1P3Y1

Mrsd from bacillus sp. hil-y85/54728
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
183
structure length
171
Chain Sequence
ISILKDKKLLIGICGSISSVGISSYLLYFKSFFKEIRVVMTKTAEDLIPAHTVSYFCDHVYSEHGENGKRHSHVEIGRWADIYCIIPATANILGQTANGVAMNLVATTVLAHPHNTIFFPNMNDLMWNKTVVSRNIEQLRKDGHIVIEPVEIMRGLITPDKALLAIEKGFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords MrsD protein
publication title Structure of MrsD, an FAD-binding protein of the HFCD family.
pubmed doi rcsb
source organism Bacillus sp.
total genus 52
structure length 171
sequence length 183
ec nomenclature
pdb deposition date 2003-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF02441 Flavoprotein Flavoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1950 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Flavin prenyltransferase-like 1p3y100
4RHFA 2EJBA 4ZAVA 3WISA 3ZQUA 4ZAWA 4ZALA 4ZAGA 4ZAFA 4ZAYA 1QZUA 4ZANA 1P3Y1 4ZAZA 1G63A 3QJGA 4RHEA 1MVLA 4ZAXA 4MWGA 1E20A 3LQKA 3MCUA 1MVNA 1G5QA 1SBZA
chains in the Genus database with same CATH superfamily
5TB5A 3AP2A 1Q7RA 3R5XA 5DV9A 4YAUA 5KYXB 4Q3KA 5A7FA 3AV0B 4JVSB 2FSFA 3BL6A 1B43A 4MVJE 3SC4A 4D46A 2C2HA 2ZIWB 3O38A 2Y0DA 3DM5A 3JD4A 1NQVA 4LXUA 4DCPA 1H8EA 4JU9A 1EJBA 3PJGA 2MIIA 2PUEA 9LDTA 2IWRA 4KIFA 1W94A 1F60A 2QT9A 4GM1A 3RHZA 3V7FA 1ICIA 3HDQA 2CD9A 3HPRA 4E5NA 1ZR4A 2QRLA 4XIGS 4LZNA 3MTDA 5JPDA 2OP1A 4GOXA 2OO5A 3NOXA 5AHOA 5TARA 4QD3A 2BEVB 1K92A 1U5BB 5J4HA 4LFAB 5E38A 3THYB 1G5HA 2ZYSA 1JDUA 5TQ0B 1AKEA 3E8SA 2UUOA 421PA 2C59A 4NARA 2B9EA 4ZTBA 1RACA 3S5UA 2FRXA 3LF1A 3TBFA 3GT7A 3DE3X 1G8GA 4EL0A 5BOSB 2XCUA 3WA7A 4RNCA 2REOA 3FB1A 1F8YA 1KYXA 1N1EA 4XEHA 1YVPA 3HE3A 5CFRA 4LHWA 2NPIA 3JVIA 3RSLA 4QZVA 1RWQA 3CO5A 3TVTA 2UUAB 1UK7A 1HDZA 3K2IA 5F2OA 4B2LA 2KW5A 3HV0A 2JHGA 4D82A 4M60A 3FWZA 1IK6A 3ZE2B 4I5GA 3IVCA 2PRKA 4I4NA 2VVTA 2E55A 1XRSB 3GGOA 3MOGA 4NLLA 1YGPA 2P6OA 4LXIA 1YQUA 4DDTA 4BAUA 1G8AA 2EKPA 4JU8A 1SC3A 3LP5A 2O14A 4IDAA 3K20A 2QZJA 2Q1TA 4HI0E 2OCXA 2J09A 3W5SA 4U9UA 1CJKC 2CL6X 3PFIA 3GLQA 4HWGA 1OTYA 3C0KA 4DTCA 1IG0A 5HZKA 3LT0A 2HJHA 1YI0A 4JNKA 4BNUA 1G16A 1RQPA 1W4CA 3EWIA 3P45A 3GLGA 4DV0B 4NOKA 3OQIA 1CDEA 3LUDA 4XTRA 3I9NA 2ZIFA 4QM7A 2XBMA 1K3UB 4JMLA 2X9LA 1ZGZA 2JGFA 3HL4A 4KYVA 5JNWA 3QSYA 4ZODA 2YOFA 3EEFA 3OZXA 2I76A 4U6SA 1LNSA 4DEYA 4ZI2A 5KYNA 5IYZA 3AB7A 1LV7A 1FX1A 4G65A 3FY4A 1C1YA 2B0JA 2CCGA 1ZK0A 1NFFA 2C8KA 2FCAA 3HCDA 5J2TF 2J59A 4N0PA 5I4CA 2WT9A 2W2PA 3FLMA 2QAGB 1KETA 3ICCA 1E9VA 4TMZA 5HZHA 3D6NB 2FWPA 5EEHA 3UWMA 4Q02A 1PKEA 1SIOA 3LPMA 5EUBA 2O19A 4NICA 3UJDA 1KP3A 1HFWA 1PS0A 3DEJA 1P74A 5M7EA 1CY7A 3DTVA 3IQEA 2FQQA 2J6BA 2BEVA 2CLDX 1VLQA 3D7NA 4K9SA 3FLBA 4NE9A 1U5BA 5FOVA 2FEKA 3KWMA 4WJZA 2PX4A 4AS2A 1EX9A 1QYRA 1SKUA 4LDQA 1Z2CA 4MX8A 3U48A 3OQVA 3ELUA 4PPQA 4B0PA 3H1EA 3E4CA 1IZ9A 2CDNA 4IJMA 4YRLA 4MVYA 4XWTA 1E4OA 1SXJD 1T3LA 1SCKA 3L7LA 3VGJA 1BU8A 2A0YA 2CE2X 2WVAA 3DEZA 5E6RA 1UBUS 2X86A 4P32A 1HNZB 3NYIA 4R68A 1JEQA 3UMVA 5FUVA 1DG1G 4FVTA 4M7RA 3QNMA 5I9BA 1SAYA 1H2ZA 4TLCA 3RRBA 5K0ZA 5KVSA 1UAYA 4IICA 2RC6A 1F3OA 4BMVA 2RHDA 1O3YA 2W5UA 4WASA 5KYVA 2J3EA 4ENUA 2X4LA 2Q7OE 3RHTA 2H1OA 2XW6A 2OHXA 5KX5B 2Q4OA 4QELA 2DERA 1UT5A 3OBIA 3REGA 2DRIA 2XUZA 3H04A 2PSEA 3G5UA 3EFEA 4QJ4A 2ISSD 3L8FA 2ZPUA 4N41A 3KYBA 1M66A 3ESCA 4NBSA 1LDEA 4ZVMA 3LFTA 2CC2A 1JQ5A 4EEZA 2WSIA 2ZUBA 4O3FA 4N7MA 5DHTA 2W4MA 4CMJA 3BF7A 3PBKA 3C5VA 4Y2PA 1BOFA 2UZ0A 3ZDXB 5AVZA 4IBOA 2XQIA 1LJLA 1Q1AA 4DSNA 3L2OB 3P0IA 3NHWA 3QYPA 4HUQA 1TOAA 2BYTA 1T8PA 4GNKA 4RF5A 2VQEB 1E2PA 1EJ0A 3MW8A 1PEDA 2UZ1B 1XQWA 4J0QA 4OJNA 1KBQA 3VYVA 3WLLA 4BATA 2RAVA 5BWOA 3U1BA 4UKDA 1C9NA 5DCYA 5EE9A 4AUMA 3A32A 4UVHA 4P58A 5FAKA 2GCPA 1YFKA 5GVSA 1BXRB 5BV2P 3TEFA 4DCOA 1XEAA 3CPJB 1TA4A 2VEDA 4FD2A 5M29A 1Z7GA 3LRXA 1BDMA 4UQOA 4TGLA 4UXJA 3W2GA 5FUMA 2LKDA 4FCVA 4H0NA 3DM9B 1H65A 1YS4A 3Q6NA 3THOA 2HMVA 3G6WA 5AT1A 2J67A 3PE3A 5K05A 4RO0A 1ZCAA 4RESA 2YY6A 1IRIA 1NVBA 1OC2A 2ODEA 1AK2A 4FNAA 4YAFA 3M34A 1N33B 1MV8A 3ZHCA 3C8UA 1S3SA 4TWJA 4ZDJA 3Q2KA 4JAVC 4KQCA 3CNEA 1ABEA 3QITA 2VJLA 4ZD6A 3CCFA 3ZLUA 3Q7PA 1U7XA 1DBSA 4MLZA 3G9UA 4MRVA 2I29A 2ZUUA 3W34A 4EIWA 4RWEA 3PJRA 3DVSX 1NW6A 3P0FA 3HUFA 4ZQIA 1T0UA 5JMPA 1BCSA 2FPSA 4JDUA 3S40A 3MUOA 2ACKA 2P8JA 4OMUA 3FBGA 4AKTA 2R6HA 4HDKA 4HN4B 3F9RA 2MINB 2ZJYA 2CNLA 1XZBA 3EW7A 2VEOA 3OPYA 2G71A 4H3SA 5KX5A 5FNVF 2O4CA 3AXSA 2O52A 1MUUA 1DJMA 3FTPA 2IJGX 4P4GA 4JNCA 1T4CA 1UK6A 1MB3A 1V26A 2GHRA 2NT3A 2PDAA 5K9ZA 1W9HA 2CV0A 8MHTA 3OFSA 3F9CA 3CM0A 4UZSA 1E64A 3OM9A 5JSUA 3MBKA 5F2EA 4S1VA 5JNLA 3K53A 4Q7EA 5IM4A 3IEKA 3OJ0A 2CNNA 3QBVA 3ORYA 2J3MA 3F6YA 2OMEA 4GC5A 5JZOA 3RU9A 3TE7A 3AVQA 4LXYA 1CUXA 2P6MA 4KKXB 1L3CA 4FEGA 3UJ8A 2NQ2C 2Y6UA 5KNBA 1Q0HA 2IPNA 5KYTA 3TI9A 2I3DA 1G8MA 1X9IA 3ZVRA 1U1IA 4AKIA 1GZHB 1TM4E 2OB2A 2WUDA 4F4UA 5HSGA 1DFHA 2DGDA 3MMSA 1YRLA 2F3RA 2OVBA 2FQ1A 3FTCA 2R1VA 3GDGA 5AK4A 4PWYA 2QL5A 1GWNA 2V6GA 4L1KA 3P9QA 1P2UA 4DANA 1THGA 2PXAA 4DNQA 1D1SA 3ZGXA 3VU9A 2XKKA 5KO2A 3TCNA 2AUTA 3MWDA 2GM9A 1YDEA 4Z3KA 5AUPB 1CR2A 1E1YA 