1VIVA

Crystal structure of a hypothetical protein
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
184
structure length
184
Chain Sequence
b'LKTTEYVAEILNELHNSAAYISNEEADQLADHILSSHQIFTAGAGRSGLMAKSFAMRLMHMGFNAHIVGEILTPPLAEGDLVIIGSGSGETKSLIHTAAKAKSLHGIVAALTINPESSIGKQADLIIRMPGSPKDQSNGSYKTIQPMGSLFEQTLLLFYDAVILKLMEKKGLDSETMFTHHANL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein yckF
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 64
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature ec 5.3.1.27: 6-phospho-3-hexuloisomerase.
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01380 SIS SIS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 1vivA00
4DR1B 4JI1B 4YY3B 2CXUA 1MOSA 5LMUB 5LL6P 1B0ZA 4DV2B 4NXNB 2UU9B 4YHHB 3QKIA 4DV7B 1N8TA 4LF6B 3G68A 4JI0B 2I2WA 3ODPA 3FKJA 3T1HB 4AMVA 4AQYB 1M3SA 4X66B 1XMQB 2DF8A 3FXAA 2CXQA 1X94A 1J5XA 2E5LB 2O2DA 3JAMA 1G98A 2O2CA 3KNZA 1VI5A 4LFAB 2I22A 1N32B 1JIQA 4JI3B 4KHPB 4X65B 2Q8NA 1C7QA 1U0GA 2UUCB 4DV0B 3BJZA 1TK9A 4JI2B 4B3MB 4DV3B 4DR3B 2AMLA 4IVNA 2POCA 2UXBB 2CXPA 4DR2B 1IBMB 4B3SB 1DQRA 1HNXB 1C7RA 4S1WA 2UXDB 4DR4B 1HNZB 1JLHA 1HR0B 4JI8B 4LF7B 2V4MA 2HHHB 5FLXA 1MOQA 2UUAB 3I0ZA 1IRIA 1N36B 2ZJ4A 3FJ1A 4JI4B 5A2QA 4B3RB 2CXTA 1FJGB 2CXNA 4JI5B 1N34B 1VIMA 3IFSA 1U0EA 1NRIA 2PUWA 4EM6A 2X3YA 4DV4B 3BCHA 4NXMB 1XTBA 1TZBA 2VQFB 5IWAB 2VF4X 1XMOB 3PR3A 1WIWA 4TOIA 1IATA 1J5EB 4X64B 4B3TB 3J81A 1XNQB 2XBLA 1Q50A 1T10A 3TRJA 2WU8A 3J80A 3UJHA 4LF5B 2PUVA 4DUZB 1KOJA 3Q7IA 2CXSA 4LF9B 4DR5B 1ZZGA 4OX9B 2J6HA 3OTOB 1VIVA 1X92A 2YVAA 3TBFA 5BY2A 1IBKB 2ZM6B 4JV5B 2UUBB 3ETNA 1MORA 3JX9A 4M0DA 4GKJB 3NBUA 4DV5B 4JYAB 2VQEB 1I94B 4LF8B 2E5FA 2CB0A 3LJKA 1HOXA 3OOJA 5BR8B 4DV1B 4GKKB 2A3NA 1GZDA 4LFCB 1JXAA 1JEOA 1VI6A 3HJBA 1TZCA 3T1YB 1NUHA 2DECA 2CVPA 4DV6B 2ZJ3A 2CXOA 1GZVA 2PGIA 5I01A 1U0FA 1XNRB 1HNWB 1X9HA 4S12A 2XHZA 4DR7B 3Q88A 3SHOA 4JI6B 3FF1A 4DR6B 3C3JA 4DUYB 1IBLB 1HM5A 3M5PA 4JI7B 5IT9A 1X9IA 2PUTA 2CXRA 4X62B 4K0KB 4U6NA 2UXCB 4LFBB 5LMNB 4LZJA 4LF4B 3J7AC 3CVJA 3HBAA 2F4VB 1N33B 3EUAA 2VF5X
chains in the Genus database with same CATH superfamily
1KIAA 1UMBB 1VG8A 2OHJA 3Q87B 4QEZA 4CCAA 4E5SA 4R98A 3IXMA 3VO9A 4IZIA 3U4MA 1SZPA 2L2QA 2FJUA 2OUKA 3IV6A 3R3UA 1J24A 1ETHA 3OD5A 1IULA 4B5LA 3WQQA 4F6RA 4MPJA 4YP7A 3UC9A 5C8XA 1JQEA 4L15A 4DV2B 3CH7A 4NY1A 3SKXA 1AU9A 3IBCA 1GKKA 1NVKA 4G26A 3KHKA 3VVCA 4YCSA 2ZI4A 1V26A 3BWDD 4U7HA 3COJA 4YPOA 2BGTA 1HQYE 1OZGA 4DN6A 1ZJ4A 1WW8A 4XIFA 3BXHA 3PQDA 3RBVA 4JLSA 5K20A 5K0EA 1BS1A 1T43A 1EYZA 3R0JA 4Q4LA 4B4VA 5JJLA 1ZUHA 3AEQA 4IMIB 3C3XA 4RD2A 5JXIA 3LWZA 3UM9A 1NQ5A 1CUIA 4CHTA 3AR7A 4JBYA 2IUYA 3RHTA 4KP7A 1AH2A 3GUUA 2X0EA 4UM8B 1GGVA 1VJGA 2C0QA 1VJCA 5DSXA 1R8SA 1IJFA 1MG0A 2WIJA 2Y66A 5DXJA 3FVWA 5BOSB 3BCSA 2V7EA 4WK2B 4QLBA 3QFFA 4EFLA 4AG5A 3TRFA 2J3MA 3DTVA 3DZJA 1BA2A 5FNVF 3ZDYB 3E9ZA 1NDQA 1BEEA 3H13A 3LY8A 4M8IA 2FX3A 4JUCA 1HDEA 4B0PA 4D9EA 1TOAA 2QVZX 4CKWA 1E7RA 4YROA 2A1UB 3VU9B 2P3OA 3N9IA 2YJ4A 4KMOA 2IIBA 1UL1X 4M1TA 5EQFA 1NJGA 4M7RA 5JCPA 2B30A 5CK5A 4P82A 2WP0A 1VHLA 3RTDA 1RLUA 4R1SA 2YOGA 4DA9A 1SOMA 2B21A 4EEXA 4RH0A 2P30A 2Y2VA 4QLOA 3T7AA 2CNLA 1AD2A 3MA0A 2JEYA 1Y1KE 1TEXA 4NCNA 2BVNA 2QLBA 5JNVA 3K15A 3S0JA 3W9SA 1R5JA 1CJCA 2C5GA 3TRJA 2CDRA 2PMBA 4BFVA 1YMQA 6REQA 1CZNA 2D4HA 3FY4A 1P75A 3R0QA 2R8XA 3D7MA 2H17A 4UEOA 3R24A 2VBGA 3JWGA 4P0PB 4ZAZA 3NXSA 3KAQA 2Z58A 3KO8A 2I6QA 4JU8A 4A0FA 4B82A 1ONBA 4Q1VA 4BLPA 1QP8A 5I8WA 4QXOA 1XPOA 3NIBA 4FFBB 4WUVA 4H4EA 2JGFA 2LDXA 1WCXA 4ES6A 2VSOA 1S2NA 4Q4JA 5JR3A 3THYB 4ZOBA 4OBWA 4L76A 5JISA 1C30B 5DBFA 4LHZA 1JQJC 4OUDA 1Z8HA 1QF9A 3CXRA 1KK0A 3GJZA 2NSDA 4IX9A 4NBVA 1TLTA 1JBQA 3NO4A 1NURA 1LBHA 2ZYHA 1FDWA 1QAMA 3VR1A 3JRXA 1NWHA 4YWHA 1NVBA 4X0EA 1AOXA 5CFZA 4M6WA 3OU6A 2ACEA 4WGGA 3I6MA 4R5HA 5JAHA 1CUHA 3I62A 5LQAA 5KB3A 2OYCA 1DV2A 5L6LB 2HWYA 1R6BX 2CLIB 5EIAA 5E6UA 1S4QA 3RUPA 5B1HA 1V8ZA 3S3TA 2O52A 1VFNA 4PZEA 1YS7A 3P0HA 3M6WA 3E22B 4I8DA 1GLNA 5DOZA 2BJVA 3UH0A 3HLTA 4BX0A 1PE0A 4IOMA 4EUEA 3KT6A 4X8OA 3VX4A 2Q6VA 1RWBA 1G20E 1T0JB 2V45A 2ZRFA 4BO6A 3CKKA 5EXXA 4ZYXA 4LPSA 1RYFA 4BZZA 4RSHA 2NT4A 2WHPA 3MCZA 4U2DA 4UHFA 3IBYA 2GBLC 3RC7A 4A5OA 5ESWA 1GCOA 3OMXA 3RROA 4QELA 3Q2IA 3PPIA 1N2CE 2XB6A 3QLJA 4O0MA 1G8PA 1RWNA 1CY1A 4MIEA 5JD4A 2BCJQ 4B3BA 3TQCA 1QC5B 5K0NA 2HRZA 4J43A 5I7EA 3OFSA 5DN9A 3OZGA 3I58A 3I9OA 4HDNA 4YRTA 4YBRA 1Z0JA 2BGUA 3FWYA 3ZIDA 2OG2A 4BB5A 1J00A 3O92A 4F04A 3UHAA 4NOJA 3DZGA 4TLBA 4LWOA 2F43B 3DMFA 4HWGA 2I22A 3K96A 3Q0TA 1JIQA 4H6WA 4S1OA 2J59A 5LXTA 1YWGO 2NNWB 1K6JA 3AVOA 2HHJA 5HJ2A 2FU5C 3FUCA 5CTAA 3V1KA 3L8YA 3LF2A 2YS7A 3M6LA 4G25A 3QLVA 4PZ0A 5GM2A 1C3EA 2XEXA 2D5IA 4M1KA 3BWEA 1R0CA 2RK3A 3R44A 4RZ3A 2VHUA 4DCJA 5BOVA 3TMKA 3NEPX 4RCZA 4AG6A 5FPQA 1U3TA 5AK3A 1WF6A 2RARA 4OATA 4HVLA 2BDEA 2X4DA 3T7EA 3TZEA 1F4VA 1M6VB 3DFUA 3IALA 1VKHA 3OZSA 4RV9A 4PHGA 1CHDA 2X8JA 3NC1C 1O08A 2FPSA 4QG7A 4QREA 3CZRA 2QN2A 3AFGA 3BK7A 1RHMA 1NG9A 3HVJA 4KH0A 3SEQA 1UZUA 2ZTMA 4YEDA 3FOEC 2QT1A 2CLOB 2XMCA 1AS0A 