2A1TS

Structure of the human mcad:etf e165betaa complex
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
248
structure length
239
Chain Sequence
ELRVLVAVKRVIDYAVKIRVKPDRTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEVIAVSCGPAQCQETIRTALAMGADRGIHVEVPPAEAERLGPLQVARVLAKLAEKEKVDLVLLGKQAIDDDCNQTGQMTAGFLDWPQGTFASQVTLEGDKLKVERAIDGGLETLRLKLPAVVTADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPPTTEDLVAKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Stabilization of Non-productive Conformations Underpins Rapid Electron Transfer to Electron-transferring Flavoprotein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/electron transport
molecule keywords Acyl-CoA dehydrogenase, medium-chain specific, mitochondrial
total genus 59
structure length 239
sequence length 248
ec nomenclature
pdb deposition date 2005-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01012 ETF Electron transfer flavoprotein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2a1tS01
1WXGA 3PNYA 3ZIUA 1JILA 2RE8A 1FFYA 3A05A 1OD6A 4MLPA 1Q77A 3IMGA 1EFVB 3HGMA 3CLRD 3IMEA 1ZJWA 4JZYA 1TQ8A 4MUGA 1WY5A 3ZJUA 1J21A 2EJCA 2J07A 4QBTA 2D54A 3N2YA 1N75A 1O94C 4EG1A 2WSIA 4YP6A 1HYBA 3ND5A 3HMQA 1OBCA 1NUUA 1R6TA 4WNYA 1EXDA 1O0BA 2G36A 3A04A 4P2BA 3Q10A 1O97C 4WSOA 1GZUA 2PIDA 3TQIA 2QTRA 2NZ2A 1YIAA 1MAUA 2ZP1A 3SDBA 2YY5A 1I6KA 4MWCA 4QRDA 4HJXA 1KKUA 4K03A 3GUZA 1PFWA 3KT3A 1O5TA 1O95D 2Z09A 3RK1A 3ELBA 1WQ3A 3IOBA 2VTBA 3G59A 1MBZA 5K0TA 1EFPB 2CYBA 2D13A 3AL0C 3ISJA 1N2BA 5TEWA 1JECA 1I6LA 3INNA 4EG3A 5KWVA 1JIKA 3X1KA 3AKZA 3X1MA 1IFXA 3QTBA 2QUKA 5HUJA 2I1LA 1GN8A 1CT9A 1GAXA 3JXEA 4MVWA 2HZ7A 1KQPA 3ZGZA 4MUJA 4MUIA 3IH5A 4KR7A 1O96A 1JEDA 3A4IA 1K97A 2Z3VA 4F3RA 1F9AA 1Q11A 4EG4A 1M8JA 1KORA 4MW5A 4G6ZA 1WJGA 3CLTD 4NDAA 3L92A 3GLVA 3UY4A 3FHJA 1O0CA 1IQUA 2E18A 1KQNA 4DLPA 1OWNA 2DETA 1T6XA 2OV4A 2PZ8A 2X1LA 3COZA 4KR9A 4DNXA 1GPMA 4ZT5A 1N78A 4DDKA 3CVXA 4PBRA 3MLBA 3N8HA 1JMVA 4J76A 1M8GA 4MQ6A 1JIIA 4MW4A 5HUHA 4EF6A 2RD2A 3DLAA 2AZXA 1NURA 3FG9A 4CDNA 1MJHA 1Q19A 1H3EA 2BTEA 3AIIA 5TS2A 1TFUA 4MUKA 3ILVA 3N9IA 2C5SA 5FO0A 3RFFA 1J70A 2E89A 5KCMA 1WXEA 1TYDE 3KT6A 3COWA 5J5AA 1NSYA 1R6XA 2OQ2A 2YXNA 4MULA 1EJ2A 2JANA 1J20A 1O95C 1G8HA 4KPUA 1U0BB 2GM3A 2O8VA 1NUQA 3MMXA 3MUEA 4A91A 3ZUGA 1GTRA 4FZJA 1VBKA 1Y42X 3LOQA 5FO1A 2ZUEA 2QUJA 3IMCA 4HJRA 3FETA 2PZBA 4ZT7A 4MUHA 3HFJA 5KHAA 4PBTA 3IDFA 4R2LA 1MOPA 4ZT3A 3CLUD 1KH2A 2YWCA 4GRIA 1EE1A 5H7XA 1PG0A 2Z08A 3H99A 5EKDA 1EFPA 1GTSA 5JBNA 2DPLA 3CA8A 3FDXA 2PG3A 3IUBA 4MW0A 4MVCA 4JXXA 1M8PA 4ARIA 4J75A 3ND7A 1J1UA 2CV0A 1MAWA 2H2AA 1ZH6A 1T6YA 3P0JA 3ZJVA 1NZJA 1QNFA 1DNPA 4R2MA 5J59A 3L93A 3TNJA 3G5AA 1TEZA 1MB2A 4KKVA 4MWBA 4U8HA 1LI7A 3IOCA 1IH8A 1MRZA 3PNVA 1KH3A 1NI5A 2WB2A 4ARCA 4MW2A 1YI8A 3U1VA 2BYTA 3VRHA 4CT0A 2J08A 4U7JA 4ZCPA 4EG5A 2VTBB 1M83A 1JHDA 2J5BA 4XFDA 3RJZA 3KT0A 2A86A 1LW7A 4UZFA 1QRSA 3QE4A 2R5WA 3K9WA 1ILEA 3PNBA 1NYLA 1G8GA 1ULHA 4DDHA 1KAMA 3D6VA 4K0RA 1IQ0A 2E21A 1BS2A 1WQ4A 2DLCX 4R0NA 2QTMA 3N05A 1A8HA 1WXHA 5FNZA 1LI5A 3COVA 3A2KA 3ZJTA 3S3TA 1TYBE 4F4HA 3VU8A 3H9CA 3CLSD 1N2JA 4G5YA 4EG6A 4RUKA 1ZH0A 4MAFA 1YUNA 3MLAA 4L2IB 4HK4A 4KPUB 1I6MA 1OWLA 1WKBA 2A88A 3D6UA 3CLUC 2A7XA 4OJMX 4JYZA 3FI0A 5J58A 2DR2A 3P52A 3IOEA 2A84A 1OWMA 2X1MA 5LM3A 3H9BA 1B6TA 3IVXA 2X0KA 2CYAA 2QUIA 3FIUA 1PFUA 3RK0A 2GKSA 3CLSC 4YBRA 4PY2A 1K4MA 2PZAA 2XRYA 4U63A 3UC5A 1EUYA 4E1AA 3FNRA 1COZA 3I05A 4YP7A 2QJTA 1YULA 4DJAA 4RPIA 4YMIA 5DASA 1MC1A 4MW7A 1D2RA 3K32A 1PG2A 3G6KA 2VXOA 4X0EA 2EL7A 1I2DA 1U3DA 1U7DA 3CLTC 3HV0A 1QJCA 5TEVA 2A4MA 3TQOA 2H29A 4OUDA 4OUDB 1T9GS 2V0GA 3NV7A 3AG6A 2WQ7A 4MVYA 1YIDA 2J09A 3M5WA 3NBKA 1T9GR 3OP1A 3TZEA 3HZRA 2E0IA 2IJGX 3HL4A 1J09A 2QJOA 3KFLA 4MUEA 1NP7A 5TGTA 3KT8A 4MVXA 2DUMA 3FWKA 4XSVA 4YP5A 2ZUFA 2CT8A 1VBMA 3TS1A 1WXFA 1QU2A 4CQNA 5IHXA 3E27A 4G5FA 1KAQA 3ND6A 3X1JA 3DO8A 3BL5A 2IP1A 4Q16A 2A1UB 4I6EA 3UK2A 4BWVA 3CVUA 1K92A 5DEOA 4L2IA 3CLRC 4EG8A 3SZ3A 1OWOA 3ZXSA 3P0IA 3CVYA 1F7VA 3SZGA 2DXIA 5DB4A 1UFVA 2PXHA 2QJFA 2B7LA 4EGAA 1KP2A 1U3CA 4XFJA 1G8FA 4H3SA 1N77A 1XJQA 2DEUA 1F7UA 2QUHA 1IVSA 1O94D 3SEQA 3Q12A 1GLNA 4GU5A 1X8XA 2AKEA 1ZUNA 4ZT6A 4DE5A 5BNZA 2O5RA 4ND6A 1QTQA 4QREA 1NUTA 4JXZA 2CV1A 1RQGA 2D5BA 3UOWA 1F4LA 3IVGA 3DV2A 1PFYA 2CFOA 3IVCA 1V8FA 4MWDA 4MUNA 4NZPA 4ZT4A 3RBAA 1J1ZA 2J4DA 3NBAA 4CDMA 4UZEA 1KQOA 4ZCRA 1JEEA 2V0CA 1P7PA 5K0SA 1WOYA 4MWEA 1H3FA 4I6JA 1JIJA 1O6BA 1VLHA 2WQ6A 3VGJA 2A1UA 1V47A 3IODA 1NUPA 1JGTA 2CV2A 1N2OA 4PBSA 2CSXA 3LCJA 2HGZA 1OBHA 1EUQA 3TZLA 1WZ2A 1VBNA 3PRHA 3CVWA 1S4MA 4MW9A 4EG7A 3Q4GA 4ZCTA 1QQTA 3PXUA 5H16A 3COYA 1M8KA 1XNJA 4ND7A 1Q15A 3P0HA 2JAXA 1QRUA 2CUZA 1IQRA 1EFVA 1JZQA 3FH0A 4ZT2A 1K4KA 4AS1A 3SP1A 2DERA 3MXTA 5LFAA 3SEZA 2GOYA 2TS1A 3F3MA 1N2EA 1IRXA 1XNHA 4Q93A 1SURA 2NSYA 1X6VA 1JZSA 1YUMA 3DPIA 4NX2A 4TS1A 2A1TS 1TYCA 5F23A 5LLTA 1U7XA 1T6ZA 4JFAA 3FY4A 1G59A 3CR8A 1QU3A 3QTTA 4KR6A 4NATA 4NAUA 3AFHA 1OWPA 2HMAA 5AHWA 4AQ7A 1KP3A 1PFVA 3SYTA 1N3LA 1KR2A 1FYDA 5HG0A 3CVVA 1TYAE 2QTNA 2JA2A 2IELA 4MW6A 1R6UA 4MW1A 1N2GA 2YWBA 4ZCSA 1H1TA 2CYCA 1M1ZA 4S1OA 2AG6A 3IUEA 1VL2A 4MUFA 1O97D 3FOCA 2X3FA 3ZXIA 1WXIA 4NAHA 3LE8A 1KH1A 5DK4A 3OTWA 1NUSA 3H97A 1O96B 1N2IA 4ZCQA 4DDMA 1M8FA 1H3NA 1MB9A 1XNGA 4HPWA 3H05A 2A1TR 4EFKA 4I6GA 5IJXA 3GMIA 3C8ZA 3RHSA 1QRTA 3AG5A 3UMVA 1N1DA 2XRZA 1N2HA 1IHOA 2PFSA
