3FPHA

Crystal structure of e81q mutant of mtnas in complex with l-glutamate
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
264
structure length
264
Chain Sequence
SCYIYWDKIKRIASRLEGMNYHFDEMDTSGVMPLLDEIEEIAHDSTIDFESAKHILDDAEMNHALSLIRKFYVNLGMKLQMEKAQEVIESDSPWETLRSFYFYPRYLELLKNEAALGRFRRGERAVFIGGGPLPLTGILLSHVYGMRVNVVEIEPDIAELSRKVIEGLGVDGVNVITGDETVIDGLEFDVLMVAALAEPKRRVFRNIHRYVDTETRIIYRTYTGMRAILYAPVSDDDITGFRRAGVVLPSGKVNNTSVLVFKCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Crystallographic snapshots of iterative substrate translocations during nicotianamine synthesis in Archaea
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Biosynthetic protein, transferase
total genus 96
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03059 NAS Nicotianamine synthase protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3fphA00
3EVZA 4E2WA 3P9IA 2PBFA 2XYVA 3G8AA 5FA8A 3LECA 3ELYA 3R3HA 5KVAA 1RJEA 3M6UA 3V97A 5DX8A 3FPJA 2H11A 5FHQA 5E9JA 1AV6A 5BW5A 1JG1A 1F3LA 3P71T 2JH8A 1WXXA 3LL7A 1PRYA 5ERGB 1EIZA 5DX1A 3KU1A 3P8ZA 5FWAA 3G8BA 2ZCJA 4FP9A 2AOVA 1EJ6A 3LBFA 2VDWA 4YUYA 4KVZA 4YV0A 3KKZA 3B3JA 5LQRA 1G60A 3RIEA 4DCGA 2IIPA 5P8WA 1JG3A 1AQJA 3EGVA 1UFKA 2IH5A 4YV2A 3KQYA 4ISCA 4EVIA 2OB2A 5D1NA 2DULA 4PINA 4V0RA 4AX8A 4YUZA 4QPNA 3HCDA 5CVEA 3G5TA 3PVCA 4GOOD 5GM1A 4OBXA 3HVKA 3MHTA 3GXOA 1IY9A 5E1MA 1I1NA 2OPBA 1ZKDA 3UJAA 4E2ZA 2C7RA 5DWQA 1KYZA 2ONYA 5F2OA 3VC2A 1KR5A 3EVCA 2JHAA 1M6EX 2B9EA 5BW4A 2QM3A 4GF5A 2P7HA 4HG2A 4ER6A 2FYTA 1QYRA 2OB1A 2ZVJA 3EVBA 3GO4A 3PT9A 3DMFA 1DL5A 3MQ2A 2G8NA 4O29A 5E8JA 5EMJA 7MHTA 4PCAA 4PYIA 5FA5A 1IM8A 3GRUA 2HWKA 2Y1WA 2OZVA 2PSSA 3NJRA 3O7WA 2FK7A 4POOA 3DXXA 3NWBA 1R6AA 2PVCA 3UJ6A 2Z6UA 1UWVA 5K0LA 4E70A 2N47A 3HCFA 2B3TA 5HIJA 4C4AA 5DM4A 3FPHA 3O31A 3A7EA 5K8VA 3FTDA 3E23A 3BKWA 4LECA 4GC9A 4MTLA 5DM2A 3Q7EA 2B78A 3TKAA 1KP9A 2P3QA 5EC8A 1UIRA 1SVUA 3KQWA 4ER3A 1YFLA 4BLUA 3G89A 4QDKA 4RTPA 4OX9Y 3KR0A 4RWZA 5D1HA 1WZNA 2CWWA 3GDHA 3EEOA 2AVNA 1WG8A 2QRVA 4FS8A 5GIOE 3P2EA 4HSGA 3EVFA 3UBTA 1N7IA 1FBNA 2AOUA 3O4FA 3KQSA 3G5LA 2O0LA 4M7RA 4KIFA 4ATNA 1NKVA 2DPMA 2PXCA 3UJDA 3HM2A 4M36A 5EG5A 5LQKA 2IDKA 3LGAA 2ZSUA 3I5UA 3JWIA 5LQNA 1JQDA 3OZSA 3KPWA 3OFKA 4HTFA 5EIWA 1ORIA 1AF7A 1IXKA 4DCMA 4CKBA 1KXZA 2BM9A 3PS9A 1G6Q1 5LQCA 1P1BA 3BWYA 4IKPA 3ME5A 1FP2A 1NW8A 1WY7A 2EG5A 2PLWA 4RTRA 3ERCA 3DXYA 3LX6A 1X1CA 2AOTA 1VIDA 2QE6A 1G55A 3JWHA 2Z6QA 2K4MA 4C08A 5KYGA 3DXZA 5LQAA 2G70A 2JH9A 4Z2YA 2VDUE 4ER0A 5C1IA 2G1PA 3MERA 1G8AA 4PYNA 1RJDA 2I7CA 2QRVB 4LWPA 4XUDA 4AZVA 4YUXA 3X0DA 4IWNA 5KQRA 1Q0SA 3DP7A 1TW3A 3GNLA 3OFJA 4WXHA 2ZULA 3C3PA 1WS6A 3FUUA 5DM0A 2ZBRA 2YX1A 4EMSA 5T6BA 5E2AA 1YFJA 1JG2A 3CJTA 3B3FA 3HCBA 3M33A 2O05A 3V8VA 1X1BA 4E31A 4QVKA 3NTVA 5EPEA 3MCTA 2H00A 4RYLA 4AZWA 5CCXA 4MIKA 4QTUB 3TPZA 4CTKA 5HIIA 2CKDA 1L3BA 5G02A 2QY6A 2BR5A 2XVAA 3HCCA 4LWOA 5GP1A 3SVZA 3U81A 4KIGA 3KR9A 3OE4A 1NE2A 2AN3A 3VC1A 3KR2A 1QAMA 3REOA 2AZTA 4CKEA 4DMGA 2GS9A 3D2LA 2F8LA 5E9WA 1SUIA 2B25A 1VBFA 4EK9A 3B5IA 3C0KA 5DXJA 1I9GA 3L8DA 10MHA 4PWYA 5LSAA 2PX5A 1BOOA 2YUIA 3HA5A 3M6VA 1ZG3A 3NDIA 3FUXA 4XUCA 5EHIA 4DZRA 2Q41A 4OA8A 5C9ZA 1I4WA 4F84A 8MHTA 2GLUA 3MTEA 1NW3A 2ZW9A 4A6EA 3M6XA 3EMDA 4QPPA 1FP1D 3FTFA 2WA1A 4EKIA 3DLCA 5K05A 1X19A 2BR4A 1VPTA 2PXAA 2IP2A 3EVAA 1D2GA 1XJ5A 2KW5A 5EEHA 4CKCA 5BXYA 1JQEA 1SKMA 3ORHA 4E2XA 1M6YA 1SUSA 2JG3A 1X1AA 3HVJA 4FSXA 4P7GA 1JSXA 1O54A 2GPYA 2PT6A 1ZGAA 4MWZA 3FUTA 3NVKI 2G71A 3G88A 5EZSA 4R8SA 5CCBA 1NT2A 3I58A 2GA9A 3PX2A 2NP6A 1XDZA 2HNKA 1WXWA 2AOXA 3AXTA 3LBYA 5EOVA 5IH3A 3G7UA 3HCAA 3KPJA 5HZMA 4GOMD 2OXTA 1RI5A 3THSA 4A6DA 2PJDA 5EHGA 5K0EA 2NXEA 4JXJA 2FK8A 3THRA 4RTMA 3FZGA 4QQKA 5DLYA 1XCJA 4E33A 2YXEA 2C7PA 1VQ1A 4NECA 4HGYA 5EQJB 1INLA 1HNNA 2OBFA 2NNWB 4K6MA 5F2KA 3T7SA 1ZGJA 5JUWA 3RODA 3K0BA 4PYLA 1DUSA 2NXCA 4YMHA 5HEKA 1JG4A 2ZIEA 1XCLA 3BXOA 3SMQA 3IV6A 3Q87B 4XUEA 3TQSA 3AJDA 1Z3CA 4EQZA 3CCFA 3HEMA 4C03A 5DSTA 4EKGA 2IH4A 3JWGA 3LKZA 3I9FA 4RTNA 5DPMA 3BWCA 3DR5A 5DRYA 2HMYB 3A4TA 4BLVA 3GU3A 2OY0A 2YTZA 4L7VA 3PFGA 5ICGA 5CVUA 1JTFA 2EJTA 2ZZMA 2AN4A 1F38A 2IBTA 1R74A 2Z6AA 1YZ3A 4GOND 2AN5A 5K0GA 1RI1A 3ER8A 4C06A 4X63A 1AQIA 2IGTA 4FSDA 3OZTA 3M4XA 1P1CA 5E2BA 2R6ZA 1KYWA 2JHCA 3OU7A 5CVJA 2BR3A 3G2QA 4FZVA 3VSEA 4PGGA 4MQ4A 4E32A 3HVHA 3CC8A 5EMMA 3GGDA 3C3YA 3UJ9A 4C05A 1JTEA 2JHPA 2VS1A 3BGDA 3EMBA 3FPEA 2YR0A 3BWMA 2VDVE 1NBIA 3AXSA 5CVDA 4ZTBA 2PX4A 5CIYA 2IBSA 2PGXA 3F4KA 1FPQA 3TMAA 4RTJA 2P7IA 1ZQ9A 3QOXA 4AUKA 3SX0A 4DKJA 5KS2A 1VLMA 4RSRA 2PT9A 3TKYA 5FHRA 3OE5A 2EJUA 5K0BA 3FUVA 1ORHA 3FRHA 1VL5A 3EGIA 4FT2A 1YF3A 3H2BA 4PONA 2IPXA 2ESRA 2ZBPA 2UYOA 3UZUA 2NYUA 1X1DA 5GWXA 3EEYA 3TOSA 3LDGA 4PGHA 2P40A 4C04A 2EFJA 1OR8A 2UYQA 3OCJA 4RTLA 4MHTA 1XDSA 2V74B 2I6GA 2VP3A 3NMUF 3G2MA 2YXDA 5CD1A 2AVDA 3FYDA 4R05A 3B3GA 1XXLA 3ELDA 3JWJA 5M5BA 3LCUA 5K0NA 2XYRA 2YVLA 2NXNA 3BUSA 3IEIA 1JSZA 5BP7A 3UA4A 5E1DA 2PKWA 3C6MA 2P41A 4HRAA 2WK1A 1V39A 5DX0A 5HIKA 5DTQA 4RVHA 4B17A 2NP7A 2P3OA 3T7TA 1RI3A 2HV9A 3FPFA 3KQVA 1L3IA 3MCZA 4RV9A 2XYQA 