1ORTA 3K0EA 5G4KA 3RTBA 4GVXA 3WKCA 3L49A 4BE7B 3EPPA 5CFQA 3KQLA 4RK0A 2R8YA 1TEZA 1BW9A 2GHQA 2WYIA 1FYEA 2W6QA 2DFTA 4A8JC 3QF4B 4W1QA 3P20A 1X9GA 2C3YA 3ZD7A 2OK8A 1RYNA 2P40A 1F60A 4OGFA 5EESA 4WFKA 1WMFA 1ZK3A 1Y8ZA 4KLCA 4X41A 3RRZA 2O8EA 2R68A 1IMJA 3KPVA 1LPAB 2BZSA 3LJKA 3R2JA 4FT2A 5IASA 4G0XA 3PQCA 5F3DA 1RPJA 2PXCA 4EKIA 4L16A 4BRSA 1HYHA 3NOOA 4BNNA 1CX9B 1TZCA 2AHRA 2ZFUA 1G9SA 5FTKA 4B6EA 2JBWA 2R2GA 4CIXA 1CV2A 2H0AA 4MHOA 3K70C 2EBFX 2NVBA 1I5RA 2X40A 4MRSA 2C59A 2WHEA 2G07A 2EGUA 1H85A 1WMDA 1YNSA 2HRDA 1U8TA 1UP4A 2CE2X 2X3UA 1ISRA 1DAHA 2ZYGA 1MOPA 4PYLA 4FTWA 4OA8A 4FYHA 1UDBA 2I2AA 2Q0QA 2GILA 4RKFA 5LR6A 1Y3HA 2C2XA 3W7AA 1PNVA 1H2AS 5A3JA 4A0RA 3ASUA 4Z9XA 3LXXA 5TXGA 1GNQA 3CRVA 4IG4A 4MW0A 1NVEA 3C74A 1KH1A 4EYOA 1TVKA 4B48A 1DEAA 1ICEA 3BA1A 1ESDA 2FVXA 1M2NA 3R5JA 4E09A 2XZTA 3H42B 3UENA 1BC5A 3TTXA 4BLOA 2BEVA 5K0GA 3OTHA 1S8AA 2WU3A 5JJIA 4UVHA 221PA 4YT8A 3Q5EA 4LTMA 1FTSA 2ODTX 1M2OB 2BTOA 2FFHA 2ZRLA 3BK1A 3FDZA 3U7QA 3ZHXA 4R8LA 1T8UA 4KITB 3FX2A 3KEOA 1QRDA 1QRAA 4JS0A 4KR0A 5J40A 3ACDA 4KOEC 1ISHA 3Q8KA 2MTBA 1F0PA 1LLCA 1XCLA 4FHFA 3U9LA 1JA0A 1GM5A 3BD7A 4C4TA 4IINA 5FTNA 3TJZA 5HKLA 2NU8A 5MF6A 4RWZA 1O94A 2B36A 2JFBA 1J5XA 1V7CA 1A8UA 4A8JA 2HJHA 4IDNA 2G82A 4IGEA 3SK0A 2WICA 4F2WA 3SJ7A 1N32B 5EIWA 3GDGA 1J21A 3WP1B 2NSHA 4RABA 4XQ0A 4NMXB 1PS8A 1KU0A 1AQYA 1NWCA 3QVOA 4IRXA 3T3OA 2ZVPX 3BFJA 3LBIA 4UPDA 3H7AA 3IHKA 4F7WA 2XKKA 1QDUA 5JPCA 1I7QB 3ADKA 1AGNA 3MB5A 1VSBA 4ZJYA 1OI2A 1C7RA 2RC5A 1RAGA 1Q0PA 2W2VA 2Z3ZA 2OZPA 3LUFA 4KIWA 4MVXA 1N92A 4NZZA 4B6PA 1SY7A 2NUTB 1U02A 2OZLA 1UPCA 3HJCA 3MOGA 3RVBA 4UBLA 3ERCA 2G0NA 1W94A 2IZZA 4FQ5A 3FKSA 2D3WA 5K0BA 4OF4A 5DSTA 4D74A 2HLDA 3I0MA 4LEIA 4U39A 5ENZA 3KFVA 1WEHA 3JQFA 3MCWA 3QQPA 4A8TA 4C4OA 3GQVA 1QGOA 4FYPA 3VV3A 3F73A 2VH5R 3WL8A 2ERXA 3EH1A 2J7KA 4FWBA 4P9NA 1IYZA 1N8NA 1Q50A 3U44B 1T0BA 1OI4A 1E5DA 3JQQA 2NPOA 3U4AA 1TVCA 4CUZA 1N6NA 2R25B 3BGOS 4DBVO 3QE2A 1NYRA 2YWHA 3I73A 4IJUA 5HF9A 5CXQA 5AVWA 2P2SA 3S8MA 4QKQA 2HX1A 1P73A 3DKVA 3MJRA 1WOMA 1SQFA 3F6RA 5AK5A 5FPYA 5G1PA 5H9VA 4ZVKA 2ZIAA 2UYGA 1I36A 5F1KA 4HO1X 1N9KA 4Z8YA 5AHKA 4E46A 1J2TA 1QHFA 1H6CA 1RYBA 2IH5A 3KWMA 3C6ZA 1M6WA 3AL0C 2Z5VA 1XKQA 1U63A 1JSXA 1UUFA 3ONVA 4E7OA 4GI2A 4J0JA 4GIBA 2G9ZA 4ZJPA 4JUDX 4R2IA 3QPAA 4JC0A 5EWMA 2A7XA 4JYCA 3S1AB 1HE3A 3LHKA 4NHEA 1YMVA 4XEUA 2FUEA 3OPXA 3I0NA 4IDDA 4BWGA 5HS4A 4CFSA 3KKLA 2P5UA 3E7WA 1ZMBA 1IL0A 4JD5A 1HSZA 1I2CA 2D5AA 4F5ZA 4X63A 3Q7EA 3CLTD 4MVJP 3WOHA 4PYRA 2OCGA 4N18A 5LB4A 2C3UA 1O2DA 2H7YA 5JS2A 4E2ZA 3IBFA 1P29A 4JOCA 1D2HA 5AK6A 1MGPA 4WOBA 4N5HX 2PEZA 5FTLA 2H11A 1E2GA 4JJ6A 5LMUB 3HNOA 4MUXA 5TY0A 1MGOA 3RU9A 2PGNA 5KS2A 3D5TA 1SXGA 4PC7A 2PIAA 1DG1G 4RDXA 4DG9A 5CXSA 1SUDA 2KS6A 1E4OA 1TECE 4ZOCA 5EZ6B 4E08A 4KLRA 5AQEA 2E82A 2KE5A 1ECJA 5B1IA 1SVNA 2G5TA 4Q39A 5HJ5A 2DQ4A 1QGUB 4TUYB 5ALYA 4L07A 5I8ZA 4D9GA 1DAMA 1SVSA 2IPLA 4AD8A 2YWGA 1XPJA 1JLMA 1P5JA 3DOEA 3L43A 3MN1A 5AWFC 5ITSA 5KWEA 5E2IA 1NDUA 2CYBA 1NJ8A 1RYDA 2VZLA 3CX6A 3LBHA 3LWNA 4JELA 5CK4A 4CU5A 1FJXA 1P4GA 3WAKA 1C8KA 2IYQA 4L73A 2X7XA 5HQJA 5BQXA 5IBCA 1RRVA 2ZJ0A 4UBNA 2JK0A 4DCUA 5LWQA 1P7WA 2V1XA 2VA9A 1QX3A 3OF2A 5HIKA 5EP2A 2QMZA 3DOHA 1N3BA 3SXUA 3T0IA 4AJLA 5K1ZA 3W1WA 4QU0A 4EKNB 4C06A 3O95A 2GBPA 1ZU4A 5K3OA 1TJPB 3PVZA 2FW6A 4DM7A 1QPGA 5DW3A 1KHTA 2Z2YA 3H86A 1U65A 2G67A 2HMAA 1VLMA 4PHTA 2I6SA 3OVMA 4RXMA 1U7OA 1MH1A 4W7IA 3SEAA 4KYTA 3V8EA 5JYBA 3D6MA 3GA0A 5A7GA 2X2PA 3NI2A 1YONA 2VPYA 3KKMA 4LW8A 5ARDA 3W5DA 4NSNA 3G59A 5CRIA 3L4JA 2WD7A 2IHZA 4XYLA 1AKEA 5AI4A 1GCAA 2BEUB 3FPEA 3MJEA 3PHGA 2YHAA 2F7SA 2FRDC 4KQKA 4DIEA 3KAPA 1L7RA 3FPFA 3LDFA 3NHZA 4MVJF 4LJ9A 3TR6A 2FSIA 4U6QA 3EIHA 2CL0X 2V9PA 2W6IA 2EZ4A 2LPMA 2OM6A 2ADFA 5CG1A 1H0HA 1JPUA 2ADOA 3RTCA 4DGQA 3OICA 1K4KA 4BZWA 4D45A 3RIEA 1ZUNA 4BXOA 4PX3A 3E1KA 1IB0A 3A26A 5FBZA 2RHCA 3H7IA 2HRCA 3AO0B 4D0RA 2FMTA 4M89A 2VPPA 3GT0A 4UTZA 5DT2A 3TZLA 4NJOA 5JZOA 1ZJYA 2X3FA 3LGAA 3BHNA 4ZYWA 3U4QB 4EG4A 3AJ9A 2C2ZA 4JNKA 3T5DA 1L5HB 1X3SA 1DIOB 1WSBA 2C1ZA 1MEJA 1WHTA 3HV0A 4MCJA 2VF8A 4K1LA 3EFBA 4YJDA 4RMJA 3DTNA 3O0DA 2FPKA 1Z2CA 3HA7A 4CDNA 3MUEA 2WU1A 2R6AA 2P2ZA 2OHHA 2QA5A 5D3MB 2I7XA 1DKOA 4YX9A 1NHWA 2LUOA 5HIAA 1U94A 2R6JA 3OY2A 2WHQA 2GM9A 3NW9A 3MILA 1ZX1A 3VO2A 5JZVA 1VLZA 2H59A 3GXOA 5K51A 2IXDA 1HLDA 1PNTA 1PR9A 3VKUA 4Y6QA 1CY4A 5CHYA 5CB0A 2QTZA 4O2BB 4ARSA 1EUZA 1HL7A 1TM1E 1LK5A 1JN0A 4LE0A 4YY3B 1N1DA 4E7PA 3EOBI 1D5CA 3BXZA 4CLEA 4Q15A 4WTOA 3WLOA 1PJRA 2BHTA 2JIZD 3R0XA 4J0CA 4X97A 4XQGA 3V8BA 2UYQA 3ZZ0A 3O8OA 3A2NA 1EHCA 2GF9A 3JSAA 3EVDA 1FYDA 3ABRB 4MV8A 4Z7NB 3QYAA 4E0BA 3FOBA 2A1IA 2YMPA 2ZAYA 4WEQA 3VTZA 1QQBA 3INNA 4TSFA 4WAUA 4EDHA 1QOPB 2FRDA 3KBOA 2GD6A 2H85A 4ENTA 1THZA 2XMPA 3P9PA 2GJ8A 3AEZA 2O2IA 5A06A 1PDOA 3PHCA 1OHHD 3LGSA 5KUTA 4DE5A 2XNDA 4MB6A 2AG6A 4WT7A 3AV0B 3X1WA 5K8JB 3K71B 2C7PA 2R1VB 1P5FA 4FDVA 4L6CA 1L4HA 2ZRQA 3CNOA 3P97A 3C5WP 3IPYA 1Y9DA 4B2IA 4NS1A 1GSOA 4Z4QA 2ZYUX 2OO3A 3GVXA 4CM4A 3ZHRA 1U3WA 1JFSA 3QFHA 2V97A 3EAGA 3HSYA 1RC8A 