3FPHA

Crystal structure of e81q mutant of mtnas in complex with l-glutamate
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
264
structure length
264
Chain Sequence
SCYIYWDKIKRIASRLEGMNYHFDEMDTSGVMPLLDEIEEIAHDSTIDFESAKHILDDAEMNHALSLIRKFYVNLGMKLQMEKAQEVIESDSPWETLRSFYFYPRYLELLKNEAALGRFRRGERAVFIGGGPLPLTGILLSHVYGMRVNVVEIEPDIAELSRKVIEGLGVDGVNVITGDETVIDGLEFDVLMVAALAEPKRRVFRNIHRYVDTETRIIYRTYTGMRAILYAPVSDDDITGFRRAGVVLPSGKVNNTSVLVFKCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein, transferase
molecule keywords Putative uncharacterized protein
publication title Crystallographic snapshots of iterative substrate translocations during nicotianamine synthesis in Archaea
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
total genus 96
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03059 NAS Nicotianamine synthase protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3fphA00
3A7DA 8MHTA 5C1IA 4B17A 1VQ1A 3C0KA 3LX6A 2PSSA 3UJBA 1SG9A 3KQQA 3ELUA 3NTVA 2FHPA 1P1BA 4FZVA 3TKYA 2XVMA 2ZZMA 3EVFA 5LQCA 3K6RA 1KR5A 1ZKDA 3P9CA 4P58A 4RTPA 9MHTA 4C08A 3HA5A 2FPOA 3B3GA 3DTNA 3JWIA 5FWDA 1TW2A 5C9ZA 4PYOA 2BM9A 2GH1A 4JXJA 4C04A 4XUDA 3EVAA 7MHTA 4AX8A 2HMYB 2IPXA 4X63A 3E05A 5EVJA 4G56A 3B5IA 5K0CA 4YUZA 1KXZA 3LDFA 3R3HA 1KPHA 3HTXA 1NW8A 3PLAE 3MTEA 4GBED 2AVDA 3P71T 5EG5A 3UJ6A 3OZRA 3GXOA 3G7UA 1QZZA 2BH2A 3OCJA 3ER8A 1JG2A 5DRYA 2QRVB 3EVGA 2YXDA 5EIWA 1NKVA 2ESRA 4A6DA 5HIJA 3OE4A 5DSTA 3HA7A 2CWWA 4KRGA 1RJDA 3GRVA 4XUEA 3KPUA 2LD4A 2P7HA 2ZZKA 4E2XA 1D2GA 1WY7A 1VL5A 3I9FA 5DLYA 4YV1A 4FSXA 2H11A 5HIIA 4CTJA 1NW6A 2E5WA 5CCBA 4AZTA 2QE6A 2P1DA 4QTUB 1YZHA 2WA1A 1VPTA 2KW5A 2N47A 5LQAA 3TM5A 3EGIA 4ER5A 4NECA 2P3OA 3MAGA 2PX5A 4PYMA 1SVUA 5EMLA 4QVGA 3A27A 3P8ZA 3KPJA 4EMSA 1Z3CA 1JG1A 3ID6C 2ZIFA 3BWMA 5GIOE 4RSRA 4FS8A 4HH4A 5FA5A 4E2ZA 5DM1A 2PX2A 2FK8A 4RVDA 2B2CA 1XDZA 2PX4A 1RI4A 1TPYA 2VS1A 3OZTA 5EEGA 1R00A 1P91A 1VP3A 3HVIA 3MQ2A 3SX0A 5JUWA 3EMBA 2ZIEA 2FYTA 5DPMA 3ELYA 4EKGA 1JQDA 4R6WA 4C03A 3TFWA 1EG2A 4GQBA 3ME5A 5DSXA 1EQAA 2JHCA 3LECA 5DX0A 2NP6A 3F4KA 3NWBA 4RTJA 4R6XA 1AQIA 2PGXA 3GWZA 2QM3A 3KHKA 5U4XA 3VSEA 5GIPE 1R18A 3DULA 3PVCA 2O06A 4LECA 1B42A 3M6WA 2C7PA 4YMHA 3IHTA 3JWHA 4F84A 5EPEA 4ER7A 2ORED 3FUXA 2GLUA 5E8JA 3SVZA 3LDUA 5GM1A 4YUVA 1L1EA 3IYLW 1ORHA 3X0DA 3HCDA 2IP2A 2YXEA 1RI1A 2PXAA 2WA2A 3UFBA 4HGZA 3NW9A 5K0BA 2OO3A 4BP1A 2OYRA 1SUIA 3FRHA 4BLVA 4YUYA 3UA4A 4YMGA 5HZMA 1JQ3A 1YZ3A 1XVAA 5K03A 4RX1A 5FADA 5E9JA 4RTKA 2IDKA 2Q41A 5FTWA 2PJDA 2VDUE 2PV0A 1QAQA 2OY0A 3LPMA 3HEMA 3TQSA 3DOUA 4Y30A 3HVJA 2EX4A 2EG5A 1JG3A 4QQKA 4ZTBA 3C6KA 3G88A 5FCDA 4ISCA 3FTFA 4V0RA 1O9GA 1HNNA 1DL5A 3CJTA 2OPBA 1OR8A 1R74A 5KVAA 2C7QA 1JSXA 1VBFA 2B25A 4RTNA 1BC5A 3HCEA 4ER0A 3UA3A 1G6Q1 2ZBQA 4PNEA 4X41A 2PT6A 2F8LA 3M6XA 2PT9A 4PGGA 5CVVA 2Z6QA 2CKDA 2PWYA 4KDCA 2IH5A 4F85A 2ZBRA 2AOUA 5DM2A 3HA3A 4IV8A 5FA8A 4OQEA 1L9KA 3CGGA 4KW7A 4YV0A 1G8AA 3KPWA 4AUKA 2CMHA 2G72A 3KQVA 5EKUA 2GA9A 2OZVA 2IBTA 5KQRA 2B3TA 1VLMA 2B9EA 3LCVB 3G2PA 2JH8A 2ZIGA 3DH0A 4HTFA 1XDUA 4RYLA 5EHGA 5E1BA 4BP3A 1R8YA 1PJZA 3QOWA 3HNRA 4XCXA 3O31A 4PONA 1KYWA 3I5UA 3KU1A 1YFJA 1SKMA 10MHA 3SSOA 4CKBA 3HCAA 2GB4A 3HVHA 4GEKA 2HNKA 3REOA 4C05A 3DXYA 5E2AA 3M70A 3FUTA 4DM3A 2G70A 1KYZA 2YVLA 4GOOD 3FYDA 5LQRA 1N7JA 2HTEA 4OBWA 5EC8A 3C6MA 1RI2A 3FUWA 4FP9A 3SMQA 4E2WA 4FT4A 5EQJB 4QPPA 2UYOA 2V7EA 2ZSUA 3FTCA 3FYCA 4DCMA 4F86A 4HRAA 5K0FA 5BW4A 5EZSA 5KYGA 2ZW9A 2BR5A 5FQOA 2AS0A 3M6VA 5HIKA 5ICGA 2VDWA 5T64A 2PBFA 2CL5A 3D2LA 5E9QA 2ZCJA 3P9IA 2AOTB 3OPNA 3BKWA 3DLIA 4FT2A 5KS2A 4MQ4A 3DMHA 5D1HA 4HC4A 3ER9A 4CTKA 3BT7A 1QANA 1WG8A 4GC9A 4U7TB 3UZUA 1FP1D 5DXJA 3A26A 1I1NA 2IGTA 3LCCA 2JG3A 1M6YA 3BWBA 5ICFA 4KDRA 5P8WA 2O05A 5CVUA 5DT2A 2AVNA 3GRUA 3FTDA 2JJQA 4EQZA 3EVBA 3P9KA 5E1MA 4OX9Y 4LWPA 1P1CA 2O0LA 3MTIA 5T67A 2EJTA 4OA8A 3EGVA 4BLUA 5KQSA 3U81A 3ERCA 1O9HA 4GOMD 4V0QA 3UBTA 3P2EA 3BWCA 3RODA 1F38A 2NXJA 1SQFA 2PX8A 2PXCA 4K6MA 4M7RA 3THSA 3GJYA 2JHAA 1UWVA 3JWJA 3GDHA 1IXKA 1NW5A 2P41A 5EMKA 5E8RA 4EKIA 5LQJA 3TOSA 2EJUA 2PWPA 3DXZA 3P2KA 2UZ4A 3CCFA 4O29A 3CKKA 4HGYA 2H00A 2I7CA 1G8SA 2ZVJA 3TKAA 4DZRA 1BOOA 3PX2A 4RTSA 2NP7A 1RJFA 1X19A 2AN5A 2YR0A 4DQ0A 1JTEA 1R6AA 1RJEA 2OBFA 2ZBPA 4OQDA 5BXYA 1G38A 2Y1WA 2OB2A 3CBGA 4OBXA 3SSMA 4LWOA 5BP7A 3BXOA 3G2MA 4QVKA 3TMAA 5K8VA 1Q0TA 4BY9E 4QPNA 2C7OA 1O54A 2CMGA 4P7KA 1IY9A 3EVZA 2YXLA 1DUSA 3KPYA 3KPVA 3LDGA 4P7GA 1X1DA 5CCXA 2O07A 2XYRA 2G71A 2P35A 4POOA 3P97A 1RI5A 4KIFA 3E23A 3AJDA 4KWCA 1V39A 2OXTA 4UOEA 1XDSA 5DXAA 5CVEA 5LSAA 4AZSA 3JWGA 5DRTA 1L3BA 5GOZA 1M6EX 3Q87B 2ZZNA 2BZGA 4E2YA 3NWEA 4PIPA 2ZTHA 4C4AA 4YUXA 3OZSA 1Y8CA 3R0QA 4KVZA 1ZHFA 5EKXA 4PYLA 2H1RA 3BGIA 3G89A 5H02A 3G8BA 1VE3A 3TPZA 2PLWA 3C3PA 5DWQA 4PINA 1EJ0A 5IKMA 3FPHA 1NBIA 3DUWA 5E9WA 3EVEA 2AN3A 2VP3A 3IEIA 3OFKA 3KR1A 1RJGA 3VC1A 3SGLA 4RTRA 3PT9A 5EIFA 3QV2A 3SXJA 2PVCA 4R05A 4A6EA 4PCLA 5ICEA 3L8DA 2R6ZA 1BHJA 5D1NA 4E31A 3SM3A 3NDIA 2QY6A 4PYNA 3T7RA 3WSTA 2VDVE 3BGDA 3E7PA 3LBFA 1R8XA 1FPQA 2GAFA 3BZBA 1L3CA 2NYUA 3H2BA 1INLA 