1NSYA

Crystal structure of nh3-dependent nad+ synthetase from bacillus subtilis
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
271
structure length
271
Chain Sequence
SMQEKIMRELHVKPSIDPKQEIEDRVNFLKQYVKKTGAKGFVLGISGGQDSTLAGRLAQLAVESIREEGGDAQFIAVRLPHGTQQDEDDAQLALKFIKPDKSWKFDIKSTVSAFSDQYQQETGDQLTDFNKGNVKARTRMIAQYAIGGQEGLLVLGTDHAAEAVTGFFTKYGDGGADLLPLTGLTKRQGRTLLKELGAPERLYLKEPTADLLDEKPQQSDETELGISYDEIDDYLEGKEVSAKVSEALEKRYSMTEHKRQVPASMFDDWWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of NH3-dependent NAD+ synthetase from Bacillus subtilis.
pubmed rcsb
molecule tags Lyase
molecule keywords NAD SYNTHETASE
total genus 110
structure length 271
sequence length 271
chains with identical sequence B
ec nomenclature ec 6.3.1.5: NAD(+) synthase.
pdb deposition date 1996-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02540 NAD_synthase NAD synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1nsyA00
1GZUA 2E18A 3CLRC 1QJCA 5F23A 3MLAA 3ZXSA 1TYCA 4OUDA 2X1MA 5JBNA 2AG6A 5KHAA 3G59A 2GM3A 4WNYA 2VTBA 3P0HA 1U7DA 1O96A 2QUHA 1CT9A 1R6UA 3H9BA 1N78A 1S4MA 3RK1A 1J20A 1O5TA 1GTSA 3UC5A 2XRYA 3ZUGA 1A8HA 5H7XA 4I6JA 1YUMA 3FOCA 1KH1A 1Y42X 3CLUC 3RHSA 3N9IA 4DE5A 3FETA 1N2BA 1SURA 1YIDA 4EGAA 4MAFA 1KH3A 3TQIA 5DB4A 3ZXIA 1NUPA 3UOWA 2A1TR 4L2IA 1MBZA 1PFVA 3TS1A 3IOCA 3ZJTA 4MUEA 2JAXA 3Q10A 3MMXA 3VU8A 4YP5A 1KQNA 1JILA 2D5BA 3ISJA 4EG4A 4MWDA 1XNGA 1Q15A 2QJOA 1IRXA 2IELA 2CSXA 2CYBA 2YXNA 3HMQA 1QRUA 2V0CA 1WXFA 4KR6A 4MULA 2RD2A 3SZ3A 1GN8A 2C5SA 1TFUA 3PNBA 5J59A 4MUGA 1KORA 2NZ2A 1NP7A 1T6YA 1N2IA 3N2YA 4I6GA 1O94C 3AKZA 4J75A 1PG2A 2OQ2A 1VBNA 4U8HA 4MUHA 1QRSA 4MW6A 2PZBA 4MUNA 4AS1A 3FDXA 4PBTA 3UMVA 2X0KA 3AG6A 2A84A 1KH2A 4MWEA 3CLRD 2X3FA 3QTTA 2CUZA 4Q93A 1O6BA 3X1KA 1O94D 3U1VA 4U7JA 2A88A 2EL7A 2PXHA 1MJHA 2O8VA 4CDMA 1O0BA 2CFOA 1YULA 3A05A 3HL4A 3H9CA 3AIIA 1JMVA 3FHJA 4ND7A 3KT3A 5BNZA 1K4MA 3MLBA 2D54A 1N75A 1B6TA 3PRHA 2CV0A 3N05A 1JZSA 3Q4GA 1TQ8A 3CVUA 4KPUA 3SP1A 3NBAA 4X0EA 1MC1A 1QQTA 1VL2A 1WQ3A 3IVCA 4MW5A 4RUKA 1JEEA 1X6VA 3HFJA 2RE8A 1LI7A 3CLUD 1IVSA 1MB9A 1NSYA 4EG3A 1O97D 1EJ2A 5TEWA 3UY4A 2A1UA 3D6UA 4J76A 2QTRA 3K32A 1RQGA 1EFPB 1I6MA 1QU3A 3CLTC 1Q19A 3G6KA 4I6EA 1M8FA 2VXOA 1YIAA 2PG3A 3IOEA 3KT8A 1NI5A 5HUHA 4HK4A 1O95D 4E1AA 3JXEA 1ZH6A 5DEOA 2HMAA 3AL0C 3TQOA 1M8KA 4NZPA 2DETA 1M1ZA 4ZCTA 1VLHA 4JZYA 3S3TA 4OUDB 2WQ7A 1JEDA 4MWBA 4ZCQA 3ZGZA 4EG1A 4MW9A 4TS1A 3CVYA 1H3NA 4R2LA 4ZCSA 4ZT5A 1BS2A 3IMGA 3TZLA 4YP6A 2PZ8A 2DEUA 3OP1A 3QTBA 1JECA 1MAUA 3SYTA 3C8ZA 3P52A 1TYAE 4K0RA 1ILEA 1G59A 4YBRA 3P0IA 2A86A 3DO8A 1I6KA 4R0NA 3M5WA 2AKEA 1N2HA 3HGMA 1IHOA 1T6XA 4ZCRA 3IUEA 3MUEA 1J21A 1MRZA 2QUJA 1JHDA 1PFWA 1P7PA 2J4DA 3CLTD 1I6LA 1KAQA 2A1TS 2BYTA 1F7UA 1XJQA 4MW1A 2CYAA 1EFPA 3SDBA 1GPMA 3SZGA 1XNHA 4MVCA 3ELBA 2XRZA 1ZH0A 3SEQA 1M8PA 4MQ6A 1HYBA 4HPWA 1NUUA 4HJXA 4NATA 4R2MA 4YP7A 4ZCPA 5K0TA 2J08A 1T9GR 1FFYA 3IVGA 1NURA 3FG9A 4DDMA 1R6TA 1G8GA 1K92A 1U0BB 1COZA 3Q12A 1H1TA 1YI8A 1QTQA 3COYA 2B7LA 5H16A 4F3RA 1D2RA 5IHXA 3VRHA 4QRDA 2V0GA 2Z3VA 5FO1A 2A7XA 1ZJWA 1QNFA 3FH0A 1OBHA 2GKSA 1EE1A 4JYZA 3ILVA 1OWOA 3ZIUA 4JFAA 3AFHA 4ZT3A 3HV0A 3H97A 4BWVA 1WXEA 2PFSA 2H29A 3CA8A 1N1DA 1U3CA 4EG7A 3BL5A 3CLSD 4NAHA 4S1OA 4ZT7A 1QU2A 1OWMA 3IVXA 3MXTA 2ZUEA 3D6VA 4CT0A 4KPUB 1IFXA 4QREA 4EFKA 3PNVA 1WOYA 1X8XA 5K0SA 3A2KA 4A91A 1R6XA 1EFVB 2QTNA 3IOBA 4MUFA 5J58A 3DLAA 3G5AA 4G5YA 4JXZA 1LI5A 4PBRA 1N2JA 3K9WA 1N2EA 5J5AA 3FI0A 1KR2A 1EUQA 1G8HA 2WSIA 4K03A 4KR9A 2DUMA 3AG5A 4MW4A 1KQOA 4KR7A 3CVWA 3PXUA 5KWVA 1JIIA 3LCJA 4NX2A 5DK4A 1T9GS 3GMIA 3KFLA 1EXDA 4Q16A 4CDNA 1FYDA 1WXHA 1DNPA 1O96B 2JANA 3UK2A 5KCMA 1EUYA 2QUKA 3ZJVA 4H3SA 2E0IA 4ZT2A 1WXGA 1LW7A 1IH8A 1WZ2A 3IMEA 2CV2A 1IQUA 3IH5A 4ARIA 1OD6A 1WXIA 4EG8A 4XSVA 3NV7A 1OWLA 3QE4A 5HG0A 4JXXA 1I2DA 2AZXA 3GUZA 1K4KA 1XNJA 2DLCX 1OWPA 1Q11A 1M83A 2GOYA 1O95C 1H3EA 2PIDA 3P0JA 1GAXA 2YWCA 1WJGA 4MWCA 4DDHA 4MVWA 2CT8A 2ZP1A 5HUJA 2YY5A 3IDFA 1OWNA 3COVA 1KAMA 2A4MA 4EG5A 1JIKA 3FY4A 1PFUA 2QJFA 1ZUNA 1IQRA 3A04A 1KQPA 1TYDE 2Z08A 4P2BA 4XFJA 3FIUA 4NDAA 3TZEA 5IJXA 1MB2A 4FZJA 2O5RA 3DV2A 2PZAA 5LLTA 1TYBE 4DDKA 1NUTA 2E21A 3F3MA 3LE8A 4DNXA 3IODA 4PY2A 1KKUA 4G6ZA 1O97C 2I1LA 1KP3A 4WSOA 3L92A 1NYLA 2WB2A 4MVXA 2EJCA 4OJMX 1J1ZA 3DPIA 1WY5A 1IQ0A 1GLNA 4ZT4A 1TEZA 2R5WA 1WQ4A 3PNYA 2DXIA 5TGTA 2J07A 2J5BA 2OV4A 3RBAA 1GTRA 2X1LA 1ULHA 2HGZA 1KP2A 1OBCA 2IJGX 3CLSC 2J09A 1K97A 1F9AA 1NUQA 3NBKA 4EG6A 3ND6A 1F4LA 4MUIA 2NSYA 1VBMA 3OTWA 4UZFA 4CQNA 4MUJA 4GRIA 3COWA 4GU5A 2DPLA 1JGTA 1U3DA 3RJZA 5TS2A 3L93A 3CVXA 2ZUFA 4AQ7A 4KKVA 2Z09A 2YWBA 1JZQA 3E27A 1MAWA 2DR2A 4MW2A 2CYCA 3CR8A 1H3FA 3ND5A 2QJTA 1JIJA 3IMCA 3H05A 4RPIA 2D13A 3RFFA 4F4HA 4QBTA 1N3LA 2VTBB 1N77A 1PFYA 4MVYA 3SEZA 2DERA 1UFVA 5DASA 3X1JA 1EFVA 1M8GA 2JA2A 4HJRA 4MUKA 1J09A 3KT0A 3A4IA 5LFAA 5EKDA 5FNZA 4DLPA 2A1UB 4XFDA 4G5FA 1N2GA 1NZJA 3GLVA 1M8JA 1J70A 4PBSA 3X1MA 3FWKA 3I05A 5FO0A 4NAUA 2QUIA 5AHWA 1PG0A 1WKBA 4MW7A 4YMIA 3FNRA 3H99A 3RK0A 1QRTA 3COZA 2H2AA 3HZRA 4ND6A 5TEVA 2HZ7A 4UZEA 1MOPA 4L2IB 1N2OA 3ZJUA 3CVVA 2G36A 4U63A 2QTMA 1U7XA 3N8HA 2IP1A 1Q77A 1V47A 2E89A 4MW0A 4ZT6A 3VGJA 3INNA 3LOQA 1G8FA 1F7VA 1NUSA 4ARCA 4MLPA 4EF6A 2CV1A 1V8FA 3IUBA 5LM3A 3KT6A 3ND7A 1YUNA 2BTEA 1O0CA 2WQ6A 1T6ZA 1J1UA 4DJAA 1VBKA 2TS1A 3TNJA