1TYCA 5LQJA 4Z86A 1KI6B 1Q2XA 1M72A 3EG9B 4RX1A 2OO5C 2ZVQX 3ORHA 4WY5A 4TXLA 1Z33A 3WQHA 2QPLA 4N3AA 3A31A 4PNHA 4L5CA 3B53X 5FQOA 5BN4A 1L3IA 2A57A 1JEYA 2IEAA 1N57A 4HPWA 3WGYA 2R1TB 1SMKA 3GFRA 3LCRA 3U4GA 3PFNA 1AKQA 4B2LA 1DJOA 1EVKA 1ZJ5A 1IPFA 5G0WA 2X6TA 4KXMA 4YI5A 4EM6A 2JBAB 3ADPA 5LCXA 5KDDA 4MRNA 4ZT7A 1CNFA 3MWEA 2IOFA 2WTXA 1RW4A 4MV1A 2Z98A 4HMPA 1A77A 2HJSA 4L85A 3BM5A 1A72A 4MP8A 1FBTA 4RXUA 5DM1A 3WLEA 4B43A 2WD9A 4COKA 5K03A 2ZUSA 2QGNA 3PC4A 2MSEB 4GZ6A 1YZTA 3VPFA 4BQFA 4B7AA 4LVOA 1VXRA 3DMYA 1MABB 2VSQA 2XXJA 1O6BA 1X13A 2YVKA 5DHFA 4ZVUA 4M1ZA 5C18A 5ALZA 3MQFA 2ZAMA 4NV3A 3HCCA 2W70A 1C7IA 3M1LA 5E38A 1PLKA 4EAQA 3LLSA 4DEXA 3IA2A 2C7BA 1R4MA 3N5CA 3OURA 2HIMA 1U3VA 4JGBA 3O8QA 4J0DA 2W6JA 1XQVA 5BN3A 4JSTA 2I9KA 4Q05A 3NH9A 4UDYX 2ZT6A 4GR4A 3C6QA 1W8DA 4KH1A 3KOMA 3K0AB 3SJCA 2X0RA 3AI2A 3SMQA 4KE8A 1FXSA 2K2WA 4X85A 4XX0A 1JWLA 5CJJA 4BAUA 5AKEA 1CEYA 3ZU4A 3C87A 1UOEA 2NSJA 1AZWA 2QN1A 4P83A 5K99A 1U7DA 4AZ0B 2XA2A 3AIIA 2BYTA 2HBRA 2AMJA 1K8ZB 2HA5A 4U0JA 2XADA 2DFNA 2OO5A 2F3QA 2FVYA 4G0NA 4MB2A 3WBFA 3IKLA 4ZVOA 4DNXA 3IXLA 3I32A 4KXYA 4ZRMA 3U4CA 5AVQA 3EXHC 3RFTA 3K73O 1FNMA 2EJBA 2L17A 1ZUD1 1UIRA 4JJ8A 4TWAA 2IYPA 3NHAA 1WJGA 4NU8X 4RVDA 1PW7A 1KTVA 2BD0A 2Q6KA 3CF4A 3ENWA 2JHFA 3M3PA 2CUNA 4Y6SA 5ALDA 1Z2NX 3RC1A 1XDDA 2E6KA 4DB2A 2HQ1A 3UOAB 1F12A 1KAGA 2M1XA 2D4AA 1WDKA 1THGA 2DKNA 3ADCA 5CFLA 2QD5A 2R7KA 2P5TB 2VTKA 1R6TA 3L46A 2WIAA 1X7HA 4GX2A 2A0KA 3JD2A 1IN7A 4I1IA 2ZYIA 4KO2S 4XKJA 4BUJA 2GAOA 4DY6A 2XAAA 3PJDA 3PDJA 5BW8A 5DYGA 2ONKA 4PYOA 3W2IA 1AGRA 1YQGA 5DOVA 1USVA 4D3FA 3VM6A 4GI5A 4J1QA 3MJCA 4LXHA 1M67A 2W2KB 2J6CA 3F90A 3I9MA 1IHXA 1I4OA 2JDIA 4M86A 1IEVA 1XK6A 3BN3A 1EVIA 4D97A 4RAQA 3FYCA 2ON6A 1GTRA 4MVJH 2EJWA 2FX5A 2ZPUA 3PKJA 1UBRS 1W19A 1ZS9A 2Z4RA 3FCXA 4NH4A 4PPQA 1APBA 1DJPA 2JFNA 2JFOA 1Y9EA 3LNCA 4DLUA 3ZHZA 5CDYA 1O95D 4RTNA 2B69A 1VHDA 2POCA 4DR2B 2ZWAA 3KD3A 4UAGA 2NZVG 1IY8A 3KAJA 3NNDA 2Q1WA 4V0MA 4YJGA 4ND4A 2YCBA 2CKDA 3C8HA 5D7NA 5AK0A 5SZHB 4JEMA 1GL6A 1DO0A 2AXQA 2DHEA 5LLDA 1U2PA 4WZBE 1DBSA 4N8EA 1ZN8A 2NT3A 3I23A 4IIJB 4QX6A 3NM6B 1XAHA 1URPA 1Y7PA 2X19A 2OGZA 2XOKA 3P9XA 3UMFA 2DR3A 3IIEA 5AVJA 1HGXA 3ZV5A 4JUAA 5KHOC 3SZMA 4A1FA 4GS5A 1IN1A 4IQGA 3ZHVA 5C31A 4DARA 4O2BF 1RMTA 4XIIA 4YQZA 3CNNA 2WJZB 3KDAA 3FFAA 1XDGA 1NC3A 1DBQA 3PLRA 4GXQA 4BO1A 4OQLA 4H1VA 1ZCZA 4DNQA 3OLVA 4JJ4A 4PXYA 3P9ZA 3Q3JB 1Z0DA 1X7WA 4XWWA 2IE0A 1A7JA 5ELLA 2ZBRA 4MZXA 2HRQA 3T61A 4FLFA 4XR4A 1C50A 1XYVA 1E3SA 3EXIA 5LYJA 3DWFA 3REFA 4QT4A 1H9CA 3HWRA 1DU4A 4W4TA 4BNFA 5JV5A 4GOOD 4C2BA 5HUQA 5K0CA 1ULUA 4CM7A 2W6PA 3DV2A 2YY7A 3AONB 2I91A 2HR1A 2FOXA 2XSZA 2FWNA 4C2TA 2GPJA 4YRQA 1UK7A 1ZL0A 2OBFA 4KFUA 3ZQKA 3PXDA 1LA2A 4CV0A 5B64A 2CVZA 1Z88A 2XUQA 2BBTA 5LZ2A 1NBAA 1D04A 1VZ2A 2YR0A 4Y8VA 4DZRA 5AW3A 3JATA 1SC6A 3BHIA 4XIGS 4CLRB 5K7SA 3DPSA 1FDUA 1KQ3A 1L5GB 3KU4A 1BGXT 1NULA 3SF0A 1P31A 2CKMA 2PYZA 4C6HA 2XGSA 4KPUA 4C22A 2NO1A 3A7DA 3WYBA 2XZOA 3CVJA 3OZWA 1B8OA 4I50A 4JWKA 4QJIA 1QG4A 2WE7A 4HDMB 3VR3A 1ZM7A 1TT5A 3IMEA 4V39A 2CNWA 1PZEA 3RYFB 1QO0A 3F6BX 1XGKA 5JASA 2H1OA 3D1VA 2PFKA 3UG6A 1X80A 2VCHA 1QK3A 5TB5A 1JRLA 1G8HA 3EYWA 3TIVA 5L4NA 1GRVA 1JEQB 1SCNE 4MKRA 1E2UA 1H2YA 2IT1A 3ESQA 3VPSA 3ZW8A 3V8VA 6GPBA 1LQTA 3PEUA 4BMXA 3DBHA 2ZIXB 3EZFA 5FP0A 3T5BA 2GM4A 3BTVA 1L7DA 2HU2A 2R79A 1UXHA 1D4AA 1KNXA 3NHYA 2X4IA 3DGFC 3SZRA 4DIBA 3NJ8A 2V3VA 2HQOA 1NN0A 1U1FA 2BHNA 2IP4A 4K3UA 4E13A 1EDEA 1V0JA 2HV8A 3EOAI 2HNBA 5C8DA 3I8SA 5HEKA 3DFZA 3FZYA 4PLTA 4UMEA 4AP5A 3OT5A 3ZWBA 1GQRA 1ECFA 4RTQA 3RBAA 1JSZA 2LV8A 2IUSA 5F76A 4RC9A 2CXPA 1KEVA 1XJQA 2ZRAA 4B8YA 3SHTA 4M55A 3ICVA 1F1JA 3CLRD 3H75A 5ECWA 5L9AA 4NE9A 2JIBA 1MW8X 1MOZA 1DFHA 1G6HA 1OYVA 3QTLA 2A5DA 4J07A 2HWKA 1KI8A 1QANA 3MC1A 3K8ZA 1UMCB 1DG3A 4ACBA 4Y0VA 5C8VA 2ZM5A 1N2SA 2ZB3A 3RASA 3HWX1 2PWAA 2PXXA 3P19A 3K6RA 3PFBA 4L9RA 3OQ1A 4TQ9A 5GJBA 1CRWG 2C03A 1WCYA 4QXQA 4AYWA 2PYDA 3PP8A 1KDRA 1TLLA 2JZNA 2G6TA 2HPZA 2H0QA 2IPNA 3GA7A 1L6IA 3L82B 3LCUA 4C1BA 2DWCA 4ZCPA 4C1NA 4H0FA 1YXMA 3GAMA 1CR1A 3A9SA 3HN2A 2GM3A 5MFPA 1V2HE 2WWGA 3BWXA 1NFRA 2H5EA 3IEVA 3SXPA 5BNTA 4BNIA 3WV4A 3KJNA 3IR6A 4UUMA 3TNLA 2FE1A 4EABA 2HMTA 3GHYA 5EE5B 4GH5A 3IPRA 1A7KA 3SWWA 5A9SA 1XRQA 5F9HA 5F51A 3JQRA 3B3JA 5ICMA 4I5IA 2ZVJA 3GAZA 2XV1A 5EQDA 3D3WB 4JYAB 2BC9A 1CVLA 4HAWA 5KCMA 4G24A 5FUQA 5HSGA 2QSJA 3CW9A 4FONA 3HLYA 3AYXB 3OE4A 3B3GA 1OUMA 1YC2A 4AICA 5HF5A 2PSEA 2H5JA 4GI3A 4BNUA 1PL6A 2OCAA 3KK0A 4F0JA 1ULSA 4OLAA 2HCFA 2VHCA 4MVJG 3QJYA 1C41A 1MCZA 1O6ZA 2MIIA 3KD2A 3R3SA 5IXYA 5JXWA 5BR1A 1K1EA 4ISCA 4ZZ2A 5CG2A 3QSYA 2C2WA 3T1TA 3JR7A 1GPJA 1W0JA 2YTZA 2Z9BA 2GN8A 3IAS1 3MVEA 3MTEA 4K9OA 3QG5A 2ZREA 5EGNA 1A9XB 1LK0A 3G9UA 1GZSA 4M21A 1Z2AA 1DQSA 2MMGA 3E05A 2NU7A 3AEYA 3UHFA 1R0WA 2VZEA 3ZV7A 1UOOA 4Z3KA 3J7AC 3T4EA 4TKMA 4TPKA 4U2BA 4ZT5A 3NOXA 3WK6A 1ST3A 3PWZA 3E1GA 3VC2A 3S44A 4N9WA 1XZFA 4YJFB 3P9KA 2W8ZA 3VZQA 2YHIB 3MT8A 4D3ZA 4BB0A 2QDKA 1X14A 4JGIA 4WLVA 2MSKA 4L8LA 3THRA 4MUMA 4RE5A 1ZNXA 3TAHA 3U7GA 4UM9B 