1VIVA

Crystal structure of a hypothetical protein
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
184
structure length
184
Chain Sequence
b'LKTTEYVAEILNELHNSAAYISNEEADQLADHILSSHQIFTAGAGRSGLMAKSFAMRLMHMGFNAHIVGEILTPPLAEGDLVIIGSGSGETKSLIHTAAKAKSLHGIVAALTINPESSIGKQADLIIRMPGSPKDQSNGSYKTIQPMGSLFEQTLLLFYDAVILKLMEKKGLDSETMFTHHANL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein yckF
molecule tags Structural genomics, unknown function
source organism Bacillus subtilis
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
total genus 64
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature ec 5.3.1.27: 6-phospho-3-hexuloisomerase.
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01380 SIS SIS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 1vivA00
1GZDA 4DR4B 1VI5A 4LZJA 1XNRB 2CXPA 2WU8A 1TK9A 1VI6A 1WIWA 2E5FA 5LL6P 2Q8NA 3JAMA 2VF4X 1XMOB 1C7QA 5I01A 4DV0B 4S12A 1N32B 3KNZA 2HHHB 4LFBB 2ZJ4A 4GKKB 3ETNA 1J5EB 2CB0A 2J6HA 1JEOA 4K0KB 2PUWA 3Q88A 4DV1B 4B3RB 1TZBA 3C3JA 1IBMB 2I2WA 1M3SA 3HJBA 1U0GA 1HR0B 3NBUA 1J5XA 4X65B 2CVPA 4YY3B 3M5PA 4B3SB 4JI4B 1NUHA 1X94A 4EM6A 1X9IA 2VF5X 1HM5A 2CXOA 3JX9A 4DV7B 2ZM6B 2VQFB 4X64B 1TZCA 2CXUA 1X9HA 3J7AC 1U0FA 1G98A 1JIQA 2PUTA 4DR1B 1DQRA 2UXDB 5LMUB 3OOJA 2PGIA 4DUZB 3OTOB 2UXBB 5LMNB 1C7RA 5BY2A 3LJKA 4M0DA 4YHHB 1B0ZA 2O2CA 4LFCB 3SHOA 3TRJA 4JYAB 2AMLA 1HNWB 5IWAB 2DECA 1NRIA 2O2DA 4TOIA 2POCA 1I94B 2UUAB 2CXTA 2I22A 4JI0B 4JI5B 4IVNA 1JLHA 1IATA 4GKJB 2X3YA 3Q7IA 4DR2B 3FJ1A 3T1HB 4DR6B 1XNQB 3G68A 4JI6B 4B3MB 4LF9B 3UJHA 2UXCB 4S1WA 1HOXA 1VIMA 2CXNA 3QKIA 2XBLA 2DF8A 4DUYB 2CXSA 1N34B 1VIVA 1HNZB 4JI7B 1FJGB 2F4VB 4DV6B 1N36B 3TBFA 4DV3B 3IFSA 1Q50A 2CXRA 4JI3B 4AQYB 4DV2B 4OX9B 1N8TA 3T1YB 5IT9A 4JV5B 4X62B 1MORA 2A3NA 4DV5B 1ZZGA 1T10A 4LF4B 4JI2B 1KOJA 4X66B 1IRIA 1XTBA 3CVJA 3BCHA 4U6NA 2E5LB 4JI1B 4NXNB 3FKJA 4LFAB 1U0EA 1X92A 1HNXB 4LF8B 4LF7B 3FXAA 2PUVA 1JXAA 4AMVA 3PR3A 4DR5B 3J81A 4NXMB 2UU9B 4DR3B 4KHPB 1IBKB 5A2QA 3I0ZA 2CXQA 3HBAA 1N33B 2YVAA 1IBLB 1XMQB 2UUBB 1MOQA 3BJZA 5FLXA 4LF6B 4DV4B 4DR7B 3FF1A 4LF5B 4JI8B 2VQEB 2ZJ3A 4B3TB 1GZVA 3EUAA 3ODPA 2XHZA 1MOSA 3J80A 2UUCB 5BR8B 2V4MA
chains in the Genus database with same CATH superfamily
3A14A 4N3GA 2Y27A 3T7SA 1CNMA 1AHNA 4YAJA 1DG9A 4B6RA 1MNQA 2PX2A 1NZDA 2PUAA 2FPPA 1HSOA 1OVMA 4NP6A 3HBNA 5C4MA 4Y2HA 3ZX5A 4YAGA 2ZSHA 1UQTA 2RHHA 3EFOA 1CEQA 2PX0A 4XGKA 5JS2A 4H1HA 4HB0A 4MI1A 2X3UA 1TQ2A 4EHDA 1XZMA 2MYNA 2QAGC 4FZJA 1ZS9A 1K7FB 2O1WA 5J63A 2GUGA 2Z8ZA 4BNIA 4CUKA 2VFAA 3DF7A 4DDTA 5JZ9A 3O9VA 1S2MA 2B8NA 3RASA 3TRHA 5L9AA 2IU0A 4CYMA 2IYZA 2FEAA 4LXQA 3R9XB 3BMCA 4CKZA 4LGMA 5JMPA 1N2CB 1PFYA 1Y1RA 2OQ2A 3DPUA 4G4IA 3F3MA 1HDOA 3N0VA 4QAQA 4UATA 2FAXA 5TPZD 2H00A 3PFBA 1FYVA 2WAAA 3WRYC 4WFQA 3P27A 1MGOA 2OYRA 3AIKA 1H5UA 2G0NA 4BUZA 1KI4A 1P2GA 3HB7A 1CB7A 2H7YA 2J41A 1FJXA 4NK5A 4PX9A 2F43A 3BGOS 1BN6A 1C8LA 5KQPA 3HU5A 1YDHA 2IYFA 4OLHA 3D5EA 5TDHA 2JW5A 3VBEA 3JW8A 5EZ6B 3G8YA 3KKLA 5LQRA 3IUSA 2OBLA 3ROFA 3O3OB 3IVXA 3HUDA 3Q7TA 4PQRA 4MQMA 4RKRA 2C1XA 2FZVA 2WJ6A 2A5FA 4I9HA 1JU3A 3GWZA 3I0NA 3AHJA 3ON5A 4G2NA 4HN9A 3NIFB 5NLLA 1CS0A 2Y6VA 1DKNA 2AK3A 1GKLA 1THGA 3KFXA 4M9ZA 3L3BA 2ZYVX 4GPBA 2JJ2D 2OV8A 2QLNA 5DIZA 1KTIA 1K6JA 4DJEC 4NICA 3NTUA 3DE1X 4Q3LA 3C7KA 1VYHA 2A92A 4GICA 2IKSA 4HDKB 4JX8A 4OH1A 3HSYA 2H16A 2O5CA 1SGWA 2P8SA 3OH8A 4X97A 4ZK2A 4QOFA 3MMXA 1X0VA 1UBEA 1O57A 4OJQA 4YJ2B 5TJ9A 1FYFA 1E6EA 1KP9A 1UJBA 2JHGA 2JJMA 3T3OA 3AY3A 3BN3A 3IAXA 4JBLA 4P7FA 3EVNA 3SZUA 3K1AA 4L0MA 4OO3A 5IFLA 2AMJA 2ZSEA 2ZYTX 2ZULA 1G5RA 3NP9A 5FPQA 3ZWVA 3G0CA 1GPKA 4Q3OA 4E22A 3UUEA 3D5QA 4ZCRA 3VSBA 4MWCA 1MORA 1Y89A 1ZZGA 2VJYA 4O1MA 1TZMA 2CNLA 1I6LA 1KBOA 1J2YA 1N3LA 1Q84A 3M1AA 1RRGA 3SQLA 5A3RA 3M4XA 1T8TA 3QMWA 5HTKA 4BFYA 2MWMA 2Z6VA 3X1MA 3JCZA 1E59A 4DR5B 3VJRA 2AJCA 1DCFA 1T0PA 1SD2A 3Q98A 1SU7A 4YRKA 3CJQA 1GADO 3DBLB 4QNMA 3PC8A 1KFJB 1X1DA 4CQMB 4QUEA 2ID9A 4EZIA 4B4VA 4PE5B 5FOXA 4MA4A 1JT9A 4CDRA 1GFIA 1R64A 3HP4A 1WULS 3VI4B 2QOEA 3B1JA 4RVNA 2KYRA 2BEUB 3FAKA 4DLWA 4DUGA 2QYOA 4PYOA 4UMDA 4EP1A 5DTJA 2FDCA 2NO1A 3MYYA 3NTRA 3WYDA 3ZHOA 4LZJA 1GZ4A 4WK4B 1ZMRA 4HZIA 4IR7A 3CINA 4Z9YA 3DOOA 2FFBA 5DX1A 3IQDB 1Y3FE 1YQTA 1ZWKA 3A9RA 3QXGA 4I81A 4XUDA 1CE8A 5EKSA 1PSWA 3WNVA 2AMVA 1E2IA 2FWBA 2WJ4A 4JOBA 3Q10A 4B8ZA 1QHGA 4BKMA 2X19A 4BUCA 3LV8A 1KSHA 3HJRA 4FOSA 4Z0NA 1U2PA 3BPSA 2Z5LA 4RMGA 4NVRA 1TTPB 4GQIA 4LXUA 1ZMXA 1L8OA 2C58A 1Z36A 3O47A 1U3VA 3KG2A 2ZJZA 3U3DA 5F12A 3ZHCA 1J5XA 2CE7A 3AKCA 2CVPA 5FUXA 3UVEA 3FFXA 3E5HA 4B3GA 4J1TC 1KL7A 4I5FA 2GPWA 3O1IC 2Z98A 2WDZA 4CN9A 1JTVA 1FFSA 2Q0QA 2FDRA 3KQKA 3ZCVA 4ZCSA 4UUPA 2CVQA 1LX6A 3IDZA 2KW5A 4I50A 1SBHA 2YOHA 2LBPA 1YRYE 4N39A 2PQ6A 3M9WA 3NRJA 4QSHA 2CK3A 2ZP1A 3KLOA 2QL7A 3FUTA 4IIFA 5I9NA 3RT1A 4JLOA 3GHYA 2O2CA 4LFCB 2JKVA 1O4VA 1K8XB 3IXLA 1FVOA 4QBGB 3SOPA 2PPLA 2YNMA 5IYZA 2QTMA 4CLEA 2FH5B 3AYZB 5G0UA 3GJ6A 1VIDA 2P0EA 4UNQA 4W5WA 2P3SA 3R9IA 1CJMA 4C6TA 4MCIA 4HNVA 2PLRA 3K09C 1RC1A 5FP0A 4DLKA 1UBGA 2BHTA 2QD4A 2ZE6A 4OHXA 4MR7A 