1P0CA 1XWWA 4DJTA 4OB6A 4X93A 2CT8A 4BLPA 2CMKA 3EQZA 5CAEB 3AONB 4I3GA 5T64A 2QUHA 1YB4A 1CJVC 3HY4A 3QUAA 2DQZA 4X60A 5ALHA 3O4IA 1CUHA 1DKQA 4M83A 1IPFA 3OT4A 4A8JC 4X24A 4EB3A 1KMNA 3DL0A 3KIPA 4OH1A 4HQRA 3U7FB 2XXAA 2FUG6 2ZSBA 2C77A 1M6WA 3E81A 1K8YB 1Z0ZA 4LWPA 1OT5A 2V98A 3F4LA 3KKEA 1ULZA 4D8UA 4FONA 3BFKA 1N2CB 3GI1A 5I8ZA 3ENQA 4BMNA 3ZVMA 2W6QA 4JJFA 4DDKA 2NYVA 1FBNA 3ICEA 3FIJA 1ICEA 3EB9A 1U8EA 2Q3DA 3ROMA 3R0XA 4J4TA 1TRKA 2LTAA 1NVAA 1NVMB 3OM8A 4GG1A 4HGQA 4YRCA 3GROA 2H7CA 5EMNA 4C78A 2VP4A 1FZTA 1WBJB 2IW3A 2IVFA 4G4SP 3OQNA 1EWKA 4DSOA 2WZCA 5AHXA 1R8JA 1N2XA 5D1NA 1P44A 4GOLD 5C8YA 5CDHA 1II9A 1YOVA 3JQEA 5AKXA 1IN7A 1GRQA 3RU3A 3D4BA 2EFJA 1NJGA 3BEOA 1VLJA 1ZQ9A 1XXLA 3A9WA 3Q1KA 4HADA 4TVSA 4OLAA 1NA5A 4FOTA 4QPPA 1XAJA 1Z4PX 3H2BA 2GA8A 3H16A 5G4KB 1S01A 1YACA 1VMIA 4GKVA 5B3JC 1T34A 3SZRA 1YR3A 1SK9A 1YHNA 4YPFA 1BE1A 2ZVDA 3FLAA 3KOUA 2QRMA 5CDYA 3GWGA 2JGDB 2QM3A 2QLMA 5L7TA 1A4XA 4IP0A 5AKJA 3TQQA 3USES 2PH1A 4GR4A 1VL6A 1TZBA 4TM8A 2I62A 3TZQA 1ODTC 5CLIA 5C7YA 2DQSA 3JVEA 1ZN8A 3VISA 4WBSA 5AXDA 1T10A 1IXZA 2Y4OA 3LNCA 1Z0JA 3QXXA 2ZOSA 4BFXA 2FEMA 4LWQA 1WZ2A 1AE1A 1PJTA 2Z04A 1JKIA 3LSTA 4JLWA 4RJKA 5K20A 3FDFA 3I6IA 2RGBA 1TK9A 1ZCZA 3L49A 2VJMB 4GZ6A 4HWPA 4LI0A 1QZUA 4OHPA 5CAEA 3FI9A 3ZHSA 5AI6A 2FHSA 1YS2X 3D59A 3ZWPA 4JGGA 2IUSA 2X0DA 3C6KA 1UBNA 3E3AA 3IA7A 3VSDA 3ZWBA 3RRMA 3EQ2A 1RQ7A 3K35A 1XDUA 3E2IA 4KE7A 5AMXA 5IN5A 1CJSA 1H2YA 3E53A 4WZAB 2RHHA 2R86A 2PZKA 5DO9A 1P9OA 3UKJA 4ENPA 1NR5A 3OOHA 4N03A 4P8RA 1QHYA 3ZDZB 4ALNA 4F12A 5C8VA 1Y80A 2PH7A 2QMYA 3K05A 1FFBA 2DCMA 1GPUA 4LOIA 5TQ2B 3AY6A 2E48A 3O4VA 2FSPA 3SMQA 3TRKA 1I6LA 2A94A 2BCJQ 3ROZA 2PX2A 1VCNA 3I30X 4CKEB 2QRQA 4IXDA 3MPUA 2B7CA 3A14A 3N2GB 3V55A 3QE2A 1KMQA 2XNJA 2HD4A 1PR6A 2ZPTX 1EWTA 3IT1A 3Q0TA 4IOJA 3P4YA 3H9CA 4PZDA 3BB1A 1U11A 2FK7A 4TMFA 4C3ZA 2N47A 4EHIA 2MYNA 5DLYA 1W93A 2NT4A 4B6SA 3CR7A 1CUDA 4IQ8A 4QIHA 2O0JA 4L5BA 5CNKA 2PVCA 3RHFA 1J1UA 1P7PA 1UJ5A 3H75A 4CN8A 1Z9BA 2ZVQX 1W0KD 1XFDA 1P7CA 5U4XA 1NDHA 1RJ9B 3GFBA 3H1FA 1X3SA 3CVOA 3T1OA 1I4OA 3V97A 5JJCA 2JGDA 2GTIA 2C84A 4LSGA 4AKEA 3T7IA 3HDHA 4LOLA 3FKSD 1NJFA 2ZWIA 3C3EA 3UWOA 3FNHA 2GX6A 1BEZA 1X7GA 1EXMA 2ID7A 2N1BA 3OPNA 3PUWA 1TU0A 4D4LA 1MOQA 2GBGA 3K0BA 3MMNA 2OLKA 3HR8A 3HZZA 5FRDA 3M82A 3QEMB 1V3UA 2ILVA 2W83A 3I6MA 2IK8A 3NT4A 1WUYA 1RBMA 4MKRA 4Y1FA 4PSCA 1GG8A 4ZOCA 3A31A 4ABTA 3E0XA 3UGTA 1PQ4A 4LY9A 1VC2A 2QL6A 2HZBA 2O1XA 3EY9A 3I3OA 4WY2A 5ISMA 3VYSB 5IZ4A 3NVDA 4NENB 4XR9A 4LHSA 4HG2A 1UXHA 3AILA 1GZ7A 1NKVA 2IS6A 5CLHA 4P1ZA 4TWAA 1PEKE 4CEJB 3RVQA 1A2BA 3AU8A 1VL8A 4KJXA 4MR7A 5U1PA 3GJRA 4EZBA 1DRJA 2WIAA 2PMBA 2ZJAA 1FDTA 1HORA 3KQMA 1ZUHA 5LFAA 4MRSA 2WA2A 3I23A 3WZ2A 3TD9A 3DV2A 4WZAA 1J2EA 1W8DA 4LV8B 4QEKA 2RI6A 4JT4A 1P1HA 1M0WA 2ZBVA 3EDMA 3WK9A 2VRNA 4MB0A 1K6JA 5H3LA 1BYIA 1KYIA 1N3BA 1J25A 2DLDA 2VDMB 3PEEA 4YRFA 1ZG3A 1V5FA 3SBXA 1NMSA 1DZ3A 3I5XA 2OZVA 3PNYA 1GGVA 1T2NA 4R9VA 5LZ7A 1TVCA 3LDAA 3KQUA 5LWHA 1IYZA 1ZGBA 3DZCA 2Q27A 4WVFA 2V74B 2H31A 2YWFA 3RYTC 3FYCA 2GPAA 4C7MA 2B30A 3G8BA 3FLEA 5DBOA 4ZI5A 2NO5A 4LXGA 5HRCA 5J23A 1J9ZA 4J7CA 5JC8A 2AB0A 3HYRA 5CXUA 2FSUA 3Q7QA 3C41J 1A72A 3O74A 1THTA 1KMIY 2FG6C 4FDMA 1QZTA 1XZIA 2X5OA 3MS4A 4TZKA 3VX4A 2RH8A 5ALGA 4S1OA 4YCLA 2WI8A 4X1YA 2IEAA 1T3ZA 3NHSA 3L04A 4XYLA 4M0EA 5KCZA 2AC4A 4RKRA 3GJXC 1HDIA 2JIDA 4RK6A 4OLJA 4YUAA 1VLLA 4EW2A 4QU0A 2QE6A 4ZTZB 3LX8A 3EXHB 3DTVD 4DE5A 5EKUA 4UXIA 3RS7A 1KVRA 1FYWA 4TVOA 3E1GA 3RRFA 4D0LB 2QT1A 1E60A 1LPAB 2Y92A 4D8YA 1I2CA 1LD3A 5IUNC 1GAQA 1KI7A 2ZBPA 3LKVA 1SXJE 2GEUA 1XAIA 2QOEA 4E08A 3V00A 5AJVB 1ZD2P 3PZRA 3QOWA 4JCOA 2Z6AA 1GA1A 1DJQA 3PC8A 1H2HA 1SUEA 4YJ2B 4AO7A 3TTTA 1RE1A 5LJLA 1R3DA 1H23A 3H5WA 3QX8A 2GM5A 3D54D 1RBZA 5EE1A 1SZCA 3GU3A 5CW2A 1KGSA 1NOIA 1L8OA 2ZB4A 3IQXA 4MXDA 2Q3BA 2VNHA 2FX3A 5LBTA 1XJWA 3CLRC 3A37A 4MS1B 3ZWOA 5JV5A 1QE5A 1HYEA 1G21B 3PDIA 4Q3DA 3NIWA 1NX6A 5DI9A 3SD7A 1KHHA 3RAEC 4N40A 5KIAA 1B15A 4JLNA 4DN6A 2J9FB 3O8RA 2ZXEA 3M6IA 3V4PB 1Y1QA 1Z6XA 2VCYA 1BWQA 4WZZA 5I7AA 2OBBA 2VG8A 1M54A 3ETDA 1LDGA 3PUIA 4LE1A 2XZOA 2BT4A 1VLVA 3ZWVA 3OIGA 5AM5A 2FWJA 2JFOA 1Z7EA 4MS3B 1D6JA 1Z6ZA 3WIOA 2QR2A 4HGNA 1ESCA 3NT5A 4WERA 5ALSA 4BE4A 1VI6A 3ZZ0A 1OC4A 3IV7A 1ULBA 1ZJYA 4YMLA 3RUFA 5DH9A 2OA0A 2V59A 2H7YA 3X1ZA 1IVYA 2XVXA 3GYBA 4LKOA 1IOZA 2ASEA 4QYSA 3CJRA 2HA4A 4Q7KA 2HV8A 2B6HA 1XTRA 4LOJA 2WKQA 4FZJA 1W30A 5IJ9A 4IR7A 1R9NA 5DM70 3KQOA 4RVCA 3BS4A 5C80A 2GZMA 1SRQA 2H4ZA 4DIMA 1J49A 4L5JA 5K8IA 5ELXA 3H2IA 1RXSA 4FFLA 3LPCA 3M4NA 1ZVQA 4WX2B 3O4FA 2HXSA 4HF7A 4IIVA 4JY7A 4WNYA 3RFFA 1V39A 4D44A 1M2JA 3PIDA 3HADA 1VRVA 2HAEA 2Z3WA 4H18A 4TS1A 5E6SB 5T41A 2VT2A 5MFZA 1CLUA 1DXQA 4GPD1 3MIIA 5LDGA 1C5KA 2IOFK 2FB9A 3A70A 3ZCTA 5LMZA 5LNK1 1TCCA 2OGZA 1ODFA 2NYUA 3R0IA 5L4LA 4Q21A 2W0MA 3L01A 1LTKA 4WIAA 3E0QA 3VPSA 2MDTA 2VHXA 5DHUA 3ZIAA 1HE3A 3AUYA 4FU0A 1GZDA 1W73A 4XQ0A 3TSWA 4LEIA 3L92A 1K8ZB 4ZOLB 3ZX5A 1KQPA 4BMDA 3H65A 5IK2A 5JECA 3KU1A 1Y1LA 2AHRA 4WXRA 2R7MA 5LZ9A 3PFHA 2G6TA 4DRXB 1CUUA 4IV5A 1ACJA 1OX4B 2A1UA 1S0UA 