3R24A 3BGVA 4FR0A 2AZTA 4P7JA 5K0JA 5DTRA 4P7FA 2HR1A 3LCUA 1PRYA 5DM4A 5K0LA 3NDJA 3KQSA 3MCTA 3C3YA 3TRKA 3EVDA 2FRXA 3R6TA 4IWNA 3VYWA 5JR3A 1JQEA 3RIEA 3ANXA 1IM8A 1NW7A 5F2OA 1T43A 1WXXA 2PKWA 3KQOA 4QTTB 1XCLA 2WK1A 3IV6A 4QDJA 5GWXA 4U7PB 3KQWA 1F3LA 3OU2A 2IDJA 2EFJA 2HWKA 2AR0A 3FRIA 1L3IA 3GGDA 1I4WA 4RV9A 1G60A 1QAOA 4Y2HA 1XXLA 1I9GA 3I58A 1YB2A 2AOUB 3HVKA 2V74B 1RI3A 2B78A 2BR4A 3S68A 1FJXA 1FBNA 4X60A 1JTFA 4C06A 2BM8A 3FPFA 4YUWA 3UJ7A 5LQKA 3R9XB 1H1DA 3ORHA 1D2CA 1WS6A 4MWZA 5F2KA 5HFJA 3B89A 2NXNA 4HTFB 2QYOA 5CIYA 3V8VA 5HILA 4PCAA 3SSNA 5FWAA 3UJ8A 3DP7A 2ONZA 2Y1XA 5HIMA 1NT2A 2ADMA 3EGEA 3DMGA 5FHRA 5K01A 2C7RA 1X1BA 5EMJA 1ZGJA 1FP2A 4MIKA 4DMGA 2AN4A 1D2HA 4WVLA 1X1CA 4L7VA 2QRVA 3TR6A 1QYRA 3FPJA 4PIMA 1U2ZA 2ZWVA 3OFJA 3AWIA 3BKXA 5K0EA 4EK9A 2NXCA 3GNLA 3KQTA 3PFGA 1P39A 5EEHA 4DF3A 3NVMB 4M36A 3DLCA 5K0NA 2AOVA 3HCFA 3KR0A 1KPGA 1JR4A 3GRRA 5LQNA 5GINE 1EIZA 3PS9A 3KQPA 2IH4A 5DX8A 2XYQA 4R8RA 3FPGA 4M37A 2G8NA 3EEYA 3A25A 3O4FA 5CD1A 3GIWA 2GS9A 4PYKA 4QQNA 3VC2A 5BW5A 5F2NA 3T7SA 4CKEA 5EOVA 1UFKA 3Q7EA 2XYVA 5K0GA 3PX3A 5FULA 5E2BA 5CVDA 4R8SA 3MB5A 5DM0A 4GF5A 1ZGAA 2P7IA 2P3LA 2ZLBA 3T0IA 3KQMA 1NV8A 5ICCA 3HCCA 2UYCA 3UJCA 2Z6AA 4LG1A 1DCTA 4FGZA 1YF3A 3ELWA 4RTQA 2UYHA 2K4MA 1HMYA 4EVIA 5EZQA 1NV9A 1G55A 2XVAA 2BR3A 4ATNA 3OU7A 4C07A 1MHTA 1TW3A 1N7IA 3CC8A 5GP1A 5DTMA 5EHIA 2ZWAA 1BKYA 3LL7A 2I9KA 2P3QA 4GC5A 3I53A 1NBHA 3FZGA 3LSTA 4CKCA 3LKZA 3LHDA 3G8AA 3GRYA 1SUSA 1AF7A 5CM2Z 4M38A 3AXTA 4GOLD 3LGAA 5DTQA 1XJ5A 5IH3A 4YV2A 2YTZA 1X1AA 3DR5A 2R3SA 4RTMA 3CVOA 4RWZA 2AOWA 1YFLA 5T6BA 4MTLA 3AY0A 3CJRA 5MHTA 1VP9A 4E32A 5CVJA 4BLWA 3GRZA 1M0EA 1SQGA 3MCZA 3P9NA 2XBMA 4IV0A 2I6GA 3G2QA 3GCZA 3TLJA 5M5BA 4CWAA 2NXEA 4FSDA 3V97A 3RW9A 1MJFA 3EPPA 1EJ6A 2O57A 4X1OA 4RTOA 2Z6UA 2A14A 1NE2A 3EVCA 2PY6A 3G2OA 3O7WA 4Z2YA 4MHTA 3GO4A 3B3FA 3UJDA 3A4TA 3BUSA 3LBYA 2IIPA 3A7EA 4PYJA 2FK7A 3OE5A 3MERA 2JH9A 3QOXA 1JSZA 3DXXA 1Q0SA 4WXHA 3T7TA 4HG2A 2P8JA 3HM2A 2HV9A 3THRA 3SR4A 2IH2A 3E8SA 4GUAA 4RVHA 1YUBA 3KQYA 4ER3A 1JG4A 2JHPA 4RTLA 3NVKI 2UYQA 1AV6A 3OU6A 5HEKA 3ELDA 1KPIA 1KHHA 3B3JA 4PYIA 5B1SA 4X61A 4IKPA 4E33A 4GOND 5LR6A 2ONYA 3AXSA 3EEOA 4DKJA 5C0OE 3KR2A 3G5LA 4PWYA 2GPYA 4DCGA 2IBSA 3PTAA 3FTEA 2FCAA 1ORIA 4AZVA 3K0BA 3GU3A 3G5TA 5K05A 3EMDA 4OA5A 3FUUA 2IFTA 5ERGB 5FQNA 4AZWA 3PB3A 3NMUF 1KIAA 3M33A 4H0NA 2G1PA 2I62A 3P2IA 4QDKA 5E1OA 4PGHA 1QAMA 3FUVA 3UJAA 3NJRA 3MHTA 3DMFA 1ZG3A 2AOXA 5EGSA 1VIDA 3UWPA 2ZULA 4ER6A 2YQZA 1XCJA 4PYQA 2YUIA 5EMMA 3TM4A 3UJ9A 1KP9A 2VZ9A 2P40A 4E70A 1WZNA 3CJQA 4XUCA 1AQJA 1ZQ9A 1EAMA 1NW3A 5FUBA 5DX1A 5K09A 2ERCA 3PFHA 1UIRA 1WXWA 4KIGA 3HCBA 3LKDA 5FHQA 5G02A 5HOQA 2NNWB 2YX1A 3MGGA 3HP7A 2DPMA 3I64A 3KKZA 2OB1A 3M6UA 2OKCA 4CXMA 4DA4A 3FPEA 3KR9A 2DULA 4RVGA 1XTPA 5E1DA 2ZFUA 4HSGA 5GM2A 5LQUA 3BWYA 2PXXA 5CUQA 3M4XA 4RVFA 4E30A 2AOTA 3B7PA 1N2XA
chains in the Genus database with same CATH superfamily
4DWOA 4F3TA 1SCUA 4AYWA 3LX6A 1X1QA 4NE7A 2NU8B 1HT3A 3UFXA 2W42A 5DK4A 5ES3A 3JQ9A 5AP9A 3NGMA 3EPKA 2G7MC 3DMYA 4MA4A 5A4JA 3EVFA 1EVQA 3O9MA 1K1EA 2E6UX 2A86A 2G1AA 5BQFA 1UZLA 1NXPA 3JQGB 3W04A 3WRYC 4WFIA 1SN7A 1KERA 5CB0A 4WKPA 5IHXA 3VZSA 1FFHA 3AL2A 1U3GA 1XZGA 2V0NA 2QU8A 1P7ZA 3AY6A 3PHJA 4XFDA 3TZBA 5B37A 1J1UA 2FZVA 1TKAA 3TLYA 1YS9A 4HMQA 4JLKA 1HLFA 2OXEA 4G56A 2YIMA 3EZXA 1GCOA 3ZDQA 1Q50A 1SKQA 3MBIA 3TCKA 3HTXA 4XQGA 4N3GA 1UKBA 3ZS8A 3UJ6A 5TIIA 2PPLA 3LWDA 2Q2OA 4C6TB 3F4LA 1CJVC 1KP3A 1KVUA 1F2UB 1C41A 1RHRA 3KALA 5AUQA 5H9VA 4I3HA 4NENB 4CU5A 3QF4B 2JFZA 1ZL2A 3R0ZA 3D43A 4KRGA 1J5XA 3VJKA 5J4KA 5KVAA 2P7HA 4RIIA 1D2GA 3D6HA 3I9FA 1ZJJA 1C80A 4LUCA 1GYQA 3LQ2A 3A9VA 3EOBI 3AB3A 5AHXA 4Q4DA 5FTLA 2PXHA 4MAFA 4GP7A 2B94A 2WG2A 4BV3A 4L0MA 3WWZA 1NX9A 1UM8A 4B4DA 5J4YA 1MX3A 2JIQA 4B0OA 2H48A 4Z99A 4YCSA 4Q03A 1GTL1 2QLFA 2FUNB 4RSRA 5FFMA 5DGIA 3TJMA 4B45A 1N75A 4OEHA 1GTVA 3WMWA 3L7MA 1AHNA 1M1NB 1ZGHA 2APJA 1BRMA 1SEPA 2CDBA 2QRZA 3H7AA 4AMYA 4DJEC 3ZJUA 4MV6A 1QK5A 1WJGA 1U98A 1LH0A 2DWUA 2H7VA 3I72A 2Q5LA 3OOWA 1QHHB 3WY9A 2XB8A 3K15A 3VNBA 2P3SA 3T4UA 2IEIA 5DBGA 2QG4A 4DJJA 5JQGF 1SBHA 1EQAA 4N12A 3HBMA 2W58A 2RB4A 4R1LA 4LMPA 2ZT6A 4ZEWA 2D1TA 5A4DA 2QHXA 4RTJA 4DV6B 3WA7A 2X8AA 3NBUA 1JHUA 3RANA 1HEUA 2AFIB 2GZHA 3MJRA 3PDIA 4FW9A 4HPXB 5A05A 3RARA 3U2QA 1TZKA 1I4LD 1UFVA 3GHHA 4BC0A 9LDTA 5AVRA 4O2LA 2UZIR 5DDIP 1CEYA 3HKEB 3STYA 3KOXA 3RYIB 2WZBA 5C4MA 4GSLA 1EU1A 4FIZA 1ORHA 1TX4B 1UJMA 1J9GA 1RPJA 2A57A 2NO5A 3EQ6A 5B7NA 5K8VA 3ND8A 1X6VA 5T5QA 4A0RA 3A4IA 2FDXA 3WWDA 3DD5A 2ZR7A 2FOIA 1J5PA 1UL1X 2IKQA 4TV9F 4V1CI 1PDOA 3OD1A 1YMUA 4PSKA 3DKRA 1F5SA 2HCRA 4TXHA 2YYAA 4FYWA 3PI6A 4F1JA 1TQ4A 1NNLA 3B1KA 3CPSA 4Y30A 4IJ5A 1IN7A 4EECA 1U7PA 1Z5NA 4PLHA 3NBAA 3ZCPA 4AIIA 1NL3A 2YQ4A 2GASA 5JXIA 4C3UA 3AFHA 2GKGA 3JRXA 3WIBA 2Z0MA 2OGSA 1U02A 1YE3A 1O0BA 1SBIA 3OHSX 4N9QA 2DHRA 1NLFA 3LUFA 2C0CA 5ALKA 2DECA 4DPMA 4Y98A 5DCUA 1KMQA 1N9ZA 3E9NA 1M2JA 1RM3A 4G0PA 1Z34A 5D7NA 1H2WA 2LGJA 5L7YA 2JJ2A 3A4YA 2Q1XA 2V7WA 1C9EA 1QUFA 2IHVA 3UK0A 3JATB 4NPAA 2OBXA 3CGGA 1JLRA 1NXOA 