4AO7A 4ETNA 3LY9A 2P30A 1P9OA 1TKAA 2NUPA 4CCYB 4Z4IA 3LRXA 3BIOA 4UUOA 4AMZA 3JPYA 3Q9UA 2R1UA 2ONJA 2A2ZA 4CFZA 4Q24A 5KVVA 5GJCA 4IQ0A 1N34B 2B99A 2V7QD 4ZEXA 1HNZB 1X8LA 3HUEA 3LZ6A 1FJGB 1XAIA 2GAFA 3DTVB 1ZIYA 1NRWA 4F2PA 1YB1A 1ADFA 5EKDA 1OI2A 8ADHA 2BHLA 2VHCA 4NZ9A 1MX3A 3HM2A 1CUSA 1YRBA 3HKBA 1PT6A 1OWLA 2QL6A 1FU7A 3ZU5A 3CLUC 4RF2A 3P1JA 1L1FA 3HYLA 4FE4A 4MVJF 5HDBB 2NPOA 2A9QA 1J5PA 1CV2A 1DWQA 1MDFA 2I76A 5F4ZA 1KO1A 3L05A 2CF6A 5BN4B 2WQZA 1PR6A 3QJGA 2AFIA 2CFIA 4RKYA 2W9XA 3CRMA 1XRJA 4IPTA 3LFHA 3VGJA 2Q5JA 4ALIA 3MWGA 3N53A 2ISSD 3PUXA 1MU0A 4TZ0A 1VHTA 3EEIA 3BILA 3QNWA 1XTQA 1DBVO 1J9EA 3TZCA 2H5IA 2C5AA 4JJKA 4BIMA 2XIJA 5KNDD 4PIVA 3G2HA 1W6RA 4JC8A 1H1LA 1FIUA 4LCEA 4LVCA 3CZ9A 4NFHA 4BVLA 1C2YA 1TUBB 4ZQGA 3WHKA 3C2QA 3MRSA 3CWCA 1E7YA 3EFHA 3OMXA 4QXOA 3Q7SA 4FMCB 2E37A 3HA3A 4GZ3A 5T4BA 5T8KA 2KLHA 3BXEA 1PGJA 4FGWA 1QZXA 2ET6A 2FFRA 4FS3A 2A5LA 2OUIA 4Q01A 3SVLA 1HA3A 1NNUA 3GFPA 1GNSA 4HUQB 1QK5A 3P0IA 4I55A 1WW3A 3AR5A 4B76A 5L3SA 3N8KA 4BZWA 1SKQA 2Q5OA 2ZETA 4K3UA 3TEJA 2QW8A 2HIHA 4R51A 4YCDA 3ED5A 4MNTA 4M6WA 4YQYA 2VJBA 3SGLA 4M8NE 3GFSA 1BU8A 2R9VA 4LDRA 4I2VA 1NLYA 1V4VA 1GQSA 5F76A 3M7IA 4M1OA 3MWLA 5BT8A 5LA6A 1QS0B 4B3SB 5JDCA 2DBVO 3RFFA 1Q1ZA 4M8IA 1HYGA 3DXZA 1P61B 3P9ZA 2NYRA 5CX1A 3U2QA 2GA9A 3ZC3A 3TGLA 2O8FB 1W25A 2WYHA 3RVSA 3HXMA 4KAAA 3J7TA 4BVFA 1BFUA 1ISFA 4OHOA 5D86A 2B34A 4KODA 4EFDA 3QVWA 4IGKA 2X0KA 1DKOA 1Z12A 1BMDA 1P75A 3SM3A 1WOYA 2BFNA 4FXPA 3K0AA 4JSRA 2AOTA 3OJXA 4FYMA 1B8OA 1U8UA 2AEFA 4GUDA 2QZJA 4OLFA 1TE2A 3KPJA 3UJAA 4LSGA 3DBIA 4RPGA 1C0IA 3V8BA 4QO8A 3Q1LA 3U1VA 4KPFC 4ENPA 4PRYA 2G36A 2L0XA 1B1CA 4R7GA 2BONA 4N82A 1HOTA 4FJ1A 2D1YA 1UMBA 1GT91 1CEXA 3ENNA 1VB3A 3KL4A 4Q9IA 1Z9BA 3TX2A 3PKJA 3DZKA 3TO5A 4P38A 2Z2XA 3O6VA 4RANA 2JI9A 4MQ6A 3OM0A 1A4IA 3EGEA 2H54A 3ADPA 3CH6A 3ENVA 4IJVA 4QUHA 3TOSA 5C1PA 5MDHA 2P9TA 4LVNA 2IZ1A 4DM3A 4YA6A 3MBKA 3RK1A 3ZHVA 5L8VA 1ZIXA 2XZOA 2P4HX 3PA8A 4I2NA 3H3XA 4TTJA 1T1GA 1T2CA 1SUSA 2NSJA 1CZOA 1I3NA 1KIMA 1QLWA 1XEWX 3WO0A 4R16A 5A6SB 1L3IA 5I6DA 4UBKA 2V6IA 1XEXB 1Z8HA 3AB3A 3LX5A 3S2FA 4ACBA 3SVZA 3D7RA 2VPYA 4OYRA 5E7MA 3VKGA 5G4LA 4LXHA 2ESRA 1KP3A 2B30A 2DPLA 1FQWA 2H08A 4MVJH 4JNCA 5ALPA 1XI2A 4RPKA 3QBVA 2OYSA 3E3OA 3LS2A 3GN1A 3T8YA 1TKBA 1V48A 2IHYA 3GP8A 2OAP1 1N7GA 4RV5A 2PXCA 1UAYA 1GCOA 4NXNB 1NURA 5IYZB 1FYDA 4RFSA 4LF7B 4A8PA 2H8GA 1ZVMA 2B8WA 1MRNA 3N2GA 2ZQYA 1H2YA 5JU6A 1GRQA 2VYFA 1RVDA 1TQ6A 5KWSA 2HR1A 3NTLA 4OOEA 4YI3A 4UFNA 3BD8A 2PN1A 5DTRA 5BMVB 5BR1A 4H6XA 5IJ9A 2UUPA 1FVXA 4UPEA 1OZHA 3WV4A 2B82A 5TX7A 4F7DA 2ECKA 3TUZC 1CZRA 1XNGA 3TR0A 2FETA 4MI3A 2IUUA 1WD5A 3BXXA 1SO8A 4TSRA 3T95A 3WO1A 2OEPA 1MCZA 2P41A 2YWEA 4ZZ0A 2YY5A 2R7MA 1UP6A 3N0RA 1N1GA 2C4KA 2CW5A 1HFKA 2FMIA 4WESB 3E5NA 5U4XA 3ZIAD 5J4VA 5KSZA 4BMZA 5BSKA 1SG6A 4MW9A 4UUAA 4EYKA 4D9GA 2WQ7A 1AZTA 5KOJA 2MSLA 3KQPA 4XDZA 3GN2A 1B6GA 3R3WA 3SMQA 4XQCA 2FEMA 1BNCA 3PEVA 4BMYA 5CB8A 4L6CA 2EDCA 3BGSA 4KAXA 4TMFA 1RHUA 3MZ0A 4P32A 2GZRA 1E2FA 1WEKA 3JARB 5IKPA 4QKQA 4LOHA 3TNYA 4DZZA 2I2WA 1M3SA 3I05A 4YREA 4HNAA 1UXIA 1VJDA 3REOA 4R9VA 4KIJA 2POQX 1IE3A 3HO1A 4TROA 2A94A 3G5TA 3FBWA 4ZRDA 2I7DA 2FP3A 2A9PA 2JHAA 3SHQA 3LFUA 3ZX4A 4HP8A 3MWEB 4B40A 4PFKA 4CLXA 3VH4A 1GLNA 1HH4A 1RZ3A 4J1SA 1VFPA 5FUBA 1I2DA 1DC6A 5TPWB 2JJ1A 2P1ZA 2P11A 1NIPA 2VHQA 2V6JA 3AUTA 2ZM5A 2XPCA 1DQRA 3ND8A 4PN3A 3MWKA 4HGOA 1T6YA 1E5DA 1MV8A 2HQSA 2QG9A 3QXSA 4KV9A 5CM8B 3UOGA 4DNQA 4E21A 4DDWA 1NQVA 1C7RA 2W37A 1H2AS 1TAQA 2D06A 1FFXA 4LZNA 1U9YA 2GZ1A 2BSQA 5IN4A 4RE6A 1T15A 4I9NA 1C9KA 2NVOA 3K8ZA 4GDMA 4Q66C 1RXIA 3SS8A 2XAUA 3PFNA 2PJRA 3HY3A 1LDEA 1TFRA 1Q1NA 1W5FA 3H5LA 1JEDA 1CR1A 3NPMA 3V46A 1Z2AA 2VEOA 4JSYA 4JUBA 3QTTA 4BP3A 2FMHA 5EJFA 3RS4A 3I53A 1G7RA 3G2KA 1EFVA 5K6TA 1YMQA 1Y7IA 3M2PA 3LOPA 2VBCA 3WDKA 4EQ6A 3L1VA 2CFTA 4RH1A 2GBGA 2CVFA 3I73A 4OQXA 1XTVA 3P2YA 4WZZA 5BNIA 3E7PA 4BFXA 2UZ0A 3RVKA 1A2KC 2ZUFA 2W2NA 4B2PA 4M9XA 3IAS1 1FOEB 4NKRA 3UAWA 1HZZC 3FHJA 4IOMA 3KWJA 2I03A 3ZJ5A 4EEZA 2Q9UA 2GZ2A 1NVVR 4FEGA 4WY2A 1FE8A 2CFCA 2WWRA 4G0ZA 5BMVA 4ZAXA 3AHGA 4BQFA 4IZ6A 4X62B 1T9GS 3W5VA 1YC5A 5HP4A 1KKLA 2C2YA 1ZM9A 3H1AA 2CKDA 3CZ4A 4P9NA 5IAKA 3N07A 3ZYCA 5JC1A 1E2JA 1FNMA 3KDAA 3QMPA 1YBVA 5ELMA 5EJMA 2FN3A 2ZJOA 4FFMA 4GWGA 4LOKA 4X1IB 3WFIA 3GDHA 1X9GA 4BE4A 3T7CA 4PNPA 4X90A 5CA0B 1LDNA 5YASA 5ALDA 3QE0A 2PYDA 5AVQA 2HAEA 1UBFA 1RHMA 1E9SA 5CVEA 5EKXA 4ALLA 3IT3A 4JL6A 3HGTA 4Q1FA 1QAQA 3PNSA 4R0VA 4QJ4A 3NKLA 1K7SN 3DZHA 1LB1B 1UBSB 3AC0A 3JVUA 1SQSA 4EHKA 1OX6A 2G5GX 1FFXB 2OBBA 2R2GA 4KUGA 3D02A 4M1TA 2DMRA 3RI3A 4MPPA 3SHTA 5ILGA 4NJOA 5BMVF 1XX6A 5CNIA 5A9TA 3AGQA 3UH1A 2FR8A 2WSIA 5C7YA 3QK7A 2WTMA 3H9BA 5CLHA 4N1AA 3REGA 2TECE 1WCIB 4C3VA 2QV0A 1BG6A 3HWSA 5KYNA 1T3GA 1M83A 1WVIA 4N03A 3NO4A 3OPYA 1T9GR 4LTDA 1OZAA 3FYTA 2C57A 3I2JA 2GZ3A 1Y6JA 2O2IA 4PZ9A 3ZE2B 4DLRA 5B7NA 4Q4JB 3B12A 2CWWA 2RCYA 3RUEA 2AJBA 3PFCA 1OWOA 4RAQA 2H9YA 1HETA 1PKXA 2AFHE 5K3FB 3GJ7A 2JH8A 1I80A 2P6RA 1P60A 2ECFA 1CQIB 2GVZC 3KLBA 5BW8A 4U3JA 3FJOA 3LVFO 6YASA 3T7JA 