chains in the Genus database with same CATH superfamily
3IUPA 4TZTA 4LDJA 1Z2EA 1I51A 1MTZA 4PR0A 4UHEA 1X86B 4FIDA 3KB2A 4YONB 1OBFO 2REOA 4CKEA 3DTYA 1E2HA 4CEIB 2BL4A 2AMYA 3IMGA 4LVUA 4D4MA 1PWEA 3LDAA 1OU0A 5FBVB 1D8AA 4EY5A 5C4MA 1FJHA 4JZYA 1ZINA 3BS4A 4RA6B 2OCIA 1CUJA 2Q99A 4KX5A 1WP9A 2A5LA 2ROQA 2ZIVB 3GRCA 4EM6A 2DBZA 2KB0A 4CLOB 4YX9A 4YPOA 3CX3A 2JI7A 2B8TA 3T3NA 2A9OA 3VSEA 5HOEA 1WW3A 2OOKA 4HFJA 2YJZA 2K2QB 3AXSA 3B1VA 4K3UA 4KL8S 5H80A 3U3RA 1T5SA 3K30A 3R9KA 2NACA 4ZHQF 3TEJA 3NNSA 3KPWA 4JBIA 1Q2XA 2X1HA 3M7IA 4J0HA 2G80A 1ZN2A 1PT6A 5IAAA 5JBIA 4A82A 3WHLA 1W35A 3K09A 1TM7E 4RE6A 4TRRA 3SQMA 3SDBA 2C00A 1L9XA 3VNSA 5AUNB 1J9EA 1C4XA 2HBYA 4B87A 3KSZO 2JFNA 3SJ7A 2H51A 2X8LA 2AMFA 2YW2A 4YPVA 1GZ5A 3WVNA 2NT4A 1KAGA 1TKCA 1GRNA 2B37A 2BCGY 2I34A 4H1WA 1F8GA 2PS1A 3E61A 2C2HA 2R00C 4RHCA 3V1YA 1ABEA 5EERA 5EE1A 3PD1A 2WJWA 2W8BA 5LPNA 3OO1A 2V96A 1TU0A 3TGWA 2VAMA 3FBGA 1NN0A 2K2WA 1CEYA 5AKEA 1IZ7A 2IEAA 1P7YA 1XYYA 2OCAA 2IV2X 3ETNA 3H9UA 2FQXA 3ULKA 3AL0C 2X9LA 1YRBA 4S1VA 3WMXA 3WLRA 4C0JA 4YJ3B 2PS9A 2MJLA 4PF1A 3T5GA 1BFDA 4G4SP 5CB6A 4ZI7B 2CVZA 5KWVA 3ESRA 4K6MA 1ICEA 2G0NA 3ZE1B 3TPZA 4F4IA 2O7SA 1H4SA 4NJMB 4CODB 2W6CX 1C4OA 4U3JB 3QNUA 1P5HA 4V39A 1P3JA 1KEPA 4LY9A 1JAHA 2GF2A 4A10A 3VR5A 3MMPA 3UMSA 4CG3A 1HPLA 3EGXB 5TXGA 1SOUA 3C5CA 1QIMA 4E2XA 4AJKA 1C1DA 4Q1CA 3A4IA 1RP1A 1U2GA 1E4VA 3ZW7A 1Z83A 2BBWA 3RRNA 1M8JA 5K6AC 3LOPA 3QUQA 4O25A 5D3MB 4YMGA 1RAIA 1E7WA 4QFDA 5AW7A 1GCIA 1Y6GA 3DL0A 3U9LA 1P6XA 4O4JB 1N7JA 2G4CA 1SXJD 4WY5A 3TBHA 3LRXA 1CS0A 1IZZA 1JL3A 2AFIB 3AILA 3L8MA 3PYMA 4IOMA 3EOBI 3HA2A 4XX1A 1X7WA 5JH7F 5JAOA 2OG2A 3Q6NA 4RD0A 5EOVA 2R1TB 4EF4A 3VPBA 1UXIA 1Y3DE 2BM1A 2P8SA 3QM1A 3LZDA 2J3LA 2X77A 5F4BA 5CEJA 2OZVA 2ZWPA 5EWJA 3TVTA 3CVXA 5E2BA 4HNTA 4BP3A 3OD1A 3UQZA 2PKYX 4Q9NA 2P0AA 3WS7A 3HTXA 3TX2A 1SCIA 1CJVC 1ODTC 2BWJA 2O52A 3DLAA 4MV3A 3DHWC 3PJFA 5DISB 1NBMA 4K6KA 1DEKA 4ZVMA 4RV4A 5I9LA 3WLSA 1L4HA 1NX9A 5I7OA 5JEDA 4P38A 4IZIA 2BF4A 3PXAA 2VTVA 2WOOA 1TEHA 1JDJA 3FZQA 2B9VA 3D54D 3ZV7A 4EEKA 2YNMC 3W2HA 4UQPA 3T4XA 1WPGA 3UPTA 3RW9A 1MTOA 4YCLA 3R0XA 1FS4A 5ECGC 1KARA 5DULA 5ITZB 1HTTA 5EMMA 1G4AE 1H93A 1AQNA 3H1AA 1X7WB 1SB8A 3GRPA 1Q1QA 3TUZC 1NWCA 2WHXA 3KUXA 4MPTA 3CY6A 5CTJA 5KS2A 5C1OA 3CN9A 3MT7A 4TXLA 1XSEA 2XTZA 2ZSIA 3PZRA 5TF4A 5HJ7A 3AVVA 3AKDA 3G2HA 4IAOA 2FDCA 3CZ5A 1U1CA 5DEIA 3T99A 2O54A 3PFNA 4Q4AB 1WZIA 3EFHA 4XA8A 2NU7A 2Q21A 2R8YA 2C2OA 1ZD9A 5TVKA 1H1DA 2MSCB 3IT3A 3L49A 4R3UC 1MOPA 1PZNA 2QRNA 2ZUBA 2I33A 1T3TA 3CEHA 4JKIA 4AD8A 2R87A 5FWXA 2G9VA 2WYVA 4A7PA 1EJ6A 2WVHA 4C04A 4EIWA 2J3QA 4Z86A 1BGWA 1FFSA 2Z08A 2YX1A 1NVVR 4JC0A 4JLMA 4R1NA 3RBZA 2EX1A 2XUFA 2ZPAA 4KSYA 1HQDA 5AW2A 2P1DA 4MEBA 3KELA 1CQIB 1L3CA 3QE3A 3ZCXA 1H66A 4ED9A 3M1YA 2P4SA 3ONEA 4PSDA 3K31A 4HL6A 3ZGYA 1ZJ4A 4BTEA 4ECEA 5J47A 1H2XA 5EP1A 5LP1A 1G5RA 2QYOA 2Q3CA 5ED0A 3IO5A 1MB2A 1RQNA 2JIDA 2SKCA 3U0BA 4ECAA 1P9RA 2BEWA 2ZJ1A 3B51X 4NJEB 1W36D 3O2SB 2R751 1GU7A 3INTA 4L3WA 4WLNA 1BRTA 4W5HA 1U2DA 4JU8A 3Q3CA 4PG8A 1J2EA 3ZQUA 2ZIXB 3WB2A 4P9NA 3HP7A 1UT8A 5DGTA 3SVLA 4FFRA 4B5LA 2A8YA 2GH1A 1LTQA 1GXSA 4FQ8A 2PZFA 3ZDBA 4HGPA 1KZ9A 1XCOA 1DTEA 2F3RA 3TIFA 5IM4F 1YASA 3AF6A 4ZP1A 5HF6A 5J40A 1DJPA 2QMZA 3DP7A 2QSUA 5T8KA 3AR5A 3DKRA 8OHMA 1Q14A 5LUAA 1OTHA 1RE1A 2XTNA 3H2BA 2HSJA 4S2UA 5F5XA 5A1TA 1D4OA 1PGJA 4IEEA 4KTVE 5FLYA 1N0VC 4H7HA 4B73A 4FYHA 4EP1A 4HH1A 5AO9A 5EE3A 4F5YA 3DBLB 2CJFA 1QYVA 3CJTA 3UW3A 1XMOB 2FOIA 2AFRA 3SQNA 5L53A 3KCNA 3H2GA 3OJ0A 2WOJA 3THRA 2JAUA 4GGMX 3BGVA 4IQ0A 1Z17A 3V48A 4BVHA 1ZH0A 3FCYA 1T13A 3IEPA 4INJA 1RM0A 4YLEA 2HWWA 3HWRA 1KR5A 1VI6A 3KCQA 3INRA 3U3MA 4WASA 4HK4A 2FP4A 3PNLA 521PA 4ZV4A 4TM7A 1Q2UA 5DLQC 3S70A 4O6VA 1CZHA 3ZQJA 2DFNA 5J1SB 3G8AA 2VHQA 1L8OA 5CBPA 4TYNA 1BGXT 2BLLA 2C8KA 2JHPA 1RJ9A 1DBPA 3JQQA 2YW9A 4D9BA 5J58A 5LU8A 4ZU6X 4Q01A 1JN0A 4FFNA 3SD7A 2W2PA 4F4FA 4QT4A 4J0KA 2XVYA 1RAEA 3PL1A 1SD1A 3B3JA 3CX8A 4QU0A 1QTNA 1XD9A 3V7YA 3MB5A 3HXPA 4IGAA 3JPWA 3N8DA 3R6LA 2GYYA 2GCOB 4PHTA 1FUUA 4GBGA 4O0LA 4ND4A 3ZI4A 1FYXA 1WDTA 4TPKA 4H6VA 3O8RA 1DLJA 3DAOA 3UC5A 4INOA 3OP4A 4RH3A 1BXRB 1PZFA 4WEOA 2DQZA 1MC1A 5FPSA 5B7GA 1D2RA 2JKYA 3K32A 1IZYA 4AYTA 1U65A 5KNBH 4CQJA 4BS9A 4DM3A 1GGNA 1FVFA 1I2DA 3GEDA 3BAZA 3P96A 5HK8A 4EYOA 3WGKA 2VUSA 4MI3A 1Z88A 1QYDA 3CZAA 3EVZA 3C1AA 4QDZA 4XH9B 2GUWA 5EYPB 4WFJA 4CN9A 1B23P 4MVYA 1KZYC 5GOZA 2QORA 4MQBA 2Z9DA 2QS9A 5JJ5A 1EINA 2RCNA 2YH2A 1VP9A 1GTL1 3W3AA 4M0KA 4DNOA 