chains in the Genus database with same CATH superfamily
3RASA 1XTKA 4UBIA 3WK9A 1T34A 3QMWA 3FFAA 4QT4A 4LXTA 4AYXA 5LOVA 2XWBF 3TZHA 2YIDA 3ECAA 3OZIA 3RKSA 2JLRA 4OQPA 1C1XB 2B98A 4UMVA 1PSWA 3SC4A 3LPMA 5IKEA 3HEBA 1F1BA 4WINA 1KMQA 2Q99A 1O95A 2ZRKA 3NETA 4G67A 4J2TA 4OXYA 1WCYA 4L6AA 4TMTA 2P9CA 4WNYA 4QTTB 2NU8B 3EAGA 1ODJA 3KYCA 4DCTA 1Z34A 4CFSA 1CT9A 1UBKS 3T52A 2ZTSA 1W44A 4GMHA 2PYIA 4MEBA 1GTSA 2W37A 4FYYA 2RHBA 1D0SA 4NECA 3E9DA 3ICPA 3KXKA 3UC5A 4C06A 4MA5A 2A35A 3PE6A 3L8YA 3Q2KA 5I8WA 3HKDA 2X4IA 3HKBB 3VHRA 2W83A 4PCUA 4DE5A 4MYUA 3WKBA 3ROKA 4WBNF 3QEOA 2WJAA 3PXCX 3H6GA 4IVRA 1KAEA 4BRSA 2H9IA 1N6PA 3RUHA 3LBAA 2JA1A 3E9MA 1KPHA 2H4ZA 2ZCVA 5ECDA 1CW2B 4L2IA 1E1RD 3WVNA 2ZIZA 1T5DX 2VYVA 3CLKA 2YXBA 1L4KA 2E4WA 3OBIA 5D84A 4F56A 5CA1F 2AZMA 3Q10A 5H3HA 3B52X 5C5IA 5JT1A 3RC7A 2GLUA 5C5DA 1I14A 5F64A 1P7WA 4AS2A 1PVDA 2EBUA 4HC4A 1XNGA 1KZHA 5F7XA 2BZGA 2EU8A 2ZZKA 3LX8A 2OPBA 1U7UA 2CSUA 3LGXA 1BWSA 4IWXA 1Z45A 1M7BA 3RS9A 3RFTA 3C45A 2W9XA 2BSXA 4PLPA 4F72A 3M6AA 3GRAA 4Q6BA 1FOEB 1NIJA 1OI7A 3A3YA 1XHFA 4KGDA 4MULA 5C4GB 3PVZA 4I50A 1H66A 3CIFA 4MCJA 3JSXA 3UB4A 2SKCA 3OIFA 1BW9A 1E79A 1FDOA 1PLLA 4LRSB 3PNBA 1NBMD 3IUQA 4RMGA 1UANA 5FF9A 3NIGB 2I2FA 2P4UA 4QOFA 4G2NA 1SQ6A 3MBKA 4GKVA 2JK0A 2YN2A 2XDAA 4E5NA 3UAYA 3AVUA 4LJ6A 4IKOA 1O94C 5AI9A 3ASVA 1JJFA 5LWHA 2EIXA 3HNPA 4GPBA 3CEJA 5CX1B 1Z35A 3WSWA 1JLSA 2E48A 2JRCA 4NENA 3DXYA 4F4JA 2C9DA 2QHXA 2AJDA 3DS8A 1QRSA 2GK3A 1YZHA 2RK4A 5EZYF 2ONZA 3OM8A 3PEWA 2SCUA 4PBTA 5DU2A 3IBGA 4HWGA 3KSDO 1JWBB 2JFYA 1VMIA 1XQ9A 3A31A 1ZGZA 1DOZA 1N2XA 3LP6A 1JL3A 1G4AE 2C3UA 4B33A 2AOTB 3P97A 3SVLA 3QKSB 4M8KA 1E7YA 1KSGA 3CW2A 4P81A 3VKUA 2NP6A 3QTTA 3Q8LA 2QD5A 4N82A 1T1EA 5IYZF 4CCWA 2G04A 4K9QA 3VV3A 1TEHA 5I9TA 5IAGA 2EW1A 4G26A 1WEKA 4MKRA 2UXBB 5BSMA 2HO4A 3PLRA 1IN6A 1NKTA 3EZ6A 1QDEA 1YULA 3I4LA 3PIIA 5JH7A 3BRSA 5LD2B 2V8BA 4ND7A 5IJAA 3USES 4CNBA 3OWXA 5SYAA 4RW0A 4AKIA 5C5CA 3FZQA 2O2SA 3H2BA 4JUBA 2BRUA 3CG0A 4HGYA 4KN8A 4UE2A 1R74A 4GE3A 4XX0A 2NP7A 3ZZMA 2V5VA 3GGCA 3HLTA 3A06A 3IAAA 4GNKA 1DQZA 4JX8A 4CMAA 3NBAA 1IN1A 4X0EA 4FDTA 4ZIRB 2Y1GA 4LJ8A 3ZHOA 4DA0A 5FIUA 4A8PA 4NMHA 1KFJB 4HL6A 1X6VA 1A72A 3LHDA 1YA6A 5K1ZA 3ZVNA 3WK4A 3IJRA 2GO7A 1VA4A 1T9HA 3Q6MA 1W93A 2AR0A 3TL3A 3TF5A 3F4KA 1V2GA 2ZPUA 3LHKA 1G2OA 2CFSA 4IDPA 3UFXB 5KREA 4FFLA 1CLEA 1R6VA 4PAWA 4LV8B 3C16C 1KEWA 4QYIB 3LY5A 3NTRA 5AFSA 4OG2A 3VX3A 1PQ4A 4TRRA 4JP2A 1GU0A 3E2IA 4PX3A 2WF8A 1OZHA 3E7DA 4QSMA 2QLLA 3EUWA 1KMMA 2WJZB 1T6NA 3MM4A 1WXQA 3AHCA 4JKIA 2YHBA 3IGFA 4KAFA 4RIHA 4ZDJA 4L0MA 4ZHQB 4LSWA 3EY9A 4IHJB 3S29A 4U9UA 2BGMA 5AW9A 4A8JA 1HQKA 1TM3E 2NSJA 2V4MA 3MTQA 3ROQA 3C5HA 3AP3A 3G0CA 3PKJA 4LX8A 4BMPB 3QYJA 1U5CA 1UMDB 1IBRA 3PNSA 2C88A 3OJEA 3R4CA 4HSEA 4JLJA 4RV4A 4DAEA 3P2OA 2QA5A 3O3CA 1E1QD 1GQ2A 2J9FB 1W1WA 2V59A 3AW8A 5D3MB 5EINA 4ER0A 1Y9DA 5IK2D 2ZB3A 1QG6A 1SZDA 1RAAA 5BSEA 1N1MA 1OU0A 1YQTA 3LKDA 1YU6A 4R2LA 3A32A 1XCMA 3B3FA 4X7BA 5GMOA 1HT3A 4W7IA 5G4LA 2OZVA 4MVJG 3RU7A 3HFRA 3QTBA 4O4HA 1V8BA 2F9LA 4RVOA 1VCOA 3P52A 1SK9A 1GGFA 1Q0ZA 1S8AA 3ON5A 1UP7A 2HPZA 1XD8A 2P9QA 4Q7LA 1PWZA 3TXAA 1OW3B 1HRDA 4QECA 2NXWA 2QGFA 3OWOA 3N0TA 5EWMB 3VR2A 1D8AA 3G0DA 4YRGA 1OASA 1MVNA 3D8RA 1IEWA 1W49A 3M3DA 3HJNA 1EP3B 2WWWA 4QXAA 3RU3A 1N2HA 3TYXA 1MPXA 1ZLXA 3UXYA 3KJHA 1J0XO 1VJ1A 2A4KA 3ONDA 3NU1A 1BHO1 4H7JA 4X8HA 5BY2A 5LZ2A 2OMKA 3PI6A 1KARA 1N2SA 2AB0A 3O03A 1Y63A 2OCLA 4LYHA 4ARUA 3E9RA 1U8UA 2Z9CA 1I6LA 2Y9PB 2CLFB 3B1VA 3PITA 2LKCA 4R1NA 4TS9A 4UVEA 4EYEA 1W5BA 3HZHA 2INGX 1VLLA 1GDHA 4F92B 4G4GA 3SZGA 2W2QA 3F74A 1ZGGA 3PXGA 4BEVA 3LQ4A 4HN4B 2EX0A 4BE9A 4DM4A 4K3VA 4XI9A 2X2FA 1GZ7A 4HNRA 5E4TA 4YONB 3RSCA 3K1TA 1J33A 3N70A 1FVFA 4OHKA 4GPTA 2AC4A 2OBYA 2ZT6A 5A05A 2IY7A 4DADA 5DNUA 3CUUA 1CRQA 3Q11A 5IT4A 2XQGA 3AF6A 3O47A 3BULA 3U5ZB 1S9HA 3ETJA 3MF4A 2FN9A 4JENA 1PZMA 5EY5B 4DZZA 4PN7A 2EDAA 2VHQA 1K06A 1JR6A 1OZ0A 2C2XA 2ZI6A 4YT5A 4I4LA 3N7UA 2NX2A 4QDOA 4MJLA 3OKFA 4O6VA 5FFFA 1XYVA 5CFRA 3K0CC 4J1TA 3RUFA 4AULA 1M2VB 1X1TA 3DEHA 4JSYA 1SVWA 5HS6A 3VYUB 1IRIA 3MHTA 1A27A 1ZNQO 4TXHA 3Q8KA 4N5MA 2XBLA 1I6WA 2LBPA 3QPUA 3PHBE 4PYLA 2XNKA 2EG9A 4LWQA 1E1DA 4ZOQI 4TRJA 3UJCA 1HYEA 4LF4B 5I7SA 1W5TA 1ENYA 1B16A 1V8DA 1Z56C 4GPAA 4I2NA 2GILA 1GR0A 1RCUA 1ST3A 3FH0A 3PCXA 2O52A 3L0IB 4L3WA 4Q1DA 4BDTA 2JLQA 5LUBA 1EVLA 2P2GA 1Z75A 1LBIA 5K3EA 2I71A 1X9IA 4M1MA 3ZDEA 1FLDA 1V9CA 3AZPA 4NENB 2VJNA 4J3JA 1EGQA 5TNXA 4NV1A 4XYBA 4EQ6A 1YKGA 1M34B 4LYEA 3OOSA 3S1LA 4ZT7A 1IXYA 3THYB 3IVXA 1EP9A 2Z57A 3MLEA 2J7PA 2BSAA 3UWMA 2V0NA 4N5DA 4N12A 1NRJB 1BKYA 4KQMA 3PUZA 4YS6A 4E88A 2O7SA 3E7FA 4JVMA 1EFVB 3A6LA 3JQ7A 3QNMA 4HEQA 4JB2A 4D6XA 1NATA 1VPVA 3BRQA 1MAVA 4ND1A 4CKWA 3IBCA 1Z36A 2CXSA 1FTSA 2XYVA 2ZJBA 2ZJYA 1CHDA 4N7JA 3RLFA 2CF5A 5FJJA 3KSBC 4HDRA 2IBSA 5EHQA 3RKRA 5HZGA 1UINA 1M1UA 