1P3Y1

Mrsd from bacillus sp. hil-y85/54728
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
183
structure length
171
Chain Sequence
ISILKDKKLLIGICGSISSVGISSYLLYFKSFFKEIRVVMTKTAEDLIPAHTVSYFCDHVYSEHGENGKRHSHVEIGRWADIYCIIPATANILGQTANGVAMNLVATTVLAHPHNTIFFPNMNDLMWNKTVVSRNIEQLRKDGHIVIEPVEIMRGLITPDKALLAIEKGFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MrsD protein
publication title Structure of MrsD, an FAD-binding protein of the HFCD family.
pubmed doi rcsb
source organism Bacillus sp.
molecule tags Oxidoreductase
total genus 52
structure length 171
sequence length 183
ec nomenclature
pdb deposition date 2003-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF02441 Flavoprotein Flavoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1950 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Flavin prenyltransferase-like 1p3y100
4ZANA 4ZALA 1P3Y1 4MWGA 3QJGA 1MVLA 1E20A 4ZAXA 4ZAGA 4RHFA 4ZAVA 4ZAWA 4ZAYA 4ZAFA 1SBZA 4RHEA 1G5QA 1MVNA 4ZAZA 1QZUA 3ZQUA 1G63A 3MCUA 2EJBA 3WISA 3LQKA
chains in the Genus database with same CATH superfamily
4QG7A 4JQYA 3IS3A 4RC9A 5HTKA 2ONZA 1Y5NA 3OESA 2HEGA 1C1HA 4DUYB 3QSYA 5JOQA 3C6KA 1HNZB 3IJRA 2VYQA 5AW4A 5DDIP 4PF1A 1JQLB 4Y18A 3HXOA 3GD7A 1NY5A 2XADA 5AJTA 1EM8A 4IIJA 1F4LA 4GKAA 1V2HE 1Z7YA 2P35A 5D3MB 3VPGA 2J5BA 4DMUB 4RKEA 4GW3A 2K87A 5BOSA 4MQEB 3ERCA 3FGZA 2CLEB 3RBXA 3NU1A 3UMVA 3IRUA 1J49A 1O87A 3ESBA 4OHCA 3DMRA 2GNPA 3BFKA 4CMCA 1Z82A 4U7FA 2VEDA 3C5CA 1YDMA 1BN6A 3ZU5A 3HP7A 3NEYA 4BMVA 4JMPA 1A5ZA 4XQGA 3WL7A 1L7XA 4XWTA 3SJAA 1EVLA 1HTBA 2ZAIA 2BFDA 4EW6A 3EZ9A 1G5TA 1E7SA 3EYWA 4J7CA 1EWTA 2ACKA 5JC1A 4KXLA 2F7SA 4M86A 3BMOA 4GGOA 3UHPA 2FJUA 2Y76A 4G1EB 2GJAA 3R7FA 2O8EA 4ZQCB 1ZCJA 1BJKA 2ZTLA 3GFGA 4DXAA 4E5YA 3AONB 1QRAA 4MQLA 3AF6A 4MIKA 1YMQA 1ZI8A 4KACA 4AJLA 1NBWB 2YMMA 1YQTA 2VXBA 1CF4A 4HKTA 2FNAA 1J56A 4OI0A 4TLBA 2MYPA 2DWUA 1JEQB 1D4FA 2HSGA 2R68A 4QHSA 4WY5A 2DH5A 2Y1CA 3RU2A 3UFBA 4EVSA 5KYXA 3S7ZA 1RMTA 2X8JA 2GAFA 4Q3OA 2E89A 3IOMA 3FHTA 1RHRA 3NALA 4U2BA 2ANBA 2XWBF 4TYMA 4E21A 1WXQA 2BCJQ 1G8YA 3C3KA 3LLVA 4L6IA 4HDRB 3FBGA 2OAQ1 4P2BA 4Q18A 4RF5A 4YJ3F 3JWEA 4ZOBA 2HNBA 3SX0A 4II2A 3ZWOA 5I45A 1L9XA 5AM0A 4NJOA 4UHCA 2I2DA 1XMVA 3DAGA 3GAZA 5AJHA 4HLCA 4YPOA 1EXVA 2PD6A 3H1PA 2GASA 1KEEB 1DL5A 1TU4A 2XOKA 5IP5A 1NUSA 4QUJA 5FLYA 1D2NA 1FLDA 3AR2A 1XROA 4D41A 4GC5A 3KOOA 1GTG1 4LIPD 3VR6H 2ZDGA 3FX2A 3QI7A 2AI3A 4I81A 4KK3A 4TLLB 1S4QA 1UKVY 3T5DA 1OC4A 1RWMA 3OQJA 3VDNB 3O8CA 1RHUA 2VUHB 1FFXA 1DQYA 1EFVB 5KJEA 1W4ZA 3NM6B 5TARA 3GEEA 4JT4A 2BFMA 3BYZA 4JLDA 4OXYA 4UREA 3RSOA 1DTSA 1N33B 2IU0A 4NCJA 1IMOA 1QGOA 5A0VA 2VT2A 2H5JA 3SHTA 3NHKA 3T7AA 4BLWA 2M9MA 5JLJA 3RADC 2P9ZA 4TV9A 1WZ2A 2GRAA 3T54A 1RXUA 3I5MA 4LNHA 1E5QA 1RLIA 2IS4A 2XQIA 4GU5A 4LVNA 2W2MA 2DKNA 4ZTBA 3SBEA 1W9HA 3AF4A 1C9JA 3Q6IA 5D3MA 1COWD 3C85A 1NJGA 3PPVA 1PVOA 4MQEA 2FQYA 2QJRA 4LY0A 3B9BA 5ALRA 1ZCFA 4J90A 4ND6A 1LRJA 3EGDB 4RDCA 3D8SA 1SBTA 1DZIA 1VRCA 3N07A 3AUSA 4X7PA 1DO2A 3ZGOA 1K92A 3MMPA 3V3TA 1WV0A 4ZVNA 3MW8A 1N8KA 1XCJA 4ZCPA 3ROTA 1NW9B 3NKLA 1FPMA 1UPTA 5GQSA 4AQDA 4B45A 2OOSA 1SCAA 3G5AA 3IPAA 1YS2X 3WJ2A 4D43A 1QORA 2NT4A 1IOVA 4QXPA 5J5AA 2OHHA 3S7TA 1JQBA 1WVIA 4NYMQ 4Y1GA 4DR4B 4TZ0A 2J9ZB 4P84A 5AMXA 3CTMA 4CODB 4M9SA 2XODA 3O4IA 1PL8A 3EAFA 3NAQA 1CLEA 2HX1A 2DLNA 5I7AA 1IOLA 1Z35A 3RQSA 3WDKA 1TECE 5L3SB 1QIJA 1NXSA 1UT5A 1VI6A 1U2DA 2V96A 1JJAA 1RVDA 3QW4B 4JLWA 5DK6A 4ZRDA 1U2DC 2JAPA 3AI3A 1E2LA 3MT0A 1TMOA 4ARIA 4ZDKA 2XNDA 1JEQA 4MKXA 5KTRA 4YUXA 2CT8A 3KD3A 5G53C 2FWMX 3P9CA 2PKEA 2EJTA 3DL7A 3E7FA 5AKYA 4QO7A 3ODGA 5SICE 1ZM3A 3PQ6A 4G5OA 5KOHA 4YUWA 1NN3A 4YRCA 2QW0X 3WV5A 5C1PA 1ZY2A 2J3IA 1U04A 3E0QA 4MO9A 5EIFA 1KDOA 5FXMA 3GHYA 2YVAA 2GHQA 2F4VB 5ANRB 1Z6XA 3I30X 2B7LA 4Q82A 4EG5A 4IFBA 3VH3A 3E8SA 1N2BA 4KDEA 4RY0A 4NZZA 3SU8A 3UATA 4DMCA 5KYUB 1KE2A 3MERA 1D6NA 3QF7A 4TRRA 2PSDA 2Z3ZA 2ZULA 3GT7A 4KQ9A 4TL6A 1P7CA 5EHNA 2AXQA 1F5NA 4JGGA 4X5OA 5JCJA 2XGJA 1V37A 1EFLA 2FZLA 3B1KA 4PHGA 1JAZA 5ITWA 1N2ZA 1Z39A 2QM8A 3RYFB 5CGQB 4JXJA 1C1YA 5D2CA 1YB4A 4M87A 4ZVSA 5BN5B 5U4QA 1GLNA 1T0PA 2I4NA 2IPNA 3VPXA 2CVOA 4ALNA 4P0PB 3O21A 3T3NA 5JNSA 4M1TA 5LZ8A 1S01A 1B8UA 4AN4A 4R2JA 1DGQA 1SCBA 4D45A 4BC1A 5JI2E 4OQ4A 1KI4A 1Z63A 5JCPA 1D2HA 2FPLA 5B2ZA 1QIDA 2BBTA 2I3ZA 3A1DA 4BNYA 4BWFB 4BX3A 4Q4LA 5FNVA 2NZVG 3A6FA 2VPZA 1Y3FE 3ROGA 1POWA 3AUTA 2FEMA 3Q5GA 2V5AA 4X45A 5AKJA 4M6WB 4D02A 1WHTB 3ONEA 3PWKA 5IF9A 5I4IA 1YRLA 4YHHB 2V5VA 5JAPA 1NR5A 2X0FA 3G0HA 4V0OA 4WH0A 4FGUA 4DDVA 3LX4A 5LD2B 4GVXA 1NVAA 1PCXA 1VRVA 1WU8A 1ZJ4A 2GZ1A 2QRJA 2QLMA 1XE3A 3BL6A 3KB6A 4HGPA 5KNDD 1Y34E 1JBEA 2CEAA 3DEHA 5KHOC 4RJ2A 5ADHA 1W5BA 2E2WA 2FVXA 4LJ7A 1QH9A 2UZ1B 5FB3A 4BFUA 3Q9NA 4M1ZA 1JU3A 3PXAA 3ZK7A 1VLLA 5JDIA 1H93A 1KA9H 4KI7A 2FMTA 2BM0A 5JDIC 5B37A 3HY3A 4URWR 4K6FA 4TKZA 2AC4A 4ZO8A 5I9NA 1PR2A 2PL5A 3D7MA 4WY2A 1UKBA 4F84A 2O4CA 1NUHA 5LA6F 1PYDA 4PLHA 4AJPA 4TTTS 3SS9X 4YHBA 3AR6A 3UPDA 3FSGD 3A58B 3CVXA 1XOIA 5L3SA 3H5TA 3OFNA 4JBIA 1G55A 2ZKIA 3GVXA 3TXXA 4EYGA 1YR9A 2IY8A 2HI0A 1EINA 