1D2HA 3DMHA 5ICCA 4YUVA 2ZZNA 5K0CA 3SR4A 4M38A 4DF3A 2P3LA 1QAQA 1EQAA 1QZZA 1JQ3A 5E1BA 2G72A 2XVMA 1YZHA 3GRVA 4QQNA 3SXJA 3GRRA 3E05A 3HA3A 2UZ4A 2PWYA 4RTSA 3UJ8A 1L3CA 4OA5A 5E9QA 3UJ7A 4X41A 5FCDA 3TM5A 3BGIA 3SSOA 1N7JA 2YXLA 2O57A 3GIWA 5GOZA 3MTIA 4M37A 3PB3A 4QDJA 3TFWA 5ICEA 1G38A 1D2CA 4GEKA 4P7FA 3EPPA 4IV8A 3G2OA 3DMGA 2OO3A 4YV1A 3E8SA 2PX8A 5C0OE 5HILA 5FWDA 2ZBQA 3RW9A 3EVDA 4U7PB 5B1SA 1RI2A 3BT7A 5EKUA 1H1DA 3S68A 3P2KA 1YUBA 3QOWA 5F2NA 5LR6A 1M0EA 3LDFA 3FRIA 5FQOA 1R8YA 5EVJA 5CVVA 3GRYA 3KPUA 3P9CA 5EMLA 1O9GA 5U4XA 4RVFA 3BZBA 4P58A 2C7OA 2ZIFA 4RTOA 3TR6A 9MHTA 5DT2A 2OYRA 3KQPA 5K0JA 5E1OA 2ZIGA 4YMGA 4AZTA 5LQJA 4KWCA 3P97A 3UWPA 3TRKA 1N2XA 1Y8CA 3CVOA 3ELWA 3LSTA 4E2YA 1DCTA 4RVDA 5DM1A 3MB5A 1L9KA 2PX2A 3CGGA 1EJ0A 3EGEA 1KPHA 2H1RA 3HNRA 2P35A 5DSXA 2ZLBA 2IFTA 4G56A 1RJGA 2NXJA 4QVGA 1KHHA 5GIPE 1U2ZA 3M6WA 2ERCA 5FUBA 3SGLA 1MHTA 4GC5A 3CJQA 3TM4A 3GJYA 4C07A 3NDJA 3DULA 1KPIA 3IYLW 4RTQA 4OQEA 1PJZA 4KDRA 3VYWA 4PCLA 4RTKA 3MAGA 3A7DA 1VP3A 2PXXA 4KW7A 5HFJA 2I62A 3DUWA 3FTEA 4R6XA 3KHKA 2BM8A 2ZZKA 4PYKA 5EKXA 3HTXA 4X61A 4F85A 4PYJA 3LDUA 2A14A 3TLJA 2ADMA 2ONZA 2QYOA 4DQ0A 2FPOA 2CL5A 3A25A 3OZRA 1NW7A 1R18A 1SG9A 4HC4A 4PIPA 3UFBA 2O07A 3EVEA 1R00A 2B2CA 2C7QA 4Y30A 1TPYA 2BZGA 3DH0A 4BP1A 4XCXA 4U7TB 4KDCA 3BKXA 5GINE 4P7JA 4UOEA 3KQOA 1VP9A 1JR4A 3OU6A 2PY6A 4X60A 3HP7A 3SSMA 2ZTHA 3SM3A 4ER7A 1QANA 2AR0A 2P8JA 3A27A 2UYCA 1ZHFA 1L1EA 1RI4A 2PV0A 3FTCA 3I64A 3OPNA 1Q0TA 5E8RA 1KIAA 5DRTA 1XTPA 2JJQA 4OBWA 4BP3A 4ER5A 3KR1A 3AWIA 5MHTA 3EVGA 5H02A 4RX1A 2ZFUA 5K03A 4HGZA 5CUQA 5JR3A 5ICFA 4PYOA 5K01A 4LG1A 1FJXA 4RVGA 3ER9A 2CMGA 2XBMA 2O06A 4AZSA 1P91A 2IDJA 4KRGA 1TW2A 3PTAA 4BY9E 4P7KA 4R8RA 3UA3A 5EGSA 5FQNA 3DTNA 3FPGA 3PX3A 4FT4A 2VZ9A 3IHTA 3WSTA 3T7RA 2AS0A 2V7EA 1R8XA 1SQFA 2ZWAA 4Y2HA 5EIFA 2FRXA 3KPVA 5DTMA 5LQUA 2IH2A 3LPMA 3CBGA 1SQGA 3MGGA 3HVIA 4OQDA 3BGVA 1T43A 2HTEA 2OKCA 3LHDA 2FHPA 2CMHA 4YUWA 5IKMA 5K0FA 3B89A 3R0QA 1MJFA 2EX4A 3NWEA 3UJBA 3P9NA 2PWPA 2AOWA 3G2PA 4V0QA 4GUAA 5K09A 2E5WA 3C6KA 3HCEA 4BLWA 5FULA 3CJRA 1BKYA 5HOQA 4DA4A 3BWBA 4DM3A 3K6RA 2YQZA 3GCZA 2WA2A 1YB2A 3NVMB 5EZQA 3KQQA 3HA7A 5GM2A 1B42A 3DOUA 3UJCA 4E30A 1XVAA 2ZWVA 3ELUA 1RJFA 5FADA 2BH2A 4PIMA 3FUWA 4HH4A 1G8SA 4PYQA 4GOLD 3T0IA 1NW5A 5KQSA 1NV9A 3PFHA 4WVLA 1O9HA 3CKKA 2I9KA 4CXMA 3QV2A 2AOUB 4GBED 2GB4A 3B7PA 1NV8A 1P39A 3I53A 3ID6C 3KQTA 3R6TA 1KPGA 2LD4A 3GRZA 3M70A 3P9KA 5T64A 3LCVB 3LCCA 1XDUA 3GWZA 3R9XB 2Y1XA 3KPYA 5T67A 2P1DA 5FTWA 4GQBA 4HTFB 3E7PA 4CTJA 2GAFA 3NW9A 2R3SA 5CM2Z 3R24A 4X1OA 2HR1A 3PLAE 1NBHA 1VE3A 3LKDA 3OU2A 4R6WA 5DTRA 2GH1A 3DLIA 1HMYA 4FR0A 2UYHA 3A26A 4CWAA 3AY0A 5EMKA 2FCAA 4QTTB 5EEGA 3SSNA 4PNEA 4IV0A 4PYMA 1QAOA 1EG2A 5HIMA 3ANXA 1NW6A 3FYCA 4FGZA 3KQMA 1BHJA 3P2IA 4F86A 1EAMA 2AOTB 4H0NA 5DXAA 1BC5A 2ORED
chains in the Genus database with same CATH superfamily
4YYZA 5FTNA 2AFIB 4OHYA 2PZBA 1ZL0A 2OZLB 4QT0A 1U3DA 1EVJA 2HSZA 2Z4SA 4WCFB 1Z7BA 2IOHA 3Q2IA 1SXJB 1UWLA 2XNKA 1J1IA 1EFDN 1N3YA 1BWQA 3KYBA 4X20A 3E1KA 5IAEA 4O02B 1MLDA 1A97A 3P71T 5DHSA 1XLTC 1CJTC 3FNFA 2YWCA 1TO6A 2IITA 4RHUA 4H4CA 3LXXA 3ZXXA 5IAAA 3V6MA 3ZGOA 4UASA 2AJBA 3KKZA 3NNSA 5JT1A 2FW9A 1J70A 3E3LA 2B6NA 4F8YA 4DCGA 1GPKA 5H9WA 1I1HA 3ZNNA 4QU0A 3NHSA 3AVQA 3IEPA 1SHUX 2XA1A 1N2IA 1U7OA 4ZYVA 1T34A 2PU7A 5KPDA 1A2OA 3TLGA 2BFPA 3MHTA 2GRJA 1FU8A 1RMTA 1S2GA 4QDTA 5SYNA 4B6QA 2NMVA 1JKXA 5AK6A 1UBMS 4TYNA 3EAGA 3EULA 5CG2A 3EVCA 4UBNA 1VMIA 3ORYA 4TTAA 3LM8A 4M60A 1GXSA 4UTRA 3LLUA 4ETMA 3Q8MA 3HSSA 4K9RA 4D82A 1TPZA 1WZIA 2BEKA 2EF1A 4DDUA 2WJ6A 3VNVA 4Z1OA 4BC1A 1II0A 1G0OA 4N9WA 1M34A 4PAGA 4KIUA 1TF5A 1E2JA 3MT0A 5LP6B 3PNPA 4IL5A 1A27A 1YI0A 3IVRA 4PX3A 4F4JA 3MS4A 1IK6A 3L92A 3EYWA 2ODAA 2YVQA 2WE7A 1K89A 4C5BA 3BHJA 4DQDA 1E6UA 1IBSA 3R0VA 1DEOA 1VFPA 2N47A 2FQXA 3DOOA 5ARCA 1BDHA 3M4JA 2HQSA 3S1SA 3RRFA 2XCSB 4CIBA 2EHDA 1E6LA 3JARB 3L07A 5ELXA 4GXQA 2LNDA 2JLQA 3D02A 3K0CA 3Q7EA 4K1XA 4D46A 1KFEB 1L7BA 1T91A 4OVKA 4IIHA 1E0JA 4Y6PA 3OAAA 2RGGA 5DOVA 1J99A 3O6VA 5IDVA 2QRHA 4FWIB 4FYYA 3WLSA 3DEKA 1VSVA 1CS0B 2XUOA 1BTOA 1V5FA 5G0TA 4PZAA 3ZCRA 2JGLA 5CURA 3AB7A 3HYCA 4YGYA 5K45A 3I6BA 1UWCA 3UIEA 3K70B 4PNHA 4FMDB 4LVUA 1ZINA 4YJ2A 1DFIA 2FMHA 4DBZA 2Z98A 2ZCUA 1QGDA 2OAP1 4PVDA 2NZ8A 3HP4A 4NS1A 1I30A 1CUFA 1VJ5A 1QQ6A 3FYUB 3OJ0A 5DBGA 1E5QA 1ID8A 3KPWA 1L2TA 5EIWA 4J07A 1TAUA 2IUTA 2HHLA 4WZ6A 3ZDFA 4BB6A 3MN1A 1MABB 3V4OA 3CIFA 4JLKA 4XX1A 1VGQA 4R1PA 5CDGA 3QMPA 4WINA 1XTUA 2NVUA 3G9UA 3OM8A 2RGNC 1DC4A 4BNGA 3KJEA 3DXYA 2G63A 4B5LA 1QB8A 1QJ4A 1E3IA 1XRLA 2FW8A 1ACJA 3LHFA 5EHXA 1GDDA 1BZYA 1S7CA 5F78A 2RB4A 1G1AA 2AE1A 2OZPA 4K6OA 3PE4A 3U48A 1Y89A 5DGCA 1KJZA 2XRFA 4JC5A 3KVVA 4NHOA 1ONPA 3NM4A 2QRVB 3PEUA 1AS2A 2XVZA 4NENA 1C14A 3H1PA 3OFNA 3Q8XB 4FCCA 4XQEA 4DKXA 4JT4A 1WXIA 2CLHB 3PYLA 3A6PC 4QRHA 2WICA 1JWLA 3FFWA 2GK7A 2B35A 1Z34A 1H0RA 3AO0B 4G3XA 2RH4A 1S6YA 4NDAA 3ADOA 4P84A 1M8GA 3JATB 4H1VA 5KQPA 4ZPJA 1O57A 4YFYA 4QD3A 1FMJA 1V3UA 1BFDA 1D1PA 4DNPA 1HDCA 2OE2A 3L7OA 3ZCTA 5DFAA 1XNGA 3QFSA 2YMLA 