1PWXA 1MNQA 5B3KA 1JFTA 4DR5B 5KTOA 3DS8A 3MEQA 1HLPA 1USKA 2BFDA 2IBTA 4YRTA 1YQGA 3ZVLA 1VYTA 1EX1A 1GY8A 1EFVA 4M0MA 3F6CA 4BB0A 2AE1A 1R8YA 4RQAA 5KOIA 2YUTA 4LZJA 2RJOA 3V7UA 1Y9JA 3ZHOA 3W6OA 4NZPA 4DOMA 4BUZA 2XUQA 1BO6A 5C35A 5KYWB 1GKYA 4CR7A 1IHUA 4D25A 1QO9A 4N01A 2LRHA 1B73A 2GB4A 3DXYA 3M70A 4M1EA 1I5EA 2O6HA 2ZJ2A 4IDAA 5BSTA 2F67A 5BPFA 2C3YA 2ZBEA 2EYUA 5GJCA 1TZMA 5EC8A 1YNOA 5E0OA 5KTPA 3SMQA 1PGNA 1GRRA 2CLOB 2GN1A 3D4NA 4IJQA 1H85A 2RHMA 3ROGA 2KLHA 3I4FA 4H7JA 4NH4A 3H8VA 1TIPA 3KX2A 3I3OA 4N3BA 3TXYA 5BSVA 2PUVA 2QBYA 4IDGA 3SBOA 2YZNA 1E2BA 3VZCA 4LYHA 1GGFA 1NN3A 1SURA 1X3SA 3VSAA 3SHQA 1WXDA 1EVZA 2BEUB 2YKGA 3OQ6A 3ZV4A 4O2AA 4YWHA 2BHSA 3ZGYA 4I50F 1WG8A 3N75A 2IEYA 3GLVA 1FP1D 1JIUA 1KAHA 5DXJA 2I2BA 2I80A 5BR7A 4LA4A 2ECOA 5KOHB 1G17A 1OX4B 5CVUA 3TEMA 3LX8A 3TW6A 1IUKA 1T8YA 1XG5A 1V2HE 3LY5A 1JSLA 2Y99A 5KYUA 4EHAA 3KWFA 3UK6A 4FM9A 5ICMA 3MTIA 3EPRA 3SQNA 3QVJA 3DL4A 4R1SA 4Z8XA 5B4UA 1EJBA 2ALJA 2D0IA 3K1AA 2ZKIA 2IHTA 2DCUA 3WNDA 1H2ZA 3ZGZA 3QEMB 4N3CA 4K6MA 3Q5EA 4M7RA 2DQYA 5BQPA 3IT0A 4EF6A 4YJFB 1OT3A 5LUAA 4IIYA 3ZNOA 4XQ9A 3D7RA 1J0AA 3GDFA 4EG6A 1KQFA 1XMQB 2R47A 2XMPA 3NTXA 2A30A 3HLKA 2QT0A 2H29A 4GYWA 4Q1VA 3A6LA 3TL2A 3UMCA 3RAJA 3KK0A 2H6EA 2OFXA 1CEEA 4QYSA 2KQUA 3IIIA 3PLNA 4KNVA 4ON9A 4PX5A 2GEVA 4E15A 4ZPJA 1ZI8A 1L7QA 5H3CA 2AN5A 2X15A 1CZNA 2K5UA 4NWIA 3OEED 3WLEA 4D5EA 2HJSA 3CRZA 4B82A 2GVDC 4PHHA 1Q2UA 1ESNA 2PMFA 3TF5A 2NTEA 5E6RB 3KXIA 3I2HA 3WI7A 1R0YA 2JEZA 3UJ3X 4JVNA 1S6YA 4TKUA 1T5TA 3QUQA 4O4HF 4B6FA 1PUJA 2QLMA 3I3SR 1SA0A 3KPYA 4MQUA 3SYTA 3ZK9A 3G0BA 4BNFA 4H3VA 1VI5A 5J5CA 1RWKA 4BECA 3HVUA 4AROA 2X8LA 4MPTA 5LXTF 3RYFA 1CD5A 5TGZA 1B00A 4CIAA 2IOFA 1CZOA 4B3XA 2ID9A 1RWWA 1XDSA 2GN2A 5FTMA 4BOYA 4WASA 5LSAA 2HM7A 1FQOA 4RHTA 1IULA 5JVDF 2EKDA 5EN4A 3VKUA 4OSEA 2ZZNA 1RWOA 1BD4A 3BEDA 1OWOA 4B5LA 3C8HA 4GYJA 3OUZA 4IO1A 5DU2A 1ISMA 1QE3A 4ZANA 5KKNB 2VYND 1Y8CA 4R0VA 4F93B 4PX3A 1JHOA 4G5GA 4GVLA 3RC2A 3FZNA 4TT3A 4C2UA 1O5IA 1G66A 1NBIA 1VE1A 5BQXA 2NXWA 1RC1A 1ZWLA 3L1VA 4URFA 2IOQA 4HDOB 1SOAA 2J9ZB 3OSUA 1V45E 2ST1A 1IWBB 3N6RA 3OA0A 4KUHA 1WDWB 3JQFA 3GBVA 2HH9A 5KWIA 2V58A 1G6HA 3CNEA 1NVDA 4ND7A 2ZRIA 1SR8A 4RJ2A 3H04A 3RYCB 4E31A 1NM5C 4NCXA 1NY5A 1ZIYA 2C92A 2EIHA 2XR1A 3FNRA 3LT0A 1U4SA 2PRYA 4ISBA 3PDWA 4KV9A 1ENYA 1MOPA 2O7QA 3EXEB 3NONA 3S40A 5M3BA 5ITSA 2VNKA 2B4AA 1XVVA 1MAHA 2JF0A 4MUHA 3DBHB 1INLA 3U39A 3UY4A 1BD3A 2Z1DA 4K40A 4JIMA 3NFYA 4JOBA 2BFCA 5DNUA 4P7FA 1B76A 4HTAA 3B8HA 3JQQA 3QMPA 2P9FA 4IOKA 3Q9LA 1ZM7A 5G3ZA 3HO8A 3NZEA 5JNVA 4XX0B 2PKWA 2XT0A 4TWJA 4DS3A 2HEGA 1EDOA 1Z74A 2JB9A 3H2HA 3NJ8A 3U4IA 3VFDA 5KQGA 5JUWA 4M1MA 3IV6A 1YOVA 1QHIA 2H5EA 4KQMA 4LVOA 4LGYA 4JJ7A 1C9JA 1DC5A 3AJ8A 4I5GA 4I6EA 3EY4A 5IG2A 2NT3A 2WP0A 4M8KA 4DQUA 3C3DA 3GCGA 2UYYA 2RCNA 2OQ2A 2GHTA 2JAOA 3JQBC 4FPXA 3ZJ4A 4E1BA 1YB2A 3FDZA 1X0XA 4MQLA 4XWKA 5FBRB 3GPLA 4DY6A 1M2VA 5HF8A 3V9PA 5H7XA 5FOWA 5T4EA 2PH5A 4HGRA 2RAVA 3LIPA 2OAEA 3HK2A 2CHGA 2VJCA 3PJEA 5B3LA 4IJMA 2KMLA 3L77A 4ASUD 4BVEA 4JLWA 2FGJA 2R00A 4LS3A 5HILA 3SSAA 4BYMA 2GXAA 2IHKA 3PU6A 4X8MA 5AXDA 3RAPR 3K2QA 1NYRA 1IONA 2OCGA 3FIJA 4HB2A 4LRUA 4UQPA 1YJCA 2GJAA 4PTLA 4CEIB 2VUHB 4IPTA 2HLDA 1Z63A 3LI2A 4C3ZA 2ABWA 1OXKB 1R6DA 3BQMB 4LDQA 2W93A 3DJFA 1YQDA 4MO2A 1ZJZA 5DHQA 3IUBA 3SICE 3QGMA 2R96A 1CYEA 1JFVA 2YDXA 4IUBS 4EK9A 3L6BA 1BGVA 3B6KA 5KOYA 4CG1A 4F72A 5J3JA 2RCYA 1U04A 3ECCA 1F2TA 4G84A 1UC5B 2RBKA 3OLYA 1H8HA 4JHLA 1BIFA 1KPGA 5AJWA 2QPOA 5FI5A 1KI6B 1EIZA 4G26A 3UWOA 1YR9A 1CLEA 3DKIA 4H60A 2FSIA 4M37A 1YC5A 5CD1A 5I48A 5KJEA 4EW6A 3GFOA 5IMBA 4OQNA 3FGPA 3TH5A 5BW5A 4IIJB 1W73A 2CLEB 3NUZA 3VA7A 2ZUWA 1SRRA 1G6OA 5CVDA 1HNZB 1EA7A 2DG2A 1ND6A 2VNHA 4NJEB 2YJTD 5AMXA 1LC0A 4W5OA 2JFNA 2X8BA 1XROA 4BNVA 5EIXA 2XNSA 1W4RA 3RASA 4C3VA 5DM70 3V4FA 2VJAA 4JJAA 4QX6A 4HXFB 4BEJA 4QU0A 3T8YA 1AOXA 1B2RA 1WHTB 3WDMA 3C6ZA 5ILOA 1AGPA 1YK0A 1N3IA 2QZPA 4UE2A 4WXEA 1YFKA 2I8LA 1HMYA 3ROEA 5A4KA 2IYTA 5B3JC 5BSGA 4B3SB 2XBUA 1YZUA 4ERNA 5CA1F 1W30A 2F62A 3CNHA 4LY9A 4RELA 4QC2A 2XEDA 3UTCA 3DOCA 4J4HA 2NSJA 3D31A 3LKZA 1GPH1 2ZJZA 2L19A 3KVNA 2R65A 4AAYA 2GOYA 2ZG6A 3FNQA 3FVRA 4OGWA 3F7TA 4QNMA 3ZOKA 4NE2A 3KTDA 5HRCA 4X6LA 1BQ4A 1WMAA 2CZCA 1W4AA 3VH1A 2YTZA 3IBYA 1QZ3A 1UKAA 2P6UA 5C1OA 5GONF 2W9XA 1TD9A 1VRCA 4TS3A 1NNEA 1W29A 2HBYA 1R12A 2EX0A 3VC3A 1X87A 2IE0A 4L8WB 4Q9NA 2HJGA 2C3MA 3BWVA 3G2QA 1DKUA 1HSZA 5CH8A 5DNVA 2QG6A 3RSCA 2LVBA 1FMJA 2BDTA 1CG6A 5COQA 1KWKA 1MHPA 2FGKA 2GEKA 2O57A 4U2EA 1FUYB 4X1OA 1NE2A 4M60A 1WO8A 1XBTA 1K98A 4H59A 1BEUB 4HMOA 5AKYA 2IIPA 4QG7A 2HLNA 3R3JA 1G3MA 3A6GA 2XWPA 3CKLA 3DXXA 1T4CA 2C4MA 4HOYA 4PNZA 4GPBA 1GZ3A 3GUVA 1AA6A 3ERCA 4M0CA 4MQ6A 1VHLA 5JY6A 5E7MA 1XHLA 4LJ6A 1E66A 3B9PA 2P2GA 1OIVA 1LDNA 1V3UA 1YL6A 3BZUA 1FDOA 4D9IA 1SOVA 1N3BA 1EFTA 2BKEA 2GHRA 4M0UA 5A3SA 3LVRE 3BS4A 3AB7A 3PC2A 4L95C 4WGFA 4MR7B 4BWVA 4D8TA 3PTAA 2QEQA 1UDWA 2YWFA 3G5TA 3N2KA 4J3FA 5FQNA 4WZAA 1DAKA 3Q7PA 3TB6A 3SF8B 2B0JA 2NO4A 1O6ZA 1ZICA 1GLVA 5K2MA 1N6LA 5BWLA 3HFRA 4OUDB 4IQ0A 4WGGA 5G41A 3V1NA 4CL2A 