2X6TA 3A1NA 4GH5A 2NVWA 1LBIA 2WWWA 2ZWAA 3CV3A 5CLIA 5J4KA 1XTSA 1PJQA 4UASA 4PCUA 2NX2A 5CB4F 1NVEA 2O7RA 3LCUA 4IMRA 1DEOA 5LNK1 4UTXA 1VXRA 1BH6A 2B8WA 1K06A 2L82A 1UAGA 3MGGA 3T4EA 3UWMA 3VDMA 1K98A 1XZ8A 1A5AB 2GYUA 2NAFA 4NZ9A 4ZQHA 4AURA 2J3QA 3ZHZA 4LDRA 2VR1A 1VSVA 1ZN2A 3SBXA 4LF9B 4DIOA 3IP1A 4FWBA 1FMJA 1L6IA 1N1MA 3TI7A 1AGXA 2BM8A 4E5DA 1P0CA 2QTWB 3SF0A 2YHSA 3E4CA 4U7DA 3UNXA 1H2EA 1QGZA 1W6RA 4HDSB 5C2JB 1E2GA 3RYCB 4ZAZA 4AMVA 4KLAA 1CKEA 2DQSA 2FEAA 2X0IA 2WIDA 1NHWA 1R18A 2Z4RA 3F71A 3UF0A 1EJ0A 5HSGA 2J0SA 1XA3A 3MC1A 3EFOB 3LWDA 4RZSA 4TWJA 1M34E 2AJBA 3QYAA 4F3TA 4FTWA 3BWXA 3RYFA 3PPYA 4EJFA 3L7LA 2JI6A 2G6BA 4U6QA 2IW3A 5AD1A 1EQUA 3L8EA 3JR7A 4ETNA 1BVHA 3QVGB 1GZSA 4KJZA 1WOYA 1U11A 1XTKA 1E3LA 1IBSA 1P45A 4JUIA 3PHIA 4F3KA 5JJCA 2NSYA 4Z2AA 4J0CA 5EZ6B 1U2ZA 1AZWA 1ECBA 5DP2A 3DXFA 4MHSA 5AWFC 4DQVA 4KQWA 2AVNA 2DPMA 1X7DA 2Q0QA 3GJ4A 3OQ6A 2EERA 4V0MA 3H4TA 3I0MA 1P61B 3OPYB 4M6WA 1NL3A 4AMUA 3OD1A 2B8JA 1BVUA 3DE0X 4AUNA 5HKAA 4HLNA 4DV3B 1IY8A 3TKLA 1U9YA 3H75A 2V5UA 4DA4A 3KKNA 3P4XA 3HDGA 3I8OA 4K9NA 2XTNA 1H2FA 3GRZA 2Y0BA 3PX3A 3QUAA 4UJ3A 4L85A 3EXHB 4L0MA 5LD2C 3DNPA 5CDFE 1TJ5A 1ZD8A 3OO0A 5CTJA 3OMWA 2ZM5A 3A1FA 1H69A 2VDWB 2HH9A 1Y6ZA 1ETUA 1NAIA 3CT6A 2HHAA 3PQDA 3QITA 3M6MD 4L8YA 4FKMA 1DU4A 4XFKA 5BSGA 2UZ1A 1A9ZA 3FVQA 4NFYA 5ESWA 1CEXA 4W6ZA 2GJ4A 4R81A 3C5HA 2X2FA 1GN8A 3AFNA 2RGEA 4C2BA 1KDPA 3MTGA 3IQGX 4NIMA 4TKUB 4BTEA 3H3FA 3PEUA 2GPAA 2QYTA 2YH2A 1ZIXA 4JODA 5LU8A 1CQPA 2AWOA 2GS9A 3Q6NA 4PS1A 1XNHA 1FEZA 2F67A 3WWPA 2C5SA 2JGEA 2PLRA 3CRVA 2IBTA 2QN3A 1H85A 3RFCA 2I3GA 2V65A 2QAGA 4PO3X 1E9AA 1KI8A 5EKSA 1NQVA 2QAGC 1KEWA 4HWSA 2VF2A 5EZSA 3R3VA 4A8PA 4F9EA 1KI3A 3VJRA 1HYHA 2O05A 2PUJA 4L8GA 4UBLA 5A0TA 1U90A 1VSQA 2KM1A 4KOAA 4OSEA 8LDHA 3N7AA 3CUUA 1G4AE 1YZ3A 4OJTA 3RFXA 1PEKE 4C1BA 1NVWQ 4HVTA 4XR4A 4MCIA 4MRNA 4DR6B 1RP7A 2DX7A 2JEOA 3TLCA 3TR5A 4B8WA 1CRWG 3Q10A 3I5XA 2YTZA 2OEPA 1KJWA 1JHQA 2H2IA 3IIJA 3L4EA 1QXSA 1Z6AA 4DJEC 5HILA 4C0KA 1X9IA 721PA 5LA6B 4MAFA 3R6WA 4B3CA 4NBWA 3RJ5A 5BV2P 4GT1A 2WJHA 1VL1A 3H5LA 3VI4B 3ZGZA 3GMDA 4P32A 3U7QB 3ZE8A 2FUNB 4PG4A 4FJ1A 4O1MA 4UFNA 3RRZA 3KXIA 2J31A 3CR8A 2C96A 2HIGA 2BIFA 2PKWA 4E5MA 3EFOA 3FYTA 3IBYA 1N5JA 5HA5A 4JXZA 1W47A 2NLOA 4HXYA 1KFJB 5AK0A 5A7HA 5CB4B 1P2GA 3HYNA 3OIWA 3ICPA 2R6DA 2ID7A 1E4EB 2CXUA 3CW2A 3HVJA 4KBGA 3VM6A 4PGHA 4RWEA 3QVGA 4UUBA 4NYIQ 4ZOAA 5TR9A 4DA0A 5CJJA 2X22A 4GVPA 1K5DA 5DBHX 5IYZF 3B6ZA 1DXQA 3B85A 1NA5A 1K66A 3BTVA 2PRJA 2PAAA 1L8XA 3ETHA 3KBBA 3MGCA 2D2FA 4YRFA 3WNZA 3PX7A 1J5XA 4TTIA 2BKUA 3PCXA 4EI9A 3GLSA 5KHAA 4V2IA 1LDNA 2RGCA 2ATVA 4HB0A 2BGIA 1AXEA 1ZA1A 3QMWA 3MYYA 2IU3A 1PUIA 2FRDA 3KJNA 2I4LA 2FRDC 3O95A 4JIMA 4JB8A 1NYRA 1UH5A 2JLUA 2ANCA 1MX5A 4FGZA 4TM8A 4GMXA 4YMVA 1N5RA 1XTZA 5COBA 1G5PA 2WJIA 4BKRA 1IEXA 2GXSA 3WLAA 2HIAA 3QNMA 4MQ5A 2ID8A 2OV1A 2XCQA 1IQRA 2PZBA 3B9QA 2JAQA 1VBNA 3QE2A 1B14A 1C1XB 1J39A 1EX6A 1G9XA 4I4TB 4PO9A 3VH1A 4PANA 3ZEAA 1DXOA 4BQRA 3FA2A 5JYDA 3IXQA 4F04A 2CE7A 1MO3A 1VECA 1G6OA 3D43A 1XXHE 2VHEA 2MINA 4PGFA 2XW6A 4PE5B 3U4HA 4LDPA 2YN0A 1U4SA 4I8XA 1ZXLA 2YC4C 3CS3A 3OU6A 4G8JA 3EJWA 3SQLA 1JKFA 4BS9A 4YRBA 3SS7X 1VOTA 2EWVA 1O03A 2PTHA 2FZEA 2CNLA 4JVSB 2OCIA 5LYJF 3C98A 4YRAA 1L8AA 1JSXA 1EEXB 2JFFA 5BWCA 2Y0DA 3CZPA 3D8UA 4BRWA 1ARZA 1N7GA 4QU9A 3JWGA 5KQPA 2P6UA 3ZZNA 2CVPA 2QN1A 3DMDA 3VO9A 4K6HA 4BWYA 4NZOA 4L9SA 1Z5VA 1KMCA 5DYWA 1ADGA 3JSAA 2FPOA 2H63A 3LAWA 3SQOA 1QO7A 1WMFA 1XPOA 1V3QE 3PUXA 3A4TA 2ACEA 5C3UA 3U31A 4TS4A 5LA6A 3DQQA 4JX9A 5F5LA 2Q1WA 5L7YA 4CUKA 2Q4DA 2C78A 3J81k 1Q44A 2HB6A 1IWPB 3U7QA 4B75A 4JC8A 3EA4A 1KARA 2Z1NA 1Y98A 2E21A 3FFAA 3TSAA 3NHMA 1ZEMA 4C04A 3Q3HA 3ZEIA 3IQIX 4FR2A 3ROMA 1SQ0A 2VYFA 4F12A 2Q46A 4M1OA 1HNNA 2X15A 3K8QA 5LNK6 3WL5A 1SZPA 3NTVA 1UKCA 1BOFA 4H4EA 1VJCA 2D54A 4KSYA 4PC1A 2R5NA 3LHSA 1E4EA 3R9XB 4KFCA 4I5IA 5KWVA 1ACJA 2QRQA 2QUIA 3OFJA 4UXIA 1NC1A 3EXG2 3VVMA 3EEOA 3KC2A 3KT8A 3ENNA 4X8LA 3RD5A 1EXWA 2IPOA 2ZJOA 1OJ7A 1F14A 1W8DA 2A0WA 4IV5A 2BEJA 2GA9A 4FOLA 4HRAA 1AKYA 4ZU3A 1Z26A 5DFAA 3R74A 4COKA 2BDTA 4IHJF 4PQGA 1UMKA 4YXWA 1HR0B 4D9HA 3GG9A 2J5QA 1FYEA 4QREA 4ZDWA 1V8OA 3NHLA 3B5IA 5CCBA 4HSEA 4KUHA 3K0KA 5CX1B 4OHKA 4A6XA 5KKCA 5AVYA 3R4VA 2JD0A 4EGSA 5TQ0A 1WLSA 2Y0CA 3I37X 4GLFA 4L0QA 2AIRA 3NKFA 4HDKB 4G36A 3K05A 4MNTA 4PTLA 3WAJA 2P9FA 1VKZA 1R8JA 4RWZA 1PLJA 2DLDA 3U3OA 1LF5A 3CUSA 3HDVA 3T9DA 3DGEC 2A88A 2R8XA 4Z9BA 1OD6A 4G63A 4I4TA 4DZZA 1XD9A 1ESZA 3RIGA 3IVMA 3COVA 2D1RA 2QQFA 1XJ5A 5IYZB 2ZRJA 1NZFA 3ZIAD 2ZYRA 1AY0A 3OMLA 3PICA 1M7HA 3KB8A 3RRXA 3T3PB 1KZYC 3OJCA 4CMJA 3UAZA 3EZ2A 2VTBB 3C1OA 3IUBA 1JLMA 3S81A 3S40A 4WNIA 4JLPA 4E4TA 6REQA 7ABPA 1BTOA 1R9NA 5ED0A 1B6SA 3RKSA 4FX2A 2OYCA 2ZR7A 4AVYA 4WKBA 3QPDA 4PXYA 3NDBB 2O7VA 1RLUA 3IP6A 1FC0A 2IIVA 3MILA 4WFJA 3U61B 1REQA 1XHLA 3KJEA 5DLPA 2PEZA 2VYNA 2ONCA 3CRQA 4YTEA 1N1GA 1LLQA 4GQBA 3ASZA 4GYJA 4BP1A 2WKWA 2CNDA 1KYQA 2GJKA 3GA5A 1VPLA 1O4VA 2XCIA 4YALA 4KL8S 3OF3A 3OLZA 3EISA 5AUOB 4KBFA 3KLNA 4UNSA 2Y2VA 1FE8A 5K8VA 2J5XA 4NBRA 1NUPA 2EZTA 3RSCA 