4QTUB 2VDJA 1CQJB 1CY0A 1H4VB 4HB0A 1JW9B 3RUPA 2HZBA 4UVGA 2W0MA 4NOJA 1QO0D 3PIDA 4KIGA 3VYVA 4UD2A 2A5FA 2BFDA 1GY8A 3REOA 2FFJA 2AW3A 2QF7A 3B9RA 2GZSA 1TJYA 3H3FA 1CF9A 1ZRHA 3CH7A 3HCPA 3NAQA 1A9OA 3FWHA 4IX9A 5BMVB 2C03A 5I7HA 1G64A 3CA8A 4G8JA 2OHOA 4B6SA 1YAHA 5D8DA 3B2NA 4EJSB 5CBKA 4KHPB 3EXHA 4KK3A 4WV3A 4CU5A 4BKQA 5C3MA 2Q41A 3DB2A 1XDWA 2AUMA 1DKUA 3OC6A 3Q0EA 3T8YA 4A6EA 1R0KA 4CDNA 5IWAB 1BXKA 3CZPA 2BV3A 4N41A 2Y6UA 3IRUA 3H42B 2OQRA 2SECE 4B73A 3VR5H 1OJLA 3EQ8A 3ZE7A 1OLSA 2B94A 3GZNB 1DB3A 1D2GA 2HF9A 4TSKA 2KW5A 1KQNA 4ZJUA 1O94A 2HJSA 3FFTA 3E61A 4OJQA 5FOWA 1GGFA 2JG3A 4GPEA 3TX2A 3AR9A 2Z30A 5K3FA 5FBZA 3CX8A 1XDDA 1PT5A 3LE8A 5KJ1A 1B6TA 1F2TB 3DMTC 1R64A 2J9ZB 3ITDA 3UB3A 1KYXA 5I9LA 2C4KA 2P9QA 4D4IA 2EFEB 2C7GA 2YWRA 3ET4A 3NBQA 2VL7A 3EGXA 5J4KA 4C4SA 2BCJQ 2VQSA 4BNMA 2R8OA 1XHLA 1T15A 4PHCA 2UZIR 4WJKB 3KZKA 4REQA 2IU0A 2NO0A 3ZWDA 3IAEA 4CDGA 1RRVA 5G1NA 3T3IA 3GUYA 3OQIB 4MWEA 4HT3B 1VQ1A 1DZIA 3W5JA 2C7PA 1WEKA 1IWPB 1GAQA 3FNRA 2GXQA 1N2HA 3VAYA 3IKMB 3Q15C 1U2SA 4XKJA 3GOQA 4R68A 1O89A 1UKZA 1TU4A 1JN0A 4QELA 2JFFA 5A2GA 1Y5MA 3AG6A 2L2QA 1ZK1A 2O4UX 2A6PA 3AJDA 1N7HA 2TRSB 1XZ8A 2GAOA 4NZ9A 9GPBA 1NT4A 1FTWA 1MC5A 3K2EA 4JVNA 5DCUA 1VLVA 5BPFA 3FROA 3G1TA 5JDCA 5BWMA 1VB3A 1Q22A 3LCJA 3HFGA 1UANA 4DS3A 2DFLA 2X3UA 5ALWA 2C5BA 1JPJA 4F2HA 4ARZA 2IPOA 1F38A 2YWXA 1D9XA 1R74A 4C0AC 4LA4A 1GNRA 4QXMA 4U2BA 1L5FA 2AN5A 3NOVA 2HNAA 3EG5A 5DBEX 5MGBA 1Y1LA 2JJMA 2HQBA 1CJSA 3TLXA 4CQJA 1QVRA 3AUJB 1DC3A 1MJGA 2B4TO 3DMDA 4OXYA 4EFMA 4UNPA 3RVRA 3AETB 5LWHA 4K9OA 3QF4B 1IPEA 5I6DA 1QQ5A 2V5VA 2YBDA 1HRKA 4H0CA 1FP7A 1Z4IA 3EMBA 4FWTA 4K2AA 2IBSA 4KH0A 2BZSA 3K3PA 4MLPA 5HQTA 3LU1A 1W0JA 2LWIA 5JFOA 1ZQ9A 2ECQA 2C1ZA 4EF5A 1Q12A 1U6JA 5KS2A 1VLMA 5AM4A 4OHPA 3CN7A 4OJTA 1C3LA 3OLCX 1GRRA 4G4GA 4KWEA 3QQPA 2WYOA 2P6UA 1F0PA 2AV6A 3BJIC 3CUYA 4I50F 5DW3A 4TS1A 2OK8A 2V4UA 4B35A 5K5EA 4GLOA 3B53X 1Z35A 4YVFA 3E7FA 1RWKA 2VHTA 2PM8A 4JP5A 3U3KA 1K7FB 3OA2A 4FGWA 3PF9A 1PR1A 3T12A 4XQCA 4ZCMA 3DE7X 1FYXA 4LC9A 2RD2A 2H5IA 1JIIA 3HGQA 3ESXA 4IW3B 3RVKA 2G06A 2XMCA 3W6ZA 3K0AB 3NUGA 2C5LA 2I6QA 1HTTA 1SWWA 2YVLA 4DV2B 3BUSA 1ZCJA 3GL9A 2H51A 4MRNA 3P0EA 4JJZA 4Z0TA 5AVVA 2Z1MA 1HKHA 2GJKA 3DOFA 3K92A 3WYAA 3UMSA 2R8PA 3OSUA 4BPBA 1AXRA 3BQ9A 1R10A 1SXGA 1EK1A 2HV9A 3O26A 4QQFA 1FFGA 2ZBEA 3QA9A 4TQGA 5KDLA 5IM4A 4P98A 4RKEA 2XYQA 3NH9A 4Y1GA 1W76A 2QKYA 3I9OA 2ZT8A 3JQ8B 3A6DA 4G5RA 4Q9NA 1ADJA 1G291 3SJZA 4MK4A 4NJEA 1XLVA 1J4AA 2BMEA 2HB6A 3ZLVA 3GARA 1SFRA 1RR6A 1P2DA 3F6BX 1GG5A 3HDQA 3RHSA 3UJ7A 4RTSA 3G8DA 2Q5EA 2Q1XA 3EWAA 1U1EA 2VAXA 3KUXA 3L5KA 5JS7A 3I6IA 5A62A 2ZBVA 4E21A 2YZKA 4JL5A 4ENSA 2WJGA 5H8WA 4IV8A 3R7AA 4US2R 1IEWA 2CXPA 4KJZA 1MP0A 5H0IA 3NHFA 4CLOA 3QE0A 3EEIA 2ZBQA 3RW9A 2BE7A 4OOEA 4F96A 5ICMA 5LP6F 1GZ5A 3ZK9A 3BRQA 4B80A 4DIEA 2CUZA 3F98A 3R6DA 4TXMA 2M1XA 2JEYA 5F1YA 1IG0A 4YPFA 1EXNA 1USIA 5IK2A 4MUBA 1BJTA 4CRWB 3CRVA 5LUAA 1LBHA 3TRHA 3RANA 3TTVA 4IIJB 1SKQA 2POCA 3AR6A 4A2QA 4J3NA 4PU0A 4YMGA 2R5NA 1XKLA 4IFIA 4MROA 1SO8A 3QU2A 1U81A 4I9NA 4XX0A 1Z0ZA 1JYSA 2CDNA 2IHYA 4R9UC 4BE7B 5HOEA 3FPBA 1Y8CA 3IHWA 2H9AA 5CH8A 3IJ5A 4MUMA 1DGQA 1NN0A 4GVXA 4EF6A 3RRYA 2C5FA 2VXCA 4JJIA 2JIZD 4XQ0A 3GF4A 2MMGA 4BFCA 4KFTA 1Y6JA 2A1UA 3OECA 5FT9A 2FE1A 3I8XA 3ZPXA 2P62A 1LK5A 4QVGA 3L6OO 3B38A 1LPNA 4FMDF 2CLKB 3IMGA 3C1TA 4R1OA 5AI4A 3TNFA 3AHEA 3ZCXA 4UHDA 4NFSA 2OENG 3JYHA 2GBLA 2X40A 4M49A 3RASA 2RAVA 3KB1A 4YROA 4EI8A 3BIWA 4OK3A 1L1FA 3N0RA 3MAGA 5C53B 4L51A 2YV4A 2FQYA 2ZB2A 5H3LA 2QXUA 4WN3A 1DNPA 4OYYA 3T1HB 5JAZA 4Y1EA 1KSJA 3MMNA 1QS0B 3A6HA 3SHFA 1ND5A 4HOYA 3VJMA 1PGPA 1NNSA 1V11B 4P1ZA 2HRCA 4E5YA 1QGYA 3OZRA 3GT0A 4PTYA 4Y2UA 1DQRA 2FOIA 4O2RA 2VDOB 4UHBA 1ZVVA 1ZH6A 2ZEJA 4CUKA 2ZXUA 2WWWA 2B2CA 3OFVA 3QXJA 1AT1A 2AFRA 3DMTA 4NV3A 4R1QA 4WWHA 2ZUEA 2ZPTX 1I01A 2O7SA 3C1AA 4BP9A 4OL0A 3K32A 1GTMA 1OGYA 1EVZA 3M7IA 1BU8A 3KZOA 5BRAA 3DVRX 1LPBB 2E1PA 2ZTHA 3D6VA 5IVHA 1MH9A 4LHXA 2XMGA 3WLRA 4GX0A 1QANA 2JASA 2OAGA 3X1YA 2ZM5A 3KJZA 5E6UA 2JLYA 1RAGA 3OPNA 4UC0A 5FUXA 1HLFA 1U1CA 3DNMA 5FPSA 1MQ8B 4DPMA 4DDVA 4Z2AA 5IUNC 4XIFA 3L43A 5G4KB 3TQFA 1N36B 2G9NA 4IJ6A 5JU6A 3PNOA 4KFSA 1W2GA 3A1TA 3WNDA 3DT8A 1T6XA 1PG0A 4PFJA 4EYSA 5CUQA 4MP3A 2VNSA 2HYDA 3NP7A 1NR5A 4FFLA 4LI3X 2IZ0A 4HNQA 2R1UA 1OLXA 1QFYA 3A3OA 4Q7MB 5BMVF 4G24A 3BIOA 4HDCA 3TXXA 4X65B 2NTVA 3RJTA 4ONEA 1AHNA 1ZJWA 3BYZA 2VF2A 1MAWA 3CH5A 1N1DA 2QT1A 2V6BA 4QYXA 1E2PA 3VSEA 2CBZA 3FE2A 5KREA 1UKAA 1PS9A 4PG5A 3CBGA 1SQGA 1Q50A 2EYUA 1MFZA 2QN8A 3H8SA 4KUGA 1NWCA 4OXIA 2XMSA 5BOSA 4YMLA 2ZKLA 3R3ZA 3AJRA 2EVWX 1F6DA 2OKCA 2HA4A 4LDRA 4R3WA 4Y6OA 4YUWA 1JWAB 1ATIA 5HJ5A 4QJ4A 5B3JC 4ZZIA 1YI1A 2F1OA 1K8RA 4DR7B 4X3CA 1GQQA 2MIIA 3O8DA 1D7AA 4QDXA 3QLJA 2IYTA 3UAYA 2I9PA 3GCZA 3JAWB 4DJEC 2Q4RA 4DR3B 1Q3KA 3UHPA 2PIAA 1GARA 2DKFA 1G9SA 3VU9B 3WVNA 3SSAA 5FADA 4BO2A 3NR2A 4UBIA 3GPBA 3KQLA 1M1NB 1DX4A 1PUIA 4IUYA 5KSYA 1HT2E 5BY2A 4WVLA 3PFHA 3T3HA 4NWIA 4XR4A 5ALQA 1VCHA 2C3PA 2HHCA 2I87A 4NZZA 4NHEA 1QK3A 4MO9A 1MBZA 3SIXA 3WIEA 2NAFA 2WTAA 5IUKC 