5ALMA 1J99A 1U3GA 3QEMB 4IGFA 4R1TA 3RREA 1LDGA 1DQNA 1U9IC 4FEGA 4C43A 1AMUA 3W5JA 2XUOA 2A7QA 4MVXA 2YYZA 3HV2A 3CKLA 4LXHA 2NUPA 1Y82A 4JKOA 4FGJA 3H2HA 1A4IA 4NL4H 2V6IA 4IIJF 3GV0A 1EP2B 1IK4A 5E6UA 3WNCA 3T3EA 2BJVA 3A58B 2QGZA 4GI7A 4OD0A 1KAQA 1NLMA 1GADO 2PHZA 3R6TA 1H2WA 4WDQA 5FUXA 1P45A 3X1JA 4AG3A 4OLAA 3UXEA 5BQ3A 4J8PA 1UBGA 1ABFA 2FXVA 2CVHA 3C4JA 3OJFA 2OUKA 1MT0A 4FE7A 5JWHA 4EHHA 2M9MA 1QGED 1S1MA 2O3QA 4YALA 4PLYA 1OMOA 3E1GA 3AYZB 1HRDA 2JH3A 2ZUVA 2D74A 3T54A 3LUDA 3T5TA 3OICA 3R5XA 3H4VA 1XB2A 1U0OC 1EHCA 2FQQA 4GLFA 3VDQA 1EQ2A 1JKJA 3EDOA 4E4YA 5KTPA 5K20A 5AMXA 4NCJA 1SB9A 2CMGA 1Y0BA 3O3NB 4ALNA 2QGNA 4L4YA 3AU8A 1NZDA 1Q1ZA 4NCKA 1SOAA 3HKCA 1FCJA 4FDAA 4R41A 2XMPA 1RIIA 5DOVA 1JWLA 3Q12A 1XVTA 1ZK2A 2I2XB 5AK4A 1HE2A 4MV4A 5IZCA 2ADMA 3IQZA 5JXHA 3PQ8A 1UMBA 2AQHA 2HHJA 3VU9B 1UJ6A 2RJ3A 4EKYA 3LDUA 5ELMA 5CLJA 2DY0A 2GM5A 2ZAGA 4EFNA 3CF4A 3LX5A 3WSWA 4YB8A 1A71A 3U56A 2PUFA 3DFKA 3DO5A 1UWLA 3W9BA 2VDWA 4BNJA 1AO0A 3I9LA 4GE3A 1E3IA 3ROMA 3RRJA 3REQB 3UJ9A 4G0MA 3VH4A 5FJIA 1BDHA 1QP4A 1PUXA 4NV1A 3VR6A 2JGNA 3V8PA 4CMBA 4N65A 5A62A 1KOJA 1QHHB 2J46A 1SPXA 4BZXA 5HQTA 1X1AA 4EK9A 4FCWA 3RYFB 4OKSA 4HQLA 3QX3A 3KJQA 2CUTA 2O2CA 3MB8A 4LJ5A 1QV7A 1OHHD 1W5TA 3GAMA 5DBHX 3ZWNA 4B3DA 2GESA 2WC1A 2OQVA 4WLVA 3OX1A 4O5OA 4PCAA 4DCVA 1QO7A 1ENOA 5I48A 4LSWA 2HFKA 2XT0A 1GUFA 3LP5A 2R65A 1EX7A 2EDCA 1A7AA 1E0JA 1USKA 4CIVA 4DQVA 4FOSA 1UXKA 1JQAA 3CVWA 3FTNA 3U4DA 1XKQA 5CU7A 2Y6UA 4Y0NA 4M1WA 4H1TA 1XRMA 3IUMA 1Y3IA 5BQOA 2A4KA 4KOAA 4J0IA 5HBGA 2I80A 5ALKA 3ROEA 3P19A 1E2DA 2ZVQX 3S99A 3PUKA 5FBRB 3TE7A 3OFNA 1W48A 3SEAA 2F64A 3FH0A 4G5XA 1BWPA 2XXBA 1XVLA 3MXTA 2BR4A 4RSMA 2ACKA 4OQEA 5IF9A 4QUIA 4XPIA 1K6JA 2QN2A 3UV6A 3T3OA 3KR1A 3LHDA 3T3GA 2CXQA 4EUSA 4I55B 2BGWA 2IDKA 2ZIUB 4X97A 3ESCA 1TYCA 3NTOA 4PFSA 2I6XA 1VL0A 2XGOA 2ZB2A 1T0BA 3ZU5A 2BI8A 3FGPA 2IUEA 4M7RA 2P75A 4G01B 4HBZA 2AJBA 1EWRA 3W4KA 1TUGA 3ZLJA 1CUVA 3L7AA 1AMOA 4KR6A 4HH3C 2I3GA 1YB7A 2IEGA 2VJYA 2XDQB 3K4QA 4X7PA 1DG1G 1KP3A 3H1TA 2ZWOA 1KO1A 3B7PA 3QWBA 4UUQA 5HG0A 1NOJA 2NNLD 2O4UX 3MILA 2IY9A 4RVNA 1T1GA 2BBSA 1C3XA 2MSKA 3RKRA 2Q62A 4CBVA 3QFFA 4A2WA 5B6IA 2HI0A 1H1TA 9ABPA 4PANA 2BGIA 1ZU5A 3I28A 5HIJA 2V98A 3RYIA 3MELA 1XMXA 1TF7A 1Y1QA 3ILHA 2JJ2D 4E70A 1O97D 5EUCA 5IAOA 1WL8A 1DB3A 3MOSA 2Q1UA 2I7VA 3DEZA 3GUUA 3LFTA 1F2TB 3OLXA 3PQ7A 4G0NA 5CA0B 4AJ1A 5BP7A 1E5DA 2X8JB 5I5GA 4PYRA 3WOVA 1A27A 1NUSA 4ILKA 1V41E 1K1EA 3ZDZB 4EVSA 3Q8XB 4LHXA 4Q4JA 2RHGB 3ZDFA 1QG0A 2CVOA 5G1NA 1ZVJA 1PL7A 1SOVA 2A1TR 5AHXA 5A3JA 1AXGA 1QHEA 2NO1A 3HN6A 3PITA 5ENVA 5F9FA 4BVBA 2CE7A 1SC6A 1DIHA 2JJ8A 2ZJ8A 1OH7A 5H82A 3SKVA 4RLFA 1CKEA 4TROA 3EEBA 1G8SA 3U7RA 5DNDA 2P90A 3PKJA 2VDRB 1A4RA 1F14A 3CMMA 2OY0A 1IHOA 3CNQS 4PWYA 3H3XA 4QTZA 4TV8F 4UM9D 1SPBS 4TXJA 1NSFA 4JP5A 2Y77A 2FG7C 5A06A 3DLPX 1M75A 4AY5A 4CKWB 4DREA 1D2HA 2VF4X 4FJ0A 3TBKA 3TZCA 3CRRA 3JY6A 3CEPB 4NHEA 2AOVA 2R86A 2XDQA 1QFZA 1TKAA 2W2XA 1NBME 1SBIA 3HBLA 5DTIA 3VUFA 1A04A 2HMSA 2AQ8A 4AIIA 3F6BX 5K8UA 4BLSA 1RVV1 5K4GA 3Q9UA 1RXSA 4EGQA 1FQWA 1Z07A 1A96A 3IULA 5A7HA 5K9ZA 3R0VA 4TLEA 2ENWA 4MYTA 3OEEA 4LV6A 3VYRB 3GFRA 3W7BA 2UZIR 5CB4B 2WBLC 4X63A 3EUFA 1NC1A 1MHTA 1HYBA 1AF4A 1HKHA 1CRLA 1YAJA 1ZM3A 2IEBA 3F8WA 4XPIB 2JL1A 1LW6E 5E1BA 4DBLC 1TPYA 4YRBA 3KKNA 1ESZA 2WWWA 2GAJA 4FYKA 3I1FA 1DUSA 4LRQA 1ODFA 1L5QA 1UBJS 3AOEC 4JUCA 3KS9A 3X2EA 2DWUA 4L8LA 1Y8QA 4RD2A 3EN0A 2PKQO 2HT6A 2R2AA 2Q45A 3JU3A 5KYYA 5CDUA 4ID3A 3W1EA 4CTKA 2UYHA 1Z7YA 3O0DA 3EHDA 4G0YA 3D81A 5BR1A 4MVJF 1UXOA 4LZNA 4PGGA 2J0QA 2ONJA 2XUGA 4L8YA 1D6JA 2NGRA 4OQLA 2H85A 1R9GA 2VQ3A 2H7CA 3G2JA 4G5OA 4Z4FA 5HFAA 4U5QA 1E9AA 4QIHA 2FMIA 4ZRMA 2FMHA 4DA7A 3B48A 2JGDA 5CA1A 3ELBA 1A82A 4ESEA 2PUEA 1EAMA 4K6GA 1M6YA 3R44A 3BL6A 1DKOA 3GDOA 5DCYA 2ADOA 4R83A 3RUPA 4BNFA 1D6NA 1AKRA 3EG5A 4EA7A 5LJIA 4LQLA 1JMYA 1IOZA 5KVCA 4ENTA 1UXGA 2XCTB 2BI7A 1JDZA 5JNRA 1HDGO 5KOIA 5JC8A 1EPUA 1ZGGA 1NZFA 1L5MA 1J7JA 3OPYB 4J07A 1XLVA 4PYOA 5AXAA 1IFXA 2ZQYA 1BD3A 4PCVA 3MHPA 4PZEA 1KQ3A 2IIQA 1IZ9A 2HCJB 3PX7A 4IOKA 5H3LA 3TX6A 1VZ3A 3DVRX 3DJFA 4QQKA 1M2WA 2E5LB 2WABA 4RIHA 1A0OA 4E0BA 4Z51A 5JC1A 3EAFA 4J7AA 2H2FA 5DBFA 2BSXA 3MUFA 1EP1B 3REGA 5A5VA 2NZXA 2BSAA 2YMMA 2M32A 3NWEA 3GJ4A 4LJ6A 1QKJA 1SFRA 4MI1A 3FRJA 1KPIA 2QW8A 3L92A 5AUQA 4MOWA 3UW1A 4H7DA 1HYEA 1VHJA 4MDEA 3KBBA 5K0LA 1M2NA 3WI7A 2JARA 1UDBA 1XEXA 3A2NA 3JVEA 1VE3A 3LYHA 4RD3A 2X0IA 2P35A 3WZ2A 5EHZA 4IH9A 1OH6A 1UF9A 1RJGA 5C8VA 1BQ4A 3OMXA 1KBQA 4JLKA 1APBA 1QP8A 2F43A 3TZQA 1W85B 2C1ZA 1N78A 3CKMA 3GGOA 4Y6SA 2E4WA 3BZWA 1W76A 4I4LA 1IG3A 1PP4A 4GOKA 4NSNA 5ALWA 2PX5A 1H1LB 2Z6UA 4CTOA 4AUNA 4ITVA 4TWAA 2FPKA 5JZ9A 3I1JA 4X00A 2XJ9A 4NFLA 3UPDA 1RLUA 3ZZUA 4NQZA 1D7AA 4RWEA 2F9MA 1OASA 1NBAA 3TNYA 3BGDA 4E5MA 2MMGA 4RELA 5REQA 4HDKA 4DNQA 1FDOA 1M2KA 2GHIA 3F49S 4YR9A 5CT8A 4BVEA 1TM5E 4RK4A 1LJLA 2C9DA 3GQBA 4LDQA 2YKGA 2X5NA 2MINB 3OZBA 4PSAA 2GWHA 2EQAA 