4TV8F 2A0FA 2D8AA 2V7XA 1SUPA 2P8SA 2O2DA 1ABEA 2P4HX 3OX2A 5ALNA 2X6QA 2VRNA 5JHHB 4RVOA 3KYDA 4JUCA 1YR7A 3X1KA 4J7UA 4CEHB 4DAOA 2O6LA 4FK8A 1SOWA 4L4XA 1W36B 4EBBA 4DUGD 4PYLA 5J58A 1DKNA 1O6ZA 2J8ZA 4FOPA 3MWGA 1N2EA 3N05A 4M1WA 4XVRA 4YV2A 2Z2XA 3DZCA 1JW9B 5KYTA 5LYJB 5HTOA 4H7DA 3WBKA 3NG1A 3WNQA 1KO1A 1ZGJA 2Y9PB 3BILA 2C2MA 1CP3A 2IYOA 4MYRA 5IJZA 3T6KA 2N3ZA 3BRWD 3CONA 1JHDA 2ATCA 4N65A 1YFJA 1CZHA 4G8CA 2IWHA 3R9XA 3BJIC 3RI3A 2Y27A 2MYTA 1Z6YA 3JVUA 4LHEA 3GDWA 1I3KA 4ERXA 5IKPA 4K87A 4NS4A 1U5BA 4IW3B 2AG6A 1PZXA 1O89A 3FKSA 3KUDA 3PQEA 3S2UA 5LVAA 1VHWA 2QD3A 5TQVA 2B4TO 2PR7A 2Q1UA 2HHCA 3FN4A 4S1WA 4XD7A 3OZFA 4HDNA 5ESXA 3T7EA 4EITA 1MMFB 1OZHA 3LK7A 4ZVQA 2P6PA 4MA5A 1AE1A 5CX1A 5I7RA 2MSNA 1ZVJA 2OCYC 5ALJA 3OG9A 5ALDA 3PGA1 3EDQA 4R83A 1GTL1 1Y4ZA 1VL8A 4HDKA 3I04A 5LZ4A 2AJDA 2MYUA 1DC8A 4RLSA 2BUCA 2OA0A 2OM2A 2Q7XA 3TL3A 2GN1A 3DKPA 3K92A 5E9QA 2X86A 3A26A 2F1KA 2WHXA 1DKQA 2O2EA 3ELYA 3GZNB 3ITEA 1JG3A 4U1RA 3TOXA 4JKOA 5J4LA 4P3YA 1WBBA 3U4DA 2WKPA 2IS6A 3FD8A 1RWOA 2NWQA 2BLNA 5KAMA 5E38A 4KPUB 3WNDA 1LLFA 1G3MA 5IYZA 1IDN1 4CIYA 1Z6GA 2AE1A 4HLUA 1OTXA 4KWTA 2E55A 2H7YA 4KYUA 4PQEA 2F64A 1Q50A 4HLUC 3ZJYA 1S02A 2QZJA 3U4MA 1VFNA 4KREA 3FWKA 4IHJB 4PYOA 4RY2A 421PA 4MULA 1TZCA 2XOXA 3AZQA 4FDLA 4GO1A 1OIXA 1U2SA 1U4OA 3ITKA 1YASA 4R0VA 1A7UA 4Y2JA 5AH0A 3ZWWA 4BP9A 1M0SA 3N28A 4UEKA 3RLFA 4R1OA 3ZDYB 2H4JA 3L7JA 3ORHA 2XAUA 3I32A 1G8KA 5D87A 1QAMA 4B3MB 3VH4A 4KVZA 1T5BA 1Z4JA 2YWGA 3DBVO 3QXXA 3L40A 5INTA 2RH9B 3V5NA 4IIDA 4DA6A 4E5SA 2E87A 1Z5OA 1Z74A 1RPAA 2C57A 5JS8A 1H1LA 3OIGA 3GFOA 1V6AA 4C6SA 1IFXA 4Y9UA 1IY2A 1LNSA 2UXCB 5H7XA 3PITA 4RCVA 1PR6A 2ZI7A 1X77A 3ZOZA 3OE1A 4Z7JA 1T8PA 4IIHA 3SZUA 2PMBA 3AVOA 2NZWA 2A67A 3N9IA 1NNSA 4BLSA 1C1DB 2Z2YA 5FWYA 1W581 1M2HA 1OLUA 4PINA 2IEIA 1X8LA 4QOIA 3ZDCA 5FA8A 3TTWA 2AMYA 4BNNA 5LIPA 5G4KB 3TMKA 3UXHA 4COOA 1L4MA 2WDPA 2GEDA 3BFXA 4JJEA 4D9JA 1FJGB 4XCQA 3HEAA 4P36A 2O7QA 1B1AA 2ZYHA 3RVRA 4OAQA 5HIMA 1W36C 1SK9A 5FUVA 3GJYA 1N1EA 2P68A 2QRZA 1VIYA 3WOHA 1JTEA 2OV4A 5K01A 4DV4B 2P6OA 2WF5A 1ZH2A 1FFGA 1VE6A 3BWEA 1NOIA 1J2JA 4HBGA 4W1RA 4Z99A 1YZVA 5DULA 4TZ6A 4IDCA 3O94A 3TZBA 2BEVB 2Q3DA 3JWPA 4MW6A 2FG7C 5EEGA 2CD9A 3H2JA 1Q7RA 4C6TB 5FDFA 5KQLA 5BQ3A 5MN4A 1KJQA 5ECGC 2KB0A 1WZIA 4ZAVA 3FFWA 5BNWA 4GR4A 4AP9A 2M98A 2QLNA 2JVIA 3CLSD 4ON9A 3GT0A 4RQTA 1Z56C 2QZ4A 4KXXA 5FIUA 3MN1A 4TV8B 2WF7A 4R05A 5EIHA 1FP7A 2BFWA 3CEPB 5BSHA 1XU4A 4LJ9A 4CF7A 1E2KA 4MKZA 1VRWA 2PT5A 1P5JA 1Z0IA 1R4MB 2G25A 4HYEA 4IPTA 1FSFA 1NVFA 3RVSA 3KQLA 2H48A 4TUYF 4HTFB 3L7BA 2H07A 5LUAA 1XL1A 4W5QA 1RXWA 2B4YA 3NXKA 3QK7A 5G1PA 7REQB 5HS4A 3OPNA 3V8PA 3PJEA 4F1JA 1ZXXA 3L1HA 3GLIA 4Y6OA 1QFZA 2VTEA 3IESA 1V4NA 2VP9A 4YJHA 3HCWA 5CM9C 5EXEA 1BXGA 4LV8B 4P38A 4Z4HA 4ZU6X 1RD4A 3V4ZA 2EFYA 4R9UC 3GD5A 4NOJA 3PI7A 4URXR 1MNQA 3BIOA 2P78A 1SZDA 2HLDA 2YMLA 5KC8A 5COQA 4TT3D 3I73A 5KJ1A 3QVOA 1QS0B 3COPA 1WUHS 3ABQB 3QIVA 4IHJA 4P6VF 5HGJA 4Q66C 2MMGA 4ROSA 4TVKA 1WNFA 2PUDA 3L5KA 3EGOA 8MHTA 2P6NA 3A4MA 1Z8FA 5ALVA 3IULA 2EZUA 2GZHA 1A88A 2A59A 4IDAA 4ALKA 2IOQA 4ZJZA 3JQAD 4X41A 4UU0A 4BNHA 4B3IA 4MJLA 4POOA 4EGFA 3AP3A 2DEUA 1ZM7A 1GZVA 4YQFA 2RD2A 4W8GA 4E15A 3QXCA 4LPKA 1PZMA 2D7CA 3D8NA 4IGAA 2R7MA 5LJIA 3GLHB 1EFRA 3D8HA 2CN1A 2P7IA 3H9UA 3VR4D 2RHBA 2SKEA 4ZP1A 4ZCIA 4JFRA 3NLLA 1N57A 1C1DA 4OHXA 1CY4A 2XKKA 5JE8A 3MJRA 4W6QA 2FW1A 4X9XA 5G4KA 2GR9A 1YZFA 3D2BA 3ZD8A 1FPQA 1PGNA 2DKFA 3TNJA 1EUQA 2O54A 4BVHA 5JTUA 3WOVA 1PHRA 1OYYA 1ZI6A 4OP2A 1VJRA 4RA9A 4M0EA 4CIVA 4KR0A 2OXFA 4LOAA 3OJFA 2IKSA 2JS7A 5GADl 4NCAA 1B43A 2FLVA 4WFKA 4AZ3B 4RTKA 1OI2A 2FWBA 3RIXA 1CNMA 4NYJR 2BEVA 5CLLA 1N2CA 1CY6A 5L95A 2QPAA 5JZ9A 4JUFA 2JHGA 1X14A 3L79A 3L7IA 1DCTA 4DA9A 4GMHA 5I9IA 1HSZA 3R6LA 2GXQA 3L9XA 4KDCA 5LBIA 5CFNA 4CFZA 5A3RA 2YQ5A 5JQGF 3I61A 3IT2A 3LT2A 4DCCA 3V8RA 2Q3LA 1FRQA 1NFRA 2WMOB 3IL2A 4H6XA 1XNQB 4JU8A 1BXZA 1R4MA 3FOFC 5TPZD 3KYIB 1EB8A 1WW3A 2DWOA 3PUHA 2I1LA 1DMRA 1EJ2A 2JI4A 1ATIA 4HTFA 4DCMA 1J21A 3E82A 4O5OA 4K9QA 1CEQA 2XA1A 2EL9A 5HIAA 2CNWA 1I01A 3GNSA 3TTUA 7REQA 3A3YA 3RM3A 1NQUA 1XEXA 5KSZA 3C5VA 3F8TA 4RENA 4RMJA 4H1VA 1SIOA 1I2DA 4LZJA 5I5GA 4Q1BA 1WO8A 3DEJA 2QM3A 4IX1A 2G71A 4OHWA 5FULA 2Q28A 4BQNA 1ZWKA 5BWBA 1C2TA 3PFIA 3UC9A 1U2GA 2XMRA 1U6JA 1U2GC 4GM1A 1I2MA 3B89A 2X8LA 3LW7A 2YFYA 1QSGA 2I7DA 4G1UC 3MCAA 4QTTB 5D84A 5I9LA 1YL5A 3F3SA 4HLDA 2DWPA 1OI7A 2PQ6A 1KP2A 3KSZO 4U9HS 1TM2A 4RBNA 5AVTA 1URPA 5DGDA 3K09A 3OX3A 4QOFA 5L4NA 2FW6A 4MUEA 3K09C 1JFFB 3DL0A 3K9LA 1A4IA 4Q9JA 2H2FA 4GEKA 1Z6TA 4F72A 3RIEA 4TUYB 3WQSB 3GPDG 5AVWA 3IEPA 4MUBA 5T57A 2H59A 2JHFA 3CPHA 3CZRA 2VP5A 4UUNA 4XUCA 4BGUA 2GH1A 1ZCBA 1N2OA 3IQFA 5ALUA 3KALA 2EJWA 3QYPA 3K3PA 4JP3A 4ZMSA 1PNQA 3HUDA 4CQMB 2WSYB 1VPEA 1CZOA 2X1MA 3QWIA 2AA3A 2B83A 4IWXA 1M0TA 4O3FA 5EYPB 2X8AA 3MB5A 4IZHA 5JAQA 3VH2A 2L0XA 1U2TA 4M7WA 1N6PA 3TPFA 3QU7A 4JI1B 4WKGA 3U2QA 1WXIA 1MDBA 4S1PA 1X7YA 1Y42X 3VYVA 2OYRA 4M9XA 1KMQA 2PKCA 3I1IA 4EY3A 1Q0LA 2D62A 1PT6A 2FN8A 1JKIA 5DGIA 3TD9A 3HLYA 5AUPB 4NV1A 1YVUA 1Z0AA 1ZQ1A 2F9FA 1DWUA 