3DJFA 1YDWA 1UEXC 1LPSA 3AU8A 4NFLA 2C2YA 4EFMA 4XGKA 3E7WA 3ZU3A 3EIQA 3K53A 4MW4A 2WKRA 4OVKA 1QNLA 1A98A 5ALNA 3FNQA 5CBPA 2PS9A 2XUHA 4IZHA 4K0KB 1JJ7A 3TFWA 2HK7A 4OJKA 4P4LA 3B89A 3KFLA 1XL1A 3KVVA 4B3CA 3PDIB 4AX8A 5A4DA 1DL5A 1L8OA 4Q16A 4QXRA 5KQPA 4MK4A 3WGKA 4O2BB 3QKWA 4E4YA 4U4AA 1FVHA 5T4FA 5C3UA 5JW6A 1Z4PX 4RTJA 1TCCA 3UFXA 5C7IO 4OLAA 2J8ZA 4R81A 1QK3A 1JX6A 5E1DA 2OGSA 3DWEX 1ZYUA 1IH8A 4OATA 3LP8A 4OSOA 1POWA 3W90A 5FX2A 1GIAA 2CV2A 4N7MA 1L4FA 3EWSA 3A1WA 3DAGA 3KVNA 2OZLB 2OXIA 4REQB 2LV8A 2VUIB 3M2TA 4JASB 4DIUA 1B3RA 2AW5A 1OXBB 2EAUA 4X6UA 5DFAA 3WSTA 3QW4B 2FEOA 1V41E 2VO1A 3UO8B 3A28A 3ICCA 3OOWA 5HIMA 3ZK7A 3U9LA 1YWGO 1QYDA 1ORDA 5EJ9A 4OHUA 4PZCA 3LLCA 5T8KC 5K0BA 5TV2A 3OBBA 3GARA 3HUEA 5CVCA 1K4KA 5K3BA 4NIMA 3WL4A 2VHCA 2F55A 1PD1A 1SZPA 3P0JA 3H8WA 2OO5A 1L4NA 4OMDA 5AXAA 4F9TA 5HS4A 2N75A 3ABSB 2XLCA 4DDHA 5FUQA 3ITEA 2GEUA 2G09A 1NP6A 4FB4A 3ESXA 5AOVA 3TZBA 5HUJA 4J43A 4X60A 4ZQHA 1Z16A 5DTRA 2W43A 4Z1MD 2NUBA 1MO6A 4D74A 4MQFB 1Q0LA 1JJAA 4DV5B 1M3SA 1ZWKA 4GMFA 3FYDA 3KTOA 1Y9EA 2W7TA 3FCXA 4P7KA 5IJWA 1CUIA 2HXGA 2W4QA 4K46A 4OFXA 4JUIA 2V6MA 3EXIA 1VIAA 4Q7QA 3KETA 1YE3A 2GRAA 1RE1A 3C3CA 4RYLA 1DIOB 1FBNA 3FPEA 1M7GA 1RQLA 3JALB 5ISMA 2BW0A 3DLHA 3JQ6A 3F7MA 3I28A 4YHBA 3ZPXA 1A88A 3NEYA 4GMGA 4US1R 1DKNA 3WLOA 4RM3A 3DAOA 1FYWA 4LGCA 1E9RA 2WFMA 1JE0A 4F9FA 5JHGB 3OQMA 2WDPA 4L28A 5HDBB 2JH9A 3ZV3A 2VEDA 1CDDA 1ZM7A 1CUXA 4KOEC 3HN6A 3BDIA 3TNLA 1SU4A 4GVPA 1BDHA 3KEGA 4U2GA 2BFCA 1NNLA 5JD5A 2ZVDA 2FOLA 2HXSA 2ODWA 4GQBA 2YWXA 5JXJA 1P29A 4TWRA 3REQB 2UUAB 1PWYE 3L7JA 2DQYA 2WM2A 1EUDA 4UU8A 2O20A 5KSOA 5LMUB 1XHLA 3FLEA 5GV8A 1JIXA 1TT5A 3KQQA 1RHJA 3KPWA 4MUIA 3DULA 2BE9A 4X95A 4IMIB 2YJTD 5J9FA 4LXHA 4EYSA 1AKVA 1QV7A 3H9GA 4EB0A 4KO4S 2W2MA 3REGA 4FEGA 4N8EA 1JGTA 1U3DA 5K4AA 4B85A 4ZAWA 3LC2O 3SF0A 2HMUA 4B82A 2G76A 3WK8A 1J0DA 1DAEA 4K3UA 5DTJA 2YVLA 3EVCA 2DR2A 3LUJA 7YASA 3NT2A 3CRNA 4CPDA 1MGPA 1LPMA 3H5LA 1KE2A 4O4JF 3GYGA 4DQLA 1Q92A 1L4EA 1ZD1A 3PA6A 5SZKB 1RBZA 5EXEA 1RAIA 3MJVA 3MRTA 2R1TB 4J1NA 5D1HA 2RGBA 4J07A 5TPWA 3VR6D 2FJPA 2ADOA 4RULA 2WSSD 1FC0A 3JQAB 4LBYA 4L8VA 2P6PA 3RCBA 4ENTA 2BJVA 1GV0A 3D0RA 5TF0A 4HNQA 4XH9B 5BRNA 4Y1RB 3DSRA 3VU9A 2O06A 1NZJA 2VNAA 3L9XA 2G40A 1Z06A 4I1OA 3GLVA 4H59A 1LJ8A 4MGIR 3WB0A 2I62A 4B9EA 3OPYI 4YCSA 5IUJC 4HH0A 3FWKA 5FO0A 2C1XA 4EQ6B 5I7AA 4KTTE 1YE8A 3KZMA 4C7VA 1WKBA 2Q9UA 2JIPA 2G8LA 1RHMA 4LQLA 2Z9BA 5EMLA 4QXOA 4IXNA 2ZT7A 1PTJA 4P5PA 4DC1A 4E14A 5HKOA 4DR6B 1RKUA 4R2XA 1CUBA 4HGQA 3UJBA 2HZ7A 5JXIA 1JBKA 4WXRA 1JFSA 1TQ6A 4GVXA 2BWJA 3W9SA 1IAVA 2E4AA 2IEBA 3SHOA 3TNYA 1TC1A 3VGJA 4DS3A 3BFJA 4ZCLA 1KDZA 1H22A 4G36A 4QFCA 4NTZA 3B1KA 4PRYA 5DEIA 3N07A 2JL1A 3OPYA 3QELA 2GZRA 3ZGVA 1CZNA 2V3VA 4HUJA 4TN1A 4TSFD 4Z4FA 5I7WA 4OK3A 1QR2A 2N1BA 5AKKA 3ZHVA 1Q12A 2UXDB 4P0TA 1ZW1A 3DKPA 4M6WB 3U7QA 4DILA 1Q0SA 5H83A 2DBVO 4OY3A 3AZQA 4X7MA 4YAWA 4PYMA 2ZSJA 4QWWA 2YNMD 1UDCA 1OJ7A 3QW2A 1HYHA 1QLHA 3CZAA 2QAGB 2E18A 4OAQA 5KZMB 1A5TA 3PC8C 1R27A 1QH8B 4XD7A 1TYCA 3DLTA 4O2AB 2QUBA 4CGYA 3CZCA 4YO7A 2CLSA 2NQ2C 4KO2S 1B2RA 1HE5A 1TVKB 4PHFA 1J49A 3G59A 2RHHA 4BLWA 2IUEA 4Z7JA 1EJ0A 1OKKA 4Q1BA 4B45A 4BO6A 4F2PA 4V1CI 5JNSA 2Q21A 3O8DA 2QT1A 3QSYA 2EFDB 1XZBA 3BMOB 4A6PA 1TU0A 2PU7A 1KMNA 2WAXA 1C3JA 3I6ZA 3S28A 4CQMB 1ESNA 1HMPA 3PHGA 1O6ZA 2Q3EA 4D3YA 1Y6QA 3V2IA 3T5PA 1PLKA 4YDSA 2YBEA 1PLJA 3CHYA 1N2BA 4FQ8A 1N25A 1ZD2P 4QVKA 1ND6A 1C8LA 4KLRA 3VVMA 4YCLA 1KH3A 5DB4A 1KDOA 1A8PA 3FSGA 3VSEA 1L5FA 2E6UX 4JH0A 4C14A 1O87A 5JS8A 2QMOA 5JALA 3EJ6A 1BFUA 2CC2A 1XEWX 3QTLA 3BIFA 3AGQA 2XW6A 4UQLA 1W5AA 4HBGA 2OD2A 3RTEA 2O14A 2O2CA 7GPBA 2J0UA 2VHWA 3DFKA 4YP5A 4IXTA 1IUOA 4YFVA 4LNUA 2VAXA 4MQFA 3TTUA 4DSAA 3CRVA 3WHIA 1DC8A 4MAAA 5DULA 3HCCA 4UOZA 1NM5A 4JKOA 1LRJA 4M1SA 5IXJA 1CUYA 2LCFA 5EFZA 5KJEA 5TT0A 3W9BA 2JF0A 4EI7A 3A2MA 3BJMA 1LRKA 1VG9B 2MSEB 1P5HA 5UKDA 3RIGA 4A26A 1QRUA 4H17A 4MZXA 4TXLA 2I6FA 3H1BA 2FPIB 3OMWA 5EZ5A 1X2BA 1WS6A 3Q0EA 1DKUA 3R8XA 3BWYA 1SXJA 4KHZA 3R7BA 1SUBA 1CP2A 2GCOA 1D5CA 2ZUVA 4KE9A 4PYKA 4DLTA 4DPLA 3RNOA 4E46A 4AJ9A 2QJRA 2A9PA 1SHTX 3BXOA 3N2YA 2A5FA 1N9ZA 5EE0A 4TMWA 1CY7A 1K7XB 4ABYA 1MCZA 3FKJA 4FP9A 1EFDN 4ZO7A 3RBXA 4Y2RA 4L02A 2RHOA 4FBLA 4OQMA 4PG7A 2PZKA 4D8XA 5MF6A 4PYRA 1WHTA 3FPLA 1PJAA 1ZL0A 2XNJA 2VL7A 3QVGB 4BO2A 2JCYA 1PL6A 1P3JA 2OMEA 4EH1A 4ES6A 5AXCA 1XN4A 3ADOA 4TLCA 3ZDRA 3WLMA 3SN6A 4XWYA 1R15A 3FD8A 5BVGB 1EINA 4KCGA 3SJ7A 3DV0A 3X1KA 3OZDA 3QMMA 1OZFA 1P4SA 3EF3A 4MGHA 1QH1A 5B6IA 4XWWA 3HY4A 1YXMA 3S7ZA 1SZCA 1Z82A 1ZJ5A 1Z08A 1U94A 4YBZA 5GONA 1OHHD 4JU9A 4E4TA 3KQPA 3WZLA 5I51A 4HAXA 4TYPA 5KNCA 1X42A 3R6DA 1G55A 2VNHA 4HEHA 2D1SA 3IQIX 4GI2A 2C96A 3ANXA 3V9PA 1HDYA 4DHEA 3B20A 3CNQS 3VTKA 1PS9A 3M81A 2P5UA 5EE3A 3N05A 1QWSA 4LA4A 4LHZA 1ZI6A 1MO2A 3SP1A 5CURA 4D7AA 5AW7A 1E1NA 2HUPA 2XE6A 2ZJ4A 3KLMX 3LLMA 3M70A 3D43A 4HUTA 3K9CA 4HEJA 3R9KA 2RI0A 4YQFA 2JIDA 1L7EA 2QE7A 3LDGA 4Q9KA 5FUVA 5AM2A 2V6JA 4KUEA 1MB9A 1U3FA 3KJEA 4XB2A 3FRJA 3P9RA 1R0LA 3E70C 3ZYCA 4YJ2A 2BDEA 2Y1FA 3K1AA 4PZEA 2ZRHA 3QE2A 4D9JA 3NJ8A 2VXCA 