3PWKA 4XYGA 1OLSB 1WZEA 4YVFA 3W3AH 3INYA 4J1QA 3E48A 2AHOA 4DLSA 3LXMA 1XZLA 1JSRA 2Q2WA 1IUPA 2VYNA 2HUPA 4PW0A 4R6WA 1SCKA 1KYTA 2OSVA 3DOJA 2FTKE 3K6JA 5FV7A 1T9DA 3FETA 1AIPA 1YE5A 4X6UA 1JR2A 4J1TC 5B36A 2YRWA 4LJ4A 1QV9A 2LBPA 1ZN8A 3U1TA 2C54A 5FBWB 3MXOA 4ZT3A 1KIAA 2VO1A 4AURA 4UTOA 1SU6A 2TSYB 5BPFA 5DT2A 2BM9A 2UXBB 1FUEA 5JH7A 4KNYA 1KJJA 1E6LA 2A35A 5JNLA 4IIXA 5KNCA 5CMLA 1EWTA 1D4FA 3DXZA 3U81A 3ZWCA 4UM9B 1SXGA 3K92A 3EAQA 3EGXA 3NBMA 3GEGA 3OQJA 4GWLA 4P7FA 1JSLA 4E15A 5KCZA 5LCXA 1QVWA 3LO5A 5FV4A 5KNCH 4MUMA 4ZYWA 4L6AA 2P67A 1E5TA 1YB1A 3OJOA 3FVWA 4I2VA 5LR6A 1U7HA 3OU2A 1NTRA 4OFXA 2Z2KA 3F9RA 4L0DA 1T26A 3GW8A 5BNFA 1XUOA 1IH8A 2HQSA 2XCSB 4MRMA 5GZ3A 2G1PA 1KH3A 1X9GA 1QKKA 1R9NA 4O2LA 1KDVA 3SLRA 2GPJA 4F4UA 1N9GB 3L8YA 3LY5A 4XLZA 1E4EA 1YI8A 1VI2A 2ZANA 3E7FA 3QPCA 1Y9JA 5K3CA 2J08A 4U7JA 4ZK6A 4RZQA 1TZBA 4A3SA 4HX9A 1RXIA 1QMGA 4DZZA 3W8NA 3NBYC 3H9JA 2P9GA 4F4JA 2OD7A 1Y5NA 3T0GA 2NO7A 3VR3A 3IL2A 4MPRA 1PN3A 5ECYA 3D3WB 5AM3A 4K0RA 1JPVA 4TUYA 2W9XA 4KVZA 3ZI7A 3RG8A 3G1WA 5HJEA 1N9ZA 3NHFA 1K0FA 1RXUA 1ICIA 5KU7A 2DCUA 2P9FA 2QR3A 2WICA 4KH1A 1ECGA 3HB5X 1N5OX 3ZJTA 4OXNA 3SVTA 1SU7A 3H9CA 3JTEA 2Q28A 2ATEA 1UM9B 3V8MA 4YRGA 1P18A 1Z15A 3CLSD 1HT3A 5C80A 3QI2A 4OHOA 5JU6A 3Q9LA 2QX7A 3HNPA 2LVBA 4IILA 1MJGM 2IHJA 2VXBA 1CS0B 4Z5XA 5AM4A 4Q4DA 4U9UA 4M7PA 4BFTA 2V6GA 4LVCA 3CZQA 5TPZA 3VDMA 1YUNA 2PSFA 4L2IB 4LN1A 3E9RA 3BMCA 5EI5A 3G2IA 1UK8A 1SVLA 2V4ZA 1TUEA 1JLKA 1P1CA 3BIJA 3WRXC 2ZZKA 1C0LA 4I4CA 2QTWB 1SBTA 5A4DA 3H4TA 5F98A 2DR2A 2GN4A 2EJWA 2J3MA 3FWYA 1L0BA 3OEED 1NT2A 1GA4A 2PZLA 3F6YA 4AO6A 4EMUA 2PT7A 4UVDA 1QHYA 5DDIP 1L1RA 2F59A 2WPNA 3GCWA 1E0SA 1CWUA 1GG2A 1FFGA 1U7WA 3CLSC 2V54A 2VEDA 2H4XA 1PYDA 1EXWA 3WYCA 4CHTA 4MMZB 1F9EA 2XYGA 4CKEB 5F52A 4KRFA 1KYZA 4YJ3F 3ZLBA 4O2BB 4B75A 3BE6A 4E1AA 3R24A 4FZ5A 2WPDD 3I05A 1XTIA 1ZX1A 1T2AA 1CQIA 4DLUA 4WN3A 4YMIA 2FCAA 4PC6A 1HDIA 1TI7A 1JI0A 3A70A 1PJ3A 2XVMA 2YWDA 3NR2A 5IM4A 1TJ3A 3GJ0A 3KLBA 4DQ0A 4WNAB 4LTNA 3GQBB 3JQ9C 5AFSA 1O6CA 3WMRA 2CLKB 4TTQA 1UKEA 1Q92A 1FDTA 2WHYA 5EHQA 2OL4A 4XRRA 3RIEA 3UJ3X 5KWJA 5BXQC 1JG3A 3D2LA 3VO9A 3IQGX 4HQ6A 2F9LA 3IR7A 4OUDB 2YFKA 4XPZA 1S2NA 3DFIA 2JGLA 1MV5A 1N1EA 1P1IA 1LA2A 3D8RA 2V6MA 4RCZA 5K2MA 3AU9A 1BE8A 3G89A 3HE3A 3TZEA 2PD6A 4CFSA 5T6BA 1ATIA 3ANTA 4GP6A 4AW9A 2E0IA 4C7JA 2P9ZA 2Y71A 1Y89A 5KOJA 1J8FA 2QJOA 2X6QA 5DGHA 4GVPA 3QUTA 4MUEA 1SXHA 4R2WA 4WUVA 3NWPA 3DDWA 3V8EA 5DBIA 3JQBA 3SX4A 3ASUA 4JJFA 3WJAA 4EITA 1N0HA 4PGFA 5IMBA 1IB0A 5TQJA 3QBDA 3KZMA 1WETA 1YFZA 1WR8A 3HO6A 4K86A 2FPMA 4BNDB 4GPIB 3LD9A 1TD9A 2ZREA 4QFMA 1FU8A 2GTPA 5K3OA 1YQQA 4BEWA 4QJ4A 1PDVA 4AT1A 3RT7A 4Z49A 1A9RA 4G9GA 4XGIA 5LB2A 4ZRDA 5FT9A 2R7MA 1G6HA 2F48A 1IBMB 3L2OB 1HFWA 3JYQA 4GSLA 4K9DA 1Q0SA 3RABA 1UK6A 1GA6A 3DOUA 3UK2A 1TXGA 3F5SA 2N3ZA 1ZONA 2IGTA 2WHPB 2IV3A 5F2OA 3ROGA 3CLRC 3ZOKA 2Y0EA 2DY1A 3GPIA 1RPZA 4I46A 5KNBD 1PSDA 4F9GA 3GLIA 2DGDA 5BSUA 4IRMA 2J7PD 2HPZA 3CUEF 1G9SA 4E4TA 3DT6A 3C97A 1C7RA 3AONB 1G8FA 5AJYA 4NCXA 1SQ5A 1C3OB 1XJQA 3PHLA 3QVWA 1UL1X 3QPVA 4ZYVA 3AEKA 3GDGA 4GEKA 3GJXC 1XMPA 3S2UA 5JMTA 1HDYA 4GKKB 1FP2A 1ZGHA 2PUDA 1ZD4A 4J2TA 2EQ5A 4MQEB 2UXDB 1WCXA 2IUTA 3OSZA 1RQGA 1CDDA 5FCDA 5K3EA 2KW5A 1QUEA 3AKYA 1PFYA 1VJDA 2REXB 2CFOA 3JR7A 4JJ7A 4MS1A 4R7ZA 3ZJ4A 2GD1O 5DO9A 4MWDA 5T8KC 2YHIB 2F4VB 5AVSA 3NBAA 3NG1A 4Z99A 3JQ9A 2CUNA 4MP8A 4CDMA 1J0XO 2ZTLA 5K51A 3LUKA 2WVGA 5PNTA 4BX8A 2V0CA 4QQFA 4MEAA 3FMVA 3TD9A 4PGMA 1EXVA 3IV6A 4BKPA 2BUCA 1RP7A 3MQ4A 4R81A 1YKFA 3NEAA 1AK2A 1EGHA 1TPZA 3WWDA 3A4LA 4YCNA 1JQDA 1NLFA 1AHNA 4TUYB 1EVJA 2P0YA 3H5LA 4C1NA 1IJKA 1XRNA 4WBSA 4KH0A 4IO0A 3C5VA 4XJSA 4Q18A 3EXHB 3FB1A 3JWPA 4RPCA 4DR2B 4F8EA 5JQGF 2BFMA 3PIRA 4GXQA 4X84A 3IVAA 1V6SA 2V5VA 3TVDA 3BB3A 2JJ2A 1V4VA 2ZWAA 3PRHA 5IKEA 3IE0A 3BDVA 1JDUA 4CU2A 2PGDA 2PMFA 1X7HA 3I2JA 1ONPA 3HRHA 4DILA 1NVKA 3N2KA 4PXYA 5A7FA 1CETA 1JW9B 1QGYA 2ZKLA 1A4UA 2GJAA 2FR8C 3LQ4A 5DLEA 3OQ1A 4QQ8A 5BNTA 2VZ9A 2PEYA 5T3UA 4XDGA 3WL4A 1FTQA 4HR7A 1MC4A 3ORYA 2H92A 3PYLA 3O8QA 3S2IA 5LXTA 4AI6A 2WF7A 3KDPA 4Y1FA 3EBLA 3D0KA 2Y1GA 2Y9MB 1M33A 3G02A 1U9JA 2G63A 3I83A 3R2JA 3RFUA 4YJKA 5IH3A 3IDQA 4NXNB 2OXIA 3GWGA 3O75A 3HO8A 4LZPA 2WWYA 2ZZMA 2A1TS 3HLKA 4IIVA 121PA 1SC1A 1W8DA 2JI9A 2NTYC 1JDBC 3EF1A 2F1OA 4LVOA 3W9YA 1U7XA 2XF8A 4JUFA 4I3HA 5F1YA 4CEJA 5LZ9A 2IXTA 2WJ6A 4WINA 2WWXA 2X86A 1AURA 4F2HA 3LKZA 4JB2A 1OZHA 1GA1A 1CTQA 2C20A 5EWMA 4DIUA 1JHMA 1T3ZA 1PFVA 2PKXA 1KR2A 3F97A 2GN2A 4Q4LA 1H69A 4X6XA 1T9AA 4UTXA 5KI6A 1RC8A 3T7CA 1KWKA 2A57A 2JGMA 1LPNA 3X2FA 2Q3MA 1IDOA 2D5LA 3NEPX 4ZO6A 2W6PA 4N8SA 3ZV5A 3I5YA 5CDYA 1RPAA 3PXGA 1ZD2P 2FZCA 1SVWA 2JGIA 2WJVA 3OE7A 4M9UA 4QNMA 4QPZA 3JYHA 5K3FA 5IC4A 2OZLA 3DZFA 3R3HA 3NMUF 3BD8A 1X1SA 2GEDA 3QXSA 2C57A 3NRBA 1G20B 1VXRA 5E7JA 3ZXIA 2XRFA 4ZHSA 2YUIA 4MHTA 1OKKD 1KY3A 5DTQA 4Q39A 2GILA 4MITA 1DJLA 2FMXA 4ZAGA 2PSJA 3QBVA 4MRNA 4B6PA 2W2OA 3GL9A 4FYIA 