1P3Y1

Mrsd from bacillus sp. hil-y85/54728
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
183
structure length
171
Chain Sequence
b'ISILKDKKLLIGICGSISSVGISSYLLYFKSFFKEIRVVMTKTAEDLIPAHTVSYFCDHVYSEHGENGKRHSHVEIGRWADIYCIIPATANILGQTANGVAMNLVATTVLAHPHNTIFFPNMNDLMWNKTVVSRNIEQLRKDGHIVIEPVEIMRGLITPDKALLAIEKGFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MrsD protein
molecule tags Oxidoreductase
source organism Bacillus sp.
publication title Structure of MrsD, an FAD-binding protein of the HFCD family.
pubmed doi rcsb
total genus 52
structure length 171
sequence length 183
ec nomenclature
pdb deposition date 2003-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF02441 Flavoprotein Flavoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1950 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Flavin prenyltransferase-like 1p3y100
1MVLA 2EJBA 1MVNA 4ZAXA 4ZALA 4ZANA 3LQKA 1G5QA 3QJGA 4ZAGA 4RHEA 4ZAVA 1E20A 3MCUA 1G63A 4ZAZA 1SBZA 4ZAYA 4MWGA 3WISA 1QZUA 4ZAFA 3ZQUA 4ZAWA 4RHFA 1P3Y1
chains in the Genus database with same CATH superfamily
4U2BA 1AKQA 4BVAA 3EBLA 2BJWA 1S0UA 3COWA 3FTDA 1E4EA 2G83A 2GNOA 2OO3A 3MCZA 4BQPA 3N07A 1IQ0A 4LHZA 2QM7A 4U7HA 3VNBA 5T3UA 1QB7A 1NVUQ 1N8SA 1SG6A 4KDCA 1DEHA 1B93A 4MUFA 4LZWA 4X20A 5LZ4A 3DLHA 4OI2A 2B8WA 4OI0A 2DQ4A 5BSUA 4DL9A 1ZMBA 4ABYA 4BWVA 4HH3C 4ZI5A 4Y9TA 1LPBB 3IVMA 1FXSA 2GPWA 2LRHA 3ACBA 4YJGA 4PU0A 1NXTA 2FWBA 5K0BA 2PLNA 5L7TA 3ERCA 4IZHA 1MQAA 5DTJA 3NORA 1H6CA 5AVYA 3FZEA 2GBCA 4YCBA 1FX0A 1G2IA 1C9EA 1UWKA 4KVFA 1LS6A 2RGUA 2E4WA 3P97A 1XZNA 2ZZNA 5J40A 4KXLA 3ZCXA 1Y5IA 1UIMA 2H0QA 5EEGA 3R5JA 1R74A 2VQSA 3P94A 4O6VA 3OF3A 1DC6A 4V0ME 3A2LA 2GZAA 3A58B 1W1IA 1JT2A 2DWCA 5LXTA 1FUEA 3TZ6A 5TMEA 2YIDA 3HLKA 4BJ6A 4Q82A 5HP4A 3BMCA 1W0JA 1FDUA 3EGOA 4CETA 1NPDA 4W6ZA 4TUYB 1WW3A 1USUA 3EW7A 4WNAA 3B1YA 3INGA 3BMQB 2YOHA 4ZOCA 4N3CA 3U4CA 1M67A 5FQNA 3PHLA 1O0CA 1XXHA 5EPEA 4YGYA 3TCXB 2JGIA 5SZKB 2BLLA 1TXGA 2HCTA 4BS9A 4NY1A 4R54A 1GKUB 1NF9A 2M6LA 2P40A 2IOFA 4I9UA 3G9ZA 2HRDA 1MGPA 3CT6A 4KACA 4MV7A 5CRIA 4QTYA 4IO1A 2CL5A 4ROTA 4PNPA 3UPUA 4NCBA 1Z5UA 3D1LA 1VPVA 2P9TA 2W5UA 5ENZA 4FR2A 2FZCA 3FDZB 4LVUA 2KE5A 2CWDA 1R4MB 2P27A 4RKWA 4KWHA 1MORA 4OLHA 4OI1A 4ZDWA 3UFXB 4BNFA 4DG8A 2R4TA 3WMGA 1NI4B 4CTJA 3MGGA 5BV0A 3KIPA 5EUMA 2ZJ2A 2YW9A 4O2AB 3U4AA 2A9JA 1VL0A 2FFAA 4TL7A 3RJ9A 4B9EA 1SBQA 4QOEA 3GNTA 4NCXA 5IF9A 1E94E 2C2WA 4FGKA 4DWJA 1I5RA 3BGIA 1KJYA 4GWGA 1UH5A 3AF6A 4KQWA 4QARA 4C20A 4YK7A 4EO9A 1M0EA 2CV2A 5IVIA 4MHTA 4Z3KA 4GX5A 2VPZA 2W22A 5ESWA 4XUCA 3OOEA 3IP7A 2YHIA 3DAHA 4Q1BA 3L6BA 3UK2A 2VR1A 1R64A 4R0VA 1QRAA 1SVMA 2MINA 5HMLA 5CP8A 3EJ6A 1RZVA 4KPYA 1CVLA 1I10A 2QD1A 3R5XA 3ND7A 3JQRA 2H0AA 5F51A 3TAHA 3UJ3X 1BKDR 3E9RA 4MPRA 4JLDA 4JOBA 4HWSA 4YQFA 5J43A 3ZW8A 5G4LA 3GT4A 1VXOA 4OM7A 3TUJC 3QWAA 4FQ7A 5EJFA 2WW8A 4AKEA 3B1VA 2G28A 4TRMA 2Q3LA 1EGVB 5LN1A 3OCYA 5F9MA 1EXDA 2IWHA 3TQQA 3L0YA 2D1FA 1JEDA 1PS8A 1R3DA 4AY3A 4ZREA 1IONA 2ZKLA 3PC3A 5FA8A 5ED4A 4GSKA 4KQKA 1ZGBA 4XEHA 5CFRA 3IB3A 1CR4A 3KK0A 1ULSA 1A2BA 1UJCA 3AJEA 4JT4A 4BNNA 3HKDA 4GOLD 5AKKA 2PRZA 2WNSA 4L22A 3PDWA 2DT5A 4NAHA 3K32A 3TD2A 3RAPR 4KYUA 1XEWX 5BPHA 1O77A 3UUFA 3RANA 3OZTA 1EUQA 2QA5A 3NTXA 1SBNE 4P80A 4LPSA 2RJ3A 5JJIA 2FX5A 3O47A 1SUCA 1XF9A 2OOKA 2ZB3A 3RC7A 3TEMA 2OBXA 5BYAA 3JPWA 1KI3A 4Z4QA 1XCLA 1TO6A 1YDGA 3NM4A 1I7NA 5LYJF 3D5EA 5K4AA 3DE3X 4U9IS 4TQAA 2DU8A 5IJXA 4DJDC 5KZMB 2NO7A 3S8YA 3LYLA 1SCJA 3ZCRA 3IKMB 1OROA 2EYQA 5JVDF 5HBRA 2FPWA 1MDFA 3IO3A 1QV7A 2YWCA 4IPTA 1G2PA 3PKIA 2AN4A 1PNOA 2W0MA 5AJVB 5LPNA 4KC0A 3F46A 4FJ2A 4RDHA 3P9YA 4FX5A 2AQIA 5TT1A 4BFSA 4YJFA 4DSTA 1S7CA 2DHQA 4KZKA 2GFHA 4K3VA 3NTRA 3QKUA 4DV2B 2IOFK 4IX9A 4QYSA 1BXGA 2HIMA 4U2GA 5BYBA 1NATA 1W5TA 4FWBA 4F11A 4OMDA 5DXJA 2AOUB 1YZKA 5KNCD 5K0LA 3LF2A 4S3MA 3EBPA 4WLNA 2O0MA 3M5PA 4OFWA 3TAXA 3JQAD 2RHRA 2XZPA 3L9WA 4DG5A 4Z0TA 2QJWA 2ZIUB 4BP3A 1M5UA 1YJAA 4C22A 3L4BC 2V4ZA 4MUXA 4G86A 4WEQA 5HWSA 4F9GA 1PR9A 4UEKA 4IVQA 3E8MA 3RGGA 1RRVA 2FUEA 3RBZA 5FWXB 2HA5A 4HFNA 2J1LA 4MW6A 1JMYA 1PJCA 1W36C 5FOWA 5JXJA 2BBSA 2Y05A 2O8DA 1VLMA 2XXBA 1N5MA 2PBRA 3Q2IA 3AHEA 1QQTA 5ALOA 4NNOA 4R3UC 2V7TA 2AVNA 4OXQA 1BKSB 1XAIA 3BZWA 1RRCA 2FMIA 3Q7EA 1G59A 3TX2A 1B6TA 2X22A 4LXGA 4TSRA 3PHBE 4M54A 1XVLA 1RYFA 3ZTTA 2B7BA 4BDSA 1WSDA 1NG1A 4WKOA 1GNPA 2IITA 2NZWA 2HF8A 1O2DA 3OKFA 4B8YA 4Y9RA 3ZE2B 4CMCA 1M7GA 2LTAA 3GFTA 3K1AA 4PW0A 5CLJA 4OK6A 1LWNA 2ZBFA 3LT4A 3MERA 3NPAA 2EOAA 1DFIA 1EX9A 1FU4A 1Z5ZA 2YNMC 1VLQA 1ZQ9A 3VKGA 4MWDA 3S8EA 2P9QA 3D9QX 1WVMA 4M0FA 1KYIA 3TJRA 1LBEA 3TSYA 1NV9A 4MUKA 1NF3A 5C8ZA 3DULA 2BGIA 1P73A 2J0EA 5B7PA 5DBEX 2Z9CA 2ZATA 5CB4A 5HZHA 5ERXA 4CN8A 1IBKB 2AC2A 4YRBA 1C8BA 3AESB 2PYDA 2MMCA 2RHWA 5BV8A 1E9EA 4BO6A 1U9CA 2MDTA 1RU3A 2L0XA 2V9CA 2OXCA 3LC2O 4AD8A 3R8CA 1N8KA 3HSKA 3TE7A 1IWPB 2P9CA 3CRVA 2IHZA 3RSHA 2G09A 3GX1A 3OX3A 1GU1A 5EKSA 4A0GA 1FNCA 3VNQA 4UUBA 3RNLA 3FGNA 1RYZA 1XHLA 2M6RA 1ZHFA 3E03A 1RZRD 5FPSA 5ISMA 4G4SP 1E5TA 4C7KA 4D9JA 3AI3A 3BVPA 1E1CB 2JHAA 3SI7A 3F3MA 5IXJA 4LDJA 