2R8BA 4LJRA 2BHRA 4BNXA 1WSDA 1YUMA 1T3ZA 2C2BA 1KEWA 1PR2A 4I08A 3ZWNA 5IPFA 1CT9A 1P17A 5J47A 1OBVA 4WPGA 3DMDA 3N2NA 4WA7A 3Q1LA 5BXQC 2GXSA 2F8MA 1Z5UA 4KJZA 4IXMA 1I5EA 2D1FA 2DF8A 1GEEA 2OXCA 3C3CA 2B1JA 3MFYA 3OF3A 3QLTA 4LGCA 5DCLA 3C7AA 3ECAA 2G6BA 3QBEA 3AW9A 2C54A 5TF4A 4MR7B 2VUHB 2NTEA 2CNDA 3B89A 3OZUA 3W78A 4Z4EA 4RZIA 1XWFA 1KZ1A 1QJ4A 1U2EA 3A3PA 1K7SN 5JCOA 3WK7A 5C4MA 1JDZA 4RPHA 1E4EB 1LTKA 5AW9A 3E5NA 4QDTA 4QFDA 4BASA 3H1BA 3UTCA 1OX5A 4PBSA 3AEXA 5EUQB 4DB4A 3QXCA 3SKVA 1SCUB 2XEDA 1XXHB 3B1JA 4OP1A 3WYGA 3M8KA 3E1SA 4UTRA 4I4NA 5E0KB 5B1DA 1E7WA 2PKXA 2R87A 3CSSA 1W34A 1EA5A 4JA0A 4IXNA 4AJ9A 1H8HD 1KQPA 1LW6E 1Y1RA 2E4UA 2NXWA 2WM2A 3OM8A 3WMGA 3U6BA 4HWKA 1OASA 3SEFA 4CM1A 2EFDB 5KNCD 2YQ4A 1RAFA 3RC8A 1WB6A 2GQ0A 2V03A 1L4KA 4PLHA 1YIOA 1VCOA 3QBDA 2CJFA 1TZBA 2PM8A 5KSOA 1UKCA 1UANA 4DXDA 1GU0A 2FUNB 4EEKA 3ZUPA 2CJPA 1KO1A 3FOCA 1ZZEA 2OLKA 4KRXA 3I04M 4CUJA 4WMLA 1QYXA 4L0CA 1YR6A 1T4CA 3JQ6A 3OE7A 4UMDA 4CRWB 5EIBD 2IBSA 3L7OA 3NV9A 4KREA 1D6NA 3VR2A 4NCJA 2Y6UA 1ZICA 3SQXA 1RBQA 3U62A 1ODKA 2DM6A 5IDVA 3MXOA 1KQOA 1YDFA 3ZVKA 3V97A 4L3WA 1BX3A 4MITA 1XT6A 2QXTA 1HETA 3NEYA 3K5PA 3QWFA 1T3HA 1Z4OA 3BMXA 4NCHA 4RZSA 4IMPA 1JYSA 4U5XA 1VKJA 4ARZA 2BI4A 5B2ZA 3AL2A 1E1QA 2WU4A 1YOVB 2GRUA 5EJ6A 3C6YA 4HNQA 4LZOA 1OLOA 1QZZA 1FQWA 1XV5A 3T41A 2VH1A 3ZDBA 4HLQB 2NSLA 3WZMA 2O50A 2PX5A 1MNQA 2AQHA 2V3WA 3EHDA 2AN5A 1JZQA 1FMLA 3B70A 3VNSA 4B09A 1VPLA 4W1RA 3UOGA 2BUAA 4YRKA 4XM2A 4X1YB 4JZKA 1S6YA 2B25A 2VJNA 5DMXA 5FLEX 3SHWA 1P0CA 2X9GA 1EQ2A 3KEFA 1I13A 3UN1A 1NNUA 1YFLA 1IHUA 1L4FA 2C9MA 5KSWB 4QODA 3D9QX 4B2PA 3GI1A 3L6RA 4JLMA 4LFBB 2X9LA 4Y6PA 3EQZA 3TXXA 3INYA 1IXKA 2YBEA 3BWVA 1QFJA 1X2EA 1XMPA 4IEFB 4UKDA 3K9NA 5ECGC 4AY6A 3QEKA 4DR1B 3O8DA 3ADDA 4HB2A 3CONA 5MGBA 3R9XB 2CMKA 1BNCA 3PJFA 3D6VA 2WM8A 1YCGA 5AJYA 1BVYF 4P4GA 3WNDA 1WBJB 4GE0A 3NWBA 3RAGA 3JQ7A 1XNGA 4IDBA 1L9KA 2P77A 2YXLA 3FRIA 1L5NA 4BYMA 4E12A 1JHOA 1FMJA 4GUAA 3K0SA 3O1JC 4QPNA 2HXGA 3OHSX 1ESZA 3U7FB 1MP0A 1E66A 3CNBA 4FMCB 3PG5A 4OU4A 4Q9JA 4YJ3A 4QYXA 1PWYE 3TJMA 4Z54A 1P9OA 4R31A 3AERA 3HHEA 1GDTA 4I2VA 3DEIA 4CUKA 1G64A 3BB4A 4M37A 2IBMA 1MD9A 3PXGA 3DTTA 4V24A 4IKEA 1WCIA 1YVRA 5GONA 1N6KA 2XA9A 4OOFA 4MCHA 1BMDA 3JRWA 4U7GA 4X91A 3JAMA 4ZIRB 2H2IA 5K6TA 5IJ0B 4M1YA 4MI1A 5C1BA 3FPKA 3H1PA 1L8AA 1Z5OA 5L4LA 5AICA 2HFKA 3VHXA 1NBME 4BO4A 1BOFA 1XA0A 1K5HA 4FQ8A 3CUVA 1G8YA 3E15A 5KJ1A 5LPNA 4LY6A 3DYVA 4B3MB 1QBGA 1FP7A 2CFRA 1QQ5A 3R5SA 4AX8A 3FMGA 4INPA 2LBPA 3X1ZA 1G2QA 5LQKA 5FBLB 3G0GA 16PKA 1I2MA 5TQ0B 4B6OA 1IM2A 4QXPA 1M7GA 4AUNA 4BQPA 1R7RA 3AUAA 4JBXA 5ALQA 3FIJA 4QPZA 5JCXA 1ECBA 1ZJWA 5FH9A 1D1QA 3OZCA 5FPTA 1IVNA 4FMBB 4TN1A 2I4MA 1BFKA 3GLHA 4UDXX 3G79A 4CTKA 1WKCA 3WS7A 4M4SA 1HFJA 2HCBA 3HUDA 4MYDA 4HH1A 4OI2A 4MKFA 5J58A 1WO8A 4N48A 3VAYA 1JP7A 2W6CX 4HYYA 1QR2A 1O54A 4I3FA 2DBZA 4MPTA 2BJHA 2FZVA 4JOBA 4KTTE 3KYCA 3USZA 4DJTA 1EK2A 1JFVA 2FCRA 2P6PA 4GPIB 4TMWA 3MINB 2ZCVA 1V3TA 2ZOSA 2EFYA 3KU1A 2QE7A 5DRYA 1YJ5A 4DSUA 4DQVA 2FW0A 1XE3A 5BP7A 1T29A 5AOVA 3VZCA 1R37A 1S1MA 3O73A 4EF6A 5KWJA 3EG5A 4KQIA 1OAKA 3ZLJA 4FZ5A 5AK4A 5B6IA 2GEBA 1ZXXA 5F7ZA 1UFQA 4GOJA 1KAQA 1QVAA 1AK2A 3H5TA 2C8LA 4OCZA 3JX9A 3MWJA 4F3TA 4TV8A 3BICA 5AKXA 1R8YA 1Q0HA 4MYSA 2GBCA 4OQ4A 3VKWA 4CJXA 5B4TA 3GXBA 1XU9A 4HTFB 4M83A 4QRDA 2J9FA 2OZEA 2WT4A 3TM5A 3W05A 1RQRA 2PJZA 3FCCA 3I2YX 3NHWA 4K3VA 5TEWA 1T9KA 1QB7A 1XRMA 4B6FA 3DOJA 2QMQA 5E7QA 1A9PA 4HAIA 4CLHA 2OO7A 2JRLA 2ZSKA 3VA7A 3QXJA 3CTPA 4LQLA 1G7SA 1YKGA 4C07A 5LFAA 2G71A 4JB3A 3ELWA 4PTYA 4BJHB 5TEVA 1KI1A 1BZYA 1OV4A 2FXIA 3PQ2A 4NPAA 5AKYA 5B3AA 3DXZA 9LDTA 3BOSA 3FPSA 1N4AA 4IHJA 2R6DA 3Q7QA 1Z37A 1NR7A 2HJVA 2J46A 4BFYA 3CN9A 2ZRDA 1AXEA 4JLDA 4K88A 1IY1A 1DKMA 4I8XA 1WEKA 1M8PA 3ZXYA 5CM9C 1LLDA 2M2IA 2X41A 1CHNA 2RHLA 5J9FA 1GARA 1KJZA 1CF4A 2OHOA 3KSRA 1RCTE 2CL5A 5ALNA 4HWPA 4A10A 2QRMA 2I4LA 5DH9A 2N75A 2RI0A 3VYSB 3PB3A 3KVRA 1M2VB 2QU7A 3GN1A 3PFWO 1R8JA 4OV6B 4TRMA 4ZHSA 3DLCA 1TQ2A 1IC6A 5A4AA 4Y6LA 1KVRA 1ZR2A 3VKFA 4NARA 1GSIA 1NW8A 4OMCA 5EZYB 4A2QA 5C8YB 4IIVA 4LSGA 3G85A 5BWNA 3M5DA 5B2EA 1CQWA 1TCAA 4LBWA 2CV0A 3GFBA 4Q3AA 1EQUA 2BEJA 1GR1A 4XCXA 1EA7A 2LW7A 1B7GO 1GPH1 1JE0A 1ARZA 4P4SB 5I7OA 2PN1A 1TVMA 2ZE7A 4PXSA 2WYOA 3GEIA 4HVCA 1T0PA 2HNAA 3ETJA 5FOWA 5B4UA 1GO2A 1UAAA 5LP6C 4PE5B 1VYVA 1RXEA 3VPHA 2H9IA 4NEQA 3WGQA 3WSVA 3KJZA 4XVUA 1LFDB 2ZSJA 3FGOA 4QRIA 2PX4A 4DCTA 1O4VA 4G5OA 1T9AA 3AUFA 2LTAA 1W6UA 3H2ZA 9GPBA 3A14A 3NKLA 2AMLA 4TXJA 4LZPA 4W63A 2Q7DA 3SHVA 3SSMA 4AKIA 3F5DA 4K9SA 4R1QA 3UJ8A 1CC1S 1DC6A 1QSGA 1MB0A 2FG5A 1LDYA 3EODA 1DJNA 2QN9A 3AZOA 5AHOA 4DLAA 4CIWA 1R18A 4NCBA 3CEJA 3SEZA 4CM9D 1SBHA 4Y1GA 1QZUA 3G9QA 2OGSA 2Q2WA 4GR9A 1RHJA 2XTJA 4TMFA 4UAVA 1C8VB 5DULA 3NCTA 4HNGA 3T7IA 2BUBA 2CDBA 2Q46A 2Q4TA 2V0CA 1HKHA 2Q99A 3F97A 2PXAA 1LLQA 3L0SA 3NBAA 3FTDA 1YGPA 3EGDB 1X1RA 4PZAA 4U9UA 3FHJA 1SG6A 5CA0B 2IWRA 4PFQA 2H4HA 2CFTA 2ENWA 4MW9A 3GWGA 4UZSA 1P7ZA 4QHTA 4LNAA 5AVYA 2PL3A 3TLZA 2JHGA 1JT9A 1KI4A 4EUHA 3PJEA 3EGXA 5SYNA 1Z08A 4CVNA 