3U31A 3NVAA 2BGMA 3FNEA 5G0TA 1IZ8A 3RHFA 4G0WA 2PGNA 1GDDA 1KP9A 4BATA 3VO1A 2GN9A 5DOZA 4HVTA 5I5EA 3EAGA 4BQRA 4M98A 1DJLA 2QN8A 1XD2B 3GY0A 4YT4A 5AVSA 3LYHA 3LW7A 3HJBA 3UF0A 1LRKA 3BWXA 4Y2YA 4R8VA 2JI4A 4DC1A 4J94A 2C0QA 1W88A 4IDPA 3JSXA 4MDYA 3HP7A 3MTBA 2WKQA 2HF8A 5DF1A 3T61A 5A4MS 1XNJA 1FUIA 2DULA 2AJLI 3P20A 1SUAA 2B99A 2QM7A 3B20A 1QRRA 1CXZA 4LWZA 4LOHA 4PE5B 4XSHA 5LC1A 1YOBA 2PUEA 1QVZA 4KWTA 4KYVA 2DETA 3P94A 3PQ5A 4M1KA 5T57A 2R6AA 1D8TA 3AR6A 4B17A 3TK1A 2FG5A 2SCUB 4QRIA 2RI1A 3ELUA 3HBFA 1T5IA 1REQB 2GTPA 3PGVA 4XFKA 5ESXA 4RIHA 5JNSA 4OUKX 4RS3A 4RL6A 1Q1BA 3R3UA 3SC2B 4AWAA 3BIWA 4BQPA 1DCFA 3CRNA 4GXQA 4JVSB 4UNSA 3ODPA 2NU9B 2JD1A 1PVOA 4JUAA 2W2OA 2IUSA 3NV7A 1MH1A 1LNZA 1UM9B 4FHZA 4YR7A 2BSQA 2PBRA 3OUUA 3DD1A 2D7DA 1OFUA 3LUPA 3VUFA 4DUYB 3HP1A 4UD6A 1FLNA 1H05A 2PYDA 5EVJA 2HK9A 4PZLA 3HYTA 5F7ZA 5AWFC 2R6FA 3DT9A 1PV1A 2GESA 4XLTA 4RZSA 3A9WA 4PO3X 1A2KC 3FVWA 4HH0A 4PHFA 1G42A 3ZNPA 4ZZ3A 1M8FA 3WO1A 3HBLA 5BMVB 1NURA 2RHRA 2UYGA 3T5AA 2IOHA 5DP1A 3VVBA 4BFCA 4C7BA 4G67A 2LV8A 3HZHA 3MWJA 1FMLA 1DSSG 3RJMA 1E99A 1PV2A 5E3HA 1JB9A 4D3FA 4ZCMA 4R54A 3WJAA 4LSGA 1VPEA 4E6PA 3EPLA 1NN0A 4MIYA 1BJTA 4HAXA 4URVR 5HZHA 4Z9XA 1E1NA 1Z35A 4ER5A 2NG1A 4ZI3A 3ZIUA 1TGVA 4YCAA 4BAUA 2CE7A 5EJ7A 4R31A 1P19A 4RW0A 4FDAA 3JQPA 1WAMA 2VKTA 3HU1A 4KOAA 4TZKA 4US0R 1DRKA 1KMMA 2BTOA 2IYYA 3DDCA 1IM5A 4X85A 1YBHA 5DM1A 2B2CA 4US1R 2W2PA 3GLIE 3IBTA 2YBEA 2XGGA 3ZNQA 3EIXA 1VMKA 2CJYA 3DV9A 4RK4A 2JNWA 4PCVA 4DIMA 1WPGA 4UTPA 1KBZA 2PGAA 4M7WA 16PKA 2P62A 1JZTA 1S5PA 4REMA 3O8RA 1MFPA 3O8DA 2AFHE 4HFRA 5F2EA 4B1FA 1U5CA 2CMFA 3RTEA 1ZVJA 3LECA 4YIHA 2C3OA 1SKBA 3F4KA 4GR5A 2XCQA 5C5DA 4HQKA 4HYQA 3KYBA 4GKBA 2A9JA 5FWYB 2IHJA 2NVWA 4CHGA 1R18A 1N6HA 1RQXA 2WSSD 2B8TA 1RCUA 3QBJA 3A0UA 3HB0A 3OQBA 4YMHA 5J23A 4RAQA 3ZVMA 2X2FA 3DLPX 3PXUA 7ABPA 5E3JA 4OX9B 3ZI4A 3FCEA 3GFQA 1T13A 3P26A 1U0FA 3IYLW 4IOMA 5BSUA 3PZBA 2YXEA 3WNZA 5IJWA 1CK4A 1KI1A 2QU7A 3JAWB 4ZZIA 4JODA 4RGQA 3DSRA 1WP4A 1BXGB 2XNDD 4I9UA 1TZJA 5K3FB 4G4SP 5JS2A 1JQ3A 5F73A 5CFQA 1I7QB 2GK7A 3WLRA 2VQSA 3OOJA 2FWAA 3SFTA 5K8TA 2IDKA 4LHWA 1BU5A 2WSBA 1LDEA 5A3VA 2O8CA 5CRIA 5HCIA 2FOXA 3TQSA 1QC5A 5CCDA 3EWAA 3OTHA 4NU0A 3AY7A 4JDUA 4FYHA 4NMWA 4OXXA 2O54A 2YFYA 421PA 4EJSC 3BGSA 4V0RA 1GG5A 4A8JB 3VHXA 3ZWCA 1X74A 2VSNA 5JH7A 5JRDS 4G4SO 1P31A 1B8VA 2BFOA 3V4LA 3QMMA 3PRKE 4NCNA 3CH7A 1BC5A 3BEOA 1AHHA 3L9XA 4WFKA 3WJ1A 1M2HA 4P6VF 1MOQA 2ROQA 3LP5A 3F98A 1Z06A 1FMCA 4IX1A 4QKQA 3LRTA 1PJLA 4TQUS 3I9KA 1PQYA 5IVPA 5FI0B 3D3WB 4S0ZA 1CE8B 1CR4A 3ETNA 1H93A 2I2CA 4DCCA 5AW9A 3EH2A 4UVHA 4MW6A 5TRTA 2XE4A 5EZ5A 1ODCA 2VG8A 1MXHA 3CX4A 3PYMA 1Y98A 3KJQA 4KXVA 2QAGC 1AUVA 5KQRA 4QBKA 2C0PA 3KKNA 2QF7A 1EZ4A 5JHHB 3U3JA 2XA1A 3PRHA 4RYLA 5LIPA 2IZZA 3HDGA 3SX4A 5M34A 2VF8A 3W8EA 4EARA 1OB2A 2JLYA 3AEYA 1TEVA 1D2RA 3C43A 1SQ5A 1PSDA 1VBMA 5FWXB 1M1YE 2DFLA 3K9NA 3PNVA 4TTSA 5AJUA 2NZWA 5I9SA 4HRXA 4C05A 4OO3A 1YZNA 1OPRA 3FUTA 4YACA 4CIYA 4B74A 2WB4A 2WSYB 3G02A 1UBUS 5BN4B 1B14A 3FFXA 4YT8A 1QKIA 2VJBA 4X0EA 4BZQA 1TAUA 1T8PA 1XZHA 2FZ4A 3S7TA 1MW8X 1OUMA 4GBMA 2OO5A 4D4KA 4N4AA 4B6GA 1NWCA 1X86B 3SHTA 3KQNA 3OTWA 1V48A 3CUWA 1ULZA 4H9GA 3OPXA 3GQBA 2CFOA 3SIPA 4C4OA 3NEPX 1R16A 1IXYA 3A26A 1WV0A 4J29A 1YI8A 4K28A 2BLLA 5ADWA 4KDRA 4GKJB 4BNGA 4ENQA 2RK4A 2VI5A 2YWRA 1MU0A 5THXA 3AY3A 3TJRA 1E60A 4QLAA 3PITA 1YE8A 1K3FA 2FQWA 4LWPA 5T67A 4BIIA 2FUG1 4HDQB 4HY3A 4IJUA 4HNHA 4OA8A 2R8PA 3GLIA 4FFSA 1ETUA 2COKA 1ABEA 3NRBA 1E1CB 1GUYA 3AJEA 2PZMA 1QIMA 3PEVA 4PZZA 1IN8A 2JHAA 4LKRA 3ZWVA 2R68A 1PFQA 1Y9EA 2AFHA 4BNNA 3FLBA 3V32A 4ZZ1A 3NP9A 2A33A 3K1JA 3OFND 2HRRA 4H31A 4OI4A 5C5EA 1IC6A 3WS7A 3AEUB 5KB3A 1AXEA 4QXPA 2GD6A 1N5LA 1WXIA 3MS7A 1XHFA 1QDLB 2MSDB 4CYMA 1A5ZA 1JKJB 1Q3TA 1NLUA 3UB4A 1JTEA 1MRSA 1NULA 1VGQA 2ZBPA 3NT4A 4FFBB 5FP0A 3LWZA 2MYTA 4G3XA 4A92A 1YA8A 2XRMA 4JBXA 4LWOA 4PN7A 1RRMA 4IIHA 2QP3A 3GRCA 4DMUB 1UMBA 3L7KA 3K0SA 4CDMA 2ETXA 4Z0TA 3E2MA 4HDSA 1TK9A 1IY9A 1XDDA 1JAHA 4FEYA 1Z28A 1XRSB 1HRKA 1X1DA 2HGSA 4MQMA 1CWUA 1DWQA 4FQ7A 2IA5A 4EUEA 1MABA 3IJRA 4BKQA 1VG9B 4R1OA 1JI0A 2NVUA 4F3RA 3EGOA 3G0CA 3OSZA 2Y9PB 4EGJA 3C6BA 5ENZA 2ZRMA 4L08A 1LFAA 2O8NA 4TYYA 1Y6JA 2CVZA 2YJ6A 5BV7A 2XIJA 5JCZA 1H4VB 2VF7A 1UQTA 4JBYA 5AW1A 4XDGA 3GZNB 3N2ZB 4MI6A 4OHXA 1LBSA 5JT1A 1ZX1A 3E5NA 3C3PA 4C5BA 3RIYA 5CDSA 1HV8A 4OFWA 1AVTA 4JQSA 5JG7A 1LRLA 4KQWA 1RPNA 3OFKA 2IV7A 2VQEB 3NORA 2ZPTX 2LE0A 2QPTA 3OI7A 3ZW9A 3TW8B 2OLJA 1U1EA 4CV2A 3L8DA 3BOSA 2WHRA 2PRKA 1RZRD 1E8DA 5D1NA 2FV8A 1XMIA 4QNNA 1UBFA 1L7XA 3B6EA 5T4HA 2OKGA 2GKSA 2J6BA 2LR0A 4JEHA 5TVKA 4EG0A 4TKZA 4J7XA 1GEEA 1GCIA 2GVNA 2I3ZA 2J3QA 2CGEA 2XUFA 3F5MA 3KDSE 1UBJS 4GI3A 4WCFB 3G2IA 1LLCA 1M1YA 4KN9S 5AHOA 5DFAA 4B6EA 1G4AE 3OCWA 4MEJA 2XCIA 3KUXA 3EC7A 3RS3A 2L2QA 5YASA 4ESHA 3RAEC 1PW7A 2PWZA 1YH3A 2DWPA 1SQ6A 2HYDA 2J0VA 2P9QA 1T43A 4R9UC 4Z9FA 5G1OA 1OX5A 1N2SA 3K0FB 1II0A 3U1VA 3ZGXA 1RADA 3K72B 3N0WA 3RVQA 3O2JA 3ABQB 3K9LA 5ITVA 3ZU5A 4MUJA 1A88A 1WL8A 5F5NA 3ZWQA 2YMQA 3PQEA 4NMXB 2J3HA 1L7EA 3ZW8A 4BB6A 3AIOA 2IYSA 3I2JA 