5AQEA 1P2FA 3ZTTA 3MTEA 2GD0A 3GDOA 4B3MB 3B48A 3NWOA 1S6YA 3BK2A 5DNWA 4M3NA 2I7CA 3BEDA 4P3XA 3LHSA 3SCZA 1W36B 1CXZA 1LX7A 3UUFA 2Z2KA 2OBNA 1U0LA 4ITVA 1EWVA 3ZU3A 4TT8A 4X45A 5D8DA 3DUFA 2IL1A 221PA 1POXA 2CHQA 3N6VA 5DB4A 1YDGA 1P4RA 1ZW1A 1KY3A 3L6RA 4HEHA 3B2QA 3FSJX 4TSFA 1GYRA 4X84A 4Y7DA 4RLHA 4WLVA 3SIPA 4MVJH 1K3TA 3QE0A 4B3IA 3F46A 2QM0A 4PRKA 3V1TC 2GERA 1NRIA 4Z4CA 5EPEA 2PT6A 4OXNA 1T13A 1EWRA 4Q48A 4B2YA 3KTAB 3BJIC 3C3CA 4YP0A 2WTAA 4D8WA 1TAUA 1WEKA 4B3JA 3MNFA 1GDHA 2IPAB 4AZTA 1PJRA 1LPNA 3Q88A 3TSYA 5BN1A 3KE9A 3AJEA 1PVVA 3BFPA 2MJLA 2ZUSA 3SI7A 1J8QA 1VECA 1NDUA 5IAEA 2GHQA 4QFMA 3H9EO 3IMKA 1TL7C 4BFWA 5KX5F 1RWBA 1GG2A 4ZHQB 4NS4A 4C14A 5HGJA 3NP9A 3IPYA 3ZWYA 2N42A 3O6VA 4JGIA 2QBYB 4BGVA 1D4ZA 2PWZA 2FPPB 3CEJA 5EUMA 5AUOB 5IT5A 5LQMA 4W8OA 3VOAA 2W22A 4JP5A 2NZYA 2O2HA 2P68A 2FSSA 2GO1A 3L6CA 3L46A 4J4BA 1KDRA 3VTFA 1MTOA 1RRVA 1RIFA 2X2OA 3NDJA 3VU8A 1U7HA 4CMGA 4FNOA 2C94A 2X0NA 2F1OA 2NZVG 2BHLA 3PC4A 4FFMA 5ECWA 2DSNA 2ISCA 1YR7A 1Z5PA 2IYXA 1GUFA 2PTGA 4MV7A 5BPFA 1BJTA 1G6OA 3TTYA 4MI9A 3FCYA 4DAOA 1UXKA 3G5AA 1GTJ1 4U9IS 1NW4A 4KUHA 1Y4AE 1FFDA 3BTUA 1X2EA 2V65A 3FH0A 3M3HA 4I5DA 2CDRA 4QXRA 4BTLA 2IXBA 3G0IA 4JB2A 4MKFA 4M8KA 1ZMOA 4GYKA 1TTTA 1EXVA 4Y67A 3LE8A 4MJ7A 4KAFA 4XLLA 2N46A 2ZJOA 3HQ4O 3OEHD 4RZQA 1TYZA 1JXQA 3SX4A 4BLUA 2CLHB 1G4UR 5LD2B 3LUCA 5JNUA 4JJAA 2NXNA 4R2WA 4M8LA 4ZZ2A 1R8YA 3AC0A 3B6EA 5IAAA 3NEAA 1L1EA 1DIAA 3C5HA 1G5TA 1PR3A 4GPZA 4H7EA 5LLTA 1AKRA 1KJJA 3GJ0A 4LZZA 4MH0R 3A3PA 1A5BB 1I1NA 1MRNA 3MQFA 4RD0A 4R8KA 4UZEA 1GV0A 2ZAGA 4U00A 2GXAA 3DAYA 3SC6A 4BNIA 2JVIA 4CLRB 2FZKA 3NFYA 4AJIA 4P0TA 2V4MA 4CI0B 4IIXA 2GCEA 1ZOIA 2X3UA 4G4GA 4RDCA 4B1FA 3T5TA 2PS3A 3FHTA 1TYAE 4QICA 3PB3A 3G85A 5B37A 3TOZA 2ECFA 2ILTA 1RHRA 4LXTA 3F98A 1UWCA 3LKZA 1NQAO 4Y2SA 1JH8A 5BSKA 2BHNA 2J0EA 4J0GA 5C8YF 5A0VA 3LBHA 2G67A 1K6EA 4O4HB 2I4OA 2VHQA 2C9DA 3DT9A 1LFAA 1X1CA 3QMWA 1MX1A 1V7QA 2GILA 2OECA 2PQ6A 5K4AA 1OQAA 2I67A 3KEFA 3SEAA 4S2UA 4YQFA 2J85A 5HF6A 2PYZA 2ZR9A 1H0SA 1KJZA 1T26A 2ECPA 2NADA 3IO5A 4A3SA 1PUJA 4LVUA 3SJ7A 4C43A 1T3TA 1ZWLA 2WWXA 1LWNA 3S1SA 2ZYVX 3Q15C 4U2FA 4C4YA 2YNMA 4QU9A 1CNMA 5H5JA 1V96A 1HOXA 1D8AA 5ALQA 3S0JA 3AUSA 4LISA 2JLZA 1VDMA 4UVDA 1MX9A 1GKIA 3N8HA 5K2MA 4ND8B 4JXJA 4E09A 5IAOA 3U09A 2HU5A 3WKBA 4IILA 3WLEA 4ANFA 3IAUA 4FMCF 1LK5A 2R8RA 3E7PA 5EZ6B 3C39A 1V3VA 6CHYA 1XD2A 4DV4B 3W5VA 1UKBA 4B7AA 3PKIA 1Y34E 1TQ6A 1I7DA 3CRZA 2D2IA 2HQBA 3K5HA 1EAYA 2NU8A 4WEOA 4AN1A 4MLDA 4PAWA 4BIIA 4ZCSA 2ZM6B 2VXOA 2GN8A 2ST1A 2YV2A 4HPJB 3GW8A 3AJDA 1W8IA 1SA0B 1YR8A 3C48A 2C2YA 2D3TA 4HAXA 3WWYA 4YROA 5KQSA 3ZUGA 4G2TA 4WQMA 1ZKDA 3E5MA 4HDSA 4BQRA 2Q1YA 3AVVA 3JQ9A 2X8JB 3NASA 1KS9A 4IWXA 1VM6A 1ISSA 4GH5A 2BZGA 1E3MA 3K8YA 1GCUA 2P9CA 5M5BA 4Y2RA 5CT6A 2PO7A 3CX3A 5K0EA 1EVIA 1L4FA 3SN6A 3FGOA 4KFRA 4ZJZA 2WD7A 1G4AE 2ZULA 3DDHA 3G0BA 3MRXA 3DOIA 6ABPA 1WULS 4RHYA 4BNVA 2NZ2A 2PL1A 4PR3A 4XIFA 2X23A 4TMTA 1TGYA 3RVMA 5FWNA 1WCIB 3ZLJA 3SX2A 3FOAA 1J2UA 1XPJA 2XWPA 1M1XB 2WV7A 1CX9B 1E2BA 3QIAA 1SOAA 4MWTA 3LGAA 4ZVNA 5BMOA 3SFTA 1T5IA 1PE0A 4G84A 4LJLA 5GZ3A 5CNIA 2GVNA 4XB2A 2W2KA 2MSKA 4H35A 4JKOA 1I0IA 3AYXB 2Z8ZA 4TS3A 2R8YA 3Q8LA 2WKRA 3D4OA 5HZMA 3JD0A 5IT4A 1EWQA 2V7PA 4N3AA 4Q7QA 3KVRA 1GD1O 2FOIA 3C3YA 1KK2A 3ABOB 2FPWA 3H05A 4FI3F 1ZFNA 2W2LA 2QZZA 4MYTA 4OK5A 3R6DA 1KDYA 5A7HA 3NRJA 3Q2IA 5B4UA 1QP0A 3AIOA 5TPZD 5ED4A 3IHKA 3TN7A 2ZSDA 3BMNB 3VHQA 1ABFA 2N3ZA 1H22A 3RKSA 3U3KA 1II8A 3ZZNA 1HYQA 1VIYA 1C2YA 2P6NA 4HMOA 3OZTA 1FSFA 3DUWA 5F7OA 1E5QA 4PM4A 1UBLS 4K9MA 2Z1DA 3W3AA 5EIOA 3WL7A 1CB0A 1WXGA 3ITDA 4XJXA 4OHFA 4ZYLA 2X3FA 4MUIA 4D8XA 4OXYA 3NS7A 2B1RA 1USWA 3BJEA 4FZ5A 1LBTA 4I9FA 1NVFA 4LYHA 3GZTB 2RH5A 5FA6A 3HA2A 3O2JA 4HUTA 4MA0A 3CCBA 2GPNA 3GLGE 4Q5IA 5JS8A 2I7XA 3KKOA 2C4TA 1HYGA 1XZJA 2PQ0A 1EUCA 1STOA 4C7XA 4MIYA 2P4SA 5CHEA 3SC2A 4Z7QB 2CBXA 3FJOA 6LDHA 5FWXB 5HIMA 3EVGA 2FN3A 4D9FA 4Q16A 3JYPA 3FDIA 1OX5A 2QL9A 3IR6A 4J03A 2ZUEA 2X8JA 1THMA 3CX6A 3E15A 1VDZA 3HJNA 4GSKA 4A10A 1JE0A 3SJUA 3KPJA 3GVPA 4H31A 4IDFA 3LBYA 3AUKA 3LHKA 4TYPA 3RS4A 3LXUX 4K6FA 4M22A 3ELBA 5EMKA 1GTSA 3AWDA 1N1DA 5FDFA 1A5SB 2VTEA 3O2SB 5L6MB 2WJIA 3COWA 2GF9A 1KY5A 5CFOA 4CXMA 3D3WA 5KHLB 4AKHA 1TPYA 2BGLA 2WJVA 3BRQA 3WIBA 3X3HA 4C2AA 3OHSX 1PNOA 4NFSA 3R40A 4XRRA 2XNCA 3S99A 2CYBA 3KYDB 3GFRA 1OB5A 4R05A 3BUSA 1VCOA 4XPZA 1ZD5A 3F6EX 3L1HA 1ZM7A 4FZRA 4YCMA 3W5AA 3ZE9A 2CB9A 4HRYA 4M9CA 4XVQA 3DWFA 3M70A 4IKOA 1XQYA 2QVYX 4KR3A 4DR3B 1PTKA 1RP1A 1CULC 1UC5B 2JGNA 3HKDB 2NV2B 1E0JA 3HP7A 4YV1A 3CSSA 4MGEA 3U40A 2BUAA 2HNBA 2HPVA 4PSUA 1RAAA 2AN3A 4UM7A 4OM8A 4PLVA 5H16A 1GSAA 3H87A 1U0NA 1L4KA 1Z73A 3OZSA 1VPDA 1YRHA 3U13A 1E6WA 2BEUA 4F6LA 4PR0A 3BMNA 1SU6A 4MW6A 4ILKA 2XNKA 3T9CA 4WOJA 4E22A 1LQTA 1PLLA 2DWQA 2G5CA 1X8JA 2C92A 3AEKB 4F11A 5CVTA 4CTOA 3UMCA 3ABIA 3B1XA 1MF7A 1Q44A 1RFLA 4UU7A 3E03A 5FOWA 3A04A 4KDCA 5FI0B 4FK8A 4FUTA 4L07A 4RHXA 7GPBA 1JDPA 2GCNA 1JILA 4LGYA 5LLSA 3DZKA 2BSXA 1EDDA 2D1YA 1MABB 4DA0A 1QQ5A 5CFZA 4XYBA 3HJUA 3IAS6 2G25A 3A3OA 4OHMA 4BRSA 5CD9A 3OM1A 4QBIA 