1TJ3A 5FRDA 1MABB 4MIYA 4MS1B 2QE7A 3A6EA 3QJ5A 5BSTA 5EJIA 1GNRA 4FZRA 1UBOS 2DUJA 2FI1A 4DILA 4JZYA 4TQUS 1X7YB 1JHDA 3D0RA 5BRNA 4CQJA 3OT5A 3L41A 1IUOA 2D54A 4ZI3A 3D9QX 5KJEA 2OK7A 5ENVA 1JXQA 1W4ZA 2VHYA 4OOFA 1M8PA 4YMWA 5SV2A 4DCNA 3AOGA 2HMYB 2UAGA 4OMDA 4W1RA 5HMLA 3WG9A 3MS7A 3LOUA 4FFDA 2N42A 3MCTA 1NN3A 4R31A 3EE6A 5ITVA 1R12A 1Z0IA 4RZUA 1QQBA 3L0PA 1GFSA 5EINA 2PS1A 5LMNB 3E7FA 3JAKA 1C1DA 1KEPA 2G6TA 1P18A 2VUSA 1NMYA 1RPZA 4KQ2A 4MGKR 3LHSA 4R98A 1HLGA 1DQYA 1F2UA 1F6DA 2YX1A 3ZCTA 1AXGA 5K2OA 4CTOA 4EPRA 2OFFA 3FR8A 2DY1A 4IIGA 2G1PA 3NHLA 1JR2A 3PQCA 3DAPA 3ZJTA 1NJSA 2V1UA 3E4DA 3O2JA 2A1UB 4WNAA 1R9JA 2YUIA 4MS4A 5CT9A 1LNQA 1FS4A 1J21A 2GLUA 3M9XA 5CHEA 1JHVA 5ESXA 4AT1A 1YMUA 4FJ2A 4C21A 5T7BA 2HXSA 1A1SA 4D81A 1YL7A 4Y9UA 3WK7A 4XPZA 3C4VA 1C0LA 4YRFA 2AXEA 1UXJA 2ZVJA 4ZVQA 5ALSA 1L7PA 1VKZA 5ADHA 1BDIA 2IUYA 2QM3A 1R00A 3C98A 4DV3B 1L2TA 1SD1A 3K6RA 2IELA 5LYYA 3STYA 3P9IA 4FI3C 5DK6A 4B32A 4L8LA 2J48A 3BA1A 2GCGA 3VR4A 4ALNA 3T1YB 1VL2A 2FFQA 4OXQA 5TY0A 2Q2WA 3H9CA 3OLQA 3MTEA 4YMIA 1M1UA 4EUFA 1XRMA 5HPYB 1J20A 2JLUA 2GXSA 1YDFA 2O3SA 4PTLA 1FJ2A 4OAQA 1W88A 3VRHA 1XDBA 4UAJA 2O2ZA 2YS7A 3ECCA 3H17A 4G8JA 4W7IA 4MULA 1UUFA 3RO7A 2VRBA 3CN9A 2A9RA 3CTPA 2WHQA 5E3JA 3D6AA 2J9FA 3C48A 2QVCA 3JTMA 2I66A 3TLAA 3G2QA 4R9SA 5REQB 1NI4A 3JYLA 4I5DA 5IMBA 4GL4A 1UH5A 3C6QA 5K3FA 4BGVA 1RYNA 1YK1A 2P79A 2PVPA 3K15A 1MC5A 4Q4JA 4K2AA 3A70A 3BF8A 4KK3A 3WGVA 3E4CA 1NU6A 3IPLA 4GBMA 5GJWC 4GMDA 1JTFA 1KE1A 5G02A 3ZJ4A 2V8OA 5K0CA 2H4FA 3BH7A 2ZBGA 4K2HA 2HBZA 1NUSA 3PE3A 4FKBA 4BO7A 1JH9A 3GT7A 5FNVB 4Q4LA 2DCMA 3GZ4A 2ZQ5A 3STWA 3UJPA 2W83A 2EL7A 2GEDA 2VQ3A 1ZOSA 3RHTA 4EGAA 3JAMA 4FFVA 1PNRA 1GPBA 3DZBA 1U5BA 3L7JA 1O58A 5PNTA 1OKKD 1EG7A 3BD7A 4L3VA 4R8MA 4X8OA 4IIBA 3QU4A 4IIHA 2XUIA 2OQRA 3VPBA 3KXPA 5DCUA 2WSMA 2ZS9A 1U7DA 4EPXA 3EIQA 3JQ7A 4EJSB 1K3UB 2FSPA 3E9DA 1WB5A 4MWTA 4B3BA 1OFUA 1QFJA 2DBYA 3SHWA 1V5IA 4UAUA 3CA8A 3UYKA 1ZL0A 1KH3A 1UODA 4GMGA 3K30A 5TLSA 1U3UA 2ZUCA 4IO0A 3QE3A 3E3MA 4QSMA 3R7LA 4KLNA 4OD0A 4C5BA 4XM1A 3HNRA 3EGCA 5EHQA 2JFGA 3F6BX 3N76A 2BYTA 4HV4A 2R84A 4C7MA 5DWVA 4B82A 4CG2A 4UUBA 2QQFA 5J1TB 3EZ2A 4AG5A 5BQPA 1C3OB 3DHWC 3QXCA 4IDDA 1UPUA 4LNUB 2B1GA 1EDDA 3W8EA 1IK6A 1IBCA 1MT3A 3EQ6A 3ZQUA 3RSHA 3CW8X 3GFTA 3W1WA 3DXFA 3PF8A 2NUTB 1YQGA 5FI5A 4MITA 3FCAA 5JARA 2DXIA 1B2LA 3G0OA 5BY2A 5EKTA 1YR6A 3QKWA 4GZ5A 1EGVB 2J3LA 4BJHB 1U28A 4FYVA 4F6LA 5BYJA 3GLGB 5B1DA 1O3YA 2FEOA 2PBLA 1XHEA 1JBQA 3OQHA 4KJZA 3VNRA 1LDGA 1TVCA 2KWIA 4A4DA 4EYOA 4U2GA 4L6AA 3ZTTA 3W5UA 3VSAA 3ISJA 3R6WA 9ABPA 4UXHA 3L07A 2JC3A 5H3HA 3CIOA 1I24A 1FNCA 5CAEA 1K0FA 2HI0A 3AB8A 4FC6A 1T9CA 1JL3A 4GL2A 2CXNA 3KZMA 4TKMA 2JATA 3NORA 4BFZA 3DO8A 4HDOB 2ZRIA 5DHUA 2X0JA 1ZH2A 1M6NA 1VIVA 2YCBA 2AOWA 5F73A 2AE1A 1U2GA 2IUFA 1IQUA 1U8AA 2Z4TA 3HVIA 4UCWA 4BY9E 3O0DA 1D4ZA 4PBTA 5FH9A 1E1QA 2QLMA 4EI8A 2FPWA 1IVYA 1LNSA 4I4CA 4O3MA 1XVIA 1EUDB 1YV9A 3TSWA 1G9TA 4ZYUA 2WF7A 2H1CA 4NE7A 5CGQB 3HJUA 5EQTA 4AN4A 4BO0A 5BOVA 4UEOA 5FPKA 4JI2B 1ISSA 1V8PA 3K9LA 3KRTA 5LWQA 2CZCA 2Z3WA 3L7DA 5KYKA 4ZVRA 3C85A 4UQOA 1GHTA 3KHTA 3WB9A 1T1IA 1U4SA 2XRFA 1B74A 5HNKA 2Q3CA 4D43A 1EUYA 1VG0B 2FWMX 5GINE 4QO7A 3K94A 5SY6A 3MWDA 1O9HA 2D59A 2IDJA 3W5CA 3K0BA 1I7PA 2NU6A 3KJXA 1C8BA 1T0IA 3A4MA 5CFPA 3TL3A 2D1QA 4BYMA 2Y0EA 4R1SA 5ICGA 5KX5A 2XEDA 1Y6FA 2E21A 3M1IA 4Q1CA 2J7PD 3IUBA 1ZK1A 5H80A 3TAHA 1PS9A 4FMBB 4EJMA 4G1UC 1WF6A 3TEMA 1YTLA 4CKWB 2E1PA 3LT4A 2Q6TA 2XNSA 5JSZA 3A9UA 5ALGA 1VM6A 1S8OA 4DMKA 4L50A 3AJ9A 3KB8A 521PA 5JYCA 3VV3A 2Y9PB 3OOEA 4KMSA 1TTTA 2CDNA 4CTKA 3UHJA 2VRNA 2JHPA 3LCRA 1DPGA 3WBFA 3EAFA 3BBPA 1PDWA 3LYUA 4ND4A 1DTWA 1Q91A 1RKXA 3C6XA 4KHZA 2NU8A 2QTRA 3HR8A 2XYQA 4GPAA 4IMJB 4QDUA 3UXMA 4HSGA 4DLXA 3QY9A 2XIQA 3EGWA 1Q92A 3VDNB 1R4NA 1CIPA 2HQOA 1SQ5A 2FW1A 3ESXA 3BXHA 3WAJA 4OLAA 1L4LA 2CHFA 2J6IA 2WR8A 3CY6A 4HYEA 1KSFX 4Q3AA 2R7AA 4Z4CA 1FTQA 3BDAA 3N6RA 3OZSA 4UEJA 4PU0A 1GCIA 1JG1A 3NJ4A 3CE6A 4Y98A 4GPTA 2A35A 4YP1A 2W6CX 5A3QA 1L8LA 1O9BA 4U9IS 3U4DA 4DPLA 2ZM6B 2C9YA 2XT6A 3D5TA 1Z6AA 4LXTA 4UVHA 2AK2A 4R6WA 2HBRA 4NABA 3HVHA 3SR0A 5C1BA 5JWOA 5LM3A 3GQBB 5EZYB 1AGYA 3U5TA 3Q8KA 1EQAA 1D2EA 4F1WA 3QPAA 2MR5A 1OWMA 3HEBA 1P44A 1E7RA 1ZGGA 2K2QB 3IGFA 1FUIA 1LXCA 2PGIA 3WYBA 6ABPA 4RQAA 3WOHA 4K46A 3PQ4A 3QVOA 2O3TA 3C5CA 5JO0A 4PS1A 2JIOA 3GJXC 1N5LA 1DKMA 2FA9A 3MGBA 4B0PA 5KHOC 2P65A 4OQDA 5K9ZA 4JJFA 1DXQA 5KSWB 5KVAA 2ZYGA 4Q3BA 4QXQA 4X1KA 3MTJA 2WG1A 2B1QA 1EK6A 1L7AA 2Q5LA 3STVA 1PGNA 2BWJA 4TRMA 1KY2A 5CW2A 2BTEA 1YKSA 1J0EA 1E2LA 3B6EA 4E03A 1SVOA 1YI8A 3LO8A 2UXCB 1I0ZA 1FNBA 4A91A 4W5RA 4TZ6A 4KKVA 1IPFA 2R6ZA 1JXMA 1PJLA 3HXQA 1TI7A 1PD0A 2PD3A 5AOVA 1GAXA 3CG4A 3JD3A 3D8BA 5C1OA 5C7OO 4OAPA 1NSTA 3FZQA 1R0LA 1IWBB 4LBVA 2JH9A 5CP8A 4FKZA 5AK0A 5DM60 4XUGB 4CIYA 1PEYA 1WHTA 3QWAA 3SYKA 3HMKA 2WEKA 4WECA 2II6A 1JKIA 1OXVA 5FTMA 1XZFA 2OP1A 2LD4A 3CN7A 3CWQA 4NCXA 2WWIA 4IFEA 4XM0A 5TT1A 3CRZA 2EHDA 4II2A 3FBGA 2RGNC 5J2UF 1V71A 3LWZA 4P4LA 4N7JA 5DM0A 1XZHA 1X80B 3PFGA 4C07A 5KPJA 3LLVA 1GAQA 1T4MA 1EJBA 