4XM1A 4X65B 2XCTB 4GL2A 1IEVA 3FDXA 1Y1PA 1BWSA 1T6BY 3D7LA 2XMPA 2HREA 2JK0A 1R9NA 3C7AA 3EQ9A 4LBZA 4DDKA 5EJ8A 3AJ8A 1I24A 3U3OA 3NH6A 3PIDA 1UDBA 3KVOA 4MWSA 1ACJA 1FDRA 1RYDA 1X9HA 2PUHA 2Q21A 2V74B 2GZ1A 3PKZA 2RHJA 5IT0A 1Y6JA 1YKFA 1AN0A 3FOCA 5BSRA 3S99A 4C7JA 1SCBA 4R1PA 3UXMA 1I0LA 5H0IA 3IKJA 1OWOA 1VPDA 2I6FA 4FONA 1GZDA 3GBPA 2ZIFA 3EASA 1OLUA 1UQRA 1SHLA 3C85A 1YE8A 2XZOA 4HVTA 2IVZA 2LDBA 3P5BA 3LY5A 4B85A 3EGEA 4BE4A 3ZHRA 1S01A 2B1RA 1K9VF 4IICA 1MJFA 2XH8A 2YJ5A 3D4OA 4HV4A 2QJRA 2QM3A 3K2QA 2SCUA 2V7VA 1SG9A 5SZHB 3W8RA 4LRTB 1O97C 3IAS1 2R44A 2ZROA 2FMFA 4ZYYA 2EGGA 5GP1A 4AM8A 6PFKA 2QQ5A 3ORFA 3LC1O 1B6GA 3GG9A 1BDJA 1GUAA 1RLUA 3D6UA 1JH8A 1SXJB 3PF9A 1GA1A 2C4NA 1GZ5A 3PNMA 4Q93A 2GRUA 1FCJA 2DAPA 4MICA 4DLAA 5JFTA 2FRDC 4I50F 4LUCA 3FYUC 4DN6A 4IH1A 5E7MA 2KSQA 4B3BA 3V7NA 2P9ZA 3TW8A 4J16C 3A6DA 1OYVA 3EVZA 3PXXA 4L85A 3PL5A 2GDJA 4GR5A 2RHHA 2Z9BA 4O33A 4C4OA 4Z7NB 1QH1A 2B6NA 2DB3A 5I8PA 2QTZA 4JBWA 4DILA 2P6UA 4UVEA 5IFLA 2XXAA 1X7WA 5BWLA 1R6AA 3OTOB 1E7RA 4HFJA 2VG8A 4C7MA 1DPFA 3MWYW 4YDSA 2CLLB 4XJSA 1U9IC 4QTTB 2K2QB 4EFDA 4HVCA 3WX0A 3MGKA 2IK8A 1WM1A 3U7IA 4CQMB 4IXDA 4OQNA 3PNKA 1UFVA 5K0EA 3M81A 1P81A 4TKLA 3RYIB 4FMCF 1QG6A 4MVJA 4CVNA 2Q28A 1Z8FA 3TK1A 3C3BA 5B64A 1JEAA 2E7ZA 3RFTA 2DBQA 1VMDA 4RGQA 4LZZA 2IP4A 3A2MA 1YZFA 1YJQA 4C43A 2DEUA 4M6WB 1X7YA 3JRWA 3OIUA 2C4UA 4QO8A 5K8LA 2VHTA 3I6ZA 3AIKA 3RK1A 4L75A 1B76A 3I5XA 1SHTX 3IUEA 2A3NA 3UB3A 2YJ3A 5ITVA 2FXIA 4L4RA 1JDNA 3CVWA 4DV4B 4JELA 4W7SA 2H1WA 4ZDKA 2NQ2C 3OBBA 1GQ2A 4ZZIA 4Y1EA 2X77A 3JWIA 1DT5A 1ENZA 2H1IA 1MTOA 2BL4A 4UXHA 1QCDA 3VHQA 2WFMA 3UBTA 1R5OA 1R88A 2G07A 3VO9A 3GCGA 4R1QA 1GLGA 1NM5A 4LY6A 1YGPA 3O03A 4MWTA 5JZOA 1QC5A 2WKRA 1V16A 4O5AA 4YQZA 1AQJA 1CF4A 1W59A 1OH8A 2QZZA 3D02A 4JLVA 3TE6A 4NDZA 3M83A 2BMJA 4C3UA 5F3WB 3NYIA 2C2HA 4I2VA 4KTVE 4YGXB 3R3SA 4DA0A 4DIUA 4EPXA 2DP4E 3K8ZA 3NPMA 5E8JA 5KNBH 3MOIA 4FHDA 2BY4A 3RVPA 4DLLA 2VK1A 4FKZA 3V1UA 3PUJA 2O19A 3PFWO 1XA4A 2X9LA 2BFBB 1A0OA 1U0GA 4JT9A 2RE8A 2XA9A 2FFBA 1B73A 4IHKA 1Z7BA 1DXOA 1E2GA 1PR2A 2A57A 2WLSA 1UMKA 3N8HA 2ZSBA 4WA7A 3H5TA 4ZMSA 1JKFA 3JAKA 7REQB 5E6SA 1C0PA 3HH8A 1GRCA 2Y68A 4IIJB 4WK0B 3UC9A 3ZTYA 4AJPA 2F1KA 2O2ZA 4B4WA 5DTMA 3V46A 3QXGA 1JDSA 4NJMA 4UU1A 1NW7A 4MK4A 4ZYLA 2QKYA 2R8EA 4N1AA 4O63O 4G0WA 1T1RA 4NMXB 1Y33E 2IS4A 3OY2A 4TN1A 2RHGB 2AT1A 1MC4A 3EA5A 1L7DA 1ZNQO 1NUHA 2Q5CA 1OJLA 3GEBA 3I9KA 1ZXXA 4IIBA 4ARZA 4DMHA 3TS1A 1P3Y1 2ACVA 2FF5A 3BORA 2DUJA 3HZOA 4NK4A 5IM5A 1IATA 3KOYA 3BN3A 1CUZA 1HWYA 1K3TA 2ES4A 3GZTB 4IJVA 5CYFA 4ZVUA 4A0FA 5E4YA 4CQNA 2VWHA 4IIFA 5EHNA 1TAHA 4TS4A 4A6XA 4DLYA 3ZKWA 2UVPB 4RPHA 3SSAA 2GERA 4UMVA 4LGCA 2G77B 4AYTA 5CD1A 4MVWA 2PWAA 1U3GA 5FBWB 5JCPA 4Y7CA 3QUAA 4RD1A 3ZXYA 5AVTA 3T1YB 4ACBA 4I1SA 2Z9DA 3PFBA 2VH5R 4G84A 2NP7A 1I2MA 1D2CA 5EE1A 5LBUA 4MHOA 3NIDB 2J45A 2AE2A 4BTEA 1QCYA 1V0JA 2QHXA 3RSQA 4D44A 3C3WA 5CA1A 2ZJ4A 3MINA 1YZVA 4YXWD 4KV9A 2X0EA 3P8ZA 2O5RA 3G2QA 2PRIA 5FTKA 5L3ZA 5KWVA 1L8LA 1TUBB 2P2LA 2VPWA 4RORA 1V1MB 4W7HA 5EN4A 1MFPA 4QYMA 2XTNA 1FX1A 4WXMA 1D07A 4ENQA 3PD7A 5JCOC 3TL3A 2OORC 3DZ8A 3PQCA 3ZZTA 2EW1A 1RWXA 2Z4RA 5DBHX 3NV9A 3RV3A 1HDOA 3N70A 1HFJA 2OV8A 2QOEA 3QVLA 1GRVA 3ICVA 1DAMA 1Y3DE 3OE1A 1ZONA 4GM4A 1RC8A 4X93A 2CHUA 5AUQA 4DLZA 2CD9A 4UEJA 3SQWA 4G5SA 3ILHA 2ZAGA 4D8YA 1GM5A 1JBEA 4EF5A 4IXWA 4OJKA 3P7MA 3A4TA 3FPLA 2MYPA 2O9JA 3A4LA 3DBRB 1Q0QA 1VKOA 2CE7A 2FJ0A 5D85A 5CAEB 5HJ7A 2JPDA 3EVCA 4CIYA 1FUYB 4X62B 4S0XA 1EWRA 3G0HA 4TQ9A 2BFNA 1NLMA 3I39X 3NATA 4M4SA 4PEVA 3K9HA 5JSZB 4XTCS 4QXOA 1IM2A 3UMBA 4N82A 2EW8A 2QMEA 1DDIA 1DDGA 2RFLA 4X44A 3H3XA 2PMFA 3NNDA 4RD4A 5EKDA 3TQOA 4RLQA 3V8EA 5MN4A 3JQAB 2BZSA 1CUYA 2ZIXB 5WRFA 2YOGA 5F7JA 3QPDA 1X2EA 2R2GA 3BTSA 1ODTC 2ZVPX 1BMDA 2C7OA 2IELA 3UAZA 2VJBA 3EZFA 3OURA 1NW6A 2EF1A 1OSNA 3AF0A 4MYCA 2IX3A 3EXFB 4JLKA 1QMGA 4IXMA 1S3GA 1DAEA 2I3DA 3MJFA 2JFOA 1UPUA 2IF2A 5JBNA 1DC3A 3W5JA 1IZYA 4OY3A 3LXUX 5AK0A 4Q47A 5FEMA 1R6VA 3C8UA 1L4HA 4LNUB 3AFGA 2PZKA 1QH1B 1B8VA 3EPPA 4COKA 4DCOA 1XPJA 3EC7A 1EVIA 2AOTA 3N7UA 3VYTB 3NTQA 1Y7IA 1ABEA 2FA9A 1WMFA 2V45A 1WDMA 4BFYA 1FQWA 2NQ8A 3O92A 4J0DA 4YJ3F 1XRLA 2HJGA 4LJYA 5CTAA 3ZE9A 5SYNA 1RM4A 4JFAA 4EP1A 5BMOA 5LQMA 3KSBC 4WFIA 2UUOA 4AS2A 1K97A 1E5VA 3OC6A 1V9SA 1JH9A 2C57A 2V97A 2QPAA 4AWXA 4HBGA 3FUTA 1JDTA 5F9HA 2WU8A 1WBBA 3C3JA 1K63A 4ZQIA 1QF6A 4U0KA 2LPMA 3WLQA 1BDBA 4G8DA 4A73A 4ESHA 5DOZA 3EHEA 3T4PA 1RVV1 3QVWA 5DIZA 2YFHA 1GDHA 2Y9MB 2NU8B 3I9V1 3QSGA 1K4KA 2CJYA 4J90A 3VXKA 4BASA 1IBCA 2A9OA 2BCEA 4JIGA 1DIAA 1Z37A 9MHTA 4JP3A 5GAJA 4R81A 5IYZA 3CPHA 3R5FA 1T5DX 4FCVA 4HNAB 1KTVA 3PUWA 2AEFA 5EWLA 2YFQA 4Y6GB 4GXTA 3OLWA 4Q3DA 1JQDA 1Y3AA 2ZJ7A 3V4ZA 4EW1A 2AK3A 3Q7TA 3KKEA 5KYWA 1YMVA 1DPGA 5JD6A 2ETXA 1EWYA 5AHOA 4B4VA 4Z53A 3IA7A 4MLCA 3EZXA 2CB0A 3ELWA 1FK8A 2P0AA 3VNAA 2J5BA 4D0GA 2IW3A 3WLKX 3GIDA 2QRJA 1SU4A 2PUJA 3LUKA 4I2NA 2RC5A 4WGFA 3VR5A 3WV4A 1QM5A 1FYXA 3LUGA 1E79D 5K09A 3RADC 3KJGA 1G9XA 4BJHB 1A5ZA 4E33A 1DX4A 2CNKA 2X0FA 2M6SA 4E12A 1NDHA 4ZOEA 3F71A 3KSDO 3U7HB 2ZS8A 5ALLA 