1P3Y1

Mrsd from bacillus sp. hil-y85/54728
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
183
structure length
171
Chain Sequence
b'ISILKDKKLLIGICGSISSVGISSYLLYFKSFFKEIRVVMTKTAEDLIPAHTVSYFCDHVYSEHGENGKRHSHVEIGRWADIYCIIPATANILGQTANGVAMNLVATTVLAHPHNTIFFPNMNDLMWNKTVVSRNIEQLRKDGHIVIEPVEIMRGLITPDKALLAIEKGFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MrsD protein
publication title Structure of MrsD, an FAD-binding protein of the HFCD family.
pubmed doi rcsb
source organism Bacillus sp.
molecule tags Oxidoreductase
total genus 52
structure length 171
sequence length 183
ec nomenclature
pdb deposition date 2003-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF02441 Flavoprotein Flavoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1950 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Flavin prenyltransferase-like 1p3y100
4MWGA 4ZAZA 4RHFA 4ZAFA 4ZAGA 1SBZA 4ZANA 3WISA 4ZALA 1QZUA 1P3Y1 3ZQUA 1MVLA 4RHEA 1G63A 4ZAVA 2EJBA 3QJGA 1G5QA 1E20A 4ZAXA 4ZAYA 3MCUA 3LQKA 4ZAWA 1MVNA
chains in the Genus database with same CATH superfamily
3I52A 4PG5A 3U7IA 1TPYA 3OEED 4MKXA 3HUDA 5SZKB 2B4AA 3ZWPA 2H2IA 2QRLA 4E2FA 1R15A 3NUZA 1Q7TA 2II6A 2R2AA 3GA0A 4JYBA 4YTEA 3T5AA 4FLFA 2FZVA 4E3WA 3EH2A 3MG9A 3H4VA 3UMYA 3GZNB 2GJ9A 3TB6A 1M76A 2BHSA 2Q5OA 5C8YF 4CIAA 1UJ5A 3IP3A 1S89A 1YBAA 2ZSUA 3E7WA 3EH1A 2EOAA 4KOEC 3QJYA 1EX6A 1XXHB 1NW8A 4DM7A 5KU7A 1JE0A 5HRUA 2Z58A 3K96A 4U5QA 4PYJA 1POXA 3TE7A 2WWGA 3ZBUA 3MXTA 4CCYB 1O6ZA 1Z37A 2GEFA 3OT5A 3C6XA 4V03A 1S4QA 1YS9A 5B2ZA 3T1TA 2O2DA 4OAQA 4XYEA 4CWAA 5AESA 3U4QB 2HRQA 1ETHA 1J20A 1Y3AA 3G82C 1OD6A 2A7QA 5FLEX 1BJRE 1GRNA 1PR4A 2FZCA 5E1MA 1CJBA 3N58A 1RJFA 3CVXA 2GZ3A 1PS8A 1CQZA 2A7XA 4X7BA 3TLZA 5C1OA 3QEAZ 4CNBA 1NNSA 5HK8A 2NVBA 3PXAA 5ALGA 1FTWA 1MJHA 2QLLA 4DRXB 1T13A 1IB6A 1L7NA 3CF0A 4FX2A 4EYQA 2VTKA 1DO0A 2HF2A 2GS9A 1E6MA 3OQHA 1EQ2A 2FSGA 2XXBA 4CMEA 1RWXA 5DFAA 4LHSA 4HLNA 1KOLA 2DQ4A 3QXCA 4ZD6A 2QUKA 4HFRA 5FNZA 1T8UA 3RF7A 3DAYA 3VZCA 2XB9A 3NHAA 1H3NA 1CQXA 1JTVA 1SEVA 3HJBA 4IDFA 4U9IS 4B6RA 2ZTUA 1SUIA 4CG3A 1O54A 5BUCA 5A7HA 1U31A 1JAZA 2PLAA 1N2SA 2VH2A 2B34A 2RH5A 5IBCA 2RB5A 1YTLA 1E3DA 3OFKA 2GHTA 3ROGA 1Y1QA 4AZWA 4BQEA 4BZWA 2XCTB 2DFKB 4QYTA 4RX1A 2GILA 4FOPA 1QZXA 3SC6A 2WF5A 3A6FA 4FFRA 1X7GA 1J56A 4BXOA 3GDGA 3IPYA 1R5BA 1T9KA 1ZK4A 2OFXA 2ZBFA 5DYNA 2AQIA 2IPLA 1BGVA 1XJ5A 2PX3A 3GU3A 3IEUA 3ZX5A 1JB1A 2AYZA 3OE4A 1F2TB 2MMCA 2A14A 3DP9A 3LMKA 1QWOA 3QOFA 4X6YA 4YALA 3SQLA 5AW8A 2JFUA 4Z4IA 4BNYA 2VT7A 3BIOA 4HGPA 3KZ1E 4PAQA 4XARA 4YNBA 4AFNA 1QBKC 1OFGA 4FOTA 1LI5A 3HP1A 3AUFA 1N5JA 2AOUA 4GZLA 3DXFA 4W4TA 2HRBA 5H3HA 3V9PA 4Q24A 1XCOA 2CWDA 3OOWA 2YXBA 3MAAC 3AKYA 2CDNA 2BM8A 4I3FA 4JJIA 5TS3A 3UH0A 1TVMA 1HE4A 1Y6JA 2HAEA 2PDAA 1J49A 5FX2A 2WKPA 3PT9A 1G8YA 3CMCO 5JY6A 2PS1A 1FRQA 2QQ5A 2ZQYA 4XTRA 2GD0A 4A16A 1VHLA 3R3WA 3AEQA 2YN0A 3A6LA 4IDPA 1BMDA 4P4GA 3TM4A 5IK2D 3TI9A 3R9XA 4J4BA 3IIJA 3LJKA 3OG9A 1Z0IA 1W34A 1SCUB 2P7IA 1O03A 1K5HA 3D5TA 3L5KA 4GKJB 1RI3A 4YQEA 1U0OC 1WKCA 1WDKA 2CVHA 4B82A 1JDBC 3UJPA 4CT4B 1K4KA 4DCUA 1KP2A 2BLLA 3U9TA 4E4TA 1OU0A 3VYRB 4MRSA 2J9ZB 1X7ZA 1JT2A 1N2XA 1RWVA 1Z36A 4YP6A 3WGLA 3I2FA 5LD2C 3ABOB 4KN8A 5KOHB 3H5WA 4R0VA 2AZMA 4OG2A 4D7AA 1QX3A 4MW9A 5J5VA 3HGQA 3QBJA 4RPKA 4RGQA 1ML3A 1USKA 4JB0A 5JXIA 1NVAA 4FDUA 2AFRA 5SY6A 1XL1A 4EYSA 1CIPA 5HIIA 3RS9A 2WD7A 5JV5A 3A1EA 4N9WA 3CZMA 5JVDA 4OI4A 3DKPA 2FFRA 1XTQA 4YP5A 5TQVA 1KAEA 1JQ3A 2RMKA 2JRLA 4REQA 2AFHA 3EXAA 4ZP1A 5AUNB 3IFSA 1GTSA 1U7DA 1Y9AA 5JSZA 3DKVA 5DM0A 2X8JB 3X3HA 1JIXA 2ZQZA 3ADKA 1BN7A 5BV2P 1HFJA 3ITDA 3Q8MA 2OXCA 4ZCQA 1YZKA 2OMEA 3O8OA 4JL6A 5CX4A 4MUIA 1FDRA 4EKNB 3T41A 3DULA 4ZGWA 1KS2A 2ZUDA 1M34B 3BC1A 4GX1A 4KGVA 4X3CA 1TFUA 4ZCPA 2P9YA 3GZ4A 2PVSA 2XDQA 4UHEA 1RT9A 2C57A 4EUNA 3HDJA 4J1TA 2VDRB 1VFPA 1SPBS 4KLNA 3WWZA 1SZPA 4BV2A 5I47A 1J8QA 1G8SA 1NFRA 5IG2A 3FWPA 3KFVA 2CXNA 2OXFA 1I6MA 2VQ6A 3P0IA 4Y6PA 1HT1E 1M8PA 1XWWA 4LV8B 1WJGA 2HEIA 1F6BA 4OHUA 1ZBDA 2H4HA 3WYFA 1MABA 2JFOA 5BWCA 3FRHA 3CF2A 1DX6A 1LK7A 2IDZA 5DWDA 3W5UA 4BV8A 4MV9A 1U2QA 3BYZA 1R10A 2JZNA 5JJ5A 3NRJA 5EQJB 2X9VA 1TEVA 1DARA 3HADA 4B5KA 5F3WB 4HQNA 2CUTA 3QKWA 4X65B 1G7SA 2HADA 3DS8A 4N12A 3UT0A 1FFHA 2CNBA 2G4VA 4WTOA 5K9ZA 4NK5A 4J7XA 4LMRA 2EL7A 1CJKC 4D0SA 2GYWA 3TTWA 4OM7A 1M8GA 3K1YA 2VK4A 2G36A 2ATCA 3EXEB 5J40A 2X0EA 3KKEA 5CPBA 3ZC3A 5BRJA 3AM4A 5LNK1 1F2VA 1PL8A 3D59A 3GFSA 3OAAD 3FI9A 3AEUB 4YR7A 3O2SB 4TWAA 4PLTA 4OJQA 4UARA 4V24A 3ZH2A 2SICE 2GARA 2NT4A 1TQ8A 3K5IA 3NM4A 4K7JA 1KJ9A 3OJXA 3ZV4A 3KJQA 2F8SA 3O6VA 1XDGA 3C39A 3C3BA 3LUKA 1ZFNA 3I9MA 4QLOA 4CGYA 1F2UA 1SUPA 3VDNB 5GGYA 2EQBA 3U62A 1Y7LA 4HQ6A 1DKNA 2BHRA 1RW4A 3KPWA 5EE1A 3RVQA 3EIHA 4DG5A 4IGAA 2JCXA 2VDLB 1TJYA 3C74A 3V8MA 2AI3A 2H0QA 3IERA 2D74A 2Z98A 1N6NA 2IIQA 1BMFA 2VDOB 2YV2A 3BMOA 3EF1A 1Q50A 4UREA 2ENWA 2C2GA 2P0YA 3O26A 16PKA 1TAGA 1HYBA 3UWPA 2ASVA 2G5GX 3DOIA 1U5CA 2XE7A 1ZGCA 2FWMX 1NMYA 5AP9A 3MWDB 2YDXA 1JZTA 1I6WA 4A8JA 4PCAA 4TTPA 2ZJ0A 4ND5A 4RANA 4B81A 4MVJA 3HCPA 5KTPA 2QQEA 3KT0A 5FI1B 