2WTXA 4L4UA 1EHCA 2N75A 5K3DA 2VJQA 1CDEA 1F1JA 1LI5A 3O7WA 2BI8A 5CX1B 1HE8B 1Z4OA 2IE0A 3L7AA 3DM9B 3NIWA 2Q6OA 5F3RA 1DIHA 1RI3A 2ZWVA 3GFBA 4RGVA 1LDMA 5CCDA 3VAZA 4OBBA 4TRJA 4YLGA 3SSMA 1PL6A 3KYIB 2ZUDA 2B4YA 2YVAA 3AEZA 4NS4A 4OSPA 5CPBA 3R7NA 3ZQ6A 4Y6GB 4D9KA 1YZFA 4BKRA 3AOEA 5C8VA 1U6IA 1KYVA 3I32A 1Z4NA 2V6GA 1QMGA 2R79A 1ZUIA 1SZCA 1ZIOA 2XEXA 2XYHA 3UKJA 2XRZA 1E1RD 3HDQA 3PUWA 2V4MA 4MVJP 2AXQA 4PLGA 3ZH2A 4BLWA 2ASEA 2VG8A 2C2MA 1VP9A 3DLBA 1PT5A 1NQAO 1Q3HA 4GXTA 4M7PA 4EHHA 1TIPA 4B6FA 3B9BA 4GBJA 1UOPA 3P2OA 1G4AE 4XASA 3RWOA 2AUTA 4N0EA 1AF4A 1YU9A 1QJ4A 4YECA 3UK1A 4CM1A 3MQ4A 1NTOA 5ARCA 2GPNA 2WJPA 3ACBA 4G1FA 1BMQA 4DIKA 1CWUA 1E1MA 1EA7A 1T3HA 4I9GA 4RDHA 2HT1A 4US0R 5FNZA 1CKEA 1V3TA 3G7SA 3I04A 1YQ9A 1TLFA 3EODA 4Q15A 3TOXA 3QFRA 2Q5IA 2IITA 1RYFA 3UY4A 1R0CA 3SYMA 2QYSA 5JSUA 5GGXA 2VYCA 2GI4A 3DHVA 2I6QA 2O06A 4J3FA 5I3CA 5KI6A 3MMZA 2QN7A 1JWBB 1MA3A 2X13A 2ZKLA 5CVCA 2J0VA 2VZEA 5KYXA 1J8FA 2XMGA 4UHEA 3KJIA 4WX2B 3JYPA 3U13A 2P2NA 4MGIR 3BSFA 1NPYA 3CKKA 3BTVA 4RWEA 1QTQA 2J5KA 1II0A 1QHNA 2JF0A 2ZU0C 1TEVA 2IUSA 3DDZX 4A1FA 4EMUA 4EPYA 4BKPA 4YMUA 4GR9A 1J9ZA 1HV8A 2W48A 3HXPA 1QV6A 4RIIA 4DWOA 1EFKA 2IYOA 5HG0A 3R20A 1YZHA 2XGGA 3S99A 4BB0A 2J9XB 3S2UA 4Q3CA 4XB6B 3ER8A 4E7OA 4G07A 2W43A 1XKTA 2NP7A 5KYWB 2ZKIA 4S05A 1C1XB 3U3ZA 1MXHA 1WB9A 4BBPA 3IP9A 1ABBA 5MFPA 3I64A 1N7IA 4EFKA 1MO2A 2CUTA 3DMTC 3AVYA 1ZM3A 3BOSA 1K9SA 2J6CA 4IWYA 4K8OA 4LNAA 5FL7A 4XTCS 4MR9A 4OI4A 2AA3A 4C04A 5A04A 1AUVA 2AEMA 1D6NA 2GEBA 1N6RA 2OMKA 5KWJA 4RSGA 2Z9DA 3OFVA 2HLNA 2KX7A 3PUVA 5KOYA 5DU2A 4Y6QA 4KQCA 4NBVA 1T5OA 3LUAA 2P5TB 1YT5A 4P7JA 4D9EA 1DOHA 3L8MA 4P54A 2HSEA 2P77A 4O4LA 4Y2TA 4BO6A 4EB0A 2PGJA 3H1EA 1MXFA 3P9XA 1VE7A 4M53A 1EDEA 2Z9BA 3V1MA 2VQDA 1QH0A 1H2RS 5ESRA 1ZUWA 2JFZA 4BJ6A 1XTBA 4RKEA 1POXA 4QUAA 1CB0A 4XGIA 3AX6A 3WQHA 5F5LA 4BZZA 1OAKA 1NP6A 2UZ1A 2DPGA 3RQIA 4F4HA 4R7ZA 3BJEA 4OYLA 4MB2A 1K4YA 3W5IA 4NXMB 3DLCA 4LXXA 2C3OA 1XZDA 3JWJA 5IJ0B 2Z6AA 3PXEA 1O4WA 3A1CA 1QH1B 4F46A 1D2AA 2PBRA 1O5TA 1TUBA 3D7NA 3H1FA 4AX4A 1JUDA 1KDRA 3DT6A 4NWIA 5AW7A 1FFDA 1ZOIA 3SF8B 4Q7KA 3KQUA 3A6DA 1W36B 1L4HA 2QRKA 3U26A 3TECE 3TMAA 2C4MA 3DKPA 3AFMA 4H17A 5C5DA 4RF4A 3Q6MA 1HI9A 1NJ1A 2LIVA 3QLUA 4HADA 5ECGC 3VQTA 4CEJA 2V7UA 2W4QA 3QFCA 3ZHQA 2A9FA 1WXIA 2ERCA 4IIJB 3BCUA 3W1VA 1FNSA 3NBKA 3SEFA 1GTJ1 3ZK8A 4ATNA 4YAUA 5KMGA 5K0TA 4ER7A 2QJOA 1M10A 3MWDB 1NI5A 3JR7A 3MD0A 1JKXA 1QANA 2GJSA 2BV3A 4NV0A 2JHFA 3EDCA 4IRMA 4L8FA 1JLRA 4RZXA 2FW8A 4D9HA 1BW9B 3RRBA 4RLSA 4CPDA 3G6KA 2BD0A 3KEMA 4OTZA 3V5NA 3OD1A 2PJUA 1IIRA 1M8GA 4UD6A 4V0RA 3CVWA 5EUMA 4JSTA 1X94A 2BDTA 3SD7A 1M2EA 2MIIA 3BJIC 1Y8ZA 1L8QA 4PQGA 2V9ZA 1QZUA 3AVXA 2VF2A 4NOMA 3UAXA 3A9VA 4CR7A 2VQFB 5E2IA 3ZWAA 2E49A 3QYAA 5FQNA 1QVVA 4GKAA 1IM2A 4GLLA 4IDNA 4UZEA 3U1BA 3I8XA 1G8JA 4BQSA 4PHTA 1K92A 2UVPB 1JJIA 2PHZA 1VPDA 2FZWA 4PX5A 4Y2XA 4F7WA 3E23A 1NFFA 2I29A 5DGHA 2FU5C 2OB2A 4EO7A 1MEJA 3JXEA 3RKRA 3CU5A 1A95A 5AK4A 5HIJA 4C20A 3VVMA 1KI2A 4Q4DA 1SBTA 1DIRA 1OXUA 2X1VA 3LT1A 4JB0A 5EPOA 4ZK6A 3LHKA 2ZIVB 3EVGA 4HXYA 4B3IA 2BFOA 3CVUA 3QYPA 1I5OA 3PX2A 3W8RA 1RP7A 2BGJA 3BGWA 1F5SA 4Q9AA 1DRKA 2C82A 1N0IA 3JWEA 1QIIA 4XQGA 5AJZA 3THOA 4F71A 1GAEO 5A9SB 5BW4A 2JGDB 1Z26A 2NP6A 4QULA 1SZJG 4PZLA 3L7OA 1SXPA 3C3AA 1SA0A 2CXSA 3VV2A 1YS2X 2UUOA 3WYCA 1ZD2P 3IDAA 1Z0ZA 5K0JA 5JXHA 1OE0A 3QX9A 1UM8A 4RHTA 4Z9AA 3FTFA 1TAUA 1YULA 4EI7A 3O84A 1JQEA 1HFWA 5CYPA 4AJIA 4YLYA 1Z17A 3DV0B 2PFKA 2DFTA 1MMFB 4PYIA 3ZE7A 4KH1A 4QHTA 5EIWA 2P68A 2F1KA 4BZXA 3VHXB 3UB3A 1QH8B 4CMCA 5J4HA 4BU0A 5AESA 1RJDA 4UPVA 2HLHA 1USIA 5I9MA 1SG9A 5JD5A 4GLOA 4D5EA 4TQGA 1N5KA 4DNOA 1FFHA 2PTHA 2P4SA 5DXJA 3IOCA 1YZQA 1YJXA 5E3IA 3TW8A 1UC9A 4OA5A 3KXIA 2IV2X 1PK7A 5LJLA 2ONZA 1ZCBA 4FC7A 1J06A 5DN9A 4NCAA 5FD8A 1R66A 2AG6A 2ONCA 1GGMA 1PJTA 1X3LA 2Z08A 4H4CA 1I2MA 3QM1A 4HHEA 4JLPA 4PYLA 2O19A 1IN1A 2QQ5A 2I7XA 2I33A 1Z08A 4KKXB 5CT5A 1GAWA 2C99A 5NULA 1RHJA 3Q6NA 1OI4A 2ZBFA 4EF6A 3AKZA 1UMDB 1XU9A 3FF1A 5HKKD 4DV4B 4MW7A 2R5WA 2C0PA 3VZBA 4TWJA 4CDNA 5HEKA 5AJHA 3WGHA 4M1MA 1J8VA 4FXOA 1LA2A 4JFRA 3O8OB 4D42A 3AV3A 5JS7A 2GLXA 3AI1A 1SHKA 3A4IA 5C7LO 4F9EA 4WBNF 1UMBB 2J3HA 4ILEA 2AVNA 2I55A 4PVCA 1WQ3A 2CSUA 2O0HA 4L2IB 2WWTA 2V7EA 4M0LA 4WLOA 1E2UA 4HNAB 2D1TA 3E84A 4F3KA 3ST7A 3MLEA 3WLHA 1SKUA 4TYQA 1YD7A 1G7SA 3BVPA 1L7NA 4PGGA 4D41A 2BEJA 2Z43A 4XRGA 4BS9A 1N8KA 2H4YA 3KQYA 1JQAA 2PK3A 4MRMA 4ABTA 2N47A 2P9EA 2GFQA 2DFVA 3CNBA 1RIFA 3EDOA 3UFBA 4DQXA 7ADHA 1FJHA 3RS9A 1HE3A 1R8YA 4GPD1 2FRVA 3GZJA 2EVWX 1DDIA 1Q21A 1RLUA 4XVQA 2ZXFA 3C45A 2CDCA 3ZLJA 1R4ZA 1KDTA 1OYOA 3UTCA 721PA 4B84A 2B8JA 3E7WA 4LNUA 4MK4A 1V4NA 3L02A 3QPWA 5JAUA 4S2UA 5L6LB 2G82A 4X24A 1XB2A 2AI2A 5FPPA 2ODPA 4HDCA 3UAGA 1GSAA 2OFXA 3FGZA 2W2QA 4L57A 4V0OA 5HX7A 2QTGA 3FRIA 3MSCA 10MHA 1JQ3A 1RRMA 5BWCA 1KMHB 1CQPA 8MHTA 2HK9A 3FROA 1GIAA 2BEWA 2PX5A 4Y18A 5CDTA 1FSFA 5A71A 1OAOA 1VG9B 4JI0B 1H8HA 3LSTA 4S2EA 1E1RA 1GPLA 4LZOA 2PGXA 3KIPA 1AK9A 1JLHA 1OTHA 5E4JA 2HO5A 4EA8A 1GL6A 4EW3A 4A8JA 3VMFA 2V98A 4Y1EA 