2UYHA 3BE6A 3C2QA 1SHTX 3EZLA 3RAPR 2XMQA 3KJIA 5NULA 3ZV3A 4FMCF 2C97A 3QWIA 2V7UA 4CEJB 1J09A 3Q85A 1MC8A 3UB4A 3GP5A 2A7QA 5KNBD 1A88A 1V2GA 3QX9A 2WT9A 2ODQA 3QEOA 4MR8A 1NXOA 1U1IA 3I9LA 1M1YE 1H94A 1NYLA 3C7KA 1MXFA 2DBVO 4LK3A 3DHEA 4MWSA 4WX2B 1Z25A 2C5HA 4YIHA 1NUHA 2F1KA 4Y9RA 3I5AA 2QV7A 1MTZA 2JRCA 4QO7A 2WUFA 4YRBA 3TLKA 2JGLA 4JMLA 4RL4A 3GGPA 4Q4AA 2JCYA 4Y2PA 5C32A 3IE1A 1NVFA 3E3MA 3MEQA 1U9YA 3OPYB 4Q48A 4W1SA 1USKA 5FFMA 3AR3A 4XWKA 2VSFA 2E1PA 3KSMA 5CVTA 3M5WA 2GDZA 2IH4A 2R7MA 2XA1A 4ESHA 4UVGA 3LRPA 4HUQA 4N0DA 4HFNA 3E7XA 4IDEA 4Q7KA 1Z16A 2WG0A 4F5EA 2GJ4A 1RS0A 1NE2A 2BLLA 4GMXA 3EZ9A 4PLGA 4RXTA 5E7IA 5TC4A 4TM7A 3RLFA 4C87A 3K4HA 2P9FA 1E3EA 4EKDA 3EX7C 1JHQA 4Y0NA 4RZ2A 2ES4A 2VDLB 4L9SA 4QO8A 1YA4A 4IOKA 3ZU2A 1JF8A 4A2PA 4DG8A 4LDQA 4TT3D 1BXGB 5C3UA 1GP2A 3CMCO 5IANA 2CF6A 2A9RA 3OIUA 3L5KA 1IUKA 1P0QA 2IP2A 2PD4A 4L8GA 4O4IB 2EBWA 3EE6A 1SZDA 4JXJA 5JSZA 3GFFA 1HT1E 3EY4A 3H9JA 1F14A 1EBUA 4K6OA 3SDZA 1YZGA 5D5HA 2NUPB 2HF9A 4F4FA 2PYIA 4LOLA 5CUQA 4WHMA 2ECQA 2UZ0A 3WMRA 3CY6A 1K0UA 1M0WA 1Y1QA 4ZTZB 1CDOA 4ND5A 5J2TF 4RTMA 1KVTA 5JADA 2JCGA 4EUSA 1I6LA 2JCSA 2YC4C 5EE3A 3HHPA 1PHRA 2D0OB 2J3QA 4L5AA 4PPNA 4PPFA 4S2EA 1YFZA 4TXMA 4ZCLA 5AHRA 4CCYB 2HDNB 1SK8A 5AW1A 1CP3A 2GSDA 2SICE 3QENA 4LV5B 3WGNA 5FJJA 1KP2A 1P5RA 2EU8A 2C5FA 2IODA 1KDYA 1H9AA 2WWFA 4LI3X 2G36A 3B38A 3K16A 3IP3A 2O6LA 2G4LA 3VNAA 4FMPA 1HPLA 1I0LA 1QFXA 4IAOA 3QNMA 4RZQA 1Z73A 2GOYA 2I29A 1Y8CA 2GD1O 5J5CA 1Q1EA 5E4TA 3C39A 3EBPA 3LD9A 3ZDQA 3V7NA 2V96A 2B0CA 1G6KA 3STYA 3T3IA 1QS0A 1BHQ1 3MW8A 3BCHA 2GRJA 4NECA 1B3RA 4O6VA 4NOLA 5AH0A 2O7NA 1XKLA 3WMEA 4H60A 1NI4B 2X7HA 1I6WA 4TLCA 3SNHA 1DUSA 1P33A 2C31A 4PWZA 4HT3B 4WKNA 3OM1A 4G6ZA 1TZ2A 2CBZA 3UK6A 2IIQA 4C6SA 4X7RA 4ZYTA 2BTQB 1NVGA 3C85A 3EVEA 5C8YF 3TWOA 4HB4A 1W73A 1PJQA 2D8AA 4J7XA 5EJMA 4KL8S 4YJKA 3U31A 1F2TB 3CLSD 4LWZA 1G6OA 1DAOA 4NK4A 4ERNA 5D2CA 1U8AA 3NAGA 4PXAA 5JNSA 2QRNA 1RQ7A 3QELA 1ZOPA 2XPCA 1G60A 1Z56C 1NIJA 3AG6A 2A3NA 4KI7A 3SR4A 3FR7A 1TM7E 4MV3A 1OJ7A 1QONA 3FB1A 3ZJUA 1N2ZA 3DWGA 4Z99A 5DYTA 5BN5B 4LRXA 1Y8QA 3GGJA 1JKJA 4W82A 3RV4A 4DJJA 1KMNA 2AOTB 2GEVA 2R4QA 2ODBA 4OLFA 4C4ZA 1GZ5A 1R4ZA 3TW8B 3REQB 1DOHA 2L69A 3MT7A 2DQSA 2PBRA 4BN5A 1NBMD 1V8PA 3BD6A 1GIAA 3P9RA 4N4AA 4MW2A 3OMLA 1OF1A 1W0KD 2PNFA 3AGQA 3EIUA 3IO3A 4NCIA 1EGVB 2ZU6A 1YL7A 3QFCA 3T3DA 3OJ0A 4OM7A 4COOA 1PV1A 4DMCA 5FCDA 5E7MA 1N25A 1E2JA 2ZBPA 4BO3A 4PR3A 1VBFA 3KQUA 4AFNA 2J87A 2HA4A 2FWBA 2ZJBA 2JW5A 3ABIA 4MYHA 3KUDA 1TRHA 3P45A 4R2WA 4EUFA 2V4ZA 4ENPA 1EFPB 4G1EB 4X8LA 1VTKA 3SD7A 3KQMA 3RHSA 3UJCA 4TLEA 4DDKA 4DLNA 1JDBB 1PG0A 2P2LA 3L18A 3ORYA 3FH0A 4NFHA 1YI8A 4ZI7A 2JGAA 2UU9B 4ZVPA 3GGSA 2ZWPA 4R7ZA 5A4DA 5CDGA 1I24A 1S2DA 3RWOA 2QYOA 3P52A 1IQPA 3LQ4A 3EZGA 3PUWA 4H7FA 4CKZA 1YV9A 4S24A 2LGJA 1ETUA 3C3KA 1NMXA 3F8TA 3GLGE 3DB1A 3QF7A 4GGOA 3WHPA 3HS3A 2ZZNA 3W6ZA 4H7IA 4ZRDA 2RG1A 2HQBA 4QOHA 2WMDA 3T8YA 3CWQA 1E3LA 3Q15C 4EB6B 3UPTA 3ES9A 3TX6A 2PAAA 3I6ZA 4JA2A 3TB6A 5ICSA 5JRZA 2H1WA 2JH3A 1FRZA 1TTHA 3FSGD 1XD2A 3PQFA 5D51S 4DSAA 2XUGA 3DPIA 1PJZA 1G5RA 1GRRA 5JOQA 3AHDA 4OQEA 2WTUA 2I6TA 4JKYA 3B9QA 1UP6A 1SUPA 1H93A 1AKYA 3B36A 1R9MA 2YWDA 4RQBA 2C96A 5F52A 3O83A 2Q9AA 4F8JA 1Q20A 1JECA 2SECE 3MCTA 2PKRA 3OG9A 3HI4A 4JY7A 5K8LA 1B74A 1FSSA 1VIYA 1GQYA 1E8NA 4ITUA 2ASVA 2JFYA 4P08A 4UUNA 1JI3A 5TMBA 3SFVA 3A6JA 1JDNA 4JLPA 5E8JA 5TRTA 2WNHA 3PEEA 4WW0A 2G1PA 1BYIA 4PYJA 2HA6A 4YRNA 1B15A 4BMCA 3IUYA 5L7WA 1ZQ9A 1VIMA 2J9ZB 2DP4E 4QA9A 4EX6A 1NMYA 1KXJA 1T24A 1WQ3A 3NTXA 3N87A 3UT5B 5FKJA 1KY5A 2OPBA 4X90A 1PFGA 2GPTA 1G3QA 4X9XA 3WQRA 4UUAA 5ICEA 2CHQA 3WDLA 3KKPA 3DJYA 3OWHA 1QIMA 2ANBA 2ZITA 2GNAA 5AUQA 5CAEB 2JZOA 4AP9A 5DM70 2IY9A 4XWOA 4WCFB 4EFMA 4XLZA 2O3TA 1DP4A 2J45A 1KPIA 3D5QA 4O4JA 1G20A 1K7CA 1UDAA 3SFZA 4KXXA 3ZHCA 1RI3A 2G8NA 2QR3A 4ZV9A 5HFAA 4LA4A 1AY0A 2AF4C 3V48A 4E33A 1Z5VA 5FWDA 4WFJA 4O4IF 3DAHA 2FSPA 2P8SA 1NXSA 1QP4A 3FYUB 1N3LA 4DABA 3FKQA 1N2CA 4Q18A 4QYIB 4ND6A 1RYMA 5TPWA 4E07A 1OLSB 3T5AA 4O29A 5BR8B 4QU9A 2QQ5A 1GZDA 4ZEWA 1DC4A 3LFTA 2BH2A 5LKAA 1DXYA 2FPXA 2K5UA 4PLPA 4MRPA 1J20A 4XTCS 1GFIA 1F8FA 1P1IA 2A94A 5L3QB 4DV6B 1IHPA 3LT1A 3N2EA 4JT8A 5I9MA 5J2UB 2X14A 2XAUA 4IFEA 2NZXA 2E4AA 1I3KA 1LDEA 1RKXA 1L5VA 1ZI8A 2QGZA 4M1SA 3SJUA 1WVMA 3P8ZA 4AY5A 4QUDA 3UHJA 4UNPA 3M9WA 2C4UA 2GK3A 4G65A 3OJWA 5JAIA 1KJIA 3HBAA 1PK8A 3M1YA 4CQMB 3D7NA 4HDRA 3SJAA 2C2GA 3STWA 4G2TA 5A62A 4TV9B 1GZ7A 5JWHA 3MPUA 1JHMA 3OD1A 2JIZA 5H8WA 1U8CB 4WLNA 3W2EA 1D9ZA 2J0UA 2RI6A 4NIMA 1DT3A 4OK6A 2PS1A 1YZVA 4UFOA 1PFWA 1TYAE 1Z2PX 5BUCA 4F97A 3B1XA 3G6KA 3A6KA 4ZO8A 4F6RB 3WB0A 4PPYA 2DG2A 4RANA 2QQFA 3EAFA 2H4XA 1OHHA 4LQ4A 2CE7A 4AQYB 2WSYB 4M99A 4WUTA 1HEYA 3WRVA 5CLIA 3FVTA 2QL7A 1KO7A 2SBTA 1EP1B 5L95A 2IIVA 3CLUC 2V7TA 5DP1A 3R3VA 4GGPA 3OOYA 1TT7A 2ZYAA 1V37A 3BL8A 4JP3A 3SNKA 4BU0A 1C1DA 2GZHA 2J0SA 1OAAA 3E9MA 2QW8A 2RGYA 3JSXA 3JZIA 2PHZA 3AEQB 4B3CA 1CERA 4RTJA 2DBQA 4O4LA 2YVLA 1EAYA 3RO7A 1S2OA 3DCIA 4NZNA 1SXJE 4HB0A 1W5SA 3TX2A 3ZUGA 3DTVB 1BFDA 