2XNHA 1A2QA 5JYBA 2ZRNA 3R3UA 4OKIA 2Z0MA 4OJMX 2P1DA 2PVPA 4LA4A 5JNWA 3EOZA 3AVTA 5IW8A 4J1NA 3FAZA 1EVJA 3EW9A 5FEMA 2QQ0A 5IKOA 2E37A 3DXYA 4RY2A 3RVJA 2JI8A 4QREA 3TQOA 4JVOA 1E9AA 2O8BB 4KIJA 4QDJA 1E5VA 2K2QB 4JNCA 2EBHX 4G09A 2BFBB 2QX7A 1AURA 1Y7IA 4KPUA 4X8OA 1Q0SA 2IBSA 1OAOA 1UC8A 3EVTA 3TNDA 4CBVA 5DYIA 3RRNA 4M0DA 4WXRA 4G9GA 4IIFA 1ZKDA 3AEZA 1YR8A 3AOEC 3BXXA 2Y67A 3IRUA 4RD6A 1PR2A 3U4AA 5BUQA 3L8MA 1CW2B 4NH4A 5B6IA 5KNCD 1N77A 1TUIA 3L8CA 4GLOA 1NBMA 1P9WA 4IICA 2DHCA 5BNZA 2I66A 2YHSA 1EUZA 2NQTA 5AJHA 4GBGA 4IV8A 3I76A 3ZBTA 2IDMA 2Q7DA 1WTCA 4DLTA 4WACA 4Y9SA 1MC5A 3QNMA 1N0IA 3PQ2A 2B8NA 3T5CA 5J2TF 5AM3A 1HH4A 2X0DA 3TSCA 3TPFA 5LA6B 1R6AA 4ZT2A 2YYYA 1T2VA 2TMYA 2JS7A 3AFHA 3FF1A 5DIFA 3U4GA 3AHCA 3W06A 1QZTA 4MCIA 4WBSA 3RYFB 1WHSB 3NOVA 1P1CA 4EG7A 3PI6A 3IO3A 4X20B 5IYZF 3W78A 4JJAA 1O0BA 2AG6A 2AV6A 3DO5A 1NI3A 2WWRA 4I9HA 1W0JA 2YIJA 3GNSA 1KWKA 3SCZA 4B4UA 3H11B 1LJUA 5D6OA 1I7PA 1OXUA 3EEYA 4NBKA 3E7XA 3LF1A 3WXBA 1R9GA 4ACBA 1M3SA 4IIUA 1OWOA 4RHEA 4YP9A 4DR6B 4Q1AA 2XZLA 1H93A 5EIHA 4UUNA 5HKLA 3TBHA 4YJFB 5ALSA 2W6OA 1V4BA 4FS3A 3ITNA 4OLJA 3KQYA 4XD7A 3P0JA 4LZLA 4MVWA 4JI7B 2BEVB 4LZZA 5LOVB 5REQB 4CKXA 1FW6A 1L7EA 3PVZA 5I9SA 1VIVA 2YMPA 5HA5A 1BX3A 2BFPA 2GAFA 2IU3A 2PZFA 1DJPA 1YBHA 2VSQA 3FCOA 3LLMA 3NATA 5FUVA 5G0WA 3T61A 3EZ2A 3ZZTA 2OO7A 2V7TA 5DX1A 3MSXA 1B6TA 1XD2B 1ACMA 1EAMA 1XEAA 3TZBA 3M82A 2ZYDA 1U4NA 5DNEA 1A5AB 4I3GA 3UT5A 5EIFA 1K7XB 3UM9A 4PYQA 3ML1A 5FOWA 4WL0A 3OQOA 5FBRB 1VHTA 4QL3A 4C6TB 4POOA 2VXYA 1HG1A 3IAHA 1FP6A 3RLFA 4L4XA 1ISHA 2ZRMA 2P4QA 3ELWA 4PZEA 2QJRA 5DI9A 2B8JA 3NKLA 1T4MA 3L06A 1DIOB 2H59A 2FUCA 5E6RA 3HUUA 2HLDA 3QEOA 3UNXA 4AICA 1EFHA 4F92B 5C8XA 3SEFA 4JI6B 3RC3A 4LCBA 3LYHA 5AKZA 1NT2A 3RAPR 3IA2A 5M7EA 1IN8A 3LA8A 1U2GC 1PNTA 3W34A 1K3FA 1QFZA 3R3XA 4Y2PA 5KTNA 3WQHA 1SM4A 3OSUA 4ERXA 1EAYA 2IYLD 2JAPA 2V7EA 2I9KA 1EWYA 1UPFA 2C92A 2H3HA 1AK1A 4CEHB 2YS6A 2BF4A 2CXRA 5EJ9A 2XYRA 3QEMB 4OGFA 4RO0A 4HYTA 1GNLA 3R7SA 1IBMB 5FBVB 5KHLB 2Z8XA 4MR7A 2WNSA 3AESB 4BFYA 2HWYA 4P2BA 4PYOA 2WAYA 4RGYA 1SZJG 3E4CA 4ENTA 3KE8A 2ILTA 1Z38A 2WIGA 3K8YA 4FT4A 4IEEA 3TVDA 3HKCB 2RKBA 3QEJA 5AI0A 4DN6A 3T35A 3I3OA 3IP8A 3WGVA 4R6XA 3CUTA 3VBCA 3ICWA 5LKAA 4BJ3A 5AHOA 5JMPA 3ZQ4A 3WK7A 2PANA 4HJRA 4E1BA 3AKEA 4IHJB 6YASA 2WZBA 1ZVKA 1GUBA 4EWLA 5HK9A 4MPDA 5M2QA 1PFYA 4N82A 3RYIA 2QRQA 2E2WA 1QYDA 3Q88A 1T4DA 4IIJB 2PLFA 3WZMA 5DTQA 3WTBA 2LW7A 1J06A 3LXUX 1II8B 2XWSA 5KSPA 5IH7A 2W4MA 3D4BA 1C2YA 2V3CC 1FTQA 1GZ5A 2AUTA 2J1LA 3WMWA 1MX1A 1IZ7A 4BKOA 3UUEA 3VC7A 1EFDN 1Y3IA 5KQPA 3BA6A 1FNNA 3CF4A 4QG3A 2ZCJA 2I76A 4E11A 2C82A 1YDWA 3MTQA 5FFFA 3F5MA 3S40A 4C30A 3H86A 1F9AA 4RZXA 5BSVA 2WU0A 5KSZA 1M6NA 3RC9A 4GM1A 4C7VA 5MF6A 2VYVD 1JEAA 1Z7WA 3B9QA 4RK6A 1BS2A 4QQNA 3K2QA 4D9NA 3KLOA 1G6Q1 4RWZA 1U8AA 2LTAA 5BWLA 3JQQA 1K6XA 4CE6A 2QRNA 4ZI7B 1DJQA 4HS4A 5EMJA 1PV1A 1ZUNA 4TL9A 3KTAB 1DZ3A 3WRWA 3ONNA 3DEFA 4H6XA 4IIXA 3LZDA 3NVAA 5TQ0A 1LVUA 1RRKA 4RH3A 1S8OA 1NVFA 4FHCA 1L5HA 3JQ8B 1ZWKA 4YAJA 3HB7A 4CKEA 4C2UA 2WM8A 4KUEA 3HR4A 2AYYA 1C8KA 4EHLA 4JI3B 3USZA 1G9SA 4G5HA 3LBIA 5GONB 5DHSA 4QASA 3O83A 1Q95A 2V6JA 1EGMB 3AY3A 5F2OA 3ZHRA 5AVSA 3NEJA 3E9MA 3OU2A 1A4RA 1IJFA 2YZGA 4JIGA 4MQ4A 1DL5A 2WYVA 4ZYVA 3TJMA 5D87A 2LRHA 3MN1A 2G8NA 3DL7A 3KYCB 3OZAA 5F4ZA 4U6NA 4X1KA 2PLNA 1GVHA 3FYUC 5EC8A 5EINA 4UBNA 1XD8A 4IJVA 4WW0A 4XYBA 1VMKA 1YZQA 3QP9A 4S1WA 1F17A 3EDCA 2HO5A 3HB4X 3SJAA 1SB9A 4YX9A 4JP5A 4NOKA 2VK2A 4LI0A 2UUCB 3OZGA 3KS9A 3P9IA 4G63A 4C6HA 2J3QA 3UY4A 4CFSA 3ZI7A 5A5EA 1E0AA 4FW9A 2VLIA 3EQZA 4AYTA 1JDUA 1FEZA 1VMEA 3IC5A 2D7DA 2OECA 3OT1A 4LMBA 3RVSA 2ZRQA 3V5NA 5T64A 3TMAA 1MJ5A 2OCKA 4I1YA 4KIFA 4PIPA 5AUQA 5SY4A 5C81A 4R3NA 2F7SA 3BSWA 3V7UA 2G7ZA 3ITKA 1G17A 1XDBA 3K0HA 3TJRA 4D42A 3AB8A 5L3QB 1BMTA 1XMIA 2WJWA 2XMGA 1PQYA 4OXYA 3ROPA 1CZLA 5K05A 2LP4Y 3GLGA 1PSDA 4OBWA 2FZGA 5AK0A 1KSHA 4ZYZA 3KU1A 2X0NA 4JUIA 1UT8A 2Q8QA 3BF8A 3DMTA 3PHBE 3LC2O 4QPZA 4Q9JA 4ZPXA 4AZ0A 1Q3KA 3DC2A 4OHYA 4WA8A 1Y1LA 3AILA 3DWGA 1X15A 3S27A 1NXWA 5FA8A 1TU0A 4P3YA 4QTYA 2EG9A 2VJAA 1W85B 4YRGA 1ATIA 2OESA 2WOOA 2ZIWB 1BWRA 3OQIB 5D7BA 3IQHX 1B6GA 1HFWA 1K7YA 4O5OA 4KQJA 1L4HA 3LXXA 5E6SA 5EZYB 1Q57A 5B7GA 4RTQA 1OAAA 1LF0A 1N5IA 2B6HA 2X9NA 1U8CB 4JUCA 4L78A 3S3TA 5F52A 2MDTA 3IIIA 1NLZA 2HBZA 2YS7A 1V9LA 4RORA 4OYRA 3DFFA 3THXB 5JZBA 3A70A 3HXLA 1OZ0A 1U2DA 5EVCA 5FUXA 4TSFD 5H8WA 1JAXA 1ZSYA 4JLJA 1GAEO 2VRCA 2W43A 4ILKA 1CR4A 4HZUA 4LXQA 1SQ6A 2ZGVA 3B1WA 3OQNA 2DKFA 3D5QA 3TD9A 3VYVA 2OYSA 2XODA 3OA2A 2QIOA 3L8EA 4EOGA 5TQ2A 4LOKA 1OSNA 4IPTA 2BKUA 4G4SO 1KNXA 2KX7A 4IUBS 3L8ZA 1WRBA 2ZK7A 1N2IA 3MVEA 4GF5A 4BRZA 5ALHA 3HJCA 4I4TB 2IHUA 5BR1A 3GP3A 5L3ZA 4MV4A 2JBAB 1DHTA 5KX5A 2I3DA 3V48A 3Q3CA 2P9QA 4RVFA 4X7MA 5FOTA 4MVJP 3HCDA 1KDVA 3WNVA 4D56A 2BPOA 3CX8A 4LNHA 3BWBA 1USIA 4QTUB 2QDKA 1Z6YA 2CB0A 4ZGBA 4FQ7A 1TUBB 1G8AA 2HM7A 3A14A 3IB6A 1LH0A 1H5UA 4UBLA 3VTKA 4YP0A 3B3JA 3ZJUA 2UXCB 2AUMA 4ENPA 5FTNA 2IOYA 2WHYA 1B1AA 1SOAA 2WPDA 5AVOA 3UJCA 3FUVA 1N6HA 1ZCJA 2X5NA 1VKRA 1EDOA 2YYAA 4ZI5A 1Q74A 