4F4CA 4WEOA 2B4RO 5F1KA 3NX4A 1G63A 2JH8A 2OLEA 3UOAB 3CB2A 1QU3A 4XPZA 1K68A 2R11A 3KSRA 3RS7A 1YCGA 5JSUA 1TB4A 4FHDA 4BQSA 2ZQ5A 3A36A 1GV1A 2ANBA 3B78A 4CEHB 4H3KB 4MH0R 3SJZA 1DLJA 5CXUA 3V4PB 4UTNA 4YJGB 1VSUA 5G4KB 1YR8A 3PLAE 2I6TA 1AHHA 1L8AA 5FORA 1PYDA 3UF0A 1KMIY 5B57C 1ZA1A 1E6EA 2OHIA 2J59A 3PTZA 3QITA 1RHUA 4Q1FA 2ZETA 4QASA 5AVRA 1PQWA 1Y6GA 1A9SA 1FJXA 1GQSA 3ISVA 4J16C 4BKUA 1PGNA 4EX6A 2XGMA 3OJXA 2V8OA 4U6NA 1U04A 4MW9A 3BORA 4N5IX 4O08A 4J0FA 1H2WA 5FWYA 3TRIA 4W1RA 1BN7A 1N6LA 1YOVA 5AD1A 5FBZA 4ECEA 2WSBA 2PWBA 1P5FA 3EZNA 3OZAA 4TYYA 2X3UA 4DQVA 2OBBA 5YASA 3L7NA 1X7YA 4UBLA 4YBRA 4I1PA 4IX1A 1SU6A 4DMLA 1MABA 5AM3A 1DRWA 2O3JA 3B2QA 2XOKA 1EZZA 2YW9A 5IXYA 1CUGA 1IHUA 2BFOA 3GT4A 3U7RA 4CKCA 2ZXFA 3M6FA 2RHLA 2C9ZA 1IZ9A 2Y66A 3O91A 2ZUSA 5BN4B 2BGJA 4S1VA 5FR2A 2HRDA 2IFTA 3OJOA 3IUEA 4EKEA 5IAKA 4QFDA 5KYWA 3KELA 1QCZA 3V32A 1HFWA 3O4JA 2J46A 4CIVA 3HWX1 2FWJA 4FT2A 1ECGA 1GYQA 4Q9AA 2PKEA 3A0UA 3IJPA 3PDWA 821PA 5HZKA 4F3TA 4DY6A 1O9GA 1EFPA 1W6UA 4HD8A 4ZOEA 3CE9A 2GK4A 3RDPA 3KZVA 3Q3VA 5LZ8A 3DLCA 3UW3A 5D51S 3D4OA 1E3EA 3A1CA 2PO5A 2VRNA 4KPFC 1Y4DE 5FI0B 1KXZA 4R2MA 2OP1A 3KSMA 4RACA 1T9GR 2ZANA 4FZ5A 3DOCA 1CNMA 2HLNA 1PSZA 2FWIA 2FQ1A 4F5EA 1J23A 4KDEA 2OKCA 5HJ5A 2FZEA 5AUPB 1I4LD 2C4KA 3EXEB 2VSYA 5G0VA 5M5BA 5TY0A 4MV8A 3PSAA 2XSZA 3IAS1 3EZ7A 1AA9A 4YMSA 3TIXB 1EEXB 4L8FA 5M29A 3I4CA 1Z15A 2FK7A 1HDGO 1I1NA 3PPWA 2VPYA 2R6GA 3LYAA 3NANA 1ZR4A 1M6HA 5DGDA 2ZWOA 4IF4A 3PR3A 4J4HA 1MO4A 3SXUA 1V1MA 1Q7GA 1UIMA 3IP3A 3MC1A 4H7PA 2PE5A 1JQJC 2OC4A 4QNMA 1VL1A 5FO1A 4EI8A 4HMOA 4DMUB 2FXIA 1P61B 1DARA 3DDSA 4NFSA 4FCCA 1NPYA 3U3DA 2XGJA 2ZBDA 3GRYA 1V96A 1OBHA 3BMXA 4Q02A 2HA7A 2NGRA 2QSUA 3MJFA 1A4IA 4YYEA 1LJLA 1ZN2A 2XOXA 3O26A 4B3TB 3VH4A 3KQOA 4JIGA 5A5GA 2PR2A 2Z1NA 4E6EA 2V58A 2PFSA 2Y1DA 5AI4A 1LV8A 1Y81A 3JWJA 2FFAA 4M0CA 2HI0A 4X45A 4D97A 3VZDA 1U3CA 1W88A 5DWVA 2NXJA 4DEVA 2HRBA 1QZUA 4AP6A 1PW7A 3P5SA 3RSSA 1BG6A 1HTTA 1KI4A 1RKQA 3F5QA 2YV2A 1DT5A 2BMAA 4RMNA 2VH5R 3M0EA 1L5YA 1TMGE 3FRHA 3VISA 3W3AA 4AUEA 2Q6IA 1R5BA 3V8NA 5AJVB 3B13B 4FX2A 1WOYA 4TKLA 2I34A 2EKQA 1Y3IA 2P5TB 5ELXA 3BB1A 3C15C 3K0EA 4ZYXA 3QU9A 4MUFA 2I8AA 5BUCA 1QWOA 1VL6A 2OORA 3JAMA 1H2FA 5LXTB 1GYPA 2L19A 1HA3A 2WFZA 3M6VA 2VG8A 5JQGB 3L04A 1JKXA 3K9LA 2WU3A 2ID7A 2FG7C 5DBFA 3LUAA 5ESXA 3SDZA 4OBXA 1LVHA 1TU4A 5K6RA 3RF6A 3ZHYA 3S1SA 2JH3A 2PV0A 1ZSNA 4OB8A 3L0PA 1CG6A 5JAMA 1X70A 3LFUA 4PGAA 3A0RB 5K6AC 1BCSA 1Q0QA 1P7ZA 2VRCD 4AO8A 4CL3A 3JQGB 3DFZA 4BAZA 4AMBA 4EAQA 4UULA 4TMZA 4CIWA 2WSLA 3OPVA 2B1RA 5FA6A 2WJWA 1GFSA 1QHFA 1VYTA 3X1DA 3IX7A 2KE5A 4BFYA 4NCBA 3QU2A 3BD9A 1GNPA 1GZDA 3WNDA 2NZYA 1XRSB 1TM7E 2DT5A 3KO8A 1IBMB 3HCDA 3AVTA 2C5BA 2G1KA 4JWKA 1WXGA 2PT9A 3G0GA 4ARVA 1ML4A 3R1IA 3HXMA 2WIAA 2XT0A 3JWIA 3SOPA 1VJDA 2IITA 1BDBA 3CFYA 421PA 1IQUA 5KU1A 4UUQA 3V8MA 1B8NA 2PUAA 4BMNA 1GEGA 2H7CA 5TIIA 4CV3A 5IFLA 4D3DA 1YFKA 4P3XA 5HJ2A 5G2OA 5T41A 3ABRB 3PC7A 4J49A 1OWLA 2C57A 2G7ZA 2YFHA 3DW3X 1ATIA 3Q3IA 1B6GA 1FNNA 2HBZA 1MUUA 1LS6A 1URPA 1NQXA 2VYND 2O7RA 5GWXA 4B8ZA 1C41A 5BUZA 2YXLA 4FINA 4JJEA 2Q5FA 4QLBA 1IUPA 4BFWA 4F7DA 1PI3A 2WIFA 1VL0A 3QF4A 4KACA 5B3KA 2X0NA 1LTHR 4UAUA 4DT1A 1A50B 1GCAA 4BVJA 3FNEA 2JBWA 1W30A 2Y92A 4RD1A 4CYMA 3TR6A 4MWCA 1Q84A 3P2MA 4Y6LA 1SCAA 1M6NA 1XCJA 2ES4A 2X1HA 4Y2QA 3TJRA 5DGHA 3V42A 3TEJA 4X7RA 2G0TA 1A9RA 2YY5A 3IDFA 4DN6A 4EIWA 5HVNA 3LPLA 2GARA 3DV9A 4ZI5A 2CL6X 2FW0A 2RKOA 3FPKA 2X19A 3FY4A 3LWNA 1FXWA 5BQXA 4YO8A 2II6A 4GZLA 2YMLA 3KQMA 2IP4A 3VJMA 2QB5A 4EITA 1SQSA 1AURA 1M72A 1XF9A 1BFDA 1XU9A 4KQIA 5IK2A 1TUBA 1QE0A 1TIKA 2IH2A 3IIJA 1FVOA 3P5BA 3PQEA 4D8TA 3ZWYA 5B1IA 3NBZC 2CLCX 2V7EA 4UVDA 1ZVVA 4MCHA 4N1AA 4OX9B 1DGQA 1Y80A 3EASA 3E6AA 2ZR9A 2PL1A 1HORA 1XD2A 3UWSA 1CRLA 1DC4A 1X9GA 3O21A 5IARA 3RIXA 2X9NA 1RVDA 3QQPA 5KWEA 1NM5C 3FTEA 1FCJA 1R0XA 4Z49A 1F5NA 2NZJA 5H4HA 3TQSA 2JI6A 1D0VA 2DECA 1RE0A 1T9KA 1W19A 4JB3A 2AOTA 1WQ4A 1I01A 4GOKA 2YUTA 1KI7A 2HJ9A 1EBUA 3AIOA 3RYHA 4F86A 3UVEA 5FOVA 1UBHS 3ZHTA 5LQDA 2IPNA 4KYUA 2FWNA 1FFWA 3HYTA 3EA4A 2ERCA 4JHXA 2AFRA 3QE9Y 1MGOA 1SVLA 5AKYA 2EP7A 4YP9A 3AX6A 1T9DA 1UBNA 4MKIA 1F6BA 1HLFA 2RKWA 1H8ED 3MS2A 1Q50A 2WWVD 3TJMA 1QO9A 4JVOA 4B2IA 2W0SA 4KWEA 2R7KA 3L8CA 3WYEA 3TMYA 3K8YA 1JAXA 5AI8A 1S0UA 1JZQA 2AFIE 2L42A 2DFNA 1GZ5A 2YZ7A 3MTJA 3IBTA 4K6OA 4Z9BA 5JPCA 1BEUB 2DM6A 3LQRA 2ZS7A 3JQ8B 2IK8A 1E1YA 3OX4A 4O5OA 4ZMSA 1DKRA 5MN5A 4LC9A 1KY3A 3VZRA 4W9NA 3M33A 1BCRA 1E6WA 1LSOA 3N8KA 4F4HA 4Z7OB 1N3LA 3UMCA 3L8HA 3U9SA 3GEDA 3P2KA 5EKTA 5C53B 3STHA 4RU1A 1PKEA 4CM9D 5DNCA 3HGQA 3K30A 1MJNA 2FW7A 3NKVA 3K0BA 3KKZA 3KDAA 3TFQA 1CZHA 1C1DB 2ZE5A 1NXVA 3GDWA 4M1WA 4XWTA 3HUUA 2IEYA 4EHFA 1R88A 3GJYA 5HMLA 1I2BA 2PA3A 4FLFA 1CPYA 5H8WA 4WT7A 2XUAA 3PZRA 3QA9A 1JZTA 3GZJA 3ICEA 4GM1A 3EXFA 3IBYA 5LD2C 1DKPA 4L8GA 4Q3CA 2IEDA 2I78A 2W2TA 1E2GA 2SNIE 4MW7A 1E1CA 1JS1X 4CG3A 3H99A 3GNSA 1NQWA 1NRIA 1HQYE 2P9ZA 1NKSA 2X41A 3DE7X 3DMNA 3H5VA 3HZRA 5D3ZA 3W04A 4V0RA 1MOPA 1Q0RA 3ONEA 5E1BA 4EM6A 3ZY4A 4OKNA 3HI4A 1SEPA 1J8VA 3GLHB 3EPLA 1KOJA 3HCNA 5A6VA 