1TK2A 4HGPA 3D1VA 3FTNA 4MP6A 3RYHA 1Y3FE 3NYQA 2CUTA 3DUFA 3CV3A 1L1RA 1C5KA 2OCIA 4D8VA 3BC1A 4PG6A 4UU1A 5FUWA 3SZGA 4YTEA 4B3JA 3FPFA 3K9CA 4UDNA 4B7ZA 4D0GA 4YUWA 2J3JA 5CLLA 4LF8B 2DUNA 2IUYA 3EG5A 3DEAA 3Q8WA 4XPIB 2WW8A 4HTFB 1C14A 1RC0A 4NBSA 2X0DA 2Q1YA 5HIMA 2RHCA 3FDIA 3RV4A 3K16A 1RLJA 3KUKA 1TGYA 1C8VB 2BZSA 3ILVA 2UUCB 1L6RA 3G2NA 1Q7CA 3KVOA 3M81A 1U94A 1YKGA 2ZSAA 3IQFA 3V1MA 3RYTC 1OWMA 4MYHA 2C99A 4RVNA 4YDHB 2JAUA 4ZEMA 5KX5A 2QRVA 2X0KA 4OYRA 3K0CA 7REQB 1DC8A 5K0EA 3PFGA 2B9VA 4RZQA 2QJOA 2VDKB 2FG6C 4Y0NA 2H51A 3IHWA 4XIJA 4JUIA 5JRJA 5ALTA 1XX6A 4GOJA 3A3PA 4GR4A 5HHTA 1GR0A 3ZIAD 4KL8S 1Q3KA 4L50A 1WSWA 4RZUA 2GK3A 3RT1A 4DA7A 2OHVA 5ECWA 4C7MA 1GPJA 3O8QA 5JEDA 5DHUA 4A6XA 1Q7EA 2HF7A 1RVDA 1YCHA 1TUGA 4KUEA 4QQNA 5IM4A 2ZXFA 5D2CA 3T1YB 1XMSA 2Q4OA 5B1EA 4QM7A 4MINA 2BHTA 4XLLA 3SZUA 2A5DA 1Q7TA 4YRBA 2GWHA 1WX1A 3GA5A 5EQTA 1IQPA 3T0IA 1SXPA 3ZE8A 2Z58A 1YB6A 4JMLA 1NG9A 3ENNA 3SK0A 1NI4A 4FYMA 4KWEA 2E5LB 1U0NA 2P9BA 4NJMA 4Q9KA 1FLVA 2Y05A 3N3BC 4FDUA 4ZVPA 3UJNA 4M49A 4EFNA 4GZ6A 4PC1A 1TU0A 4OXNA 2H4YA 4OSOA 2XXJA 4W9NC 1JH8A 4JI7B 5IF9A 3I39X 3ZGNA 4GC5A 4HX5A 3FZGA 5AUNB 2ZSDA 3BF8A 5ALNA 3SC3A 1M2OB 4MRPA 2O4CA 3CZCA 2BGRA 5KYNA 5LU8A 2EX1A 5DHTA 4N5NA 4LPSA 4A4DA 3AXTA 3GB9A 3OIYA 2P9YA 2QN7A 4JSRA 3WLOA 4TL9A 1WW2A 3B51X 2AOWA 3B2EA 3CPJB 2ZAGA 4CL0A 5A5DA 3H1EA 3NR2A 3E4DA 5B12A 5LMZA 1EUCA 1W1WA 1MZPA 4YAGA 3B13B 3SYRA 4BFVA 3EGDA 5KNDA 2BYTA 1OASA 2W4MA 3DTVD 1SHTX 4H16A 4RXMA 4ZD6A 2FR8A 3ZY6A 2PD4A 2I8CA 2XCUA 3ZJTA 4BO8A 4C01A 2IYZA 4XVCA 1N8SA 3GLHE 5DI9A 4GLJA 4BV2A 1LFDB 5FA6A 2QRLA 1Y6ZA 4HH1A 4MW2A 2JZCA 1D6JA 4Z2YA 1NFFA 2JH3A 3B3FA 1E4OA 2B5OA 2FOLA 1G21B 1O8CA 3VKVA 3W5JA 2KE5A 2J32A 4EO9A 4QDTA 4EUSA 1ZR2A 2EL9A 3HM9A 1CP3A 1U0GA 2FW7A 5AVKA 2H06A 4M9RA 4ER3A 3URKA 3QE3A 3VNVA 1KHHA 2VBFA 3VGJA 2C8LA 4D8UA 5EE1A 5JBIA 4DKJA 2DU8A 3AXSA 4IINA 1UPFA 1EX7A 3I2GA 1VPLA 5JCOA 4JLJA 1EWTA 1U9YA 2CL6X 4XWGA 4EW2A 2IYFA 2BFEB 2XVZA 3OEHA 4NATA 3OO1A 1DG3A 1XK6A 2OEPA 3WSWA 3M33A 3ACDA 1YRHA 1C3VA 4OHKA 4CLDA 3FWZA 4US2R 3ZDDA 5JQGA 1QCZA 3JW8A 1PT7A 2GETA 3QW4B 2V8OA 1ID1A 2YUIA 4MWSA 3TM4A 4X92A 1XKXA 5BORA 3EH1A 5DEOA 1O6FA 3TYXA 1SB8A 3JASA 3ZXSA 2C5GA 4E5YA 3CNNA 2XVYA 5HPYB 2O2HA 2X77A 1TM2A 4G25A 3L0YA 4U2DA 2YVAA 3B1VA 2IX3A 2HHHB 1NW3A 4I1VA 2LWIA 3JXEA 4NV0A 2EFCB 1CQXA 3IJPA 3PFHA 2EP8A 3WB1A 5CM9C 5HOQA 5CYPA 2QNBA 4G1UC 2GERA 3U4DA 1T6BY 2GYWA 2UXCB 5IJ0A 4DA4A 1L5NA 1KAMA 4KR0A 5KTRA 2BFDB 1RQLA 1MQ8B 2LUOA 3GEMA 2VQ3A 1GZSA 5GM2A 1EFVB 2QVBA 3VZQA 4TV9A 2PXXA 1R8SA 1QBKC 1DBWA 3MTJA 1Y6GA 1WF6A 4AJEA 4YN3A 1OH5A 4KXUA 1EUZA 3C0KA 4IGFA 5BN5B 1SG9A 1Z2DA 4V0OA 5HZKA 4RY0A 5M7EA 1EEXB 4FB4A 5MGNA 3IPAA 1VFNA 1SD5A 2CXRA 2PFGA 3B6IA 1QGED 3L6DA 2EHJA 1RLUA 4IGAA 4TM8A 4DSNA 1QX3A 5LBUA 1XLTC 1RIFA 4HNAB 1SXQA 3ENWA 3MSXA 3F90A 4JJ8A 4ZDWA 1Y1KE 3T1HB 3R4CA 4Y9RA 1UZAA 3AJAA 3KZMA 3VVCA 4EGFA 2SNIE 3BXPA 3DTNA 5JZVA 3D5QA 4KQEA 2BGUA 4CNQA 1L5YA 4DUGA 1YI1A 1YVRA 4DLRA 1OXTA 3EARA 4HNSA 2E37A 3PR3A 1G3RA 1RR6A 3IBFA 4MB6A 4OSPA 1ORWA 2AI2A 1J7KA 3TBFA 2Q6VA 3HJUA 1SZJG 1OI4A 3OIGA 4OK5A 3TNJA 2PG3A 3NYIA 3N58A 1UP7A 2WAMA 1JZQA 4Z7OB 2C9OA 4R9NA 4MVJI 5L7WA 4IRUB 4A73A 3OE4A 3IVXA 3U6KA 4XUEA 2QJFA 3WLLA 5LKRA 1AKMA 2XZDA 3BJIC 2VDNB 3OBBA 5LZ7A 2WIKA 3RK4A 1EXDA 3NIGB 3PNOA 1A4IA 4IQGA 1YJ5A 4TSKA 1G8HA 3U4MA 1H2XA 4OM8A 1X7ZB 1ZM9A 3OZXA 2ZEJA 3T1TA 1NVWQ 3O92A 4DR7B 3NTRA 2HYIC 2NNLD 3LA6A 3LUDA 4JP8A 2WVHA 2ZIAA 1J06A 2JCBA 2KM1A 2WHXA 3A27A 3ET4A 3M6FA 1PFVA 3ZD6A 2GEDA 3O4VA 4ZCLA 2FP3A 1CFZA 1H3EA 3EGXA 3GLHA 2O0HA 4D7AA 1N5OX 4EKNB 3IQDB 2ZDQA 2H2WA 1FS5A 5CJPA 3MQ2A 5B1HA 1FFXB 3OF5A 1D07A 1YIDA 3E8MA 1I4EB 2ZIEA 3PL5A 1FDSA 1K89A 1MPTA 3IQEA 2QRNA 4QFBA 3O91A 4HNQA 4GQBA 3HCNA 1DTSA 2W2LA 2WMDA 4AK9A 3STVA 4I50A 4JGIA 1JHQA 4TYMA 4P33A 4JS0A 5EXXA 5F4ZA 1N0HA 2OQRA 1SA0B 2X76A 5ALVA 3K0HA 2ZJ5A 3BFJA 4F46A 3L4JA 2J3IA 4DLBA 2VJQA 4AN4A 2X3FA 4OJQA 4OXYA 2OP1A 5IZ4A 1CRZA 5DHFA 1WZCA 3U7JA 2P27A 3EK2A 1E8MA 1G5FA 5DI3B 1YQTA 2XMGA 1ZRMA 3OJEA 3RFUA 2WA2A 2W2KB 2CXXA 4OQLA 4B4VA 1YIOA 3G1UA 2OO3A 3JY6A 2XUZA 3ANNA 3AHDA 1YFZA 3GT0A 5JCJD 1L5MA 1XCOA 1LWNA 3I45A 4ZWNA 4XIIA 4Y2PA 1E4EA 4LQLA 2H8GA 5IT4A 2OR3A 1R0KA 3D7KA 1B0AA 1GD1O 2IVFA 2VDUE 3DVLA 4CUZA 4NHEA 4WBNF 1H42A 1NUSA 3AB8A 5JO0A 1KAGA 1WHSB 1XTKA 5CIWA 3UQZA 1KEKA 1ONPA 1W2GA 3C6KA 3RTAA 3IVCA 5FCDA 3FTFA 3RKRA 4A03A 2FZKA 3WAGA 1XEAA 1OJ7A 4J43A 2B25A 4ZYVA 1CCWA 1Z6AA 1UH5A 4O4HA 1SCJA 2XB6A 1TLLA 3WWOA 2GAIA 4ZICA 3H1AA 1TZBA 1PFWA 4BNTA 1EE1A 2HY7A 2CNOA 2PT9A 4PGGA 2Z6QA 5IEJA 2IH5A 1VBNA 3TAUA 3WLQA 4F85A 1DHTA 1PDWA 5LXTA 3VSBA 4PIVA 3WX0A 5DM2A 1IG3A 3BG5A 1DBRA 1R10A 5HF5A 1N36B 1PE0A 4F4UA 3FNBA 4GRDA 1EE2A 1P0PA 1CF2O 5JVDA 4EW3A 3WMRA 5A62A 2B9EA 1J2JA 3P9QA 1O57A 1PF7E 2H4ZA 2UZ1A 2V59A 3S5JA 4BP3A 2I6QA 3WDSA 2C4KA 3EUEA 3QOWA 4CMBA 5LP6C 2NWQA 4XCXA 3BREA 4C7JA 1T1EA 5K7SA 1RM0A 2NADA 2J0EA 1SKMA 3TR0A 4C0HA 3K70D 5GVRA 3AP1A 4AQ7A 1GLNA 1FOEB 1Z2EA 2I7VA 4IIVA 4KMSA 3TAHA 2G6TA 5GQSA 4C0BA 3FYDA 3T4PA 1OBVA 5EERA 4WFQA 4E0BA 4YO7A 