1FSSA 1Y9DA 3ABQB 5KVQA 1VKZA 5I8PA 1EUCA 1Z25A 3VVCA 1X15A 2HBYA 2V65A 1PV4A 2PTHA 3IPCA 2AYYA 4R83A 3FNEA 1QYWA 5T67A 3E4DA 2C4NA 2B37A 5GONB 5JRJA 3LKDA 1REQA 1PR0A 2GPNA 4EFDA 5EESA 2UYHA 1SCUB 1CYDA 3U26A 2FWIA 3ZIUA 1J22A 3QXCA 1IB0A 1N6LA 3AR4A 1Z6ZA 4N7MA 5FNVA 2O8DB 1YB1A 3I52A 3WKCA 1ZOIA 3ZWPA 3AHFA 4LJKA 5LIRA 4WZAE 1OH7A 3A1WA 5L7TA 4NYMR 1WBBA 1EWKA 4DC1A 2B1IA 1QCCA 1Z7WA 1LUAA 3ELYA 3GCXA 1UT5A 2NUBA 4I5EA 5B3AA 1I2BA 5JWHA 1HYQA 2KJQA 1T3GA 4P82A 1PR9A 4QVIA 3V97A 5DX8A 1H0KA 4RA9B 1Q74A 2H5JA 3UAWA 2H11A 2L0XA 4A6PA 4AO6A 5JD4A 4UEQA 4JUFA 4LBZA 3GFRA 5FUWA 4DAOA 5J40A 1TCUA 3R0XA 1P0IA 3KQKA 4XYMA 1O03A 1B14A 1FUUA 3E3NA 4RVUA 5F76A 5KYUB 3KSBC 4M0CA 2X9NA 3VPCA 3QOFA 4W9RA 4YUYA 3U56A 2QZZA 4YV0A 2GCOA 2EERA 3C4JA 3L7BA 3O4HA 1D2AA 1VKRA 3BFPA 4HDMA 1E2HA 2PRJA 4N3NA 3SJ7A 4LF7B 1JEYA 4OYRA 5DH9A 2Z58A 1AQJA 3KV3O 1UBEA 3LL4A 3DNPA 1LC3A 3FDZB 2H16A 3LZCA 4CKEB 2OCYC 4CM9D 4AX8A 5IVDA 3O8BA 2W58A 2IPMA 5B58T 5EXXA 1ZAKA 4EW1A 5AI6A 1XI2A 4YCLA 3BA1A 4A15A 1MTOA 3HFSA 4RK5A 1BA3A 5E7IA 2DUUA 1TAGA 5ALMA 1KR5A 4IXNA 1IEVA 3V33A 4HYYA 3U7QB 3DLHA 2B9EA 3KJIA 1Y63A 3PD1A 3ZK7A 2XZDA 2XXAB 3KB6A 4DWWA 1EUZA 2FFRA 3MZ0A 3KZVA 4YAOA 4HQ0A 5I9NA 3QKTA 5K0TA 2QRLA 3HWRA 2HWKA 1T4DA 1X7HA 2BFFA 2WAOA 3VHXA 1C3JA 2HRRA 4JY7A 3UMFA 1M1YB 3D4LA 5IVPA 1OHHD 1QFMA 3WQQA 4YALA 2FZ4A 3UJ6A 4HPJB 3WY9A 3MCAA 1PD0A 3S4YA 5GZ3A 2O3JA 1ZWKA 3H83A 3DQQA 4Z8YA 4BFTA 3UGQA 2IGBA 4BQPA 4IG4A 1HUQA 4NATA 2BKLA 3WMEA 2JAWA 3U7EB 1W49A 1D7OA 2VTKA 1EE9A 4UE6A 2IYRA 2Q6KA 3BCSA 1YOBA 3P9YA 3ICCA 2QGNA 1A0OA 3KAJA 4FDTA 5D87A 5JXJA 4E7PA 4QICA 2AVNA 4XLZA 1WG8A 3P0HA 4FS8A 3TGPA 4EHFA 5MN4A 5GIOE 1PFUA 2YDXA 1ESZA 3H75A 4Z4FA 3QELB 4MV5A 5A5FA 1U3CA 1EX1A 4B2IA 3W05A 3SICE 2ZCVA 1A76A 1L8XA 1NF9A 3O3OB 4MIEA 2XNJA 4MX8A 1L4MA 5BSTA 2FB9A 2HT6A 3D64A 5KB3A 2ZTSA 1U0JA 1YDHA 1GPWB 3ELBA 2BFCB 4W4TA 4IIJF 4UW9A 4OTZA 3E9YA 4RF3A 3T95A 1N0WA 1WY7A 2C0CA 1WXHA 2WV9A 3Q2OA 4G65A 4HH0A 1QPBA 4QT4A 2FRVA 2YHAA 1Q15A 4WE3A 2AOTA 5EGNA 4YEDA 4C2TA 2BF4A 2G70A 4Z2YA 3MGBA 3DR3A 4HBGA 4GPBA 3MERA 3Q2KA 1XYYA 2I7CA 3LPCA 1JJAA 1E7SA 3BZUA 2UVQA 4IWNA 4WCFA 3WS7A 2BSQA 4PPGA 3AH8A 1YC5A 4NH4A 5LM3A 1I3OA 4B4KA 2WF7A 2YFHA 1DQPA 4A26A 4D99A 4ZEVA 3QTTA 2Q2WA 1YVUA 4MKRA 4UDNA 1JHYA 5CDTA 5F7OA 2FDRA 1YT5A 4ZAXA 2O05A 1SH7A 3H0EA 3N2IA 1G4UR 1I4DD 3QXGA 4ZCQA 4EHLA 2WVHA 2CUNA 1MRSA 5TSDA 3RIYA 3KKOA 4G37A 4Q1BA 1TVEA 3EXAA 4LMPA 4CTKA 3QWBA 4K9DA 2HN9A 5C7LO 3F9IA 2X8LA 1UM9A 1SC9A 2GSDA 1ZXLA 1LDMA 2D4HA 2XKAA 3PUWA 4NTZA 1UWKA 1U3WA 2GNOA 4DBLE 2Q1YA 3DMRA 2C9CA 1IFXA 3E6AA 4HN2A 1KJ9A 1XVLA 1ZM4A 1K5HA 3LKBA 5E9WA 2XCQA 1KZGB 2FPRA 3GMIA 4E03A 1EFLA 1ZN9A 2EOAA 2BJVA 3HXOA 4DGQA 1S3FA 3KT0A 1ZD9A 4KGVA 2A0YA 1EBFA 2JA1A 2IW3A 3L6UA 3M4YA 3DCJA 3R5KA 3TCKA 2FOLA 2WPDA 4DBLC 3LI2A 4JP8A 4QPPA 3T06B 1UJ2A 1JQ5A 3F3KA 1VIVA 4AROA 2NV6A 2W93A 4JS0A 2R66A 1GL9B 4GX2A 4RAOA 4JBXA 3TOVA 1XJ5A 2Y1EA 5ALGA 4DT1B 1W29A 5LP6A 1JQEA 7YASA 5HYVA 2CSXA 3QU4A 2C2XA 4RZ3A 1JE1A 4X20B 1JSXA 5GPBA 4HB2A 4X1YA 5JNRA 1YB5A 5EZSA 1KK1A 2JD0A 5CR9A 1NT2A 3P52A 3RTAA 3U49A 1PX0A 3SMVA 1XDZA 2W8BA 3WDSA 5EIOA 1QHGA 2V4ZA 3CW8X 3JARA 5IXSA 2QD1A 2B83A 3SQLA 1CRWG 1XMQB 1DAEA 2QL5A 4B8ZA 4DLXA 3NBMA 3H9UA 2F90A 3NHPA 3VTKA 3H2KA 3S5UA 3PXDA 3QOYA 1CS0A 2XTZA 3BWXA 5FPQA 4CEIB 2LCIA 3SEFA 3IOCA 3FBTA 4TN1A 3K0BA 2YJ5A 4WMLA 3QH4A 4GBMA 1NWHA 1JSCA 3VPSA 3U5ZB 1K86A 4PXAA 3BDIA 4G0ZA 4XVRA 2HM7A 1DEKA 5DJ5A 4DXAA 5DSTA 1TJNA 2D6FA 2WYVA 1LZLA 2VYNA 1D2EA 3IVMA 3QKSB 2EW8A 4GRIA 2NVBA 4GMHA 2XRYA 3BGWA 4KAXA 4X6UA 1BG6A 1MABA 1D8AA 3UWMA 5FXMA 4DIBA 3COSA 3S68A 2P0AA 2CLLB 2WKSA 3RK1A 3ZE8A 4NBSA 5BT9A 4QTXA 2IYAA 1IH8A 2FSHA 1LV8A 2QZ4A 4P3OA 1M2KA 2V59A 4BDSA 4WKCA 3F5MA 3RAGA 1AGRA 2IGTA 2AQ8A 2R6DA 3AEZA 2ZSAA 3ZWBA 5LP1A 1CUJA 1XV5A 3OU7A 4C0WA 5KAPA 4RPIA 1DDIA 4JMPA 1BN6A 3FNGA 1I10A 3DAGA 3HJBA 3RYIB 4MW4A 2FFAA 1U3GA 4S12A 1EXMA 1XEWX 4ZTBA 2VDVE 1B93A 1G66A 4JLJA 1U04A 1DAHA 2HDNB 4DR6B 3ES9A 2IHTA 4H6PA 4P4SB 4TM7A 4BNZA 1NNEA 3ZDBA 4MZDA 4MVJM 1IM5A 1P44A 3QOXA 2C99A 4AZ0B 1BDMA 3I32A 5KNCD 1A9QA 1WIWA 4XB6B 5CM8B 1MIHA 1P2UA 2MMCA 1QNFA 2C2WA 1RXYA 2OMEA 1VL5A 1F2VA 3KUDA 2IHZA 3BRSA 3H2BA 4ZAWA 4UREA 1QRSA 3K73O 4I14A 2UVDA 1CQZA 4DUZB 1J0EA 1H4TA 5FWYB 4D3ZA 5ALOA 4ZCTA 1BEUB 1DO2A 4AAYA 5FPKA 3CSUA 1I1OA 4QXAA 3FMOB 2R4QA 2VF7A 4WIAA 1KAOA 3FBGA 4A5OA 4QKQA 3X1WA 1DG9A 2OHXA 1TJ5A 3LQRA 3FYDA 3H8WA 3IPRA 3PQCA 3EF0A 2QNIA 3MELA 3C3JA 4JWKA 4RU1A 3C6XA 3E4CA 5BMVA 3U7HB 3QXXA 4PCVA 1EINA 3A1NA 2VP9A 3ONEA 3K4HA 1NRIA 2J48A 1SCJA 3INYA 4S35A 1YS7A 2D2FA 1LDYA 2PLRA 3AFIA 1YZTA 2DUJA 1DC6A 1DKQA 1RLOA 3H2JA 1BOFA 3NHBA 3GEBA 2FZVA 3GEGA 3H2GA 3QI2A 4DDHA 3GZNA 4LDNA 4YMTA 1PN3A 1CK4A 2FOXA 3BHNA 1TF2A 3W8RA 4O63O 4AMVA 5IT4A 3HRIA 1IZYA 1XROA 1NU8A 1U8AA 5EKSA 3WWCA 4KO8A 5CB4B 1QAQA 4MA0A 4Z4IA 4ND1A 2E6UX 4M8SA 2FWMX 3AP1A 4LY6A 1M66A 3NBAA 4TKMA 4MI1A 1QTNA 5J4HA 1W44A 1JIXA 2R65A 3CNBA 3OCUA 4DV6B 1UPBA 3NV7A 3WJ1A 2C5EA 4I6EA 2XKJE 5P21A 2YXLA 1E7WA 1IATA 3E9DA 4WBXC 3T9FA 4RJTA 1NOJA 1QTQA 3C3KA 