4ZI7A 4RJTA 3INNA 5F7OA 1UBRS 2FQXA 3OQIA 2CNOA 5TLSA 5DRTA 1XEWY 4JLPA 1Y7HA 2I6GA 3OZCA 5HPYB 3ZDAA 5ESWA 3FDZB 4F21A 1V8FA 2C77A 1N7JA 3IUBA 4JXKA 1JHRA 2B36A 3FSGD 4IOKA 1FW8A 3DE1X 4P80A 4E2WA 2W6IA 3U0VA 2PZEA 4C6TB 3ZCVA 3KQHA 3GROA 1ZKDA 2O50A 3I9OA 3CKYA 5ICCA 3ZBTA 3K8OE 1NZFA 1YJ5A 5FNVA 2P0YA 2QX9A 3GRKA 1I0LA 3OLVA 3QXSA 4NU8X 4R9UC 1UK8A 2O05A 1X7ZA 5CB4B 2O5CA 1LPBB 1Z74A 4M87A 4YT8A 2P0EA 2HTEA 3I9KA 3ZLVA 4DF3A 4EARA 3EYWA 4E2ZA 5CCEA 2OHJA 2BFDA 2O19A 5JCJD 3N8IA 5BXYA 4MR9B 1K4YA 1I7PA 3LWZA 3ZXSA 1JKJB 4OUDA 3CGGA 2UUOA 3NIFB 3O8OA 5AXBA 5ITZB 3LY9A 1HLDA 4W7SA 2ECFA 5HF5A 2AUMA 1GZ4A 1FB5A 5EWJB 4K6GA 3ROTA 3RS8A 2XR1A 1Z5VA 1XOIA 3B3QA 5LBIA 2IXDA 1VGRA 3HCOA 3LCRA 3ED1A 4LSZA 3WDMA 1Y5MA 1JFTA 3HG7A 4YT2A 3ZXYA 4ZVUA 3HVRA 3TVTA 2W2LA 5KX5F 2OCXA 1GDDA 1RBQA 3ROPA 3FETA 4INZA 3NBMA 3PC3A 4FSHA 4YXWA 3TGPA 4I50B 2AYYA 2CZQA 4M0DA 5C1DA 3U6BA 4FYJA 1RAGA 1U0SY 2EFGA 4WZAA 2WJHA 3UA3A 4AT1A 1KHTA 1RCTE 2YC4C 3KQVA 4OM7A 4UBJA 5JROA 2NVOA 4JT9A 3D4BA 4NI5A 1K6JA 3O84A 3M1AA 4CQMD 2OCIA 4HS4A 2ORWA 3ZX4A 2OBLA 3G9UA 2H54A 4RHCA 1O5OA 3G2QA 3R41A 4UBMA 1N6RA 3UMFA 1CQJB 2CFIA 5A9TA 1T24A 3ABZA 1P77A 1VLMA 1P1FA 1RYMA 2FQQA 5HJEA 4DKJA 3E9EA 2DFDA 3CX7A 3GLUA 3MAGA 4K6KA 4ZK6A 2FOIA 3UMGA 5BWMA 3K71B 3ILSA 4WW0A 3OLXA 3MWEB 1CZRA 1A1VA 2YASA 3T1QA 2A9JA 2I1WA 2PRSA 3TW4A 4AMVA 4X8LA 4MUAA 4L74A 3KYJB 5GADl 2BFEA 4EB6B 2C2GA 3ZE1B 2QP9X 3N0WA 5F2NA 4C0WA 1LLDA 2J4FA 3FCYA 3I3SR 5ILGA 4YJ3F 2CNDA 5J2UA 1GUYA 1S2OA 1YS6A 3DR5A 3JQ9A 3RRFA 3M5PA 1UOEA 1UZNA 2PJDA 4QUJA 1GZ6A 2C61A 3W6UA 5K0ZA 4IV0A 1YDGA 3ICQB 1ZNXA 1R9GA 3UGQA 1DMRA 5BQ3A 2ZZMA 4IGKA 2QV0A 4MB2A 3QY0A 1BAPA 2VLIA 1GTG1 3FR8A 2ECQA 1ZMOA 4JYBA 5CLHA 3S4YA 1X87A 4X84A 4BNXA 4MRPA 2BEVB 5KQMA 2J41A 3LUBA 1PDWA 3RSLA 1ST2A 5TQJA 4HNGA 1BVHA 3CUWA 3U3RA 5KOJB 2F8TA 4P58A 4Y6GB 5BR8B 4RA9A 1NLZA 1SULA 3EG9A 4M36A 1Q6YA 3NEPX 4FFVA 3VDQA 1N32B 2UZIR 3I4FA 3MD0A 1A7AA 2PCLA 4DIOA 4IQ4A 4KWTA 1PHRA 3F5SA 1T15A 3NCTA 3U1VA 4DLLA 3F1KA 4ALJA 4WLUA 2JIZD 2AQKA 2H57A 3OZGA 3OE7A 4JXJA 2ZTHA 4M1EA 4ONEA 4D9KA 2P6RA 4Y7CA 1TK2A 1DWPA 3WDLA 1ZIXA 1EXVA 1NFRA 2FRVA 3RIEA 2W00A 3LIPA 3PDIA 2QK4A 2HPAA 3KZXA 3GCDA 4OA5A 1JZSA 3BAZA 4C43A 5LMNB 3NYIA 1BXRA 2H4YA 2ZDQA 1TADA 4HX5A 1NQTA 4KPUA 5JRDS 2HNKA 4HLQB 4PGMA 5I4KA 3TLGA 2Q3DA 1JDVA 1YV9A 1AQIA 2YZNA 4M9RA 5KWSA 5I7RA 2GVNA 4LMRA 4R8VA 5LB4A 5CDUA 1D3AA 5LLSA 4G9BA 2HHAA 4LJ5A 1KO4A 3ZZ0A 1DSSG 4PAMA 2A1UA 4U6QA 1UODA 1GNTA 5K0EA 3N28A 2QN7A 4R05A 3B53X 5NULA 1UJMA 4BUCA 5DCYA 4YRIA 2XNDD 3U17A 1F2TA 3G6KA 3R5KA 1T2DA 3SX4A 2AN4A 2VWHA 4DCJA 1A9YA 3MT0A 4ZK2A 1IOZA 1R4NA 1FZTA 1XIVA 4ZN6A 4IEFB 1A69A 1DEHA 1FNCA 2QRZA 3JXEA 4BNIA 4MR8B 3HN2A 4NZPA 1WOMA 2LCIA 3W05A 3HJGA 2ZIVB 2ZRLA 4OHPA 2PGXA 3T94A 4JZYA 2RHTA 3LECA 3U4CA 3IRUA 3E1SA 1OYVA 1LA2A 4LMBA 1NXSA 5IN5A 2WQ7A 4BBZA 4EECA 1P6XA 2XVYA 4IJ5A 2ZRIA 4N3AA 1XWFA 2NV6A 2P6UA 2GNOA 4W6ZA 1PYOA 3DQQA 4GZ5A 2HADA 4QJ3A 1PQUA 2XGGA 1L5MA 1OY1A 1GG9A 2WZBA 2PZ8A 3FYCA 2I4IA 3HBFA 1ZJZA 1JAIA 1F1JA 5CGQB 3FOZA 4NH0A 3AUSA 3EXHA 4D80A 1RMTA 1O57A 3MYYA 2K87A 5JBIA 4EKDA 4ZGWA 4YAFA 3TIGA 2WW8A 4UASA 2YCBA 1Z0JA 1TLLA 1IN8A 2FVXA 1LS1A 1QYVA 3F4LA 3P0IA 5FLYA 2GUGA 3FA2A 4ZZIA 5CA1B 2V7TA 5K8UA 1UMCA 1U81A 2VATA 3P96A 3ASZA 4R0NA 5KNCH 5D5HA 4P7FA 5ITZA 4IUBS 1G1MA 1Z4MA 2AN5A 4Q3KA 4X71A 5LR6A 3FLBA 2PEZA 3KJNA 1KVSA 3TXXA 2W2XA 4WZBB 1Z4JA 4D46A 2C2WA 3T15A 2J6BA 2J30A 2XDQB 4EUFA 3F2IA 1UUFA 1DJNA 4AS3A 1MX5A 5I4BA 2C7BA 2GJ8A 3DE6X 1YQEA 1BGXT 2BEJA 3UKDA 2FR0A 1F0NA 2G67A 4AF6A 1CVIA 1H5UA 1NW3A 4RY9A 4ZYUA 1YZNA 1EA7A 3DVAB 2J9FA 4AN0A 4U5QA 4Z7QB 2P7IA 2BVNA 4CODB 1GTJ1 1L5SA 2F1JA 4YK7A 4HT3B 1GTL1 1CNEA 1FBTA 3GGOA 2JLZA 2VDUE 4OFWA 2KPOA 3MERA 1DDIA 4ZI2A 3A4TA 3FE2A 4HV4A 1M8PA 1RQ2A 2UKDA 3T5MA 3O73A 4MSUA 2LD4A 2QX6A 1QAQA 3L8MA 1DTWB 2IYNA 3HABA 4QYWA 2WVAA 3MBIA 5A3VA 2I1VB 3R7FA 3DLPX 1YQWA 3G1UA 4NJOA 4KQ1A 5E2BA 2RGEA 4ZYYA 4GLJA 3O82A 3STUA 2PLNA 3TE7A 3UYKA 3OD1A 3KAPA 1MVLA 1XVTA 5BNTA 5ALEA 1T4CB 4UEJA 3O8QA 3QVJA 3U62A 3COYA 1ZU5A 1IULA 2AVDA 1NVGA 2NPIA 1P0FA 1VG0B 4CTOA 3AHIA 3L82B 3ADDA 1ISJA 1VRCA 3L6OO 4Q5IA 3WDSA 1E61A 2X5XA 2X8BA 3E23A 3R77A 1QM5A 4A1FA 1T3ZA 1C9JA 1GADO 1P44A 4PQRA 3W1VA 1J8QA 4QLOA 5AKXA 2HSEA 1L4BA 3TTTA 4KUHA 3X1YA 2YOFA 4G5RA 1AHIA 2YOGA 1F14A 2XADA 2ZG6A 4LXYA 3JQBA 3T1HB 1L5WA 2FZVA 5ALTA 5G3YA 1V4NA 5SYNA 2JJMA 4DQDA 2JKVA 4JT8A 3W5VA 5KNDA 1UBTS 1W5FA 2P91A 3RHZA 2ZR8A 5DLYA 1W87A 3K31A 4FYMA 3BCRA 1E20A 2BEKA 1Z29A 2IHVA 4A8JC 3E8SA 1VLJA 2C83A 2DFVA 2JVJA 2XPCA 3AH8A 3I6QA 4KL8S 2IU6A 4TMFA 4KQGA 3TOCA 1GXSB 1T8RA 1KTVA 3MXTA 2ZUEA 5MGBA 4MUBA 3E9QA 3V8QA 1TO6A 1DBPA 2B5WA 4J0IA 4H4CA 1JHZA 2Q0HA 3ORFA 5LB2A 3ZDDA 5ILOA 4FGKA 5DKFA 5TC4A 1ZN8A 4NBTA 1ENOA 4L5IA 2X76A 4TWAA 4X1IA 1X8XA 5DBEX 1E2MA 3NTQA 5ARDA 4YFYA 3UAGA 3UYLA 4DEYA 4F4UA 5CFPA 5K09A 3A2KA 2CZGA 2RH8A 1AQ6A 1S02A 3GG9A 4WAUA 4FDMA 1ZBQA 1MA3A 2CNWD 2KSQA 3RR2A 4PBRA 1GUZA 4E07A 4M3NA 3D6NB 2AXEA 4X1YB 3BJIC 2Y93A 1TQ2A 1GUDA 2WAMA 2G70A 3EODA 3HLKA 3IQWA 2VHVA 1W85A 4HPJB 4CMIB 1D4FA 1DDGA 