1I2AA 2F17A 3AVQA 3UBTA 3O8QA 3K2QA 3ONDA 1NVVQ 4GZLA 4UU7A 4A6XA 2VOJA 4JUAA 5KVQA 2QVZX 2O20A 3B1WA 4HTAA 2F9FA 3GFGA 4LXIA 3RJ9A 3SXUA 3TQTA 3A1NA 4Z2AA 1VP3A 4I4LA 2JAXA 2BISA 2XUZA 4HQRA 4PZDA 3RANA 3RC2A 3P2IA 1EUDA 1WD7A 4PG4A 3WIUA 4AF8A 4ZYTA 2EX1A 3IR6A 5JAMA 2FUG1 3KE9A 3KR0A 3BT7A 2YW9A 1EE1A 2QL9A 3DLPX 3SYTA 4B7UA 3CNOA 3IUPA 3I9FA 3KXLA 3OTIA 3VTZA 4URVR 1A9YA 1E96A 4Y6OA 2OORC 1T8YA 1YXMA 4H77A 3CUTA 2QLFA 1PFQA 2WKQA 3PS9A 1T6NA 2MSEB 1A96A 4MDFA 1WVMA 1VFNA 2QVBA 4E7PA 1SC4A 4EG1A 2VJNA 1DJMA 1TKRA 4A92A 1HNXB 3GBSA 1XZIA 5I47A 4E12A 4HWTA 5CT6A 3LBNA 4C1BA 4CMHA 2GAJA 3SBOA 3L2OB 4YV1A 1UDXA 3R0XA 1UKBA 1Z88A 1M7BA 2PL9A 2PMEA 2XNDA 2G1JA 1QK4A 3ZLBA 4TL8A 4AC9A 1JPNA 1KJNA 2WUEA 2LCFA 2QTLA 3NDIA 3CW2A 1F14A 1WVGA 2J46A 3AJRA 3WAKA 2VJMB 3HCPA 1K0UA 4QDZA 4U8HA 5IC5A 3B52X 2GK3A 4Q4HA 1G6KA 2ODAA 4QICA 2JIRA 4R2HA 3EGVA 1EQUA 4MRAA 4YJGB 4NI5A 1JFSA 3CPEA 2IE8A 1M7HA 2VDKB 2SICE 2WHYA 4IH4A 2VF4X 3HJNA 4KQKA 4FT2A 4L7VA 4QU0A 5FOSA 4UCFA 1BXGB 4OIFA 1FSZA 1KZGB 3OLCX 3PNKA 5AKGA 3E7DA 4FCWA 5BSVA 1QH9A 5JAOA 3FGNA 2ZIEA 3L4EA 5EYPB 5AVJA 4A6EA 3A6LA 5E0KB 1W87A 2OAGA 3ABQB 2JGFA 3K32A 4L74A 5HKLA 3N8DA 4C3UA 3Q7RA 1M1NA 1VC2A 4O2RA 3R8XA 3PJRA 2ZAIA 4FGLA 4IDAA 1R0KA 1BXGA 2PZJA 4XWGA 2EU8A 3WWEA 5LOVF 3ZD7A 4P4SB 2IZZA 4MHOA 5LQCA 2WABA 3PPVA 4HZGA 1EWYA 1FMCA 1M2GA 2P5YA 3AI3A 4WINA 3U4HA 4R2IA 4TLCA 3IVRA 4MA0A 3UUFA 4QARA 4BE7B 4OJTA 2WIJA 1PTKA 2W2MA 2V9CA 3E0XA 3E81A 4XYLA 4C5AA 3HLTA 4BNJA 3L7MA 4WXHA 3TL6A 1QU2A 2WJIA 3LLMA 4G0MA 5ADWA 2WD8A 1ISGA 4PEVA 3V4ZA 2VKQA 3DFZA 1POWA 4BNHA 1CJSA 4PZZA 1B76A 3FB4A 2Q2NA 4H7DA 5AM5A 5E4FA 4D8WA 2CJXA 3BWVA 3R7WA 3L18A 1Z5WA 3NAGA 3S8YA 4JI5B 2BKLA 3TIIA 4D4MA 2J7PA 3WMEA 2RONA 5EG5A 1VLMA 2G9UA 1EXMA 1PNOA 2O23A 2R48A 4RA9B 4YACA 3WGGA 4UAGA 1P5ZB 3ZZNA 5JCJD 1TNDA 3F6CA 5JALA 1VPEA 1EAMA 2P9JA 3QKSB 1L4UA 2RHOA 4BB9A 4QGSA 1GG2A 1U9JA 2G80A 2ZR0A 3EXEA 5BUZA 2E85A 3MYRA 5HUJA 1AXEA 1UPXA 3G9TA 4K8RB 4M86A 2IS1A 1LH0A 1C3LA 4W4TA 1XZQA 5FUWA 2GYUA 3H9QA 4RABA 3IAHA 4MV5A 1C2TA 1FP6A 2PZLA 4DPMA 1BXRB 2H5JA 3U44B 1WW2A 5AW1A 4JENA 3WRWA 4Z9XA 3LDFA 2VAVA 1G5PA 3BAZA 1FZQA 3DBHB 2OXEA 2CFOA 2R66A 3AY0A 1Z4LA 1W35A 1V7QA 3K92A 1SXQA 4OI1A 5KU7A 3MRXA 3FCEA 1O0CA 4EGCB 4IEIA 4KN6A 1D1QA 3RVBA 3V42A 1UADA 3UMVA 2IH5A 2D8MA 3RAGA 4AMVA 4ZV4A 4UHKA 3L93A 3E0QA 4NC9A 4PZ0A 2JCVA 1GUYA 2I8CA 2JJYA 1R4NB 4JROA 4GYWA 1KZHA 2Q1XA 1BGWA 4PLTA 3R75A 3F90A 2ECOA 1C8VB 1ODKA 2IYPA 3FDIA 2NGRA 2HDHA 3NIGB 1E9VA 1QLHA 4UU8A 5FAXA 2W4IA 3FHCB 4P3OA 3SIPA 3TOZA 5MN6A 4CM4A 1YVEI 4BBZA 1OVGA 5BR8B 1QCYA 4B9AA 1X8XA 5L6MB 1DBWA 5BSMA 1B1AA 1B0PA 1WMAA 2H0QA 4GHWA 1BDMA 3TQRA 5BP7A 3B13B 1NM5C 2ZBEA 3F4LA 3L5KA 2Q6LA 3BMOA 3MWYW 1D1SA 3OCXA 4FR0A 3ZWOA 1QIKA 2G9VA 4GF5A 3T9BA 1ZCFA 3D4IA 4YRCA 5EEGA 2Y92A 3GJRA 2XGMA 3IKVA 1OUMA 2I2DA 4UNRA 3QV1A 2F62A 2EOAA 5IAGA 2CYBA 4FYIA 2PWYA 3DR5A 4DLZA 4WV3A 4RGQA 3MJ4A 5JLAA 1M75A 2GARA 5B53A 1TK3A 3MC1A 1G4HA 3DONA 2WOJA 3PIRA 4HGQA 3RS0A 2IT1A 3WE7A 4ZHQF 4ZZ3A 1LBHA 1NL3A 2IC5A 5DX8A 4YPOA 1MO5A 2ZWPA 5K8TA 1P45A 3DAOA 4LYAA 4HTFA 2OHHA 4RF3A 4D8TA 1FXWF 1XAGA 3R3JA 1EKXA 5DGDA 3AVUA 3EC7A 4WBSA 3TB4A 1GUZA 4E5NA 4GVPA 3V8VA 2H7CA 3S8EA 1S4QA 2WU1A 5KSOA 3ZVKA 4S1NA 5JH7B 2A5DA 1ISMA 3VYSB 1P7CA 3QBDA 4B7ZA 1REQA 1FW8A 3HJTA 2PUTA 3F5FA 4W7SA 4NK4A 2NQ2C 4PG6A 5C34B 3WB0A 2OC4A 2NXNA 4NJEB 1SEPA 3FTDA 2XYPA 1FUUA 3LYHA 3O90A 4QDKA 4C0SA 4D6XA 1MC1A 3OIVA 3ZW9A 2I7TA 3N6VA 3NHMA 1L5NA 3TSCA 3QVUA 2EP5A 2HV9A 3S70A 3HDHA 2POCA 1T4CB 1T8PA 5EFZA 4B6QA 4HD8A 3AUAA 4HVCA 2FZEA 4KO3S 4E1AA 1EMDA 4WHMA 4URWR 3WIDA 5BPFA 1W2HA 2XVMA 1OHHD 2NM0A 2JLVA 1VYVA 2PH5A 3B1YA 4W9NA 4ZANA 3QUAA 3MFYA 1DE0A 2QMUA 4TLDA 2V4UA 4X61A 3GPDG 5BWNA 4RKFA 2GT1A 1S02A 3A4VA 4U1RA 3AHHA 4R9UC 1A8UA 2R65A 1EE2A 2R8PA 1L4KA 2BFAA 2G5PA 4O5OA 4JS0A 4B3DA 5B4VA 1QYCA 4BJ3A 1PL7A 1YKFA 1YFKA 4JLMA 1Z22A 1S1CA 3CUVA 5SYMA 4QOIA 1G3IA 3KELA 3MMNA 4ZA2A 3E2MA 1IUPA 2OE2A 2QYHA 4ZHQB 4RORA 3H4MA 5JI2E 3GUVA 1FQJA 1Y7HA 1KO7A 1UJ6A 2W58A 3SYLA 3ZCUA 4EG8A 4BNTA 3QE4A 4HJXA 4U9UA 1WMBA 3TCNA 3WMFA 3NOXA 1X14A 1CR4A 2YJTD 1SHTX 2VPQA 3FH0A 3T5AA 1FDIA 3PHIA 1NR1A 3HFJA 4BNYA 1HWYA 4F5DA 1DWOA 2C9DA 1GGVA 1DAIA 4GP9A 3BFPA 4Z7NB 1JLLB 3V9PA 2Y3IA 4EB6A 1J09A 5TV2A 2I4NA 2WTNA 3VI3B 3TLXA 5DCWA 3B3GA 1ZU5A 1W47A 4F4CA 4BPRA 2VDMB 5I7RA 1N57A 2ZW9A 2PANA 3LD9A 2QT1A 4XCQA 1ZGCA 3PYMA 4JHLA 3DO5A 5T6MA 3RJ5A 3HADA 1MDBA 5KJ6A 3OFKA 4KDCA 3KYDA 5TS3A 1NMSA 5IK2D 3TLGA 5LKAA 4OXKA 3PC8C 2VSYA 4WFIA 4M3NA 3K9FC 4YWHA 1Q1EA 4D97A 3R6DA 1XEXA 4GP7A 3EGDB 4INOA 1H6CA 1ZD4A 2HX1A 3ZY6A 1PGPA 4HG2A 3TZKA 1ADJA 2X8AA 3VVLA 4ERXA 2H52A 1Z4QA 2HY7A 1SOAA 3LCUA 1BS1A 1N92A 4TWBA 3H05A 3VDMA 1GLVA 3TB6A 2ON6A 4KRFA 1K8QA 4UULA 3WIVA 4MJ3A 4NE2A 4MWBA 4II3A 3TDKA 2ZUVA 4LAFA 4KWEA 4N40A 1J7KA 4FN4A 2REQB 3DP7A 4HATA 3GU3A 3QUSA 2PBZA 2NYUA 3UOAB 1KZ4A 1NUHA 1P4SA 3LNCA 3NUGA 4CFYA 1WTAA 2IX3A 3B7GA 3ONNA 2JGLA 1SIOA 1C9EA 1J0AA 2CXOA 1N6LA 3ND7A 4U7FA 2AB0A 4DT1A 4NG5A 2X8JB 2Y2UA 2XITA 4MUEA 5JMTA 4YDSA 4D9FA 4EG6A 2QS9A 