1Z6TA 2RGBA 3R0XA 2C07A 1R0XA 5IVDA 1GTZA 3UWDA 3IEMA 2QUHA 4YO8A 2BM1A 2CMDA 2E48A 1DQZA 4DYHA 3WB0A 2P6NA 2XGOA 2FE1A 3PPXA 2ANBA 2AZTA 1TMOA 4IMPA 5A9SA 3HXMA 2GN0A 3O8BA 3Q11A 3BWEA 3GVPA 4X8LA 4KNYA 1EA5A 2DQYA 4FQ5A 4Y2QA 1DUSA 2TMGA 3FCAA 3OUUA 1QK3A 1GGJA 3T7JA 2VCHA 1V1MA 3S1AB 4XIYA 4IFIA 1F1BA 2BEWA 2DY0A 2J48A 2R5WA 3DVSX 4LRSB 3ZV5A 2A1IA 3A6LA 2ZJBA 3CB4A 2J59A 1ZJWA 2QXYA 1R27A 2GPYA 3NS7A 3X43A 4KRYA 3JZAA 5JSKA 3D8UA 4WLEA 3E1GA 5BRNA 4C7XA 3QBVA 3ADPA 1XD8A 3CLKA 1M8PA 3DB2A 3EVTA 4C87A 4NPHA 4ZMRA 1QOQB 4BO2A 2J0UB 1L4BA 2NV0A 1TMGE 1SXJD 4I5EA 4PN3A 3PP8A 4BV9A 3FLMA 3CRZA 4S1OA 1VMKA 1B2RA 1EB8A 1P9WA 2QVZX 2VWGA 1G3IA 4PX3A 3UM9A 4BU1A 3RS2A 3KDPA 4HX2A 4DXAA 1J49A 2WB4A 5I48A 5LQKA 3LVRE 2VQ3A 1U8EA 3UCEA 2ZUEA 5FF9A 3WGTA 3VR4D 4OTZA 3V1NA 2YWFA 4KIFA 4EVQA 1EUCA 1TA0A 5KAPA 1M1NB 2QD4A 1YUNA 3BJEA 3CXRA 4KL8S 1Q1QA 2QU8A 3X2EA 4A6PA 3ER9A 3WLHA 2WYHA 1Z0KA 2A94A 3ZWKA 3J7AC 3PC8C 1CUBA 1IHXA 4D02A 4U6SA 1NJ6A 4JDUA 4L2IB 4HXYA 4Z8YA 2D6FA 1YB6A 1Z82A 3MD0A 2QRGA 4KUGA 4KW7A 3FOFC 1CC1S 2R7MA 4N7RA 1FVOA 2ZT6A 3KJNA 3ZJ4A 5KSZA 2QRVB 4KO3S 1L1FA 5KNBD 1Z45A 5CW1A 3FHCB 2CUZA 4NEQA 3CKKA 3SYRA 5T64A 1LPAB 1YRHA 3IJPA 3JS5A 4PBSA 1W581 3PWZA 2XNJA 4FZVA 4FFBB 1XWFA 4HG2A 1SUEA 3ZDEA 1ZHHA 4C07A 3ZY4A 3L84A 4XUDA 2PFSA 3IUSA 2DFDA 4PTLA 5F3DA 2J8ZA 3QEJA 3VJRA 2FX3A 2GK3A 2XVZA 3FKSD 1JDJA 4U1RA 4UDYX 2D1SA 2HAEA 3DMNA 2QVYX 4RHTA 3T1NA 1G8KA 5D00A 3K6JA 4LNUA 4BMPB 4ZK6A 4WBXC 2WG0A 2Z2IA 2PU7A 3IOEA 5AW4A 3LE8A 2YMMA 3KQSA 1Q3TA 2ZDQA 3GJ3A 2ADMA 1NE2A 3R6LA 1SOUA 1V5FA 4HDMB 4IUDS 4P2BA 4J1QA 5CHYA 2B4YA 3CYFA 4Q02A 1XZAA 1LUAA 3F49S 4O2LA 3T9FA 1BGWA 4OU4A 4U00A 5AJYA 4B6SA 3L9XA 1RM3A 3K0AA 3C3AA 3OQVA 3WLMA 3DPIA 3FVVA 1S3SA 1GAQA 5EIWA 3TXXA 4AJJA 1T29A 1YKGA 3JVEA 1H42A 4AMBA 3H5LA 2PSDA 4EVIA 2QIPA 3M6IA 1Z26A 2C1XA 4ZCLA 5GWXA 1J23A 3WLSA 3D2LA 1IB0A 1ISPA 1RYBA 4AJIA 3GMDA 4X8OA 4TYWA 2ZJOA 2JI8A 3D0QA 4MWBA 2YXEA 2CCJA 3OM9A 2HLHA 2IGTA 3QKWA 1MMFB 1LNSA 4GIBA 4H4EA 4IDGA 4MCIA 1OH5A 4RMNA 1Q91A 4HPXB 2DLCX 2FEXA 5CM2Z 3PEEA 1YWGO 3DJYA 1AUQA 4FEEA 2JLCA 4KMOA 4PZLA 5FTWA 1JSXA 1VL8A 2P2CA 5JCOA 1Z16A 3W2TA 3CNOA 1R5JA 1DT3A 1SQ0A 3OUZA 4J2OA 3H9JA 4CCSA 3A05A 2PL9A 4OB8A 4RD3A 4JEHA 4CQLA 5JC8A 1SXQA 5IMBA 5IVKA 1VG0B 2O1SA 2CXHA 2JJ2A 4DLUA 4G5XA 2DCMA 4NCAA 1BHSA 3ZNNA 3LG2A 3KR0A 3KVVA 3RVDA 4HNTA 1JJBA 3DTVA 1PN3A 5BVGB 2ZS7A 2I3BA 2FSVC 3AEYA 3FDZA 3H16A 3HMKA 4DW8A 5KB3A 2ZB2A 3BOSA 4Q01A 1Y3FE 2AFIA 2F3SA 2Q0HA 2X8LA 4V0KA 2C7BA 4AECA 4DV6B 4C2UA 4G0QA 4R8KA 3ZVMA 1XNQB 2X9NA 2VDRB 3GVCA 2R1VA 3FWKA 2Q6IA 1F38A 3E9QA 3NGLA 4H60A 1TFRA 4WCFA 2W2KB 4NNPA 4BYGA 2WJ6A 4M9QA 3WBJA 1QYCA 4EH1A 1N33B 2QR5A 2FN8A 1GY8A 4P53A 1QE3A 1NVKA 2HA0A 4PXAA 3LS2A 4GFDA 1QVVA 1OREA 1RACA 4JIMA 5CVTA 2GN1A 1SUPA 2Q46A 5TY0A 3EZLA 5JATA 2PUAA 3AHGA 1PV2A 3EF1A 4MYDA 1AO3A 3KO8A 5D3MB 1PR5A 1LZKA 1ZD3A 5C8YB 2JIZA 1QLWA 1T26A 2F3UA 1CEQA 3ZGYA 2IXTA 1KJNA 5DB4A 3K70D 5IC5A 1OILA 3H75A 4S2UA 4CG1A 1RABA 5K3CA 1DBRA 3FJOA 3LDUA 1X39A 2IE0A 1SU8A 2E9SA 1QV9A 3L41A 1IXKA 3OTQA 3QJYA 4HHEA 1G3MA 3H5WA 4XYBA 2XUGA 1BD4A 2GRJA 1PL0A 1OBFO 3BMNA 1T2AA 1FTQA 3DMDA 4NMMA 4UM5A 4XA8A 3EIEA 1DIGA 3TDMA 4PNEA 5MN5A 3Q0TA 2FEWB 2WU3A 1WXXA 1OWLA 4JJGA 1V37A 2Z3ZA 1CDDA 5JROA 3KT0A 4KVAA 3WJ2A 4YRIA 3SHWA 1SVKA 2G76A 2YWJA 4ZQBA 1ZNWA 3ORSA 2FUKA 3OWHA 1W4ZA 3L7NA 3T52A 2EKDA 4TWRA 5CT6A 2AN3A 2IZ6A 3L49A 5EIAA 1YBFA 3UG6A 3TW4A 2ERCA 2GFIA 1D04A 4DQXA 4I3HA 4FGUA 2JD1A 2I6GA 2EP7A 1MU0A 1USKA 2HMUA 4P1ZA 4GZ6A 1TQ6A 4GD3Q 4O4HA 1EAYA 1EKXA 1QJCA 1WNFA 5AQ1A 1REQA 4XGNA 1U1DA 2ZT8A 2ZXFA 2IBSA 2EJBA 5G3ZA 2PWZA 4O4HF 2Y0DA 3AQ4A 3FNEA 2CDBA 3KHSA 3OEYA 3V7YA 3VTKA 4BJ1A 1EFPA 2CKDA 1YZHA 2FE4A 2GYVA 5BORA 3F73A 2ZTUA 4FYHA 3U4QB 2UU9B 3SDSA 2LDXA 2JRLA 2FX2A 3JSAA 3UK7A 4MS3A 2BZ1A 5DCLA 1T0BA 1YI0A 2OO5C 1J9ZA 1QGYA 1ACMA 1MKYA 2A30A 2XUKA 4N65A 4F7WA 1A5TA 1JG7A 3MB8A 4HSEA 3QBTA 4QFDA 3WLIA 1RLOA 3JY6A 4LVCA 1EMDA 2XQVA 2Z5LA 2O6HA 2K87A 3AP2A 4HDMA 4W7IA 4UU0A 2V1UA 3LMKA 4MRRA 2CK3D 4JP2A 2RK4A 4L0MA 3HHEA 3LQ4A 5CCEA 1JDBB 2QPLA 3OICA 1CZRA 3AIIA 4Z9AA 5B2FA 4MV1A 1AKRA 1Y8QA 1GN8A 5SZIA 4CMAA 3B9PA 3F5SA 1BG6A 1N6PA 3LXMA 3USZA 2DQSA 4AO6A 4B3SB 2SHKA 2YHSA 4ZQGA 2ZR9A 4FX2A 1QX4A 1MUUA 1L1RA 5U4XA 1E9FA 5FUYA 3COJA 3CLUD 3RVJA 2VP4A 5U4QA 2VL7A 5B4VA 2X2PA 2B1QA 2QP4A 1NT2A 2W8ZA 3GEPA 4PQEA 4RA9B 4YFVA 4IWXA 3GFFA 1NF2A 4IGIA 5I4KA 3T9EA 1KEVA 2C1EA 3MLEA 1GQYA 2OHFA 5KOJA 3TLYA 5LR6A 4MA4A 4A8JC 4IJKA 3BTUA 4EY4A 3DD1A 2R6AA 4R8RA 2IHUA 2XE6A 5AKZA 5JSFA 4AZTA 3OCCA 3EQ6A 4FFBA 4O29A 1XPOA 3VKVA 3M6AA 1AK9A 1Q95A 1M83A 2X0NA 4TWIA 4D4MA 4Q1FA 5TQ0A 4ZGBA 1CY6A 3CUVA 5LCXA 2OMKA 4BU0A 5B30A 2QQEA 1N9GB 3M6WA 3VO1A 2OXEA 3KL4A 4MKRA 4RF2A 1R5BA 3NDBB 4IDEA 2WUEA 1MV5A 1MHTA 1M2HA 2AFIE 5DW3A 3TRDA 3GFOA 3MXTA 3P0HA 1KF0A 1KYQA 1GCOA 5BSVA 2Y93A 1EFAA 3OEHD 1E9SA 5KYYA 1R1DA 3G1TA 5DCWA 2W2OA 3BIFA 3ENNA 2PZBA 1TAGA 2ZR7A 1OIXA 1BU5A 4FFSA 4N7MA 2OGZA 4LSGA 4UM7A 5AKJA 4DYVA 1GJRA 4D9BA 2OBNA 3AOGA 4M1QA 2Q07A 4MGKR 4MAMA 5FOSA 4CMGA 1UANA 1SVLA 5TDHA 3G9QA 