1ZD2P 3CNHA 2CVOA 2FOLA 2AOTB 2RHJA 4P83A 2PYDA 5C5CA 3GCGA 1DX9A 3JATA 1RWPA 3OPYB 1USUA 4K6GA 1DAHA 2ZVPX 4ZOAA 4WHMA 2OSBA 5EE9A 1JPJA 3R6LA 2IOHA 2FETA 2VQ3A 1QV9A 4J3FA 3I2HA 1LX7A 1X7YB 2PCLA 2FPXA 3NHFA 4LWPA 4MMZB 3OLCX 2G3YA 2Z2XA 4G1VA 3M6XA 4N40A 4ROSA 2PQ6A 1NXVA 9ATCA 5I8PA 4RTLA 3K9BA 3U1VA 3R5FA 3K70D 1RCFA 3MMZA 4C78A 4IZIA 1SWVA 3WLEA 4JWTA 2AG5A 2AJCA 1NF9A 2NTYC 3ELDA 3T94A 5IKEA 4OMCA 3OZFA 4MGEA 5C5EA 4BWFB 1GXSB 1SC1A 2OCIA 2WSSA 1DKLA 3IELA 1K9VF 2VJMB 4B3DA 4TKVA 1ORDA 2Y0EA 4N0QA 2AN5A 5JADA 1EEHA 4IJKA 4M9RA 2G9ZA 3PPIA 1Z39A 2ZAOA 3IUSA 3W8DA 3JQEA 2HKIA 2ZETA 4GP6A 1UKBA 4H17A 1JMVA 3DEZA 1X86B 2P9EA 4JUFA 3DV0B 4LHEA 5AOBA 3P2OA 1DT3A 1N33B 4ZDWA 2HZ7A 2FR8A 1NUPA 2QPAA 3NPMA 3IAEA 4RDIA 3WLNA 4DWOA 2CT8A 1M2HA 1BQEA 3BL6A 1BHO1 2A2ZA 4G0ZA 4GBMA 4I0WB 3VSEA 4IUDS 1PWZA 4JQYA 4LRQA 3NBYC 3TO5A 4UEKA 4UUBA 2WJ3A 2Z8ZA 4ZAVA 1ESZA 3TEJA 4C2BA 2WM2A 2YWEA 1EP2B 2V59A 4Z53A 3H04A 3FZGA 2LCFA 1P62B 1GTG1 3DKRA 1E20A 3HB1A 3JASA 4Q39A 5JS8A 1JR3A 3GJ6A 3MIZA 1J2JA 1NM5C 3QG5A 1U0SY 3NU1A 3EZFA 3GA7A 2MSNA 3ROXA 2JFVA 4F4UA 1YJ8A 1B8UA 2NU9A 4FT2A 3TQHA 4FM9A 1PQPA 3SQOA 3GGPA 3MUEA 2XBMA 4TV9B 3OZBA 5JBIA 4X95A 4AWBA 2ZUSA 2P2LA 1ADCA 1U8XX 3AFIA 2WKSA 3GLVA 4NR0A 1D2GA 3DLAA 1LPNA 5TPZA 1KDZA 3IBTA 3LFHA 1PUXA 4PX3A 5EUCA 1V2GA 3ENZA 1ONPA 4TOIA 1JJ7A 3OHSX 2O3TA 3L05A 2BGWA 2X14A 1I24A 2W2XA 4HDMA 4IHQA 4LJAA 5EIAA 5EXEA 3DLTA 1W4AA 3OJCA 4Q00A 4RQTA 4KRGA 2FMUA 5E1DA 1KJWA 1XU9A 3IAAA 3B6JA 1TK2A 4LXXA 3I9FA 1QK3A 4O1IA 4XR9A 4DCTA 2AKAB 1HK7A 4EZIA 4LJ7A 3PFFA 4AZVA 1HYEA 1PX0A 2Z2KA 3C24A 3AI2A 1ZXBA 3LP8A 4G36A 3RRXA 5F7XA 3LLVA 2H1CA 4X64B 1EH5A 5EMKA 3ZHYA 1U28C 2VCEA 4MLPA 3U31A 1E69A 3RUIA 4GOND 1L5YA 2Q2OA 4V1CB 1E2PA 1E8NA 2Y05A 4O4JF 3SY8A 1RWBA 3NEPX 5BVGA 1ZNXA 1WL8A 3P9YA 3OLZA 1IM2A 4EARA 2CNDA 3LZCA 2C0PA 4CKCA 3RVLA 4N5IX 3WGTA 4DLZA 3GYBA 3TUJC 4X44A 3KSBC 3UHFA 5IT5A 1PVVA 1LSOA 2QQFA 1SG0A 2PS3A 3H3JA 4Q3AA 3PEFA 4CZ2A 3CUYA 1MDFA 4K9MA 1JXMA 1U5AA 3UWMA 2ZYRA 3PXEA 1NTOA 5C7LO 1OBOA 3F0TA 4CG1A 3T9BA 1FDUA 1GPAA 3BXHA 3N2GB 1NKSA 4U9UA 1GQFA 4B87A 3QY9A 4RKEA 2IA5A 4L5IA 1NHGA 5A9TA 4A73A 1T3ZA 4BQQA 4F4IA 1UC4B 3FVRA 4GMFA 4DLYA 5K6AC 1RXUA 4IV0A 2DECA 3I09A 2YXLA 4YCDA 4URHA 4NSNA 3V7YA 4BMNA 5BRAA 1E3QA 3HVUA 2PUTA 4CPDA 1SVSA 3ZOKA 4BASA 4W8HA 5FLYA 2EF1A 5IT4A 1T9AA 3L1JA 5JFOA 1QHFA 3QIAA 1BKSB 1XGKA 4ZVNA 1N8SA 3D0KA 1VSUA 4KH1A 1MENA 1VLJA 2CMKA 2YZ7A 4EGJA 3COZA 5I7OA 2FN8A 1GSOA 4OB8A 5JVDF 3MD9A 4DV6B 2QTGA 2I3ZA 4M60A 4UW9A 2ORYA 4NCXA 2F62A 4P4UA 2OFFA 3UJ9A 3UGQA 2AIRA 5JECA 2DE0X 4OHFA 1TT5B 4XGKA 2EWMA 2HMVA 2WWYA 2BJVA 3M9WA 1EX1A 1WETA 2YMLA 4HZIA 2RIRA 4FCTA 4KO4S 1J5PA 1S2IA 2JD1A 4LZNA 4EGAA 5TF0A 4WBNA 5HQTA 2DQSA 3SKVA 5E3JA 3PRJA 7REQA 2ONJA 2BVNA 4RMIA 2VHXA 3RAJA 1IWPB 4YB8A 1N1DA 5FWXB 5J2UA 1WDTA 5K3SA 3WHKA 1XZKA 4HDNA 3DZCA 2EJWA 4E4RA 4PBSA 5EJMA 1HE3A 4UM8B 2Z9CA 1ZBQA 2V6IA 2WY2D 1FYVA 2CVPA 3L6EA 1DV2A 1XD9A 4FEEA 4D4MA 4NPHA 1ECJA 2A9PA 1JDVA 2VHEA 4FMBB 3FTNA 1RACA 4FLMA 3WL5A 5I7RA 3CX6A 3EOAI 1MORA 1Y9DA 2NUBA 3AF3A 3GQVA 4BP3A 3T1HB 2ZYAA 1M2FA 1Z88A 4BUCA 1L5MA 1WZIA 2GD6A 2V7GA 3A6JA 4GX0A 1NPTO 1C5KA 2FQQA 4A1FA 4BLSA 1XJWA 3SZUA 4XWTA 3TBFA 1U7ZA 3RBAA 2KI5A 4F9GA 2F3TA 5CBPA 4OHRA 4I1UA 2PSHA 4JXZA 3PFIA 1M1YE 3ZNNA 1J1UA 4B2YA 4CDGA 4HTFA 2A3NA 3H5AA 3I6BA 3GDOA 2OOSA 4KYVA 5KYTA 4QYWA 2RIPA 3LUHA 1HTWA 4JODA 4NF2A 3GUYA 4ECEA 4D5EA 5JFGA 4ZHQF 5AVYA 2IWHA 3ETLA 3GJXC 3V1LA 2ZAYA 4DIFA 4HKTA 3FYUA 3QLEA 3AI1A 3G23A 5AXAA 3ZHXA 3JZFA 5JJLA 3ZHSA 2G08A 5TVGA 4I19A 1GO2A 2GXAA 2WYIA 4IOJA 4N3BA 5K8CA 1RZUA 3MFQA 4ALLA 4JVLA 4F97A 1SKUA 4DMMA 1VMIA 4JXJA 1U1FA 3ZXSA 1VCNA 4LZJA 4EDHA 4Q3KA 4MITA 3CZAA 1TVKB 1QP0A 3VPXA 4CQMA 2RH9B 2VHWA 4CV3A 4WCFA 3P9KA 2XMPA 3R3VA 4EDFA 5ALNA 2JHFA 2QT1A 2O2HA 2P3OA 1YOVA 1DCKA 3NH6A 1C1YA 5G53C 4DMFA 2CBZA 4MI6A 1B93A 3LWNA 3URMA 1BMFD 4ZEWA 4IKOA 1GAXA 1IXKA 4Q4HB 3AJEA 2R2GA 1SU6A 3ID6C 3KB8A 4YIKA 3GGJA 3RYTC 5IM4A 4B9EA 3A0RB 1W36C 2AKEA 3EQ6A 3HYNA 4LY0A 3S4YA 1NIPA 3A1NA 3WFJA 4DMGA 4EO9A 4G86A 4YRRA 1DNPA 5JHGB 3NGLA 1LLFA 4AURA 5AI5A 3V2IA 4MVJD 2KS6A 3VHQA 2RGXA 1X0XA 3E2MA 4ECAA 5L9AA 3W9SA 2O8FB 1PG5A 1F7UA 2BDUA 2FPOA 4UTPA 2EX1A 1RAHA 1BROA 3C2QA 5FWYB 3O8QA 5KWJA 3IUJA 3NKFA 4URXR 1Y8ZA 4BZQA 4I99A 4P4NA 1E59A 2QMYA 2Z3ZA 4MH0R 1OKKA 2HLPA 4QOEA 1L7VC 1OFVA 2XOXA 4P34A 2RE8A 5ALVA 1A5ZA 1TKCA 1XK7A 2OY0A 4DXAA 4MJ3A 5GM1A 1E4VA 4FYHA 2CXOA 4FQ8A 2C3UA 3BXGA 3LQRA 4H08A 1ENZA 2PQ0A 4M4SA 4K2AA 4H7EA 4QAJA 1Y81A 1PD1A 3FA2A 5INTA 2HWWA 3S8YA 4O2RA 4RTSA 1GD1O 1Q92A 3N3BC 5LDGA 1EYZA 2IOQA 5CNMA 1NBMD 1W6UA 1T3TA 5IAJA 1C30B 2HA5A 2AI1A 1OZFA 1J8VA 3B51X 4PYMA 4TRMA 1P4AA 2I0FA 1GY8A 4P93A 5CU7A 4ZIRA 2B4QA 3W5CA 5IU6A 3NHSA 1LFDB 2YW2A 5LMNB 4GR9A 1QHSA 3JQ7B 4GLJA 4Q4CA 1MGOA 2O3JA 3K72B 1TTQB 3HK2A 1JNYA 3K5HA 4ND1A 1D2AA 4G25A 1GU0A 2AF3C 2RD2A 2GETA 3H9JA 4MWEA 2YOHA 3V1TC 3U7HB 3M7IA 1P2VA 3GEPA 1ISIA 4R51A 1D6MA 1AX9A 3P8ZA 4I4IA 2JB9A 5E4TA 3K0SA 3LPCA 3H5TA 3U81A 3VH4A 2A9QA 4ZO6A 3WLQA 3H9EO 8GPBA 1NI4B 3GEIA 4I50A 3W8RA 1PFQA 