3JAWB 4AIRA 3ENKA 4GI7A 3FLEA 3JYLA 3OZSA 4LY6A 4D7AA 3ZVNA 1DIGA 2GZMA 3DGFC 1O9GA 2QYSA 3JYNA 4AAYA 3VXKA 5A5EA 4EK9A 1R0SA 1ZYUA 3KE9A 4AZ3A 2AL7A 1L8QA 2CXSA 4LVUA 5KTNA 3JTEA 1LRKA 5IAOA 1S2GA 2B5WA 5DM60 4D80A 2XMCA 3BDVA 5DBOA 3TG8A 1E4OA 1GRRA 2AFHB 1RRMA 2V58A 1AGPA 4ICIA 5DGHA 5HF5A 4DV6B 2C9MA 2E1PA 1RYBA 4PLGA 5FI0B 4M99A 1N7JA 1M5UA 1ZNZA 5FO0A 1XK7A 4PHCA 3VNAA 1JSRA 4DCTA 1AUVA 1E98A 1A9OA 5JADA 3RAJA 4TYQA 5IXJA 3IAM6 3OZUA 1W19A 1T5HX 1Z15A 1WQ1R 2DVMA 3B1WA 4G81A 4JYCA 4ZT5A 3C8DA 3TOCA 4L16A 3QVWA 4EY4A 4PCAA 1E9DA 3U1VA 4CZ2A 4W8HA 3DFZA 5KNCD 4PHFA 4YP9A 4KQKA 1I6KA 1V6SA 3NPMA 5IJ9B 2YIVX 4HMQA 2J9YB 3UJ9A 4BAGA 1M1NB 3D3KA 1G21B 2Y1LA 1RBYA 3KDSE 3PNBA 2UYQA 3FYSA 4GX0A 4K88A 4DVGA 7AT1A 1QZ3A 2VL7A 1TJYA 3U40A 3JXEA 3UN1A 5BR4A 1J8VA 4WJKB 5T6BA 3T3IA 2ZUVA 3W6OA 2H54A 3ZDRA 2QB5A 5FLXA 1EK5A 1WXDA 4G5RA 3SSAA 1YZKA 2COUA 3BD8A 2RGXA 1DAMA 5JQGB 1TYEB 1SU8A 1P19A 5E7QA 5CRIA 4LFAB 1X92A 3D0KA 4WDQA 1XI2A 3T99A 3FZNA 4HOYA 4LE2A 3F5SA 3MWYW 1L5QA 2CDBA 2ZU0C 1D5CA 1SIUA 5IF3A 4LQ4A 3T4PA 2H11A 5EWJA 4PTZA 1JFFA 1KYZA 1ZMOA 4K26A 2ZAMA 5AJXA 4HL6A 3U7RA 4DCVA 2DU8A 1G17A 4TQUS 1CG6A 2V7WA 3AW8A 2IV3A 1ZG3A 5G1OA 1JEYB 4YRZA 3N2KB 3AEYA 4M7OA 1Y3CE 1ECFA 5H0IA 2UYOA 4FEYA 3ZVRA 2B1IA 1CX9B 3BGDA 2YL2A 4MVJE 1E89A 4RIHA 1WDTA 3G9XA 5E7MA 3R3UA 1YKGA 2HQRA 5FOVA 1GGFA 4M4SA 2O59A 4HDCA 4IR7A 1KKMA 3EA5A 1OLXA 4RS4A 3LOUA 4U2GA 2DULA 2C82A 1UC4B 3JQGA 4S35A 3L7CA 3WLOA 3LIIA 1CUYA 4PR3A 1F2VA 3K5IA 2Q4RA 2H4ZA 3D4PA 1E20A 1M0EA 2BEWB 1PRYA 5IXYA 1IWOA 3UEOA 4E5PA 4K1LA 4O4HF 1D6MA 4DLNA 1PR5A 3T94A 3DTVB 1C0LA 2WJWA 3KOXA 1XQVA 3QOFA 4O1IA 4RZIA 5DNDA 4GPIB 2QR5A 3ZHXA 2PPVA 4B1FA 2G82A 5IUNC 1E92A 2SNIE 2FR1A 1UPBA 3O8OA 4EIWA 1G8GA 3IT3A 2OZLB 1TAHA 4L9AA 3HO6A 3K6RA 3OJWA 3UCXA 2QD2A 2CYAA 2DC1A 2DYKA 2AFHA 1OAAA 2I3AA 4NBUA 5K3BA 4EVRA 2BMWA 5BRJA 4ZTUB 3F3KA 4RZ2A 1SXQA 1JT2A 2Z56A 3C1AA 4OQNA 3EPPA 2W2TA 3CX7A 4EX7A 3TXAA 5T3UA 3RYHB 4MPPA 1J09A 2XKBA 4L22A 4CEIA 2D6FA 1BA2A 5LQDA 2DETA 1PWXA 2OHJA 3DLAA 1DUIA 4M8LA 4CQJA 4BZXA 2P41A 2PYIA 3ZHTA 4J0IA 3QVUA 1UPCA 1A9QA 3S2EA 3MK31 3OEYA 4TQAA 4XJXA 2O3RA 3W4KA 3E6AA 5KNDH 4NPAA 3ZV6A 4JP5A 1UJMA 1Q14A 1G21A 1U0LA 1ZVVA 2Y4OA 3NVDA 2J0EA 2Y0EA 5HCUA 3UJCA 5DNWA 5IG2A 4L5IA 1R9JA 1L5YA 4YVFA 1XF9A 2XT9A 3TG2A 5KYYA 1KQNA 4UMFA 1RHMA 4PEVA 5H4HA 4KIFA 3GPLA 2IUFA 4MGEA 4L74A 4R1SA 2J6CA 5HIJA 5FWDA 1YR8A 2WWGA 5K3CA 5BT9A 2VSNA 4A0QA 5JQGA 1Z3IX 1P4JA 1E2BA 5H16A 1KSHA 4URVR 4CMKA 2IYZA 2Z09A 4DXHA 4X85A 3BUSA 4RCYA 1KXJA 3VR2A 2BSQA 4D3XA 4EPRA 3BMNA 1SXJA 2G04A 3FF1A 1XTPA 3U37A 1JBQA 1SXJC 3L1JA 3NATA 3PDWA 4WTOA 5J4VA 2FR0A 3O9VA 3LUAA 1G6KA 1NRXA 2Q5EA 4XFDA 3ZY4A 1QVRA 1XU9A 5DLEA 3MCWA 3ND9A 5D5PA 3VR1A 4ID3A 4X8OA 4I6EA 4TOIA 3NH6A 3N2KA 1JEYA 1B41A 1RI5A 1NV8A 3HP4A 4XLTA 3P4YA 1R16A 3PXDA 2RE8A 2VOEA 3QMPA 1ULUA 2O8BB 2X58A 5B1YA 1W75A 5HF8A 3IJPA 2OK7A 2X1LA 4E1BA 3HH8A 1TA4A 4Y1RA 3SBOA 5A6VA 4UHDA 2JK0A 5AOBA 4M8SA 4C3UA 2PUCA 3OM9A 4XB1A 3GIDA 3IKLA 3K9BA 3QEOA 4QAJA 5DEOA 4L4YA 5JG7A 1YBVA 2PYZA 5H1YA 5ILGA 2O2SA 1E1QA 3NIGB 1RWPA 4WA8A 3UK1A 4M1SA 4AUKA 4OUKX 1V41E 1IVNA 1E3WB 1M2OB 1LWOA 3HBAA 2RHCA 4X8MA 2UUPA 5HE9A 5HQJA 4ALIA 2AMVA 1I94B 3HE3A 1NT2A 2VF4X 5FX2A 4FBMA 3A6GA 4KWEA 4J2TA 5DHQA 4YFYA 3OBBA 3SYLA 2PLFA 1XJ0A 1QHNA 2IE8A 4WHMA 4DQUA 4IHAA 1PS0A 2I2WA 4C22A 1L4LA 3V2HA 5AVUA 2Z9DA 4QNMA 2CJYA 2H31A 3TW8B 4ARZB 1ZD4A 1FS4A 4NPHA 4DYVA 1D03A 3RQIA 1NVUQ 2QJOA 4LK3A 4HYTA 2ZB3A 1E69A 1K7XB 1KP9A 1P7WA 1FLNA 3EWIA 2VJNA 3AW9A 1HE5A 1UT8A 2R7LA 3NT5A 4W7IA 2BE9A 1MZPA 1Y82A 5ALQA 2WSBA 4IMPA 4LZPA 3H13A 4LJ6A 1LJ8A 1NAHA 4MGIR 3TKYA 1QFJA 2HRRA 4C78A 3UC5A 2IELA 3MAJA 4Q4AB 3JSXA 4C7KA 2A2ZA 1SQSA 4O4IA 4D79A 3E03A 1L1FA 3WMRA 3PHHA 2EU8A 1AB5A 3RK0A 2BGKA 2ZIFA 4D4LA 4B46A 5AVVA 4O4HB 2X77A 3FNEA 5KEIA 1MABB 3RVKA 5LZ9A 1GTVA 2D0IA 3WE7A 3IHTA 3I2GA 3OWXA 4X66B 3HCBA 4Z5XA 5GONB 2FFAA 4H3HB 4M1EA 1T4DA 3R24A 5LR6A 4AZWA 1ADFA 5HIKA 3UGKA 4PG5A 3DP9A 1TYDE 4CMHA 4RDHA 4FLMA 1ZISA 4OUDB 3IV7A 2QTCA 4FOTA 2YBEA 1F0NA 4LE0A 1G3UA 2I67A 4HH0A 4NPCA 1AF4A 3D8TA 4A2CA 1VG0B 3O83A 4G0YA 3HCAA 3OSUA 1R4AA 2ZUWA 4JXXA 1Q19A 5JMOA 3EW7A 1FY2A 3ZWAA 4NP6A 2NVBA 3B3QA 3GI1A 2KW5A 3VJMA 1VKHA 2IUTA 4CM3A 2IL1A 3UGQA 1CS0B 1E2IA 4A6PA 4BMCA 4B0OA 5D51S 4F7WA 1NMQA 2UV8A 5JXJA 3LCVB 1T5OA 1ZRMA 3CLHA 1RQLA 3VSCA 2ZXEA 4ENWA 4ER6A 3EWAA 4J03A 2VH2A 3C24A 1GSOA 1YI1A 1G38A 4CGZA 2ONKA 2IK8A 3I64A 1U3DA 3CY6A 3MMZA 1O8BA 3QFSA 4G4SO 4S0XA 1WPRA 2HHHB 4TQ9A 2B5VA 3QNUA 2Z2KA 3C97A 3S68A 4FT4A 5B7PA 3S2SA 5TT0A 4ITRC 1SUAA 3GNQA 2OCDA 3WNVA 4MAMA 1M0WA 2ODAA 3GEPA 4QTUB 3BEOA 1E3WA 1USIA 3CBGA 2IXEA 1WJGA 4Q1VA 5DOZA 2WG0A 3UWSA 3H4VA 5C5DA 5AW0A 5KMGA 1IAVA 3FUTA 2P5UA 2VYCA 1A82A 1NLMA 1R0ZA 3LYUA 2QYHA 3P0FA 3WIVA 2CL5A 4JUAA 2AKEA 1A2KC 4TROA 5AVSA 3DWIA 1RWVA 2F2TA 1T9AA 1VI2A 2FP3A 4LRXA 5AO9A 5MDHA 3SQXA 2DBVO 1YTLA 2R1VB 4AD8A 1F8UA 1T2FA 3TPCA 4C89A 1W9MA 5A1JA 3O2NA 2WM9B 4NQRA 3TW8A 1K9VF 4DAEA 5JD5A 2Y3IA 2XB4A 2FWPA 4CM8B 4RHUA 4JL5A 1DAEA 2P2LA 3ROXA 2DUJA 3HSKA 3KBOA 2HQSA 1JYFA 