5AW4A 1YMQA 1SC1A 3C45A 1P5HA 5JSYA 5EKDA 1O7JA 2AG1A 2V58A 3C48A 4QOHA 2W2LA 1FNNA 1NXPA 1DEAA 3QOWA 3L1IA 1OF1A 2XTMA 4PSKA 1NQVA 2AMLA 3H4VA 1H3FA 5FI0B 3KPUA 4KFRA 3ZWOA 1PZMA 1ZNZA 3ZZ0A 1M8PA 3IKTA 1DAPA 1X14A 1U0EA 2BGIA 2JIOA 2YW9A 2TECE 1QRTA 1RACA 3P1JA 3HDTA 4C7KA 2HZ7A 3AIMA 2AI1A 2WTNA 3GVCA 4JOCA 4FD3A 1WU7A 1GKIA 1PJLA 1BWRA 1QCYA 4Y2XA 2A1TS 3MB5A 6Q21A 3UYLA 1R9MA 2G1JA 4E6PA 1AKNA 3TW6A 2DBVO 2DTDA 4G4SO 1NBMA 3DZGA 3VR1A 1U0SY 2A8YA 1NXSA 5IJ9A 1T1EA 2OCKA 1TZBA 4D7AA 5ALNA 2BLNA 2P68A 5JXWA 4L50A 2X3YA 3R6LA 1P4HA 4EZEA 2IZ7A 3R0JA 3OLYA 2I2CA 1Z2NX 2UYYA 4EGJA 4AJNA 1UADA 2CLEB 4I1SA 4LV5B 5F33A 3VYWA 3LPNA 4XPZA 3FHTA 3SZRA 1VL0A 1W1WA 2G7ZA 1VA5A 1W5SA 3ANSA 3C8DA 4MWOA 5EIBD 3TNYA 3GBPA 3W7AA 4KPYA 1EEXB 1V1RB 1S2OA 3I4FA 4QPDA 1NMXA 3LC7O 4DWVA 2AXNA 3WX0A 2BHNA 5HK9A 1YA4A 1LEHA 1R18A 3D5TA 3D1JA 3E03A 3ROFA 2HLDD 5L7WA 3EVEA 5ALEA 1R00A 3ITKA 3DBLA 2PFSA 1PL0A 1VL2A 1SHZA 2PKYX 3SQNA 4DIKA 3FOZA 3SDBA 2LE0A 3ZV3A 4HZGA 3FM9A 1NX6A 1WXEA 4G0NA 2ZTUA 4GR9A 4WKGA 3JTEA 2ACEA 5DLPA 5HTKA 3DFIA 2OV1A 3QKRA 3H86A 1E1RD 2VJLA 3TL3A 2CJXA 4OKSA 1BGXT 1GZ4A 2C5HA 1E2FA 3RGGA 3A3PA 3LPDA 3WHIA 1QIFA 1PV2A 1H5UA 4IIYA 2XUIA 3KLMX 3WYFA 1RI4A 1LSOA 3WHPA 4FOOA 1Q0TA 1QBKC 1K92A 3TW8B 2QRZA 2IUFA 1YJAA 4IY1A 2AQIA 1GZUA 4GR4A 2CVPA 4XD7D 5SZIA 2AFVA 2P0YA 3NTOA 2H5EA 4IWYA 1WKCA 3KK0A 4EYQA 1U1DA 1QP0A 1P5ZB 2P90A 1YS6A 2FR0A 2J6HA 3DZIA 1MF7A 4NCIA 2VWPA 3VX4A 4BECA 2HMTA 2QMQA 4RM2A 1I4OA 3GEEA 4L3WA 1A4UA 2F4NA 2OBXA 3DTNA 4FT4A 3C5HA 1WLYA 4L9RA 3U37A 3T7RA 4DW8A 4YXWA 4WLNA 1NZJA 3BEDA 4Z3OA 1JDVA 3W79A 4NZNA 3WQHA 4MH0R 4MUHA 4BFZA 4EPRA 3C7AA 4OH7A 3WK5A 5EJGA 2IH2A 3IEVA 4DNXA 4MA4A 3S2GA 3B1XA 5COBA 3TYXA 1PR4A 4P81A 1I2ZA 4GBGA 2CXXA 1V6SA 1BDJA 1L4YA 1OIWA 2GEDA 2ZYVX 4TT3A 3BRWD 3IKJA 1K3TA 5HE8A 2PEYA 4EG8A 2ZUVA 4C4XA 1EFVB 3I28A 4V0QA 4IIGA 5CFZA 1WCIB 4Q9LA 1IUOA 1GNVA 4LZAA 1EDOA 2BTOA 3EF1A 4GW3A 4N0DA 4NIMA 1FUYB 1ZY2A 5JADA 1X9IA 3V7WA 2XUDA 4FC7A 1QRAA 4DR1B 5DK4A 2HQRA 1XVAA 3F4BA 5D6OA 2P77A 2R1VB 3ESQA 1XWWA 2C2OA 4IIJA 5E6SB 4FXPA 4RIHA 5KTRA 2FTKE 3GJ5A 5TIIA 2HEIA 3JYOA 2ZXEA 1K8XB 2W6MA 1PL8A 4HZIA 3RFCA 1ZSYA 4DV3B 3IBGA 3G85A 1R2QA 5CLJA 4QEZA 4NC9A 4G4JA 4YMHA 1QVVA 4BB9A 4RACA 3JCZA 5DW0A 2BAGA 3HRHA 1MOZA 3T1VA 2ECFA 1UZLA 4OHRA 1T6BY 4HLNA 4KYTA 2CZGA 1E63A 3PWZA 1VE1A 3DLIA 3I34X 2VCYA 3OLQA 4KQCA 4LHEA 4QOIA 8ADHA 3W04A 3QLVC 5MF6A 4E4YA 1EG2A 5ERXA 3N39C 1NW6A 1SXHA 1VBKA 2CFSA 1SD5A 1SVLA 4LRWA 2C04A 4NYIQ 3TAHA 1CVIA 4BJ3A 5KTSA 2FRDA 3NOOA 3JW8A 4MQ6A 3UMGA 2YV1A 1SUFA 6NULA 4HDRA 2YYZA 3TI9A 1XZFA 1CUCA 1V11A 2TSYB 5DO9A 2QXTA 2I3DA 4KI0A 2XAAA 2VATA 1OILA 3D6MA 1TM7E 3FPJA 3VZSA 1X3SA 9LDBA 1Z38A 1H42A 1IDOA 1T24A 2Z0MA 5E9JA 3OP1A 2CNOA 2BBOA 1N32B 1ADCA 2VYCA 3QJYA 5EIAA 1MJGM 1WHTB 5DX1A 2ZYWX 1R6UA 2CXTA 3QZUA 4P0QB 2XBLA 4OGWA 5HA5A 2VPQA 1QX3A 1A9XA 1NYRA 1FNCA 2KLHA 4A16A 2P9HA 2FWBA 2O2EA 3OX4A 3T4XA 1XAGA 3VHQA 4H08A 4CV1A 1JI0A 3I9LA 3NKLA 4J4TA 4O1HA 1XQXA 2ZSFA 4UD6A 4DSNA 4MJXA 3LD9A 3BJEA 4F6CA 2J3HA 3NHUA 2POQX 3KXIA 2O6LA 4EVIA 4YV2A 1U94A 3I2YX 5G4KA 4DY6A 6CHYA 3EIHA 2VHVA 3INNA 3T3DA 3WJAA 3H0CA 3A1UA 2CEKA 1Q0ZA 1L4BA 4ZRNA 5BN5B 1BSVA 2H9YA 2XMZA 2H3EA 2WVAA 3GFPA 1KQOA 1NVEA 2FWJA 3EA4A 1JEDA 1Q91A 2YIVX 3I6ZA 3KXPA 2SICE 1XQVA 3WIUA 1WMEA 3UAVA 4E6EA 3PC7A 2Q1SA 2IIVA 1SCIA 2DQKA 4BS9A 1SOAA 1P72A 2WG0A 2VBFA 2X4GA 2HF7A 2IIBA 3L7MA 1CB7A 2FYTA 4NMMA 5ERYA 3P94A 2XH8A 2REQA 4ABYA 2Z1DA 3FSEA 3LSYA 4MV4A 2XUKA 1SBZA 2QJWA 4IVRA 3SPXA 2B4RO 1XVUA 2YZ2A 1KOJA 3I6YA 1PFWA 1U02A 3TQOA 4YTEA 1E1YA 3INTA 3HB4X 1MGOA 3GGCA 2C20A 4RAQA 2FPPB 3F0TA 3WLMA 3IILA 1RPZA 1ENOA 1PYOA 4KVFA 5CB4F 3WDLA 2WU1A 3O31A 4PLYA 3SF0A 1IE3A 2J4CA 5JFGA 3R9IA 3M3DA 4BAZA 5JQGB 2XEDA 1NVVQ 2C2GA 3QEMB 4JBIA 5BN4B 4K9MA 5K3CA 3GN1A 5T41A 2DLCX 4LQLA 3DVAB 5A6SA 3U13A 1OWPA 4JJ6A 5D1HA 3SZMA 4GRAA 4OU4A 3ZV4A 2HU7A 3GDHA 5JZVA 3DT9A 3H3XA 4FHEA 3AR7A 2D06A 4AZ3B 2OGZA 1GCGA 3EVFA 2ZOSA 3G0CA 2WKQA 2HSDA 3OUZA 1Y3BE 3ZDDA 3TIVA 4KR2A 3E27A 4YP1A 1T9GR 1OFHA 5FOXA 3TFQA 3W9YA 3WTCA 1LF5A 4WJZA 1JA9A 4XLTA 4M36A 3U4CA 2IK8A 1N8SA 3MF4A 5DF1A 3CWZA 4BMZA 3AR3A 1B3RA 1N2JA 2ZDQA 3Q12A 4MJLA 4O4JB 3MQFA 1JLSA 3LVBA 1VA4A 2QRUA 5GONA 4DCMA 3PS9A 1Y5NA 4N6NA 2VH2A 2GWHA 2Q9UA 1UC9A 3NHLA 4QFBA 3EOZA 3VDRA 4R9VA 1P2TA 2AXPA 2ZI9A 5CEJA 1SB8A 5T7BA 4P0PB 2I4LA 3O91A 2O8DA 3DFKA 5L3SB 3FZYA 3X44A 4BMPB 3A1EA 1FDRA 2VFAA 1BAPA 3I9JA 3H7IA 3JS5A 4FEEA 3T52A 5EJIA 4OHBA 4YONB 2CYBA 4RORA 2ZAIA 3I5AA 4PVCA 5K0SA 1V7PC 4MAMA 4AZVA 3N2KA 4EYKA 4XGKA 4EUEA 3UM9A 1W4RA 3FCEA 3W4JA 3L9XA 1ZC3A 5DASA 3OFJA 2ODPA 3ZHUA 4QXQA 5E9AA 3B78A 2YX1A 4LHVA 2VP2A 1U8UA 2OT3B 4U02A 2VJOA 4JZYA 2BEVB 1JEQB 1K8QA 3K0FA 1OX5A 1YV9A 4YCBA 3RUCA 1ZK3A 3CB2A 4QUDA 3ZKAA 2QSUA 1RM5A 4QVKA 1EDZA 1XHFA 2YWJA 5JVDB 2ODBA 3MCTA 5A0FA 1IHOA 4QE3A 1JAXA 4ARAA 1LI7A 2J3IA 3VBEA 1Y5RA 4A10A 1WTCA 1NDHA 2IEZA 2PEZA 1Z7YA 3NH6A 4LSGA 3N59A 4WT7A 3OP4A 5GP1A 3O74A 5BQXA 3F1LA 4CKEA 4H27A 4UHEA 1QH9A 1B3BA 1SEPA 4Z4QA 3SJUA 5D7NA 3QBJA 2ZAGA 4N7JA 4CG3A 4TTQA 2OBNA 