3MBOA 3K2QA 3GUVA 4BMDA 2IYSA 3A6LA 4D6YA 1VGQA 3VR5D 2X0NA 2WUGA 3GP8A 5EWJA 3K2EA 4DC9A 1NT2A 4Z4IA 5KWIA 4CKWB 1KZYC 3RT9A 2HKIA 3WRXA 2Q28A 4CL0A 2B2NA 2KWIA 4I6EA 4MS3A 3UCFA 3KSAC 4BL5A 1T5BA 4K6CA 4DY4A 2GXAA 5JATA 1DX9A 2Q2QA 1VB3A 2OGTA 2OV4A 1HORA 3AEKA 3CEMA 3GF4A 3DDWA 2GESA 2JVIA 3IDFA 4YRLA 5AJZA 4B71A 3GEGA 3AIKA 3AB3A 1T6YA 3EIOA 3HPRA 3RT1A 4TRRA 2CSUA 3AZQA 3GPCA 4QATA 3MELA 4EA9A 2AKAB 1DDOA 2WKPA 1D1SA 1DIHA 5G40A 4CFYA 1VIVA 3OQPA 1C0PA 3G1WA 1XMJA 1NV9A 6REQB 5G3ZA 2PH7A 3LV8A 1DLJA 1Z3IX 2QP4A 2YYAA 3C5EA 4OHVA 3ZZTA 2OV6A 1O57A 2NO9A 2NZ8A 1MIHA 1PR4A 5GJWC 2J4FA 3MSCA 4JASB 3G0IA 3A9WA 4I55A 3A9VA 3V7WA 4YCMA 3GPLA 1PNRA 5CHEA 4BVAA 2GZ2A 4RGYA 3GDFA 1TM3E 3LRXA 4KIFA 3VQTA 4Q4JB 2HPAA 5H3HA 1SVMA 3IERA 3IQIX 4XR9A 3ZHQA 1UPBA 4ZYUA 2GBIA 1L5SA 4MVJM 5DNEA 3CKMA 4BX2A 1MLDA 3KOUA 3D3EA 4BY9E 3I4LA 1O0CA 1UBCA 3TTVA 1C1XA 1C9DB 5DGDA 1DG9A 1G8MA 2ZRMA 3E27A 3EA4A 4M6WB 4Z9FA 3VV2A 3VZDA 4NAUA 4BEJA 3E9EA 5FI1B 4B75A 5LKRA 1KY3A 2GJSA 3WWYA 4CV1A 2GASA 4JODA 1OFHA 2OKCA 3WISA 5E6UB 5CLGA 3FNEA 1BH2A 1IG3A 3IS3A 2A33A 3LC1O 2KM1A 3LBNA 1PFKA 2VT3A 3AFOA 1XVTA 1OI7A 4PO1A 3UV7A 2W4QA 4MUGA 2I3GA 3Q8WA 4LNUA 3X1KA 4B3HA 5B7NA 4Y6RA 1THMA 4FZ3A 1LEHA 4C14A 1HY3A 3A4NA 2DETA 3ORQA 2VDQB 1K0FA 1HURA 1WP9A 4HQOA 2OFPA 2WHPB 3I1IA 4ZI5A 4IDHA 4EY3A 1K9VF 3QLUC 3N58A 1S1CA 4HLDA 3S68A 1T3TA 4TTSA 2XIQA 3OZRA 1P45A 1XWIA 1NMZA 2VJMA 2J07A 3URKA 3WSWA 1E63A 4KAXA 1MPTA 2JARA 4PC3A 2OWEA 4C0AC 1SKYB 2A5FA 4NYMR 1X74A 1XZDA 5K3CA 2RCYA 2D54A 3RJ5A 3EQ6A 4HDNB 1C8LA 1KHHA 4LY3A 3WGZA 4F1WA 2ZJAA 5CFRA 4JBNA 2PMDA 3Q6NA 1O95A 4FYYA 3TQTA 1GAEO 3AP1A 4XGQA 4QOSA 4ZYYA 3SI7A 4HWOA 2O2YA 4U63A 5LXTB 4PQGA 3HDJA 4FDMA 1Q57A 1QYDA 5J2UF 4M0FA 2FN8A 1W2HA 4QYTA 5H5JA 1AXRA 2NOAA 3IOCA 4MVCA 4U1RA 4ZO4A 2R84A 4F7DA 1NW9B 2E18A 2X6QA 3EWSA 4F9TA 2V65A 4YR9A 5IJWA 2JFHA 3KKQA 2V6JA 4MHSA 3JPYA 1JIJA 4XUDA 2J41A 3QE4A 4GSYA 4CHGA 3H16A 5HKKA 4NS4A 2QZJA 1KVQA 1U80A 3GRYA 4R2XA 1KEEA 1CZKA 3BRWA 2W2LA 3H83A 4ZAYA 2O0LA 2UAGA 3K1AA 1JBEA 2AFVA 4LDJA 3RFVA 5TJHA 4CL8A 2Z6UA 2X8JB 1P80A 1PVOA 5FRDA 1SD5A 4QOFA 4R16A 2YQ5A 3CX4A 3JYOA 4P38A 5JD6A 2YC2C 1YRYE 5A5EA 4B4UA 1KOJA 2DMRA 1PHPA 4LF9B 2V7VA 2QPOA 1MO4A 2SKEA 2RJNA 1O9GA 4KI0A 4MINA 3W5VA 5G4KB 3HEBA 4P5PA 2DTEA 4C7JA 3WHLA 1QUFA 1E2MA 3AUUA 1Y7TA 1D3AA 3A1DA 2H1IA 4YH1A 3WQSB 3VDMA 1BW9B 1FUKA 1GUAA 3OSZA 4PIPA 3KZXA 1D03A 3EC1A 4Z7OB 1EGHA 4L4XA 1IOLA 4NQZA 3FNQA 5B1EA 3PIIA 1YHZA 2Z1NA 2IF0A 4AL4A 3QLUA 2AMVA 4KLNA 1MR3F 2XVAA 4L5JA 2WJAA 2ZR7A 4MEAA 4NESA 3OQ6A 4DDMA 2O8EB 5KTRA 1B0AA 5A5FA 5FQNA 3LS2A 1NOIA 3MCUA 2C58A 2Z1DA 4KQ2A 2ZRKA 4D9FA 1YK1A 3SHOA 2W6ZA 2ZB8A 1KE2A 1M1UA 1R0ZA 1E6CA 3LOPA 4D9BA 4GKAA 2FN9A 4RORA 1IUPA 4D8XA 3VSAA 2PUDA 3C70A 1QMPA 3FG9A 1Z6XA 2OB2A 2Z30A 4NU6A 1NYTA 4R2MA 3ZV6A 4V03A 2REQA 3T3HA 3P26A 1UBNA 3RANA 3SGLA 4ESVA 2I5PO 1QGAA 1RC0A 1OTXA 2BKEA 3IAHA 4PCAA 3ZDXB 3DLHA 3I76A 1PVDA 1RPZA 4BQOA 3X43A 6ADHA 1E69A 3HXTA 3HJHA 2P9BA 2HMVA 3ROPA 2ZRHA 3MERA 3BTUA 2I7DA 3V4RA 2N46A 4HX2A 3EUFA 1TVKB 5MGNA 1WX1A 1JDJA 2MOKA 3L1JA 4HRYA 4I1SA 3WGTA 2EJCA 4ETNA 4W5OA 3WGLA 1EG7A 5JJ5A 4GI1A 2BEVB 3DBOB 5I3ZA 1YVPA 3KJEA 4D1YA 2Y0BA 3QJGA 3U7QB 1G5TA 1I14A 3DMNA 4M2LA 4D9KA 3FDZB 1C3OA 4MB0A 5F5LA 1EVQA 2Q0HA 4G4SP 5HXAA 3HM9A 1V7QA 3IOMA 2CXQA 1JKMA 4QVIA 2IHNA 5IYZA 3COWA 1T5OA 4GP7A 4MRRA 2Q3HA 1OJLA 1UAGA 2CN1A 1M6YA 1H6AA 4NMLA 3TJRA 3RSHA 4BDSA 2NU8B 4DQXA 3A9CA 4CNBA 5CDFE 1NVUQ 3AOGA 4KNYA 3HPQA 2JJ1D 4A8JB 5GMOA 4G81A 4ETIA 5AI0A 1T9GS 2QIPA 2R6CA 3THXB 4MV4A 1PK7A 3ZJ5A 4ZVQA 3O7MA 2QUBA 3V1MA 4NC9A 4Y7DA 5JC8A 2HGZA 4LF7B 1WULS 3ZIAD 4PCLA 4LRSB 3VR4D 2ZQ5A 1GA6A 3WWCA 4A8HA 2W58A 3KFLA 3WLRA 5LQMA 5J1TB 1JNYA 1SCKA 3PD1A 4ALIA 3C5VA 4ZEMA 1KZHA 1SKQA 1FDVA 2OZLB 2QRUA 2AMYA 1ZY2A 1XXLA 3NGLA 3W3AH 2YZNA 2WR8A 1FTQA 3IEIA 2RAVA 4BRUA 3ESDA 4FYWA 5GIOE 3PPVA 4RIFA 2BIFA 1J8YF 1TD1A 2Y1EA 4UXJA 3I2FA 4BQEA 5CD9A 2B7LA 5C81A 3URMA 5TIIA 3U7JA 1WKVA 2B6NA 3F46A 1PL0A 2JI7A 5BWBA 1CR6A 4IL5A 1PD0A 2KPOA 1FYWA 3OLXA 1J0XO 2FSVC 1G2PA 1K66A 1YDHA 2XNCA 4X3OA 3HVKA 3T1VA 5KYYA 4EJ2A 2GD0A 3M5CA 2PGAA 2WOOA 1ZM4A 3DBVO 2O0KA 2NO4A 1X15A 4WOCA 5KHLB 1XZEA 4ZXFA 2VTEA 1GKIA 1U5BA 3NBUA 1J97A 3PX3A 5TGZA 3SIXA 1LSJA 1LPPA 1TU4A 4HP8A 4XXHA 2O54A 1SA0A 2C99A 3FTCA 3SE7A 1E3MA 3L4BC 2OLEA 2JAXA 2IW3A 4YP0A 1SVUA 3AZPA 4B73A 4D4HA 3CE9A 4XJTA 1BTOA 3I8XA 3OCCA 1VIDA 4P81A 1E3QA 4LXYA 3JR3A 2BEKA 4Y2SA 4CR8A 2BE7A 1RJ9A 2R97A 4HPXB 2IV7A 1ZOIA 1LJ8A 3HXKA 2VHYA 5BO5A 5EIXA 3JD1A 3NHKA 1FS5A 4NWIA 1U4SA 1CLEA 4TKVA 4PYQA 4BS9A 1BWRA 5JPIA 2BN4A 1RPNA 3M5PA 5EWMB 5JWRA 3TBKA 2JC3A 4C5AA 3SJZA 5C1OA 3JQPA 3MTBA 2ZUUA 4C2AA 4YASA 1SXJD 2V7QA 4ZAXA 5CGQB 2FI1A 1OPRA 5DWQA 2QT9A 4O08A 2HHAA 4R1MA 1U8XX 5E9AA 5LL6P 2XTMA 3HCNA 1EHYA 4G4JA 4ZVNA 4F9GA 5B1YA 1IPEA 1FRQA 3EMBA 1KSJA 2VHJA 4UBMA 2F8TA 5C9ZA 4XGRA 1OU4A 2CHUA 2P9HA 4PVCA 1RZRA 3U5TA 621PA 4TROA 1PGQA 1XRLA 1ONNA 3L84A 2FSVA 4R8MA 3TSZA 3WG9A 1H8ED 2HPHA 3M33A 1T1EA 5ALOA 2C92A 3O94A 3OZVA 2Q49A 1ESEA 4RVNA 3FUVA 1KI3A 