3CVVA 3KUCA 3LHKA 3LKDA 1PWXA 1WDWB 3HE3A 4QD3A 2XWJI 2CXXA 3FG9A 3UFBA 2FLWA 2P9BA 5JFGA 1JUDA 3BFPA 1QK4A 3AF3A 3I5UA 4WY2A 1S8FA 3H2IA 3OPYB 2P8SA 2XCLA 2HHJA 2PO5A 2IUFA 1JB9A 3LI2A 4NH4A 1BHQ1 1Z88A 4GZ3A 3VO2A 2ZWOA 4BO5A 1XRMA 4FGWA 1EB9A 1QGAA 2O7QA 2OORA 5K45A 1FLAA 2I4MA 5IZ4A 3GPIA 1LX6A 1RPZA 2ZRJA 3ZD8A 1YC2A 4Q3LA 1KYVA 1M1XB 2BOVA 2IDZA 4V0SA 1AB5A 1UJBA 2PZMA 4I1IA 1GN9A 1ZLXA 2OFOA 1B3BA 3LKBA 4OUDB 1SIWA 4G0VA 1LVUA 2GTPA 1BW9B 4GQIA 4X1YA 3CVOA 3L8GA 5B1YA 1PUXA 5KJCA 3WGMA 1JLLB 4ND3A 1ND5A 1G7SA 3G9UA 1NDUA 1A2QA 3G85A 4EG4A 4C4TA 1OLUB 3T35A 1C3JA 1MC5A 3VYRB 3KLMX 4J8PA 3AINA 2OCXA 4GAEA 4RZQA 3ZHZA 4X7MA 1XQWA 3CKMA 1Y4SA 4HEA1 1Y7TA 4MR8A 4PC3A 3L4JA 4M0DA 2ZYWX 4NOJA 1GPAA 5EHXA 2HMVA 5JYDA 5M29A 1T8WA 3CNBA 4E70A 4DJAA 3PPVA 1E64A 6ADHA 1R50A 1BCRA 4OJMX 2R84A 1SXJA 2WYIA 5DM1A 3TUIC 1RWWA 2ZTSA 3UHAA 1JSZA 2FAXA 4BQSA 3ZPXA 2JLBA 9GPBA 4BYMA 1TKBA 4LQLA 4R3NA 4EQZA 5K1ZA 2WSSA 1AV6A 4CXMA 3JATA 2PBLA 4Y98A 4OGKA 3DL2A 1YRQA 3VTFA 4MV4A 2H1RA 1ZVVA 3O1HB 3R5HA 1I1NA 1JXMA 1NXWA 1P9NA 2PD6A 4AX4A 4FOLA 4M7RA 5DYIA 4F6RB 1OPRA 4U3JB 2ECPA 1YQWA 2WFAA 3HO6A 1YRBA 1FP4B 3BH7A 3B3GA 3EDCA 1N9KA 1PGPA 1VYHA 1JKIA 3C6QA 1A2KC 1DHRA 1GL3A 3PHCA 4LJ4A 1EINA 3K71B 1IZZA 1HLGA 1P2UA 4QNMA 2YC2C 4RMGA 5G1PA 4D9EA 4E94A 3ELUA 4QDUA 1N2ZA 3OFNA 3GOQA 4MWZA 4DLNA 1PP4A 5FP0A 1JIVA 3DBLA 1I3LA 2YV3A 1O4VA 1FFHA 2GAFA 5JDIA 3LHDA 3DLAA 3ELYA 3FFXA 4JB2A 1OAKA 4WA8A 2MINB 4NDNE 1UPAA 4V3BA 1XPUA 1E66A 5TPZA 5JAOA 1IOWA 5IUNC 2VDPB 2REQB 4YP1A 2A5JA 1A04A 2NZJA 2RIRA 2YJ4A 3NO4A 1CUFA 3BE5A 3I32A 3H1AA 5KTYA 1X7YB 3QGMA 2WHXA 4XR4A 1F3LA 3FSGD 1RWNA 3G7SA 4O2RA 3A1UA 4O4JF 5LQSA 4P0QB 5IG2A 4NCHA 3IQFA 2J4DA 3AHHA 1ECGA 2ZAYA 4LX0A 1YOBA 1IVSA 1FP6A 2RH9B 1V8FA 2OXIA 5B6JA 3KLBA 3QUCA 4E32A 2DUNA 4YS6A 5AJTA 1SA0B 4I3GA 1P8JA 1GTJ1 4Q0MA 4LQ4A 3K0CA 3AF4A 3QFFA 1XTKA 4AO7A 3P2OA 3PXBA 3UWPA 1UXOA 2X15A 1V11A 3GJZA 4I8DA 3PGJA 4BZXA 1UIRA 3ENVA 4OFBA 4JI5B 1QYRA 3QLTA 5ENDA 1VJDA 1ZOIA 3DOIA 4GP9A 3U80A 1W9MA 2ZYUX 3H4TA 1MP0A 1VIDA 4CL0A 5A04A 5AK4A 3KETA 3T6KA 3DR5A 3JAWA 3VGJA 3BB4A 3MWDB 2WKSA 5C7IO 3PR3A 1Y3HA 2JRCA 2V5AA 3L1HA 4N3AA 3O2SB 1J6UA 1E7QA 3TZBA 2HOQA 2DXIA 2CXNA 3I1YA 1Z12A 1X9GA 2RGNA 2C4KA 3L0CA 1IUKA 3AR4A 1CPYA 2QZPA 1GTVA 1J9EA 4EX6A 1D2GA 1NR7A 1JKJB 2H54A 3BHIA 3LT1A 3OOJA 2HL6A 3P96A 3NVMB 4Q00A 4BUZA 2WUFA 2IXGA 2JJ2D 4OBXA 2TSYB 4LXTA 3RC9A 2JFHA 3HKCA 3W9SA 3S2ZA 4D79A 3G79A 3INYA 5CIWA 1Z6AA 3R8FA 1UBHS 5AI5A 5EJ6A 4J1SA 4JCCA 4QBGB 5DYNA 2OFFA 1RPJA 1XZKA 1KOLA 2EHDA 2A92A 2KQUA 5DHTA 4DAOA 3W1VA 1Q1GA 1M6VA 2HHHB 4JL6A 4B47A 2D13A 4B6OA 1LTHR 4E4RA 1IJBA 2OAGA 4H3KB 2JGKA 1ORRA 1PZNA 2AL7A 3HY3A 2P0EA 3GUYA 3JQBA 3R41A 4S04A 2H5JA 1WB4A 3IESA 4EEZA 1XHFA 2XAUA 2PCJA 1M2FA 1Y81A 3R7BA 3PDIB 2ASVA 4ILEA 4ZCRA 1DC7A 1FDVA 1QGED 1I7PA 4BC1A 1XZIA 1TAUA 4S1TA 1TT7A 5BW6B 2MIIA 4JQYA 3RVSA 1MGOA 3WRYA 4CLRB 1WP4A 2G88A 2DJIA 2NO5A 2GZDA 3R09A 2PKCA 4WBSA 4EG3A 1JEJA 2XRZA 3DA8A 3MFQA 1NN5A 4UNPA 3VV3A 3UPDA 3PHIA 4D8VA 5MDHA 1YUBA 2NZXA 1VBFA 2YN0A 2QGFA 3LT0A 2IYTA 4WVLA 3SS8A 4BMZA 3I61A 2CWWA 4W5HA 1ZOPA 1OXTA 4GPTA 4RTKA 2ZQZA 1FOEB 1V5IA 3INNA 2IU6A 4QXMA 4ER7A 2VOJA 1WSAA 4Q05A 5M5BA 3ESCA 4P34A 4PG5A 3MTEA 3LLUA 5C4MA 3AR3A 4QUGA 4R05A 2GK6A 4FDVA 3B20A 1JR3D 2R8YA 3KSMA 1U7XA 4MGYR 1I3CA 4BNXA 1KQGA 4QXPA 4K0RA 1VJCA 1M6WA 1YJ5A 5AM3A 2B7CA 5FWDA 2P7IA 1IN6A 1G20B 3F96A 5JXGA 3M1AA 5B1DA 1KBOA 4XPIA 3ZK8A 4ALNA 1HNXB 4FT2A 3IS3A 4E15A 1QH8A 2V8OA 3CZQA 4JP8A 1G1MA 1K0FA 3HFRA 3H99A 1TVMA 4QRIA 1MOSA 5C0OE 1YL6A 4ETMA 4GMHA 1Y89A 1HTBA 4H0CA 4F5WA 3BF8A 1AE1A 4LWOA 1SB8A 4C7OA 1IY8A 1NN1A 4R8SA 3SNKA 3ZWYA 4O1HA 5CAEA 1UBGA 2QTNA 1KI6B 1NAHA 4KQ6A 2UUAB 1IXZA 1EP9A 1OWMA 3ESDA 4L51A 5IYZF 5TMBA 4AU1A 4BO9A 1WY5A 2VUHB 3H2SA 4FDMA 3HU1A 5A02A 3SZMA 3PTAA 2W2VA 2QSZA 4A2PA 4BGVA 1FW6A 2RD2A 4KO2S 3TIIA 2ZSEA 5K3SA 5DW0A 3VOSA 1E1CA 1JG1A 5GM2A 4AB1A 4F56A 3LC0A 3QE9Y 1Q22A 2CJWB 1XX6A 1UPCA 2ZRDA 1F17A 2YZKA 3M1YA 4GGPA 4ZDIA 4DANA 2VHJA 2LXNA 4PFJA 3OOHA 5CU7A 3E5HA 2M9MA 2GJSA 4K81B 3ZV7A 5ICGA 2HRCA 1U98A 2RAFA 3EEYA 3FGZA 4RSGA 1RJ9A 5B5SA 3Q88A 3ESXA 4H1VA 3ANMA 4EY3A 5FULA 3Q9LA 3LY8A 4GI2A 1X14A 1KVSA 1P80A 2A7XA 2G70A 3KPYA 3RVMA 1IZ7A 3RC2A 5LNK6 4W5NA 2XITA 4LDAA 2OSVA 4JLBA 5HFNA 1XDZA 3GRAA 5LNK1 4RMIA 1DARA 4PQFA 5A5GA 5FTNA 1F14A 3QUTA 2V03A 5IWAB 4O4JB 4UXIA 4IZOA 2WVAA 3TLBA 2GI4A 2LP4Y 4ZCPA 3WJAA 4E46A 1VP9A 2FSVA 3ONNA 2ID4A 4PLHA 2VP2A 2I7XA 4BY9E 2H2HA 3F7MA 2YFYA 3LECA 2AG0A 3R0VA 5K0CA 1O89A 4HBZA 1KQPA 3AR8A 5DM60 4KQIA 3TW8B 1JQ3A 1LCIA 2BGKA 5DX8A 1H9AA 3VC7A 3IP8A 5D86A 4J3JA 4Y1GA 1EK0A 1ZCBA 3MWJA 1KYYA 4BEWA 2Z1MA 5EJAA 2AJDA 4DM3A 1E3SA 1TC1A 1NBMA 3WDKA 3W5VA 3U6KA 3NZEA 3PPWA 2QPTA 3KUXA 3NBUA 3GIWA 4KN9S 2J3KA 5A4AA 2CUKA 5K3EA 4DUYB 3CONA 2O57A 2AXEA 4UBJA 3RRXA 1IM8A 1I5EA 4AN4A 5G0UA 3I3OA 3FKQA 5ALEA 1U7PA 1A9ZA 4WD3A 1ZGCA 2QE7A 2VDWB 4L3VA 4CM9A 5H1YA 4PR0A 3HTXA 4LA4A 1Z6XA 4TZ6A 4KXVA 1L5SA 3G5UA 4KXWA 5KOHB 4UOZA 5JV5A 2X40A 3EWIA 3I8XA 1T36A 1B42A 4PYLA 4CEHB 4WFQA 1SVUA 1E2FA 3FPGA 3V97A 