2BMEA 4X20A 3VPXA 9ABPA 1Z4KA 1GPBA 4FNMA 2A92A 3ONDA 4OPMA 4OVKA 2HCBA 3ANXA 1OU0A 2A4MA 2QJTA 4A36A 4OQPA 1CZKA 2Z4RA 1QGDA 4OLHA 3U7RA 2ZWVA 3KEGA 3ZDFA 1G8SA 2OB1A 2QYHA 4O33A 4P2BA 3WG9A 1I4DD 3CT4A 1UF9A 3SLKA 2L69A 1VHJA 2R7AA 3AY3A 2G17A 2Y4NA 3URKA 5A71A 5FPSA 2YW2A 3COYA 3ONEA 2C7BA 4Q4JA 5FLXA 4I3HA 4OM7A 5GVRA 5F12A 1S9HA 2DKNA 3FIUA 4HTFA 3REQB 5KU1A 1RABA 3COVA 4IMRA 4TL8A 2FWIA 2XRMA 4FWBA 4EH1A 1K3FA 2QN7A 3MSXA 4PGHA 3GPDG 3MAGA 1CUYA 2G0AA 3RSZA 1JHVA 5IWAB 4FDUA 1LLUA 3IAXA 4MRAA 4WWHA 3AIKA 3PNOA 3OFKA 3QE3A 3BICA 1K2VN 4YJ3A 3CVYA 2J9ZB 1S7CA 2F62A 4MW7A 3ZIAD 3TW0A 2DEUA 5K3CA 4R2JA 5J58A 2IA5A 1C4WA 3HXPA 4UUMA 4WY5A 3KOWA 5DYWA 4V0KA 4HDRB 3EG9A 5ALZA 1QM5A 3DVAB 2OXFA 5DNUA 2JRLA 1QO0D 4NBKA 2VC2B 1NYRA 3DBOB 4H1HA 3JYLA 4LV5B 2PMEA 2CXQA 3GA0A 1VL0A 1Z4MA 2YMMA 3FMIA 5LQCA 1FJ2A 1JBQA 2ROQA 4ADSG 2ADFA 3I2JA 4JJGA 4MKIA 1X15A 2MYPA 1FQWA 2WJPA 1RCTE 4IS2A 1UK9A 1YJBA 1YOBA 4J49A 5J3JA 2F17A 1G7SA 1I9CA 1KQOA 1SXHA 2GXUA 3C6XA 4G9GA 2OC9A 2XY4A 1PWYE 1XWIA 4L4ZA 3JQFA 5EWJA 3DBLB 1NWHA 3KDPA 4BLTA 5DN9A 3B8EA 4RFSA 3UF0A 3MTIA 3VHRA 3PR2B 2XMSA 4TXLA 3X0DA 1JQDA 1KC1A 3I5UA 3GLIB 2HMWA 4HEQA 2BI4A 5ICFA 2MCFA 1FQJA 3FOFC 3ROFA 4IDBA 5ITVA 4YV2A 3UYKA 3PWKA 1MIOA 4GOOD 4OHXA 2WJWA 3FNRA 4NBNA 3V8MA 5AHKA 1V6CA 5GJVC 5FWYA 4KTTE 1C2TA 5HNKA 1NXPA 1KC3A 4HTAA 3SIWA 4DR4B 2VDOB 5KPJA 2YWBA 4EKEA 2YC4C 4WT7A 4ITRC 4BJ6A 2B2CA 2OXEA 1TZKA 2VJDA 2ZVPX 3QLVA 4ND1A 3PXGA 5L4NA 4MWGA 2FZVA 2XIJA 2QLLA 3GVXA 4H1TA 1HQKA 5FEMA 1UJBA 3MCUA 2Q4BA 2HT1A 1VLHA 3WWOA 1E8NA 1QDLB 4GR5A 2QKYA 1EHIA 3IP7A 4GHWA 2ZDGA 4JMPA 3VH3A 1RAEA 3FDXA 3BRCA 3M49A 1UQUA 4UARA 4BGEA 5KC8A 2QNBA 3DGEC 1I6WA 2BY4A 4P4NA 3BULA 3RFTA 1UXIA 4UTXA 2HIHA 4WA7A 5KC9A 3A2KA 4OATA 1HLGA 2DJ5A 2RGNA 3PFFA 3WFJA 3EA0A 1JFFA 5F4BA 1RRFA 4YRRA 1GKYA 1K0FA 4L8WB 1DKNA 1OASA 1EUQA 2Y1WA 3O7MA 5DWDA 5DSTA 1QX3A 4DMLA 4Z86A 1TKAA 2H2GA 3VSCA 4BWVA 2WRZA 1RVV1 3PSHA 3ZG6A 1ZH0A 3ABSB 3L0IB 4RY0A 3LUJA 4TYYA 2PR7A 3AFHA 3D7RA 1PJCA 5HE8A 5DSZA 2X4GA 2OO3A 3LHDA 2RJOA 4XWYA 1Z28A 3PGJA 1WUHS 4PC7A 1E0SA 1RRCA 3EVNA 3AOEC 3UMJA 4XIYA 1N2IA 1SOWA 1NVGA 4EFNA 3PC3A 3S1AB 5C4MA 1EXNA 4J0EA 3SWWA 3VSBA 1W36D 2QENA 2JFWA 1WTAA 1EP9A 2GOYA 2Q5FA 2RONA 3INGA 4IVNA 2JCYA 3TNDA 4ECEA 1JE1A 4IJ5A 1AS0A 2WU0A 1ZQ1A 4J6FA 8ATCA 3FOEC 1Q14A 2I2DA 2Z9CA 2VJOA 3ZX4A 1K89A 3VKHA 3GLIA 2H48A 5JBNA 1VGQA 3I6YA 1PLKA 3DFZA 2VTBA 4Q18A 5ALUA 1VJTA 1ISJA 2YDXA 1US8B 4B6EA 4O4JA 4AN4A 3T5CA 4K0RA 4GOJA 1YDFA 2YXNA 4FGUA 4MRNA 3MWEA 4R2IA 2ZRPA 4CW7A 2BDTA 3L0DA 2X7HA 4ZOLF 2GZ1A 1M5TA 1AQ6A 1A95A 2ZBEA 2RIRA 4CTMA 1YB5A 3LTNC 2ZR0A 4ECAA 1IJFA 2IZ5A 3FF4A 3RT1A 4QFBA 4DCCA 1VJ0A 1V5IA 3IOMA 2PV0A 5DI3B 3RCBA 5IMSA 5BPHA 1YJ5A 2FK8A 5K0GA 3FPHA 4V3CA 3MWFA 1MAAA 5DYYA 2P3LA 5G0UA 5A3QA 3DH0A 5BP7A 1I80A 1B8NA 3P0EA 1MU0A 2WSLA 2OOKA 3AIIA 5EMMA 2WP0A 4IZHA 4W1PA 5GPBA 3R9WA 1JPJA 2HBQA 3GMTA 1SKAA 1E61A 1UIMA 3ZDRA 2HYDA 1QTNA 2YHAA 4GRIA 3QFRA 3VMMA 3C6BA 3T1NA 4GX2A 1Z7BA 2AC7A 4M1YA 5DTRA 2TS1A 4Z53A 1N5DA 2OCGA 1CIJA 1RHUA 2CMHA 1ZX1A 3CLSC 3PWTA 5CDGA 2W6CX 2OV6A 4V1CA 3PQFA 4YCAA 2GN9A 5EWLB 1SHKA 4KI7A 3A05A 2NTNA 3NKLA 1VHQA 3WDMA 1DAHA 2JLCA 2PSDA 5I4KA 3MB5A 4S24A 2OQRA 1BU5A 2ANBA 4Y9UA 2W8BB 3KFLA 2P41A 3IO3A 2X2FA 2JJMA 3X1JA 4BYGA 4HY3A 1TYDE 4F9GA 4GQAA 3BFJA 1SZPA 4OJTA 4BUCA 1LLFA 5AI9A 4U5QA 1MC8A 3HU3A 3QPBA 4NBUA 5H68A 4ZHQF 1UPBA 3NTOA 1QLJA 4X91A 1QHNA 4D56A 1O94C 4BNWA 4EAAA 4R8LA 5K3DA 1DC8A 3G59A 1V7CA 4UPDA 3F8TA 1PK9A 2ZI6A 5KINB 4X54A 4KWEA 4TMVA 3N2LA 1QGOA 1V3TA 1X1DA 4HB2A 2PS1A 1NUAA 4N8DA 2WF7A 1GPMA 4DCTA 2C4NA 1YI8A 3PNPA 3HXKA 3VR3A 4UM9B 1UBEA 3HL0A 5F78A 1GL3A 5KVAA 2JJ1A 1US8A 1YZKA 2ECOA 4DILA 2PCJA 2JIZA 5CH8A 4F4HA 4Z4FA 2PO5A 4FDAA 4EG1A 4NMXB 2WAAA 1ZMBA 2Y6VA 4ZVVA 1XRMA 5CT4A 3TAXA 4BNYA 1YQEA 4EVRA 4B74A 5HUJA 4CLXA 3WB9A 4MS4B 1SKBA 3NC1C 4DEXA 1Y7TA 3PX2A 3QV2A 1FF9A 4TYMA 2P78A 1N2BA 2M6SA 3ZCVA 3LUKA 5TPWA 2KYRA 4WXPA 2Q6LA 1Y1RA 1USGA 3LQ4A 1H66A 4LXHA 4MCIA 2QS9A 1K8QA 5CK5A 3WGOA 3D6FA 3DDCA 4L6AA 4PCAA 5A1JA 2Z8XA 3DOOA 3OTHA 4WZAE 2E5WA 2ORVA 4MUNA 2BTEA 2PAFA 5BW6B 4DQLA 3D31A 1ZIPA 1GCIA 4PX5A 5ALWA 3TWOA 2C1XA 4MAAA 4XQCA 5KYWB 3LS2A 1V7ZA 2BFWA 1SUSA 4J3JA 4LUCA 4B34A 4EYGA 3PX3A 1M2WA 2MYUA 3RHSA 1V3QE 3GDWA 3WLJA 4GXRA 1D09A 1RWVA 3DE0X 3FNGA 2X0EA 2V3VA 4URWR 3U17A 3D4PA 4KCGA 1X7DA 3TLYA 3ZI0A 4CG0A 4PG6A 4AMVA 2BTQA 3BOSA 1FX0B 1IFXA 3D0RA 4W5HA 3ZY3A 1WCWA 1CW2B 2IPMA 1VIAA 2AFIB 4S12A 3D6MA 4G5QA 4IDEA 1DIGA 1UDCA 1GG9A 2RARA 4XIJA 3OUZA 4WN9A 4DKXA 4O4HF 1L5YA 4J75A 2OK7A 3U1TA 1GAEO 1XVLA 2YFYA 4I4CA 2B4QA 3PQDA 4I4TB 4BO7A 1EPUA 2QJOA 4R84A 1YULA 1G20B 4WNAB 4Y0AA 2WHYA 3QZUA 1PNRA 4NCAA 2P79A 3IXMA 5EFZA 3LL7A 4AMUA 3UPTA 2D6FA 4BCBA 5BR1A 2VFAA 1BE8A 2BD0A 2AD5A 3UH1A 3RBXA 1ZH6A 3FRHA 5JQWA 3V2GA 4G1UC 1V47A 4RVOA 1K8XB 1TQDA 2Z1NA 2K6GA 3L18A 3GGDA 5HPYB 3C74A 5JD3A 5COQA 1MN6A 1S1CA 3NHBA 2IDKA 2D74A 2QM8A 3GRUA 4ZO6A 4BVKA 1LXCA 5DW3A 4RY9A 3FB4A 3WFIA 3QHAA 4U39A 1E5XA 4MV5A 4WXEA 4YP5A 4A4DA 1CHNA 1N5IA 3I0ZA 1LPOA 4FBGA 1R1DA 3DAOA 1DXYA 