5KOJB 4N76A 1GTRA 1PVDA 3UTDA 4G24A 1DC7A 1Z0UA 3T5PA 3G89A 4O4LF 4E2FA 4URFA 4B6SA 1ZXXA 2AVDA 4BCBA 2D0DA 4YUYA 4ZCIA 3IA7A 3UWSA 3UUGA 3JR3A 3JYQA 1V9CA 4YYEA 5GPBA 3RUAA 3TQFA 1SQFA 1A8QA 1JNXX 4O59O 2VJCA 3SKYA 3WLOA 1K1EA 3A2NA 4OHFA 2VWGA 3DCYA 1N5JA 1X38A 3OZTA 1R6VA 3OM9A 3ZV7A 2HL6A 4N6NA 4AJJA 1MB2A 3D3EA 1KGDA 1F3OA 1WEHA 2XUHA 3HN6A 3OC0A 1U8FO 2Q1TA 2XGOA 4KLAA 2EX4A 4Q47A 1EVYA 3LLCA 2ZB2A 5AVUA 1ENOA 3OEEA 4BO3A 2F55A 1MA0A 1VIAA 3EPRA 1N6PA 4PLWA 5EIHA 2GAIA 5C53B 2HWYA 4RIEA 3DVRX 1BIFA 1NR7A 2B69A 3A2LA 4PZCA 1QFXA 4YRZA 3ESRA 4OGGA 3LQKA 3R1IA 4QXMA 1VLLA 1J22A 4PG7A 1H9AA 3GPIA 2I6TA 3DZDA 4QDXA 1CTQA 3IIIA 4PG8A 4J6FA 3KP1A 2WIBA 2R1VA 3T1QA 1T6BY 3TIGA 3UW1A 1A5ZA 1PZEA 1SKAA 2LR0A 2A30A 1U3DA 2GCNA 4D80A 2RHGB 4CF7A 3E3NA 1EFRD 4M98A 3DFMA 3FLMA 4JZKA 4D8XA 2J3EA 5FYQA 1LTHR 3GLIE 2B98A 3LW7A 2Q8QA 3DV2A 3IBCA 1ZNXA 3UKDA 4LIPD 3TTUA 3ILXA 4P92A 3GDGA 3HB5X 3Q3VA 4PAOA 3VFDA 4A8HA 4Z53A 4IIUA 3R9WA 2X15A 4KX5A 2HDOA 1AY0A 1P2VA 3FDZA 4H0NA 4ACAA 2PJDA 4RZ2A 5E6UB 2UVDA 2VCYA 4C89A 3ZWNA 3GRZA 3I6MA 3L9XA 4YMLA 1XRQA 1C30A 1QOZA 4LOIA 3EIFA 2WJJA 3WX0A 3FPSA 4D25A 1LVUA 2FK7A 1VQ1A 4LWZA 5AW0A 2JCBA 2WVJA 3E22B 4XD2A 4MVJM 3E82A 1R16A 3GAAA 2DLDA 3N2LA 4P4NA 5FWXB 2PKCA 3WMRA 4ITVA 3SU8A 3UBMA 4JEMA 2F6RA 1EIZA 4A2CA 4X6LA 4QELA 4MUMA 2JGEA 4YNBA 1RZVA 2VA9A 5ER9A 2PMKA 3HDTA 3INRA 4EG5A 3W6PA 3TM4A 1TO1E 3V7FA 4F6RA 2ZB8A 1QQ6A 1JEOA 3GAZA 1UBCA 3GJSA 3TG8A 5LLDA 3KDSE 2OXTA 1A4XA 1UZUA 2KBEA 2I5PO 1K7YA 1BEZA 3CJRA 3V1NA 5B2ZA 3VU9A 5D2CA 4FP9A 3DDCA 3AUKA 1YBMA 1CY4A 3QPVA 5G3ZA 2CDBA 3K72B 1SULA 1EP9A 3SX4A 3EEYA 2IHKA 5C31A 2QRJA 1R4AA 5DNUA 3GOQA 2Z58A 1FX0B 3PEUA 3DC7A 4Z8YA 5EERA 3VR3D 1DT3A 1NR5A 3EA0A 3OIYA 3ITDA 4B75A 4C4YA 4TKVB 3ZW7A 4GZ6A 3LX6A 1NAIA 4BB5A 4E6PA 3OPNA 2ZJ1A 3QWHA 1I2BA 4LVUA 4PN7A 1QGED 3X1YA 4AL4A 2B5WA 4PIMA 1TYAE 4YT5A 5AKKA 5I51A 1N25A 1QB7A 2VAPA 3HSKA 3MTIA 4NBTA 4IGEA 4E5UA 2AQKA 2TRSB 5BW6B 3UK6A 2RGRA 1G38A 4R2MA 5DXAA 4C9BA 2EGUA 2VTEA 3NAZA 3O74A 1L5OA 3I39X 3PUYA 2QNIA 3SHOA 4F11A 1Y98A 2ZCUA 2H29A 3B89A 5EHZA 3D43A 4DSUA 3CPSA 3D3NA 3F6EX 2WUVA 2ZI5A 3OIUA 4LNHA 5JQWA 1PNVA 4JXJA 5HBGA 2GNAA 5FKJA 1DPFA 3KSMA 2MSCB 4Y2PA 3ELUA 2X14A 5J47A 3SEZA 1P0FA 4H60A 1I10A 1X2BA 3H0KA 2WW8A 3PDIB 3SQMA 3WWYA 5CD9A 3OX3A 1MO4A 2OXFA 1I4EB 2Y1EA 2OCBA 5ICFA 1R37A 1U2DA 1TC1A 1M6VA 4TGLA 5CYFA 2KPOA 4F45A 1AF7A 2B61A 3ORHA 4NHEA 3BMQA 4JBWA 1SB8A 3PKZA 1L7VC 1SKYE 1NULA 4XIYA 2WJWA 2EKLA 5DB4A 3OQIA 5I4BA 2I4MA 5BUSA 3A3PA 2NN3C 2C29D 3B53X 2ENUA 2HJSA 2RGXA 1TJ5A 2W90A 4EUEA 1CUWA 2SCUB 1M2FA 1VJRA 4M9CA 2PJZA 1JU4A 3GNLA 2H8KA 1IONA 1WXXA 4POAA 3V7YA 3WNCA 5AI8A 5BRAA 2JCGA 1EX9A 1W19A 2C84A 4MV1A 2P27A 1NN0A 3PWTA 1KI6A 2CMDA 1OY1A 5AM4A 5C3UA 3TNLA 2DT5A 3S28A 1C4KA 1K5HA 3NEPX 3N8GA 2VSFA 3ZY4A 4AN1A 1EFAA 3V3KA 5ITZB 3NI2A 2ZJ8A 1W7AA 3FHOA 1JGTA 1P5JA 3HXTA 4UBOA 3T9AA 4YRGA 1AUPA 2B9EA 3J81k 2QRGA 2C98A 4CWAA 4F4JA 3FPBA 2XMBA 3RUDA 5LQAA 4EKYA 3N0XA 5CDHA 1FDRA 4QTXA 1OYYA 2Q3LA 3ETDA 4I1UA 2HQBA 2XECA 4MWDA 3V32A 1SBYA 5D7NA 6GPBA 4KITB 3B1ZA 2F8SA 4YJ3A 4PFSA 4GDFA 3PKIA 2ODWA 1UINA 2I3BA 3A1VA 3F5QA 4MIKA 3Q8WA 2H4XA 2BT4A 3LK6A 1ZSNA 4MINA 1GN8A 1RLMA 2W2PA 1UOEA 4UXJA 1T36B 3KO8A 1G17A 1JZQA 3UGTA 3AZQA 4CKEB 3AUJB 2I6GA 4GIBA 2GNPA 4TV8F 3VUFA 1HDEA 4B5LA 2H9IA 1A0OA 1GQFA 1S96A 2ATIA 4J7UA 1M66A 1XDGA 3BQNB 4LHZA 3LDUA 2FKAA 1FS5A 2X2PA 4BMPB 3KJNA 1UWVA 3KUCA 3L43A 3GBVA 2I87A 1NV8A 2X4IA 3UXYA 2G1AA 3H7AA 2VHZA 2VIIA 4Y2YA 2CNBA 2BGNA 3AB7A 4G3XA 4G4GA 3W90A 1BCRB 3T99A 3UK2A 2XA1A 2YHAA 3P0EA 1M54A 2WIDA 5KAMA 1HM5A 5C1IA 3GVXA 3OE7D 4HYTA 1QE0A 4BC0A 3CKMA 3QZUA 3RBXA 2CFRA 3NHRA 2EEPA 3PRYA 3ZE6A 4BHTA 4EL0A 3K8QA 2F9LA 3ICQB 4GR5A 3DGEC 1F0YA 1K06A 3T12A 1GQQA 5KX5B 2IYLD 4ZZIA 1R6XA 1D09A 1OW3B 2V7PA 3MGKA 3F46A 3SZOA 4REMA 3NJ8A 4AMUA 3NXSA 3A3KA 4FYKA 4Y2VA 2GBLC 2MJLA 4FW9A 4FB5A 3GZTB 3GEDA 4E30A 4OFWA 5CEEA 5LMCA 4AS3A 1U0TA 1TW2A 4M83A 1TM3E 1WXEA 3QU5A 4GP6A 5EHNA 3EQ9A 1YZKA 2HA5A 2A0YA 3MRTA 4Q16A 5KC9A 4LRUA 1PJ2A 1VRCA 3E05A 2GCPA 3UMBA 4F72A 4EY4A 2BVNA 4CM9A 5HRAA 5CD1A 2ONKA 3PQDA 3DVSX 4EOGA 3ZDYB 1GOTA 4OHPA 1AD2A 5GP1A 1WU7A 4PO8A 3I1FA 3VJKA 4DNPA 4B3MB 1L7QA 3CR7A 4CEIA 1YFLA 1AGPA 3PR2B 3DVAA 5DEIA 3Q0IA 2QTFA 1HE1C 3KKOA 5IBCA 4N41A 2GBFA 2BAGA 5GONA 4TXHA 1CNEA 3EFOB 5ILOA 4EY3A 1DJQA 3JQBA 4AJNA 2DHQA 4BNKA 2QX8A 4AP9A 2O5VA 2PT7A 3AEQB 1LJLA 1X0XA 2B92A 4WWHA 1YB2A 1TMGE 2HHLA 2L82A 2ZRPA 2NO7A 2HA2A 3PPWA 2TMYA 1UDAA 3MGCA 4OMFG 4QVKA 5K09A 4F2GA 4YJFB 5BSFA 2KQUA 1Q77A 3PJFA 2Y0PA 1SC1A 4HNRA 5JE8A 3CVYA 1MHTA 3K2EA 1E2HA 1CP2A 1E3WA 1GCAA 3C5HA 3OPYI 2ZRAA 3G17A 2FPIB 1TECE 1TKCA 1A2BA 2WFLA 3GYBA 1T6XA 3KT0A 1HEUA 2QUJA 1PYGA 2PZKA 3VOSA 2JLZA 1DINA 2AFHB 3QKUA 4FONA 5CA1A 3K70D 1GQYA 1EBBA 1EVIA 3T3NA 3K73O 3QX3A 3OP1A 3DEHA 3LC7O 2OO7A 4KVFA 2PSDA 4Y6RA 4ZT3A 4GO1A 3QMMA 4L02A 4YJHA 3ROKA 3W8FA 4ISBA 4LMPA 4UBMA 4I6EA 2EFEB 3EH2A 1IM8A 2P7HA 5DBOA 4ED9A 4O02B 5J2UB 5JSKA 4FSXA 3EUAA 2Z2ZA 1JR3A 1CJBA 3KBBA 3MUFA 3VNQA 3BHMA 3L1UA 3H8VA 2Q07A 2ZTLA 4KB5A 