3A1TA 1S8OA 5EUBA 1GQFA 3W5UA 1YD7A 1OT3A 1SZCA 3JWEA 5HRCA 4DV7B 1KZYC 1M1YB 2ZLBA 2C2KA 2PS3A 2XMSA 2EARA 3ML1A 4OGWA 3KSRA 1DO2A 4TV9F 3PTLA 3S8MA 3SLRA 4AUMA 3LPNA 2QAGA 1SB9A 1T5OA 3GMSA 1H2EA 1THMA 1NAIA 3OE4A 5F76A 1JIUA 4BBJA 5EJ7A 1P5HA 3K70C 2BM0A 1UM9B 3EXHA 2Q3EA 1X8LA 4QZVA 1CRWG 3RB8A 2B61A 1EAMA 3DW1X 1Z0SA 5G40A 4JQSA 2I1QA 3R9KA 1M2GA 1WNTA 4RYLA 1TKRA 4YYEA 2VQEB 2AQKA 4NBWA 3AX6A 5A05A 3KQUA 1AZTA 3EIHA 2IOHA 3FVWA 3FYUB 3WZLA 2HX1A 5FBQB 4R2MA 3VU8A 1NFFA 3BQ9A 3BYZA 3SLGA 3LYHA 5E7QA 1E99A 3UMJA 3PA6A 1ZD4A 1Z7WA 1J1UA 3AJAA 2WAOA 3EUWA 3FAKA 4PHGA 3ND5A 2WAXA 5DLPA 1XZPA 2LIVA 3EQZA 5AW8A 4N39A 4GLBA 4NZYA 5AJWA 3C43A 5HXAA 3N0XA 1GTG1 2W6ZA 1MRSA 1GGKA 5F7XA 1MJHA 1ZD1A 1HYQA 4K03A 1P1IA 4ZAXA 4UM9B 4Z9XA 2FZ5A 3PDUA 1JHPA 2JVIA 4M60A 4PLYA 2EZTA 2IYQA 3ZE6A 1F9EA 1ZINA 3H8WA 2ACWA 2FDXA 3QVUA 1U3DA 5E1BA 1T0JB 2E85A 3BSYA 5BN4B 1G63A 2QUJA 1ZRMA 4QAQA 5LB4A 1O3YA 2CJWA 1NOIA 4CTMA 1T9DA 3ZY6A 2GCEA 3CUEF 1W88A 1A7JA 1UOQA 3JD0A 3FCXA 5AM5A 3SHQA 1N2GA 2ZSUA 3EB9A 3MC1A 3QMVA 4Q1CA 4F0JA 4DM4A 2PU5A 1TQ4A 5JEDA 3NP9A 3UK1A 2BYTA 2NP6A 4PTYA 2CNOA 1XAHA 3H5IA 4BLUA 4E1VA 2WYOA 2H07A 2AWNA 1HETA 1CY1A 1EA7A 4IYRA 1XQVA 4B44A 3WQRA 3OE7A 3CU5A 1IU9A 5FFMA 5C5IA 2ZUFA 3C6KA 1S7GA 4F2GA 2QR2A 3HXKA 4DNXA 2XWPA 3B52X 4NENA 1Y9JA 2EIXA 1NI4A 4Y67A 3FMIA 2K7FA 3C0KA 1PFQA 4DV0B 1YS9A 2H2WA 3AFHA 3D7NA 1YB4A 3LAWA 3N53A 3ZZ1A 1Y37A 1V5EA 1X15A 5FJJA 4YI3A 5BY2A 1Q11A 5EUQB 5LMNB 4IF4A 4GMXA 4M7OA 1YB1A 5ARCA 5CX4A 1N57A 2Q1WA 1RRFA 4I8IA 1RI1A 5DPMA 5EZQA 3NBXX 2QTGA 2F8TA 3KVNA 1G3RA 1E92A 3PNOA 4HYYA 2VN8A 3HWRA 4HX5A 2RB4A 3P32A 2CLHB 5TS2A 5LMUB 1V7QA 5LB2A 1BJTA 3A14A 3BIJA 3KR2A 4M1TA 1YR8A 1EDDA 4QOFA 5CH8A 1DMSA 3VH3A 1CUCA 4CM8B 5KYWB 5BSEA 3W77A 4MVJF 2DHDA 1F7UA 1SRRA 3A9CA 3I53A 4PPFA 4FK8A 5HUHA 2PKYX 4YP7A 1CWUA 2F62A 4EKDA 4RH1A 5BMVF 1Q1BA 3W4IA 1QHNA 1QBGA 221PA 4AP5A 2XCRB 1XTPA 3FCSB 1ZVQA 3CSDA 3W9UA 2YZMA 3TOCA 3TG2A 6GPBA 1P0QA 2IEAA 2P9JA 1B23P 3FF4A 1C0KA 1MV8A 2PJDA 1ZCAA 4BJ5A 1IUNA 4ND4A 5L3SA 3MRSA 4QWMA 1P6QA 1PWZA 3SJZA 3DWGA 4QREA 3UWMA 5FR1A 4TMFA 2ZITA 1TM5E 5GPBA 2VHXA 3I9LA 2PD3A 1OZGA 5DSXA 4H6WA 3RNOA 3I5MA 2DGDA 2AQ8A 4BMSA 3JALA 3QXSA 2XDQB 2QI9C 3DTVB 1Y42X 3NEAA 1H6BA 2YRXA 3INTA 4TLEA 1HT2E 2WF5A 3FIJA 1W6UA 1QHFA 1YBAA 2CJPA 3BKWA 4BNDA 5CIYA 3U40A 3ZVNA 4EENA 5IPFA 2HHLA 3AR2A 5LZ8A 4X6XA 1KHTA 3SDBA 4ACAA 5KVCA 4M1KA 4H08A 3ETLA 1AQNA 4G5RA 1USVA 1KEEB 2H11A 1H2ZA 1K7XB 1CR6A 4DBLC 2C96A 1KR5A 2IYFA 4H7KA 4KMMA 3KT3A 4NJEA 4CE6A 1R15A 2DLDA 4FNOA 2ZGVA 3HVHA 5DFAA 2H92A 2Z8XA 5FNVB 5GONA 3VU1A 4EG1A 1CSEE 4QUHA 3F6PA 1E1RA 3C7TA 3OSZA 4O8ZA 4YCSA 4J3FA 2OP0A 5IARA 2IH4A 1UC5B 4EITA 2R6DA 3LCJA 4RVHA 4RK4A 5AXAA 5H4GA 1NUSA 1A3CA 1Y6ZA 2BEKA 3HCEA 4HXGA 4KGXA 3HB5X 2JFUA 2YV5A 4XTRA 1KEPA 1MQ9A 1HC7A 2NU7B 4M7PA 3ET5A 1C7IA 2GUWA 4PGAA 5FPTA 3Q0IA 4EUSA 1PS9A 1B16A 2O1XA 4I66A 3JZMA 4QPDA 4HTFA 3LX4A 3BFXA 1L4KA 2XUPA 4UQLA 3AM1A 3RVOA 3F7TA 3SG0A 3X2FA 4PRYA 4D5GA 5LZ5A 3W2GA 3SEQA 4KOAA 4LWZA 2PX5A 1KU6A 1ZSYA 2PVCA 3BF7A 3DZKA 1W46A 3IBYA 5I9MA 1WG8A 3ZWVA 5EPOA 1DOHA 2B83A 2J87A 2OR3A 3MW8A 4G5QA 2HJ9A 5AYVA 2AN5A 2NU8A 4AKHA 4JITA 1YE5A 5K6AC 1XALA 3R75A 1I0IA 3KOZA 3Q5EA 3RWBA 4LV5B 2JAPA 4Y6LA 5DHFA 3ENZA 3HBMA 3X2SA 4KH0A 3VZPA 3RF7A 3WR5A 3LUAA 3HV0A 2J0VA 4ZEWA 4YAKA 1J8VA 2AC7A 5B6IA 3Q5DA 3ZDBA 3AONB 3FCUB 4Y0VA 2VF7A 1IHUA 1DRVA 1Q0ZA 3C5VA 3OA2A 3KKLA 3LK7A 4M1OA 1UKZA 2UXDB 3P45A 1WPQA 2FMUA 4MRVA 1F8XA 3CLVA 5NLLA 6LDHA 5FAKA 2NUAB 1UMDB 3CNEA 3WYEA 2QRQA 4QXQA 5CEFA 4OX9B 3TRFA 1YR6A 1HE3A 3TNFA 3BKXA 1AVTA 1RQ7A 3F90A 3SHOA 4RY9A 3DTNA 1PVOA 1P3JA 1C9DB 1UDCA 5DBFA 1EH5A 1H2WA 1Q1ZA 2PX6A 3SQLA 1U6IA 5A0TA 1MO3A 3MD9A 3D3EA 2RGXA 4F3NA 1CFZA 2DECA 4EQ6A 1QDLB 4MWCA 1QRTA 4ISBA 4P22A 4Z99A 3EEBA 3BD9A 4GEKA 3TM4A 3VR3A 3CHYA 3ECSA 3ZIDA 4YCLA 1M54A 4C08A 2GASA 1RQPA 3WLFA 3VR3D 4HNSA 3ZZMA 3WKEA 2JAWA 5F2EA 2OILA 3BDAA 2P1RA 5ICFA 1WZIA 3WKDA 2OE2A 4DHWA 2Y4NA 1T9KA 1OWPA 1PLJA 2HF2A 1ISJA 2VRBA 2XQKA 2Q49A 2YV2A 3G6WA 2BHLA 4XM2A 2P78A 1NVDA 3QWFA 4UNIA 3UWKA 2HZ7A 4G37A 4Q3KA 2QTBA 4QGGA 3W1WA 3N2IA 4D80A 3H1GA 5JJBA 1QVZA 3EDOA 1ZICA 4LHWA 4UPDA 2E2WA 3A3OA 4MIYA 2OCBA 3N5KA 5ADUS 4W4TA 1KAEA 2VQ6A 4AULA 1W5BA 1ZK2A 2G0AA 2J0UA 3OFVA 4H0NA 4RA9A 1ZEMA 2XT0A 3JQ8A 1IHPA 2PJUA 3EOZA 3HA2A 2ZCUA 3WK8A 4GBED 3SR0A 1MJ5A 1PL8A 5ITZB 1MZPA 3A2NA 2AUNA 1SXGA 3IDZA 5CURA 3FKSA 3UATA 5LWHA 3P4XA 4I4TB 2AG1A 5KNCH 4QA9A 1CBUA 4UAVA 5ALIA 4NG5A 2ONYA 2VNSA 5DLYA 5LBIA 5BNWA 1XN4A 4NYIR 2QVLA 2JLWA 3L6UA 1PDWA 4AJOA 1RAEA 3K15A 3R7WB 5AH0A 1NYTA 3D81A 1KH2A 4B3GA 4UHKA 4RXTA 1XA3A 2P2SA 4W5QA 3JYHA 5NULA 4I5IA 3DDNA 1UBKS 5TSDA 1JN0A 1WP9A 3D5TA 4OOFA 4EEXA 5SY9A 3CIFA 5EMHA 2C31A 3F6BX 2H5LA 3V55A 3PRJA 3QYJA 3GUUA 2EEZA 1T9GS 1YK0A 3DOFA 3KL2A 2A88A 4P2GA 1VE6A 1S89A 3IT3A 3IQZA 1KARA 2PGLA 4UCQA 1G5IA 4LS3A 4KUHA 1CS4C 1DC5A 5FI3A 5LM3A 2VPIA 3HVKA 1Z13A 2PA0A 3LUPA 3GH3A 2P6OA 4KWCA 1OMOA 3H05A 1EP2B 1DCFA 1B6RA 2F1JA 4G1BA 3REFA 4OJNA 3ZGNA 3OLXA 5AOVA 2N9UA 4FXPA 4BHTA 3VSCA 4QJBA 4WTOA 1APBA 1IEQA 