4EA8A 2GXUA 2LIVA 1DTWB 3K9NA 4TRMA 1T2AA 5CNIA 3DBRA 4M8IA 4XM1A 1JIJA 3NXSA 5FR1A 5CURA 2D0DA 3L82B 5U4XA 4Q7KA 3A2KA 2DQZA 4KMSA 3VZRA 3ZWMA 3SXUB 3INYA 1T24A 1W85B 3I2KA 2F17A 2QRUA 1C14A 3DYBA 3GG2A 1PG5A 1S8AA 1DCMA 1MABA 3MJ4A 4KP7A 4OB7A 4RJJA 5DKFA 4CF4A 3HB5X 5L4LA 3H42B 4RTPA 2XMDA 2VXYA 4OQLA 2GZ2A 5GONA 3WISA 2PM8A 1JDSA 1Z88A 2ZBDA 1A4UA 1FW8A 2ATEA 3DW3X 5EUBA 3HM9A 3A1SA 2ZZMA 5FT9A 1NHGA 5DSXA 4ZCRA 3OCZA 1GGNA 4CR7A 2CD7A 3W0LB 5ES4B 1Q7TA 1BG6A 1ICIA 4FEAA 1IB6A 3ZE7A 1D0SA 4WDRA 4R7GA 2A0YA 1D1PA 3ANSA 4ZT7A 3LLSA 4DEYA 6CHYA 3VSBA 4NEQA 3EIQA 3VOTA 2GBLA 2OUIA 4DLUA 4LSGA 2BGUA 2GBLC 1EHIA 2GUGA 2JIOA 1M1YE 3C7CB 3LP8A 4LZOA 4M0FA 3U1TA 3UBMA 3VDXA 5DISB 5I3ZA 1I1NA 4BNGA 2K6GA 1L4UA 2OL4A 1K3UB 4G41A 1CF2O 1SVKA 4P4SB 3B6IA 3A11A 1U63A 1CS0A 1CRPA 1L3CA 4R3NA 3RU3A 2IF0A 1GG5A 5FLEX 3V3KA 1XK6A 5AYVA 4R2XA 5JD4A 2X23A 3AHEA 3H6HA 4PBTA 1EUDB 4ERNA 5DZSA 2IH2A 2I6FA 4OCZA 2VRCD 2YWHA 4PS0A 3PFGA 3H11B 4X24A 1XPUA 2XUKA 1SBHA 4OG2A 4OYRA 4YY3B 3CZQA 5DM2A 2WT8A 1FFSA 5DTMA 2D5CA 5AM1A 5DHAA 1Y3HA 2I54A 2I80A 5HK8A 4D3SA 4F96A 4M55A 1W76A 3P52A 2VQSA 4PZ9A 1O77A 2V3VA 3IDQA 1OH6A 1E5VA 1A76A 1OX4A 2BI8A 2WAXA 3ONNA 1RBZA 1NN0A 1PYGA 1XF1A 3R9KA 3NV7A 5BQPA 1OY1A 1SVUA 2D00A 3Q2IA 4IMJB 2ZUTA 3IAS1 1CZLA 4P92A 2A1UA 3W05A 3PQ7A 2XIQA 3EWNA 1XGKA 5ERXA 1SC1A 2YXDA 3C6QA 3DWEX 4QU8A 1UR5A 3A14A 4I1IA 5I4KA 3BBLA 2I7TA 1CFJA 4H2DA 2PSJA 1MJGA 3H2YA 4QE3A 1LUAA 2R1VA 3BSFA 5E1DA 5AICA 1JA0A 4QWWA 1EX9A 3A4IA 4BGIA 3K9CA 4BO9A 2X5XA 4KXQA 4OHFA 2NM0A 4RHFA 2QVGA 5I8WA 1CJUC 1BWSA 2CL7X 1R50A 2PVPA 3DHVA 3QV2A 4EYKA 5CH5A 2OQ2A 4O0LA 5JC8A 4ZPJA 3A70A 5REQB 3BTOA 2I33A 3PYXA 4NENA 4HQ0A 4B71A 5HRUA 4UUOA 4MWDA 1O97D 4AM8A 4PAMA 2PT9A 3LXRA 3O74A 3GBVA 2I1QA 4RVFA 2VT6A 3IDAA 2HHJA 3AFMA 3NONA 5ES3A 4BWGA 5BPFA 1HNWB 1UPUA 2B36A 4IEFB 5ADWA 1GCIA 4WCFB 2RIRA 2YZKA 1N3IA 1Y4UA 1E60A 4LVCA 4GI3A 5C4GB 1JR3E 5F4BA 2OZPA 3NHAA 2J1LA 2P77A 4KVFA 3WVNA 3Q5EA 1RM3A 1BQEA 2V03A 2Q1SA 1T4MA 3L06A 1OBHA 1NZJA 2WJ6A 1NBAA 2WIAA 2ZRBA 1VSUA 4QOSA 4Z1MD 2Q6KA 3DH0A 5DE3A 3RFUA 1RJ9A 1RQRA 2Y0PA 3IAAA 1R5NA 2AYYA 1S7GA 4G97A 1GPDG 2CJWB 2BZGA 5KJFA 1UL1X 2EBHX 2NT3A 2GCEA 3IDZA 3KFVA 4IQGA 1Z7EA 2YV4A 1I5RA 3IILA 3NBUA 3OEWA 3F6PA 3ZWBA 4BV9A 5KTSA 3PSAA 1YR6A 1HOTA 2ONJA 3T3GA 4H1WA 3OOJA 1J22A 2VTKA 1TVKA 1ZOPA 2FLWA 3A6HA 3AO0B 1NVMB 4V24A 4GUDA 4FOOA 4R01A 2Y8EA 4HNGA 2WU8A 1U3UA 1JP7A 2X4DA 3OOEA 2A58A 3Q98A 4X71A 1ZSNA 2B1JA 4LWOA 4TRJA 3N2EA 4A10A 3ZV3A 2ZRNA 5GOTA 3VYSB 1HT0A 2XZOA 5K3FA 1ZU5A 2Q0HA 5A4DA 5AP9A 3EARA 2HV9A 3VU1A 4MTLA 3L8DA 4MUGA 5LWHA 2GM5A 4KZPA 2G88A 3UAOA 2DWQA 3SFZA 4GXTA 2JI7A 2ZB8A 4EECA 5F2NA 3S5UA 1B76A 2VCEA 4EMUA 5M2QA 1VHLA 4QYWA 3P0JA 3RF6A 1RYHA 5EIBC 3CVWA 4WZ6A 4HJRA 3BWVA 1L3IA 2Q5IA 5EERA 3LWZA 1ADJA 1T1IA 2B8EA 3CRNA 3UA3A 1XB2A 3G1UA 1QHGA 4BASA 2C88A 3GOQA 1MJ5A 1ZKMA 1UP7A 1EFPB 3DD5A 3IPXA 4MJ7A 1TEVA 4PC2A 4DYDA 5A9RA 4X95A 3DDSA 1MAWA 1G64A 1KAQA 4QGSA 4ZI3A 2H1OA 3DLBA 3DVRX 5BV1A 2XAAA 4O2RA 4RPJA 3F67A 3AGQA 3JPWA 4YI3A 4Z0PA 1H2BA 1EK6A 1EVZA 1WZCA 1YBFA 3M6XA 4G5XA 2QUHA 4XTRA 3ED1A 4ZRNA 4LBVA 3OPXA 5H80A 4MV0A 5GOZA 4MLCA 1KSGA 3SLKA 1KP3A 221PA 3KYCA 4OLJA 1Q0QA 1JB9A 1ZD9A 4Y2GA 1EG7A 3ZCTA 4ZEWA 4Q9NA 2YYSA 1I8TA 4GKKB 3CUVA 2C2YA 2QPOA 5DI3B 3VR5D 2IEZA 4LJ4A 2ETVA 2OBFA 3K5PA 2ZAGA 5FUBA 4DJFC 5LN1A 1YZLA 2YWCA 2O57A 4DLXA 4FUQA 5REQA 4MGYR 4Y9RA 4DPLA 1KWGA 2E18A 1N9KA 5EKDA 3CM0A 4C5CA 3P71T 3SIPA 2VQ3A 3EG9A 2XYHA 5I7EA 3ZU3A 1TLLA 1DC5A 5FUYA 1I4LD 3N8IA 1UJNA 2A9VA 4ZVPA 5F1KA 4MHOA 1NTRA 1LSJA 3DEYX 4RAQA 1HQKA 3G1TA 1G7RA 1QQ5A 3CX6A 1YOBA 2GCNA 3FZYA 1LD3A 2XB9A 1GQRA 2W6MA 2D8MA 5KVAA 2N9UA 5K2OA 1PGQA 3AVQA 2WJYA 2PS9A 1FUEA 2BZ1A 2VHYA 4IH4A 2PL9A 4IZ6A 4LDNA 4HN2A 4YLYA 3EB9A 4ENSA 1WSWA 2DTEA 3M5DA 4ISBA 1JDTA 3RTDA 1FQWA 5K51A 5B57C 4R1TA 3FNHA 4BQEA 3KAPA 4AIIA 2QRPA 3VU9A 5I9SA 2JLBA 1DJQA 1RKVA 1JF8A 4P2GA 4WZAE 3DBLB 3FNRA 2ZPUA 4XM2A 1B2LA 2ZRPA 2CCJA 2C9ZA 4X61A 2J3JA 1U1EA 4FFLA 5AK3A 3UHAA 1OFVA 5GJWC 2C1ZA 4F92B 3HXQA 4HEHA 1H2YA 1Z7BA 3NTRA 4BP3A 3OPMA 2ZRIA 4Z8XA 1XC7A 4R1QA 3X1WA 4TXMA 1ZDMA 3F8SA 4FHDA 2NU8B 2PJUA 2VPTA 1U1IA 1ADCA 2C3UA 2G4LA 3UM9A 3UHOA 1FVOA 2ZJZA 4M9CA 2R62A 3KNZA 3V8BA 3ESDA 4L4SA 3ZGXA 1T3SA 5JSZA 2E4WA 3UT5B 4G4GA 1RXIA 5K5EA 4ND7A 1J1ZA 3L8YA 2CHUA 1X1QA 2Y68A 3OF2A 4BVJA 1H23A 3AKYA 1CZUA 4B34A 1CUXA 1UDWA 3NI2A 3ITNA 4G5QA 4BLTA 2DFLA 3VNVA 3W4JA 4B7AA 1F51E 2ZIAA 4NE9A 4JOBA 4UZFA 3G7SA 5CHEA 4H6VA 4DIUA 1XEWX 4JJ4A 5T6MA 1JXOA 4NXNB 4N0EA 4BNMA 2IVFA 4X63A 5IC6A 3ZHVA 3QHQA 1TQ2A 1S4MA 1ILWA 2BKLA 4F21A 3IB6A 4G1MB 4CMGA 4P86A 1WSDA 1XQYA 5EA2A 3FDIA 3F5DA 2ZVJA 3BE5A 2AN4A 4PC6A 3H9QA 4RIEA 4Z4FA 2GAOA 5EKTA 2ODQA 5CT4A 1P4GA 1L5SA 1SVSA 1K08A 1ZC3A 4FGWA 4ZO4A 5DI3A 1Q0RA 4KU4A 1FFAA 4YAIA 5TQ2B 2GLXA 1FYVA 2PH7A 2Q29A 4MKIA 5LP6C 3FNGA 1ISIA 4UMDA 5E8JA 3ZDQA 1QU2A 2AEFA 4DV5B 3F78A 2IF2A 4J0DA 3E7XA 4ZYVA 3PYMA 1G19A 2X3UA 5HRAA 5HZKA 1CW2B 1WTAA 5HQ3A 3OVMA 2OGWA 1S2MA 1TUBA 2WIGA 3DHNA 3IAS6 3NTUA 4NCHA 1CU1A 4Q19A 3SR3A 3SYTA 1N4DA 5C7LO 2ZRMA 1QYDA 