2X2PA 4TZ6A 4ZCIA 4IH1A 4U9IS 1WVGA 1P6XA 4LQDA 1WMFA 3B5IA 4N49A 4YWHA 4D9FA 2PBLA 1NP7A 4W82A 2PX5A 2YUIA 1U2RA 3HA5A 2WBLC 3C4VA 1LS6A 3QKWA 4LOAA 4RLSA 2FU5C 1MAUA 1XF9A 2D5IA 1N6NA 2R7AA 2HRZA 3C7KA 3CLTD 3OMLA 3I9V1 2F1KA 4JENA 5DN9A 4EAQA 3IIEA 2JPDA 2Q46A 5K8IA 1RVDA 4GYWA 3DGEC 4N40A 4R2KA 4K3UA 4HLUC 3HACA 2LTAA 2X1MA 2ZPAA 4X95A 1YVDA 4YRTA 5IN5A 2A57A 1M1YA 3QBTA 2GERA 4N47A 5C5CA 5CJPA 4HQ6A 4XYBA 4R01A 3DKRA 1H94A 5I8WA 2OAQ1 3BSSA 3OZVA 5CCBA 3T3MB 4HMQA 2J85A 2WIGA 2RAPA 1XZIA 1H1LB 3DZFA 2PRSA 1SHTX 4DARA 1NLYA 2QDKA 4U7WA 2IU6A 1JT2A 2J09A 2O0HA 1K08A 5EOVA 3EQ9A 2FWRA 4YJFB 3WLQA 3Q8LA 1GDHA 2CV2A 2ZQ5A 4IV5A 4LTDA 4TTVA 4UU8A 3SC6A 3G8YA 2WVGA 3TD6A 2N0SA 3SEQA 4TS3A 3SZUA 5K0EA 1ACLA 1Y1SA 3THRA 1PEDA 1D4FA 4PLHA 3UEOA 4RTMA 2O3TA 4E33A 4Q1EA 1SAYA 1T3TA 3ROKA 4DM4A 1HG0A 1V8PA 2XKBA 5IC5A 2K5UA 3DB1A 3GFVA 2AI2A 3PDIA 4JOQA 4J2HA 3Q7QA 3TEMA 3DA8A 2XGMA 2NTEA 5C1DA 3IH5A 2ZJZA 3AVVA 3DDCA 2MSDB 3MLAA 1IJFA 1G5RA 4J4BA 4YDHB 3H2YA 3RLIA 4YR9A 3KUCA 4Q1DA 3KTFA 3SQWA 3ENQA 1TMOA 3LKZA 3SEAA 1I4LD 4NAUA 4MMZB 3DR5A 1IOVA 4EA9A 1GNPA 3WIBA 1ZX1A 2ANCA 2P91A 2XOKA 2QD4A 2YTZA 4JQOA 3PUJA 4Q9HA 4UNSA 3RARA 4JI3B 3ZV6A 5KYXB 2EJTA 2RI1A 3EQZA 2PKRA 1E9RA 3ILYA 3B9QA 3OPYB 4G0QA 4GP6A 3VOTA 3HXLA 3RS3A 2CFOA 1I4EB 2MSLA 3OZTA 4C3OB 1X8KA 1JIQA 4TMKA 4KVGA 2VP5A 4F9FA 4HQFA 1TA9A 3PGXA 1H3NA 2FPMA 4D5GA 3C43A 2CXRA 3VR6D 3PEFA 3OOHA 1E6MA 4ZT3A 4C05A 3STXA 2FUCA 4P53A 4DIUA 3FPEA 2AEMA 2J9XB 1P1IA 1P7WA 4E94A 4QNRA 4AN4A 4OUDA 1QM5A 4LCEA 4LYGA 4ZVLA 1UJ6A 2A86A 1HDXA 4RTJA 3WLAA 2IVFA 3KOWA 1J8YF 1B4DA 2AWNA 3SX0A 3HNOA 1PFVA 1SQ6A 5C5DA 2HL6A 3DFFA 3GMDA 4AC9A 4UPDA 1FE8A 2JGDB 1RC1A 2H1CA 5LA6B 2VT7A 1PJSA 1XMSA 3BWDD 3EIUA 2HI0A 3G9XA 5CVCA 5FTJA 4KV9A 4J75A 4FC6A 1CY1A 1TM4E 2WB2A 1KSHA 4F56A 1FW6A 3WL8A 1XDSA 2I6GA 2ZE8A 1VYVA 1Q7CA 2O1SA 4KPUA 3SY8A 2C9BA 1G17A 4UVDA 2WEKA 1X7XA 3HWX1 5TPZA 3UW1A 1MDBA 1O87A 4Z5XA 3P0RA 1FOEB 3MOGA 1NW9B 1K1EA 4RFSB 4A4DA 3H9QA 3ZUGA 3AWDA 4CMKA 3I92A 4H2DA 1W4CA 4IFEA 4W1PA 3ORRA 1CZLA 1L5YA 2X4LA 3U16A 4PY2A 1J07A 1Q5PA 2F48A 4MPRA 3GFSA 4Q4HA 2ZS8A 4YT2A 3EZNA 3KZ1E 5BQPA 4ALMA 1UBFA 3AEQB 1VPLA 4I3HA 3RTEA 4AU1A 1P9RA 4DT1A 5LMCA 1SXPA 3HJFA 2C8JA 3MCZA 4HAVA 3SDSA 1JIVA 4PX9A 1LSSA 3NIBA 4JJKA 1LZKA 4M88A 4TRNA 5TT0A 5TX7A 1RRMA 1XNQB 3SXJA 4M7OA 4YT8A 5KOHA 4LNHA 5HCIA 3TTUA 1GFWA 4X1KA 1TLLA 4PS1A 4AKHA 3CX6A 4FPXA 4HDSB 1RXSA 4FQ5A 1NASA 5B7NA 1JEOA 1Y1TA 5FOVA 2GR9A 1QGAA 3SN6A 2MSEB 3I2IA 1ADGA 1ZMXA 3DE0X 1UBLS 3FETA 3TBFA 1IONA 1C1XB 4FYJA 1VI5A 4DREA 2G09A 3QE9Y 2WWVD 3Q0TA 2GN1A 1GO2A 3PNMA 3R7NA 4C2AA 1U5AA 1DQSA 1WVIA 1HY3A 3DHEA 1H1DA 1JWBB 1TGYA 2IU4A 1XRPA 4M99A 5F2NA 2YHUA 1AXEA 2Q0SA 5IRCD 2CVHA 4E22A 5CB6A 1J5PA 3D6JA 4KBFA 5HX7A 4JU9A 2UUAB 1F8FA 1RRKA 1MORA 4B4DA 3ICVA 4MUIA 3FMFA 2DJIA 5ALRA 5AXDA 9MHTA 1U7WA 1CRZA 4CN9A 4NOMA 3G2NA 3QX3A 3BMCA 3QKSA 1FRQA 2CLIB 2Y6VA 5JQGF 2JK0A 1KAGA 3KDSE 3LT4A 3UWPA 1RQLA 1ZL2A 2CXOA 3O8OB 4H3HB 2VO1A 2F64A 3CVOA 3UJPA 2B99A 4LJLA 4BRSA 1KRHA 4YCNA 1X8JA 1EJ0A 1T0JB 3A4MA 3F7MA 4PLGA 3UWSA 2QP4A 3MJVA 3CZ5A 1JNYA 2R97A 2E4XA 3GLRA 3CZ4A 4PN7A 1QFSA 4Y9RA 3FMVA 3RYIA 2VJDA 2BI7A 3F4LA 3HGMA 5I3ZA 4EVRA 1ECLA 4QL3A 5CAEB 4B4UA 2ZKIA 3NHJA 4L8YA 5BURA 3PKJA 3PNSA 3DNFA 3HFRA 4QOSA 4O4JF 1VP3A 4KWTA 5AVJA 4ALJA 3D43A 3U4QB 4GG1A 3QPCA 3NAZA 3R4CA 4AZ0A 3WK7A 3OURA 4HLUA 3MIIA 1UBHS 4YAJA 1MAAA 1XN1A 2QYOA 4FYMA 5JALA 1Z4JA 3D7KA 2FPOA 1WMAA 3ABRB 2OD2A 3D5QA 3N8GA 1JIKA 2F59A 2LCQA 3TKLA 4DOMA 5G0WA 3L4BA 2XV1A 1TU3A 3RS7A 5GAJA 2C7QA 4BP1A 3MWGA 3WBKA 5CFLA 4HZUB 4W99A 3HP7A 3ZGLA 4BU1A 3HS3A 1MQ9A 3ZLTA 1VYTA 4HADA 4XH9B 4AJ4A 5CK4A 2DOKA 3IQWA 5L3ZA 1PWHA 3PUXA 5DHAA 1TA4A 2BPOA 2FPLA 3WFIA 3WLIA 3OQMA 3SEZA 2WUDA 4RF2A 4Q3CA 4MYHA 4GI1A 4B74A 1GUBA 1L1QA 1TO2E 2E55A 3D59A 5FO0A 3VPAA 5JVDF 1EWRA 3GVPA 1CJMA 3BXZA 4NARA 1R0RE 1RXUA 2C95A 2W83A 1FFHA 3CZAA 5K03A 2B3DA 3VYTB 3OOEA 3JVIA 1WF6A 1QKIA 1YZGA 2XTNA 1PJTA 3RPEA 3CO0S 4Y67A 2GVDC 4I1OA 3ZD8A 2HOQA 1FJXA 3AV3A 1KH1A 3CLSC 4L6AA 1A4XA 3MC1A 4O8CA 2X42A 3AL3A 3RF7A 2GHQA 2Q8NA 3CVJA 2UZ1B 5KCZA 5FQNA 3WGYA 3OZBA 1JECA 2VZ9A 1EGVB 3M3PA 3K53A 4Y2HA 5K2OA 4WRRA 1E1MA 1RJ9B 2WWGA 2AGVA 3K9FC 2ORVA 2LPMA 4FZJA 4GP9A 5DTMA 5LUBA 5IAOA 1UXIA 1ZIPA 1GA1A 5ITZB 4OQDA 4C7JA 1E6KA 3LYAA 2HTEA 3G79A 2BM0A 3GPDG 1R4ZA 1ZH4A 3OOWA 1QF6A 2D1QA 2EX4A 2XXJA 3BB3A 1QUFA 3QG5A 4ZIRB 3DL2A 3OZUA 4AMGA 3V1MA 1MRNA 1JF8A 2Z8XA 3QSGA 4K26A 4OHKA 2NZJA 1H69A 3C7CB 4ZVRA 2E0IA 1JIUA 1M75A 3IKLA 2IF0A 3EIEA 3LQ2A 2FW0A 3PJEA 4LJ9A 1K7YA 1ELOA 4ME6A 2HH9A 3A4NA 3B8EA 4REMA 4BX9A 2GPTA 5JATA 3KETA 1P18A 1ZCBA 2VJMB 3GC6A 4C0HA 3CRRA 3ZWAA 4HX5A 5C5EA 5L6LB 1BQEA 1T8YA 3QW4B 4DR4B 4LQCA 1BN7A 3HVUA 1WQ4A 1NVDA 5KX5B 2GB4A 4E5PA 2GEUA 1A88A 1B8UA 1WHSB 3HXKA 2M2IA 2PDAA 4YA6A 2WJIA 3E9QA 4MO2A 4IQGA 4JSTA 5JYDA 3TEJA 2YQ5A 4OF4A 3RLFA 4ZAGA 2AZXA 2H7YA 2QY9A 1OMOA 3KEQA 4M0EA 2QP9X 1QO0A 5CM2Z 5JO0A 2BKXA 3R24A 1UOPA 4A73A 1AB6A 2HGSA 2RGCA 4ZQHA 1EFTA 2ZRKA 1ZJ6A 4YDSA 2VF8A 3U5TA 1SCQA 4IAOA 4MYRA 3SSNA 3PFCA 3FRJA 3GZJA 