3KV1A 1NXSA 2R87A 4IS2A 1Z34A 1QP8A 4M89A 1XG5A 1WB5A 3KWJA 3AILA 4GR9A 3MQFA 5K0JA 3AFOA 4IXNA 4B32A 1B14A 4I6GA 5EKUA 3E70C 1AA6A 3HDTA 1QIEA 1BEEA 2M32A 1NN0A 3F8SA 1PD0A 4L0CA 4MV6A 3A3NA 4LDNA 4AY2A 2WDPA 1E89A 2YWBA 3DKPA 1UXIA 2I7DA 2ZKIA 5CT5A 4MUIA 4PYKA 4UUAA 3UWSA 3L0ZA 4DT1B 4P38A 1JRLA 4ABTA 3C14C 3OO0A 3NM5A 1KKUA 3JXEA 4YP0A 3C41J 4YDQA 1CP2A 2PA3A 2NWQA 4NP6A 4R8LA 2BSQA 3HXLA 5HBGA 3L06A 4MW4A 3OZAA 1PQ4A 2BRUC 1GGEA 2IU3A 2ONCA 3HGTA 1G5RA 3LUFA 4IMRA 2H7VA 4N5IX 2NPIA 3S2YA 4ZHQA 1B43A 1Z2NX 5BV2P 5JNUA 1HFWA 3TZHA 3EZ6A 5D3KA 1TEVA 3AERA 2OYCA 2IHYA 3EDRA 5I7SA 4UUNA 2B5WA 4NIMA 4NBUA 4M9CA 1RHJA 4HGOA 5EZYB 4OB7A 4FS8A 1YJBA 1MB4A 2ZRHA 1UBOS 5D51S 2D54A 4E6EA 1TZ2A 1FS5A 4R7GA 2Y1WA 2N75A 4R1OA 4BWYA 4C1BA 2JIOA 3D0KA 3IEPA 1CUDA 1L3BA 4ENWA 1XROA 3BCSA 1YCGA 1HYHA 3PYMA 1JFTA 3RFFA 1EHCA 1ZR2A 2A58A 3U1VA 1WMAA 4ZI3A 2H57A 4NTZA 2WSBA 3R7DA 2CFRA 3BRQA 3GRZA 5BSTA 3V34A 5A5DA 2P5YA 1R8XA 1PT7A 1TI7A 5EINA 1HOTA 4YWJA 3F67A 3TRKA 4R84A 4UEWA 1T8UA 2WJZB 4KQ1A 1BS1A 1EVLA 2OCKA 3QMPA 4QC2A 13PKA 3ZWQA 2L42A 2JGDA 2EL9A 1KIMA 3K31A 5ETJA 5BYKA 2O8FB 2WJAA 2B2XA 5BRAA 4BB5A 3ND6A 4IQ0A 3RVRA 4DZTA 5T7BA 4RSRA 2FP3A 2Y4OA 4QLOA 4R98A 1DEXA 1S2DA 1AT1A 1KS2A 1YBMA 1UBJS 1RXYA 2Q2VA 1WS6A 2R7KA 1HDGO 2WM3A 2YJ6A 3AU8A 4HNRA 4M7WA 3O4VA 3DXFA 4HH0A 3ANTA 4YT5A 4R0NA 2BDEA 2OL4A 2X7HA 4KLAA 3VSEA 4DQLA 4YJ2A 2DSTA 1XTVA 4KQEA 5B3AA 3L8YA 4ZANA 2P69A 5CGZA 1YAJA 2XOKA 2B4TO 2DUMA 4M76B 5A2GA 5KPDA 4ITRC 3HP1A 1UAGA 1J8MF 3JQFA 4M0UA 5FX2A 2ILTA 4UTNA 4QJ4A 3IIIA 1AK1A 2ZUSA 3PTZA 4IX1A 1DV1A 1I01A 1FJ2A 2AX3A 3G8DA 2NV2B 4LOHA 1KDPA 3IPAA 5G41A 3W3ZB 4BP9A 3EPLA 4G5OA 2P90A 1HQDA 5G2OA 2NU6A 4GI7A 2BRUA 3WIVA 3NTVA 4HD8A 4UNRA 3SMVA 5ANRB 4WUTA 5KKCA 2P5TB 4HY3A 1V1JA 1VLJA 2O0LA 1ZDMA 2W70A 3B5JA 2F59A 3G5TA 2A9VA 1JMVA 4NZOA 4A36A 4FFLA 4PAGA 4QDXA 4RGVA 3TSAA 5IS2A 1BQEA 1MLDA 5E1DA 3G1UA 4R68A 1QFSA 1H0SA 2P67A 4F5DA 4MAAA 2NTEA 4J0KA 1MO5A 2X4IA 4HAYA 4QGFA 4RAOA 4B81A 1ZL2A 1J22A 5DTRA 1X0XA 2PJRA 1W75A 3QEOA 4G2NA 3T1QA 4OIFA 3RTEA 3U3MA 1DXHA 1ZD5A 2DWPA 4YLEA 1E6CA 2PH5A 3LHSA 3P4YA 4H27A 4EA9A 3I5YA 2EJTA 3CBQA 4CL2A 2VS1A 3GVXA 3SYLA 2HEIA 3S2UA 3UKOA 4DV5B 2BMEA 3ZVRA 1J0DA 2WV7A 5F7OA 2LCQA 1ETUA 1XA0A 3FMPB 1TYZA 1BNCA 3I52A 4B6EA 2LD4A 3T3EA 2TMYA 2WSLA 4KXQA 2W6QA 3G0GA 2CLEB 3SQXA 1EFPB 1P60A 3AH8A 2EERA 3I92A 3DFFA 1AKMA 2J9RA 4LJRA 1Z7YA 4MS4B 5TGZA 3WIEA 1RXSA 3PLNA 1SD1A 4Q4LA 4RVCA 2JCYA 4UJ5A 4EAQA 4N7BA 1QFJA 4BZWA 1L1QA 1W30A 4NU6A 1I6WA 1JG6A 4ZVOA 2L18A 5HKBA 3F3YA 4WLVA 4Q4AA 1VRWA 3DOUA 5DM2A 3BFJA 3W78A 4IRXA 3BIOA 3WGOA 4L95C 3Q8MA 1GSAA 1W4RA 2I2AA 3AKCA 3P9XA 1EE2A 5IJ0A 4C76A 4PLPA 5IRCD 3LFHA 3R0ZA 5AW9A 2AKAB 4JUBA 2VXYA 2WJ4A 3W3AH 2XB4A 1V6AA 4F12A 2B78A 3PEFA 1LPOA 3MCWA 4GXRA 4LJAA 5EJ2A 5ADWA 3OZXA 1M6VB 3KV3O 2CT8A 2WJVA 2HIAA 1T1JA 2IXEA 4P5DA 3WRVA 2QZJA 1CFJA 1ZUNA 4J4BA 2D3TA 1A8HA 2D5IA 3KOOA 1JSCA 3DE7X 1MVOA 4KE7A 4D1YA 5BWCA 1JLSA 5A1TA 2HWYA 1UJNA 3T5DA 1EWQA 3K09C 1BA3A 2IFTA 4NR0A 1GDDA 4C7BA 5L9AA 3L18A 5HEKA 4IIJF 1DQYA 1YA8A 4R9UC 1R6BX 3MAGA 3WLOA 4RKEA 1U7UA 3OFND 3I8OA 2D2FA 1LK5A 3EIWA 4K2HA 4TVOA 2ZWPA 2QN9A 3USCS 1UP4A 4PO9A 2X6QA 1B0UA 4MVJE 4BO1A 3M0EA 1VSTA 3Q12A 1YL7A 4JI1B 1QGUA 4PIMA 1IHOA 1I4EB 2CZCA 4DSZA 1O8BA 5AKLA 1U7WA 5FNVF 2BR3A 5F1KA 2OAEA 3OCXA 4FDLA 3RRFA 1U6JA 1L4YA 1KU0A 2PWPA 5LBTA 4DAEA 1R0YA 1OX6A 3OCJA 4PAWA 2ZSJA 3GLFE 3L1VA 1FNDA 1SWVA 2GJ9A 2QX6A 4RV4A 4R9VA 4H1TA 4N49A 4KLCA 3RVQA 4GRIA 1U04A 3UMCA 5H3LA 3ESRA 5K5EA 3DQZA 4PZPA 4FFWA 1Y9AA 2V7WA 2Y1DA 5JPIA 2HUNA 4DLVA 5CNMA 4N0MA 1IK6A 1BE1A 2DVMA 1C7FA 1XQYA 3VTAA 5CFPA 1TCAA 2R5FA 3MUFA 4GOJA 5KTSA 1A5SB 2Q9AA 5M7EA 2I29A 1G20A 4DC0A 4Q4HA 3B3AA 3ZDAA 1O54A 1EVEA 2G17A 2P2DA 1M2OA 2QW1A 4BX9A 3KCQA 2E89A 4ZJYA 5C1OA 2A2ZA 2VSFA 5KU7A 1VHJA 1XNHA 2QMHA 2VF8A 3DMTA 3WWYA 1DRJA 3H0EA 4DWWA 1ITZA 1AHHA 3I76A 3RYCA 4CI0B 2W42A 3L1JA 2EFYA 4G1FA 2P9HA 3NETA 4HGZA 5EMLA 1DI0A 1DXYA 1E2DA 1S2MA 2HFKA 1IBRA 3P2KA 4JN6B 4HLNA 4BVHA 4EUNA 1A1SA 1L8QA 5J2TA 1D1PA 2WF8A 4OYHA 3R3XA 3RJTA 1A9OA 6NULA 3ZH2A 3AERB 4OK3A 4DMLA 2J3MA 4QPPA 1GNVA 3G2LA 4F7DA 5IC4A 3FUXA 4KQXA 1WEHA 3OTGA 1XZJA 4P3XA 3U1TA 4FE3A 3CR7A 4L50A 2BONA 4BC0A 3VZCA 2PX0A 4J0EA 3WAJA 4UMFA 3IPXA 2NO0A 4BQNA 1QO7A 3DOCA 4XGKA 1XXHB 3A28A 1GYPA 2VRWA 5DHUA 5FEUA 4KJZA 4WXRA 4Y2UA 4Q66C 1FS6A 2VT6A 4AJHA 3CG0A 3KT8A 2RC6A 4JP1A 3E22B 1H8EA 5KINB 1YS4A 3KQVA 4NBRA 4UTZA 1JX6A 1Z8NA 5KAMA 4ARCA 3F6YA 4HZIA 3FSRA 1GPUA 1FUIA 1GYQA 3N2YA 4U02A 2AN1A 2I4IA 1J56A 3D7RA 3FSJX 2ORYA 2B92A 4WW0A 3ZLTA 3OPNA 3DQQA 1ONBA 4TRNA 4MVCA 1K06A 1KOFA 1MD9A 5CX1A 5I7HA 2F8MA 5JNTA 4UOEA 2ZBGA 3KZCA 4HS9A 1ZCJA 3UCXA 3U44B 2I22A 3TLGB 3MNFA 5DGHA 4LDQA 3L6RA 5B7GA 5IT9A 1W5FA 3JYLA 1PUJA 2F3PA 2Q1XA 3CCFA 4EATA 2EJCA 1C9KA 2GKGA 4GOMD 5EHIA 4ZALA 5KHLB 2A8YA 3HCWA 3QU2A 4PGHA 5DHSA 1YTUA 1XKXA 5ELMA 5KNLA 4ZRDA 5ER9A 3WRXA 4YCCA 1UZLA 1T2CA 1D2RA 4WK4B 3GLVA 5EAIA 4FPXA 2H48A 5CG1A 2NXCA 2ZJAA 3W2IA 2CNDA 2J7PA 4DY4A 4MDEA 1TK9A 3W7BA 1ULAA 3F6EX 5JXHA 2AOUA 2YY5A 1G21A 2GLTA 3EC1A 