2IXGA 2OGSA 2QN9A 4R2HA 4UDYX 4RCZA 3BQMB 1N3YA 3W4KA 5JY1A 1W0JD 1SU4A 3CVJA 4JB3A 3G5LA 3HO8A 1UJCA 3ZGNA 3SC2A 3EXIA 3R5XA 4PZAA 2WJPA 2CV0A 1USWA 3STTA 3A1WA 3ORSA 1Z5NA 3RDPA 1GLNA 4D5GA 3SEAA 4F6CA 2VLBA 1KI2A 2VJCA 3G17A 4BEVA 5BQ3A 3HU5A 3O94A 3C4JA 3CLKA 2XKAA 4ENWA 4ARSA 2RARA 1IXYA 1AN9A 3Q0IA 1S2DA 3K35A 4XD7D 5CLJA 1PQ4A 3EW7A 1VCHA 1EUCB 1DTWA 4JELA 1T1JA 4NATA 4BKUA 5BUZA 3LUGA 4K0KB 1GT91 1CUXA 1ZIOA 3IB3A 3IVGA 4I55B 4LYFA 2FRXA 1GDDA 3IXMA 5E2IA 5EWLB 1DBSA 4BRWA 1L3CA 1CE8A 3NTXA 1MH9A 2H4FA 1Z4PX 5A5VA 2DHDA 4JB2A 3EZYA 2QYTA 3OU7A 3Q41A 4OHCA 4GW3A 1QKJA 4V2IA 3VDRA 2GCNA 1VCIA 2Q2NA 4R7GA 3TAXA 2CYBA 3RRJA 2CLCX 1GU7A 1Z08A 4LTNA 2H4XA 4O8CA 1L5VA 5IJ9B 5JZVA 1UH5A 4EMUA 2GPSA 3LKBA 4F4CA 3P2MA 1D1QA 1XCGB 4RMNA 2ZIGA 1XN4A 4FR5A 2HFKA 3LI2A 4I1SA 4LY3A 4N5MA 4Q4LA 3RHFA 4KVFA 4N65A 3FNGA 2IC5A 5C18A 1VZ2A 2GZAA 2MOKA 3ET4A 2B78A 3HEMA 1Z28A 4JU8A 4PNEA 3SQXA 2HLDD 3MGBA 4M49A 4J0DA 1H65A 2RGAA 1TOAA 1TEZA 1P5JA 2F6RA 1YULA 2J6CA 1RYDA 3ZH9B 4PF1A 4DIDA 2O8NA 3WFIA 2GFHA 4E5PA 1Y7TA 2QTFA 1C7ZA 2HF8A 2QTAA 1SVNA 3QF7A 4LKOA 2RHTA 1XTUA 2IOFK 3LCCA 4R31A 2GJKA 4WBXC 2F48A 3TG2A 3JQ9A 3V4PB 1NXQA 3VR0A 1CB7A 1UC9A 3BFVA 1VZ3A 4GPTA 5DM2A 4G9BA 3NYIA 1QTNA 1V7PC 1DEKA 1P0IA 5D51S 1NM5A 1GG9A 2GOYA 4KV9A 5H1YA 1SBQA 1ZI9A 2BSQA 1OIXA 1Y9EA 2V7BA 1WP9A 2IUFA 3Q2IA 2A0FA 2YY6A 5JCZA 1THZA 3OFVA 1HO3A 1S3FA 2X8BA 1TVEA 1A97A 4KX3A 1SWWA 4AP5A 4CTJA 4RFLA 1I4WA 2JVKA 3Q2OA 2PUAA 5KDOA 2P7HA 1VGRA 4O2AF 1T0JB 1J21A 4BBJA 3NIBA 1N6OA 2E4ZA 2I4OA 2X2EA 2PX0A 2PKYX 3QPAA 1EVIA 3W2HA 1WMBA 2PUFA 2QAGC 3A4LA 3IXQA 3D3QA 2RK3A 4D4LA 3H8VA 2WWIA 3H65A 4NBWA 3ZDCA 3G49A 5NULA 4IJWA 1VKHA 3GPDG 1NAIA 2J8ZA 4PNHA 5MFZA 5I6DA 4E07A 3D6VA 5UKDA 4JJ4A 1XTRA 1D04A 1F8GA 2YY7A 3H9CA 2G70A 2WF7A 1YXMA 3L0BA 4FILA 4KK4A 4YQZA 2W2MA 4CF4A 1YUNA 2A30A 2OOKA 1V7ZA 1FMCA 3K4HA 1NDUA 3I5AA 2ZWMA 4PYNA 2ACVA 2BBOA 2BV3A 2ZJ6A 2ZREA 1F12A 1CUEA 1G5QA 2XGOA 4NIMA 4HGYA 1X9HA 4OUDB 5C8YA 3RTAA 1NUSA 1U28A 2WVGA 5TR9A 3BIWA 1CVRA 4TRNA 4JI2B 1J6UA 5JNLA 1AF4A 3QZUA 2I2DA 2G04A 3HU1A 3AEKB 4LZPA 3IKMB 4RSGA 1GPNA 1MC1A 2CLEB 2ABWA 2QA5A 2WFAA 3FFXA 4Y2TA 1CV2A 4M7OA 1AE1A 4BMDA 3C15C 1L8QA 3MPOA 2I2AA 4ZCMA 3O8LA 4NQZA 4YMTA 3T3IA 2NGRA 1J99A 5IN4A 1R0KA 1FNCA 3L49A 5AHRA 2Y1FA 4FDTA 4K26A 5LWHA 5LUAA 1QF9A 2PRSA 1IOZA 3K94A 4RVUA 3QUBA 4OAOA 1OLSA 4PAWA 1QK4A 4D43A 1EGQA 3FZYA 1E3EA 1Z5GA 2FPKA 4G8BA 1Z3CA 2FP3A 3O9MA 4I4CA 1T29A 2H5LA 4JQSA 1OLUB 2WUFA 4CL8A 4GQAA 2VSOA 1OFTA 3W6NA 4YAKA 5K6AA 2Q1YA 2CJYA 1R0RE 4GI7A 5ALDA 4JC0A 1JU4A 3U3KA 1JYEA 3GBPA 3GA5A 2PU7A 3LL7A 1XYYA 5CTAA 3L18A 5CLHA 5B3AA 5HVNA 1Z6AA 3S8EA 2I2FA 2IH2A 5FTLA 4KDCA 1A5TA 4W5QA 3GLFB 5JTTA 4FYYA 1NQXA 4MVJM 1KSFX 5B1EA 4BU0A 4HV4A 5LLTA 3FMPB 1P9NA 3RV3A 1LK5A 3KQTA 4IOLA 1ULAA 2Q29A 3UJHA 4WERA 3GELA 3FZNA 3PNSA 4NH0A 3KT6A 5MN4A 4OKNA 3DFZA 2E18A 3UMBA 3W5IA 1ENPA 4ALIA 2FFQA 3HVIA 3OZEA 3DL2A 1GGEA 1GTL1 2B21A 3VV3A 4JGIA 1JR4A 4AJPA 3EFEA 3EQ9A 5CXXA 1CR1A 1VKJA 5A7GA 4IS2A 1D03A 3KYDB 3OJLA 3O47A 1OT5A 5CM2Z 3S99A 3NJRA 1DAEA 4QPJC 2QN7A 5HTKA 2X0JA 4P5PA 2JKVA 4PR3A 2EKZA 4S04A 3OLQA 1NX9A 3TNYA 5C1DA 4W7SA 4KWIA 1N34B 4DQUA 2F9LA 2HXYA 3MB5A 3R5HA 3VR1A 2I29A 4DJDC 3X44A 2E82A 1DDOA 1FXWF 2XOKA 2Z2ZA 3VI4B 2WHEA 4CT5A 4DIOA 2AMJA 1NUTA 1P1HA 2BI7A 3SQDA 3VR5H 4AECA 4S1PA 3NTRA 3T9FA 3B3FA 1I2BA 3N2KA 5A71A 2POQX 1V39A 1D2EA 3KB6A 4TL6A 5DT2A 2EWVA 3K0AB 2H9IA 4GFDA 3RVMA 1XSEA 2O0JA 4UZEA 1RVDA 5CAEB 2F8MA 2XA2A 4ME6A 2VPPA 3VGPA 2IHZA 2QV7A 4U7DA 4G4JA 4GP9A 4ND7A 3TQQA 1M1NA 2H4WA 1U1IA 3WJ1A 2OPBA 3SQWA 2AD5A 3UAXA 4DILA 3B9RA 3DHNA 4Q9HA 3MWGA 2TS1A 1DUVG 1TQ4A 2ZIXB 4M1YA 1RBMA 5AJUA 4XVHA 4JA2A 1L4UA 1NU8A 4ZT5A 3LWBA 4YFYA 2NUPA 1K7SN 5HKKD 3NT4A 2C5BA 3X0DA 4AQ7A 2RAVA 5CHYA 1EM8B 5L4NA 3TTVA 2XRZA 5JSKA 2J9FA 2P6RA 4QSHA 3D3WB 2EKDA 4IWYA 4KV7A 3PS9A 2BTOA 1L7DA 2H08A 4N8DA 5CDGA 1ULZA 4WLNA 4EUKA 5AKHA 2C9BA 5CB8A 2QX9A 1XN1A 3SSAA 3LLUA 5HJEA 1OIVA 2ONYA 5MN6A 2C78A 1NF2A 4I6JA 4Q15A 3QKIA 1GUDA 2NVUB 1C0KA 4XIFA 2O4UX 5EMMA 2VRCD 1NL3A 2ECOA 2G88A 2QROA 3IPXA 3L79A 3K09C 3PHHA 4G8JA 1FFCA 4UTXA 1P2SA 3KD2A 3OM9A 3QXGA 2PAAA 4EPWA 1HDGO 1DAIA 1J7KA 3QVTA 2JVJA 4INJA 3VHLB 1NJ5A 5CA0F 5IP5A 5G4KB 2WFMA 3MC1A 1XDUA 1WXHA 2OD2A 4RV4A 1G98A 2IUEA 3E48A 1RAAA 2QN3A 3HXQA 2ZU6A 1L0BA 4ZT3A 1ZC3A 2CDRA 4FHFA 1RM4A 1U99A 2H29A 4N3GA 4S2EA 1ETUA 4J03A 1TO2E 1R5NA 3MAJA 4Q7JB 4XE5A 1RJ9B 4TMWA 3ORFA 1WXIA 4YDRA 1BFKA 3KJZA 3WJ2A 2MSKA 3FNEA 3DAHA 2C5SA 3BHJA 2ATVA 2P2CA 3AGQA 2OBLA 1OXMA 5BQ5A 2BKEA 2SKEA 5TGTA 4Q3CA 3FBTA 3RSCA 4PSAA 2WPDD 3ADCA 3VNSA 4HNRA 2H9AA 1KP9A 4I3HA 5IAAA 3K53A 1F3OA 4FZJA 5AK5A 2YWRA 2EGHA 2PR7A 3WAKA 1XQXA 4HRXA 5DGXA 1KFEB 4ZOEA 1PJQA 5LJLA 1DG1G 3T7KA 1A82A 2VHQA 1A2OA 3BCHA 5CLFA 3LTNC 5BV1A 1GNRA 2P9TA 1A69A 1C4KA 3EGOA 2J0QA 3BFPA 4P53A 4BFZA 2RI0A 3BOSA 4O4LB 3CKKA 3C43A 4CEIB 1RXVA 1UPBA 4JITA 1SHJA 4DARA 3HN6A 1ZHOA 2F43B 4RXUA 4XAQA 4DMCA 4HNSA 5CDFA 3OTHA 1KBZA 3QUAA 4KACA 4KKVA 5EHNA 1IZYA 4HMOA 1OJLA 1LS6A 1TL7C 5KEIA 1UXOA 4FXOA 1R4MB 3HB0A 2AQ8A 2QL9A 4FYWA 