3K9BA 1F38A 1U5AA 3B9RA 1AUVA 4JXKA 1S2DA 1O58A 3PPVA 1I94B 1QO9A 3Q0EA 3F1LA 1R9MA 1FTGA 4NS1A 4I55A 4MB2A 5T4HA 5G0SA 3Q3HA 2A0UA 5CB0A 1RI5A 1R74A 4H15A 1MB4A 2HMYB 2AN3A 4URUR 1WB5A 5ALXA 3U9SA 1JILA 2JBAB 4XVQA 2RE8A 3SMVA 1PF7E 1FZTA 2DPHA 2P6PA 1GNVA 1QH9A 4R5MA 3LT1A 4OPMA 3ASZA 5F35A 1WNTA 1ISMA 2FEOA 3C98A 2VCEA 3TK1A 5IX8A 2O20A 2Q1TA 3RSLA 4EPWA 5D1NA 3U4IA 2R7KA 1LVHA 1VG8A 5SY6A 3N2YA 3GIWA 4QZVA 4EHFA 1YL6A 3NHPA 4CKYA 4M0UA 1IB6A 4HT3B 2JASA 1T5IA 2X2EA 4EY7A 2JLYA 5IVDA 3LCCA 3FFXA 4UPDA 4FNMA 2ARKA 3G2OA 1XTBA 4EYQA 3IV9A 5EJEA 3L6CA 3GP8A 1V3QE 1W6RA 2V1UA 2E4YA 4ACBA 4AZ0A 1SUFA 5LC1A 1QHXA 3CW8X 4FEEA 1KWGA 2A58A 3CRQA 4OTZA 4XKJA 5EJ8A 4HLDA 5DWDA 3WIVA 3QVXA 4OB8A 1MIOB 3DXFA 4G85A 4B35A 3Q7EA 2JEZA 4S0ZA 4A15A 4CM8A 4DJDC 4BECA 1GAJA 3ANLA 3N87A 2VT6A 3AI1A 4FMCB 2W58A 4V1CA 3W79A 3I4FA 3WDMA 2G28A 2PH1A 2YVAA 3ID6C 2GNOA 4EOGA 5CVCA 3LWBA 3BQ9A 1C7EA 2JKZA 1R00A 3CG4A 3L9WA 4DJEC 3IEMA 1AA9A 1QDEA 4ZVLA 5C0OE 3P94A 4N8EA 1VE7A 2YYSA 2N42A 1KRHA 1PEAA 4LGVA 2REQB 2Q2QA 4Y2XA 4C0XA 1OU4A 1I5OA 2QTGA 4C7KA 4E31A 4EEZA 2R8ZA 3ISJA 2JFPA 3JQCA 3KE8A 3DTVA 1BS1A 1YK1A 5FQOA 5AW0A 1UMCB 3J7TA 1G4UR 1KGDA 3TAUA 5FTKA 1W34A 3ZU3A 1Q7RA 2WU0A 4N6NA 1F6WA 3INNA 4NBSA 4RVDA 4GYWA 4WKOA 2H9YA 3V1TC 2LW7A 3X1MA 4BPRA 1LPBB 1FRFS 3QJ5A 1TNDA 5CT4A 3KTDA 5KX5A 1TTHA 1FFYA 5KNBA 2H1HA 4J4BA 7MDHA 1E3SA 2JFYA 4DQUA 3LUCA 4I1YA 4KBYA 1K5DA 4NOMA 4KR7A 3CGGA 1F9AA 3OOJA 3ABRB 3P2YA 2OYSA 4P08A 3LQYA 5BMOA 7YASA 1XNRB 3COJA 3FUWA 1JNYA 1G8PA 3OFND 2AYXA 1FBNA 1ISPA 1WX1A 1X70A 2EZTA 2IUFA 2GN6A 2OZLB 4TT3D 5EIBC 3UY4A 5JAHA 3FHJA 3QMMA 1YVDA 2YRFA 3AF0A 4NG5A 5BYAA 3OJLA 4PPGA 2G04A 4IDHA 1LPPA 2DKNA 1NOIA 4FX5A 4AIRA 2X1LA 3RH0A 1JYSA 5DE3A 1NW3A 2BR5A 2FWAA 2YN0A 3PVZA 1UDWA 1DI0A 1V71A 2IYPA 4I99A 1FNDA 2B5WA 1M2VA 2NUPB 2FPUA 1U2TA 4S1TA 4M8KA 4N5HX 4DHWA 5C1IA 3VGPA 3LYAA 4F3CA 4QXQA 4WK0B 3SVZA 4DMGA 5DNVA 2RD2A 1KYIA 3ONNA 4MKGA 1IG0A 1EU1A 1JAZA 3IAS1 4HEQA 3DHVA 2AFIE 2VXYA 2XB6A 4RHEA 4MV0A 1T3LA 1F2UB 2EGHA 3NHMA 5JXIA 3O8OB 1X1QA 2FUG1 3VSDA 5HM6A 1V9CA 4K6FA 1LBHA 4MVJP 3BIWA 5IHPA 1TYDE 4KE9A 3H19A 2JHFA 4HLUA 3BT7A 4NYJQ 1FZQA 4OXKA 4QAQA 2C42A 2HUNA 1P4AA 1ZNZA 4KWTA 4TOIA 1LFDB 1GFIA 2N0SA 1J8MF 4LCBA 2DFTA 1NLZA 1NUQA 5E3IA 2H4YA 3PWTA 4TKMA 3Q1LA 4WD3A 1GTRA 4HRYA 5KPJA 5JZMA 1MAHA 4CIDA 4AQYB 5LD2B 1U9ZA 1FQOA 3BIXA 1P4HA 2PL3A 4TLCA 4AX4A 1ZA2A 4M9QA 5EA2A 1GL7A 3W5IA 5EESA 1R15A 3L1IA 1XKLA 4Q7JB 5B30A 5KB3A 4PBTA 1XCBA 2I4LA 1Z0AA 2DLNA 1PT9A 3AFNA 4LZAA 2O5VA 5GADl 3A4VA 1Y1KE 2JJYA 4MR9A 4Q3AA 3CUWA 1MJGA 3BERA 3CINA 2OGZA 5D84A 1LX6A 4CM6A 3PKIA 4YAEA 4I08A 3VO1A 3DBLA 5FD8A 1NW6A 5AVVA 4IIUA 4ZVSA 4BXOB 1YJXA 4FTWA 4JOBA 5HZKA 3RYCB 3JQAD 4MW0A 5HUQA 2ZWVA 3LUJA 3S2YA 3G7NA 5A3VA 1AZTA 2WNIA 4TKZA 4FKZA 4K9OA 4V3CA 3QUBA 5J3JA 3VDRA 1V6AA 4BIMA 1YRAA 2ZIFA 1CC1S 2H2AA 2YTZA 4RCYA 1TK3A 1I2CA 3HYCA 2C1XA 2Z4TA 4X7MA 4FS8A 4JA2A 4UFOA 2C7QA 3JSAA 4JA0A 2E4UA 4ZMSA 3TG2A 3AXTA 1YB2A 1ESDA 2Q5IA 3IOCA 1Z6YA 4NCNA 4EKEA 1NF9A 4FWBA 4L51A 1AHPA 1MOQA 5JNWA 5G0TA 4KB5A 4LC1A 3ROXA 4M53A 3HNOA 3Q7TA 2FFAA 4R0MA 2QN7A 1R37A 2BN4A 3DQQA 2JIQA 1Z36A 3IUJA 3VRHA 4KUGA 3ER9A 3R7LA 3IERA 5JXWA 1V0JA 4MTLA 4HCJA 2Z57A 2QVXX 4DEXA 3G8YA 1C8VB 2AYYA 3N74A 3EVCA 4KWEA 2A5DA 1TJNA 3TSCA 2OCGA 1BQEA 4XAQA 4JNCA 3D6VA 5FBZA 2A33A 2PYIA 3AUJB 1PD0A 3PZBA 2KI5A 4KO1S 5IW8A 3M5CA 4FM9A 3PJRA 2YS7A 5EQFA 1MD9A 1PW7A 5DIFA 2H2GA 2R11A 4FNOA 3GLIB 1Z4OA 2EZUA 2OTCA 2VHCA 3B2EA 3L6UA 4EB0A 2AOTA 3DE2X 1ADCA 1VJ5A 4NAVA 2Z6VA 1XU7A 2IYZA 4D9JA 2PPVA 1TYBE 3WLPA 1T2UA 3ZWKA 1ANKA 1CDOA 1OAOC 4Q6BA 3ZZ1A 3I2IA 1N2JA 2XWBF 4UEKA 4UMFA 4CM4B 1DIRA 1SIBE 2D8MA 3KVVA 2VLBA 4BNXA 3NTVA 2YL2A 1KS9A 2YMQA 1YC2A 2DT8A 4HTAA 3W8RA 1SXPA 2ODPA 2H5IA 5CYPA 3C6KA 4XB1A 2W8ZA 2W2LA 5BWOA 1Z5WA 3A1DA 4P0PB 1U7PA 3FI0A 1X3LA 2ORIA 5THXA 1NFQA 2WDZA 3G0DA 3HCCA 1K8QA 1WMFA 1KDPA 3ZE7A 5DLDA 4RM3A 3ZGOA 3OI7A 4FR2A 3VNVA 4R68A 3K2QA 2Q5EA 3FIUA 2WJYA 3C6YA 3BK1A 3LP6A 1NJ8A 4L9WA 4M36A 3B3AA 1FLDA 3OKCA 3VA7A 3ST7A 1A98A 4XR9A 3TPCA 3AL2A 4NEHB 4CT4B 2J5RA 2Q4EA 1XYVA 1ZXBA 5HX7A 2NXCA 3QVKA 1N2CB 5JRZA 4P83A 5F73A 3PDIA 3MUOA 4QBIA 1R16A 5I7FA 5BSEA 2H4WA 4G3XA 1IAVA 3PDCA 2RJOA 4GBMA 3QF4A 2HIGA 5EHGA 2H4HA 2JAOA 3R5TA 3AJAA 3WXMA 4GMKA 4YRJA 3FTEA 1NXXA 3EVGA 2GK7A 5KSPA 2O3TA 3BMNA 3A11A 3SNHA 3CH5A 2Y1DA 3PFWO 4QE3A 1BXZA 1BC5A 4S35A 1G8KA 2BZ1A 1ODJA 3WLJA 3KFXA 1XLWA 2ZRHA 4EAQA 3DLBA 2CVQA 1E2EA 1YIDA 5HKLA 3BMOA 5L7WA 1KZ7B 1NVEA 1KO8A 5EJ2A 1YFKA 1ECLA 2VP9A 3PRYA 2EX0A 4L5YA 4YUWA 4DABA 1O6ZA 3OCCA 3R4VA 1J90A 1G3RA 2PV7A 2QB5A 1XFAA 3BIOA 3EWIA 3FBTA 1AGYA 5EN4A 2VOJA 2FN8A 4J94A 1KDYA 3SKXA 1XCGB 1H0HA 2QROA 3AVWA 3AHCA 3IUNA 1EGQA 3E9CA 5FXMA 2CDNA 2AJ8A 1JG1A 5K45A 5EJ7A 4OH1A 1P8JA 1UFOA 1OLXA 1T36B 2IQ5A 2BSQA 5FHRA 3ZG6A 5DTRA 5JPCA 2EKDA 2QRGA 1UPBA 3KKPA 2FPXA 1L6IA 3C4QA 3NUQA 3O26A 4GX5A 4LXGA 1GAQA 4HQKA 4I8IA 3EBOA 2F8SA 3PUWA 4MH0R 2EOAA 