1M2VB 3T7KA 4MA0A 4ZT5A 1IHXA 3MMZA 4TL7A 2FJ0A 2A5YB 4HRAA 1QQBA 4LC0A 1R3DA 4AP9A 1IHOA 2PHZA 2BR5A 3PHBE 5EUBA 1GDTA 4NIMA 5E9QA 4EENA 2WAXA 2VZLA 4MH0R 4GPZA 3DW3X 1P4GA 1DBPA 1J8VA 2ZBFA 4OY3A 4WPGA 5CW2A 5D1HA 5HQ3B 1P9NA 2J5KA 2JIRA 3L93A 4P7BA 3ANLA 3H4IA 2C2ZA 1HE3A 2Y1FA 3ORQA 3TRHA 2QRKA 3PIDA 2MYUA 2FZCA 3QFHA 4IP0A 4GM1A 2ODNA 3K53A 4LCBA 1CTQA 4U5XA 3JZIA 4CMEC 3PXXA 1QYXA 3L04A 3AHHA 4JC4A 5K3CA 5K3SA 3HDHA 4K9DA 4GYKA 3EVBA 2PU7A 3QOYA 3X2SA 3UICA 3MT8A 1JPNA 1GA6A 5DNEA 6NULA 4ZT3A 4FUQA 4GOMD 1GWNA 1JECA 3RODA 4KR6A 2OLKA 5FO0A 1C1DA 3NH9A 3PI7A 1NVVQ 5AIAA 4AJ4A 4UPEA 2Q3BA 5LD2B 1PL6A 2C2HA 3L5KA 5KOJA 4RH1A 1KH1A 4ARIA 5I8PA 2ZIWB 2EJUA 3DXZA 2K7ZA 3WGTA 2F1HA 3CCFA 4G1BA 3WHPA 3TOVA 5GADl 5IK2A 4HR7A 3TZ6A 4B2IA 4BMOB 1EYZA 4KXMA 3ZJ5A 2M6LA 3OZFA 3E0QA 1N92A 1RJEA 1ZW1A 1EWRA 3KQHA 2JVJA 1G20B 4A5OA 2I6FA 3CT4A 3RU2A 4C2TA 4AI6A 1M6VA 4PX9A 4O4LF 4TN5A 1DP4A 1S7CA 3CNLA 4Q4JB 1BE6A 4R8KA 4XSVA 4A8PA 4HVLA 4I5IA 5CAEA 4HYEA 1A97A 4RK7A 3DOJA 3G9ZA 3VDXA 4L5YA 1Z0AA 1H9BA 4QXQA 3OAAA 4GGMX 3VNSA 2FXVA 2WJHA 3FYUC 1GYPA 1JG6A 3P97A 3AUKA 4GICA 4KEAA 5CYOA 3AJDA 2C2GA 1MB0A 4BKOA 3HXKA 3K7EA 3V7FA 3WV5A 2VWPA 3B2QA 3FW1A 1HYGA 3H99A 3L7IA 2ZXEA 2WUEA 2V9PA 3IIMA 3KKQA 3PPIA 4MYUA 4ME6A 5IC5A 3CUSA 1EHCA 1Z17A 4JLVA 3T15A 3JPWA 3ZWBA 4AX4A 3WK6A 4YVFA 4GX5A 2V7UA 4WD3A 5EQFA 3W5UA 4D3ZA 3R0QA 1EM8A 2A9RA 4ZHSA 3ND9A 4M9XA 1Y5LA 2X6TA 3LKBA 3MS4A 3W5CA 1ZA1A 1E3QA 2I4TA 1S9DA 3T0GA 2XF2A 3LQKA 4D26A 1GJRA 1NDUA 2GCPA 1D09A 2ZIZA 4RDHA 5GY7A 3IEIA 3EF0A 2EG9A 3VR3A 4EG1A 5A5EA 1RYDA 2ODWA 4WKGA 3KYIB 5EXEA 3RT9A 1P2DA 1V9CA 2C3PA 2NX2A 4YEDA 1G1AA 1FXSA 1P29A 1UJBA 5C32A 1XALA 3A10A 1RHKA 3DC2A 4BFXA 3FLMA 3EXAA 3QVKA 3ZU2A 1UXJA 3FOFC 3MMNA 1NOIA 1EGHA 2BUAA 3D1JA 4AG5A 1OLOA 1F0NA 1YS4A 2C5SA 3OQJA 3D3QA 4RDIA 4OHCA 2GARA 5CA1A 2WVJA 1N2JA 3WRYA 5FB3A 1H2EA 1AGYA 1Z2NX 2O7VA 2FW1A 3F6EX 1GSIA 4UPDA 4MV0A 5FUVA 1Y6FA 5T3YA 1Q1ZA 3BGVA 3F5FA 3GAZA 3DP9A 5E4TA 4DCPA 4Y1RA 1MH9A 3S81A 3SQXA 1RRGA 3KAQA 3KJNA 5AJYA 1NMQA 2FRXA 3EVDA 1C4KA 3NBXX 4KFSA 5GONA 1TVKA 3S2EA 4CU2A 1VLVA 2OHIA 5F2OA 3RT7A 3HO6A 3TVTA 2XXBA 4EA7A 2JGEA 2MYNA 1L7BA 3W3AH 1XCLA 3QIAA 4YFVA 3VYRB 1VSUA 4A36A 3RUFA 5HE8A 4RA6A 4U7PB 4LK3A 2QLLA 2QXTA 4DDVA 3E82A 2VHTA 4W6QA 2I6SA 4CIDA 1FA9A 4RV9A 1OWLA 5DM60 1KFCB 1IVYA 1W34A 4HS9A 3KAKA 2C88A 4Q15A 2OGTA 3C5CA 2PYZA 1XYVA 2VWHA 2W6JD 3ICQB 2X0EA 2DOKA 2J9YB 1FJXA 1RTKA 3AVOA 3JQ7B 3B78A 1W47A 1YMVA 3DV0A 4Y2TA 2MDTA 4C06A 1GGMA 3QXSA 1T1IA 2X1LA 3LLUA 4ZAWA 5LQKA 1NMZA 2GUWA 2LCFA 2NXNA 2JHGA 3QTLA 2GPTA 1WULS 2ZJFA 1DT5A 3OZBA 3SXPA 3EGEA 3C3JA 1X1BA 1DDOA 5FDFA 1V2GA 3KJFA 5EMJA 3BXHA 5IARA 3WOVA 4EUNA 1OLSA 1DXHA 2YWJA 3T3NA 1ZCBA 5T4BA 1QHSA 2F43A 4H4CA 2FUG6 4HRVA 3X1MA 2BDEA 1J90A 2HRCA 3QZUA 4FE7A 1JLLA 4UJ3A 3ONDA 4JT2A 1XPRA 5FX2A 1EZ1A 1XAHA 2Z2IA 3GNLA 3TSOA 1I2ZA 3AUYA 2J9GA 2WVAA 3VR4A 1L5GB 2WWYA 2JFUA 3FR8A 4PO8A 3VJMA 2RGAA 1IH8A 4LSWA 1ITZA 3L7YA 1L1QA 1PQUA 2V6GA 4YAJA 1C81A 3KBOA 2I3BA 5I4CA 2Y6UA 1B8UA 1XU4A 4FGKA 3BTOA 4ZOLA 1RKBA 1QVWA 3C15C 2P2LA 4X93A 4ZO9A 4Z2AA 1TB4A 4CKEA 5DBFA 1N77A 1AH2A 1DAIA 3TSAA 4HDMA 3HBNA 3ZCQA 4C9BA 2AN9A 5GGYA 3DFUA 5JD6A 1VMDA 2GAOA 2HA7A 5E2BA 1JU4A 3F8WA 2QYTA 3OX4A 2RHTA 5HF6A 1OC2A 3GGCA 1ZNWA 2C98A 2VNJA 1DX4A 3CEAA 3G0OA 4L22A 4QWMA 4BX8A 1UEIA 2GZMA 5FL7A 3RS2A 3AQIA 2NU6B 2OG1A 1R5BA 1Z0UA 4FGZA 2BHNA 2VUSA 3G5MA 4A0HA 3ZHRA 1IY1A 1BU8A 4CMAA 1NMYA 3JVVA 3I6MA 4FR5A 5A0TA 1DG9A 3OU7A 5F78A 3VPBA 4DGSA 2Q0QA 1XZJA 3OX3A 4MTCA 2JLCA 3I53A 2ACVA 5DK6A 2CHEA 4V38A 4V39A 3L2OB 5I9BA 3A6PC 4BO4A 1AF7A 2WSLA 4CUJA 3ZHZA 1ZONA 5GJWC 3OLWA 5FBKA 4TKMA 4XIGS 5B6IA 5JC8A 1P9OA 1OA1A 1VXOA 3HB1A 1W96A 2A9QA 3OIFA 1JHRA 1Z5UA 4DMLA 5MHTA 1V9LA 1X39A 1B1CA 2G1UA 1R1DA 2RHWA 4PPFA 3GRZA 4JMPA 2VPYA 1T5DX 4KGDA 4UU8A 2A5JA 3SFZA 4D9GA 1EDZA 4B80A 5F98A 1QGZA 3SZLA 8ADHA 4DV7B 1ECFA 1JLMA 3V55A 5M5BA 4CWAA 4DAEA 3ZI7A 5AHKA 4Z4QA 5L6MB 1EJ6A 1S2GA 2YHSA 2OC4A 5I9LA 2XUGA 5TPWA 1PL8A 1W0KA 3FGZA 2KYRA 4UQOA 1IK6A 5C53B 2VBIA 2BPOA 1SB9A 2PVPA 1LSSA 3R7WB 4HSEA 1E6WA 3H5TA 3T7TA 3Q2KA 3WWCA 3K70C 3THRA 1E3EA 5DH9A 3HM2A 3VGPA 4ZTUB 1KO1A 1W49A 2CYCA 3D6UA 5AW5A 3TTTA 1L4BA 1YUBA 4B85A 1XVTA 1Y4SA 2JHPA 2NSLA 5EP4A 4LRTB 1ZW6A 1RM4A 4D8WA 3C5HA 3GEDA 5TF0A 2BCEA 3LPCA 2GK6A 3CB4A 2YW2A 4MMZB 3AZQA 1YBMA 2WMOB 2Z2YA 3X44A 5ARBA 1ISHA 2R60A 5AW8A 1V95A 2FZWA 2Z9DA 5EJ8A 1BWPA 1QC5B 4LRXA 3Q5DA 2B8NA 3VR5A 2V7GA 4J91A 1EUDA 2FI1A 1ISJA 1NQ5A 3CG4A 4N8SA 1YB5A 3VSCA 4G2TA 4FWTA 4FOOA 2PIAA 1A8HA 3DMFA 2AJCA 4RHUA 3TZLA 4YP5A 3INRA 2IT1A 1XSEA 1SIWA 2V45A 4YRJA 4K9OA 4F4HA 4OH7A 3V4SA 3M1AA 4PSVA 1FSFA 3D8TA 3UJPA 2VJKA 5F7XA 2WTEA 3U13A 4W6ZA 4HN9A 5G40A 3SDBA 3IT2A 5DX1A 2JFVA 1BSVA 3L7AA 3NCTA 2PQ0A 4DWWA 5KTNA 5LM3A 2WWHA 2GBFA 5L3ZA 5LMUB 2IELA 1CY4A 2R86A 2P2YA 2YHIB 2DPMA 2AXPA 2FB9A 2OKCA 1U1CA 2GA8A 2VL7A 3O47A 4OI2A 2R8OA 4NBRA 4LDRA 3WKAA 3F5DA 2QJRA 1G5TA 4MVYA 4I4TB 1H1LA 3RFFA 1G98A 5J59A 3M4XA 3O8LA 3QE2A 4MAMA 3U4CA 4B2YA 2RH9B 4DCVA 3OMWA 3A7DA 4UHDA 1VJTA 1FVOA 4NBKA 4URWR 3GVXA 