2WAXA 3ND5A 4EQ6B 5JQGB 4Y2HA 4OO3A 3V4LA 4UM8B 1H2BA 3SSNA 2CUZA 2CK3A 2RAUA 3E27A 3G9TA 1F7VA 5JAOA 3NYWA 3N8IA 4N8EA 4B48A 3TZEA 2RHRA 2ZT5A 3KL4A 1YL7A 3D3QA 3DULA 4PLWA 1IXRC 5AICA 5EXXA 5JTUA 2RGYA 3EY4A 3KAJA 1SQ6A 2ZROA 3CLHA 1RQRA 3WGKA 3AFIA 1AMNA 3TDKA 4Q47A 1Z25A 2UYQA 5EESA 1Q12A 3R76A 3OESA 1HE2A 2J5XA 3EG5A 1CPYA 4ZAFA 4BQEA 3ZDQA 3CVWA 1LZKA 2AZ4A 1SBIA 2H7XA 3CEPB 2CHFA 3G8DA 2DBRA 4BQIA 1OKKD 3JU3A 4PPYA 2PRZA 3RV3A 3NHJA 1PNTA 3DYBA 2H4FA 1O58A 3Q7SA 4BAGA 4TOIA 3DFFA 2Q50A 2XD4A 3VSEA 1X7WA 1KYZA 4FT4A 1Z34A 1YIOA 2MSLA 2ZBQA 5I7UA 2C9CA 4C04A 3M83A 3T4EA 1MOPA 5B7QA 2AQHA 3Q3VA 3A6LA 5K8LA 5ALOA 3ZI4A 1TUBB 4HAZA 3V34A 2VDJA 3KAQA 4AW9A 3EIEA 1TZ2A 2XEXA 1JI3A 1QGYA 2DFNA 1FDWA 3LCCA 4KLAA 5E95A 5GJBA 3U6KA 4RCYA 4MB2A 1P1JA 4TRMA 2FW9A 2OY0A 1FP4B 2CW5A 3P4XA 1U2TA 3IE2A 2VK2A 1QZXA 4WKCA 2Y1XA 1KI2A 2OD9A 4I4TA 3G68A 1G20A 3I01M 4XFKA 1JAIA 4XZ3A 4V24A 2BFFA 4U7PB 3DV0A 3MGGA 4AJ2A 3DCYA 4LXQA 4IXNA 5DTQA 2N75A 2XQGA 3AX6A 2L19A 4LC9A 4XJVA 2VUUA 3I0MA 1VIMA 2HSDA 4XCXA 4BVLA 1UPCA 4UOEA 1QJCA 2OGSA 1XOIA 4ZIRB 3V4RA 2BM0A 3BD7A 2EX1A 3ESQA 4E88A 1H2WA 1KEZA 1LNQA 1UOOA 2HSWA 3DTYA 2DH6A 3G2JA 3FPBA 4A8JA 3AF0A 3C16C 3HB9A 4GI5A 4X7BA 1E1MA 4KLZA 3D6TB 3ZHOA 2WAMA 2VJPA 1Z6QA 5JNVA 3PCRB 2GN2A 5CYPA 1GDTA 1R7RA 4IYRA 1MFPA 4N7BA 5EZYB 3OIUA 4AJHA 3WKDA 5BNTA 3K9GA 4YECA 3A2NA 4RD3A 4EGQA 3HA7A 4KO3S 4UAVA 2NVUA 1RZRD 2JLAA 3PRKE 3A4VA 1G60A 2G80A 5K0CA 1E0AA 2YV4A 2OL4A 1VE1A 1B6RA 2MSCB 2YTZA 4RZSA 3V8PA 1QV7A 1FYXA 4N3GA 3KLNA 3OP1A 1HFKA 4U7HA 4P0QB 3BGWA 1A4RA 3OIFA 3STTA 1G21E 1Q6YA 4MUHA 1WPRA 4WA8A 3F6BX 4FHDA 2QSUA 3OZDA 2OAGA 2RB4A 3PNLA 1EDZA 5L4SA 1C1XA 3FFBA 1SZJG 1K0UA 2QJFA 3K8ZA 3O5AA 4RYLA 1OBVA 2C29D 3IAEA 4FQ7A 3W1EA 1XPUA 4BX0A 4TXHA 4WD3A 4F4JA 2VDLB 4JL8A 1DUVG 3QJYA 3RVBA 5BOVA 4XR4A 2FG5A 1DRKA 4RMGA 1R4NA 3R6GA 5B3JA 1LPBB 3ANLA 2Z2IA 4RVSA 1EEXB 3EN0A 3NNSA 621PA 3GLFA 1XNRB 2P4EA 1H6CA 3OQ6A 3DLTA 3QVWA 4BNMA 5LQSA 2GN4A 4Q3OA 3CA8A 4HS4A 3WYGA 2G7MC 1TK3A 1ZIXA 2Q2WA 4Q4AB 4G01B 2GMWA 2M9MA 4HNQA 1K5HA 1RM0A 2FPUA 4AJJA 4ZOAA 4KXXA 3OJEA 3T34A 3RD5A 5KNLA 2O7SA 1VPTA 2GO7A 4G2NA 4YAIA 4ZYXA 4LYJA 5L3QA 3VC1A 2B98A 2NVWA 4PXAA 2QLFA 2CBZA 4W63A 3N0TA 1YJCA 1PGNA 3F1LA 1O54A 3EGXB 4IG9A 5ANRB 2HIMA 4M36A 5CA0B 1D5WA 1LRKA 1E6CA 1XZMA 3MJEA 5A06A 2Z9DA 3GJ4A 4NECA 2H9AA 5HKOA 3TK1A 5F5XA 3VO8A 2AIRA 2JPDA 3MELA 3BCRA 3IKJA 5JNRA 2XMZA 3HEBA 3JQGB 2XF8A 4JUBA 4O3MA 3FYSA 2A9VA 4WXHA 4PONA 1HZJA 5IJWA 1T9GR 3K0HA 4KNVA 1HQDA 3AGPA 3D7LA 2K7FA 2VP0A 2ZTLA 4D9JA 3F5MA 3JSAA 4KLNA 4N4AA 2D62A 1YFLA 1Z2DA 2EP8A 2TMKA 3S7TA 2HSEA 4U7FA 3PXEA 4KPEC 4BXOB 3X1MA 1P0MA 4UBIA 2CUNA 3PR3A 3RRZA 4NIMA 10MHA 1QPBA 4NU8X 3H0KA 1ZNQO 4OJYA 4HGZA 4R98A 4LVOA 2VH2A 1K7EB 1HURA 5LBUA 1U7PA 2N1MA 3D6HA 2DWOA 4PYRA 4GPBA 4JI1B 1VHLA 1HNNA 3I2HA 1M10A 3W6ZA 3HO6A 4NBWA 1BC5A 3RKUA 5EJ6A 1DJPA 1AOXA 3OKAA 2ATXA 1LBQA 3JASA 3WGQA 4YUVA 1ECFA 1P75A 1YUMA 3F6RA 3BX1A 1VHWA 1UEJA 3KC2A 1BIFA 5ALDA 5C8ZA 5DOVA 4I46A 4TV9A 2ZTMA 5F9MA 1C3LA 1L5WA 1LI5A 1VXOA 1U2GC 2V58A 4RMHA 5EJ5A 2GEDA 5KWSA 5DULA 2PLWA 4GEKA 4C03A 3IALA 4I19A 1TCBA 2A35A 4N01A 1BTOA 3D2BA 3HCNA 4A82A 2FN4A 1QH0A 5KNDA 1IHUA 5G1NA 3LZ6A 3OA2A 3RIYA 3P2JA 4AP6A 521PA 1E9RA 2D0PB 3VDXA 3LCVB 3ETNA 2KHZA 3EQ7A 3OLYA 4FLMA 4QJ5A 2F43B 4U5XA 1XA0A 5HVNA 1RXWA 1GAXA 3T3EA 4UHKA 3PGXA 3VV3A 1D4AA 4N39A 3WBKA 1FFWA 5KKCA 4YQEA 1MP0A 2X9NA 4OOEA 4P4SB 3UWKA 1QBGA 5B1DA 2GJKA 2AOTB 1WABA 1Y3FE 4FHGA 5BSRA 3RAGA 1VP9A 2OFPA 1K2WA 3CZAA 4RF3A 2ZREA 3L7CA 2AMLA 4JVOA 3SR0A 4LF4B 1NFQA 2YWJA 2REXB 3D6JA 3EGXA 3L8EA 3PC2A 3ZBQA 3ZWKA 3EXIB 4BNXA 5BUZA 3LM8A 4OLFA 2PG3A 5EE3A 1ENYA 4ZGWA 1CY2A 1LEHA 4URFA 1ZIDA 3WLQA 2Q9AA 5BNIA 1WDWB 2ODQA 2J9GA 4KO8A 3GZNB 4UUQA 1NC3A 1TVEA 3HMKA 1LDMA 2JGMA 3PPYA 1K8RA 1N5OX 2X14A 5ECYA 4KAXA 1AGRA 5L3SB 4K1XA 4KN6A 3GLHB 4QXMA 3AP1A 2D2FA 2NOAA 3B9QA 2A9JA 3LIIA 3OAAD 3P2OA 5BSTA 3SZGA 4V0RA 1A5TA 1FP7A 3V1YA 3WVNA 1G9SA 2Z2XA 2C0CA 3EVBA 4C6TA 3UW3A 1LK0A 2IHYA 4E4YA 2VUTA 1NF9A 1OLSB 3KT6A 2QP4A 3M6AA 5YASA 5EKXA 5IZCC 3HCEA 3PNVA 5COAA 2RHGB 4BVEA 2DYKA 2CXPA 2HI0A 3DWGA 4DJ5X 2IHTA 3R7SA 5HCUA 4BN4A 2QPTA 4CM4B 4JA0A 5CEEA 1BH6A 4N3NA 4HR7A 4K2AA 5KUTA 4QBTA 2GEVA 2O9JA 4FYHA 1J22A 4CCYA 3P0RA 2PGJA 1E5LA 2WWIA 1UP6A 3PEVA 1CKEA 2LWIA 2Q9BA 3L7JA 5AVWA 4Z8XA 3HJHA 4YP7A 5JAQA 5ICCA 2V5UA 5ETJA 3RVJA 3WE7A 1UP4A 2YUTA 2NUTA 3OT5A 3GNTA 1OILA 1MTZA 1T2AA 2A14A 3CW9A 3H1PA 3OZBA 4IV0A 4KAAA 1ORIA 3VTAA 1J99A 3PNMA 3PNBA 3B36A 2XSZA 3WAGA 4B4WA 1N8SA 1KL7A 2HZ7A 2ZTSA 4D9MA 2HRDA 5DGIA 1UWVA 1NXWA 2JGIA 2V9CA 1PV4A 3M6MD 1IHPA 2JIZD 1TC1A 2PCLA 3AJ8A 5ALIA 1QYWA 5T4BA 3HB0A 4ZHSA 3T3PB 3EZFA 5KOHB 1GV1A 2FUG1 4BC0A 1OA0A 4WK6A 1V1RA 2WJ6A 3NIDB 4REMA 3W6UA 1HLFA 2NX2A 1ENPA 3HVHA 5AM4A 5H80A 3L4SO 1VYUA 4B71A 1USUA 5KNDH 3ZJTA 2PBFA 2GUGA 2A5DA 2JLSA 4OJMX 2TYSB 1E9FA 2LIPA 2ZIAA 4KLCA 1X19A 3WGGA 1U9IC 1GPDG 4HNAA 5MDHA 2EW2A 4JBWA 3DMNA 1G66A 1D1TA 3G3EA 5BQ5A 4D0SA 1W88A 3GFFA 2RGDA 1TZMA 4RMIA 2PUCA 4OGLA 3T9DA 1OV4A 4WOCA 1IBSA 2VYFA 3TQTA 2YWEA 2RFLA 1MA0A 