3UHPA 3ZTWA 2RGGA 2CE7A 4M7PA 1WABA 3DHVA 2WJ4A 3NXKA 3R6WA 1TX4B 2QUAA 3I2YX 2WSSD 1XTPA 2W0SA 1E9DA 1JEQB 3A1CA 4B4DA 4NPCA 2FZWA 2PU5A 4MIKA 5K3DA 3EC2A 1KVUA 1P7YA 4BQRA 5J47A 5ELLA 2UZAA 1VYHA 3FDZB 1AQUA 3ONFA 4FD2A 3TX6A 4HQ0A 5GZ1A 5HTOA 1TCUA 2PNJA 3S2FA 2XUQA 3AQ4A 5B1DA 3B53X 1XLWA 1LQTA 3IQZA 1FMLA 3OQPA 2DJ5A 2B4KA 2YINC 4C0LA 1VGQA 4E2ZA 2CBXA 1GTVA 1VP9A 2H9YA 5EYPA 3KG2A 5G02A 2XTNA 3EZNA 1GGFA 1QDLB 3U44B 3O3CA 4KLRA 2EW2A 4M22A 2X9GA 1G8JA 1C7QA 2WHQA 3ADOA 2C3OA 2J08A 3HLKA 3KQQA 5AW4A 1DFGA 5CEJA 1V0JA 1NDQA 4DR5B 3ZYCA 3TVTA 5CFRA 2XCOA 1CP2A 2CCJA 4YRFA 1SQGA 1SBNE 4G5QA 2VYNA 1NN0A 3ONWA 3AX6A 4RL6A 4C6RA 4QXMA 1E3LA 1MB2A 4FMPA 4RVSA 3WZ2A 1V43A 1QGUA 5GQSA 5T3YA 1J07A 1SQ0A 2Q9UA 1XFAA 4F06A 2XZTA 4LYJA 1GPWB 4TMXA 4R1QA 1GQOA 1ODTC 2B5WA 2I62A 3BZBA 2UYYA 4FJ2A 1AGPA 4QUIA 3NCTA 2P2NA 4L4UA 4Y6OA 3N9IA 2RGYA 2YNMC 1DS6A 3JQGB 4QHSA 1XDDA 1YWGO 2ZE7A 4N39A 4WJZA 3L1UA 5CP8A 1V37A 2CHVA 2NO6A 3R75A 1L8LA 5IUJC 3QA9A 4IVQA 3VKHA 4R3UC 2Q5FA 3ADDA 3TXXA 1JW9B 1PW5A 1SC6A 4D9KA 4L1KA 4B79A 3WX0A 2K7FA 4ZV7A 3O1IC 3PCTA 5EEHA 2EIHA 2H2AA 1E2UA 3CUEF 2YQ5A 2GPTA 5JO0A 2NQ2C 1Z9BA 2WFLA 3KCQA 3KKNA 1KRWA 1SQ5A 1RQNA 4US1R 4LSWA 4BYMA 4XWAA 4FOSA 4PHCA 3NM6B 2G9VA 1E3WB 4FDVA 4NE7A 4TWJA 4ZU1X 1DLJA 2I87A 1CQIA 4Q5IA 1FQOA 1CUYA 1PEYA 3FYHA 5J2TA 5DPMA 2QORA 4RHXA 3CXUA 2CSXA 3LSYA 2P2SA 2AXEA 2HA0A 3PEEA 4IDOA 3ZQ6A 1OBHA 4DY4A 3KNZA 2F90A 2FMIA 4EBBA 4CJXA 2GSWA 2YVQA 1A5SB 1MHPA 5ILQA 1T8WA 5IYZA 2R79A 3I9LA 4TPKA 4CODB 1NQAO 1DKPA 1UJ4A 3JYNA 1T4CA 1E1RD 1HE5A 2WC1A 5AI6A 5IEBA 4F2DA 3E5HA 3ESQA 2BKVA 1VE3A 3E8XA 4E3ZA 2V55B 4J29A 4PX2A 3PX3A 1MO2A 2NU8B 4ZJPA 4LHYA 3TZ6A 2PK3A 1RHJA 4CG0A 1MR3F 2IEYA 4DLRA 1IZ9A 1MQAA 4M76B 3DMPA 4H18A 1XZHA 2XADA 1YQUA 4U8GA 1BMQA 2VTVA 1NYQA 3CA8A 2B6NA 1C8VB 2YICA 1ECBA 2H4JA 2DBZA 5FBLB 4F5YA 1H2YA 1NTRA 2BSAA 2QAGA 1QVZA 1SVKA 3EVGA 4YLGA 1A8SA 3BCUA 3FSGA 2HNBA 1XCPA 1Z4NA 3ABSB 4S2UA 4EHBA 5BSKA 1H6AA 1ZAYA 1EX9A 4GYYA 4UMDA 1Z0DA 2XMQA 3AF2A 2RGEA 1UMDA 1ORRA 4M8IA 2Q3CA 1N3BA 3F7MA 4K05A 2J3KA 5EESA 4QDTA 4ZVVA 3RI3A 1QQ6A 3MTJA 3LK6A 4PE5B 5BMOA 5KTRA 3R76A 3EAFA 3MWYW 3RFFA 2YJ4A 3V33A 3K0BA 3O84A 4MWSA 3NC0C 4R2KA 3KJGA 4XX0B 4BE4A 3RFVA 5AM4A 3K0FB 3U26A 3DM9B 3JWEA 3F7TA 3MD0A 3DBOB 4G23A 4PQYA 1KEEB 1W5BA 4JQZA 4RADA 3ASVA 2QRVB 5ALYA 3FLEA 3JZMA 1CR0A 1O5OA 2R66A 1HLGA 3GF4A 1GR1A 4AF7A 4DDMA 1CLUA 1IMJA 5HOEA 1F0NA 1A04A 1PZGA 1IHUA 4YXFA 2DPHA 2Q50A 2I2BA 1NG9A 1I3MA 1IEWA 1NFQA 2WG1A 2IY9A 3DCYA 3P0FA 4KU4A 3K6SA 4L8VA 4K1XA 1LSSA 1LY1A 2UUPA 5AOVA 1XZMA 1GFWA 1UM8A 2ZWOA 4NJMB 4BNNA 2JJMA 4J9UE 5CB0A 2D5AA 2WB2A 1ESCA 1ECPA 2GF0A 1E7RA 2I4RA 4ZCSA 2OAGA 2BGKA 4R4JA 5FUYA 4YMGA 4F9TA 1B8NA 4R8KA 4BZXA 1UQRA 1X3SA 2CYAA 1H1LA 2R8RA 3UANA 3PD0A 5JPCA 1EFKA 5KYNA 1NP7A 4HL6A 1AZWA 5TMDA 4ETWA 1A3CA 4QWWA 3VHRA 4RHTA 1ZD1A 4UXJA 1M75A 3SVTA 4ZYLA 4CLRA 5DSTA 5EXTA 3LT0A 1V1RB 3IQWA 4M0PA 5LB2A 1D9ZA 3CEJA 3GLIA 2YY5A 2HJVA 4X9XA 1T24A 4RD0A 1G20A 1L5FA 2W83A 4C6SA 3DV2A 2H3EA 4NDZA 1SC4A 1W5TA 2W37A 2G07A 3JR7A 1UT5A 3SM3A 1VL0A 3H1EA 1XHLA 3Q3IA 1ZM7A 2WDPA 4E7PA 2MT9A 4MQEA 3RROA 4GWKA 1QIKA 4XB1A 3CC8A 4QX6A 1H2WA 3G89A 4BNXA 1E7YA 1UDRA 4K8RB 2V0CA 2W2KA 5E9AA 5GONF 1V8BA 3RHZA 3SEQA 4X1YB 2Q4EA 4AJ1A 4D97A 1OB5A 4BRUA 3HSYA 4CQMD 1N0UA 2C5AA 2QPOA 3ZK7A 4ASUA 4CMIA 3WWPA 5A4FS 1BFDA 1X1QA 3QY0A 1QGZA 3HNRA 1OJ7A 1T2FA 1ZGGA 1JFFB 2YUIA 4J16C 4R1MA 3V97A 4DWWA 2GWHA 2NIPA 1YR6A 3FTDA 4YPOA 3TAHA 5JYEA 2BP7B 2PJZA 1IQPA 3O95A 1XPOA 1KBOA 2GYVA 3G2PA 2A4KA 4NYIR 4U3JB 3NIDB 3UQYS 5BR4A 4EHAA 3VVBA 2D2VA 5AW7A 3EUFA 1YVEI 2CLHB 5MGBA 2MSCB 1OWNA 4UD6A 5TF4A 5HIMA 5FHRA 3MS2A 3WQRA 1Y4UA 1BEEA 1QIIA 3NHBA 3C3YA 4F1JA 2QMHA 1RM0A 4MP3A 1C7EA 3LT4A 1F4VA 2GEJA 2EFYA 4KTVE 3RWMB 1TK9A 2J6HA 3BILA 3GCWA 4PBTA 1J42A 1DC4A 4NLLA 4C0HA 3U4DA 1K9SA 2QTRA 3K9QO 1FYFA 1HDYA 1LSUA 5AIAA 1FMFA 5I9TA 1Q44A 4DANA 4QM6A 4F71A 4MPTA 2HCFA 3M3HA 3ZWOA 2FWPA 2IY8A 1FXSA 1LVGA 1QK5A 1E9FA 1I0ZA 5GAJA 4YRNA 1KS9A 1QDEA 1XCMA 3CXRA 3K8QA 4C4XA 1EHIA 4B3MB 3KOYA 1P61B 1NSTA 2PD6A 2GXSA 3VU9A 4RABA 5SYNA 3FHOA 3GVCA 1DMSA 3IKJA 4O4IA 3ZGXA 1AHNA 1HQDA 3PU6A 2OUIA 2X2OA 4KXFB 2G9NA 3R0ZA 4NNOA 4DA7A 1R6DA 1I4TD 2W8ZA 2PSSA 3B1JA 1RI5A 3GRVA 1L4MA 2YCBA 3RB8A 4F2PA 1XTJA 1NU6A 2HJGA 1WAMA 1Q7GA 2ZYUX 3GT7A 3WYGA 1NBIA 2AL7A 2WTEA 1Z8NA 1GZSA 5GZ6A 3JAWA 1HYQA 1Z18A 1G4HA 2HRDA 3UHAA 1OREA 5FWDA 4HWRA 2LE0A 1ZRSA 3DAGA 1L5OA 4ER0A 2HK7A 4C5AA 2W90A 2XUHA 3HY6A 3CZ9A 5EI5A 3PLAE 2ZRCA 4CM6A 3GD7A 2EFCB 3R4VA 4WESB 1RIIA 3H8WA 3BK1A 3GEGA 2ZT8A 4NEGA 5CYPA 4Z9BA 5BQXA 3DW1X 3N53A 5HF9A 2ZITA 2QYSA 4YJ2B 2R1TB 4Y1EA 2DERA 4NJEA 4NONA 5BN4B 4YAOA 1I7NA 1Z5WA 3KJNA 3DTNA 5LMCA 2SNIE 1WXGA 3B89A 2HN9A 5ALUA 3DBVO 4DR4B 1G64A 1MT3A 1Q1NA 4IGFA 1PKXA 4QXQA 1PT7A 3BGWA 1G42A 2J0UB 4LYEA 2NO5A 2XMRA 1N3IA 1N6IA 3M6AA 2B7LA 4LE0A 2W8BA 5LP1A 2GK4A 4GMXA 3V7FA 4DKJA 3LKDA 4C4YA 1L5NA 4ACAA 1PR1A 3U16A 4KE7A 1TF7A 5F5LA 3TD6A 5DLQC 4MZXA 4NV3A 5SYAA 4LYHA 3R7WB 5B1YA 3KEQA 2VP4A 4M0UA 3SR0A 3AUJB 1G291 2XF8A 3PEWA 3N2EA 1IK4A 5CR9A 1Y8QB 