1TGYA 4FZRA 5EIBD 1PJTA 4UM8B 1GJRA 4HZIA 2ZM5A 4B75A 4KR7A 3QWAA 5IABA 1Y1RA 3V8RA 4CG2A 5FBVB 2GNPA 3DEAA 3H3FA 5B4VA 4E3ZA 2FWPA 2Y0DA 3RGWS 3VPBA 4PLYA 4LECA 1YK0A 2YV4A 2Z4SA 4BFSA 1MJGA 3SBOA 4ZIRA 5JAHA 2ZB8A 3OEWA 5EUMA 1WDKA 2QM3A 3KOOA 1DNPA 3BH6A 1ZN7A 4WVLA 4Z4CA 5HX7A 2KHZA 3EUAA 3PQ8A 3VH3A 5SYMA 3DQPA 3RS4A 4QKQA 1C8BA 2FR8C 4B8YA 3MGKA 2PS3A 5F4ZA 1XCLA 2FPLA 2IRWA 2X14A 2X9LA 2B8WA 4COOA 4Z2AA 2KB0A 3B5IA 1GA4A 1N1GA 3HDJA 4NOJA 2J3IA 1QUEA 2ZI7A 2IEZA 1UDAA 3TZQA 2I2AA 3ZE8A 2P4QA 4K40A 2KX7A 2XRFA 3C98A 2M98A 4C89A 3PEVA 4V3BA 5KYYB 1MQ8B 4M7WA 2I7TA 5H02A 3RVJA 3QWIA 2C0QA 3CNLA 2XECA 3GUZA 3K0AB 2IF2A 4JC5A 3WWPA 2NMVA 4QPDA 3WIUA 3GCWA 4MCAA 3TJZA 3WMXA 4B5KA 4PYIA 2GOYA 5KQSA 1JSCA 3HJHA 2EOAA 2C04A 4KXQA 5D3QA 4O0MA 3KAJA 3ETGA 2JNWA 2VT6A 5JCOC 3RAEC 2G1JA 2YICA 2Q6VA 3UJPA 3IIIA 3TLAA 2H9AA 5BWCA 1QG0A 1DXYA 1XRLA 1Z6ZA 1SMKA 3DLBA 2DUJA 4LJYA 5BPFA 4OQFA 3AHDA 4UHBA 2FSFA 5I8ZA 3RJ5A 4BMCA 2IZZA 1HKUA 5WRFA 5HOQA 5JFTA 4LV6A 2BKVA 5IJXA 2WFLA 4KIJA 4CMEA 2OZLA 4BNZA 4JQOA 1OAAA 2QMUA 2FRDA 3EAQA 1X19A 1J90A 2C5EA 3BXPA 1HYQA 4B34A 4C6HA 1EWQA 1PV2A 4ITUA 4RKFA 1XQYA 2C5AA 3KRTA 4PW0A 4MWTA 2XVAA 3H11B 4I1YA 1QG4A 2DPHA 3F3MA 3G5TA 4FOOA 4IKPA 5EAIA 3IODA 4ESVA 2FN7A 2PBFA 1O97C 2JJ2D 2BLLA 4CM9A 1KP3A 3ONFA 2HWXA 4Q7MB 1WPRA 4KRFA 2WB2A 3ZVRA 2P40A 3EDOA 1HNZB 3QSGA 3GDHA 3I2KA 1J1ZA 1B6RA 1PF7E 4H18A 1ONSA 1FRZA 4L0DA 4JI3B 4INJA 1A9XA 2IW3A 2A14A 1O1YA 1Q57A 5B3JA 2DXIA 5F5XA 1MFZA 5EMJA 1P8AA 2EARA 4KXVA 1NJ5A 1PUJA 2R5NA 2VAVA 1TRHA 3ILXA 3GP8A 4UTRA 3CLSC 4I5DA 2X5JO 3EIXA 1MNAA 1YHYA 2IDMA 2JPDA 2NVUA 3A1EA 4UHDA 1AKYA 1WEHA 2N3ZA 4J9VA 4Z8YA 5DXAA 3ESAA 4BN0A 4BNWA 5IM4F 4QQKA 2Q9BA 5IZCA 3ZDCA 3K72B 1ZHFA 4JI4B 4LHXA 1GM5A 1N2CB 4GU5A 4MVJI 4QGFA 4KHPB 2CY0A 1FMJA 1NYTA 1XLVA 5BORA 5KMGA 1E59A 1JR3E 1JQBA 2YWBA 3QXHA 3OIUA 2FZKA 1JDPA 1VRWA 2C7GA 2V4ZA 2VEOA 1NVAA 2Y6UA 1QQ6A 2ZU0C 4MW2A 4HDKB 2P1RA 4A03A 4X54A 2ONJA 1PR1A 4RPIA 2B9EA 5KDDA 4CI9A 1EWRA 4PAQA 5K0GA 1CULC 1Y4AE 3S8EA 3SEAA 2DERA 2AI3A 3FLMA 3CQ9A 3D4LA 1NNEA 2VPQA 2C9YA 1M8GA 1P0CA 4DA9A 1C0IA 1QE3A 3HYLA 2ZAIA 4QRIA 2WE8A 2GFQA 3A4IA 4IH1A 3U3XA 4IS2A 5JFGA 4EVIA 1PVVA 4MQEA 4PO8A 5FOSA 1E1MA 1E5QA 1MAAA 2GHTA 2OORC 1D9XA 3LP5A 3NOQA 4BCDA 1EFRD 5EPUA 4Q12A 4PBSA 4EEXA 1DX9A 3NV9A 2YCLA 2Q4DA 4YJ3B 1JRLA 3HI6A 4LXIA 4EMSA 4B2PA 5IBPA 3L77A 5BMOA 1WO8A 2B61A 1ISHA 2MU1A 3MIZA 5KHOC 1BDIA 1Z2OX 3COZA 2MHCA 3KKEA 4ZAYA 1NBHA 1EVKA 2L82A 2A58A 2HF2A 1O6FA 3HVHA 3U4QA 1EUZA 5KJCA 1LF0A 4DMHA 2QAGA 5BQOA 4D41A 3IP1A 1K27A 2FG5A 1U1IA 3T7JA 3KHKA 1G8FA 2RGAA 3KPJA 4II7A 1Z5WA 2NXEA 4V1CB 2BUAA 4LPSA 4PIMA 3QOXA 3RYFA 4D0GA 3MILA 5B2FA 1N9KA 1SVSA 2QVCA 5DW0A 5HOEA 5FBWB 2ENUA 3DVSX 3KBOA 1GT6A 1PEYA 2RJNA 1GKYA 3D5QA 5KVVA 4PM4A 5IEBA 3FJOA 2ZLBA 3QBTA 5KI6A 3ULKA 4LJRA 4RQBA 3GIDA 4DW8A 1ZRNA 1DWQA 1DEXA 1YE5A 3U7IA 1OFTA 3DKKA 3PEUA 3WLFA 1U9JA 4IXDA 5BRJA 3DZCA 2VHZA 4OI2A 1C9NA 4YX9A 1YB6A 5KYWB 4GOLD 2MWMA 5ES3A 4XJSA 3DGEC 3ZCXA 3B6ZA 4B7XA 2NYUA 4C01A 3LWDA 5CITA 3AY0A 1Z0SA 4JLSA 4LNUB 1G8MA 4IHQA 5CG2A 2OCYC 3WRWA 2F7SA 4RCZA 2BMWA 4NG5A 1ORRA 4J91A 2RGYA 2ROQA 4RX1A 1UWVA 1YUMA 5CNIA 1OR8A 2R62A 1HFJA 5IZCC 1BO6A 3N9IA 4ZANA 4DREA 3W1WA 5F35A 5HBRA 4BY9E 2J3KA 5E6RB 3TWOA 4ERNA 1PL0A 3EQ9A 1NUPA 2F3UA 1UDRA 2Z5GA 4AI6A 3GVIA 2VH1A 1MBZA 1SUCA 3KHUA 2JFNA 1ZOSA 3NHMA 1NXTA 4GKAA 1W8DA 1T4BA 3MMXA 1NP3A 2FF7A 5F21A 4DIDA 1JILA 2QLFA 5FTMA 4ZOLA 3C87A 4AZ3B 1GQRA 1SUFA 1ZSVA 2WBLC 3FGOA 1M5RA 1GGVA 3ENKA 3OVMA 5IKPA 1BKDR 3COJA 4J2HA 3A1VA 4Z8XA 1GZSA 1SEVA 1NR5A 2H65A 4FNAA 4K86A 2OESA 4KR6A 1XO1A 4TRNA 3T3OA 2H1SA 1YJQA 1GN8A 3DBRA 3WYBA 3RSFA 1UFRA 2WI8A 2ZE7A 5ILQA 3O8CA 3QEAZ 3N1UA 1RR6A 1N2IA 3ZWPA 4KAXA 2ZBEA 3W8FA 4H60A 3UHFA 1FQOA 1E0DA 1E6LA 1GQYA 4HAUA 5K0JA 3N2LA 1LFDB 3KQUA 2I7DA 1ZMXA 3IA2A 4GC5A 1ZRMA 1V5IA 1LWNA 3P0EA 2W58A 3BREA 3V7YA 4WVFA 3OZRA 1MC8A 2WICA 4ADSG 1KC1A 3OQ1A 2C7PA 3PC6A 1A9PA 2Y99A 1NTOA 4OX9Y 4OAOA 5JADA 5LBTA 1W52X 1G3MA 2CLMB 2ZRFA 3HNOA 4JIMA 4L9SA 4A8HA 1RXEA 1MH9A 4EO7A 2CCJA 1JJBA 2O5VA 2A84A 2R6AA 4CN9A 5JNWA 1EDDA 4FGLA 4KR2A 2WF5A 1IN7A 4Q93A 4R16A 2WOOA 3K2IA 4A0HA 4CM4B 2OCPA 4FWTA 4ZREA 1N7IA 2IYEA 4EGSA 2GAOA 3WLSA 5HYVA 1MRNA 3B82A 3CUTA 5JAZA 2A88A 1JIVA 2ATXA 4GDFA 2IEAA 4DLZA 1BE6A 2ZBQA 1RI5A 1SXJB 2BBWA 1VMKA 2RHGB 3K6RA 4I9HA 4AC9A 2QTBA 1B8PA 1H2RS 4MX8A 4TVBA 4ZHQF 5GM2A 2BMVA 1S1CA 2QW0X 1H1LA 2A5JA 2XZTA 2JAOA 1LBQA 1YRLA 2NTNA 3Q8WA 3L7MA 4DLNA 1K3UB 1MT0A 2NVBA 3MB8A 4W4TA 3TM4A 3L0ZA 3GFFA 3N2IA 4CM6A 4MQ5A 3I9LA 2G0AA 4ZYZA 1U11A 4C0HA 4LGVA 5C8YB 5C8VA 1SWVA 4WLEA 4RUKA 4GXQA 5ALQA 2RE8A 2OGWA 3T1TA 2P3SA 3ABIA 3GUVA 3OT1B 2DUWA 1GAEO 3ZTWA 2X3YA 4BJHB 1R8XA 3N2GA 3U26A 4MKFA 1FX1A 1UJ4A 2QY9A 3BRCA 4XD2A 3LHFA 3LBFA 4B6PA 3BE8A 1VE7A 4AXBA 3VFDA 4Y1RA 3VU9B 5BVGA 1MVOA 3EVAA 5JNVA 1RLJA 1QS0B 4HNTA 1V5WA 1EFKA 2H1LA 2I6QA 4JJZA 5K3DA 3RTAA 3WOVA 2D5AA 1PN3A 2PRZA 3JAKB 4CCYB 4F2HA 4P83A 1M8FA 1MZVA 2C4MA 4MIEA 4BO8A 4BUJA 2PKQO 3K2BA 5BSUA 2GVZC 1U2PA 2BFPA 4IVQA 1R5NA 2MDTA 5EXXA 1T0BA 4ZO9A 3ZBPA 2ZT8A 3KYDA 