1EE2A 5T4EA 3Q87B 1MP0A 2WPDA 3A9VA 2B21A 4TS1A 4F4HA 4Q15A 4L2IA 4TTAA 1K63A 2Y77A 4GI5A 3D6JA 1G66A 3HWX1 1DBIA 2QUBA 4C7MA 1ZW6A 1B74A 3ID6C 3BK7A 1DUVG 1EESA 4P3OA 1E6CA 2G0AA 3K1AA 3WA7A 3ONWA 4TLCA 4M38A 4CIXA 3ANNA 5TGZA 3QVVA 3SR0A 3PS9A 4EL0A 2EEZA 3NEJA 1ZH6A 4JLVA 4GOOD 1YVRA 3EBOA 1JHZA 4D6PA 1D6JA 1WQ3A 3HZZA 5D3QA 3W77A 1VJDA 4EGCB 3SKVA 2CVZA 3AR5A 2R1UA 5KI6A 5ERYA 1MX3A 2C3MA 3AG6A 3U7FB 2QL5A 2H00A 2QE7A 3NM4A 3EEYA 1ZJZA 2B9EA 1RXVA 1PNOA 1Y89A 3RV4A 2A5JA 3LP5A 1E63A 1RPJA 4IDGA 2AJCA 4PQFA 4DREA 4EJSA 4PNEA 1TJ4A 3K94A 3U62A 4EJSC 1TAGA 2F59A 4CMIB 4CR8A 2GVZC 2NU8A 4E11A 4DABA 2NZ8A 1SCDA 1T3ZA 3HGTA 5KNBA 1BS1A 3H0KA 3AVYA 4WUVA 1IZYA 1Q1EA 2HA3A 3P2YA 1SKYB 3EVDA 3HI6A 4KFUA 3VR4H 2FE4A 4HQFA 4RF3A 4KGXA 2HMTA 5DLYA 1H65A 5IAJA 5IM4A 3FHJA 3Q7SA 3UT5A 1IEWA 2BH9A 1A8IA 4ZCQA 3ENZA 2AB0A 3KO8A 1MGPA 2OV2A 2F6RA 1NM5A 2ZRAA 4LXQA 3AP1A 3CX8A 1CHNA 2JC3A 1NM5C 1C81A 1D0VA 3DO6A 1X8JA 5JR3A 5IJ0A 3MQFA 1ZVQA 2C4VA 2NO4A 2R1TA 2WPNA 4EELA 2D0OB 3VKVA 5DU2A 3WKDA 1WCWA 4LHYA 3K70C 1UANA 1YZTA 2K7FA 3CPEA 4DLAA 4RFSB 5KYGA 3TO5A 1MLDA 3LS2A 4E14A 1MC8A 2TYSB 2WU3A 1ODKA 3F3MA 2R6ZA 1RM4A 3F98A 1V26A 5DO9A 3OZIA 4WXRA 2A94A 1XN4A 4LW8A 4RA6B 2XECA 4OB8A 1J9GA 2ACVA 1SQGA 5AW5A 4H60A 3ABZA 2HMWA 4UCWA 3RVNA 3JASB 2YNMD 1QYXA 4UEJA 2YN4A 3HNOA 2RK3A 2VOJA 4W5TA 5JO0A 4BZZA 2BKXA 1Z4NA 1YJCA 3G13A 1XRSB 4GDFA 5TQ2A 5E4FA 3FPSA 3ZIUA 3JZDA 5EZ5A 3LOQA 5DTQA 3UKDA 1L7DA 1S1CA 3N75A 1UUFA 1ZD5A 2X4LA 2XR1A 4MJ3A 1GLVA 4RJLA 5JSUA 4XQ9A 1E8DA 4YIKA 5G3YA 6YASA 1UZUA 4QECA 3NP9A 5ICFA 2PBFA 2IH5A 1P91A 2X7XA 3DULA 3T0FA 1HI9A 1ZZGA 3LHFA 2ORWA 3A05A 3E70C 3PF9A 1J7JA 3PFCA 5JZBA 1DB3A 2MSCB 1V43A 4LPSA 5B53A 4AF7A 4DADA 1LLUA 4XTCS 2OHIA 5DYIA 3ROZA 3T3HA 3R7AA 3AR4A 1NJSA 3U9TA 5IZCA 4ASUD 5A5FA 5IZCC 2A1TR 2OBXA 1TOAA 4CTOA 1F3LA 4IIEA 1UP4A 1NV9A 3D6HA 4QSMA 5L4SA 1P2SA 2V7GA 2VF7A 1Q84A 3H2KA 2QUZA 3SEFA 3WLPA 1OGYA 2YZNA 3KJQA 5B6PA 1NBHA 3MTBA 4O4LB 2WDZA 4CKWB 2JBHA 4EF4A 3FPEA 2RONA 4XEUA 5DWQA 1T3LA 2LR0A 4IBOA 3L8MA 3ZQ4A 3O03A 2R6FA 3JYQA 4YROA 3LHKA 2PRZA 3V4SA 5M7EA 1II9A 1ECLA 3LRPA 2F62A 3HKEB 1IWBB 2QP3A 3S1LA 2DZDA 3ZY5A 5F2EA 2IZ0A 5AW9A 5BSKA 4LZZA 3M1AA 5AVJA 1BDJA 1S1MA 3L0PA 2VSOA 2GVNA 3MXOA 4GWLA 3TL6A 4ZZ0A 3RC2A 4NATA 4P9NA 5DMXA 1A77A 1CUGA 1T10A 1KVUA 2GN2A 2XBLA 4N01A 4LHXA 4RKWA 5CTAA 3B78A 4CI9A 1SXHA 3ESCA 1CEYA 3LC0A 4GGMX 5B5SA 2N47A 1GR0A 2B4KA 2WA2A 5PGMA 4ZOEA 4YQZA 2V3WA 3BWMA 10MHA 1JBKA 2R6HA 1Z2NX 2IHTA 2XH8A 1U7OA 2ZTVA 4OLFA 2IFTA 3ZKWB 2R8BA 4CL8A 3ZDDA 1C9DB 3ILYA 1ELOA 1KERA 1OI4A 1WCYA 2ODPA 5IBQA 4IJ5A 3HU1A 3GK3A 3KS9A 5BURA 1XLVA 1U02A 4WKCA 2P4EA 2PV0A 3EIHA 3OZWA 4PX9A 3TAHA 3TQSA 3VTAA 3EDOA 1N5OX 3U80A 3KV3O 1VP9A 4IFIA 1R6TA 4OFZA 2WHEA 1LSSA 1PTJA 3FRHA 3DV9A 4WOKA 3TCXB 3TMAA 1NNEA 1PTJC 2G7MC 4WL0A 4JI0B 4DMMA 3QVJA 4HFMA 5BUZA 2W6OA 2XJ4A 3LHDA 4RVHA 4HUTA 1JSLA 3FTPA 1M1XB 1N8NA 2YY6A 4ZVTA 2ROQA 4X1IB 3ZJ4A 4TKVA 4IIXA 2MMCA 5L6MB 5CFZA 4QTZA 4OHRA 4X1KA 1DPFA 2H06A 1PR3A 1YNSA 2BY4A 1SR8A 2X14A 5LCXA 4RA6A 4BNDA 2PKRA 1R5OA 3AZPA 3AK4A 1NVVR 3I6QA 4YMGA 1X38A 2VT3A 1XIVA 3I39X 3DONA 5CVTA 1ORHA 1IZ8A 3LQYA 4JOQA 4Q1EA 1N36B 2ASEA 2BKEA 3EQ9A 2EW1A 1PO7A 4LSWA 4Q47A 3C48A 4YPVA 5H8WA 1ZX1A 1AK9A 3PKZA 1HDZA 4PONA 5CDGA 1Q17A 3R5FA 1YQ9A 4M1KA 4EOGA 4AF8A 2B99A 3VJLA 4GM0A 1O95D 1KFKB 5CW1A 1COWA 2AZ4A 5EPUA 2ZS7A 2QN9A 1IUPA 3PCTA 1QE0A 1TADA 3DE2X 3D0RA 2QZ9A 3KZMA 5E1BA 4EW2A 2I78A 2JANA 4DLYA 3RG2A 3ODPA 1TQDA 4S0ZA 2BT4A 1QK5A 3Q11A 1JPVA 1QGUA 4KJXA 2PJRA 1JMKC 3JARB 2C7GA 3DNFA 2X6RA 4DW8A 5T5QA 1NKTA 4IF6A 3NCTA 2W98A 4NMMA 1ULBA 2FUCA 1BKSB 3NC0C 3T7SA 4CL3A 5C8YF 1WDWB 3EDYA 1J0CA 4NE2A 2XSZD 3G2HA 5TVGA 4O4LA 5L53A 1J8QA 1KOLA 1QJ4A 4DDHA 3FYUA 4WT7A 1E3DA 3W2TA 1D8AA 4D42A 8OHMA 2Q6LA 3FYUC 3RO7A 1I32A 1BFUA 1KZ6A 2HA0A 4BMYA 5HBRA 4DIEA 2VP4A 3EF1A 1XZNA 4L0CA 1HKUA 1LNQA 2ZSAA 3H05A 5HE8A 1E1RA 5AW3A 5KSYA 5MGBA 1JH9A 2XYGA 3VHRA 5EIOA 3UAYA 1M2GA 2JCYA 3GP3A 1QG0A 3LUPA 4J7AA 2CYBA 1T1GA 2DHQA 3DL2A 4N8DA 5ALTA 5FO1A 1OGJA 3WWDA 4YMUA 5EIEA 1DRUA 5T67A 1KY4A 3G7NA 1Y1QA 5DBGA 1WIWA 4L8WB 2R97A 4OFWA 4B7UA 4O25A 4DF3A 5BY2A 4PLPA 3WTBA 1Z0DA 4ZA2A 5C18A 1Z2PX 4UMVA 1P1CA 3IR5A 1QFYA 2FETA 1C3OA 1PLLA 1VDZA 2XA2A 2RGRA 2O3QA 2VP2A 3IR7A 1AK1A 3L46A 1CR4A 2DQYA 1JVSA 2OLKA 5FPKA 1RS0A 5JBQA 2CHEA 5A4JA 1U8CB 4QIHA 4YN3A 2JFQA 3G2MA 4QFDA 2YY5A 4B6JA 5IAKA 3LZDA 5CJPA 1KIMA 4LAFA 4H16A 4W1QA 3G79A 2WMNB 1D1QA 3OIUA 3PDIA 4ZYYA 5HG0A 5IKMA 2R00A 1ID8A 1E9SA 3SAJA 1YFLA 2R00C 5AVXA 5BVGA 1GZ3A 3OZ7A 3QH4A 1R00A 2BJVA 4XPIB 4PRLA 2CDCA 3IXLA 4TL8A 4QJ3A 1NIPA 3AU8A 4GQIA 4FD2A 3AHIA 3PL5A 1V6CA 4MWOA 4OMDA 1E1LA 1Z34A 4WFIA 4JYZA 2GLTA 1WLYA 4UTZA 1U0HC 2ZE8A 1ISRA 2FR8A 3JATB 3K9HA 3HCDA 3MS4A 1ZJYA 3DJFA 1T2NA 2A33A 2FR8C 4QUEA 3ZS9A 5AOAA 1XZBA 2R4QA 4UPDA 1A8SA 3R8FA 2ZE6A 1U81A 4RXTA 2X4GA 1O0CA 1U8FO 5FAKA 3SHQA 2ZANA 3FDFA 2KHZA 3CH5A 3KDPA 4HGQA 4KQ6A 4QXMA 1JLRA 2WVHA 3AY0A 4LF7B 1NSFA 4RSGA 3LQKA 2AD5A 2ES4A 3LBAA 4MSUA 4YIHA 4F9TA 4ZQBA 1Q3TA 1RC0A 4JJ6A 4RPLA 3TMYA 4I19A 5CR9A 5JSYA 