4EG7A 1OXMA 1WX1A 3L6DA 1EXWA 1T4CB 3L8EA 3E2IA 1IHDA 3L8MA 1E0AA 1OFVA 3GRPA 4K8OA 4P3YA 2ORED 3CVVA 1YQQA 2R00A 3AL0C 1VG9B 1A3CA 3ZHCA 1V1RA 3JPYA 4O3FA 1NF2A 1NNI1 5FA8A 1BRMA 1RKVA 4GR5A 3TOXA 3CISA 2KYRA 1C9DB 1TZCA 3N07A 3ZD6A 4N3GA 2I4MA 1T2CA 1JR2A 3L6RA 4PIVA 1H23A 1P77A 4GBJA 4GDFA 3Q11A 1U28C 3EIWA 2QJOA 1NPDA 2RFLA 2O4CA 3U3ZA 1XVVA 3PNQA 3U6BA 3GUZA 1Z63A 1O0BA 2X58A 4D9MA 3TRDA 3RV4A 2RJNA 5TC4A 4QARA 3M3HA 3N2GA 3QENA 4MGHA 1TEHA 4QBTA 3MTJA 3IJEB 2B36A 4B4WA 2IIPA 3SLRA 1PR3A 2IQ5A 1JG3A 1M6HA 3TW8A 4BZXA 2JGJA 3GLIE 4MW0A 5I4CA 4OIFA 1N34B 4CGZA 3IV7A 4ZCRA 4PEVA 5LA6F 5L95A 4YUZA 1U5CA 1XRMA 1TQ8A 5E7JA 3UAOA 3F96A 1AHPA 1SQSA 4KSYA 4F6RB 4LIPD 5B1HA 3ZUPA 5AJUA 3LXUX 5CLFA 2IEIA 2XQIA 2OUIA 3O1IC 1QFXA 3SP1A 3T9EA 4QJ3A 2PZMA 2AXQA 1DIBA 3D6HA 4FR2A 5CJ2A 1CUVA 3W3AD 4DR2B 1JHQA 2GFHA 4RHCA 4KR3A 2QAGB 4HB3A 3NJ8A 4FFSA 5JPCA 4MI6A 4D0LB 4NE7A 3I04M 2ZWMA 3PCXA 3K9HA 4S1TA 2J41A 3GA7A 4IJKA 5BRNA 1E1CB 2Q9CA 3AZPA 4Y6LA 1N5KA 2HRBA 2ZB8A 3EEFA 5FL7D 4EB8A 4MRSA 4D02A 1WBJB 4GHWA 3NPAA 1RQGA 2D00A 3K96A 1JYFA 1EFVA 4U63A 4RCVA 5DM4A 1LBQA 3NDPA 5K3AA 5KJCA 1LBTA 1YK0A 5BO5A 3QWAA 1VMDA 4RK7A 4FM9A 3RG8A 2XGOA 3SKXA 5E3HA 4JJ4A 4CCWA 4WI1A 1IUPA 1KKMA 1PO7A 3W5UA 3O92A 2VJQA 5E6SA 1A77A 3EEOA 1SM4A 1MVLA 1SVKA 2WHEA 3M4NA 4XJVA 4EHAA 4PFQA 3QEBZ 2O2CA 4NBUA 1W8IA 1N7IA 2RHHA 2CL6X 1JVSA 1XZQA 2RKBA 4ZVQA 4CL0A 1UXJA 3T1NA 1V9LA 3D4NA 5HFAA 2OXCA 4ZKEA 1U2DA 2OO5C 2NX2A 3OIYA 1E5XA 5FYDA 1WPXA 2G76A 3OBIA 4OQMA 1HG1A 1T10A 2JZOA 1RP1A 1OLOA 3ZIAD 5CDSA 5LPNA 5FV4A 5FTMA 2YC2C 1KVUA 3P9QA 4F06A 2QL9A 3EBPA 2QTBA 3QPBA 3PNLA 3H6HA 4MPDA 1MAHA 4Y2TA 1XEXA 1OH5A 2ENUA 1NBEA 3DMPA 3ERCA 2I76A 2DPHA 2VNKA 4ZT4A 4A0FA 3GJ6A 1GTL1 4NFLA 4LBVA 3ZHVA 2ZIXA 5CB0A 1F2UB 4WSOA 2IEGA 4QOGA 3TD2A 3ESRA 1SPXA 3KSUA 3VMMA 1VB5A 3HO6A 4KO2S 3ZXIA 1B1CA 1ZGGA 2C8VA 1EBBA 2NSJA 4BVGA 3CLVA 2KQUA 1ZO8A 3ZNQA 3TTXA 1YIDA 3M1IA 3A11A 2GI4A 3RVBA 4AJOA 2XOEA 4B81A 2KPOA 3GHHA 4D3XA 3K6SA 4Q3EA 5LOVB 1WHTA 4UNQA 3U4HA 5IT0A 3LP6A 1X1BA 4LY0A 5ALLA 4WEQA 2NN3C 3X43A 1V5IA 1CVLA 4EUFA 1C0LA 3QFFA 1IUKA 4WDQA 3WGHA 4NJMB 4R40A 4A0GA 4O0MA 4CF5A 1OW3B 2ZDGA 1HE5A 5F35A 1NHGA 4OQYA 4QIHA 3THWB 3FFXA 3LRPA 4KXVA 2WE8A 1NXXA 1SELA 3JQGB 2FZCA 4WOCA 5EJ2A 5JH7A 4KE8A 3P20A 1ADYA 2Q2OA 4R69A 2PJUA 5BN5A 5CLGA 1UM8A 3HXPA 3ZI0A 4WGGA 2B25A 4CFZA 5KOJB 6PFKA 2LIPA 1N2CE 5LZ7A 4C3VA 3KC2A 3M6VA 2LIVA 1UT6A 3UXMA 3ECCA 1BQ4A 1Y48E 3SQMA 1EK5A 1DELA 2X0KA 2XITA 1HA3A 1GPNA 4MV3A 2QBYA 5D2CA 1AKUA 4O2BB 1J2RA 1TVKA 2NQ2C 4JB8A 4MCHA 2OA0A 5K05A 2C2MA 5ITSA 3UC5A 5FFFA 1J0AA 1SOMA 2AJTA 2H4FA 3C41J 3W2IA 3HWWA 3KEFA 3RYFA 1M6YA 1L7NA 2JJ8A 3RC3A 1NXWA 3FBWA 2PT6A 2JIZA 2FPPA 3UYKA 2QS9A 4EGFA 4Z4GA 3U1TA 3OZGA 4I36A 2XJ9A 4R8VA 1JQAA 2Y77A 3DPSA 4LXGA 3A6EA 3IAM6 4UM5A 4ZRDA 4ASUD 5IH3A 3LF2A 1YZVA 4RFVA 5U4QA 5JQGA 3THSA 4MDYA 1SK8A 2PJDA 3ZHRA 1V6AA 2FSPA 4PQFA 1TZ2A 3MWDB 3DXFA 1V0JA 1W5AA 2OG1A 3WG9A 3M2PA 3NAMA 1K66A 4HNGA 4U2DA 2PZGA 4D0SA 5LIPA 1TXGA 1XCJA 1QCZA 3V32A 1WBDA 2G9ZA 1QSGA 2BD0A 3IIKA 4HGYA 1HNNA 5EQJB 2NNWB 2JIPA 4B6FA 4M46A 2G4CA 1WULS 1P29A 1DXQA 1E18A 2VEOA 2XUFA 3HU2A 4TX1A 4OL9A 1SUDA 1RNLA 1D1QA 2HCTA 1DE0A 3I9MA 5AVTA 1NU6A 5JNSA 4H59A 3S0JA 2JI9A 4DCPA 1R5NA 1TZJA 2ADFA 1HDZA 2GM9A 5CTAA 1ZKMA 4UU0A 2QIPA 1YBVA 2QZPA 3JD4A 3OQHA 4L2IB 1DADA 3R3VA 4X85A 3QP9A 4M7WA 5KYWB 1Q19A 4AUMA 1Y8QB 4KAJA 5ETJA 5FEUA 2UXCB 3S44A 3Q98A 5L3SA 4YAWA 1NSFA 3L1KA 3WAKA 2HJVA 3OQOA 3N2LA 4N03A 4FOSA 4QUJA 2D1YA 1EZ1A 4LDAA 4OQQA 1A5TA 3USZA 1HBJA 4ESVA 3SXPA 1U8YA 1WMBA 2YIJA 3HVHA 3UMJA 1ODIA 2VNHA 4FDUA 3BRCA 1EVIA 1G9TA 3GXBA 4PG7A 5MFZA 1KDRA 1KWGA 1H2BA 1ZSVA 2AF3C 2YR0A 3AXSA 4RXTA 1GAJA 5TGZA 4BOYA 4MR8B 1QP7A 3N28A 2WJHA 5IXJA 4CT0A 2YMQA 4YAKA 1Z6GA 4MAAA 1J7KA 4EUSA 2BEVA 5BR7A 4D80A 2EJUA 1R9NA 1ORHA 3R77A 4RD4A 4YRDA 4JNCA 1MZPA 1IZ8A 5I9SA 3H97A 1CIVA 4LJYA 1KS9A 2B5VA 1QU2A 3UT6A 3LV8A 2BGMA 2VUTA 2DG2A 4W5QA 5KCMA 3GHYA 3U62A 1E9DA 2ZI4A 3ACDA 3CU5A 3E35A 1SCBA 2AVDA 2CY0A 2OBYA 3EMVA 3G8CA 2XDAA 1VPDA 4L5CA 4HL6A 1IYZA 1AS3A 3F5FA 3BILA 3T3OA 2I1QA 3QYJA 2LDXA 1S8OA 1W47A 2C00A 3DKPA 4FI3C 4YP5A 4DDKA 1WNFA 2EP5A 3COZA 2CL7X 1VGVA 2NXNA 5AHWA 1L0BA 3W5IA 2DY0A 3EIOA 3UA4A 2PAFA 1KP2A 3SX4A 2WOJA 1LPAB 1XA3A 1B0AA 2M6SA 2XVYA 4HRAA 4Q48A 3O90A 5DTQA 2OO5A 2K6GA 3LVRE 1GT6A 5EHQA 3ANYB 4JB2A 5G40A 1Z5UA 2WQ7A 2B8WA 1NXQA 5LBUA 1PHPA 4PLZA 3K8YA 4FXOA 3P7MA 1F1BA 1DFHA 1MW8X 2CNLA 1V45E 1T0BA 3E84A 3W5HA 1RKXA 3QEKA 4X7PA 1O6FA 2BBSA 2P79A 2QZJA 3CLRC 4RIFA 4Z9YA 1H1LA 3AINA 4FKBA 5HF6A 3L84A 1E1NA 1L3CA 1XTJA 2Y9PB 1ULAA 4L4XA 4MR9A 1R4AA 1P5JA 1U0FA 4YJFA 1U2PA 5D3QA 5DWDA 5ICEA 3AI3A 5IPFA 2TMGA 4YBRA 4P7FA 1IOLA 3CF4A 1Q2UA 3DMGA 4JUDX 5KNBA 1TT7A 1K7EB 2PX8A 1JFTA 2NYAA 3VNQA 3BH7A 2PCLA 2V7XA 3IQGX 2SKEA 3ZV5A 1PGJA 3B82A 3LBAA 4MQBA 4KN8A 3LDFA 3BL5A 2CXNA 3JXEA 5EVJA 2ANBA 1U0RA 2GM5A 1KJWA 4G1EB 5KVSA 1T9KA 3UHJA 4DV0B 5LZ4A 3ROQA 4JI1B 2VIIA 2DT5A 3PHGA 2NYVA 2XECA 4P86A 3GP5A 3OZXA 3NHZA 1PJ4A 3IIJA 1S2MA 2JGIA 3KOUA 3CNOA 5EAIA 1E9CA 2OCDA 1WD5A 1NMQA 3OPYA 