1YRYE 2GVNA 4D9HA 2WP8J 1UBOS 2NP7A 2K5UA 1SKBA 1WZUA 2BEJA 2JAQA 2MTBA 3SE7A 1UBUS 4M89A 2MYTA 1VB3A 1K92A 4HXFB 1I1QB 5TC4A 1RYNA 1HC7A 3EDCA 4MP3A 4URZR 4BE9A 4EG8A 1USVA 2EKQA 2PL5A 3A27A 3DM9B 5DPMA 3TLXA 3WSTA 6ABPA 3GHYA 3R3VA 5DNYB 1PJ4A 5KJCA 2YHBA 4F60A 2XBLA 3MWEA 1ZVKA 1F8YA 1V25A 2BMJA 3O91A 4K8OA 4P4TA 5DB4A 4EHIA 3DMGA 3VI3B 1F0NA 5IDWA 1U8AA 2IK8A 3DQPA 4XFJA 5EXDA 1UJ2A 3WADA 5C7YA 3PI7A 1V5FA 1YR1A 1XF1A 4GU5A 2ZRLA 3ZC3A 4DE5A 3VJRA 1NJGA 1S8OA 3NS7A 4TMKA 4Y0AA 4UHCA 1FFXA 1P72A 1X7YA 1H9CA 4JXZA 4KREA 2IA5A 3TLAA 1RWQA 1ZZGA 3UXYA 3BEOA 1T10A 3OZDA 3DV2A 3S4YA 4MRMB 3AHDA 4I9NA 4OJQA 1T6BY 4J4HA 4BWYA 2FZ4A 5E4JA 5GQSA 3IAXA 3OVMA 3IOMA 1FIUA 2HHAA 2JD2A 2DUJA 4A0GA 5IKOA 2L2QA 5DM2A 1JU3A 2H1SA 3EPKA 1V2GA 3GUCA 4CM5A 1Q50A 1X39A 4FSDA 2WJZB 4UPEA 2ECKA 5KWIA 1XZPA 1G7TA 1V47A 4EB3A 2OD9A 1S8FA 3ZH2A 2HNBA 3NWOA 3O03A 5YASA 1P7WA 4TLBA 4OI2A 3TL2A 5J4KA 3RSGA 1N6OA 1RLIA 3IBYA 3AEUB 5CVTA 5SZHB 3TLMA 1C9KA 3IJEB 4AK9A 1P74A 3CUUA 1XWWA 3QIVA 5IJWA 3LU1A 1VBNA 5HIKA 1SRQA 5HKAA 3LKVA 2V6BA 2OQIA 3S44A 4UQLA 5HSGA 1IRIA 3RWMB 1K5PA 3W04A 3BTSA 1DKLA 3NIDB 2RGWA 2XB2A 1QQTA 3KETA 2B1GA 2XECA 3AP2A 3A36A 1QGOA 3WJ1A 2PRSA 3TRJA 3FE2A 3TW8A 5C46F 1DX9A 4HQRA 2BOVA 3PIDA 4N7JA 3UT5A 3GRUA 3M33A 4QJBA 4WRRA 5FFNA 5AI8A 5HEKA 3S1AB 3OZWA 2DH5A 2J3HA 3EUEA 3T1YB 5K03A 3SM9A 2Q8NA 2C59A 4H7EA 3NH9A 5KJ6A 1IY2A 3O8NA 2NSHA 3KSUA 1WRBA 1DBSA 1L7MA 3OHPA 3ANNA 3C5WP 1AKWA 4IDGA 3AM5A 2Q3BA 4OLJA 1J49A 1W25A 4A0SA 2YWFA 3C45A 4JP1A 4RL6A 1RJDA 1ULZA 3TYXA 3UMGA 2UUOA 3KJZA 4RORA 2ID8A 1U8YA 3U7HB 1Z6PA 1V7QA 2FLWA 2H1RA 3PEUA 4OO3A 3AM3A 5D5PA 1Q0RA 1Z28A 2D7DA 4KQFA 1E2NA 4DZTA 4D5EA 1GUAA 2R8RA 4UTVA 3F7NA 1B76A 4LHYA 4R16A 4FLEA 4LKOA 4CJXA 3H11A 2CFTA 3GNQA 1PFKA 1G6Q1 2PJZA 4DS3A 3N8KA 1ZOSA 5CLIA 2J8ZA 4G81A 1CHNA 3PQDA 4QAJA 4S1OA 3DE0X 4NZMA 1LQTA 1RQRA 1YZLA 3S40A 2OYRA 1N33B 1ZLXA 4GX2A 2G1JA 3EFOA 4MO9A 5G3YA 2NAPA 4E3ZA 2KBFA 2B98A 2YNMD 2OHXA 1P1FA 4ER0A 3LCUA 3FNFA 3IS3A 4HXYA 1K66A 2NW6A 4XYEA 4QUEA 3FCEA 1PE0A 2HK7A 2W4IA 3H97A 3NUGA 3F6PA 4CQLB 4B6FA 3CZCA 2VSXA 3O38A 1W94A 2B2CA 3A6GA 3RRFA 4Q4CA 3LQFA 5JY1A 1CUBA 1YCDA 2UVQA 3ELDA 5F1KA 4L7QA 2HF2A 5TF0A 2DB3A 4BWGA 4XGQA 3ANXA 5K8VA 4U0KA 2I99A 2GF0A 3ICVA 1JEOA 1K5GA 4DG5A 4BMXA 1QXSA 2P2YA 1PK7A 3L7CA 4XDHA 5LLDA 2XKJE 5EFOA 4BO4A 1OXKB 4NE7A 1W46A 1M2JA 1B26A 4TV8B 2N46A 3HUFA 1B74A 2Q0XA 1N2CA 3A05A 3W8FA 3RR2A 5KMGB 5B6PA 2D6FA 1WS6A 1SBZA 1IEVA 5BW4A 1EB8A 2BKAA 2O2HA 2AFIA 2JH8A 3T4EA 3N3AC 2ZT5A 4AY2A 1TYZA 3UWKA 1KI2A 4I4TB 4J9VA 4YH1A 4DDTA 3UGJA 5BSVA 2ZT6A 4V0LA 2ZRMA 3V1UA 3UMCA 4P3KA 3RLFA 2VUIB 4YV7A 2NXEA 2QAGA 3FSJX 5LBIA 4XX0B 3GBPA 1PJTA 2NUTB 2HDOA 5DMHA 2FWRA 3JV7A 3NBQA 4D8WA 1GZ4A 4ENQA 1W88B 2VQSA 1U94A 4OHPA 3K70D 1U7TA 1HGXA 1YDHA 3QYPA 3UM9A 3LVBA 4V1CB 3DVSX 2QZ4A 4KN6A 2Q6OA 3OAAA 4ZYYA 2QE7A 2QDXA 4WESA 3GGJA 4HWPA 2MSWA 2OCBA 3S1SA 2IHYA 1YIAA 2P5SA 2A9JA 2Q4BA 4DWVA 5I4IA 3L0CA 1I6KA 1E77A 1HT1E 4MWCA 4OLBA 6CHYA 4BMZA 1W0KD 1QX4A 3EA4A 4YJHB 1PFWA 3ZPXA 4PAOA 5C7IO 1U0TA 1A2OA 2O05A 3GA5A 3QMPA 1QVAA 4CMGA 2XTAA 5C53B 5K8TA 3I23A 3AVPA 4DQKA 4F9EA 4OGWA 5ESRA 5GOTA 3LTNC 3A6EA 3L8CA 4PTYA 3C5EA 4QFBA 1YRQA 1T8TA 2AEJA 1MRNA 5K3DA 5DYYA 3U7JA 1GVHA 3QA9A 5K0FA 4DMFA 4L3VA 3RS9A 2QR5A 3GYBA 3DEIA 3PQFA 3HM2A 3G2MA 1IJEA 3IXLA 4PX2A 1IXRC 4WOBA 4MRSA 4CM9A 2JLVA 1I6LA 2IYNA 3O6VA 1NXPA 3OURA 2QZPA 4EATA 1RPTA 1YS2X 2XIQA 1NJSA 1TM1E 4P6VF 1L1EA 1B00A 1D09A 2QK4A 3SIRA 1OZ0A 1JH9A 1SZDA 4YP0A 3GLSA 4MVWA 3V42A 1JLHA 4TMXA 3OQ6A 4UUAA 2MHCA 1THGA 4X1KA 1SC4A 2X8JA 3W78A 5HS4A 1UBTS 3RS0A 1E9VA 2DTDA 5E2AA 4BOYA 4JI5B 1DAMA 4QXPA 5EMJA 1N6LA 1AKVA 5IUKC 5JASA 4P31A 1N8SA 3LW8A 2QQGA 3HUUA 1NQWA 5AH0A 2NU6A 3I9FA 2GTIA 4P7GA 1OFHA 2W0MA 4XQCA 3V9PA 3DC2A 1IN1A 5BYBA 3RS7A 4N5DA 4ABTA 1IBRA 2QE6A 8AT1A 1DCTA 1GZ3A 1QF6A 3BRSA 4D9NA 4B9EA 4IXMA 1OWNA 2DETA 3UG6A 3GRYA 5IDVA 1XBTA 5JLJA 1QAQA 4ZT5A 5H9WA 1V9LA 3A28A 4DQXA 3TRFA 5EE5B 2MYPA 1NW5A 2NU6B 3WKDA 1KXJA 3MT0A 4FS3A 2YBEA 1DCFA 2J6IA 4HVAA 1U11A 4XD7A 2NSDA 2R6GA 1LQUA 3NHBA 1LTKA 4HDNB 1JTFA 4F06A 1R7RA 1OAAA 2VP4A 4MS4A 5G0VA 5LP6B 2GETA 2AZXA 4QXOA 1ZCFA 1URPA 4ZN6A 2AI3A 1TFUA 2DC1A 3T95A 4C88A 3ESZA 3FPFA 3SYRA 1UZLA 1KJZA 2XD4A 1WUKS 1WXEA 3EXEA 1FFBA 4UDXX 4RVGA 1EVIA 3VZQA 7MHTA 2Z1NA 3DAPA 2IYOA 2JGKA 3LLCA 3QW4B 4YHBA 3DVAB 3TAXA 2ODWA 1K68A 3FCOA 3QSGA 5BR4A 2WU3A 1EJ2A 3PRJA 1G64A 3Q3GE 4K2AA 2J4CA 4UNIA 4D4IA 3WBJA 3NHRA 1Y8CA 3QWFA 1P4GA 3PENA 5CLGA 4JBXA 4GOND 4JUAA 5AVQA 1ZGBA 5JFGA 1L7DA 1VBKA 1E7YA 2J9GA 1Y42X 3LOQA 3O1LA 2BMWA 4ZVVA 4L5AA 2PRYA 3V2IA 2DQYA 1NBHA 3BJRA 5C5IA 2BKVA 3IR5A 1YL7A 1OX4A 4NXMB 1JLMA 2D2EA 1R4MA 2XMCA 4HDRB 4YJFA 3TIIA 4RHXA 2HMUA 3VM6A 4M0CA 3DF9A 1KVQA 3FZGA 4JBGA 2ACEA 3JS5A 2H54A 2OKCA 2XF2A 3G0GA 3O8LA 1AV6A 1TVEA 2HIAA 1EP9A 1KS2A 2VT7A 2HMWA 2XXJA 3FDJA 4WAUA 3IP9A 2DPMA 2GKGA 2V9PA 3Q0IA 1FE8A 1I3LA 1TM2A 1XQYA 4MB0A 3I6IA 4KQ1A 