3NBQA 2VTVA 2G76A 4M9QA 1QRTA 2HBZA 1HA3A 3MCVA 3VKFA 2DTEA 4ZCIA 3TX6A 3T5DA 3WWPA 4TZ6A 3UKDA 1W9MA 4TRJA 1JEJA 4G0UA 1F7UA 1SC9A 3ET4A 3JWHA 4TWBA 4IFIA 4UTRA 5BMVB 3M4JA 3GPIA 1L4LA 3IEVA 3ROKA 2IU0A 1RWKA 4D3SA 2UXBB 4DV2B 2M2IA 1QV6A 2Q5IA 3I92A 5EP4A 4QNRA 4JIMA 1U3TA 4G85A 1Z45A 2M98A 2RHJA 3LYHA 3MQ4A 3QFSA 4PGGA 2EW1A 4WEQA 1CU1A 2Q6IA 1PJ2A 1SQGA 5G3ZA 4BTVA 1EFTA 2ZRHA 3DBRA 5CVEA 2R11A 2C3YA 5LSAA 2YBDA 3U56A 4D4GA 1YVUA 1RPJA 1ORWA 2CFSA 1ACMA 4S1TA 2G3YA 2BJVA 3UMRA 2QG4A 3S2EA 1BMFA 4R9UC 1RWMA 1HDYA 1NMQA 2AQIA 1UBCA 2JD1A 1V9SA 3FVQA 1V2HE 2IYVA 3Q9LA 4JUCA 3OE1A 4A6XA 4LJ6A 2PD4A 4F2WA 5E2AA 3G13A 3UN1A 4J94A 4Z4QA 4FFBB 1A2KC 4UTNA 1IZ0A 3DMFA 1TQ2A 1Z13A 2JJ2A 4MGKR 5J40A 3VR4A 1CERA 1E4YA 2BFDB 4AUKA 3G2LA 3W5IA 3QQPA 1VKHA 4Z9XA 4DQVA 5T4HA 1JZQA 2CLIB 2XE6A 3GVCA 2HK9A 3HMQA 1VQ1A 1U8ZA 4TQAA 2UKDA 1ZJ6A 2O59A 2KQUA 1JMKC 3JYQA 3EZNA 3WK7A 1JWBB 1BS2A 3E9CA 3C6QA 4QPNA 3EPKA 3WHLA 4WKPA 1J5XA 3ZCPA 3PQ2A 2FP3A 3BZWA 4OP3A 1KARA 3OF5A 2J4DA 4IZOA 1Y9JA 4YUXA 2FMHA 1BZYA 1HSOA 2ZI4A 3EH1A 2ZP1A 2W93A 2Q9UA 3FDJA 1QYIA 1YVDA 3JQRA 2HNKA 4DSUA 4C2TA 1B23P 5CX1A 2CNKA 2AG8A 3LY5A 3DEFA 3BGOS 2SCUA 4F2PA 4B47A 4OXQA 4BPBA 3KKZA 5EY5B 4J9UE 1FXWA 4O4IB 1PV2A 1APBA 4HDCA 5BMVA 4G37A 1C50A 1I2BA 5T8KC 3SSAA 2NMVA 5D6NA 3HWX1 5DWVA 2OYCA 1EFKA 5IG2A 4OEHA 4Y8VA 1ZAKA 2COEA 2ZUCA 3QBTA 4MWZA 4YAOA 5CNJA 2LNDA 5C9ZA 3OJCA 1M76A 1I2MA 4DUPA 1CHDA 5F51A 1G0OA 3EWSA 3D4IA 1ZYUA 2PJDA 4JB0A 3WLPA 2V7EA 3FN4A 3Q12A 4GD3Q 1XMPA 4EFMA 1R88A 1FDIA 2ALJA 2GJ8A 4CUZA 3IJRA 3TZ6A 4XUDA 5ITWA 4F06A 4EG4A 2PLFA 3JCZA 3LOPA 3OH8A 5E1BA 3EFHA 4X9XA 5JROA 2BV3A 3FKJA 1VB5A 3NTRA 5E7MA 3T06B 3REOA 2BW0A 5K03A 4R2HA 3PRYA 3VH2A 2J6HA 2TRSB 1P2DA 1Z6GA 2DQKA 1XMJA 4GZMA 3LO5A 3V4ZA 4C05A 3A4MA 1BWRA 1O95C 3FSGD 3NUZA 1WY5A 1N78A 4JC4A 5CPFA 2CVZA 2CXNA 2OBLA 4H4CA 4YYEA 5JSQA 2ET6A 1A2QA 5IXSA 3M5DA 3EOBI 1JVSA 1NBMA 1QLHA 1YDHA 2G72A 2HBRA 1HOTA 2PM8A 2Q99A 2VXBA 2XQJA 3NTUA 3ORRA 3R20A 1ORTA 4J1TA 3WFZA 2WWYA 4IL5A 4COOA 4BX2A 1IBLB 4ARUA 5LCXA 1Q15A 3VR4H 2IELA 4BJHB 4F2GA 4ZARA 4I4TF 2C7OA 4OHUA 4XJTA 2R4UA 2R1ZA 4U7GA 4AKSA 3KS9A 2DHCA 3P9YA 3GRKA 2XB4A 4XM2A 5JH7A 3THXB 3GVHA 3V2HA 5CDSA 1PZEA 1G3UA 3ZJ5A 3GJQA 3DKPA 1TYCA 1V6SA 3PI6A 1SUDA 4K9DA 1EGQA 4LZOA 2XVYA 1L5NA 1SD5A 2EHDA 4LRXA 2OGUA 2IH5A 1Z0FA 1BEEA 2GAJA 5DZSA 1QMGA 3ZV4A 1ISMA 4AKGA 3B8HA 2YCBA 2X6TA 4EJSC 1RR6A 4H6VA 1V1MB 2W58A 4NYMQ 5ICEA 6AT1A 3OT1B 1B1AA 2YN2A 4I3FA 1G3QA 1XALA 2CYAA 1ZKMA 1I10A 3H8SA 4K6CA 4NI5A 1QFSA 2B25A 2BEKA 1R6XA 2IOQA 3UMSA 2F67A 2P9QA 3WJ1A 3F47A 3ILVA 2J3KA 2EP7A 4HX9A 4HRAA 3UTCA 4QQRA 1ESEA 1J42A 2FEWB 4J1QA 3TL2A 4C4XA 4PIVA 1OWMA 5JXIA 1G2IA 4C6HA 2YJ6A 1Q11A 3OE7D 1NYTA 2OCBA 4NQRA 4ZT6A 1PP4A 2YFQA 3VXKA 1ZJWA 1YUNA 3NYRA 2XCOA 4RHFA 4WBNB 2PL3A 5EGSA 3IOYA 3W79A 1QH1B 3N8NA 2ATIA 4A1FA 4LJRA 4IDDA 1QIKA 3I6ZA 4NK4A 5E9JA 3CVJA 2BFBA 3T3IA 2YS6A 4PS1A 1Z22A 4C87A 3JV7A 1JI0A 1KZYC 3AJRA 1KI9A 1U1EA 1UDRA 4X1KA 3JS5A 3N0WA 3N5CA 4EDFA 4YLYA 2D1RA 5JRDS 3SXPA 3E5HA 1WJGA 4JXXA 4FSXA 1QRUA 4PHFA 3A6ZA 4NBTA 1TT5A 3ABQB 3B7WA 1VBKA 4E5VA 2E9SA 2ORIA 2GEBA 1G5PA 4F1WA 3TD6A 1MR3F 2QRZA 2R7LA 1AGYA 3AVPA 4K9PA 4EGCB 4N9WA 1F4LA 1FTSA 4HGOA 4YWHA 3K8OE 4Q9NA 1IWOA 2G9RA 2J0UA 1DCMA 2WM8A 3T7SA 1QPZA 1UOEA 1ZJJA 3N75A 3NTXA 4W7IA 5CIQA 3RWBA 4B7UA 4GI1A 5G41A 4J0CA 4V39A 1DKOA 1VJCA 2IWHA 3O3MB 3ZWQA 4AZVA 1BVUA 3SM9A 5BN4B 2B5WA 2X8WA 1GNQA 3PQ7A 1E9BA 4AJOA 4TTRA 5J4KA 2GAAA 4O63O 5I01A 2HPHA 1NUPA 4EFLA 5ITZA 3G89A 1TJ3A 5JRZA 3RFCA 4RPJA 1OYVA 1VSQA 2B78A 3BWVA 1RRPA 1X70A 3STUA 2VIIA 4BKQA 3GLIE 4NFLA 2C9YA 2VRWA 2WWRA 4ZK2A 5F76A 3GPCA 1BVYF 1XVTA 2JGEA 1L5FA 2ZJ2A 4IVRA 2Y1GA 2WJAA 4Y2UA 3WLSA 3ZQKA 1FL9A 2B99A 4EITA 5DBFA 4J3FA 2AOUB 2AYXA 1U90A 4RJJA 5GM1A 1M2VB 3BHJA 3HJAA 4MCHA 4N47A 3ZK8A 4WESB 4B9AA 4F38A 2PWYA 5EZYF 4CF4A 5EIBC 1DJNA 3G2KA 3ENWA 1QWSA 2UU9B 3E35A 1U3CA 2QX9A 4I50B 1OZ0A 1J2TA 4K6KA 1R4AA 3EZ2A 3H1BA 3VC2A 2BM1A 3EIXA 2CWDA 5DM2A 4E7PA 1D2AA 4RDHA 4REQA 4U2EA 1P4AA 4F4IA 2YIVX 4W5RA 2PMDA 3N0XA 4I55A 3E1SA 1XB2A 1NATA 2W2TA 4L8YA 1NV9A 3PUHA 4WBNA 1WCYA 3MWGA 2WZQA 1YS1X 2Q3MA 3NIFB 1B76A 1GHTA 4FBLA 4O2BB 3RVKA 4CI9A 3T4XA 3DXFA 2OCKA 3G2HA 4TYNA 2G09A 5L3ZA 5KDOA 3R5KA 3JY6A 2WFAA 3Q6MA 5T6MA 3K2EA 3DLIA 2A7XA 3SQMA 1MQSA 3I04M 2GD6A 3D5QA 4RSMA 1DEAA 1H6BA 1I94B 4UFPA 3D8TA 5J5AA 4EQZA 5J43A 1EVLA 3B3FA 3PWZA 1TQHA 3LLMA 2H06A 3IC5A 1R6UA 2IUEA 3S68A 2DHRA 4H6XA 4J29A 4KU4A 4LDZA 2Q1XA 4KBFA 4UBJA 3QXCA 3RLFA 2CHEA 3KLOA 3LLCA 2KSQA 2EDAA 4QKQA 1ZMRA 4Q4CA 4FFSA 3U7JA 2IU4A 4ZZ3A 4TKLA 4EYQA 2F1JA 1P0IA 3DZIA 2CF5A 1XZHA 3R41A 2QRGA 4ZKEA 2ODPA 2WVJA 5GINE 3ESRA 5BN4A 3ZTYA 1PNQA 4L2IB 4CR6A 2OCAA 1R00A 5IN4A 3LF2A 2OAQ1 3PE6A 4G81A 3RKRA 5JAIA 5CA0F 3CVUA 4ZYUA 1KFCB 1BA3A 1KZGB 4JEUA 3RE1A 5KNCD 4B35A 1SBNE 2FWAA 3IDZA 3TAUA 1DFGA 4LJ5A 5JCJD 2ZT6A 1NHGA 2EWVA 3RVNA 5U9CA 3WWCA 1BW9A 2WWFA 4NV3A 1UC9A 2O23A 4A5OA 4OSOA 1FP6A 2E4WA 2PH5A 3OUTA 1UKZA 3LC2O 3MJDA 2P9FA 4MVCA 4EI2A 2AWNA 2HREA 1K66A 1M8PA 2XSZD 3O21A 2VP2A 3VQTA 2O1WA 5ALTA 