2VZ0A 4ILEA 5FRDA 1FK8A 4C7XA 4F91B 1B7GO 1XMXA 5BQ5A 1Q0LA 2IYAA 5LQCA 2P6MA 4J0CA 2JA1A 2QW8A 3K4QA 1DEHA 2DT5A 1D6MA 3K9QO 1LS1A 1X2BA 1K6EA 1YZKA 1J21A 1SOMA 3MIIA 4KYIB 3H16A 3O84A 2GBGA 4G36A 1PEAA 3VAZA 4EA8A 3DQZA 4GPTA 2E6KA 2PEYA 1W2HA 2BOVA 5FOQA 2HMYB 1U7WA 3NTLA 3E05A 4QECA 4X63A 3B5IA 3PKIA 4Y6OA 3ICVA 4KAXA 1YL5A 3B2NA 3AF2A 3BL5A 4BMCA 4Q24A 5KC9A 1CUCA 3SE7A 1FXUA 5EWLA 1XTSA 2C07A 2FP4A 3BXZA 3L7BA 4HN2A 5FV7A 1VHJA 4NS1A 3PDCA 1Z4OA 2GF9A 2G9QA 5CHEA 2HA3A 4D9EA 2YXDA 3ER8A 1NKVA 5D3KA 3IAS6 1ECGA 1P1HA 1ZD2P 2IGBA 2QP9X 3AEQA 4DQLA 5LP6F 2PQ2A 3OJCA 3Q5GA 2PV7A 5HOEA 2B30A 1B0UA 1ZOSA 2SKDA 5DLYA 2JZNA 3TRIA 3M0EA 3UWDA 2XUAA 1OXUA 3IKVA 3ZEAA 3QEBZ 3PLRA 2WA1A 1C4XA 3FETA 1ADYA 4KN8A 4LNHA 4WADA 1J70A 2YMLA 3CW8X 4UD2A 3SC6A 3SG0A 3TTVA 5KNLA 2M2IA 3B9BA 4IJVA 4OXRA 1OVMA 1RE1A 2AFHB 1J23A 1OZHA 1YJ8A 2BEVB 3E9ZA 4DYVA 1RKQA 5HJ7A 1BCRB 1FNDA 4ARUA 1EFRD 1LWOA 3LUCA 1NM5A 5HK8A 3BRWD 1SKYE 2PX2A 1SFRA 2QQFA 2AMYA 3HKDA 4RVDA 3DZCA 4S0XA 4EB8A 3ROMA 1G8GA 1UXKA 3IDZA 4LE2A 5K3EA 3TD2A 2R6DA 2V9CA 3D81A 3EMBA 3DDWA 4O4JF 3ELYA 5JPDA 4LJ7A 3TFWA 4L4SA 2OUIA 2VN8A 3BIXA 1A95A 2W11A 3L82B 1T5LA 1ZRSA 2QR5A 2XT6A 4NEHB 4BFYA 4EB6A 1E0KA 4EKEA 4R6XA 4KR2A 1FU7A 2YZKA 3JR7A 4JYAB 2YXBA 2V97A 3KHKA 4DCOA 3I37X 1K5PA 4IXMA 5A7HA 1U7OA 4CM4A 3EY9A 4GEGA 3PD0A 1SRQA 4F84A 1A8SA 1I4OA 1L2TA 1TZ2A 1YONA 4PZDA 5IAKA 4YAUA 1LLFA 3AKYA 5E8JA 1EQ2A 3MGKA 2NVUB 1MENA 3H6HA 5KPDA 3N05A 5T7BA 3OMXA 1K7XB 3CHYA 2B34A 4O5AA 3H6KA 3P5BA 4XTCS 4ZZ2A 4R8MA 3VI4B 3H83A 1W4LA 3JQBA 3X3HA 1YJXA 1JFFB 1R7RA 4G6ZA 2P9JA 4PSUA 1P3DA 2Z04A 3L0IB 5ALEA 3PE4A 4W1SA 1I14A 4BU1A 3ZKAA 1IJBA 1C7JA 1FB5A 1HDIA 1N0UA 1GPKA 3FI9A 4Z4FA 4X54A 2OY0A 2Q1WA 5EYPA 1JEOA 2NUTB 3NHRA 4BKUA 2DWOA 2FKAA 4N40A 4A0SA 4BO7A 4CQLB 5A3JA 3EPJA 2O2GA 3KEMA 1R4MB 4K26A 2WVGA 3JD0A 2I7XA 3BHIA 5AR1A 1VOTA 1BMDA 1Z13A 4ZYLA 6REQA 1HNNA 1OLXA 3EWIA 3A6JA 4UZFA 3EEBA 3RLFA 3PFWO 4JI2B 1GT6A 1K92A 1X38A 3ETGA 4ZCTA 4JN6B 1MPXA 2PZKA 4KX3A 2VHQA 2NO6A 1XCGB 5HM8A 1E6CA 4D6YA 1OQAA 3WLAA 2IZ0A 3QVTA 2DH5A 2W4IA 1EFUA 2ZBRA 3QI7A 1CY1A 3T1QA 1Q20A 3VYTB 4DXAA 2SKCA 3HA3A 1NI5A 1OFIA 1JWAB 1M1YB 4ERXA 4UTRA 2GZ3A 5EHZA 3KHTA 3DLAA 1LQUA 4QHYA 1W35A 2L17A 4DEXA 1GO2A 1ETHA 5IHPA 1QIGA 2C9DA 4N39A 1MQAA 3Q12A 3MWKA 1P81A 2G28A 1XDUA 1B93A 3DH0A 4KQ1A 5G1PA 4AIRA 2QVZX 3GJRA 2P0YA 5AM1A 4CM7A 3UMRA 5TT1A 2A3NA 1VPWA 2B1RA 3E22A 3DHYA 4YJ2B 3UK7A 2Y4OA 1BDBA 2FG7C 4RFVA 4X65B 4GEKA 4O0LA 1QFYA 2BGTA 2ZRAA 4WX2B 1PT5A 4I3FA 5KVQA 2F8SA 1KRWA 3EF3A 4U6SA 4TKVA 3WBBA 4HT3B 5B3JA 3FR7A 4DG8A 3OIDA 2WINI 1JIQA 4GWGA 4JUDX 4EQ6B 4MIOA 4F86A 1QTIA 4QDUA 5I7FA 2F6RA 1USVA 1L7VC 3PUVA 5L4NA 2G4VA 2OT3B 3WLIA 4MVCA 3ETHA 1UBGA 4HWKA 4LXHA 5T64A 1Y9DA 1I6WA 1ZP6A 2V54A 3LXUX 3P9IA 2AOTB 2E55A 3D6AA 1GADO 1XEXB 4TLCA 2DFDA 3M34A 3QVUA 2WICA 4YP9A 1TE2A 1TT7A 4HDRB 4A26A 4D79A 5AUPB 1CNFA 4P32A 5KJCA 2AQIA 2NYRA 4HWTA 4NOMA 4UBLA 4EF5A 1QDEA 3K09C 1RYFA 2IF0A 2JAQA 2JIZD 2VBCA 2FEAA 2P2CA 1HGXA 1P2TA 3MWEB 4XYEA 4OX9Y 3EGVA 2MTBA 5ALGA 4A0QA 1A04A 1Q15A 2A9OA 4QA9A 4AYTA 3EDMA 5K3BA 1OGYA 2GPSA 4KYUA 3CBQA 4OFZA 3P2EA 4PRLA 5E6UA 2WQ7A 4UE3S 3SQWA 3OOEA 5H8WA 2JL1A 4IIDA 3THSA 5AW2A 3KKKA 1QOQB 3N0TA 3Q7SA 3DOEA 4M21A 5EMKA 2IW3A 1PG2A 4WKOA 5LQJA 1I2DA 1LSUA 2PWPA 5DEIA 3TOSA 1Z5PA 2ZR8A 3HDYA 4JB8A 3ITDA 4DJAA 1FNCA 1IBLB 4DZRA 2V9ZA 5F7OA 4YMIA 2O48X 2ZB3A 2FX5A 1RJFA 1UZUA 1X19A 2IHZA 2X9NA 4FLEA 1KEEA 4HLQB 3UPTA 4CMGA 2Q6TA 4BN0A 3SJBA 2X2PA 2PSEA 4H2DA 2BTEA 4K05A 4CT0A 4BCDA 1PT6A 1WF3A 1WEHA 2X5NA 5F33A 4NJMB 3EULA 4OHMA 3R7AA 2C7OA 2HMUA 2R6CA 1JFLA 4C2AA 2RGNC 1F8GA 1NATA 2GPJA 3I5MA 4JLAA 3QUCA 4P7GA 3SNKA 3W4IA 3KTAA 3ZHXA 1G8KA 3GD5A 1YZYA 3MCUA 4B4KA 2MMGA 4RVUA 3THXA 2BEWB 3DEJA 1TQ2A 5G0SA 2OXTA 3ZHQA 2HBRA 1DFHA 1JYEA 2F4VB 3U48A 1KZYC 3QNMA 1FE8A 3AR7A 2BZGA 2QGNA 4KPYA 4TMWA 5TGTA 2C2MA 2ZITA 1WMEA 1ZD1A 4DQDA 2Q8PA 2YWGA 2DM6A 1MJHA 2A4MA 1I6KA 3EGDB 3LZDA 1ZJWA 2OHGA 3G89A 3JARA 3K05A 2IHUA 5JXGA 1IEVA 621PA 4FHGA 3EUAA 4J3NA 1P0FA 3FPHA 4LHXA 4P54A 4E09A 4QGSA 1E77A 3EVEA 1P1JA 4PLTA 4YHHB 4DR1B 4IJ6A 4FTWA 1X0VA 1T9BA 3SXJA 2AV6A 2Z98A 3EIFA 2IH4A 4KBYA 2QV7A 4FW8A 1WBDA 3LFUA 2HSZA 1AB5A 4UHHA 3OEEA 1X42A 3EGCA 2FW8A 1GG8A 2R11A 3UW1A 1IOWA 3VKFA 2D0OB 3TUZC 1FTYA 2ZB2A 1LBEA 4RKQA 4JV5B 3A6HA 3PENA 1FPQA 1DRJA 1A4RA 1NJFA 2I4IA 4GVPA 1S7GA 2EFEB 3N2IA 1E18A 4K88A 1EB8A 4LHVA 2O0KA 1W5BA 3DHWC 2D5CA 2IU0A 4Q4CA 3KKOA 5I51A 4ZCIA 1VL8A 3NWPA 3SI7A 3T5DA 3TE6A 2ZT5A 2XNCA 2QTAA 3MJHA 1Z0ZA 1RFGE 3QBEA 3C3BA 4QTTB 3T9FA 1CS0B 1OCEA 2Q7OE 2PZEA 2EFGA 3W6UA 3ZKWB 5JQGB 3WYCA 3EC1A 3MJFA 4YP6A 2VOJA 3C1TA 3FGOA 2IDJA 4X84A 2H4HA 5JZOA 2VYNA 2O2CA 3R5TA 4JOSA 3S2GA 1N6KA 3P0HA 3EMVA 3Q41A 4GBGA 1OI3A 4I8IA 4RVOA 3VTKA 3EYAA 4PRYA 4TMKA 2ZJAA 1D3AA 2QW0X 4TTVA 5TSDA 4FXOA 2O1XA 2Q5HA 4JEMA 3GJ8A 1I51A 2X9GA 2ZSJA 4NPHA 4P4GA 2Z2XA 4ZYTA 3R9XB 2ZP1A 2YIDA 4KQ2A 4AO7A 2OD7A 1TXGA 4GPEA 2ZWMA 3TLGA 4U3JA 1OFGA 1E1RD 3UHJA 4GM4A 4PCAA 3DP7A 3MOGA 3KZOA 4D56A 2CMDA 3S1LA 5KU1A 1TT5A 2XUOA 4JVLA 3A36A 2MINB 4RV4A 4KG7A 4MPPA 