3L2OB 4P31A 1PIWA 3R5SA 4BNTA 1TJ3A 3IP5A 4US2R 2XB8A 3OZWA 4HB0A 1QRAA 3PHCA 2C84A 5KTTA 2D2IA 1AMNA 4NULA 2AMVA 1KI9A 1G6Q1 1NN1A 4M1OA 4BV2A 1XFDA 1EM6A 2A59A 2JFZA 3NWBA 4GIBA 4OJQA 4G4SP 1WZCA 5IRCD 2Z95A 4MWBA 4ZCQA 4B0PA 2JIQA 2QUAA 2NPOA 4CKXA 1H4QA 4ZDKA 3C6XA 3A10A 3RAGA 2A5YB 2WKPA 3CXRA 3UH0A 3RVOA 2DEUA 2RGNC 3O7MA 2HBQA 1EESA 2AN1A 4D9CA 1GG5A 3SYTA 3CKMA 1LGYA 2OFWA 2PMBA 3LZ6A 5FFNA 2CKDA 4BJ6A 4YH1A 2JZCA 4N0EA 1TDJA 1WY7A 4RS3A 2GEBA 2ZRBA 4BZZA 3QVKA 1Y37A 3E0XA 4R9RA 4XE5A 4A0RA 4E08A 3GLIE 1L1FA 4TGLA 1PGQA 4TQUS 4ATNA 2VF5X 1Y9AA 3PC2A 4FX5A 4TQAA 5K6AA 3WLTA 2W6ID 2O8NA 5THXA 2OO5C 1UXGA 4LBVA 5CLIA 2RAFA 3GJZA 3RRMA 2AHOA 3E5RA 1YVPA 4L3VA 4XLLA 3ZY6A 1IZ0A 4OKIA 2ODPA 4QGSA 1MB3A 2LIVA 4KBYA 1EFHA 3ZNNA 5KYGA 4Z7NB 3E5HA 3HB0A 2JI4A 3FPBA 3R44A 4JLVA 3VYSB 1JEYB 1G6KA 4O4IB 5JJCA 4TVSA 2A1TS 4OP2A 3CE6A 4DR4B 5K9ZA 2XXAA 1Y9JA 3GNQA 5AH0A 2HU7A 3TX6A 1U2TA 3ZTYA 2HWUA 2Y67A 3O3NB 3TBHA 4J6FA 3FMGA 2GPWA 4GPD1 4JQSA 4TTRA 4MV7A 4WXEA 2IXTA 4X94A 2NU7A 3O90A 1N0UA 1HDCA 3BWVA 4CIXA 4CM1A 1KDRA 5IASA 3H83A 4PLVA 4YRSA 4KO1S 4NATA 3KFXA 1YTLA 2Y0CA 4TLAA 3RVNA 1YRQA 4Z1MA 1NURA 5KKCA 1S01A 1Z5GA 3VMMA 3CUEF 2V9ZA 1CVLA 3INRA 5DM1A 3HP1A 1JLLB 3E8MA 4WBNB 2ZFUA 1II0A 2BR4A 5CFMA 1CYDA 1HO3A 3TTSA 5CBPB 3QXGA 3BGIA 4BGIA 4DGQA 5COAA 1G8YA 5M7EA 5ENDA 5L8VA 1TJNA 3UT0A 3RVKA 1AV7A 4PX2A 1RADA 3EUEA 4HWKA 1AKEA 4LNAA 5HK9A 4NCXA 1YZTA 1SCIA 1IWBB 3GC6A 1C1DA 1E6KA 2D5CA 3FUCA 3HCRA 3IDSA 4MQ4A 2V96A 4M0UA 5DOZA 4IFEA 5E9JA 5IP5A 1XZIA 4F1WA 3K4QA 1NVFA 1OXVA 3THXB 1GEEA 2Z3ZA 1IXZA 1ZJYA 3CN9A 3N2NA 5EESA 3CLHA 2IUUA 5KSYA 1XJWA 3UW1A 5DVZA 2BHRA 2DQSA 5I7EA 2VQDA 3RFVA 3MB5A 2BGLA 1WZIA 2C2BA 4LYGA 5BWOA 4YJKA 4G4SO 2NO0A 2VSXA 5E8JA 2Q29A 2XA9A 4BAGA 4QUGA 4G5QA 2C7OA 2B3DA 2OY0A 4QPZA 5EUQB 4LOIA 4BNLA 2V5UA 3AL3A 4LF6B 4DXDA 1II8A 1HNXB 2YVKA 1VYUA 2FFBA 3CA8A 3O4VA 1SVIA 3K6JA 3GMSA 4JNCA 3MW8A 1Z22A 4DGSA 3S81A 2C82A 1ZP6A 1OWMA 5E7IA 4MA0A 2AXPA 5JNUA 2IP2A 4PLFA 3CW8X 3OPMA 3OHPA 3UUEA 4LYYA 5HRCA 4XQGA 1G66A 3RC2A 3ZVMA 3ZYZA 5KQGA 4WH0A 2R2AA 2JBAB 4L4RA 1XUOA 5LDHA 1Z6PA 3SZLA 3BICA 1ZD5A 4U7WA 3TIFA 4YUAA 3BWEA 4IH9A 1LC0A 1Q1AA 2W2KB 3LQFA 4Q48A 2ZZNA 5DBHX 2DUNA 1PR6A 3QKTA 3LQYA 2DPXA 4KXWA 4M8LA 3EOBI 2V3WA 5EJ8A 1J4AA 4R7TA 3VC7A 2DY0A 5I01A 4GD3Q 5H80A 2VP6A 3UM9A 2OAQ1 1DO8A 1ZGAA 1AN0A 1Y5LA 3B6EA 2BFDB 3BXEA 5E1OA 2EBFX 3JALA 4AICA 3WMFA 4D4HA 5B5SA 3PSHA 4LWZA 1GARA 1JQDA 1PEKE 1Z5OA 4CIAA 1JXOA 3OO1A 2YYSA 5HSGA 3H5WA 2G17A 1UBUS 4RTQA 2MJLA 2CL0X 5FWNA 1PYGA 3OEHA 4W5OA 5LQRA 2QZ9A 4ZT2A 1NW6A 2A5LA 1E9CA 1I7DA 3W1EA 1BX3A 3IMEA 3VNAA 4UFPA 3CNBA 4V2IA 3FZGA 3NI2A 1OD6A 2ZS9A 5T4EA 2UVDA 4CCSA 1RWBA 1YF3A 5J47A 4PQGA 1SIBE 5JQGA 3AQIA 2I6XA 5JXWA 3VSAA 2ACWA 3AOGA 4Q82A 3I9FA 2PWZA 3SC2B 1U7WA 1YFLA 4GYWA 1D4ZA 1XXLA 1GPAA 4EFLA 2AZXA 4BXOA 4I99A 4RF3A 1E0AA 3TL2A 3T61A 4A10A 2XODA 3F6YA 4M86A 5JE8A 4D4KA 1P3DA 4Q4HA 4Y6OA 3R9XB 1D1QA 4GZ6A 4YMWA 3CF4G 3PICA 2GYYA 3ZNOA 5TQVA 3KPUA 3KOMA 2FMIA 1WJGA 1VCMA 3DXZA 1RQNA 1IHYA 5TQ0B 1FY2A 2Y1LA 3L7OA 2ZYGA 1ZAKA 3JQFC 5AJYA 3RHTA 3SQOA 3VHXB 3HB7A 4K9SA 4ZICA 1EIZA 1ZOPA 1UXIA 1RI1A 2R8OA 2HQRA 3IKJA 5HDQA 2A4MA 1RYNA 4LHSA 1E7RA 2VT7A 3BXHA 1CFJA 4I9UA 1HNWB 2X8JB 4K7JA 4JBIA 3A04A 4ZI3A 1P7CA 1RRVA 5ER9A 4YLGA 3RYHB 1KETA 3W7VA 1IBLB 3SLKA 5KNBA 5LL6P 1LPPA 1DAPA 1NMXA 1E18A 3N8GA 1M1YE 3FGNA 2JI8A 4NAUA 3FRIA 4LZAA 4MGYR 1H4VB 5BNFA 2XB6A 2FJUA 2HJGA 5D6OA 2FWAA 1CIPA 2P6MA 3D3EA 3N3AC 2L2QA 2ZPTX 4FJ2A 5E0KB 3RRZA 4WY2A 1NUTA 3DT8A 5KS2A 3UAOA 4R8MA 1YVDA 2D5LA 3KZCA 3LO5A 3NYWA 4RGYA 1WUTA 4XVQA 1YVRA 4F5ZA 2DHDA 3ZDYB 3KB6A 1DJMA 2ORIA 5P21A 1CUVA 2WMNB 2XCIA 4JC8A 2DFLA 3ETLA 4RFVA 4XJXA 3A4MA 1CF4A 4WN3A 4ENUA 4LOKA 3AI2A 4N9QA 1OU4A 3I5UA 1RC0A 4H6WA 4C1BA 4AJ1A 4UQOA 3PCRB 1YMVA 2WF6A 3ADPA 4EOGA 5EJ4A 5FFMA 1VSBA 1E4EA 6YASA 3M1YA 4GWKA 3HY6A 2XDWA 4TL9A 4WADA 1ZVJA 3IPXA 5DHUA 3HY3A 2X0DA 3VOTA 1KMCA 3OU6A 1XP8A 4EF5A 2I54A 1T1SA 4G2TA 3OPYB 3QELB 3FTQA 3QEMA 2NOAA 3DB2A 3WKDA 5A62A 2G1PA 1EG7A 2X4GA 3IHWA 1VBMA 4C0QC 3QENA 1J5PA 1QVRA 1RRMA 3CX4A 3COWA 4F84A 3A58B 7MHTA 4BB5A 1JHMA 1LZKA 3L93A 1NAHA 2IHJA 2ZUFA 2VJLA 4MLDA 3HNRA 1RMYA 1E2LA 1OI3A 1U2EA 2HMSA 1B8UA 4FI3C 1UT5A 1SBNE 3EC2A 4A0QA 2I91A 1XDWA 1I2AA 1XD2B 4W5WA 1C8VB 3UWDA 3VYVA 3RFFA 3H05A 3O74A 5K8CA 3ZNQA 2FI1A 1CJBA 3AY3A 3QMPA 1X14A 4OK6A 1P2GA 5BNIA 3ITNA 4JB0A 1F0YA 1XRMA 3MK31 2ZRAA 1V48A 3C5WP 4HJRA 5AK4A 3SIXA 4AWBA 4XDGA 2K2WA 4DR5B 2BD0A 2N1MA 2ZIUB 1QCCA 3OLQA 3QX7A 3VPDA 1AV6A 3C3KA 4QPJC 8ABPA 4MQBA 2AX4A 2NM0A 3TG8A 1XZCA 3T9CA 1L6RA 3GMDA 1ZD4A 1HURA 4HLDA 2C1EA 4WNIA 3IEUA 2P4HX 1DMSA 3IMFA 1UEIA 1NMSA 2ZWVA 4WNAB 1I94B 1X0VA 1QF9A 4UM7A 1PWXA 1GUFA 1V1JA 2XNHA 4U7TB 5EHZA 2YQ4A 1VFPA 4ND6A 2QUZA 4C2AA 1OILA 3JD1A 2YY7A 4BIMA 2AXQA 4PYJA 1L5GB 1E3MA 2WTMA 1RPAA 4OHBA 2G28A 3C3EA 4IX9A 4MPJA 1HWYA 4RY2A 5TDHA 4IJVA 2Q4OA 2GYUA 5IXSA 1DZIA 1JDTA 1F7VA 3O8OB 5LYJB 2H59A 2IDJA 4OQQA 4ZO4A 2B99A 3EEOA 1PZNA 3VU1A 3RS2A 3VYRB 4LQDA 3KPVA 3N87A 4FMPA 4XRRA 1YJBA 1PJ8A 1OPRA 4QG3A 4D0NA 4ZAVA 3QLVC 3QJGA 