5LWQA 3KEMA 3Q6MA 3DLBA 3AVXA 2UXBB 4EGSA 1W87A 3EY4A 4Y2GA 4FGZA 3REQB 1JKJA 3BCSA 3MT0A 3W9BA 3MAGA 4XRRA 4EKIA 1PV4A 4R9SA 5JD4A 2HHCA 1Y6GA 3EFBA 1A9QA 1U9JA 1UZAA 1QOPB 1XKXA 1ABFA 2IYZA 1ZMRA 1V3TA 2OSVA 2MTBA 3PHCA 2XWPA 1FOEB 5KHAA 4GKKB 5B64A 3HN7A 1K68A 2NZJA 3IEXA 2XUAA 4BQSA 2IOFA 3DDHA 1DSSG 1BDHA 4IQ8A 1OFUA 1EEXB 1I3KA 2WHPA 2R6GA 2SKDA 3GMSA 4KVAA 4P36A 1GKKA 2XUZA 3HRHA 4ALKA 3SXJA 5LQCA 4AIRA 4JDPA 1WM1A 3HU3A 1TUEA 1W94A 3RNLA 1NMXA 4DIKA 3IHLA 2C42A 4XUEA 1GSHA 2I03A 3AP3A 3Q9NA 2H18A 2QUBA 4FFNA 2FJPA 3SSNA 3VYTB 3B6MA 2J3DA 3FDFA 3WGMA 3VH3A 2PKEA 1BAPA 4XUCA 4BDTA 4YUAA 4UQLA 3CFYA 1ODCA 1UUFA 1QIMA 1WA5A 2WICA 3IUBA 4Y9RA 4YFVA 1T6ZA 3REFA 3WA6A 1RZRD 3Q4GA 4ER3A 1W4BA 3PC7A 1ZESA 4Q02A 3AHJA 2EP8A 2IP4A 2WYUA 2CMGA 1G16A 2PY6A 2Y76A 2B1GA 4MPJA 3WYNA 3OZUA 1W4LA 2QE7A 1YQGA 3L6CA 3LAWA 1SY7A 2QR2A 3OMXA 2AOXA 1JHDA 2Q0XA 3KXPA 3QKUA 4HH4A 1YR3A 3VHXB 1K86A 2IE0A 4NKRA 1CDZA 2ZJ7A 4DTCA 4UMEA 3WLKX 4FWTA 4LISA 3QBEA 1NNUA 5HOQA 2PH3A 4QYIA 1JIIA 1E1QA 2F9FA 3L1KA 4RZIA 1KVRA 4ER7A 5AIBA 4FR0A 5K0EA 4D4JA 1JG4A 4S35A 5ALFA 2VTBB 5EQDA 3AVYA 2YJ3A 1DI0A 5EQFA 4O1MA 1H3EA 3IHTA 1E2KA 1M6VB 2L18A 4YJGB 4D26A 1YQDA 3WO0A 3NUGA 4A3SA 3WLSA 4JBWA 2Q2WA 2YNMA 1XZPA 2P65A 2V45A 3NEAA 4JT8A 5FR1A 1KR2A 3T06B 5A62A 4RNCA 4E94A 3SM9A 4KMOA 5AH0A 4CM3A 3TS1A 2VJPA 4GI2A 3ZNPA 3NHPA 3OECA 1RPTA 3SX4A 5C1BA 3ZDEA 4KXQA 2XWBF 4W9MC 1Y98A 1NY5A 2AFIB 3NDPA 2YWDA 3WLOA 621PA 4HF7A 4V0RA 4G0VA 2CHUA 2FZLA 5FQNA 4PPGA 1GTMA 4ZAGA 3RR2A 1PVOA 4RULA 1C41A 3HN2A 4JLSA 5ITZA 1HX7A 3IP9A 4BQIA 5B58T 1YI8A 2A5DA 4EW2A 1KFJB 1X8LA 3LH5A 5ALPA 3JD2A 1DQNA 4DR2B 1Y3BE 2AWNA 4H59A 1WPRA 3V1KA 1VA4A 3NIWA 5DN6D 3D02A 1AMOA 4PCVA 4QLAA 4S0XA 1T0BA 3Q12A 4NBVA 1NQOA 5HR5A 4HDQB 3U6KA 5DLEA 3DDZX 4JJGA 2QVYX 2V7QA 5BURA 4TYYA 1XYGA 2FDXA 2OCYC 2X0KA 1G8PA 1PWHA 1P7VA 2XJ9A 3BAFA 4TMYA 1CY8A 4A91A 5HRCA 1WXEA 1Q91A 5C34B 2Z8YA 5C51B 3C41J 5DASA 4RM2A 3S1AA 1KEVA 1ZGHA 1W93A 1ZIPA 2FSSA 3PX2A 4IRMA 2C03A 4RDCA 4CF5A 5AQ1A 4GHWA 3BTUA 1Y9ZA 1NBWB 2A9JA 3E2PA 2IP1A 3GPCA 4YDSA 1OYVA 2N1MA 2PTHA 3VI3B 4Q34A 2JBHA 1E9SA 3DC7A 4J8PA 5F1PA 5HUJA 3ORHA 1KO7A 1QGED 3OOYA 4NYIQ 3VR6H 1P6XA 1WW8A 3PPXA 1YS7A 1AXGA 2IHBA 1Q17A 2R65A 3DB2A 2ZI3A 3KL4A 1MG0A 3COYA 4J2HA 4JAVC 4NCNA 2ZT6A 3GB9A 4U5XA 4UFPA 1FA9A 2MR5A 4QULA 1F8FA 1XLTC 4TLLB 4PW0A 3LHSA 5I9NA 3QVMA 4OU4A 4F6LA 4MEAA 4EB6A 5E8RA 2GN2A 2X8WA 1A9YA 1WZNA 1E2FA 4UVIA 4ZAZA 2PXCA 3CBGA 4OU5A 3HGTA 3HXTA 1FRNA 2M6KA 3DDOA 1JHXA 1KXJA 1UJBA 3HA7A 2QYOA 3AFOA 3WG9A 1AZTA 4CM5A 3G6KA 4QHYA 1S7GA 1E1CA 4JYMA 3L4EA 2OHGA 4YRZA 2W6ZA 2C5EA 3CEMA 4GYKA 4MVJE 3B1VA 1LNZA 4YGYA 1R5OA 1Z6GA 1N6LA 3LYAA 4XUDA 3WYCA 4BMXA 5LM3A 4RZHA 1XALA 3DQQA 5F78A 4BUJA 3VXKA 1E1YA 3KDAA 5BUSA 3NR2A 2O2EA 3H7AA 4S12A 1FB5A 1W59A 5IUNC 1YVPA 5A3RA 3PNOA 5DW3A 4QKQA 5BVHA 5DM4A 3PKZA 1PF7E 3B5EA 3EC7A 2XOKD 1VHJA 1TMYA 3U48A 3FM9A 2BKLA 5ISMA 5EGNA 1X1BA 2XBLA 2VWPA 4S1OA 2Q62A 4PV7A 1YKSA 4JC4A 4QXOA 1A8UA 2QAJA 4HNAA 4E2XA 4TTTS 5EUBA 3M3PA 5JRDS 3HFRA 5I7SA 2P30A 3AERB 3ZI4A 2FRDC 1RLOA 1YU6A 1HKUA 2B36A 2IELA 3LUCA 4PAGA 2HH9A 3L7OA 5ALMA 4BO2A 4TRJA 4DR1B 4DA4A 2RC6A 5AKJA 4HVCA 2UZ1B 1YNOA 1KMIY 3UEOA 2IPAB 4YQYA 3TRJA 4C7OA 1NBME 1KDRA 2Q45A 2Z1MA 1DDGA 4BJHB 2XYVA 1C3LA 3HO1A 3OM0A 1PNOA 2OBXA 3DOOA 4PFKA 4RK4A 2Z83A 4HNHA 5D3ZA 1P4GA 3OVMA 2L19A 3P2EA 4HEA6 4PY2A 2QLFA 5L3SA 1JNXX 2XCIA 2Y77A 1L7OA 2XMBA 2EYQA 3BRQA 3GMDA 4OO3A 3WLFA 4CIDA 5BORA 4JXKA 5M29A 2P6PA 3AK4A 4XFJA 5KVVA 2OBYA 4J94A 2A1TS 2Y99A 5JH7F 1U8EA 2X40A 3N7UA 5JWHA 4M9SA 4FR2A 1DAOA 1KY4A 3U7FB 2YVAA 1YQQA 2HK9A 2HK8A 3EY9A 1E60A 4DUGA 4YDHB 3C8UA 4Y8VA 4KHPB 5JAZA 2AVNA 2AH5A 5BW4A 3QI2A 2YKGA 4MLCA 2O8EA 1YUBA 4U7GA 1D07A 3RRFA 4MVJI 4QVGA 3WLHA 1E9BA 3BK2A 1I32A 2V1XA 2CLSA 4OK6A 1TRKA 4BO3A 4CV2A 4AQYB 5HMLA 4B32A 3FWYA 4GI3A 3FZEA 5C2JB 2GJ8A 1PZXA 2SCUB 3BMQA 8OHMA 2IEDA 5JRJA 3O4HA 2NP6A 1DMRA 1PJ2A 1CG6A 2J33A 2ZRHA 2ZBGA 4L4SA 2C4UA 3L8FA 5ESRA 5ERYA 3TCXB 2QAIA 1XRRA 4INZA 1QYWA 1DJMA 4KB5A 4ONEA 1SUWA 4ON9A 3KQKA 1LLDA 5JROA 4ITUA 5HKOA 4FHEA 2BRUC 4HWPA 4J16A 2ECPA 1AGYA 1MXFA 1IZ0A 2QTVA 5DCYA 1AY0A 3BB3A 3OMLA 1CF2O 4TROA 3QELA 3CIOA 1R0SA 4MS1B 4QU9A 2Z09A 3BB4A 1N5DA 4WA7A 1C9MA 1N5KA 2JFNA 2QP3A 1W36D 1URPA 4D8VA 4RHCA 1D5WA 5IM5A 3DEAA 3WKDA 3ZWAA 3A4TA 2GZRA 1I4EB 1NG1A 1O2DA 1PEKE 1F38A 2FVXA 4FMDB 5TPWA 2X0RA 1PZMA 1W96A 2BFCB 3E22B 4DDKA 1BEZA 2WUDA 4FW8A 5TDHA 4AS1A 1DVRA 2A94A 1DOHA 1C9JA 4TS4A 1C4WA 4J3NA 4RTRA 3L9XA 4IMJB 5EAIA 3O8CA 4PR0A 1EFPA 5ECGC 5TS2A 4K40A 4ZVLA 1Q15A 2AMFA 2NYVA 1U90A 1XTSA 2CHFA 2NO4A 2P8SA 1IY9A 3GMIA 3M5WA 4L0CA 3SU8A 3VRHA 2LKCA 2UDPA 3TNJA 5E4JA 1BHQ1 3I8OA 4PNPA 2PMDA 1P33A 4XD2A 1V8FA 1S3GA 5EVJA 5GPBA 5EWMB 3SS8A 3TJZA 3NNSA 1KJZA 3NTUA 3E9NA 1V6CA 5ECWA 3VAYA 3QK7A 1KRHA 1EZ4A 2VNHA 2C99A 1DX4A 2Z43A 1QQTA 3EGDA 4JOQA 2CLKB 4MRMA 1GQ2A 4P22A 5E95A 2IZ1A 4BN5A 3ADPA 4TQ9A 3KV3O 2LD4A 5LQSA 3AU8A 1RKUA 3RU3A 2RHWA 4NBSA 4ZHQA 2HU8A 4B3FX 2WIDA 4F45A 1E6LA 1TD1A 2CN1A 3MMXA 4GOOD 1TF2A 3OCCA 2IV7A 1W47A 4EG3A 5ADUS 5HIAA 2JLRA 