4TX1A 3CO0S 5JU6A 1W48A 1CY7A 2AOVA 2IZ7A 3CM0A 4QD3A 2WMOB 1V96A 4JHXA 5C1IA 5C34B 1L5ZA 4C7OA 2CBGA 4MR9A 1V7PC 2G1UA 2WV7A 3MS2A 3TLYA 4KR7A 3EK2A 3L4BA 1PSWA 2OFWA 3FNFA 4E2WA 1LBSA 1P7CA 4JVOA 2O8BA 5ARCA 4M87A 3GO4A 3KQVA 4YT5A 1TQHA 1XA3A 3UMVA 4BLSA 3UFBA 1F6DA 1QCYA 3LUCA 5CT5A 5LLTA 3FPBA 5IH3A 1EKXA 5A0VA 5EVJA 1LUAA 3ZQ6A 1E5XA 5KNCA 3SXUB 1Q77A 4EUNA 1GLGA 1OVMA 3L0DA 3S6JA 2WWRA 3TL3A 1KWGA 4FP9A 4FZJA 5INTA 1J1UA 3MZ0A 2P27A 3D2LA 5LQCA 1M34E 3TXAA 4R8VA 3W9YA 1KARA 3Q6IA 2TS1A 3WQBA 1HQDA 3M70A 2Q4OA 2FYTA 3AETA 4MQFA 2AOXA 1KMQA 4WN3A 3RKUA 4E6PA 2J6HA 2HTEA 2P3QA 4RLQA 4PAOA 2JLQA 5H3LA 1H1LA 2QM8A 3B3FA 3SBDA 1EFRD 2GYUA 4MA4A 3UWDA 1YZ3A 1NSYA 2DBYA 2QTWB 3OX2A 1KS2A 5BRAA 3E23A 3COSA 3GZJA 5IULC 4DV5B 1EXDA 5DNUA 2HMWA 3GGGA 1JQ3A 1ZUNB 3GRVA 2E85A 4BXOB 3QEMA 4ZI3A 1UWLA 5G02A 2QU8A 5C5DA 1X1QA 1NVTA 1TYBE 3L0PA 2WYWA 5JQGA 4Y98A 2D2XA 1MZPA 3WIVA 2FLKA 2GFHA 4D8WA 1MFZA 1RKQA 1LC3A 3Q3HA 1J07A 4LSWA 5LBTA 5C8ZA 5EJIA 3KE8A 4WZAE 1QZTA 2ZBEA 3CPSA 1WHTB 2OHIA 3QQ5A 2AOWA 2JGDA 4O02B 3QKUA 2BV3A 1MO6A 5JMTA 2BMWA 2DPGA 3V3TA 3GA5A 2I4OA 5GZ3A 5KYWA 1K27A 1IBLB 4CV3A 1QG2A 1JG7A 1Z0ZA 2I3DA 3EGIA 1DEXA 3GJ8A 4GKVA 4ZZ1A 1BKYA 2W6OA 1EP9A 3O21A 4P3OA 3D6NB 3ET5A 1KAEA 4FFSA 4FZVA 1ZPDA 3WBBA 2AVNA 3EIFA 2RFLA 4Q19A 2FZCA 3DDZX 5IS2A 2Y1XA 1NJ5A 2PL1A 2QT0A 4R41A 3EARA 3DD5A 1AQLA 4WZBA 3GU3A 1Q1NA 3IJRA 4XB6B 3BC1A 3F8SA 5J4KA 1O5TA 1SXHA 5D1NA 2IZ6A 4IILA 3B51X 3V7FA 3IPAA 2QRVA 2PZBA 3U1TA 1RIIA 5KU1A 1PI3A 3IEKA 3E9NA 3LPAA 4AC9A 1PQPA 3PHHA 3VU1A 3O8OB 2HK6A 4PYMA 5CM2Z 4YJHA 3CLKA 5AW5A 4UCQA 4JBIA 5A7FA 2PX3A 4NCKA 2Q5HA 4L74A 1N5LA 2W00A 1VYUA 1D9XA 1T2EA 1E79D 3VRHA 4PHFA 1T2CA 2J3HA 2ZSAA 4DCOA 2QX6A 1T3GA 2NZJA 3LZ6A 3ML1A 1FTWA 3AVPA 3MJSA 3PEYA 3K94A 1FFAA 1XZKA 3DLAA 3FPJA 3JQ8A 2Z6AA 2I3AA 3NDJA 2G5PA 1BDMA 1VGVA 3D0RA 5KYXA 4CEIA 5HGJA 4DR3B 3TQIA 2ZUWA 5ALXA 1O9BA 7YASA 1ZM3A 2AG0A 4HGQA 1R9GA 2VVTA 1KU6A 3OY7A 5ED4A 2IEDA 4G67A 4K6HA 4CM4B 1PL8A 2EQBA 1G3MA 4CKEA 2GTHA 5EI5A 3UXMA 4D0NA 1SIUA 4H16A 1FUYB 5L7YA 2WQ6A 4L8YA 2JL1A 1JPJA 3A1WA 2ZYWX 4G41A 4HQLA 4MAAA 5JFTA 5EHXA 2WVGA 3DE6X 4LOJA 5C2JB 4F4JA 2VS1A 4R54A 2P4HX 5LWHA 2SKDA 3PHIA 3RKSA 5BN4B 3G0CA 3W8RA 1JEYB 3GMIA 3PR1A 3BIOA 4HNTA 5FUXA 3DL2A 3G5TA 2FDRA 3PBKA 4AMGA 3CT4A 3PLNA 5JDIA 2R44A 1YJ8A 5HRUA 2V7WA 3VYWA 3CLVA 3OOHA 3ISJA 1NASA 4K1XA 4LRQA 3NDBB 2NTVA 1BX0A 4KQGA 4DA0A 3DDSA 3R7WA 2JLYA 4MVJE 1MB2A 1FCJA 4AVYA 1K7XB 2ATVA 3IHLA 4RDCA 1C3JA 1JB9A 1U1GA 2XB4A 3QIVA 1HNNA 2FGKA 4KXNA 4O4HA 5CT8A 5IKOA 1EFTA 2H6EA 2VHVA 1HG0A 1R3UA 4MWBA 2V5UA 5HR5A 3KL4A 1EIZA 1W30A 4BAZA 2PLRA 3MRVA 1WR8A 2FV8A 5AIAA 3FCEA 3ND8A 5F3RA 4TTQA 1UODA 2AFHE 4HI0E 1S2IA 3CNHA 3FUXA 2AN1A 5KQSA 1BAPA 3MIIA 1E92A 3KXIA 2W43A 3GHHA 3MTDA 5HOEA 1VKZA 1CS4C 3AKYA 3BPSA 2A1TS 3OM0A 4JJAA 1R4MB 3GJ0A 4YVFA 2P5YA 1AKTA 4ZCMA 1N0VC 3O8QB 1NHGA 1R88A 1KDPA 1Z13A 4GRIA 5BN3B 1XVAA 1F5NA 1WB5A 4CBVA 2VT7A 4EBFA 2R8OA 5EG5A 5FX2A 2AG5A 5K45A 4UBKA 4MGHA 5DXAA 2WWIA 4MW5A 1D4OA 4GQIA 4R6XA 1XVVA 4AUKA 2ZJFA 2X7JA 3QJ5A 4JJIA 4CCWA 1XQ9A 5KYTA 2GRAA 3OFKA 4B3GA 2JA2A 3KPJA 3OETA 3PICA 2A0FA 2L19A 1QRRA 2I33A 1L8OA 2FWMX 3L01A 4CM3A 4RTKA 3HGQA 4UE6A 1AKUA 3V55A 1DBIA 3ZWDA 4BWYA 3LSYA 2J3IA 4GLLA 4X1KA 2XTZA 5GJCA 4E21A 3HXPA 2RHJA 4PQFA 4W6QA 4X3PA 4AMYA 3R77A 3MK31 3QV2A 1CUUA 1DKNA 2Q0XA 1HE4A 3PFIA 5H81A 2ID8A 3A0RB 3R6LA 2D1SA 1YASA 1NV8A 3BREA 1X7XA 2R2AA 3I9KA 3KV3O 5D5PA 1W29A 4AJPA 4KKVA 4BGEA 4BVLA 4CNQA 5ILQA 3NTRA 3AR2A 3O4FA 3HKDA 3SHFA 4S1TA 3OWOA 3O93A 3CG0A 1EWKA 4C43A 1S02A 2OXRA 1W4RA 2F64A 3A58B 2QRZA 4WY2A 5JROA 3K4PA 1GGJA 2QVCA 2YINC 3EVAA 4PLZA 4RPGA 3GK3A 4UE3S 5A4FS 2I1WA 3UMYA 4OHFA 3T7TA 3DZCA 4GG1A 4KFTA 4GWLA 4GOND 4IRUB 5IT0A 3DLIA 1C0EA 3ASZA 4GYWA 4WEOA 3TIIA 5C1PA 4JI3B 1HG1A 4IP0A 1SCBA 1W2GA 3GJ7A 4IXTA 3T4UA 4EGAA 4RETA 4DLVA 3F7OA 3HJAA 3IAEA 5JMOA 5GTDA 3LPDA 2YYYA 1KMHA 2H5IA 4D4IA 4L6AA 3L7CA 3QKWA 2EG9A 3GIWA 3QFTA 4HNUA 4B3SB 2B94A 4MPPA 4TTVA 1FMTA 3CNQS 4G84A 3EPHA 1ZLYA 5BNIA 4C4YA 1P0MA 1W4AA 1XMSA 1AGYA 3PPYA 4MVYA 4BGVA 3P0JA 3BS4A 4J76A 5EHQA 4C4RA 4YJGB 4RA9A 4BJ1A 1HDZA 3VR6H 2ZP1A 4D99A 2ZB4A 2IHTA 1IHDA 2WUEA 2CZCA 5EZQA 3ZG6A 1SC4A 5DP2A 4Z9BA 4KGDA 3AVUA 4M60A 1JYFA 2WYUA 2C2KA 3L40A 1HE1C 2AZ4A 1B8VA 2Q7OE 4KO3S 1U0OC 4EO7A 5LVAA 4BVEA 1N3YA 4B7XA 3QU5A 4B4KA 4IDFA 1RBYA 2AI2A 3PENA 4PLVA 3R7DA 5JSHA 1FQJA 3V1YA 3UAWA 2CLHB 2VC2B 1VCHA 3E8SA 4HYTA 4OIMA 5DCWA 5AVVA 1OB2A 1ZH4A 5EP1A 3TZBA 2GLTA 2IPAB 1EX9A 4IM7A 2VJBA 2VRBA 3A6HA 2OK7A 3ENKA 3LP5A 4IFBA 4ICIA 3SAJA 5JD3A 1EDZA 3CZAA 5KNBA 1KDOA 1DKLA 1UOPA 1POXA 2FEOA 3C3DA 1TAHA 3DG9A 2WQ7A 1ZR4A 3IMGA 4M9UA 5DNDA 3ZTWA 5KQRA 4MQ4A 4A5SA 2NO0A 2QYHA 4Q3OA 3U6KA 3IAS6 3H2KA 4AZSA 1CIVA 3EXIB 2AA3A 3HL0A 5LYJB 2Y77A 1NBIA 4FW9A 4HUJA 1YKFA 3RFXA 1VMEA 2CF5A 3WGOA 1YQ9A 1BHSA 1BCRA 4BLTA 2VXYA 4OXXA 4R68A 2R8PA 4LI0A 4EB0A 5HPYB 3OQJA 1U0JA 4EFKA 3EIQA 4YN3A 1NNSA 4U2EA 1DPGA 2NACA 3L79A 1FNCA 3EDCA 1IZ8A 2B98A 2FQ1A 4UEJA 2GPSA 3BHJA 5EPEA 5CB4A 5LM3A 1OZ0A 5JH7F 4FSXA 