4YCJA 5CCXA 1UZAA 4AY4A 1JPUA 1VHDA 1QDUA 5FA5A 4AN0A 4Q37A 1QK4A 3L1VA 5BNWA 3S55A 4M46A 4D0RA 1XAJA 3LT4A 1NZJA 3ZK8A 1J0DA 2CNBA 3G5AA 3JVIA 3KX2A 1QQ7A 2DHQA 3DT9A 3RRMA 4B79A 3L82B 2GZSA 4P92A 2V4UA 2YOFA 2IU6A 2GNAA 2GUGA 1X94A 5ALLA 3KWLA 4BBAA 3GGGA 2XUJA 2ZBEA 4DEVA 4IJ6A 4D3SA 4FDMA 4JSTA 3L43A 3PXDA 3V1NA 4XARA 5A3RA 2P6RA 4KSCA 1ZG3A 4KIFA 4W5WA 2IBSA 2XMDA 2VHEA 2AEFA 3O4HA 1GGKA 3I5UA 1JQJC 3OE7D 5JPIA 2QY6A 3FVVA 3PR2B 3QXXA 4HVLA 2GZDA 3A31A 4K05A 3HKCB 3WGVA 1S0UA 5K0GA 2POCA 2DR3A 1E1RD 3T7EA 3WWZA 4BNGA 1ESCA 3TQQA 1DU4A 2I1WA 3OZ7A 3SS9X 2GAIA 1T0PA 5DHUA 4TL6A 5L7YA 3PLAE 2W11A 2YN2A 1P5RA 3H1GA 4B3MB 3CVOA 2BELA 3L46A 3NAMA 3DR3A 4Z4CA 4C0HA 1UT6A 3QNWA 1QLJA 1VE1A 4M99A 3VJLA 3UEOA 4ZAWA 3PNQA 1UBEA 4TL7A 1JF8A 1U99A 3HL0A 3PXBA 5K6RA 2F8TA 2UVPA 2CB0A 1QOQB 1ISSA 3SC4A 5IYZB 2XNCA 1RADA 3WOHA 1AY0A 3A9RA 1GHTA 1HDEA 3NQ41 4NFSA 2PU5A 3VZPA 5KZMB 1YQDA 2QL9A 5ERYA 1W5SA 3STXA 1T9HA 5A2GA 2RAVA 3E84A 1VFPA 2OV3A 3Q6IA 2HDHA 5T5QA 2HSGA 4M6WA 3OTGA 1CZUA 1G20E 4GWGA 3OPYI 4YRKA 5ITVA 2GDZA 4I5FA 3AO0B 5AVKA 1IQPA 5FOWA 2XQGA 3NVAA 4Y2YA 1W2GA 1ZW1A 3CRNA 3RK0A 5IVPA 4TZKA 1NJFA 3H11B 2GXQA 4HAWA 3FPSA 3RWOA 4RXTA 2J45A 4O0MA 3W2FA 5JT1A 3VVCA 4N0EA 3AX6A 3BCRA 1MABA 3L01A 2BGNA 3LW7A 3R0QA 4QHTA 3RRBA 2JIBA 1JBKA 2H31A 3EXEB 3FNRA 4UVIA 5EL0A 1SHZA 1NYTA 2ORWA 3EMKA 4LGMA 1Q16A 3GUVA 5AJHA 3W6OA 3LXXA 4BLUA 2OFPA 5B55A 1VLVA 4MPPA 3VTKA 3MIIA 2WI8A 3DZCA 3LRPA 5CA0A 2HCTA 4XXHA 2AJLI 3ZY2A 4UVHA 3TOCA 2JLSA 1U7DA 5ADHA 4JCOA 3HV0A 5B57C 1QJCA 1HNZB 2QYSA 2ZUDA 2C92A 2A4MA 3MOIA 1ZJYA 3AR4A 1V9SA 1I2ZA 4OUDA 4PZYA 1M54A 1QLHA 1BO6A 5A0FA 3MK31 5FI5A 3S29A 1NU8A 3OLYA 4KAAA 1BXRA 5C2JB 1E9BA 1GPDG 2EVWX 3K35A 1YE8A 4R9SA 1TA4A 1DV1A 4X6LA 3VKHA 3RI3A 1HRKA 5TS3A 3D7NA 2HV9A 3GLQA 1NE7A 1AV7A 2LCFA 1XZMA 4LTMA 2RI1A 4OGKA 4ZQCB 3TW8B 4DCNA 5KTOA 3ORSA 4R2IA 1O77A 3ZY5A 4BO5A 1EBFA 3GA7A 3KVNA 4YQYA 4RIIA 5JNSA 1RXCA 3CU5A 1H8HA 2CLEB 2QG9A 2Z9BA 4G1BA 1L4YA 1D0VA 3EZ9A 1U2SA 2IODA 3Q5DA 4RADA 2V3VA 4UU0A 5ELXA 3GFSA 2R6CA 3MYYA 1AUXA 4GI5A 5K8CA 2R60A 4MQFA 2R6R1 1RBMA 3RADC 1RFLA 4EQZA 3U9TA 2C9ZA 5EPOA 1CRQA 1GFSA 3BL5A 2B3TA 3EC7A 2V3CC 2AWOA 1UJCA 4EI2A 2HA0A 1T1SA 4OA5A 2PUBA 1H2EA 3A0RB 3I0NA 4Y9RA 1KI3A 3N8IA 1FDVA 4EGJA 4BFSA 2FWPA 3CVUA 3N76A 4RANA 1R64A 4KXWA 5ER9A 3OWXA 3KAQA 5IABA 5KC9A 1HDCA 4LZOA 3HDTA 1QZZA 3ABSB 3BA1A 3GFFA 4NHOA 1NBEA 1YZQA 5DYTA 3BK7A 3O7MA 2WKSA 1GU0A 3MJCA 4OEHA 1VYHA 2GPSA 1FP6A 2W7TA 1UK9A 1IN5A 1LGYA 1KKMA 1ADYA 2C83A 3HDYA 4G2TA 4TTJA 2Z4RA 5F1OA 1UWCA 3E7PA 4P4SB 5IASA 1CEEA 1UPFA 1SXJE 4LZWA 3DDNA 4PN3A 1F06A 4XWTA 1SBHA 2AR7A 3A6HA 1NP6A 2AKAB 3B89A 1V6CA 1A5AB 1E9EA 1TC2A 4FMDF 4C3VA 1HETA 4E30A 4BRWA 2AKEA 3QBJA 4QGBA 2BRUC 3HKBB 2O5RA 4L8WB 3QXCA 4LCEA 2GLUA 4NBTA 3JQBC 1F3LA 4IG9A 5GY7A 1NUTA 2C31A 3OUZA 3TGLA 4HGYA 2CLHB 4LX0A 1NNSA 1QUFA 5CEEA 3UK6A 4ZIRB 2CNLA 4WUTA 2LXNA 3UB3A 2ID4A 4F6RA 3E3NA 4Q3OA 1Z33A 5A71A 1UAYA 3UNXA 5JYEA 2ONCA 1U81A 1D2GA 1F48A 2NPFA 3SC2A 4AFNA 1N8KA 2GAOA 1CVIA 1EM6A 1B6GA 1P2DA 4IGKA 4LNHA 1N9GA 3RAFC 4WXRA 4DR5B 1H5QA 2ZRNA 2VPZA 3GLTA 3B6IA 3KG2A 1H6BA 3R3UA 1IDN1 3TSWA 3IIMA 3LV8A 4RPGA 2O2GA 4ER3A 2NO6A 2H4ZA 4JWTA 5DXJA 3VNAA 2LZ0A 3UG7A 2Z1DA 3KJXA 3MLEA 2PJUA 3QWAA 3R77A 3UAXA 2AMVA 2C5GA 1XK7A 1RWXA 1Y3BE 4P3YA 5TQ0B 1ES9A 2XB9A 5U1PA 1NUPA 2XQKA 4HGOA 3PFGA 3DDCA 1G1AA 2JFZA 3HCEA 1ZAYA 1Z5PA 1JHAA 4QUDA 1DC8A 4BB5A 4DLTA 2VK1A 2I3ZA 4U9HS 1XWFA 2YIMA 4AN4A 3VNUA 3PL5A 2FPWA 4EA9A 1GQOA 1T8PA 4BP8A 2QAGB 2WM2A 3W9SA 1DL5A 3DV0A 2P11A 2FY8A 2VRCA 3FWZA 3I04M 4X7BA 4YROA 2IUSA 1HOTA 2P9TA 4CKCA 3VKUA 1EWYA 5LNK1 4YR7A 5KC8A 1DIAA 1PNRA 3A6PC 4B7UA 3IEVA 2QSYA 4BKMA 4EX7A 4ND7A 1Q15A 3TQFA 3X43A 2JLZA 2ZSBA 5BSFA 3DCYA 3HP1A 1ZNXA 4RF4A 2HFJA 4FBMA 4CTMA 3BGSA 3D4IA 5JECA 3IE1A 2X14A 3ICOA 2IS6A 2ST1A 2YIVX 1X7DA 3O1JC 1AK1A 3GPBA 3R8XA 3K5HA 4I5IA 4DHEA 1UKCA 1SURA 4D80A 1Y4ZA 2VYCA 2WG2A 3LKBA 3HVJA 5KTKA 3CX6A 3LSTA 2C5BA 5IANA 4TS1A 4Y2GA 5CX1B 5BMVF 1K63A 4Y6RA 3DH0A 2OPHA 2ZYVX 1G42A 3K2BA 2ZU0C 1OC2A 3C48A 4QVKA 3RYHA 3CR8A 4C87A 4YXWA 4C9BA 4Q9LA 3BXEA 1MP0A 3O74A 5AK0A 4EECA 2JIZD 1T1JA 2EG9A 4QTUB 5A6SA 2OV8A 1BVHA 1P0CA 3E53A 1EUCB 3CZRA 4GLBA 4ESOA 4MMXB 4OX9Y 4I14A 2AEMA 221PA 1FYDA 1U8EA 3CSUA 3V4OA 1DOHA 4G8DA 3HJCA 4IRXA 2ZYHA 2VG8A 2VNJA 5FI0B 3PEEA 3JATA 2IOHA 2KS6A 2FH5B 1E9CA 1ZZEA 2Z5FA 3ROTA 3UANA 2FZGA 2J59A 3CEAA 1U6IA 3HADA 1N5JA 2Q9CA 1UMDA 2WSMA 2PCJA 2Z8YM 3QLUC 5C1DA 2CN1A 3EZ6A 1S8NA 2JCSA 2PSDA 1CSEE 1PVVA 1HQYE 4RKFA 3GFPA 3HA3A 1IHXA 3EIQA 1PKXA 2Y1FA 4H6XA 3KBOA 5AVUA 2VF5X 3WWOA 4I6GA 2C0PA 1OXTA 3FNGA 2G7MC 1YCHA 3F7MA 5JROA 3T9EA 2WUDA 3VYTB 3KC2A 3ELUA 1FYFA 2ZUUA 1JXQA 4EA6A 1DT3A 1JJBA 4O2BA 2YHAA 1OXVA 1WHTA 1G63A 1ZC4A 4US1R 1T5LA 2QRMA 2HZBA 1TIPA 2JIZA 1BMTA 2JZOA 1T0JB 1ZK1A 2DUUA 4MLPA 1RJ9B 1Q77A 1QWSA 2FEPA 1BFUA 2OFOA 2X9VA 2X58A 3CB2A 2BMVA 3ZNQA 2PKRA 4K40A 2J9FA 1DDGA 4JLPA 4ZI7F 3UV7A 