2FN3A 4D0RA 3FHLA 1G9TA 2AMLA 2JFBA 3FGPA 4QTZA 1ODKA 4NCJA 5DYGA 4CM8A 4QZVA 4M9ZA 3LS2A 1X74A 1IXRC 2VQFB 4JP1A 4CF6A 4EQ6A 1W5EA 1D4OA 3O1LA 4G8CA 2GHRA 3C3KA 5GV8A 3FNQA 1ZM3A 4MW5A 2I80A 1TMKA 2YRFA 1RQGA 4NG5A 4JN6B 2AG8A 1B8PA 4UVGA 3G5AA 3KR0A 1SRQA 1NUHA 2R00A 1O87A 1HE2A 4L8FA 1IJKA 2XUDA 2FDCA 4L4ZA 1AZSC 4O59O 1E0DA 4A5OA 1MAHA 2WUGA 2VYND 3WDSA 4XWWA 5EHZA 1EBBA 1LKZA 3CQ9A 2CNWA 2O7SA 3OCYA 4G65A 4PSVA 3WSVA 2WJAA 4H7FA 2XXAB 1GKLA 1KY5A 4OB6A 5KYYB 4ZQCB 2G9QA 2XWQA 5ITWA 1FZQA 4IIDA 2CXSA 4LUCA 4DIEA 4DSNA 5FYQA 2HU5A 1Z8HA 3C14C 2C5LA 2GBCA 1TYBE 2W93A 3OMWA 2PBZA 2YR0A 4ZPJA 2DT8A 3GVHA 1GSAA 4B2LA 1K5GA 4TZTA 1NWHA 4WLEA 5KVSA 2ZWAA 5LYJB 2JLSA 4BB9A 2C95A 2QD4A 1L7PA 4PANA 1HI9A 1VE6A 2P2GA 4GNKA 1OI7A 3FNRA 4YRQA 5D1NA 4R9VA 3KT3A 2JIDA 3PDIA 2BZ0A 4O2BB 4IG4A 5EZSA 4JHLA 4PEVA 1NW4A 2OCGA 3KTFA 4PGGA 5TB5A 1UDXA 1IXSB 5IJ0A 2XUOA 1G55A 1Q7EA 4YRIA 1VA5A 5L6LB 1JLKA 3KXDA 4KYTA 1D6JA 4BYGA 5KMGA 3NVMB 2YJ6A 5THXA 4MKHA 2GZHA 1ZXLA 4LCJA 3HRIA 4LOIA 2ZS9A 1UOEA 2FF7A 1PGOA 5L40A 1NRIA 2P5TB 1T5HX 3A8TA 2MSEB 1X2BA 3NH9A 4P5DA 5EHGA 2FPGA 4BNUA 1CTQA 1HDCA 1QDUA 1RE1A 1LDBA 4H1VA 4IO1A 4Q4JB 1NRXA 1X70A 4YMLA 1IVNA 2RI6A 5DSZA 4MYDA 1RJEA 1W0CA 3T12A 3EF0A 1KHTA 3PL1A 5K45A 1O97C 2P5YA 3GCDA 4ARZA 1V3UA 2HCRA 2XZPA 4DDUA 4NCKA 1T6YA 1BSVA 1KJNA 5E2AA 1NBEA 4C7JA 2XNKA 4CQJA 3IAXA 4ZVSA 3WRYC 2PBRA 2UKDA 3MWEB 2PEYA 2QVGA 3UGJA 3TQCA 4OKSA 3KOXA 3C98A 5K0BA 3VR4H 3O3MB 4EA9A 2R4TA 2BTQA 4EI8A 1SD5A 3UB3A 3UAYA 3BKXA 3KHUA 4LX8A 5F5NA 4CR8A 4EELA 3WADA 4KRFA 1J1ZA 2XWJI 1QE3A 3B7PA 3TGWA 3CNEA 3RSQA 1D0VA 2QD3A 1M6EX 2LKDA 1OC2A 2WAXA 5CVEA 4LFAB 1BXKA 4EHNA 2I8CA 3LGXA 1PBNA 3RIXA 3KM0A 1W29A 5BSFA 3HHEA 1JBQA 1SXIA 2ZATA 4MRAA 5IKXA 1LB1B 2JGMA 3ENVA 3I04A 1TJ3A 1YR7A 3PYMA 4A26A 1JV2B 2HA3A 2A5JA 2OO5C 2JGJA 3HABA 5EPUA 5HHTA 2ECKA 3GLGE 2X3UA 1L4GA 3PQ7A 1WUIS 2ZEJA 4MIOA 2O1WA 2YYSA 3MJCA 4V0NA 1OI3A 5IBPA 4KMRA 3IMCA 1UKYA 2CFIA 3QFCA 4LMAA 3WLMA 1ZHFA 1QLHA 3ZK8A 3NZEA 3ZCXA 3P20A 1FYDA 4L75A 4OL0A 3VPBA 3ZW8A 3V8NA 2ZFUA 4B8ZA 3ISVA 1P0FA 1T3GA 3IDAA 5J9FA 5JRZA 4BFWA 2FP4B 1VB3A 5GMOA 2UZIR 3LECA 2B2XA 4RIHA 5CDUA 5I8WA 1E7SA 1EWRA 4OQDA 4JIMA 3RIYA 1QPZA 2JIPA 1CVLA 1UDCA 2IZZA 1PQUA 2CLOB 3RTCA 4BVKA 2O6LA 1UKEA 4UJ5A 5AI9A 5H68A 2O59A 2JARA 1S2NA 1PCXA 1ZVVA 2VA9A 1HE8B 3T5MA 4N5DA 4GMDA 4QUAA 4QJBA 4M1QA 2B61A 2OFPA 2C9OA 4G1MB 3BMXA 4EI7A 1A1SA 1CUDA 1JG3A 2EXXA 4RPHA 1H0KA 3GJSA 3GZNA 5L7WA 1H94A 1Q14A 1DIBA 2HDNB 4KXMA 1T35A 3AHEA 1GILA 4MWOA 2PT7A 3UFBA 3OIUA 4MA5A 4AWXA 5LXTB 1SVIA 2O1XA 1JSCA 3QI7A 4Y67A 1CXZA 3NQ41 4RIGA 3JTMA 1YZGA 5AT1A 3DBLB 3ZXUB 4MDEA 2D2FA 4M1OA 4KN9S 4BATA 2ZS8A 4GSKA 3GFOA 2EYUA 3DBRB 4GSYA 2BBSA 4Q3EA 3WYEA 3IOYA 5FBQB 3JRWA 4HSEA 3OOHA 1GA6A 4YRCA 1GPDG 1EVYA 4OMUA 5DI3A 2UZ4A 3U4QA 5AHKA 4O2AA 3EXFB 4ZKEA 2YXDA 4DDWA 1OE0A 3K0EA 2GZSA 2HDHA 2QB5A 1ZUHA 1SKAA 3B3GA 3DDUA 4QC2A 1JQKA 3FUUA 3D6TB 2PJRA 3HWRA 1YFLA 4X84A 4DWVA 2B0JA 2GMWA 1LDNA 2XB4A 4TVBA 3E8MA 5FV4A 4QU5A 1U02A 1SIWA 1OX6A 2JD0A 2ZVDA 3HXPA 1FP2A 3F3YA 3M6UA 4E0BA 3CH6A 1EJ2A 1A9ZA 5E9JA 1ULHA 3HCEA 3RW9A 4ASUD 1JFTA 2PPVA 5CVTA 2YJTD 3IDFA 4D96A 1XNJA 2BFDA 1TTPB 2ZDGA 3NT5A 3QITA 1SBZA 1VCMA 2FGKA 3IOEA 1GCAA 3HVJA 3AP2A 2W6QA 3RARA 2HT1A 3LYUA 1O6BA 2QL6A 2PXXA 3ETCA 3WGGA 3NHUA 1H6CA 1JKXA 1MV5A 2CF6A 1QFMA 1A8QA 1ND6A 2QX4A 3BDAA 3IDSA 5DE3A 4TTIA 2FF5A 3LDUA 5JD3A 4YH1A 1SQSA 5EE3A 3MCTA 1YA6A 1GNTA 1BNCA 1MO4A 2FRDA 3IUMA 4FCVA 3T4UA 1L5QA 1B00A 4ZYWA 3P4XA 4B8WA 4P4TA 5K0LA 4LDAA 3F74A 1WEHA 1MDBA 2X2FA 1U9CA 3S2GA 4ZAWA 4DNPA 1RE0A 2PNFA 3FWNA 3DH0A 1E2HA 5J3JA 4RXTA 3LDHA 1HURA 3GPBA 4HX2A 1M6HA 4JSTA 4R8SA 3F6RA 2O2GA 3I1YA 3TOCA 4BFTA 1UC5B 2QHXA 2Y1XA 1U9IC 5BQOA 4DNQA 4EJ2A 3M81A 3B48A 4V2UA 5LQMA 4ZQFA 4YXWA 1A98A 4QFBA 5EJ6A 4OQ4A 4ZZ2A 1LV7A 4X8HA 5JMWA 1WS6A 1C0IA 1SH7A 5DXFA 3U3OA 2GCEA 3L7NA 5KJCA 1EI9A 5DMHA 5DN9A 3QA3E 1T0PA 1V7CA 1QR6A 2IHVA 1P3JA 1BVRA 2ODNA 2HMTA 2FAXA 3DFUA 3L4BC 1GFIA 3P2JA 5DU2A 3TMYA 5CLLA 5DCWA 3ROKA 4L51A 4MQUA 4AK9A 3I61A 4G0UA 2DPLA 2VIIA 5JSHA 4GXNA 1QC5B 4DEYA 2XGJA 3VU8A 4QYXA 3DVLA 4XDGA 4YASA 3J81A 1FSPA 5JCXA 1YL6A 2EC5A 3HCNA 4UZFA 5DBHX 3ROQA 2MSDB 2VJKA 3OFNA 2XKBA 3NHYA 4ARIA 1Y5RA 1J9GA 2HNKA 1H42A 1SCJA 1QFJA 2R86A 1GGJA 3PFBA 4FDAA 1FFBA 1OB2A 1YJXA 3BEDA 4POAA 4H2DA 4B75A 1E32A 2D13A 2W2LA 4TSKA 4HEJA 1KZYC 3FBWA 1RD4A 3SYRA 4WEOA 3O4IA 4K6HA 2C88A 1U3TA 5BWBA 1B6SA 1F4PA 3ICVA 1T36B 3L1HA 1TM1E 1PR9A 3PB3A 4YCBA 3ZIAA 2X5JO 1CB0A 1GV0A 4JUBA 2CCGA 2V03A 3GVIA 4PIVA 5EFOA 4UXIA 3T52A 2Z2JA 5EKTA 1FXWA 1EA5A 3CCFA 4QXPA 1U7PA 1V11A 1AG9A 4DM3A 2ZUWA 1JVNA 1NJ8A 2J3JA 5A02A 1KEPA 5DEIA 1OT3A 1E89A 2BKAA 4INOA 4LOJA 4GXQA 4QNMA 4DA6A 2X2PA 2H7VA 1NC3A 2D0DA 3NOOA 4QU0A 2VPYA 3D0QA 4ZKDA 1ZUIA 3FAKA 1SCAA 1E5DA 1EFTA 1G7CA 2FEMA 2X8JA 2ACWA 2BEWB 4B31A 3GRPA 4TN5A 2BFEB 3OQBA 3NJ4A 1FVHA 2XNJA 4PLCA 4QBGB 1M34A 721PA 3UMFA 5LCXA 5JC1A 4G3XA 1PSWA 4JC8A 4WFQA 4TXLA 2G7MC 5CGZA 3TYXA 2I2XB 2NT3A 3AR5A 3I4LA 3PNKA 5AJTA 3ZKWB 4YYEA 4C4AA 4DQVA 1CULC 2XNCA 2CFSA 3TOVA 4AJ4A 4E6PA 3IDQA 