3SG0A 2HY7A 1YBHA 4CJXA 4BKRA 1M2VA 3IKVA 3DBHA 1AZWA 3D8SA 4C0BA 2V1XA 4N48A 2NUBA 4Y9TA 2C31A 4BP1A 3M6FA 3PD1A 1T8UA 1B3BA 3DWIA 3DHVA 2V7GA 2QF7A 1JTEA 3EGCA 3QUTA 4ALJA 2DC1A 1CWUA 2H1CA 2EFCB 2PA3A 3FETA 4MUMA 1DAFA 3AG5A 1TO2E 1W4ZA 1XZFA 1DOHA 1ZM3A 5G02A 2ZBRA 4QYTA 3WMGA 1C0KA 1KEUA 1L4GA 3L3BA 5IJZA 1M34B 3QEAZ 3GJSA 2X1HA 1WY7A 2VJKA 1EE9A 4MHSA 2F59A 5F33A 4PN7A 4F04A 4RH1A 2LPMA 2Z3ZA 3UGKA 4M54A 3MD0A 1QHXA 1U02A 4DCMA 5AFSA 5JFOA 3P5BA 1KAEA 3U3RA 4OFXA 1RHJA 4C22A 4MSUA 2EZ4A 3U7EB 1U6IA 4WJLA 2C20A 5DX8A 1NNUA 1KP2A 2XRFA 5HS4A 1DSSG 5T57A 2IHNA 3G9XA 1UIRA 1CQJA 4B76A 1CZRA 2BC9A 3BTOA 4Y2XA 3T7JA 1QO9A 3RLIA 1KH1A 5EWMB 3TXAA 4UU1A 2GPSA 4WAUA 1PFKA 3DC2A 4KXLA 2OENG 4WCFB 3UEOA 4BX8A 1V9CA 1CUGA 2F4VB 5HS6A 3UC5A 1SULA 2ZRJA 1UBGA 4M76B 3EWAA 2XCTB 3VRHA 4DJDC 1NG9A 2ESRA 4NNJA 4RA6B 1FYVA 4G0YA 4HDNB 4K6HA 1XTBA 2ZRBA 4GYWA 4X63A 2R79A 4PSDA 1MT0A 5F21A 1OXBB 5SICE 4L0DA 3EEOA 4PIMA 1WHSA 2IHKA 2PZBA 1KTVA 2WSSA 2XVMA 4LBYA 4A6DA 3NJRA 4CV1A 1PJ4A 2CF6A 4HNHA 4MMXB 5EL0A 4KN9S 1L8QA 4KWCA 3VC3A 4ARVA 3WLKX 2PWBA 2C96A 1NF8A 4YP9A 2O8VA 1K1EA 4DQ0A 1AB6A 1QFXA 2C42A 1BMFD 4BO0A 5TGZA 5KTSA 3PLAE 1HDRA 1OFUX 1D04A 3EGDB 3EVEA 4L0MA 2EJUA 3I04A 4N9QA 1YASA 4FJ2A 4OXKA 4O0LA 1SQ0A 2DPXA 4KZPA 4JI6B 5DNYB 3ICWA 3UAVA 5ALXA 1XZLA 1S3GA 3LGSA 4OBEA 1D0SA 3NHLA 2JJ2D 3VAZA 2WPDA 1XTKA 5D3KA 4HX5A 5HJEA 4GF5A 1EBFA 4UOZA 1ZI8A 2HLHA 3A1EA 1M83A 4WGFA 4I1PA 2H5IA 1TYEB 2LRHA 3MN1A 5D3QA 3QVGB 1UOPA 1IONA 2FMXA 3JVVA 4MR9B 1YRYE 1EX1A 4NJEB 3R8CA 3RNOA 3NVMB 3GB9A 4IJ6A 1OXSC 3NV7A 4DMKA 3U80A 1LBHA 3VJKA 3Q40A 1O87A 2NU9A 1PFVA 4QG7A 2ZRMA 4OHYA 1L7PA 1SVWA 1JG1A 1JR3A 2Y8EA 3W9BA 5JEDA 4AI6A 3EXEA 1X7XA 2XKJE 3JQCA 2QD1A 3K0FB 2CJFA 1YONA 3GRCA 3LCUA 5AK6A 5DX0A 4YXWA 4I4IA 3WKEA 5K09A 4WLEA 5F1YA 3L06A 3CLKA 3ND8A 2H4WA 1ZDMA 2JFZA 1RLMA 2RIPA 2Y0CA 3B1WA 3O4GA 4CWAA 2EJWA 2PKWA 2H59A 3GIWA 3HB7A 1J5EB 2J1LA 3QVVA 1EVKA 3K1AB 2H8GA 4K28A 1Q0TA 2GARA 1GXSB 3GLTA 1KMCA 3DBVO 1S02A 4YMIA 2HDWA 3T7DA 4V0NA 2XCRB 2W6OA 2ZIEA 4WINA 1IEVA 2EQBA 4L4SA 4PYKA 1XEWX 1VIDA 3UCXA 1LGYA 1NOJA 4NEHB 3T35A 3UV3A 4PZZA 4AWAA 2AH5A 2O6HA 3V8RA 3FNFA 1L8XA 5JUWA 3VNBA 3A26A 3GAFA 3MC1A 4MQBA 4B3GA 3YASA 2ZWAA 1G20E 5HE9A 1UDBA 2IEYA 5IW8A 3M3DA 5BQXA 3NHFA 2LP4Y 4GP9A 4MWSA 3U0VA 3V7YA 1IUOA 1I2DA 1F2UA 1Z6YA 1MOSA 3KOOA 4JC8A 1J0AA 4B4VA 1GUAA 2XGGA 5AOCA 4B4UA 1BMDA 1HT0A 5K7SA 2OV3A 2IW1A 2Z2JA 4YDQA 4AT1A 3UAOA 1L7OA 1ZD3A 3P9ZA 4FX2A 4EBFA 5DHAA 3B7GA 3ZZMA 3FWNA 4QEDA 3NBZC 1P77A 2OK8A 2ZJ6A 2EJBA 5B2FA 4WNIA 3LRPA 5EXPA 3QQ5A 4JCCA 5BNZA 3NYQA 5IAKA 5KWEA 3ZR4B 5ENDA 1C3VA 1O5TA 5F3WB 1KVUA 2AOWA 2LIVA 2R00A 3AETB 1OLXA 4MV8A 2XDQA 1NRWA 2CNOA 3QKWA 5EKSA 1T3HA 2QE7D 1PG2A 1SIUA 2ZJ7A 5CR9A 2GDZA 4PXSA 2Q3HA 1EQ2A 1JDVA 3NI2A 5BMVF 3CVVA 1H1LA 2EG9A 3OQPA 1AQLA 2Z56A 3PQ4A 4G07A 4IIYA 2EEZA 7AT1A 5A03A 1NBMD 2UZAA 4KIGA 1XTJA 1OHHD 1Q1EA 3CZMA 4MR9A 4ZVOA 1U8FO 1FXSA 3TW8B 3FDZA 3RUIA 4DHWA 1C80A 4BBZA 2SICE 1E2UA 2G1KA 2I9PA 1T0IA 2OESA 2CCKA 2VXCA 3ENZA 3O8OB 3CF4A 1KS2A 3IQIX 4KPGA 2WSBA 4DLBA 5A4JA 2ANCA 3RYIA 3TX2A 2XPCA 2NZ8A 4W5QA 5HBRA 1UXJA 1Q1GA 1RNLA 2ONZA 5T6BA 3K0FA 1CS0B 2C9MA 3RS9A 3AOEA 1C1DA 1OI2A 5IKPA 1H42A 4OB8A 4E2ZA 1ZH2A 3VNVA 1SMKA 3KB8A 1KSJA 5A5FA 3GLFE 4BNDA 2VHZA 2IS1A 3HEMA 1J1ZA 1GGKA 4TL6A 1KEVA 4H2DA 2YHBA 3BGIA 5BUCA 2GN1A 1E63A 2QN1A 4YCBA 1D6SA 1VE7A 3AR8A 3CHYA 5A5GA 1PFGA 5EJ9A 1XDWA 1WD5A 2PS9A 3QOXA 4H77A 4XJSA 5K45A 5IXJA 4YRJA 2BDEA 5D85A 4QYIA 1G8YA 4J0KA 2QYOA 4QDXA 2D5CA 1SOUA 1R18A 3PDUA 4M55A 3ACDA 4YX9A 5H9VA 5KJ1A 1PZHA 4JOCA 4QWWA 2DM6A 5AKGA 1N9KA 2V9PA 3DDZX 1MC1A 1FDOA 2OTCA 3LPNA 3F7OA 3UNXA 4RPGA 3S2GA 3EIWA 4WE3A 1LSJA 2WILA 2AZTA 3OOJA 3PP8A 2AI3A 1PGOA 3RC2A 1IQ0A 1YD7A 3CKYA 4B8YA 4D9HA 1R6TA 5JH7F 4J2TA 1NW9B 3ZQ6A 4UTOA 1N2JA 5BT9A 3I9LA 1W5EA 1XKXA 3HDVA 3KCQA 4RLFA 4JJKA 4XX0B 1DV2A 3AIMA 1KRWA 3E2MA 3R23A 1L5RA 5E3IA 4JKIA 4RPIA 3I76A 1O6BA 2Q0SA 2I7VA 1GLNA 1QS0B 3OPQA 2FWRA 3PFBA 4H7JA 4XSVA 3U4HA 5JBQA 2P0YA 1U9YA 5LMCA 4ENTA 1IHXA 3GA7A 1A8SA 1OLUB 3DMGA 3HLKA 4GDMA 4O4IF 4PRZA 4DW8A 5JY1A 4I1IA 2HO4A 4B5LA 3ZGNA 3T1QA 1OZHA 3U37A 1PQWA 2A7QA 1QU2A 4RIEA 3H4VA 1OAAA 5CA1A 3BE6A 1WAMA 4MAMA 1DJLA 3TM5A 1PR2A 1MNQA 3O91A 5IPFA 4ZQCB 2VH1A 1WXXA 2ZB7A 3O8OA 4I1OA 2YOGA 3RO7A 3KSAC 2SNIE 2O0LA 1V37A 1XCOA 3AR2A 4TLMB 4U02A 3ZU5A 4D3DA 3UGJA 1ZRSA 2QN3A 5EIAA 3OX1A 3PHHA 3IAS1 4NCIA 4Z3DA 1XXHA 4RVHA 4IG4A 2QTZA 4X6UA 2OYRA 2O5VA 2F3UA 3NKFA 2BFMA 1ZBDA 4MKXA 2OAP1 3AY7A 4UHBA 4AYWA 5KSOA 2AGVA 1X6VA 1SXPA 3JZMA 1JEYA 2IUYA 1FCJA 3NH9A 1MJNA 1O94A 2BUCA 4OHWA 4NCBA 4I7EA 1Z33A 4AMBA 2O8CA 2AJBA 3LT1A 1EB9A 4JJEA 3V48A 4RZHA 4IJKA 1BHSA 4DJFC 1YA6A 3OZAA 4C4SA 4HAOA 2VBGA 1BXZA 4HH1A 4HVTA 2EZ9A 4WSOA 4EGAA 2XZLA 2GYVA 3TQHA 2JANA 2YXBA 2V8OA 4BASA 5JWOA 3BDAA 4OUKX 3ILYA 1J0BA 3K9QO 4HXFB 2WQ6A 3E61A 5JG7A 2ZAMA 3QLEA 4O29A 1Q3TA 2P7HA 4RKYA 2QTBA 4ZVLA 5B1IA 5TMDA 3UKOA 1G3IA 1LKZA 1P18A 3HFRA 3GFQA 4K03A 4P31A 1YCDA 4Q1BA 3K32A 1TCVA 5T3UA 3ZU6A 3EDRA 1MX3A 2PWAA 5KTYA 4DMCA 4Z6KA 4IEEA 4IEIA 3BBLA 