2W6JD 3LPLA 1FDVA 5IDVA 3A1WA 5EHZA 3RAFC 3ADDA 3TAUA 1CK4A 4BVEA 2GNOA 4CYMA 5T41A 1UXHA 3PGVA 2XX3A 1QV6A 2AR0A 2NW6A 2I7VA 2Q2QA 2WAMA 2XNHA 4LF4B 1DDIA 1GL7A 3ZBTA 2C8KA 4PZAA 2YXLA 1JQ5A 1YRQA 3P2EA 3PC7A 2F1RA 1THGA 4G0OA 3DPIA 4BFVA 2YBDA 3E3OA 2IU6A 1VPDA 5IC5A 1VGRA 4WINA 4BN0A 2MSKA 4CLDA 5AW7A 2IBSA 4HDQB 4FYYA 5CVCA 5HFJA 2X2PA 1SUFA 3HUFA 5CK4A 3SIWA 3BGIA 1SCNE 2FPMA 1XLWA 3UT0A 4XH9B 3FSGA 2BJWA 5JLAA 5C31A 2FP4B 1IBCA 2FCAA 3OIVA 3M9LA 4LA4A 2BCGY 3DCNA 4P83A 4H7KA 5EHGA 4ZAGA 1LV7A 1LBQA 2FWRA 3M4NA 4CM5A 1NBEA 2IYPA 2P0YA 1UFVA 4PX3A 1C8BA 1H3FA 2COKA 2KI5A 3R40A 1XYVA 5F3WB 1U2QA 2P2GA 2MT9A 4UU7A 3UV3A 3BN3A 4B44A 1XZJA 1T4BA 2JJYA 2VJAA 4UOEA 1WY5A 4GX1A 3ZLJA 4NMWA 1AUOA 1NQTA 3A9RA 1N5DA 1FJ2A 1L4NA 2PH5A 3AI7A 3LCMA 5I7UA 2CLHB 2IIBA 3BX1A 2WJVA 4O63O 4JA0A 1WULS 1PJRA 1JN0A 5F2KA 5C8YB 4GPZA 4YO7A 1QAQA 4UU1A 1UOEA 2C2KA 3NUZA 2OWEA 4ZPXA 3PUKA 3W3AA 4ZI5A 2F43B 2VBIA 3FPGA 2PANA 3ZWDA 1RHJA 3DM5A 4RVNA 2AN1A 2E49A 2BFAA 2GKOA 3E0XA 2B6HA 5M04A 2NGRA 3OM1A 1WL8A 2HJGA 4CGYA 4XPIA 5JATA 5FWXA 4G0XA 4ZU1X 3FFBA 1M34A 2DUWA 4INOA 3ZOKA 3GLUA 1I7NA 7ADHA 3DLHA 2DGDA 4QGGA 1VHJA 1I2AA 4Q3NA 4AS3A 1ICEA 2PA0A 4DLVA 2DHRA 1XWIA 3CH6A 3CF4A 1UXKA 2A0UA 3R6GA 2YQZA 1V3UA 2XYPA 3FUCA 4AJ9A 4CCSA 2AT1A 2KX7A 2R4UA 2QMZA 3SC2B 5K8TA 2YXEA 1GUDA 3WLHA 3U4AA 4B7XA 2WVJA 1QIIA 1XRQA 3TR6A 4EKIA 1QWSA 2MIIA 1UAAA 1QF9A 3RWBA 5D3KA 1OBCA 3M5PA 3W2GA 4EHJA 2E5FA 1E96A 2WKSA 2I34A 3OICA 3AIIA 2IH4A 2FCRA 4NJMB 5AKIA 2G76A 3INTA 4EVIA 5C52B 2AUMA 2QR3A 3QRWA 4AJJA 4Q3LA 3VPBA 4YT4A 2YS7A 1RAFA 3CRZA 4GAEA 2BEKA 3TCNA 3THWA 5EL0A 1TCUA 3RSHA 2JB9A 4D3YA 2CDAA 5CDTA 1W46A 3QTLA 4MRSA 3V8VA 3M6UA 3HCCA 3VX3A 3BSSA 1N2JA 3EH1A 3LBFA 4V1CB 4J75A 4ZEVA 5JMPA 1QYRA 3AL0C 1PJ8A 2QLBA 3IQHX 4AQ7A 5BN5A 3FB4A 1ODSA 3K6SA 2I2CA 4JJZA 3MWKA 4ZALA 3ZCPA 1X9GA 4Y30A 2O2XA 1OXVA 3FZEA 4CW7A 1ZGAA 1H6DA 4F45A 1YVPA 4HX5A 4P7JA 2VH5R 4CIDA 4RANA 4K9MA 1N2HA 1FSGA 1HX7A 2WOJA 3IVXA 5T4FA 3UUEA 4YUZA 2ZE7A 2JFUA 3VHXB 4YR9A 2IP2A 2RIPA 1FQOA 1UBTS 1AGNA 1EP3B 2FP4A 2HWXA 1XZAA 2YWXA 3PJFA 4NOLA 1RE1A 5DTEA 1CYEA 1H6AA 3AEQB 1WDMA 2BTQB 3LLMA 2XXAB 2F9LA 3CG4A 4QUIA 3I6BA 2PCLA 3UMMA 5DT2A 3QLJA 4LYDA 1P73A 4YCLA 2FN9A 2XB2A 1AKMA 3L9WA 4HX9A 4EKGA 3U60B 4K8OA 5FR2A 5CB6A 1QLJA 2W4QA 4BO3A 3R6DA 4N7JA 3K9QO 2YICA 4MCHA 3JVVA 4H7PA 1ADBA 1VHDA 2IW1A 2XB8A 1PJZA 4FXPA 2RI1A 1ENPA 2W48A 2YXPX 5EKUA 2H1RA 2C5FA 4MMXB 1B42A 4XCXA 3IKTA 3U49A 4FWIB 1XZMA 1LJUA 1PAUA 2F43A 4UUPA 5E9AA 3ZJ5A 1U0NA 3IJEB 3N2ZB 1MRNA 5AT1A 4O33A 1M66A 3S2ZA 5IANA 5FD8A 5H02A 4A6EA 1TTPB 4ZMBA 4BXOB 5FTWA 2VRBA 5J40A 4PYIA 1HDCA 3EXAA 5K05A 2H0AA 2YCLA 5ALWA 5JARA 3SJCA 2C4TA 3CJRA 3V4FA 3ELDA 3KWFA 4ALMA 1YVDA 3U7IA 2WUWE 1P7PA 3BH7A 4RD1A 3NNDA 3WICA 4EHLA 2Q6OA 2XTAA 2GVDC 3R8XA 4IEIA 3A9UA 2QQ0A 4XUEA 4BIMA 3ZQKA 3SC2A 3CE6A 4DUZB 2QD4A 3L0IB 3SFTA 3TK1A 2FG5A 4CTKA 3NTQA 2CLLB 4Q9LA 1ZIYA 4DMHA 1FDRA 2DR0A 3KPJA 3NT4A 4FN4A 4PBRA 5B4UA 2C1XA 2V55B 2VZ9A 4B3DA 1Z8HA 3N2NA 4B3RB 4DVJA 5DEIA 1SKUA 2PMEA 5L8VA 4I5GA 1XRJA 4TYYA 3G8CA 1MT3A 3VR3D 2JGAA 4E88A 4TT8A 4Y0AA 2ORED 3PTZA 2RGBA 621PA 1FW6A 4IQFA 4A1FA 4DQDA 2KWIA 1NRIA 1W48A 2VTVA 1PE0A 2A9FA 3DMGA 1GJRA 3O3NB 1NMYA 1PWEA 1QPBA 3CPJB 3Q0TA 4AK9A 1I3OA 3O7MA 3N59A 4OYHA 2H4YA 3UMRA 3VU3A 2JLQA 1H94A 3MJTA 1YFKA 3G2QA 4GICA 4IGEA 4M0PA 4K7JA 1LNZA 1GZHB 5FOWA 4O0MA 2FPIB 4MGHA 4NOKA 2GF9A 1TX4B 4WKPA 4DQXA 4CMBA 1HE2A 4KV9A 5CVEA 1XXHA 1LTKA 3UXEA 4MHTA 3AVTA 1PJ2A 4R3UC 2FFHA 1GLGA 3VHQA 3ZK8A 4LXXA 3VHXA 5DYGA 3Q3GE 5KCMA 4ZD6A 4AMYA 2G8NA 1I9GA 1W5TA 5CCEA 3AEQA 1AUQA 2QTVB 4I66A 1VBKA 2GBGA 1JWAB 3PGKA 4DWOA 4EJ2A 1FDOA 4XQEA 4FFOA 4EYEA 5KTPA 1G5IA 3WKEA 2I0FA 2X9NA 2WG1A 4J16A 1NUQA 1UK6A 1ZUNB 3ZYCA 4M9RA 2HLNA 4J16C 3WMWA 1Z2DA 4MR8B 1B8VA 3KL4A 3OOHA 4PIVA 5DX8A 5C8ZA 2PQ0A 2B5OA 3HBJA 3HR7A 3G6KA 1UQRA 5THKA 2KJQA 1P5FA 3O75A 2X9VA 1B8OA 1TT5A 4RHTA 3PIDA 3QYJA 5B12A 4JJIA 3L49A 1RABA 4YACA 3V97A 3LKDA 3GROA 1E1YA 2VDJA 3AUYA 1EFKA 1SKBA 3U81A 5JZSA 3Q85A 3DMNA 4X3CA 3GRRA 1VGQA 3KJGA 3ZCXA 3K20A 3DV2A 5JIBA 1SCKA 3GLKA 3PDJA 4RK1A 3G2IA 3FHLA 4LQLA 1YT5A 1C7FA 2O2CA 2R7NA 4N7MA 3NJ8A 3GZ4A 1NMEA 2Q3CA 1Y9DA 3EGXB 1HLPA 1XRPA 2HF8A 2WJZB 3FE2A 1XZCA 2WJPA 2WP0A 1X7XB 2IYQA 5IRCD 4UDXX 1IQPA 2EOAA 1G7SA 4NYMR 1BW9B 5BW4A 4K86A 1FUIA 5HYVA 5FNZA 4E3ZA 1XLUA 5K20A 4Q7LA 4JUBA 1Q0HA 5FUQA 2PX6A 3HKCB 3FTFA 3PL1A 5KIAA 1LPPA 4YJKA 3INNA 4XW2A 3WLNA 5ARBA 1GSAA 3KZ1E 1E58A 4F71A 1BHO1 3ZCRA 4KRFA 3JQPA 2CF5A 4MQ6A 4YP0A 1R4NB 4BLRA 1AKRA 1KNQA 1PSWA 2C0CA 5GJCA 4ESHA 2PFSA 5CXQA 3WL8A 3QXJA 1PW7A 1QHHA 5ISMA 2BF7A 1CUHA 3ZC3A 4QOGA 4RMGA 4TWAA 3A1UA 2I91A 1R8YA 3N3AC 1Q1GA 5DYYA 5FOUA 1K3FA 2RJ3A 1H8EA 1U98A 5FUWA 2ZJ7A 1M8FA 3GL9A 3MQ2A 4F86A 3BG5A 4NICA 3ABIA 4P1ZA 3RIYA 3HLTA 2VJMB 3EF3A 3COYA 4XIGS 4BO1A 1JA1A 3OWOA 3V1NA 1E0JA 2DJ5A 4JK3A 3C43A 3C3EA 3EZYA 5KTTA 1XG5A 4JT9A 1XO1A 2ZR8A 3O31A 3ZI4A 3HKDA 4PY2A 4MI3A 2J09A 2O1WA 3FMFA 5FQNA 5NLLA 4U9IS 5IAEA 1ZZEA 2FMFA 2R8PA 3MAGA 4K46A 3U4CA 1E4VA 1KJZA 1G3IA 3HVUA 4XIIA 3PUWA 1EXNA 1DP4A 1E5XA 