2KX7A 2RHJA 1VYHA 1UK7A 4NE2A 4I4TA 4QFDA 2PR2A 5FFMA 4DNQA 5JNLA 1YQ9A 2B6HA 1PLLA 1Y4DE 3TBHA 4DTIA 1KWKA 4L0DA 2ZJFA 4TYMA 3EPHA 4ALNA 1JHPA 4UUAA 3SZOA 5GIPE 4QHTA 4IDAA 3DAFA 3SYTA 4AJEA 2CD7A 2F3TA 4HHEA 3TM4A 1E2MA 1HZZC 3FNHA 3O7MA 4EVQA 2C2HA 4IDHA 4IGIA 4KOEC 1H2RS 2VTEA 2XCOA 4UTVA 5EIXA 3NYWA 1AIPA 2IUYA 3OLVA 4G26A 4P4TA 4HWPA 1ENPA 1XCGB 4UDYX 1S01A 3ROMA 5IHXA 3UB4A 5G1PA 4QOEA 1I0LA 1N2CA 5GGYA 1KSFX 3URMA 2QRQA 4J90A 1E3TA 2MWMA 2JGMA 2ONZA 2OZKA 2JGDA 1L5KA 4NNPA 1QR6A 5FIUA 3ETJA 3NONA 2ZTVA 3GVIA 5D5PA 4Q7QA 2O7NA 5TQ2B 1H9AA 3AF5A 4DA0A 1XAJA 4YRMA 3MINA 3DH0A 3E2MA 4QG3A 3TUJC 3ZW7A 4XCXA 1JJBA 1PR5A 1BEZA 1P7PA 4KDCA 3T7CA 3LTNC 1ST2A 2AEEA 5LDDC 4DG5A 1JR4A 1CZKA 2HQ1A 3A9UA 5ENDA 3RSFA 4EW3A 5HR5A 1A04A 4NU6A 3FFBA 3A27A 4YHBA 3LW7A 1XRQA 3NBUA 4AJHA 1NI4B 1Q57A 2VUIB 2WTBA 3NWJA 2BEUB 3RTBA 1MAVA 4Y7DA 3Q6IA 4PBTA 5LOVF 3U4IA 1XTPA 2DUWA 2FPKA 4H6XA 3RFVA 5B37A 5LU8A 1SKUA 2D3WA 2X86A 5KVVA 4RY9A 3I23A 5EXEA 1U11A 3F5SA 5ER9A 4RX1A 2ZFUA 1WRBA 3RIGA 3RBAA 2P5UA 2Y1KA 3BDVA 1R15A 5KWEA 5ALIA 2WUEA 3HMQA 3T38A 2Y0CA 3WXBA 4KXYA 3F97A 4MYDA 4WN9A 5TNXA 3PNBA 4IHKA 2LUOA 4KRGA 2EKLA 2ZRPA 3PLNA 4YJ3A 5MGNA 3OLWA 3HB5X 1IMJA 3SCZA 3CLUD 3PX3A 3F49S 1N0IA 1QG4A 5G53C 1IY2A 2ID4A 2XWSA 1JALA 5T4HA 1N2GA 4OMCA 3UTCA 5CA1A 3F6SA 5H3CA 2WWTA 3U2QA 3R20A 5F5NA 2P9EA 1DTEA 1IBCA 2JJYA 5LC1A 3PV0A 1D9ZA 1P0FA 2P11A 4O2BF 4P3NA 4AG6A 3NP9A 5H1YA 1CF4A 1C1XA 2H2AA 1GL7A 2CHEA 1J56A 5JBNA 4F6LA 3CJRA 2YRFA 4QPCA 4K9SA 2G7MC 4FONA 4F38A 5FI5A 1IVYA 1K0FA 1R1DA 3AUUA 3PA6A 3PL1A 4K9LA 1T2FA 3S2SA 1FSFA 4GKVA 1IBRA 1Q3TA 1SULA 4EG6A 5A02A 3KHSA 5D84A 2IJGX 3HE3A 1T5DX 3K2BA 2HLPA 5A3SA 1J5XA 4UOZA 4KWIA 1XG5A 3H18A 1B76A 5CIWA 3CKKA 3OUUA 2P9CA 1N6HA 5BV8A 2WAXA 5BVHB 1KETA 2PMCA 1JAHA 2JDID 3BIFA 3O8OA 3OX2A 4Q19A 4NULA 3MJ4A 3STTA 3EVNA 3L05A 3DDOA 4M8KA 3TIXB 1LTKA 3KBBA 5IKOA 1TM3E 2G6TA 4CM1A 3KJNA 4M0KA 4Y8VA 1A95A 1T6ZA 5DOZA 5I47A 3OT1A 4PRLA 5DVZA 4HQRA 4UAJA 4GQBA 2I33A 4UEKA 1E2KA 3PUZA 1FQJA 3GNQA 1SURA 3C3XA 3LT0A 3OJEA 1OE0A 4V03A 2GH1A 1WUKS 3LDAA 1CUHA 3NIFB 4EB6B 1XEFA 5CGZA 5EEGA 5CAEA 4IV0A 2YWGA 4UUOA 1I4TD 1ZUNA 1I80A 3OE1A 3DC7A 4ZOLB 1UFVA 4C89A 5HJEA 1BHJA 4I46A 4MJ7A 4PANA 2VPIA 2GNPA 2XUJA 5E38A 1QYDA 4EX7A 3U4QA 3HBAA 2HO4A 5CRIA 1P61B 3QMMA 4OPMA 1J25A 8GPBA 1Z17A 3ET5A 1FDIA 3EAQA 4L5YA 1ESDA 1GQFA 4YECA 4QZVA 1YCGA 4WERA 3MRTA 1YS1X 3C3DA 5KTPA 1W36B 2P2ZA 3JALB 4KN5A 1Q95A 1WOYA 1RBZA 4FOPA 1BMTA 2IHBA 3L7YA 4MLZA 2YJGA 3ZKWB 2NGRA 1DKNA 4NYIR 3RH0A 1V8DA 2Y27A 1PRYA 3RRMA 3WQSB 2QJRA 3OO1A 1XYVA 4AJ9A 5CXQA 1E92A 3ZYCA 2D0PB 4NBLA 2AUNA 3FN4A 4MNTA 2BDEA 1AZTA 1YB4A 3WYGA 1EM8A 1QIIA 4OEHA 3UXYA 4I8XA 4EY5A 5P8WA 2O5CA 1QK4A 1U3TA 3WK9A 5C18A 4JOBA 3OQJA 3NOXA 2OB2A 2PS9A 3B60A 1UJBA 2XE4A 2G88A 4V0RA 4OHFA 4YCJA 1FFXB 3HCNA 4M9RA 3ODGA 4QPNA 2A5GA 4Z54A 4CE6A 2KWIA 2K2WA 2VNJA 1J00A 1L7MA 2KSQA 3JVUA 3MG9A 3V46A 4L76A 3SQDA 2MR6A 2R7KA 3G6WA 4D4MA 4KLNA 7GPBA 4DV7B 5LXTA 1GCAA 2WWRA 4GSLA 2JJ2D 3T3PB 2IXTA 3HBNA 2EEZA 9ABPA 2UZ1A 4IQ4A 3RWOA 1VLJA 3RS2A 5JWOA 4MVWA 3VFDA 1YRLA 2ABWA 3GJ0A 3BD6A 4UCQA 4BBZA 1I6WA 1QYXA 4D3YA 4LYDA 1MV8A 1WO8A 4ZU3A 1Z06A 4D9KA 2G77B 2PA3A 2DBZA 4ZHQB 2DFNA 3IUJA 3WWPA 2PSSA 3HC7A 1H0HA 1I2DA 2ZRJA 3S5JA 2C58A 3UNXA 1ZMOA 2GYUA 1BGWA 1AF4A 1ODSA 2OTCA 2PVCA 5JZ9A 3IQZA 4IVNA 4M54A 4Z9BA 3C4QA 1XN4A 2QA5A 5D3ZA 1CRPA 3SF8B 4HAWA 1F4PA 2HD4A 1DBPA 2Y1DA 4HXYA 2JBAA 3CURA 3H65A 4KQ6A 4XDYA 4BO4A 2XUQA 3Q41A 3K94A 4ZODA 5IJXA 3ZQUA 1VHWA 3F7OA 3PXUA 5A5EA 5LZ9A 2IODA 1PJRA 3P4XA 2UUCB 2FCRA 2CZCA 4OAQA 2P3QA 4G6ZA 4CFSA 1PTJC 4G1BA 4PX2A 5I48A 2X7HA 2VJMA 4FGUA 1DU4A 3TG8A 3OTGA 2VHEA 3C16C 1UC5B 4BZQA 3BE8A 1VE5A 4D25A 5BQ5A 2ZUSA 1C2TA 1W59A 4M98A 5C32A 5KNCA 4FEAA 2JCBA 4HUTA 4XJTA 1G8YA 4J43A 3PC2A 2J31A 1UBRS 3BCUA 4D9CA 4Q4CA 1QHYA 1NVVR 1VRWA 4UM8B 5ELMA 4C87A 4C88A 4WY5A 1C0EA 3ROPA 4A23A 2ZSUA 2YJ3A 5A0TA 2E6KA 3BH6A 721PA 3M2TA 3C6YA 1P5FA 3CZMA 4FZRA 4K2HA 1U7XA 4O59O 4HATA 2F1RA 3EAFA 4Q7LA 1FNDA 2HK9A 4B71A 3LQ4A 4W63A 2FDXA 4F45A 1X87A 1HQYE 1NW8A 1OB2A 1MX1A 5FJIA 2VF4X 3ZQ4A 1VIDA 2F43B 2WSIA 1YDGA 3GJSA 1GPH1 2K4MA 3BCHA 3BTVA 3ETDA 3JWHA 2LW7A 4O0LA 4XWAA 3ISJA 5DEIA 5JCXA 4XWWA 5EHZA 3V5NA 2AW5A 2F2TA 3BGSA 2HBZA 4E2FA 4LWPA 3WLPA 4QATA 2JF0A 3TVDA 2ZRIA 3ZWYA 2JW5A 3OOYA 2F3RA 4J0FA 4DE5A 3Q9SA 3TTYA 1M10A 3IT1A 4PPFA 3E58A 4WLUA 3GAFA 3F6CA 4EMSA 5AI8A 5AW8A 3CF2A 5HRCA 4LQ4A 4KJXA 2W43A 3V2HA 3IHKA 2B4AA 4LSZA 4IGFA 3FI9A 5JCPA 1E2IA 4CKBB 3VDXA 3HJHA 3TPZA 1Z6PA 1WCYA 2F3QA 4S1NA 3RRNA 1KMMA 5AJVB 2W71A 5INTA 2D59A 1BH6A 2Q8PA 2VQEB 4DMGA 2DTXA 2I8LA 4EO7A 5JMOA 3C85A 1DV1A 4F6RA 2RK6A 1IQ0A 2VUUA 4EK9A 3KT6A 4L8VA 1LFDB 3N2NA 4MW9A 1NM5A 2BH9A 3AZQA 4RZSA 3QKIA 3WL4A 3HYRA 1OVGA 1EGQA 3EWIA 4HVTA 3GROA 5EJ9A 2WHPB 4IJVA 2NOAA 1GPMA 3IUEA 3QKUA 4QFCA 5EWJB 4LBYA 1L4EA 4BUZA 4DLAA 1RXIA 1L7OA 4IO0A 4Y98A 4CEJA 4MRMA 3FWZA 3CNEA 4OFBA 4ZZ3A 1FS6A 2RC5A 8ABPA 5HM8A 3HHPA 5LBIA 1E1CA 4H16A 1MO5A 3L4JA 1MO4A 4ZN6A 1FFCA 1NNLA 1T3ZA 1G3MA 2HK6A 3E9NA 3LZDA 4U7FA 1BIFA 4LAFA 3NVKI