2AFVA 4KXLA 2W6JD 3KAKA 2DQKA 3I2YX 3N2EA 5IU6A 2YC4C 4K9KA 1C3JA 3CZ5A 5IPFA 4EYQA 5K45A 2IU3A 2O2YA 3AP1A 2C5GA 4HFJA 4MKHA 2FFJA 3L6CA 3UJ7A 4B74A 4YRBA 4ZYLA 1ECLA 1L9XA 2AIRA 3GOHA 4K03A 1DJOA 3IAM1 4F38A 3F6YA 3HVUA 2BFEA 4DAOA 1PV1A 4KVAA 3DEAA 1VKNA 2IEDA 4N12A 4LDNA 3M70A 2J6HA 3O8BA 5CA1F 4C2BA 5DOZA 4HAIA 4DREA 1XGKA 3LT0A 2ASVA 5CT8A 5G4KB 5CYGA 1V11A 4C0JA 2H1VA 4CKXA 1XMIA 3W5SA 2OHXA 3NBUA 1E20A 4FCCA 1UXGA 2Q0XA 3IOEA 4MAAA 3LBHA 4AXBA 1A2QA 3EXEB 4XSVA 1T0JB 4HFMA 1KTVA 5CLGA 2XADA 3UF0A 3ONFA 4XWYA 4NQRA 5FT9A 3O7MA 2XRMA 1A9ZA 3M4JA 1ABFA 1TZCA 2CXUA 4BV9A 5FQOA 1BS2A 1E3DA 1U0FA 4KU4A 4B6JA 3ISVA 3RYHA 1LD3A 2YINC 3V1TC 4RTLA 4OFBA 2Q3EA 3CGWA 1UWCA 3F3KA 5FAKA 2DETA 4I9UA 3FTPA 4KNWA 3RAJA 2IZ0A 3VHQA 3LY5A 2NT3A 3O8LA 2IWRA 3NDBB 2QVYX 4XIGS 2ZIUB 3GPLA 1ZD9A 3OETA 4EATA 3IVAA 4B3CA 1I1OA 4C6SA 1NVFA 5D6OA 4YRTA 3IE2A 3UPTA 3ZZTA 2FK8A 5EWLA 4NMXB 5EP4A 3UCFA 2RD2A 2DSNA 1SC6A 4TTPA 3ZEIA 1ST2A 3FMVA 2A1TS 4Z54A 5KNBA 1YRQA 3CUSA 2PE5A 1P3JA 3M5WA 4NU8X 3VSEA 3UMJA 1KOFA 4JODA 4BFSA 4DLNA 1KKMA 1QHSA 1JHAA 1Y8QB 1J39A 3N39C 1M34A 3N74A 4HWKA 4JT2A 4QGBA 3PA6A 2PEZA 3FM9A 5F77A 3MIIA 4HMPA 4QNNA 4YDHB 4YMHA 4YT8A 1GPUA 3RIEA 2JLSA 3PXBA 1VBKA 3T7IA 2Y66A 3EQ7A 3EIXA 3L6UA 1PWEA 4LJ4A 3H5AA 2BGGA 1JH8A 3I52A 3LLSA 3ZE9A 2HRQA 2IPNA 2OAEA 1ZVJA 4XWAA 1PZHA 3BRWA 4AMGA 1K4KA 4I3HA 2ZRFA 5IT9A 4EMBA 4M1EA 4HPXB 4GXRA 1NLUA 2ILTA 2NZYA 3W2IA 3B1XA 4H3HB 3T5CA 4HUQA 4UVIA 3RFTA 4KR3A 1KVTA 3CLRC 5AW2A 4S1PA 4BVHA 2ZANA 1P5HA 5G2OA 3GP5A 3IEKA 2VHTA 4H6WA 4JJEA 1JJVA 4JWTA 2WVHA 5F7ZA 5IJZA 4BGDA 4NBNA 5EWMA 4G86A 1H65A 3GK3A 4RXMA 3LPCA 4UBNA 4GVLA 4YRJA 2AKEA 5FBKA 1RVV1 1DXOA 1T0HB 2CK3D 2P2SA 3EFBA 4Q6WA 3FWNA 3FPAA 1C9MA 4F3YA 4KYUA 4WOKA 3RC1A 2OLJA 2PXXA 5F2KA 3JQ8B 1A5BB 2GF9A 3H2BA 4L9WA 1DXHA 1RYBA 3AF4A 3L7LA 1SZDA 2VPPA 4IXTA 5ALJA 3MT9A 5FBRB 3Q7QA 4DRZA 2CLIB 4ZKDA 4YJFA 2AX3A 4AIIA 5KOIA 3GNQA 2WT9A 5JANA 2XTJA 1J9GA 3N28A 4XQ9A 4ZAYA 5G41A 3ZU3A 1FCJA 2OQVA 4PXAA 5C5CA 2JRCA 4OP1A 4ZOQI 1IJBA 1RWQA 2ZJ4A 4XE5A 1P0IA 2VYVA 3ZCRA 2ACKA 1P2DA 2Z5VA 3DD1A 1E89A 1MAUA 4IZIA 1LSOA 3Q11A 4WLFA 1WU8A 4H08A 4YP5A 3HBJA 3M49A 3MA0A 4UASA 4R1UA 4YVFA 1ZC4A 1V0JA 3U7QA 4AJHA 4B4UA 3ZV5A 1W0KD 1Y3DE 1WQ4A 2A5JA 2PRIA 2Y1CA 3WBKA 1BGVA 1ZJYA 2IEAA 2FUG6 1TVMA 5TPZA 2X4GA 3RAPR 2Z6UA 1ATIA 3LDHA 2H1LA 1MUUA 4R7TA 4X1KB 3I6IA 2FCAA 4YUZA 5AR1A 4G63A 3FKSD 3N58A 2ZSKA 3UHAA 4D44A 3BH0A 2CJWA 4GEKA 5JTTA 3HCOA 4BIIA 2F00A 1QP4A 3N3AC 1NMXA 3VNBA 1WABA 2GHQA 2IYUA 5KYUB 3H1GA 3G82C 4XARA 4AXXA 2JD0A 1DX4A 3HWWA 4O2BB 1J7JA 2IYXA 2BCEA 2RKWA 3GEGA 4QHSA 4FUQA 3JD1A 3EUEA 3QMVA 1DTSA 2DC1A 5COQA 4D79A 1WP4A 3DW1X 4WSOA 1K63A 3LM8A 2R8YA 2VSNA 2A0FA 4FX5A 4PW0A 4X71A 4YH1A 4HNTA 3EN0A 1JR3D 4ZU3A 2H2IA 2FR0A 3H0CA 2BBOA 1ZFNA 3UAZA 1DAKA 1E1CA 2H1IA 3H5OA 1A71A 1PTJA 1M0TA 3OKCA 4PC7A 4ZP1A 5TVGA 4F56A 5LQDA 1QIGA 4G5OA 2X0FA 4LF9B 1LTKA 4L72A 1HTTA 3M1YA 4NMWA 1M2WA 4RCYA 5EY5B 3QKIA 4ZI5A 2PQMA 1KXJA 2WJZB 4WFKA 1KEEA 3CZRA 1D6JA 2JGRA 5EE5B 4ZICA 3KQNA 1N1DA 2IS6A 4WA8A 2EIXA 4LWPA 4JKIA 5H70A 3PC2A 1YJQA 2VAXA 1DKPA 4LWQA 4QEZA 3WK4A 4L08A 3W04A 3FPHA 2O7RA 3VTKA 1JKMA 4MUJA 3CZCA 2COKA 4K6KA 1XROA 3BKWA 3HFSA 4R1MA 5CB0A 1W2GA 3ECAA 3R0JA 1J0XO 1Z6GA 3UW3A 5FTLA 5KEIA 1QV7A 1SOWA 4JC4A 1S0UA 2PLFA 2PL5A 3A9WA 4N9WA 5IUNC 2B8TA 1KI3A 4QUDA 3MWJA 1E1QD 1U31A 2VRWA 2QUKA 3FTNA 4N7MA 5EMNA 1TYCA 3DOIA 7ABPA 1VG8A 2PZEA 4N5MA 4LY9A 1UFQA 2JIDA 3KSUA 3N8HA 4PZUA 2BFDA 3OZBA 4QYMA 3UJ3X 3KB6A 1K6XA 1VCMA 3FUVA 3N3BC 4A1OA 4DIEA 4JB2A 5ERYA 4WASA 3ORRA 2HA7A 3I30X 1MVLA 3O21A 2FEPA 3AR7A 4TN5A 3HN7A 3TR5A 2TS1A 3R5HA 3SXPA 2IXAA 4V0NA 5H16A 1I01A 2O9JA 5D6NA 1A9SA 3AJDA 2QAGA 5HM6A 3ODPA 2VSQA 4UZFA 4LOAA 3STUA 3HKEA 3BE4A 2GZDA 4YN3A 1TQDA 1JG7A 5EJ5A 2I34A 2AHOA 2Y67A 3AEXA 3ONWA 3IT0A 1NMQA 2WU4A 2WRZA 2A9OA 4URYR 4RF5A 5EC8A 3AG6A 1O8CA 2GLTA 5A06A 3A31A 3DBVO 1XNJA 4FNAA 2CB9A 2P6MA 2O2EA 1NVBA 4QQ8A 3R74A 1KQOA 2O6LA 3PWZA 1T5IA 4HVTA 1XLTC 3OX2A 2Y77A 3GMDA 4D3DA 1Z83A 1P9NA 3GRKA 2C77A 1L5KA 1XAHA 1K8ZB 1MJNA 3EUFA 1EK2A 6NULA 5IJ0A 4IX9A 2WNIA 5I8ZA 4EG7A 3R5FA 3MTDA 2YIJA 3BCSA 4XI9A 4B17A 3NP7A 2WSSA 3U4GA 5K4HA 4MB0A 5K8IA 3S2SA 1NBEA 4D3YA 4BQPA 3DT9A 4LHYA 2COEA 2E4XA 4X64B 3ZD9A 2UYCA 3AHDA 3NRCA 5H59A 1SUPA 2XNJA 1NG9A 1E6UA 4NZMA 2FPXA 3AF1A 1TCAA 4XYMA 2WP0A 4BRWA 2LV8A 2IV7A 1BA2A 2V6MA 3ER9A 1AZLA 5EJEA 5E7QA 3L77A 3TNDA 1ADYA 5AOBA 4H7JA 4C0XA 1QIJA 1KVQA 4OKNA 4CCWA 3AKEA 4EBBA 3ERCA 3OKFA 4KNVA 1PW5A 2DX7A 3RVOA 3KJFA 4HQOA 4D26A 1L7XA 2G4VA 1U6JA 1Z56C 3G2OA 3HKCA 4LOJA 4WZBA 2FZKA 5F21A 4EY8A 1ZVVA 1KJZA 1OFIA 1O6ZA 1JJFA 2AYXA 1TTQB 2RB4A 4I3FA 4W6ZA 2HHAA 4AJ2A 4F2DA 5DNCA 5L4NA 3R2JA 2RAVA 3DBHA 2NQ8A 3ND5A 4JH0A 1H2WA 2DSTA 3UJ9A 3HNPA 2NSHA 4P3XA 3GJYA 4GM0A 3BRCA 1NVEA 1JV2B 3NVDA 5F9FA 4YIHA 3G2NA 3WL3A 4FGSA 2WTAA 2F90A 3CFYA 1W581 1U2ZA 2EBFX 1IJFA 1MEOA 1BH2A 1MG0A 1SXGA 2HREA 4I14A 3EB9A 3VHRA 1OOEA 3PT9A 3TRKA 1MJFA 2HFJA 3REQA 2X0IA 1JR3E 3S2EA 3QWFA 1YCHA 1A8HA 5IANA 3URMA 3QE2A 1BHQ1 4MYHA 1XDWA 2LE0A 4NZNA 