1DBQA 3IPCA 3M4NA 3ZCVA 4GOOD 3VKWA 1GD1O 2I1LA 1KMMA 1YBHA 1XL0A 2ORIA 1JVBA 4MLDA 2BEUA 4MRAA 4A82A 5LQCA 2DBVO 2H1CA 3RTGA 3ND9A 2NN3C 3IBGA 5EJ9A 3U09A 1XEXB 1OA0A 4RFLA 1L5KA 1M6HA 1DCTA 3WLJA 2CNLA 1M1NA 1WETA 4MROA 3QTTA 4N8EA 3QFRA 2YUIA 2OYRA 2ZBUA 2DHRA 4K6KA 2OB1A 2CXSA 5JJLA 3UMMA 1RTKA 4OCZA 3WKAA 1IM5A 1TM1E 1P2TA 4LXHA 1KSFX 1JIQA 2CVZA 2BMFA 1ZLYA 1CJKC 4U63A 4EB6A 2MOKA 2HK9A 4FD2A 1L5LA 1RVDA 4IIEA 4QUAA 4Y3UA 4MARA 4O25A 3X1WA 2WQZA 3EXG2 2QTWB 5LP6C 2L19A 2G0TA 1CF2O 1TF2A 2OHXA 4YMSA 2HPHA 3AFIA 4MUGA 4RCVA 2YZ7A 3GJ6A 4ZO7A 4HAVA 2D0IA 2Q5OA 3WFJA 4LSZA 1Y3BE 4MQUA 2PQMA 1F51E 3RUDA 1L6IA 2TECE 1LXCA 2WHEA 3I6BA 1I3KA 5HIJA 6REQB 1R12A 8OHMA 5HIAA 3BK1A 3LCCA 2TRSB 2ZWIA 4OUKX 1NLUA 2QQ0A 3RU9A 3PU6A 1INLA 3GOHA 4FXOA 2E6UX 4GR4A 3DUWA 3OPYA 2B1JA 2D8AA 4Q4DA 1GHTA 4YP5A 1Q0UA 1EGHA 1O94D 2HWKA 3BRWD 3Q6IA 3JAWB 3F4KA 1GSHA 3UV7A 1Z5NA 3DW3X 5K8UA 4QFCA 1KJIA 1E3QA 1DJOA 2QSJA 4FHFA 2BFEA 4HLCA 3OD5A 4GYKA 4OUDA 5C8DA 4XDYA 4I1UA 1IQUA 1CD5A 1JDPA 2J3HA 4LKRA 3AMVA 4NNJA 3DMGA 4JKOA 4RVSA 3UTDA 1GARA 1YV9A 3WJ1A 4N7JA 3BA6A 3I58A 2IEBA 2JFZA 3FTCA 4BKUA 2J9FB 1J0BA 3DLIA 3HVRA 1RFGE 4U6QA 1T6XA 4YRTA 4YBZA 1USIA 3K6SA 4FSHA 3PHJA 3OT5A 3LCRA 1K68A 1L5FA 2ZJZA 2QTTA 4C6TB 1UP6A 3ADKA 5JSHA 2A5FA 2IXBA 2ZJ3A 2ATVA 1W47A 3S27A 3M3PA 3KOWA 2Q6KA 3AUKA 5BMVA 4DPLA 2I6TA 1GCAA 2MYUA 2JCGA 4CFZA 4HB3A 3GZNA 3LLVA 2REXB 5JSZA 3V5NA 3L82B 1ZG3A 3LFUA 1KK2A 2C92A 2AMYA 2JAOA 2DKFA 3ICOA 1PX0A 4MVJM 4MAFA 3ZZNA 1UBSB 4A2CA 5JAIA 4NYIQ 2ZT7A 3EGDA 3N8IA 2EFGA 3ILYA 3CUUA 3OQIB 4FDTA 1N3BA 1XJQA 2Y76A 1X7XB 3H9BA 1GIAA 4RFVA 4GE0A 3HP7A 4MW2A 3VNSA 5A9RA 4MUNA 1WUIS 2IIQA 5E38A 3IULA 4CR8A 3DO8A 3AU9A 3S0JA 1G8JA 1N32B 1CLUA 3QE0A 4WLFA 4O0MA 4P3NA 4Q6WA 3AKZA 2ZTVA 4B35A 4GGOA 1DUVG 4JYBA 5H9WA 5EXSA 1Q92A 1I7DA 5ILGA 5EIHA 3UV3A 4F5YA 5JQWA 3GQBB 3B5IA 4Z3DA 2AI3A 2VHQA 2XVAA 3PJGA 1C3OB 4JBYA 4W9RA 1ADBA 5CX1B 3SDZA 2Q5QA 3PBKA 5IAJA 1P74A 2JDIA 1ECCA 2ZYTX 4HB2A 2ECKA 3LVBA 5JISA 4DR1B 3BWBA 2VC2B 4PX9A 3AY7A 4B6FA 3A6KA 3HJCA 4ND8B 1NI3A 4M9ZA 2H06A 2JFXA 4WJZA 3PRYA 1TCVA 2O3QA 1U7DA 3QF4A 2NZ2A 4Y2JA 5FUWA 2FVYA 2QNIA 3OBIA 3ZGOA 2GPNA 4GYJA 1M2EA 1RC0A 2ET6A 3ROXA 2UUPA 2ZWMA 3KZXA 4ZCQA 2ACEA 2CEKA 2JZOA 1FYVA 2P41A 3A8TA 4P9NA 4RGYA 4Y2VA 4FMCB 5FQOA 1DQPA 2O7VA 3J7TA 4O0LA 2WYVA 3Q2KA 3TR0A 4HLUC 4AIRA 1Q0RA 1Q1AA 5BXYA 5JR3A 2Q9BA 4REOA 3H6HA 3OHMA 2UUCB 1M2WA 3COZA 3IVCA 4PIPA 4LC9A 4M0EA 4ED9A 1IBLB 3IUQA 4H7PA 3EF3A 1NBAA 2NW6A 2O8NA 1SG0A 3O38A 1Q7BA 1XV5A 3O8LA 4IG9A 5K4HA 1SO8A 3GLGB 1X1RA 2QUAA 3C2QA 1UMBB 2Q4RA 3KTAA 3L8HA 1FFXB 4Q21A 5M3BA 2FFHA 2OZLB 3IT0A 1AO0A 3HLYA 2LR0A 2F67A 1LBIA 1YVUA 4JBXA 5FHQA 1LLFA 3HI4A 1WU7A 3QFSA 1SPBS 2FK8A 4FGZA 4G4GA 4ZARA 1ZW6A 4ZOLB 2NZUG 4RIFA 4EFMA 5KJEA 3MAAC 5EC8A 3H9CA 1SY7A 2BIFA 2AFHB 4FBGA 4M49A 4YNBA 3TAUA 2C5BA 4F4IA 1RAAA 1IG0A 1V95A 3I0ZA 3Q3EA 2ONJA 4DDTA 2NAFA 4S1VA 5KYXB 1WU8A 2JJMA 3MCVA 5HILA 1D09A 3ZZ0A 1C14A 2UYCA 3P26A 1PW5A 1QYDA 3VPAA 4D4KA 4TYQA 3O90A 4MLZA 1TVEA 4EGAA 4W8GA 2Y0BA 521PA 3L3BA 1H6DA 1U0TA 1UBTS 2YR0A 3PUKA 4M1EA 4MS3B 5GMOA 4QTUB 3T0GA 1E1LA 1GOTA 1TM2A 2NZYA 4IW3B 4PV7A 4MW5A 4JVMA 5INTA 3FYCA 4X00A 1ISFA 1LLDA 1YVRA 1NRXA 1YR2A 5FI5A 1EHIA 2QZ4A 4CG0A 1DJMA 4LCEA 3N39C 3RKUA 1NT4A 2NVWA 4ZAFA 1TRKA 4PGMA 5TPWB 1DGQA 1CIVA 3NYRA 3HXTA 3S5JA 3NHUA 4CR6A 5D5HA 2BGUA 3JW8A 4EBFA 2FR8A 1DTEA 1FMJA 2GCOB 5KCMA 1QTIA 2IIVA 3KPWA 4YFYA 1NA5A 3VNRA 5GJCA 5IZCC 2O8CA 3DKIA 2BI8A 4QDOA 4BMNA 3RAJA 3NKVA 5LA6F 3KT6A 3E9YA 5JBQA 1U2PA 1P3DA 3WSTA 2VJQA 2ASEA 1Q20A 3BAZA 3ZQKA 2WU4A 1HEIA 4KWEA 1MA0A 1R6DA 3R40A 4MUJA 4ZAZA 4LXYA 2B4KA 4Y7DA 3B3QA 4DUPA 3QVJA 3H65A 4JYCA 4BO0A 4CLEA 5T8KC 4Z51A 4FC7A 5E3HA 4C0WA 2YXBA 4EMBA 1LH0A 4BPBA 3ROQA 1RKQA 4I1VA 4OYYA 4HQNA 3GPDG 1DAFA 2XQIA 5EL0A 4WN9A 1H9BA 4GRDA 3PNBA 2V0NA 3WIBA 5K99A 1QNLA 4MDYA 1QC5B 1O6CA 1XJ0A 4G01B 3TJZA 1AJEA 2NTYC 1UK9A 1DBVO 1P7ZA 1U3WA 1SZJG 4K9KA 2BF7A 2PEZA 3COPA 3U3KA 3ZE1B 4BKOA 1Z2OX 4F4HA 3R3UA 3TCKA 3CUKA 1Q2UA 3OH8A 2AOVA 2QN1A 3FPBA 4IEFB 4PGGA 1ECJA 3CH6A 1BC5A 1JECA 4Z1MA 4QGAA 1NNSA 1YZTA 4OSOA 2GF0A 2WWFA 3ORYA 3EARA 2BFBA 4FFPA 5EVCA 3LBNA 1Z29A 1HNNA 4DLWA 1SOWA 1M6NA 3R7SA 3LQQA 3D5QA 3NLLA 3WFZA 1QRRA 3F0TA 1UC9A 3QXXA 2G1UA 5CLLA 4I36A 3TQHA 3ZBTA 4MDHA 5JRJA 2R62A 4DADA 1PWYE 1R18A 2CFIA 4GMKA 1RBMA 2XF8A 4QDZA 4NG4A 4W9NC 3QVXA 5BW8A 1VJTA 4LJLA 2JJQA 3IOYA 3DBIA 4HVAA 4J76A 4NAUA 3L0IB 5I7AA 2IYSA 5H8WA 3WL3A 4W82A 4DGSA 5BMVB 1GGVA 4HYQA 1OLXA 4K87A 4IHJB 4X1KB 2QMZA 3ECAA 2X41A 2RGYA 1W1WA 3ME5A 1P19A 2CHGA 1Z75A 4ZT7A 1SN7A 1J00A 1E2PA 1OFUA 2OA0A 2JBWA 2BKEA 3TZEA 4AJNA 3PKJA 1X80A 2RJNA 3HKEA 3TVDA 5KWJA 2PVPA 1N6KA 2Z8ZA 3UJPA 4I4TA 1L4UA 4F6CA 4N40A 3KPUA 1JILA 1KP3A 5BSFA 1OXKB 1RT9A 2P77A 4O59O 1XFAA 3QLEA 4U2FA 2HU7A 1JPNA 1Q14A 4IH9A 2XMDA 3JARA 3FPAA 3MUOA 4NHEA 4P3OA 5EHGA 1CS0A 4J3NA 3FB4A 2GJKA 4RTOA 3X1KA 4ZI7A 4ZCMA 1MPXA 1Y1RA 4RKQA 3ST7A 5BW5A 5IASA 1I1OA 1OBOA 2Q5LA 3LO8A 2ICAA 3R9IA 4BVLA 1HDRA 2ZRGA 2HBZA 4FFRA 3T4XA 5HR5A 2B5VA 4CQJA 2NX2A 1BOOA 2HF7A 3RFVA 4E3WA 