2AEJA 4MW1A 3LIPA 3NBMA 4INAA 2JCVA 2QGZA 3SDBA 1MNQA 1VLZA 3D3KA 4UTZA 1XQVA 4C76A 3DUWA 2BFWA 4ZMRA 3UC9A 3LW8A 1KQNA 4LZWA 4S0ZA 3I0ZA 2WKRA 1PR6A 4TMZA 1C3EA 5DTRA 1ZR4A 1TUGA 3DF9A 3OKCA 3S7ZA 2I8AA 4C20A 3AUYA 1QKKA 4XDHA 1ANKA 1I4OA 4JHXA 1DIAA 1GNVA 2OZLB 5B37A 2Q5QA 4E5SA 1KETA 1AUOA 1JIQA 1WXQA 2WD9A 3PBKA 1HXHA 4OXRA 1YB2A 3MCUA 3QVJA 2JJ8A 1IVYA 1U1DA 4YMSA 2H57A 3HLYA 3LHKA 4IJ5A 4W1QA 3RFTA 2BHTA 3V2UA 3SOPA 1AN0A 4J07A 3L84A 4LTDA 4A8HA 4Z3KA 1WZ2A 2XTAA 3CZRA 2IZ5A 3BWEA 3MT8A 1NE7A 1CC1S 2QE7D 3CG0A 3ETGA 3DFMA 2JI7A 5CLIA 4OP1A 4OAPA 4LN1A 4RYDA 1SHTX 4OIMA 3AEUA 4GE3A 2RGRA 3V1MA 5K20A 2JD2A 3A2MA 5CCDA 4EG6A 5K3FB 3AM3A 3IAS6 3TRKA 4ZOCA 1C14A 3PDJA 5DO9A 1ULUA 1F2DA 1XTTA 2DBYA 3I53A 1XNHA 4GPIB 4JT9A 4NCHA 1KMQA 4ZQGA 4AO6A 3AVVA 4DJAA 3OTGA 3PV0A 1C9KA 4LTMA 2QSJA 4RV5A 3THRA 1Z8DA 5LP6B 4UMVA 5JQGF 1SXPA 8MHTA 1ORWA 1ZCZA 2O2ZA 2CXUA 2CL6X 2H1HA 4EMSA 3Q7RA 1VKNA 1AKWA 2E4XA 1JR2A 2H07A 4PU0A 4E33A 2C7PA 3HEAA 1BOFA 2J4CA 2YNMD 3TAUA 1DB3A 2D0IA 4HAYA 2YRWA 1A7KA 2OGTA 3BIXA 4KR9A 2BMAA 1RYYA 3IDOA 3ZV3A 2NLOA 5AM0A 2XUFA 4OX9B 1XF9A 1E0SA 2J0VA 4X90A 1QQAA 3VSCA 1WD5A 1ZONA 3LHDA 2POCA 4UDNA 1MNAA 1IEQA 4U2CA 5KOJB 4PC1A 3NDIA 1W2HA 3RYCB 1G7RA 3NXSA 2YZNA 2QBYB 2XB6A 3DQPA 1V41E 2H1OA 1W52X 1KVSA 2Y2VA 1OX4A 2G40A 1O96B 1Q1AA 2ZIEA 4HUQA 1SD2A 4JS0A 4E51A 3RQSA 4NMWA 4J2OA 3FNFA 2VHZA 1GRVA 3Q10A 4G37A 3UMSA 1N2CB 2CMHA 2CSUA 4UCWA 5DNYB 1JLMA 2PUGA 1DGQA 4GOKA 1GDTA 3BJEA 1ZM2A 1XA4A 3E3OA 1DRKA 2V7QD 2BCEA 3L6BA 4BLTA 4Z8XA 2ZE5A 3ZD6A 4DR7B 4CW7A 3EIOA 2Y1OA 2GNOA 4ZT6A 3BULA 1Q77A 3GNLA 2DF8A 2H51A 3EQ2A 4H0FA 3KEGA 4HWGA 3RIHA 1T6NA 3IT2A 5EKSA 1J25A 2XRMA 2YVLA 3LY8A 1G5HA 1X38A 3H5RA 4E5UA 4B4KA 5HRAA 2J9XB 2Q1UA 4BLWA 2HK6A 4C3ZA 4BPBA 1J09A 5HF8A 4HPXB 4IBOA 4OP3A 2GESA 1M10A 1M6WA 3VR3A 5G2OA 2ID7A 3BH0A 4JVNA 4I9FA 1VG9B 5AKGA 5LQJA 1G59A 1NDHA 3H9GA 3HDYA 3UAWA 4BBZA 1VE9A 2QTWB 4REMA 3WRXA 2JLAA 2JAQA 5EXDA 3DMHA 4YIHA 1ZCFA 2ACKA 4BLUA 2PWBA 1WVMA 2XVAA 1H22A 3PZRA 3GMTA 4DQDA 3AWIA 4PPNA 5CFOA 1ZD5A 3ZHVA 1HDEA 2ES4A 3H99A 3PQEA 4C0JA 4BP1A 2E4YA 2WIJA 2HPAA 4MWZA 2BISA 3HRKA 5BN5A 4X20A 1N5RA 2YJNA 1D4ZA 1ZJ5A 3ROTA 2HHAA 4Q3LA 1KIFA 2V5UA 3N8NA 4OTZA 4QOJA 5JATA 5IVHA 1LPSA 2Z3VA 3TD2A 4JYZA 1U3FA 1R0YA 2PWYA 3B3AA 5CYFA 4AZSA 1LBIA 3MQ4A 1UWCA 2O7NA 2WU4A 3KKPA 5TGDA 2Q4OA 3E9QA 4AY6A 1YS4A 1NT4A 4LGCA 4O3MA 3I6MA 1U6KA 4MUYA 5DEOA 4UU1A 5C4MA 2AN1A 3JY6A 1UBHS 5CH8A 3IUNA 5J4KA 5JNUA 3SG0A 1ZU5A 2EGUA 1W25A 2HQSA 2O2JA 3NM5A 3MIIA 2BEVA 1CUGA 5LOVA 3R3YA 3IKLA 1Z2CA 4V0MA 4B7CA 1ZM9A 4DSZA 3FOAA 3U0VA 1UXKA 5D86A 3TNLA 1UOPA 1EWVA 1CRQA 4G1CA 2G1JA 3ED5A 3K9LA 3RE1A 4FDMA 5BW5A 3OZCA 4ZCLA 3O91A 5H82A 2ZAGA 3D4IA 3GH1A 5G3ZA 5JBQA 5A3JA 1TW2A 3M1IA 1XVTA 4JJFA 3KQSA 4M36A 3WK9A 1G6HA 1TC1A 3GJYA 2QGFA 2E6UX 3GAFA 3GL9A 2ZS7A 3HKBB 4C6TA 2P4UA 1E1LA 4U8HA 1GAJA 2HGSA 4TKLA 4HNUA 3UJNA 2ZRAA 1R5JA 2NYAA 3OURA 5JDCC 2P9HA 2WFZA 4BX8A 1UK7A 2O1SA 1VL5A 4Z1MA 4Y7DA 4DPLA 1L4NA 2RGUA 3MMNA 2FWIA 4GQBA 5ER6A 2OBFA 3ZCQA 4DFDA 4BEJA 4IXWA 4NOJA 1VL8A 2ZDHA 3JAKA 1W5SA 4DCNA 2V8OA 1DKRA 2WJIA 3HXKA 4PC3A 4DJEC 3T95A 4DUGD 3AUXA 5CG2A 2VAVA 1WMFA 1JUDA 2X22A 4V0OA 3F8TA 1FS4A 1SFRA 4AKSA 1AQYA 3DHYA 4HI0E 2CZCA 4ZVPA 4BGVA 4RD2A 3AHIA 5CNJA 3DXXA 1I14A 1JFVA 4G2NA 1SUFA 3QEMA 5DTMA 4TRRA 1EUDA 3PKIA 3TLEA 5KIAA 2WSYB 4LV5B 3BE8A 2IGTA 4QGHA 4D9JA 2QLMA 1JHZA 3V8VA 1ZOSA 3AESA 3R24A 2GRUA 4RK1A 5K09A 1OU4A 2C7BA 2VEOA 3BIJA 3F6SA 3C5HA 4Y3UA 5FBZA 2ZIUB 3HKCA 1JKFA 1ZOLA 4MVJF 3U3ZA 4GE0A 4XGNA 4JMLA 2BCGY 4KFSA 4NYMQ 3RH0A 5AVUA 3GN1A 3VTFA 4YBRA 3HU2A 2XW6A 1P31A 4IHJA 4LRXA 3UB4A 4DLPA 4KUGA 1SXJB 5E7IA 1W9MA 2QTNA 1D0SA 4FFOA 4AKEA 1M2VA 4UEWA 3WLLA 1KYXA 821PA 3HTXA 4IIJA 3NTLA 5TJ9A 3BRCA 3K5WA 1L7RA 3SYKA 1SBYA 4BX2A 3TFQA 3QBTA 1M2EA 2FXIA 3VZQA 4F5EA 4RGVA 4A0GA 3IAFA 4CIBA 1KYIA 1H2RS 1FDIA 2J3EA 3A06A 1FSFA 4O6VA 4R1SA 2HREA 4AZ3B 4N0MA 1RPAA 3NONA 3VZDA 5I7UA 1U9IA 2FMHA 2DEUA 5ICEA 3BRWA 1OZGA 4JKYA 4YDQA 1AKYA 1J24A 4FINA 4XGQA 2B69A 3GP8A 4G8DA 1O8BA 3QFHA 4JJZA 5K4HA 2HW8A 2XXJA 1K27A 3PNMA 3L4BA 3WWEA 1FVFA 2Q3FA 4NULA 1M2WA 2CUKA 1FUEA 1TKAA 3IIEA 4JLUA 2W6PA 2YIVX 5EP1A 5HBRA 2OQ2A 4TGLA 1ZW1A 4XCXA 1CUAA 1QLJA 2FJUA 2X0FA 2GN8A 1SUCA 1IULA 1FDTA 5EPEA 5JE8A 2XOEA 1GRQA 3EA5A 4FKBA 3MSCA 4XM1A 4ZI7A 3WKCA 1J5XA 1Z25A 4C08A 3SJBA 3KTAA 3THYA 3CTMA 3ZY4A 3WKAA 4AY5A 1QV6A 4GOXA 3KBBA 3WVNA 2FEKA 2QPTA 1D7OA 4GIBA 1Z2AA 4DV1B 4C22A 4B40A 4YV1A 1UWLA 2X23A 1E6EA 4W6QA 5GONA 3HYCA 2JW5A 1V7QA 3OY7A 2IE8A 1US8B 3ROMA 1NVEA 1E98A 4YJHA 1N36B 2Y66A 1RWWA 2CJPA 2YZ2A 5TV2A 3KETA 2R97A 2RBKA 2PX2A 5E9WA 2H16A 4F2GA 1LBTA 3KYCA 4GLBA 1OXBB 2GA8A 2WBLC 5EE0A 2QTLA 4AMUA 2PZLA 4TZ0A 1YKGA 1JBEA 3TCNA 2IYWA 2CNWD 4LJYA 4YMIA 5DGIA 5JUWA 2IYQA 1YMVA 3E82A 3CLVA 3R0JA 1WY7A 4FGJA 1XBTA 1QAMA 4O5AA 4D79A 1S2MA 5AM2A 3AF6A 2VT3A 3EEBA 1HNXB 1E7WA 3C45A 2WF9A 4C1BA 2WWFA 1NNEA 4Q6WA 2GF2A 3IILA 4QECA 4RLQA 2PX4A 2HIGA 4RLHA 3RF6A 1W35A 2R6FA 5TSDA 3DL4A 5AI8A 3VDQA 3ZVLA 4MXDA 1F5NA 3AR3A 1O8CA 1DBIA 3E5MA 5FUQA 3T4XA 1ICEA 3WBBA 1CP3A