2A14A 2PXHA 3I01M 4OI0A 1KEUA 2HV8A 1SVMA 1NLMA 3U3JA 2C3UA 1FRFS 2E87A 3IOMA 3TTXA 1WKVA 3I45A 1ZVKA 1B6RA 3C3CA 4EL5A 5TSDA 3T4PA 2C95A 4COKA 2PWZA 3CB2A 1OYWA 3RWBA 3THXA 1JFLA 4YC7A 1CX9B 1ZW6A 1HYBA 2D1SA 2D5AA 3CWZA 3LUPA 4HAVA 4IW3B 4BQRA 4CIWA 3WMGA 2OESA 2HA0A 2ZDGA 3HBLA 5DP2A 5IJWA 1XOIA 3C16C 3FOEC 2W70A 4OH7A 4IJQA 3AFHA 4WRRA 4UFPA 5FWYB 1PR4A 2I78A 4GBGA 3E5RA 5CH8A 3RVNA 3EGDA 3D2AA 4WMLA 2CBZA 2ZAYA 1IQRA 4IZHA 2NUBA 3G5LA 1OI3A 3ASUA 4QREA 4X93A 3G0BA 2W2KB 2OBMA 3ZZUA 2ZYHA 3V80A 2J6BA 4M9SA 5F5NA 3VO1A 4ZO4A 4AG6A 1D2CA 5IXYA 1NFRA 2HF8A 2H92A 2YHIB 4JIMA 3UPDA 4PLFA 3HJHA 3CISA 3D3WB 5SYAA 1GGKA 3GMSA 3AF6A 2YJZA 1KAHA 2AS0A 4JITA 1U2SA 1ZKMA 5BQXA 1S5PA 3ZY5A 1F9EA 1ESCA 1JVBA 5JXGA 2J7KA 2IBTA 1OJLA 3QH4A 3ZNOA 1NONA 3TLMA 5KHAA 1MR3F 1NC3A 1ZK0A 3OZCA 2GN0A 3CRW1 3WS7A 1R0ZA 2PQ0A 4IINA 4J0GA 1IAQA 3SLGA 1OWNA 2GZAA 3PQ8A 3C6ZA 1I2CA 4JA0A 3WLEA 1AH2A 1O94D 4K88A 1EGMB 1DZIA 1KY4A 4M1KA 3QHQA 4CKBA 2E6UX 3NUQA 3CURA 5IW8A 1SUEA 1XN4A 3ILHA 1B6SA 1U1EA 1JPVA 1ZR2A 1N9GB 4DMFA 4EECA 2CHVA 3H2HA 3Q8LA 4G25A 3M6IA 1CIVA 2P1DA 5B7QA 1PWYE 3L4KA 4QFBA 4BASA 1XXHB 2Q3MA 3ADOA 3LIIA 3UYLA 2Q3HA 3MILA 2HBQA 2OLKA 3ADBA 4RYLA 4B2IA 3HCBA 3QI7A 2EL9A 2QR5A 1PFKA 1THMA 3QVMA 4LZPA 4XQ0A 3TTYA 1I0LA 5KYXB 3R8FA 1L4GA 4KNYA 1E1DA 2OZLB 1AOXA 1P9RA 4D98A 4AKHA 2C8JA 2CFSA 1O95C 3WIEA 1XNQB 5KNCH 1N5RA 1W88B 3SKXA 1L5SA 3A3NA 3I34X 3HL0A 1VIMA 1NQWA 5EVJA 3WGIA 5F78A 1KMQA 3OP4A 3AIOA 4K0RA 4KQXA 4KC0A 1DMSA 1HORA 1D2MA 1T5BA 5J4KA 1V6SA 3LCJA 3ROTA 5LP1A 3DBLA 4ZIRA 4HQ6A 3MTAA 3TX6A 5ITSA 3U19A 2O54A 4TSFA 1XT6A 2AJLI 2M2IA 4W9MC 4OGKA 1QG2A 4Y0AA 1XPJA 5K5EA 1YO6A 4YAKA 3UQZA 2PKWA 3FMIA 2ZTSA 3TRDA 3K09A 4GFDA 1Y8RA 3BB4A 4LXGA 3MMSA 5CLIA 2PM8A 4YRLA 4KO1S 4IIXA 5ERXA 1KJQA 1PWXA 3MINA 2NTNA 4P86A 1WTCA 2EYQA 3ACDA 1RM3A 4ZXPA 2XMRA 4TL7A 5EZQA 1BCRA 5K03A 1YE5A 1AKTA 1GRNA 4J0KA 4DHEA 1JYFA 2ANCA 4BUJA 1PV2A 2QENA 2BBSA 4EUKA 2M1XA 5AJYA 2PYZA 5A2QA 5CA0A 1DARA 4CJXA 2AZMA 2H6EA 3DVQX 2QQ0A 1WG8A 2BFBA 5AJVB 2ZPAA 1X6VA 4YMSA 1IEWA 3K2BA 1GG5A 4UVDA 2C8KA 1V6CA 4L8YA 4KUHA 1FXSA 5LMZA 3HRKA 3NV7A 3U7HB 4MROA 4BTLA 4EJFA 4DR4B 1M2KA 4XYEA 5JO9A 3C74A 2YN0A 2QRMA 1MKYA 1L4EA 1Q95A 4FWTA 1Z35A 3UV3A 2VP9A 1VTKA 2JASA 3LHIA 1T9AA 5ESWA 1AK2A 3T5DA 3W78A 5I01A 2Q1SA 1VBMA 2ZTHA 3UUWA 4F97A 1G7CA 4XEUA 4KE8A 1SH7A 5T4EA 2YZMA 1Y3HA 5KTMA 1HBJA 1QQTA 1Y3AA 2F59A 3NHYA 3TBKA 3ZIDA 2D5BA 4BMNA 3QU2A 1TT5B 3C14C 3QVTA 4U0JA 5ITWA 4O4JB 1R74A 3FYHA 3GMTA 3SAJA 2E4ZA 4QOGA 4XDYA 3EXHA 3KOMA 2DHDA 3GEPA 3LU1A 1E3SA 1PHPA 1SXJC 3ME5A 4NCNA 3ZJYA 4QLBA 5CFNA 5CHYA 1WZIA 3FUUA 5HF5A 1HLDA 1P1BA 5AIBA 1X9IA 2ZRDA 3Q6IA 1E4VA 2GPBA 4W8OA 4DL9A 5KTOA 4DRXB 4UNSA 4GI1A 1YJAA 3KALA 3K20A 1W6UA 4MJLA 5HKBA 2C5FA 2H4HA 1WCIA 2CWDA 5D8DA 4CBVA 5J43A 2CDAA 3EZ9A 3Q0EA 1FTNA 3ISTA 2I3AA 3E9RA 1SG0A 3ZY2A 2UXDB 3MWFA 3HKDA 3UC5A 1XYVA 1G8SA 5DTQA 2ZROA 3BFXA 3TLEA 3BSYA 1NKTA 1MAWA 5EAIA 3VNAA 2G9RA 1CJKC 2AHRA 1P0CA 1Z39A 3DEJA 2PBFA 1YQEA 3QQ5A 4XJTA 2NO4A 3S40A 2BZGA 2PVSA 2EBUA 3TW8B 3R3UA 5TGTA 2WQ6A 2PT9A 2OV2A 5DEOA 1U8YA 1SHLA 2R4QA 1FP7A 2AF3C 2QMYA 3FDXA 3AM3A 3IO5A 4L28A 4A0FA 4EHBA 1E3JA 3V1LA 4OU5A 1QX4A 1XP8A 1VDZA 5TVKA 5LU9A 1UF9A 4IVRA 1DSSG 1WDTA 1RXVA 1KR2A 2BKUA 1EWVA 3JALB 4DLUA 3TSAA 3WYFA 2GH1A 1I4OA 1PK9A 5JHGB 1LQ2A 4DMGA 1OFVA 4FFLA 9GPBA 2DEUA 1PR0A 3I9V6 4ZDJA 4IM7A 1FYXA 3MBIA 1YNSA 2BFFA 2W98A 4HAWA 3INTA 4HGRA 4K9SA 4L5JA 5EP2A 5ILQA 5K0LA 1OAOC 1M1YA 2AE2A 2O4UX 1MP0A 1OGYA 4HS4A 1ECFA 2BFBB 3G8CA 3LC1O 1YHZA 2V6FA 1M2HA 2FQWA 4PC6A 4H16A 4WESA 4G5FA 1P1IA 2H3HA 2WJ3A 5KTRA 2Q28A 3GYGA 4HQNA 3RTAA 1IXKA 4OB8A 5HE8A 3UMRA 2ZWMA 3AINA 4EMTA 2I62A 3LIPA 2CMFA 2A8YA 2E5LB 1ST3A 2V58A 1NPTO 3AM5A 5CDFE 1ZKDA 5FHRA 1ETUA 3Q0TA 4BX8A 4CF4A 1XTJA 4UMFA 1DDGA 1OFUX 3UMMA 2XYVA 3PT5A 1ZGAA 1QG0A 1DRWA 1OZGA 1NA5A 2WYWA 4YRPA 1KSJA 4GX2A 1DKUA 2CXXA 3IPRA 5C3MA 3ICPA 3NIDB 1PSZA 3MAGA 5I7SA 3G13A 1LS6A 4LE0A 1V5GA 4RIHA 1ECJA 4YV0A 3U4IA 3USES 1E3QA 4JKOA 4Y6SA 4C76A 4RVUA 4NV1A 4FHFA 4EMSA 3HNOA 1T4BA 4O4HF 2P2ZA 3WRYA 1I3CA 1W94A 4Y1FA 1Z06A 2D4HA 5FBQB 1SZPA 5CCXA 4QDTA 5G0VA 4AW9A 1LRJA 2DM6A 1BMTA 2AI1A 4YFVA 3LXXA 4GR4A 3VPAA 3QA9A 2W5UA 2MOKA 3F97A 1JB9A 6CHYA 3QWBA 1GNQA 1XVTA 3QSGA 2GESA 1KAOA 2XOXA 4JU8A 3QFHA 4QBTA 2H3EA 2W4MA 2W00A 1KC3A 1UKAA 2WM2A 4HFNA 4OA8A 3WISA 3NHAA 3KL2A 2ZJ0A 3BEOA 2UV8A 5CJJA 2CB0A 5CT4A 1Q5PA 4AQ7A 1MEEA 4B43A 1W0KA 1EDZA 4CT5A 2JVKA 1BQ3A 1XA4A 2IOYA 4LISA 3WDSA 1PLJA 5ABPA 5HQTA 2I1QA 1U99A 3DKRA 3RG2A 3FDJA 1OLUA 4U39A 3ZXXA 2X9QA 3ZKWB 3H18A 1QYVA 3PGA1 1H3FA 5BQFA 3HCAA 1KFKB 4QUKA 5LCXA 3OT1A 4X9XA 3PQ2A 4D4GA 1J0CA 4O2AB 1MX5A 2FPGB 1K98A 3TKYA 3HI4A 4XGNA 3BMOB 2M9MA 1HRKA 2BHRA 2WUGA 3CLUD 1GGHA 1LLCA 1E4EA 5KCMA 4BMSA 4ZAZA 3K9HA 3ESYA 3CLVA 1YZGA 2C20A 2A1TR 2HWWA 2AOVA 2PKQP 1P19A 4P3NA 5EP1A 4NYIR 2WV7A 1WMFA 5A4MS 3UT5A 2OHGA 2XQIA 4TS1A 4KGZA 1NNLA 3UHFA 5LKRA 1S9DA 1SVKA 3AR6A 5A5GA 2E55A 1RACA 4QT0A 1O5IA 1Z7YA 2WWXA 5SZIA 3YASA 4W5HA 4NPCA 3SDBA 1YRWA 2MYTA 13PKA 1E9AA 2NVUA 2UYOA 3D2BA 5HS6A