2H51A 3GFPA 3E0XA 2IUYA 3ENWA 4O2AA 4CEJA 1XLWA 4IGKA 2PX4A 4Q1AA 2F1HA 4EY7A 3VU9B 2XSZA 1UJ2A 2IU0A 1GFSA 4TTQA 3TD9A 3BX1A 4M99A 4TSFA 1XEFA 1R8QA 4FCTA 2XQJA 1E8DA 3NWJA 2GYWA 5A03A 4DEXA 1J25A 1R6TA 1QSGA 4J7AA 3S28A 2FPIB 2Y0EA 1Z63A 3FTEA 2JLXA 4TXJA 1H3NA 2BAGA 3V4OA 2PZFA 1RM5A 3IQXA 4PIVA 5HTOA 2RAVA 1YBVA 1Y5MA 4KI7A 4Z4HA 1U8YA 2FQXA 4R2WA 2FOLA 1XCMA 1GTL1 1E5LA 5JALA 2AOTB 3ZDZB 4NMWA 1RKUA 4TWJA 3A1FA 4PSAA 2AJTA 4QYIA 4CIAA 3GXBA 3KEQA 4ZVQA 3MRVA 2QN3A 4N5LA 2GHIA 2FGKA 1D2HA 3OQ6A 2GETA 5BWNA 1KQFA 5L4SA 5IM4A 1XMOB 1ZW1A 4K6GA 4MB2A 4TYMA 2BSAA 3AF1A 4XX0A 2PLRA 5I7RA 1JNXX 3GGPA 1WCIA 1H0HA 3O83A 4LYAA 4ZOAA 5JZMA 1RI5A 2NUTB 4HFMA 4EFNA 2JAUA 2CEAA 2V98A 1JLRA 4CKZA 2WE8A 1ZM4A 1JG4A 1M2VA 1Q0PA 2B30A 2OLKA 3DWEX 4CM8A 4B3TB 4KXUA 2PR2A 4IOLA 2QRKA 2FDCA 4WZAA 4KAAA 2EKLA 2HY7A 1E20A 1AC5A 2IDKA 1VIAA 1XCPA 2ZRBA 3F9CA 2C3PA 3OTHA 4CV2A 4L9SA 1CRLA 3GD7A 3K94A 4LYGA 2NXNA 2XCIA 3ZTWA 3L01A 4ZODA 5FUBA 1V48A 4H17A 1LI4A 1YS1X 2R11A 1FSSA 4JXKA 4XXHA 3RC8A 2IXAA 2OTCA 4FEYA 1L5YA 1N5JA 2A0YA 5AOBA 3MS7A 3F6CA 2D5LA 5LVAA 1T6NA 1N2EA 3IJ5A 4G85A 2PYIA 3MT0A 4C4XA 2QJFA 2VDLB 5HRUA 1AN9A 3VZSA 1GYRA 1C3XA 1GZ3A 2MHCA 3CRQA 5FORA 4BMCA 3NVKI 1LEHA 5ALZA 1ECPA 2QQFA 3WMEA 5BVGA 3PHGA 3A32A 2WYWA 1M6EX 4W9NA 4D99A 1T8PA 3J80A 5E0KB 1Z35A 3IAAA 3N0TA 1NJ1A 2RHDA 3NBMA 4KPUA 4XE5A 5D5QA 4JLJA 4CIVA 2D0PB 1URPA 1GSIA 4WRRA 1A76A 3VX3A 5EVJA 3OA0A 4AVYA 1GO2A 5AW0A 1DWQA 1K86A 1NZDA 2VDVE 1ZMRA 2FG5A 3ELDA 3OZVA 1LV7A 4B7AA 4H6PA 1VHDA 4MTLA 3AESA 1P7VA 2AR0A 4P35A 3LOUA 8ABPA 1PSZA 1NQAO 2G72A 3BJIC 4HPJB 3SC3A 4FINA 3Q5GA 1OR8A 3DAPA 4HH1A 4TMWA 5KHAA 3C16C 5C8XA 2OGUA 1L9XA 1KEUA 1L5OA 2GXQA 2B9EA 3OKPA 1Z25A 4NZNA 3N75A 4Q9AA 4R3WA 5D3ZA 1O94A 4GX0A 4D7AA 3IAEA 2JHPA 3UV6A 1X9IA 5AW6A 5C8VA 2XXJA 2PT6A 4B8WA 6CHYA 5LLTA 2OD2A 2XCSB 2O52A 3HCCA 1EGAA 4X3CA 5EFOA 3HB7A 4QBKA 4DLSA 1BFUA 1Q6ZA 2Q2OA 4LAFA 4C3VA 3HDYA 5JSYA 3I01A 1QTRA 4RPLA 2G9NA 2H65A 4RHUA 3OD1A 3STWA 3OLVA 1GEGA 5EIFA 4BB0A 4PWYA 4MQFA 5JJ5A 1BJRE 1U4SA 5CTJA 2UDPA 3L8ZA 4RPIA 1W35A 2EJVA 3KOUA 3NU1A 3R44A 1QHSA 5F1PA 4JASB 2BMDA 2HQBA 3IHLA 1AKEA 3LUCA 1AKVA 2HFJA 1XIVA 2CY0A 3PIIA 3RTAA 4WAUA 5DWDA 3T5GA 2ODPA 3PGLA 4FTWA 4JOCA 1H2FA 2PS0A 3DCIA 3E61A 2QN2A 3L6EA 4DUGA 2SCUB 4LXUA 2JEOA 2VIIA 4J7UA 4C5CA 4U2KA 4EPRA 4KBGA 2I6UA 3DFKA 1DFGA 1MW9X 3I9V6 3ELBA 5E2BA 1K8XB 3DS8A 3ZQ4A 2GPTA 2ZTMA 2FW6A 3HWX1 1T3SA 3NHPA 1XK7A 3BREA 1NLFA 3MILA 4RTMA 1AUVA 3E35A 1DQSA 3I42A 2NXEA 2GUGA 2PQ6A 5KMGB 5AW1A 1WA5A 2X42A 1KS9A 4QOHA 2V6MA 2Y2VA 2LUOA 4CDRA 4OYRA 5LIPA 5JCJD 1NQOA 3KKMA 2PXAA 1ONNA 4QE3A 5H5JA 4DXHA 4F1KA 2WUGA 3U6BA 1KPHA 4RK5A 5KKNB 2ZSHA 1H3FA 3LDAA 2OYSA 1QCZA 3KEOA 3PG5A 4IUBS 1OWNA 2EYUA 5H68A 1E3DA 1AGXA 1OLXB 2B8EA 2YXPX 5CVVA 2BTEA 2SECE 2C54A 3VA7A 1X6VA 2JH8A 4J07A 4H1UA 1GPYA 1PR3A 2A5GA 4II7A 3L7IA 4V02A 3E4DA 4N48A 3PGVA 3CTMA 4MITA 3IODA 1X80B 4Q1EA 5TE9A 4ESVA 1EBBA 3G13A 2Z5GA 3B60A 3BXPA 4C4PA 1Y5RA 3UT0A 3OO1A 1PGOA 4Z1MD 5JQGF 5CJPA 5FI0B 2WVJA 4R6WA 1QS0B 5H3HA 5HW0A 5I47A 4YJ2F 1A98A 1U0EA 2BHNA 3A4YA 4WCDA 4X0EA 2ZI6A 1K7SN 2UVQA 3J81k 3RYIA 2QW8A 2VP3A 4DUGD 4IHQA 1YR3A 2I66A 2PO7A 2PT9A 1C50A 3AVUA 1P0IA 5AHXA 4DMGA 1F2TA 3ES9A 4X94A 2PL1A 2I03A 4MMXB 3I4LA 3E82A 3JQ8B 5BOVA 4L15A 3AY3A 2FG7C 3JWJA 3FY4A 4HZGA 1R0WA 3H13A 3I2KA 1UUFA 4I55B 3ZY5A 2VDOB 1LDGA 2JFWA 3G2KA 1KAGA 1K2WA 5JNRA 3OLYA 1XNGA 1IHYA 3EVEA 1RWKA 1SVSA 3L0PA 2YKGA 3EAFA 2ID9A 4S0ZA 4DF3A 2BHTA 2X1HA 5KPJA 3CWZA 3FPSA 4CTOA 1J20A 2FPGB 2A1TR 4Q18A 4RPCA 4TM7A 5CCBA 1PJ2A 1JWLA 1JPVA 3LLMA 3UWOA 5DULA 1DO8A 1LDNA 2WWIA 4KR7A 3AVXA 4TKUA 5BN3B 3KB6A 3GBSA 3N7TA 3EULA 3P5SA 3D0RA 2HIHA 1OXSC 4X63A 5H80A 4WZBE 4ZT5A 5JADA 4ENPA 3RVLA 3TQSA 3QLUA 2OWEA 3I6MA 4BTVA 2OAQ1 2O7SA 5GOTA 1QO0D 2G9VA 2HQSA 1OXUA 2WD7B 3E3MA 4KEAA 2BBWA 1XMXA 5EIBD 4BVGA 2CDAA 2VDJA 3MTQA 4PLTA 1VFPA 3GNLA 4OAPA 5J5VA 3ILVA 3GFQA 5IJ9A 1EWVA 1U9YA 3KJQA 1UK8A 3EG9A 3LRXA 2NVUA 4I4NA 5F52A 1U2EA 1PKXA 3LUHA 1C9MA 3DBOB 3CMCO 1G8GA 4HADA 1LTQA 3KDSE 2WG1A 5A3JA 5KWSA 1LC3A 5LJIA 4EAAA 5MGNA 1XKLA 3AHJA 3WYBA 1Y48E 1T24A 3QOWA 2W6PA 2ABWA 2P2YA 3O82A 3V4LA 4CV3A 4CEIA 3BXOA 3Q1KA 1QG2A 3ILXA 3CLTD 4WZAB 2XE8A 2C5AA 1DKPA 5A7HA 4QEZA 4YIHA 1L4MA 4O2AF 3U56A 5FTLA 2RAUA 4FYMA 2IYRA 2UYGA 1X13A 2FSUA 2XKBA 1K5GA 1YQUA 2O3SA 2OHVA 4EYSA 3PQ7A 4QGHA 1R16A 4MIEA 1U2TA 2V7XA 1D4ZA 1LPMA 2X6RA 1DC8A 1GL6A 4YASA 5HVNA 3HA5A 5I9IA 1A8PA 3R0QA 5AFSA 4IKEA 3Q85A 3KQKA 2AD1A 1XYYA 2FG6C 2JFFA 2B36A 1G6KA 1SCIA 3LUJA 4OHWA 4A2QA 2X13A 4QQNA 2Z4SA 1R8JA 3KAPA 5EWJB 3TECE 4DCGA 1XU7A 2J5XA 2L69A 5DGIA 2L17A 3WDLA 5ELXA 1ST3A 4XIJA 3E22A 4ZAGA 2IEIA 4LGMA 2IHVA 2BCJQ 2G25A 3BXZA 3G5MA 2AFIB 2VXBA 1LQ2A 1NPYA 1SKAA 1GGNA 2WTAA 3RO7A 2GESA 3A06A 3KTDA 2VZ9A 9LDBA 4CMIB 3OF2A 2I71A 3CX4A 5T4EA 3R8XA 4DSUA 2RB5A 4YV2A 3UPTA 5AOAA 5KYNA 1WOYA 1H8HA 2Q41A 2WRZA 4XW2A 5JLJA 3HEMA 1X1SA 2IXDA 2VHWA 4B7UA 4EG8A 2DFVA 1R9GA 1PR6A 3MT9A 4DCMA 2ZB8A 1Q7GA 3HSYA 5GJWC 3ONVA 3NYQA 4KIJA 5H3CA 3ULKA 3VR6A 3UT5A 3Q9SA 4MEBA 1ORHA 2ZIVB 1RQ2A 2YUTA 3C8MA