3K32A 1KSJA 3AQ4A 4FFBB 5F12A 2QTBA 1NURA 3RDPA 4L4ZA 3UJHA 4F1KA 4ENRA 5AR1A 2WFLB 4MYHA 2Z6UA 1H2XA 4C5BA 4NH4A 1VMDA 1PT5A 1UBLS 2CLCX 2OBNA 4LHVA 4MR8A 5CT9A 3U0VA 4JBGA 3WLMA 4EG0A 3FWZA 4QYTA 4PXSA 3TRIA 1OIVA 5EHIA 3EEBA 1RP1A 4A6DA 1TFRA 2GPBA 4XQ0A 1IZ0A 3DT8A 4NS1A 2CXTA 2AGVA 3A1TA 1Q1ZA 4H7FA 4KKXB 3AR8A 4G1BA 2CKDA 1G3RA 4GPTA 3GP8A 1YU6A 1H66A 3D4LA 4JEUA 1RI3A 1U0EA 2FUEA 3PC2A 4XSVA 4P98A 1VC2A 2F3SA 3TTYA 4DSNA 2J4FA 3T9EA 3ZX5A 4R54A 2XEXA 2RC6A 3KJZA 4POAA 3VVBA 2Q5LA 2BGRA 4N76A 2XIJA 3E5HA 1TEHA 3L4BA 4G07A 3QWBA 4BL5A 4QA9A 3L4BC 4HH1A 5CYGA 4DUGA 3TLGB 5TF4A 3KR0A 1Q22A 1ZK2A 2BZ0A 4DHEA 5HEKA 5EWLB 4FFWA 4XEHA 5HJEA 2ISQA 3SIRA 1ZHFA 1M2FA 2GUWA 4LC0A 1MFZA 3RAPR 1ORVA 1DQSA 3Q3EA 4DCJA 1GM5A 3C0KA 1XZHA 1X7XA 4GXRA 3ER9A 4PLCA 3MD9A 2YRWA 3ZZ0A 3O4FA 1BW9A 1HMYA 1Q83A 1JDBB 2ZYDA 3HBNA 4FBGA 5AW6A 3GQVA 3V7FA 4FEEA 2JRCA 4DRZA 1LI7A 4LY3A 4BX2A 4C0BA 2AFRA 1GFSA 2NZYA 3SVZA 4F6CA 3KE8A 4K81B 2JFPA 1BCRA 3MOGA 3R5TA 2JHAA 4QOEA 4R68A 4RH3A 4YQYA 4QBKA 1QKJA 1T4GA 1AQLA 1T1SA 4WK0B 3NC1C 2ZLBA 4TMYA 2HAEA 3OE7A 5DCUA 4ONEA 4DDTA 1R4NA 1JAHA 2AXNA 3AB3A 3HADA 4K5QA 4PAGA 4UTNA 1RRFA 1THTA 3KTDA 5DTJA 4Q00A 4KKVA 5K0LA 5TSDA 3ZZMA 4BU0A 1QU3A 2UYHA 1IN7A 1IHXA 4PSCA 1BEEA 1JPUA 1K5GA 3ANTA 3CF4G 4HDOB 5EE9A 4DNQA 3HYRA 1UFRA 3JQRA 2X2EA 1RC1A 4EFNA 4BEBA 1XKQA 3WHPA 2I6GA 2WB2A 4G56A 4AWAA 4N40A 2VJMA 3HCOA 2ECPA 1FQJA 1XMIA 2REQA 2YW9A 3M7IA 2VSYA 4XR9A 3NO4A 5IDYA 1T5TA 2ISSD 4YRSA 3SDSA 4RIGA 3NKVA 4DG5A 1YMVA 1TXGA 4YV1A 1JQ3A 2QDXA 5K8UA 2ADMA 5EINA 4QM6A 4CG0A 1VQ1A 1EBFA 4MQUA 5IX8A 1JHYA 2FZVA 4TX1A 1IIBA 2A1TS 2E82A 1M83A 3WLEA 3HKBB 3H1GA 4KLCA 4LMAA 4Y2PA 1U4NA 4P7KA 4P3XA 1THMA 1YL7A 2VPYA 4FSXA 1HO3A 1IUNA 3KTAB 3TRKA 3BD6A 2PG3A 1B8PA 1YV9A 4PICA 2ODBA 1B6GA 2Q3HA 4Y2VA 4QC2A 3EVGA 4LJRA 4IMIB 3WXBA 5K3OA 1N6KA 2ZUDA 1B0AA 3DB1A 4MV3A 3WHIA 3JQAB 5ICSA 2XMPA 1VG9B 2CVQA 4CN9A 1GNVA 1RWBA 1IG0A 1LY1A 1L5VA 3UV6A 2Q9BA 4OM8A 4QICA 4DV2B 1T9KA 3KAQA 4LRWA 3UWDA 3VU8A 3HJCA 1NJ1A 3NAMA 2YIJA 5KSPA 3VTKA 2NP6A 3NH9A 1A9TA 1J99A 4OAPA 3VV2A 3IJ5A 5KOJB 3G0DA 3LBNA 1UBMS 4OPMA 2I65A 4QODA 5IMBA 4YJGB 1DRKA 2CJFA 3NNSA 3HJBA 3BB1A 3OY2A 3QVMA 3OEED 4MGZR 2OMKA 2PNFA 1H2HA 1JLLB 3CEAA 3TTTA 4PLZA 1SBNE 2P3SA 3ESYA 3GP5A 2DBZA 3C74A 3K6JA 1U0TA 2X4IA 1AUXA 2EG9A 2XUAA 4WAUA 3WK8A 3AGPA 1I10A 1KL7A 3BZBA 4AJKA 4B32A 3V55A 2BH2A 3IXMA 2OV6A 5EQFA 2PNJA 5LMNB 3HFRA 5D85A 1Y6FA 4HB2A 2PZJA 3GAMA 3R3HA 4PSUA 4JQCA 1W5EA 2CZCA 1NNI1 4ZXFA 1DXHA 3ANYB 3HZHA 4XASA 1R3UA 5ALPA 1DG3A 4H7IA 2HFKA 1A9SA 2IGBA 2XXBA 1F0KA 2VAMA 4RK6A 4H08A 4AFNA 4ETWA 2RBKA 1Y7IA 3I4CA 4PU0A 1KTVA 4QDUA 4XDGA 4KHPB 2A4MA 4X84A 3PFNA 3PQCA 4L75A 1A5SB 2GEUA 5KQSA 2Q27A 2B34A 1A4XA 4GSKA 5EJGA 1IM2A 2BGGA 2O07A 2L19A 1F1BA 3CLSC 1O7JA 2RGDA 3NANA 3L7KA 1TL7C 4F6RB 1V25A 2JIBA 4N3AA 2J4DA 2PT6A 2ZU6A 2BEUA 2J45A 2O7SA 5D5QA 2B4QA 2PWAA 3H3JA 5H59A 3F73A 3VNUA 2AFIE 4KX5A 1XALA 3WLRA 4KTVE 1O6GA 2MCFA 3ROQA 1JXAA 3ND7A 5BP7A 1DEKA 2X19A 3E3NA 3D81A 1O9HA 3GXOA 1V39A 3A10A 4YT8A 2FFBA 2A7QA 4R5HA 2GN0A 1OOEA 1IXZA 1NIJA 2JJ1D 1KVSA 3WX0A 4BNKA 4CPDA 4BNWA 4UUMA 1AN0A 3NTXA 2FTKE 1NR7A 5FI1B 1PGJA 3EGEA 5AI0A 3VPAA 5TPWB 2DHEA 1SAYA 1XUOA 4ZO9A 4EW1A 4PW0A 4YP1A 3NHZA 3TDKA 4OTZA 1G41A 2DTXA 4C6RA 4TT3A 2P62A 3PA8A 3G8AA 3HKBA 4PG8A 1KZ1A 1QOZA 2D4AA 1M6YA 3EUEA 4RV4A 1KMHB 2PY6A 3UIEA 3GLHE 2ZREA 3GFPA 5A05A 3KT0A 1BKYA 4LJ8A 3TH5A 2A5FA 1ISMA 3AETB 1V5IA 1VL2A 1MH1A 3MUFA 4R1UA 3TX6A 4ZCMA 3OIYA 2WYWA 1KXZA 4NYIR 3EIFA 5TXGA 5C81A 3E15A 1BU5A 1Y80A 3QVLA 4BQIA 1BE8A 1LPMA 4JVNA 2WQZA 3UG6A 4RHYA 3D59A 3QQPA 4C7XA 5SY4A 4BC0A 2A6PA 3LC1O 1PVVA 3VR6D 2I03A 1C7RA 4S1VA 3UAVA 2GDJA 5EESA 3TRDA 3ZHQA 4AU1A 4KRGA 4OXNA 2OT3B 5JZVA 3ZWPA 3PXBA 4DSOA 2I99A 5DHFA 3G9QA 1L7EA 1GNTA 2HU2A 2ZETA 3EULA 4KR3A 3CZAA 5JH7A 3AJEA 3G49A 3D0OA 3H4MA 3RK1A 3H83A 4KWCA 5TS2A 1DOAA 1T15A 5L40A 2FGKA 1KYVA 4KXMA 2JH9A 2EAUA 2LDBA 4HJXA 3HRIA 5E95A 5BW8A 1HYQA 1UBRS 4H35A 3VZSA 3ZX4A 3HCNA 1IOZA 3I45A 1I0LA 2JFWA 4GE0A 4GKVA 4GEGA 4OX9B 1DKLA 4AY2A 5EMKA 4OQQA 5DSZA 3EASA 5BN1A 2JGMA 1YRBA 2AR9A 3R3XA 3WQQA 1AMOA 1GZ7A 3DZFA 2NUAA 2X0DA 5JEDA 3WGHA 3H9BA 2D1SA 1ECJA 1BJRE 3DLIA 3KKLA 1T5DX 1FDTA 2WV7A 2WUVA 4E2YA 2WNIA 3B6MA 4MMYB 1JLSA 4G23A 2ZXUA 4BHTA 2GM3A 2C7VA 3BKXA 2NXEA 3O8DA 1FXWF 1FUYB 2PL1A 2FPKA 3EGVA 3D3QA 3HO8A 5TJ9A 3VGPA 1BOOA 4OQFA 2I8CA 5E2IA 1F2UA 1ZD3A 3PLRA 5SYMA 3UKJA 1G9TA 4OQEA 2IRWA 2ORIA 2V7UA 4K6KA 4M0KA 1DUSA 3QENA 3CVJA 3ND6A 4YMIA 1TK9A 4P54A 4C7OA 3UJNA 1ONOA 4RESA 1YBMA 2PMCA 1RI1A 1J24A 2AZMA 2JFYA 1A8HA 1H8HD 3RWOA 3SXJA 1EAMA 4O8ZA 3MUOA 4XDZA 4E2XA 1P9OA 1VCIA 1KTIA 1OH7A 1ABFA 2XHZA 2R66A 2C92A 4DIFA 1PL6A 3NTOA 2RB4A 2PSEA 3LY8A 2SKDA 4JLUA 2EARA 2C9DA 4E13A 2IDZA 2ZR9A 4DNPA 4LJKA 3ROFA 4OL9A 4Z51A 2BHLA 4S1NA 5TPWA 3O8RA 2FSHA 4S12A 1LLCA 3BE4A 3NOVA 2WEKA 3ZE1B 4X00A 3ECSA 2NG1A 4IX9A 1KJYA 1HE8B 5HXAA 1U5AA 2X0KA 1FS6A 1GL9B 4E3WA 4HMOA 5E3HA 1GL6A 1DARA 3O2SB 2ZATA 1QHXA 2E0IA 1NQXA 3IGFA 4XFJA 3ZZ1A 3AETA 3QKTA 3UWPA 5HZGA 1GG2A 4JEHA 2RAFA 3KKEA 3DVAB 1CUCA