1TW3A 1L4LA 4MUMA 3O2QB 3QOWA 4GYYA 1NRXA 4QOJA 4BFCA 4V0NA 2W5UA 3PEEA 1GKLA 1XFAA 1QVAA 3BE4A 3V7WA 1EK6A 3E4DA 4L73A 4C07A 3FFWA 1GTMA 1OX6A 1ESZA 1EZ1A 2R7MA 3FPFA 4OLHA 1J0BA 4ZOBA 3I30X 4C3OB 4F45A 4UEWA 5B2ZA 4ISBA 1OB5A 5F23A 1JYEA 1U2DC 1K08A 4I2VA 2YV1A 2UUPA 2AQ8A 1QG2A 4NE2A 3WI7A 3R4VA 3JQDA 4PFKA 3VTAA 5B7QA 4KMMA 2GM3A 1AHNA 5AKJA 4F2DA 1K2WA 3EPPA 1HF3A 4U7FA 1N78A 1T4GA 1G21E 1BNCA 1WCWA 2BISA 2REXB 5AI5A 2IZOA 4IV8A 5CYFA 4L3OA 1KKLA 1WABA 5CA0F 2E4VA 3FROA 4EUNA 3SLGA 1R00A 3O7WA 3ZUGA 2UYCA 4V0MA 4YACA 2DTXA 2X40A 2C97A 1LW6E 4O4LF 5CA0A 1KH1A 1KI1A 3PUXA 3NC0C 3RHSA 3FI9A 5HXAA 1DTWA 3SFZA 2XJ4A 4FONA 4MPPA 1HI9A 1U2ZA 1MX3A 3PPIA 5GONB 1YCDA 3IXMA 2P1ZA 3BK7A 3W7AA 5C1OA 2XCQA 2E49A 2IOHA 5A06A 4O3MA 3ZJTA 1ATZA 1HDIA 3NTOA 4FOSA 1Q0PA 3B8EA 3D7LA 3GFVA 4HH1A 4LJSA 4U3JA 1XVIA 4K8RB 4M99A 2HLHA 1LLFA 4WOJA 5EXTA 4D3XA 3AW9A 4IVPA 2J9ZB 1Y7TA 1NVKA 1O4WA 3V48A 3T54A 1YZLA 2XYQA 3FCUB 4S12A 3L1VA 2H0AA 3A1TA 1E2IA 3DCYA 4K6CA 3I23A 1O0SA 3KQYA 3HMQA 3WWYA 4IW3B 1PWEA 4F3CA 3HKDB 1HQCA 4E1VA 4NJMA 3NASA 1O8CA 2WT8A 3OUUA 1OLUA 2FDXA 3KJGA 2JRLA 3B1YA 5L7YA 2QL9A 1OOEA 1LBHA 3L18A 2QQ0A 4MUGA 4MP3A 1MXFA 2WUGA 1U9CA 1Y6RA 2JDIA 1P4HA 1VKZA 1LX7A 4MWZA 2AEEA 4N3GA 3ST7A 4IVNA 4RYDA 1Y6JA 7MDHA 1Z73A 3VTFA 2GDJA 4NNPA 4RGBA 3ZKWA 1T4DA 3A25A 4U8HA 1KJJA 4WY8A 5FEMA 4MUNA 2HA6A 1T8UA 1ZMBA 1HNNA 1S2MA 3JCZA 2X0KA 3HYRA 4ZD6A 4EZBA 1E8MA 1A3CA 4ZKDA 1H9AA 2HCJB 4B6GA 4D9MA 1ID8A 1Q2UA 4B71A 2ZWIA 1UT6A 2IIVA 3CLRD 5BT9A 3RTGA 1KSJA 2KJQA 2WWFA 4ZU3A 3SVZA 5KNDH 1ZIPA 3MHPA 2VHXA 1CUAA 3GQBA 3QLVA 2B9VA 4RKQA 4PG4A 1AQYA 4L9RA 2VDLB 4HGRA 5EIBC 1W85B 2ORVA 3NYRA 2G71A 3H9CA 1EAMA 4S2UA 4AZWA 1R18A 3PIRA 2WINI 4YMLA 3TRJA 2HO5A 3L0DA 1W59A 3WGMA 4IDCA 4BTEA 721PA 3HU5A 5DPMA 2H1CA 2MINB 2Z04A 2EJUA 4X24A 3S27A 1Q83A 2PJUA 3ID6C 1R6DA 4LKRA 1DIHA 3I12A 3VR3A 2YXDA 4AMYA 2XZOA 1RKXA 3OF3A 1BN6A 4DCMA 2CK3D 1GGJA 4ER7A 1JMKC 2DZDA 2O8CB 2P2LA 1QGAA 2H85A 4F4FA 3VC3A 3TAUA 5KYXB 4YCNA 2P41A 3DZ8A 5FAXA 2YJ6A 4YLYA 5I4IA 4LX0A 1JE1A 3NNNA 3GAMA 3KYBA 2CHGA 1PHPA 4PV7A 3F6SA 1V8ZA 3GLKA 4X1KA 4ZEWA 2DMRA 4D3SA 4QTXA 1VKHA 2AWOA 2CMFA 5B1DA 2GN1A 3E4CA 1GPH1 2CLHB 1QOQB 4CUJA 1SM4A 2QBYA 1NJ1A 4JS0A 2XV1A 1ZJ4A 3TZ6A 3H5RA 3WS7A 4IYRA 4QDUA 2J87A 1CHNA 1P1BA 1YOBA 2VDNB 3FMOB 3A6PC 1RU3A 5BXQC 2QGNA 1V35A 4MVJM 4BMVA 1K7CA 3RYCA 4XTRA 1I3MA 3HDVA 4OLFA 4KN5A 3T7TA 3BMNB 2WYHA 4WESB 3CIOA 1JHXA 4EB8A 4NZOA 3LZCA 3ZH2A 4PNHA 3I5MA 3A26A 3I42A 2XITA 2XA1A 4IUYA 4UFNA 4DYHA 3L5OA 3N2ZB 1QIIA 1T5HX 2VHJA 1YR2A 3QEJA 1P9OA 4OLJA 3UCXA 1H3NA 1REQA 1LC3A 3PQ2A 1JKMA 4CQLA 5IT5A 1M1XB 1R1DA 3D3QA 4HWRA 3SSMA 4NPHA 1L7RA 2UYGA 4BQPA 3AI3A 1E6CA 2AW3A 1DAMA 2QN9A 4UUBA 1RIIA 3T4PA 1GA6A 2OFFA 1WSDA 4YRCA 3URMA 5LIPA 4RADA 1NSTA 4ZHQA 1ZESA 2V4UA 4KMSA 1RC1A 4UD2A 1HLGA 3QOFA 5HIJA 4R8RA 1T4MA 3EQ2A 1DKMA 1PT7A 1QE5A 1XWWA 3EXG2 4Q9NA 1KVRA 2YIJA 4HLCA 4TM7A 3PJFA 1E4VA 2EHDA 3T5TA 3LQKA 2PFGA 1RXVA 1PTKA 1ISRA 2BM1A 3OCCA 1AG9A 1MNQA 3DVQX 3O9VA 3QNWA 4JI5B 1W88B 1KYXA 5BWBA 5L95A 5LOVB 2VKQA 2WAOA 2AIRA 1DKQA 2VFAA 4DWJA 2YYAA 1EGVB 2XMDA 1WE2A 3JW8A 2PSHA 3STYA 1WAMA 2C2HA 3I83A 4LE2A 4DQUA 3U7HB 5A5VA 5JVDB 3JVVA 5IPFA 4MIOA 2WIJA 3USZA 4ESEA 1D9ZA 2JEOA 3EH2A 5AO9A 5KOHB 3QG1A 2WC1A 4RELA 5GJCA 1RKBA 3SEQA 1SIOA 3HGTA 4XYLA 3DTTA 4MTLA 1S2GA 3VNBA 4BB0A 2G63A 3KR1A 4QU8A 5CHYA 3U4HA 2J3LA 2O3QA 3CYFA 3KXDA 1ECCA 1NC1A 1Y8QB 4JVNA 4MS1A 2WMDA 5AM1A 1WDWB 1BQEA 2XT9A 3CBQA 5AJWA 1L5VA 4D4GA 2YIVX 4MICA 5FUMA 3WGIA 4EW1A 2D8MA 4EO9A 5JDCA 3Q12A 1ZRHA 1JHOA 3OKPA 3RTCA 4DANA 3DYIA 5H4GA 1NA5A 1U0OC 4WZBA 3TGWA 1XZGA 2JHCA 1QO0A 2J0VA 2UVPB 2TMDA 4YREA 4C78A 5IHXA 1C3OA 1P7YA 3KLPX 3DT9A 1SOUA 2QYHA 4DXHA 5AQEA 1SXQA 1KSFX 5CNJA 4PZ9A 5D2CA 1X8KA 4AZ0B 4RENA 4XCXA 1G7RA 1FFHA 3OZ7A 4PCVA 4Z1OA 2WTUA 5DK6A 1FSSA 1QV9A 1OXMA 4J0EA 2Q3CA 4GWLA 2C1ZA 4H7DA 3UBMA 3L4EA 3ZIDA 4ZQIA 4BP1A 5IF9A 2I33A 3G5UA 2IYFA 4WI1A 2NSLA 1WUJS 3A9VA 1IVNA 2ZSIA 3SBDA 2O2HA 5EPEA 2XZPA 4GRDA 4FR2A 4IOMA 4YCAA 3VPHA 4C08A 2DQZA 4GKBA 4ENRA 2CB9A 4EG0A 2M1ZA 2QQEA 2RG1A 3AVQA 4QU5A 2V1UA 1A8UA 1MFPA 2JFWA 5KOIA 1G5PA 1ZINA 5I9LA 5ER6A 1YQXA 4CV0A 4D9IA 1EVZA 3LT0A 1RRGA 3HA2A 2C5GA 4RJIA 3H2ZA 1ZFNA 5M04A 3TLJA 5BR4A 1XAJA 1R6XA 1PT5A 2RFLA 3DDUA 1THZA 2FETA 2VJMB 3I6MA 4PPQA 8AT1A 1IY9A 4MKXA 1P5JA 2XQJA 1RTKA 5EHIA 2B0CA 3EQZA 3T8YA 4ANFA 4D99A 3Q98A 3VH2A 3ZWQA 1FW6A 3EXHC 3FPGA 1N2JA 3C8MA 1SUDA 1WXXA 1JVBA 2AG1A 2HN9A 3A6JA 3VR6A 4A0GA 5K20A 3FI0A 5AUQA 3S6JA 1QC5B 1TPZA 4UBOA 3GYBA 3KQTA 3TOSA 3BKWA 4BKPA 2BAGA 2XVMA 1E0KA 1VZ3A 3BK1A 3SX0A 4COKA 2FAXA 3DOJA 4PPYA 4LJLA 2L17A 1RP1A 1SBYA 3UUFA 4D4LA 4PPNA 3BEDA 2XAUA 4RCYA 3PFCA 2Q5CA 4P82A 5ALLA 3LHSA 3DC2A 2D2FA 4IR7A 3G2PA 5D1NA 1RDFA 2CHFA 2W6QA 1E1LA 3A11A 3G9XA 3TSAA 1EXDA 1OI4A 3RC9A 3I32A 4MIKA 4RSMA 2A0KA 4QEZA 3IAM6 2FDCA 3ANTA 1I51A 3FBGA 3H0CA 1TEXA 4P35A 1IAQA 4TL7A 3WMRA 4DNOA 4HWSA 3IBSA 4X1KB 1KRHA 4QDZA 3VNRA 4DSTA 5B58C 3AM1A 3TR0A 3GCXA 4I8DA 4LF7B 4QAJA 2A67A 3SF8B 3TVDA 4IIJB 5ARCA 4QWMA 2CCKA 4HNAB 4PC3A 4DA8A 1ZG3A 2OCDA 2Q6OA