3HB4X 1QQ7A 3JATB 1XLVA 3UANA 5L53A 3ZR4B 3K05A 3I4CA 5EY5B 1EEHA 4LDZA 3AY7A 3IUJA 4K7JA 3W1EA 5HFNA 1SURA 1Z0IA 4KPUB 3FFXA 3L7AA 4A6PA 4NV0A 1YI1A 3G0DA 2PUCA 3BRCA 4I50B 4WXRA 4F96A 5BWCA 1Q2UA 3JV7A 4EJMA 5FV4A 1IK6A 2D06A 1RR6A 3ITEA 5AXDA 1TT5B 1WCV1 2WIDA 3FE2A 2G70A 2XIJA 1AF4A 4TS9A 3UGKA 5CJ2A 3NWJA 2V5AA 2ZJ7A 1A04A 4V0OA 4JAVC 1ZK4A 5IVDA 3W2GA 1X80B 2G72A 3U9SA 3H99A 3DFFA 4ASUD 2EKLA 3DWIA 1O9HA 2I54A 2O4CA 3DO8A 4ND7A 3SFTA 3NTQA 3WP0A 3EOZA 1J22A 4G1UC 3QWHA 1OKKD 3P27A 2Z3WA 1NXXA 2ZPTX 3WFJA 3DBHB 3HG7A 2P4SA 4B84A 1FLAA 3DYBA 3I4FA 3LQRA 3L8GA 4RLSA 5HZGA 2BT4A 1C9KA 1E7SA 2MYTA 4LOHA 4BEWA 2UUPA 4KNVA 1GL7A 4OYLA 4ECAA 5JY6A 2DFLA 5DIZA 4MV0A 3DAGA 1UZNA 4NE2A 5AVXA 2QQ0A 5FAXA 4J0IA 4IV8A 1XL1A 4YP9A 4E5UA 3LOQA 4EQ6A 1WCWA 2VJLA 3MRSA 5AXAA 5A71A 4OIFA 5AW0A 3N1UA 1E9RA 2GBGA 1F0KA 5KI6A 4BLQA 4TL6A 2QORA 4DHWA 1ODFA 1A9ZA 1PW5A 1YRQA 2B1QA 1NVWQ 1CP2A 1U0LA 2ID7A 1WUHS 3A0UA 4GRDA 2YY6A 5FHRA 1Y3DE 2JAWA 4MJLA 1VJ0A 4NZ9A 4XUGB 4B3XA 4B3FX 5JHHB 1WTAA 2BSXA 2XYPA 3WYFA 3DNPA 2I66A 4PC6A 3AVXA 2R751 3WFZA 1RWQA 1IIRA 1NXPA 1Q3HA 1UXIA 3AFHA 3FZNA 4H6PA 4PR0A 2JVJA 3A27A 3TECE 1CWUA 2X2FA 3VH3A 1Z8FA 3LP6A 2GEUA 1B43A 1TX4B 4PG4A 4PBTA 4Y1RB 2PZGA 3FWZA 3IP7A 3HY4A 2WJ6A 2XMRA 4CMGA 4DLYA 2XXAA 4QBFA 3C7CB 5CU7A 2I7VA 5DNVA 1SKUA 3N3AC 4IV0A 3LUGA 3TB4A 5ALTA 2C4HA 4A0QA 5LSAA 3LPMA 2AJCA 4RVHA 3HMKA 3FGPA 3BX1A 2X15A 2ISSD 4MW6A 4RCYA 2G17A 3RT7A 4HWSA 2CB0A 1I94B 4OXIA 5A9SB 2PBLA 2FNAA 3N2YA 4M0CA 1RMYA 2VPIA 5HWSA 1IUOA 4B3JA 1A98A 2GX6A 1TGYA 5GP1A 1C3LA 1CZRA 3GAFA 3IKTA 1E60A 3LC2O 5I01A 3I9V1 1VMKA 3HJGA 4CI0B 3JZDA 2OWDA 3D8TA 3ZHYA 1ULTA 3GCZA 2WM3A 3TCNA 3G8CA 1FSPA 3GLVA 1F0NA 1I80A 1NBMA 4Q9LA 3GVCA 1OWMA 4IUYA 3TH5A 3SZLA 2DU8A 1QIFA 3L0CA 1XKXA 1AKWA 3IQZA 1IXRC 2O06A 3K9GA 4Q9AA 2C00A 1Q1GA 1K6XA 4ZWNA 3RAJA 3IP6A 4ARCA 2TMKA 4ID3A 4JLVA 7ABPA 1T26A 2O07A 1K3FA 4HRAA 3Q6MA 1RWMA 1PWEA 4Q3BA 3CIOA 5LBUA 2NU7B 2ZIUB 3R40A 1MFPA 5IT5A 5K0JA 3N07A 5KDOA 4M38A 1XDBA 1ISFA 2BI7A 4U2GA 1ULZA 3FZQA 4ENUA 4EI8A 2V0NA 4YHHB 4M1EA 3QVJA 4OJTA 1TIBA 3EXFA 3LC7O 2QNIA 1OXVA 3PEFA 4JL6A 1I4WA 4JLNA 1NW3A 3VYUB 4PQYA 4JI0B 2WTMA 3ZKWA 3UIEA 3TKYA 4J75A 5KNDA 3I2GA 2C9BA 1SQ5A 2PH3A 1CZUA 2W2PA 4MV9A 4J0HA 3H3FA 3IQGX 4KMSA 1PEAA 4EVQA 5HDBB 4WA8A 4LSZA 4JVLA 1XZIA 2AUMA 4J49A 2AIRA 3I6BA 5F73A 3PF9A 3ZDDA 3K0FA 4MVJD 2ZANA 5FT9A 5BNFA 3FSGA 1Y5LA 3ZN2A 3Q7TA 2Q8NA 1P60A 1XEXA 1OYOA 1D1TA 1UKAA 4FFMA 1KRHA 3O4RA 4FINA 3VISA 4U8HA 1N2HA 1V5EA 3D8UA 4BYGA 2NAFA 5LYJF 2PNJA 3RK0A 1G4UR 1YJXA 2ZYDA 4GU5A 1NZFA 3FI0A 4QICA 5A7HA 2JCBA 4WIAA 1A5BB 4OHZA 5T6BA 3EIXA 4EATA 2XWSA 1MNAA 3LAWA 2EYQA 1UMKA 3NHFA 4M9XA 4DJEC 5JS6A 1JLKA 4J03A 4MTCA 3QVTA 4K86A 3CJQA 2DJIA 4QGBA 1HMPA 1U2DC 2H2WA 1S7CA 2FEPA 3JALA 1R6AA 2JD2A 3LY5A 4TSKA 4JI4B 3P2IA 1GR0A 3JWJA 3QU7A 3AESA 1R2QA 3BXEA 4GX5A 2PUWA 1UKYA 3T1NA 2WY2D 3A1CA 3TYXA 4PLYA 1TQ8A 5LJIA 4J16A 2ZSFA 5LOVB 2DERA 1HI9A 1ZG3A 2HYDA 2YZGA 2N0SA 5D3KA 2QM3A 1K68A 4EKYA 2OBLA 3UT0A 3QOFA 3A1EA 4ZHQA 2G7MC 3IIJA 5HKOA 2VP6A 2HO5A 2PDAA 4FGSA 1P1RA 2B9EA 2Y76A 5E1OA 4C7VA 4I50F 2FA9A 4KK3A 5DBIA 3NHPA 2DFVA 5BQOA 1LB1B 1JSRA 1CZOA 1Z5WA 3ZU3A 4UOQA 3MGAA 1PRYA 4L0MA 4QUHA 1QFMA 3CO5A 3FMIA 1FNBA 1KWKA 1M9NA 1T4CB 2PRSA 4IJ5A 2QG6A 3GJ5A 4LOAA 5AI8A 1SFRA 3NPAA 5F78A 5BW4A 3TUJC 1OWOA 1VDZA 2PQ2A 1GNTA 3C7TA 1GTVA 4MRMA 4FQ7A 1CVRA 4IY1A 1JXQA 3PITA 1IY2A 3DC2A 3GBPA 5CBKA 3X1YA 3TSOA 3PD0A 4K28A 1G1MA 2GYWA 5JANA 1T13A 4ARZB 4AS2A 2NG1A 3ZCTA 3KR0A 4URHA 4AYTA 1X87A 1UZMA 1AK9A 3T7CA 3GMDA 5KTNA 4V02A 3SJBA 1KYQA 3KYBA 5B6JA 3SZ3A 3KLOA 3WMFA 1CD5A 3KYDA 5IG2A 1AGXA 1KK2A 3DC7A 3HCDA 3G2NA 4PZYA 4N82A 4DQ0A 2ZTLA 4Y1FA 5ABPA 2AFIE 2EKQA 2NQTA 5COAA 1PLJA 2NSYA 2X1LA 1AKMA 3SY8A 3OFVA 5GWXA 5AMXA 1BDBA 4IH1A 3U37A 4AKTA 1FF9A 3RVJA 1Y6JA 3VNUA 3UK2A 2CSXA 2H48A 2PQ0A 1FFGA 2IEYA 4GC9A 3DAYA 1NX9A 4H2DA 1EUQA 3A1VA 4I4TA 3WKEA 2C82A 3D4NA 3EEIA 1U2DA 3FVRA 1X38A 4GFDA 3NT4A 5L8VA 1E1NA 4MI3A 1JL3A 1BO6A 1NFFA 3IQEA 2WTEA 4WCVA 2VUTA 2WMYA 1A5TA 3IV9A 3UOWA 3CG4A 3TNJA 3QEAZ 2QZZA 2UVPA 4RVUA 2BP7A 3PXEA 4DM3A 1W7AA 1KEPA 3VGPA 3PC8C 5LNK6 2FPOA 3B60A 4BFTA 4DMHA 3IPLA 1AS2A 3H2JA 2PT7A 1Q95A 2IPOA 3EZXA 3JQ7B 1FW8A 2B4QA 2NLOA 4YCCA 3ROKA 3PE3A 2D2EA 2W98A 2PXHA 4R84A 3ZZUA 5KWSA 2O14A 1OFTA 3RADC 2H18A 4YJ3B 2LCQA 1O03A 2RH5A 1JR3D 1NQAO 3V4SA 3KXLA 3AERB 2QRJA 1V5GA 4RHUA 5THXA 2IWHA 2RMKA 3UF0A 4KXQA 1G98A 4HSGA 3K9HA 2OZKA 5T6MA 2X2OA 1V8BA 3U3DA 1WCIB 1U0HC 1F06A 5GONB 3PGLA 3NDRA 2G5CA 4J94A 3ZWKA 1UKEA 3ZWMA 4DV3B 1NMSA 1ORRA 1SEVA 2ZUBA 3N6RA 2JLSA 1REQA 3ZEAA 1KQGA 3VHXB 5L3ZA 1M1YA 5DHQA 3BRSA 5BMVA 1FSZA 2O5EA 1EE9A 3UT6A 1HR0B 1P6QA 1PFYA 2WA1A 4FHEA 2JLBA 3RSLA 1M2GA 5LU8A 3E5RA 4TMYA 4I66A 3HA5A 3P0IA 2TRSB 3BF8A 1ISSA 1USGA 1BMFD 1ZVMA 2H3HA 4UFNA 5DYYA 1EFVA 1I7LA 3L6UA 3TDMA 1NJ1A 3L1KA 2AZMA 1I4TD 2A30A 2EIXA 4MCIA 4OKNA 4AM8A 4ZALA 3GLHB 1XZQA 5DIFA 4ZZIA 5D87A 3L7BA 4GP6A 5YASA 5B55A 4K26A 2I4NA 1YQEA 2X13A 3AHIA 5EYPA 1MX9A 4PO9A 1GPUA 2RBEA 2WG2A 4HN2A 3IMCA 2PX2A 3CJRA