1XEWY 1K75A 3N2GB 3GRRA 4H08A 4RWZA 2ERYA 4X7RA 5EXEA 5FHQA 1BTOA 4A27A 2OENG 4KLAA 3L4JA 4XJTA 2I62A 2X8LA 1XWWA 2LR0A 1XBTA 2G1UA 4JI0B 3ELDA 3FCEA 1NNEA 3DTYA 4QKQA 5ARCA 4JLBA 5HZHA 2FR8A 4D46A 2V6FA 1RYDA 4FE4A 3HXQA 1Z5NA 1JJVA 4YQFA 3UK0A 2C9BA 2XAAA 1HYHA 3WDSA 2VXCA 2D1RA 2Z0MA 3I6YA 3KT0A 5JE8A 3DFZA 2V7BA 2ZBRA 2ZRMA 4H31A 3F97A 4ICIA 4DV4B 4PXYA 1FRFS 3PJFA 1TC2A 4KQFA 5JD4A 4CXMA 1IJFA 3AVQA 4JP5A 2E3JA 4Q1AA 3IEKA 1U9CA 4LY6A 5KVCA 3A1WA 2ZRLA 4ZHQF 3OBBA 2DSNA 2GBIA 5IKOA 1UL1X 2HMTA 2PM8A 4TT3A 5CM2Z 5A03A 1TO1E 1ORTA 1YOVA 2RH9B 5DCWA 1CIJA 1G38A 5ICSA 1G9XA 2R60A 3K5WA 4R7GA 4HHEA 3ZHBA 4Y30A 1QU3A 3K9FC 3EIOA 3LY8A 3RM3A 1BQ4A 3OO1A 1MABB 1H23A 1TM1E 1C3VA 1MQ8B 1VL0A 2FPSA 2FMKA 3Q7PA 4OYYA 4RD2A 2VT7A 3V7FA 2FDRA 2FXVA 5LQDA 3CW8X 1EGVB 2D0DA 3IMCA 2H2GA 4IH1A 4K9MA 3EH1A 2WJGA 4G07A 3UHPA 4QZVA 3CVYA 4FDLA 4RF3A 1D0IA 5B1SA 1CDZA 1CU1A 3WQHA 5KS2A 2HA5A 4XB6B 3TQCA 4AROA 1Q0TA 1JSZA 4DABA 1Z82A 1H05A 1RI1A 3FLMA 3K8ZA <