4CLHA 4RIIA 2FXVA 5JANA 1VKRA 3URMA 4E2FA 1HRDA 3QKUA 2FWNA 4BX9A 3F7MA 4W8HA 4BAZA 2EJCA 3FSEA 2OT3B 3L5OA 1Z5ZA 3DKRA 2P67A 3HKEB 3NHZA 2FDCA 1TXGA 1TEHA 3H3FA 3TIVA 1BFUA 1W85A 1HUQA 3DL7A 1AO3A 3GJZA 5IT0A 1ITZA 1QS0A 1V95A 2OG1A 2DBZA 4TN5A 5EIHA 1GZ3A 4ID3A 2C3MA 2WJ3A 5CVDA 4QT4A 1J2JA 4QNMA 1COWA 1ML4A 4NMLA 1DKMA 1QHEA 2WNIA 1CVIA 4TQ9A 3ZNOA 2HWWA 3WLMA 1AV7A 3V4VB 2X5NA 2GEFA 1FVHA 2ZYIA 2AR9A 2GASA 2VF7A 3R3VA 5EHGA 5BO5A 3TLXA 4KRGA 3T52A 4PZ9A 1Q7EA 4ALLA 4D0RA 1QHHB 1P72A 3BDVA 4H6WA 3LC0A 4HGYA 1RXCA 3N7TA 5BN3B 1M1YA 3QG5A 3QUQA 3EMKA 2PUWA 3C6YA 4ZRMA 3WHIA 1EK1A 4I55F 4ID9A 4RAQA 1YHZA 2D5BA 4AMZA 3L7IA 3JXEA 3M6WA 1F48A 3O8DA 4IDNA 4WBNF 1HQCA 1AC5A 1PSDA 1ZC4A 3F1KA 2AI2A 3QSGA 1NBEA 1R4MA 4G5FA 3TRFA 1XZNA 1A27A 1XJ5A 2VT3A 1LBIA 4QDZA 1OFUA 3D3EA 4OOFA 4K9KA 5KTOA 1Z6PA 3BE8A 4GFDA 4KIWA 4S0XA 1SVKA 2NUPA 1RS0A 2IUFA 4UAJA 4O1MA 5JWRA 3LPDA 1Z62A 2YY7A 4IO0A 2NNLD 1NQUA 1XJ0A 4F4FA 2QTGA 3NGMA 4EB0A 2PMKA 2Z4TA 4FDTA 2EIHA 2FPGB 4Q1VA 1WE2A 4UBMA 1N0WA 5A04A 2WJGA 8LDHA 2Q3EA 5DP2A 3BB3A 5JWHA 3WQQA 5LKRA 1ZPDA 4G4IA 5CYFA 4ZQEA 1NXXA 4E5PA 2D00A 1PD1A 4C4AA 1YZVA 1KK0A 3AB3A 1PK7A 2EFEB 3MMZA 3X1YA 4KLRA 4GICA 4EB6A 2Z3VA 5MN5A 1R0BA 1S96A 4GMKA 4E5SA 1Z8FA 1ZEJA 9GPBA 1NVEA 5L3RA 3IELA 5FBWB 2JH9A 3PJDA 1Y81A 1ZHFA 3ZY6A 1GFZA 3A9CA 2X13A 5J9FA 4NABA 4C06A 5CH3A 3T9EA 3VM6A 1E79D 4MWEA 3ZXYA 2GN6A 1NV8A 4KPUB 5ENVA 1JLRA 1QOQB 1HFJA 3GR6A 3R3SA 3BWYA 2HA3A 2O5RA 3HBAA 4GE3A 5ELLA 1CF9A 4C01A 3OFND 4YVFA 5FI1B 4XWOA 5ILQA 5SY9A 2PD6A 2JCGA 3G0OA 4WFKA 3WNQA 1OJLA 4D9IA 4RQTA 4YLGA 4IMPA 5I9TA 4DDHA 3VR0A 4O0MA 3QP9A 5HUHA 4HVAA 3FMOB 2GWRA 1CUEA 4X7PA 2NQTA 2FRVA 3OLVA 4D9NA 1WMDA 4WZ6A 2ATEA 1QH8A 2I65A 1YNSA 3QE9Y 3UJAA 3ESDA 4FMBB 4A91A 5GAJA 2VHCA 3EFOB 3PDHA 1V6AA 2FTKE 5GGYA 3IAFA 1ZN9A 1QHHA 4DQXA 3UQZA 3I5MA 3QXSA 1T36A 1P61B 2ID9A 1YHYA 2KPOA 5AVTA 1GRRA 1NU8A 4UM5A 2EFGA 5KU7A 4AJNA 4FYPA 3HWSA 4O2BF 5DNEA 3HU2A 4TROA 2XEDA 3WL5A 3K9FC 4QULA 5JY6A 5C52B 2AJCA 2P2DA 3NIBA 4BMXA 1KE2A 3K09C 1SEPA 3IRVA 3G49A 3NWPA 4ZT7A 1HI9A 1T1IA 4I9NA 1E2KA 3CN7A 2NAPA 4Z49A 1JAXA 3HK2A 4DMMA 2I2WA 4ISBA 3GFTA 5KS2A 5A05A 3T0IA 3KXDA 5HCNA 2CJYA 2O6LA 4QOJA 1ZHOA 4DIFA 2W6JA 2ZSJA 1X9GA 2HSGA 2Y1DA 3CBQA 3HG7A 3K0EA 7MHTA 4UUAA 2WPDD 4GBMA 1QF7A 5DP1A 2GUWA 3RGGA 3BORA 3GELA 2XUGA 1KEEB 2GFQA 3T12A 2EIXA 5JAZA 1PBTA 3O94A 4L95C 4PC2A 1Z8HA 4P92A 2VBCA 2VCHA 3GFPA 5D3ZA 2J0QA 3UBTA 2ZW9A 4LYYA 1Y9AA 1YAHA 1SBZA 2VR1A 3VGPA 3VR6A 3W2EA 3O8NA 3UWDA 1P81A 5DLPA 2HHHB 1SVLA 4UHFA 3IIEA 3AVOA 3BRWA 5LXTB 4JI5B 3IIJA 1JMVA 2D1QA 1JR6A 1Z4IA 1Z2AA 3FCSB 2G1UA 1BMTA 2C07A 3PFGA 4PLTA 3TQCA 3IGFA 4RZXA 4UEWA 4P2GA 2FPMA 1IVNA 1NLUA 4DSAA 4TPKA 3E9DA 1QVWA 1QU3A 1Z15A 5IJ0A 1MGOA 1J2RA 5KJEA 1QTQA 3ZQJA 4BWGA 4Q3AA 1JDTA 1YB2A 2VOJA 4LY0A 4P6VF 3C7DB 3ESBA 4KQFA 4UMEA 4BUZA 2HUNA 4KREA 1YCHA 4IVQA 2IYWA 4PYOA 4YACA 1HE4A 3H11B 3KPYA 2QD5A 1RPZA 4N49A 2Y68A 4HWKA 3NG1A 4L51A 3U4AA 4S05A 3BIFA 3R7AA 2FQXA 1RCFA 3EXG1 3L0YA 2FPLA 1DIBA 1RPNA 3N1UA 1J23A 1JPNA 4L5CA 4QOSA 1A8IA 1P1IA 3RUCA 1I4TD 2AMVA 4GRDA 3QXHA 3OP4A 4PU0A 4RYDA 1DX6A 5CB4B 1MEJA 3MVEA 4OIFA 4HZUA 1UJ2A 3QWBA 1NRJB 3KQSA 1VXRA 4KOEC 4OYLA 4B83A 3KYCB 3IUYA 4WZBB 4X6LA 4OHVA 5DM4A 1YS7A 1HL3A 2XUJA 3KXIA 3RYCB 3D1VA 4P33A 2YW9A 2IHBA 4BHTA 1QJ4A 4FD3A 1GPJA 5TMEA 4ZQGA 4JYAB 3KV1A 2D1FA 1Y89A 4IXWA 3LK6A 1SBHA 4ESHA 1G7RA 4L5IA 4JI4B 2WZBA 2XXJA 3P9SA 1ZOSA 1P4JA 4PHCA 4QPZA 1DQZA 2GCOA 2O8BA 3EVDA 2LCQA 3V8EA 4G5GA 1X42A 4BMOB 4OQYA 5EKTA 3PX7A 1PR1A 4RKQA 4RULA 1MG0A 1X7YB 4XFDA 1NBME 1X94A 3E23A 3PYMA 3I42A 3FTDA 5FOTA 2DMRA 2PZJA 2VP6A 4XAQA 1OYYA 3ZW8A 3DJYA 3JAWA 1YTLA 3FUXA 3DW1X 1A8QA 1KTIA 1QF6A 2WWVD 3HWWA 3B12A 4GBJA 5SZKB 4CMHA 4P35A 1E1QA 3WSTA 1I3KA 4YMGA 5HF5A 4XDGA 2X77A 5C8DA 2QUKA 4LGVA 4LPSA 3K72B 4ARZB 3HYNA 3QHPA 5JBIA 4V0SA 3FOWA 4YRZA 5EJAA 2WFLA 1B8UA 2PUTA 2YJZA 3IULA 3L0ZA 3BTSA 1RSZA 2MOKA 3L7NA 5AXCA 1E3WB 3S2ZA 4A03A 1Y4UA 4M8NE 1M7GA 1EZ4A 3Q9SA 4C4TA 3I0NA 3LC1O 2Q4TA 4IUYA 2W71A 4L8LA 5EXTA 1G98A 3AHJA 4CL2A 2QW1A 2RHBA 4Q39A 2WYIA 3UFXB 5HQ3B 2O54A 4PNHA 1PR5A 5FF9A 1LU9A 3TQOA 1LSSA 1LPPA 1U2GA 5AM2A 3ANSA 1NDQA 3QWIA 1XD9A 4JWKA 5TY0A 1DAEA 3T1YB 2HV9A 2TMDA 4J0FA 3K70C 3NIGB 4FQ8A 1PQUA 4QGFA 3EARA 3VVMA 5BVGB 4QYMA 1A9OA 3CJTA 2FPIB 2JFYA 3F5DA 5CUQA 4EGFA 4MI1A 4R5HA 2PFGA 4IUDS 4W1RA 1JDZA 4EI7A 4JLMA 1NM5C 2P5TB 4GOMD 4DMUB 2P90A 1GEEA 1QNFA 2YCLA 1VE9A 4KHPB 3UANA 4LX8A 4RL4A 5IHXA 2AW3A 5A3JA 2CLMB 2H3HA 2AFHA 3G2IA 3GRZA 4RPCA 2XYQA 2WHPA 2E4XA 1S2GA 2G0NA 5ALYA 4AIIA 3ZHQA 4LSWA 2P1DA 1YQDA 2YJ4A 3C7CB 1B2LA 3H84A 2BE7A 4LWOA 4GEGA 3CZ4A 2AQKA 4II2A 4YO7A 5EYPB 2QTHA 4AXXA 4YT4A 5IFLA 4HVCA 1O6GA 4I5IA 4UE2A 5KDDA 3O95A 4Q66C 4JOQA 2A6PA 2AMJA 4TLBA 3BSFA 2O3QA 3OZIA 3TB6A 3TS1A 4ES6A 1QFMA 1W2WB 1AKQA 3GQVA 2NTJA 3H4TA 3EGIA 4C6RA 1U31A 4HQ6A 5GIOE 2B35A 4GPEA 3PT9A 5FL3A 3DWEX 4M1EA 5CLGA 2VAMA 3BAZA 3MK31 4XUCA 1TEXA 1U3WA 5E8JA 2EKZA 3OCWA 1EFDN 4OXXA 2JFHA 3CLSD 3OCJA 3JATA 4FHCA 4J7UA 1USVA 3BFXA 3O26A 1FJGB 3IBGA 2YQ5A 1X1EA 4IDQA 4C0QC 3VV2A 4I66A