1FP2A 3FHJA 1GNRA 2DKFA 1TUEA 4KV7A 2I6TA 4RK0A 2AN4A 4WK4B 4BMSA 4ZQIA 4RC9A 5FEUA 3TBKA 1U2ZA 2FEWB 4H3KB 4X3OA 1GPAA 1KJYA 2XZTA 3S8YA 4KHPB 4IDEA 1DFGA 1J0DA 4JZKA 1TA9A 3BWEA 2WUFA 4IFIA 4M36A 3BRQA 4R51A 4UEOA 1L5LA 3U7QA 3OESA 4F97A 3RVBA 3GVHA 4H3HB 4II3A 4WKBA 4QLBA 3IUJA 2WWXA 1N2EA 1IZ0A 1V8DA 2D3TA 3ZCUA 4ZJYA 4TTRA 1UPBA 1GTZA 3GFTA 5BRAA 5BVGA 1JSCA 1AJEA 3QXGA 5AVZA 1TCVA 1QLHA 3GIWA 4MQFB 1KMHA 3U7HB 4UNIA 3E7DA 1LPMA 1XFAA 2ZI7A 2IZ6A 1Q1NA 2QUZA 4G1VA 2QTFA 1OBCA 2ZYUX 2IXAA 3QWBA 4U02A 4AZ3B 3WLMA 5E2IA 1GRNA 4OL9A 4NFLA 4Q01A 3ZW7A 2D2XA 4I0WB 5AKJA 4M1QA 1VJCA 2JGFA 2F55A 5HW0A 2D3WA 2PJZA 2BRUC 2X0RA 4OBBA 3GX1A 1F60A 1MW9X 1DOAA 4PSAA 2D62A 3JPYA 3OCUA 1BAPA 5EZ6B 4QJ5A 4QQ8A 5G4LA 3EOZA 3ZX4A 3F78A 4L8LA 3PVSA 1AURA 3JAKA 3P0FA 4EVIA 2C57A 3ETEA 1JEYA 3TX6A 4N03A 4ASUA 5FUQA 1Z37A 4M6WA 1UJ4A 5DE3A 1LK5A 2I9KA 2XCSB 2OCLA 1SWWA 1US8A 4BE4A 4PM4A 2A3RA 4CKCA 1ZKMA 5KIAA 3T3OA 1V5IA 3MAJA 2ZBDA 1MJGA 5CGZA 1VDZA 1HLDA 1A72A 3HHPA 3U7EB 1JMYA 5AI9A 4KXFB 5DTQA 3WLJA 2UKDA 4YV2A 1A9PA 3Q8KA 4N48A 4LNAA 5CIQA 3JQAB 5J4LA 5T6BA 4AJIA 1NZDA 4MTLA 3L07A 3FCXA 1AKUA 1TRKA 2CZQA 4N47A 1U5AA 3DDOA 5JHGB 4D9NA 1A8PA 1W0CA 2JJ1D 1L4MA 4MCAA 5TEWA 2DCMA 4Y2QA 1POXA 2HKIA 3FXAA 3TTWA 2OBYA 4ZI7A 2IXGA 2JJ2D 4IV0A 3VNUA 2OV8A 1JIVA 4P31A 4R2KA 4V2IA 4KO4S 2QAGA 1R4NB 3EFEA 3RJ9A 2EWVA 1I0LA 2G7ZA 2ODQA 3NGXA 2JD0A 3PQ7A 4IS2A 2Y1DA 3EFBA 1J2TA 1OREA 1DKMA 3G2OA 1CDZA 3HJRA 3HPRA 3C3AA 1COWA 4GIBA 4ND2A 3CLSD 4EI2A 2IYWA 4R1UA 4EYQA 2NQ2C 3GA7A 5BN3A 1JQBA 2F9MA 1YTLA 2FK7A 4YAWA 4WZBA 3U3ZA 5BUQA 1QP8A 2XF8A 1JSZA 1PR6A 4HG2A 4QXAA 1NF9A 2GYYA 2I7TA 3N59A 4K5QA 4RESA 5FLKA 5B2FA 3Q6MA 5DV9A 1XTRA 1YDFA 1KMIY 4ZHQB 3FF1A 1NJ5A 5FORA 3LJKA 3TTYA 2RB5A 5IDYA 4CGZA 3V3KA 1KPIA 3RFTA 3ZOZA 3EJ6A 1J0XO 1TQ6A 4X8LA 1YK1A 4ESOA 5JISA 5C0OE 3RJ5A 1IBMB 5IFKA 1LJLA 2ORIA 2C2BA 5F1OA 3HR4A 1RD4A 1SPXA 4IAOA 4QPJC 9ATCA 4MV8A 2ZS8A 1PJ8A 1TCBA 3MM4A 1KZ6A 1TF7A 4LF7B 5E1OA 4PGHA 2HCBA 2NAPA 4QBTA 2PL9A 2D2FA 4LDAA 3A1WA 4M8NE 5AKLA 1EDBA 2VO1A 3DAOA 2C5LA 3UJHA 2NZ2A 3WK9A 2FF7A 3BK2A 4PO1A 4QREA 2P40A 2BZ1A 4GWLA 3VVMA 3HJFA 2ZOSA 3T7IA 1N0WA 3MCAA 4JWTA 4XUCA 3LQRA 3GJ5A 2R7KA 4QYXA 2R1VB 5IULC 5LXTB 3WGIA 4I5DA 3CEMA 5J9FA 2ZRBA 4GL2A 1K06A 2CNLA 2ECFA 3CUKA 3LX4A 9GPBA 4P08A 4MROA 3GVIA 4HAWA 5E9AA 2HT6A 1SM4A 4O02B 1ADGA 4TXLA 3EZ6A 1UDRA 1EZZA 4HYTA 4ZO6A 3QUSA 5B3AA 4EYOA 4URXR 1DO8A 2RHJA 3AFOA 3CTPA 5EPUA 4HSGA 5K8LA 2VTDA 1GU7A 1BCSB 3NDPA 2ODBA 2A92A 1YKSA 2X1MA 4E30A 1XAIA 3I04M 1TM3E 1DCMA 3BB3A 3ID6C 3RREA 1YBAA 2H2FA 4WBNA 1VQ1A 3N07A 4X3CA 1UCFA 3DPUA 2FR1A 3N7TA 3PNBA 3ZEIA 4BX3A 4GECA 4EYSA 1GCAA 5EUQB 1GGHA 1SHKA 4KCGA 4OOFA 1Y34E 4OYLA 1W36B 2PKCA 1DJQA 2XAAA 3TE7A 2I34A 3IQZA 3BMOA 2FMXA 3MJEA 5EMNA 4KWHA 1TTPB 4ML3A 4Y9TA 1T91A 4U9HS 1DVRA 2PFSA 3T94A 1Z3IX 1N78A 3ORYA 4QBGB 1U8YA 3FCUB 2X0FA 1UT6A 4QD3A 3TLCA 3O8CA 3LLCA 4C04A 1XTIA 4QGBA 4AX8A 1C7RA 1UAYA 3C3MA 4H15A 4RCYA 2PDAA 4DT1B 5K0CA 4NCAA 1E3SA 1OFUX 1GAEO 4MKXA 3FDXA 3HXPA 3QYPA 4Z1MD 1P3Y1 4URZR 5EG5A 4CFSA 2O8FB 3G7UA 2B4YA 4U2GA 4RZXA 2VXCA 5DRYA 5BQ3A 4A6DA 2JATA 1HWYA 3VU9A 4A7PA 1ZIDA 2YVUA 5DSTA 4HO1X 1KKUA 5T3UA 1EE9A 5JNUA 4JCCA 4MJXA 2EQ5A 3AFIA 2DHEA 5FPYA 3SOZA 3D5TA 3T7CA 1PD1A 2XYPA 4LMRA 3KFVA 1NOKA 2Q9CA 5IXSA 3OE1A 1FU4A 4AKEA 1C1DB 1Y1TA 4JJIA 3ZE9A 3NASA 2P3OA 4ES6A 5E7IA 2I55A 1SVUA 2PLNA 3GROA 5FLYA 5LQSA 5KOJB 3FMGA 4ARSA 1MVNA 1Z4JA 5JE8A 1EA5A 1JS1X 1R2QA 4OM7A 3DEIA 5M2QA 3VV3A 4ACBA 4MYCA 2W6NA 2ZS7A 3FH0A 1S3FA 4ZP1A 3REQA 2R7MA 3H4MA 1P0MA 1PG5A 3B9QA 1E9FA 3C8UA 1PWEA 2W90A 5D00A 2BSAA 3A6EA 1X7YB 3NHKA 3I5XA 3HEBA 4RSMA 3DKKA 1N2IA 1HDOA 1ZL0A 3G8DA 5IDQA 1O2DA 1H23A 2D0PB 1BW9A 1M6VB 1O4WA 2BFFA 3GFFA 4J0GA 4LI3X 5AW0A 4JUBA 1DC6A 4P0QB 1JKFA 3AHGA 4MS3B 3DPSA 4IHJB 5KNBD 3FOZA 1N34B 3CGWA 3H0EA 3THOA 2HX1A 4Y67A 3IHTA 5IYZF 1QGUA 3H17A 4X5OA 4WTOA 3HY3A 1QH1B 4HXYA 1NR1A 2FZEA 3HUFA 3LK6A 1EFDN 1PGJA 3AG6A 3LT2A 4MRMA 5CNJA 5B55A 2CXOA 1RP7A 4F3KA 3ZZMA 1ZD9A 1OXXK 3EDQA 3NW9A 3H2ZA 3I9NA 2QB5A 4M89A 4XYGA 1Z2CA 1EFAA 3G9TA 3K71B 3P7MA 2H1OA 2WG0A 2XMBA 4RTKA 1GGEA 1E3JA 1PNTA 4R2WA 4B6SA 4EX7A 3FZEA 1GL6A 4CKZA 4MV1A 3O2NA 1U8XX 2HXYA 4LW8A 3DEHA 4KSYA 4QQKA 4TRMA 3G88A 3KOZA 5F64A 5BRJA 1T4MA 1V71A 1X1TA 1KSHA 2BP7A 4LWQA 2WU0A 3COJA 3VZBA 1N6PA 1MB4A 3CJTA 3HEAA 1DJMA 1O7JA 1CJMA 5A03A 4KKVA 1JSXA 2NQTA 4O4LA 4RTNA 3WLNA 2UZ0A 3QSYA 2JLWA 1Q95A 4YT5A 3M3PA 4B5KA 1Z0DA 2XY4A 3EVTA 2XGOA 4YQEA 4X41A 4Q39A 5CA1B 2AWNA 2X3UA 1FX1A 3I1JA 4E7PA 2M6RA 4XOUA 4EP1A 5LKAA 5AKEA 2P79A 1QLJA 3HNOA 2PSDA 3JYLA 1UDCA 2IYRA 1ZY2A 2YRFA 4Z3KA 1XA0A 3BILA 1T0UA 3HN2A 4KW7A 4RGBA 2WSSA 4OJYA 3NAMA 3AR4A 4Y1RB 1YNSA 1AZTA 1XN4A 3B8EA 3E15A 3FE2A 5EKUA 4LDJA 4EHHA 2OZVA 5GONB 1ULBA 3QMVA 3IODA 4MDFA 3UXMA 1PS0A 2REQB 4ID9A 5TJ9A 4C7OA 3B53X 4L6CA 3ZH9B 3HNRA 1PJ3A 2UVDA 4HLCA 4C0QC 2PZGA 2XNDA 3HKCA 1GGJA 2G5PA 3HRHA 2RBEA 4GZMA 3AOEA 1GHTA 3JZFA 5JIBA 2AYXA 10MHA 4TZ0A 4G5RA 3T9CA 1EG7A 1T25A 4CKBA 4JELA 4DJTA 3HVHA 1KOJA 3WBFA 3PFFA 2Q4BA 1NUQA 1TCAA 1KYZA 2YVLA 1NBMD 2JLBA