4YAKA 1ZL2A 1GL3A 1REQA 2R5FA 3OSUA 4MAMA 1G2QA 1TO6A 5AHRA 1XZIA 2XX3A 3KU1A 4L0QA 4QBTA 4GX0A 1XZQA 2E82A 2FXIA 4CL3A 1G3IA 2Y8EA 1N75A 4NE9A 3VKFA 5EJMA 4PQYA 4RACA 1SVUA 1GSOA 3CF0A 4NJOA 3HMQA 3LA6A 2C98A 4U5XA 1UC4B 4X7RA 3GVXA 1MB0A 1XD2A 1ODKA 2QSJA 3E5HA 4AWXA 4WL0A 2F67A 3I8XA 4OU5A 4U6SA 3NTRA 1Y6RA 4TUYF 4R54A 5BVHB 1YAHA 5BVHA 1OXUA 2B8WA 2XOKA 3REOA 2DUWA 5HTKA 2GN8A 2JFBA 1GGHA 2V7QD 3FAKA 1WPXA 1XOIA 2ZE5A 4UU8A 1L5NA 3EH1A 3BRCA 1R8QA 3KVYA 2O1XA 1Z13A 4KV9A 2WDPA 1XK6A 3QEJA 4JJ4A 5FPKA 5BR8B 2IH4A 2I91A 3RV4A 4KMSA 1UP6A 5ICEA 4MICA 2ADFA 5D8DA 3T4PA 2QM0A 4EYSA 3EAGA 4IXTA 5J2TA 4RJTA 5IEJA 1UPAA 2QW1A 3GMSA 3IQIX 3OPXA 2AZTA 4L4SA 2PT6A 5GONF 3IOBA 5F51A 3OE4A 4PYMA 4CHGA 5CDFE 5JSUA 2JG3A 4QGAA 2BEWB 3WLIA 2DXIA 4GP9A 1TQ2A 1XCPA 1MW9X 1T0IA 2BZSA 2XZTA 3R6GA 4P5DA 3OOEA 7AT1A 5F12A 3FOEC 3WISA 2I55A 1Z2NX 2P65A 3CNLA 3CCFA 5F3DA 1AM4D 4IDEA 1WF6A 4BN0A 1IIRA 1FTYA 2VPIA 4CPDA 4CL2A 1KI1A 4YJGB 3ZV3A 5FUWA 1E2IA 2CF5A 4BNLA 3U19A 5ELLA 2QUKA 3QFCA 2I1LA 4BQQA 1PT7A 5FPQA 2RGEA 3EF0A 1UOPA 4EGSA 4EH1A 4HYTA 3ZGZA 5I4BA 3VOTA 4ISBA 3FSGD 4DT1A 4OFBA 1SUIA 4BVJA 3ZBTA 4N54A 3G9QA 3IA7A 2UZ4A 2E9SA 2V7QA 3N1UA 2WKRA 4X85A 3BEDA 1K8ZB 1PR5A 3KQOA 2BD0A 2D0DA 3GYGA 4F4DA 4MW5A 5IJ0B 3PXXA 4Q4AA 2XRMA 4RV5A 4JVNA 4BCBA 3CLTD 3GG9A 5BN5B 2V7BA 3BH6A 1IBCA 1E2LA 1OGJA 3N59A 5JG7A 4JBHA 3BKWA 1E3QA 3PRKE 1JR3D 1G66A 5ETJA 1YO6A 3AJ9A 3FDZA 3HABA 3KEOA 2LNDA 3EG9B 1XN1A 5SZIA 2R1ZA 3A3KA 2C5FA 1LPAB 1RJEA 2IU4A 1SBNE 1Y80A 3HSYA 4HN9A 4IMJB 2WUEA 2QAIA 3K6RA 1CERA 2A5YB 4IQ8A 1E5VA 4PQGA 2NNWB 3E7DA 4ZYXA 4M0EA 2JVIA 1N2XA 1A95A 3UH0A 5JSZA 3NP9A 4OHBA 3N07A 1ECJA 2CZCA 2WHRA 4NNPA 3AUKA 1RPJA 3PGLA 3TO5A 1JB1A 1T4CB 2XV1A 1G5QA 4BLOA 3HYSA 4G0WA 1XZAA 4J3JA 1XKTA 3LWZA 4I5DA 5REQB 1Z4PX 1L8XA 3SMQA 3I09A 3C3EA 2BPOA 1KMQA 2YC2C 3Q15C 1H0RA 2FHSA 2A1IA 3AKCA 5DN6A 1XHLA 3BSFA 1DV2A 4G41A 4RZ3A 5JZSA 1QDLB 3MMXA 1XN4A 3MUEA 4WZBA 1UMCA 4QUAA 1W96A 1NA5A 3EXHC 2QTVB 4COKA 3P5BA 3ZUGA 2CNWA 3VDXA 2AOUA 3C6QA 3KYCB 4MJXA 1J0CA 1Z6GA 2C2MA 2DWOA 2I0FA 3PDIB 2ZUEA 2P79A 2GR9A 1JLLB 3DE1X 4CCYB 2FDXA 3FI9A 5ECDA 2X2OA 3ZLTA 4BLVA 2O8DA 5BUQA 1Y9EA 3GLGB 5AJUA 1PL8A 4FKMA 1SC3A 3CLUD 3M2TA 3MSXA 1KH2A 3RSHA 4BZWA 2VDKB 3FX2A 1M1NB 2YWCA 1EE1A 4WV3A 4ZAYA 4XWWA 5COAA 3DZKA 1XZNA 5HF8A 4WZAA 2LCQA 3SFZA 2XTJA 5DX1A 2UZ1A 1EK2A 1XP8A 4JYMA 4CQMA 4IEIA 4TKVA 1EFPA 2HPAA 2I3DA 4B3BA 4CV1A 1XO1A 3LBHA 3MD0A 4HNSA 3RVBA 5KYWB 1YK0A 4HMQA 4C7OB 4DB4A 4IUBS 5GONA 1E1KA 3VSBA 2DT5A 4EB6B 4YXWD 3ZHSA 3AVXA 1JDBB 4MYHA 1JHQA 4ACAA 1UANA 1XZBA 1WUJS 1ZIYA 2VVTA 3BA6A 4YGXB 3VKVA 2PQ2A 2ZDHA 1YFLA 2WKQA 3G2KA 3HWSA 4S12A 5E4YA 1QYWA 1SKUA 2PXXA 4UE2A 2IVFA 3FPCA 4JQOA 2C2KA 4BZQA 3PNVA 5IDXA 2I03A 1Q3TA 1BQ3A 2BMEA 5EZYB 1X74A 4Z3OA 3FFWA 3U1VA 4S2EA 1DFIA 5K8LA 1NAHA 3ZHZA 4CEHA 1ST2A 3U4GA 5JHHB 4KIGA 4Q21A 3N0TA 3OQPA 3UF0A 1GSIA 1TO1E 3BXOA 2MU1A 2O2JA 1X0XA 1LK5A 3N86A 3PNBA 1C8KA 3EDYA 4QVIA 2C77A 5GWXA 3WRXA 2FRVA 4LV5B 4KE8A 1FFAA 2QSZA 2N75A 2YZ7A 2P5UA 1WQ4A 4HDMA 3IO3A 5KYUA 3RAGA 1ZISA 4CQMD 1SEPA 1WEKA 2IX3A 3WGJA 3OEHD 1OBVA 4RZXA 2G67A 3IHKA 3N0WA 4L5BA 4C6TA 3RVDA 1NNUA 2R96A 3PCXA 1JSZA 3RKSA 4BNHA 3C8MA 5I7HA 1ZR2A 5ALTA 3SF8B 2O3RA 3BD7A 1PI3A 1UOEA 3R5JA 4RHFA 4WZBB 5FUVA 3RVQA 1HTBA 1Z3IX 4C2UA 3C6MA 3TCNA 3W3ZB 4Z9FA 1S3SA 5CB4A 5AW5A 4XWYA 4KP7A 4IIJB 4F91B 4U7TB 3CZPA 3SPXA 4J6EA 4Q19A 3ZDRA 3D4LA 3COSA 2QQFA 2HNAA 1SXIA 3E82A 3L0BA 2XW6A 2O2DA 3H86A 3W0LB 5JXJA 3AHFA 6ADHA 3EFBA 1XXHE 2CYAA 1CUSA 1L4FA 2X0KA 4BX2A 1QGDA 3I76A 1M6HA 1PFUA 5C1PA 3I5MA 2CDCA 1TKBA 4Y7CA 5EIWA 4MV1A 4EKIA 1VCOA 3OM0A 1UEJA 4PYKA 2AT1A 1VYTA 2NVBA 4L02A 4EMBA 2ODQA 3HJNA 4U63A 1CK4A 3K7EA 5CB4F 3VPXA 1RTTA 5CK4A 1BW9B 1KBOA 2QJTA 3NHAA 1ZEJA 4MVJE 3NXKA 2GFIA 4Q15A 1TCUA 5G02A 5GM2A 4HGQA 5K3FB 4FGZA 3VNRA 4I1OA 3BJMA 1L7OA 3BILA 4AMGA 3BWXA 3ZQ6A 3FOBA 3M1AA 3QENA 3QOYA 1UBMS 3BRQA 5AK5A 3CLTC 5JMWA 5KU1A 3L7OA 3N39C 2QRPA 5I8ZA 3FVQA 1OV4A 3LIIA 1K7SN 4LRYA 3RRYA 1QHIA 4KXLA 1T9GS 4CRWB 3WQRA 2XGJA 3SZRA 1CFJA 4IUDS 1GZ7A 3HC7A 3BB1A 1YD7A 3HU5A 3O4GA 2O57A 4X45A 1L5FA 4PC2A 3M5WA 4V0OA 3T61A 3X1XA 2WFLA 1USIA 5F9HA 4KXVA 1RKUA 1SK9A 1NJ1A 2Q6TA 4L8GA 4UXIA 1KPHA 3T5DA 4XD7D 4AJOA 4QDUA 3ZHOA 1OYYA 4H7FA 3WBBA 1L5VA 1ZD3A 5IZCC 2KHZA 3WO0A 4KACA 3JALB 1TM3E 1Q20A 3RVLA 3NPMA 2CCJA 4QTYA 2JFVA 2P68A 1AQUA 3L7KA 2RAUA 4YWJA 4GDFA 3EMBA 3ET5A 1SUSA 4CQNA 3E27A 2ZSAA 3C15C 1T4DA 2R4TA 1V5EA 1U2ZA 3V8BA 4KLAA 1Z82A 4YRDA 2VRNA 4EBFA 2JFFA 4D26A 5IJ9B 3C8DA 4D6XA 3KU4A 3P7MA 1GKLA 4PPQA 3S2FA 4B2PA 2XSZA 4PHCA 2C2YA 1UWVA 1OAOA 3T7RA 4YRSA 2ZQZA 1QZUA 2C4WA 4JVMA 1K88A 5JZOA 3VI4B 1ZXXA 1GV0A 1X9HA 2XB4A 2QRLA 4GC9A 3SZ3A 1P60A 2G8NA 4BJ5A 3H7IA 4QT0A 3LVRE 3VZBA 3UFBA 3F4KA 8ADHA 3Q0TA 1JYFA 4I1IA 1AN9A 1KBZA 1XPRA 4KI0A 2PXHA 4R8KA 5E7MA 3IOYA 3PGVA 4QHSA 3KXIA 2X7HA 4C22A 3AIMA 4F84A 4DN6A 1IVSA 2OHVA 1ENZA 4GD3Q 1JIQA 4KK4A 3ZTYA 3PQ5A 1X8XA 1R5BA 1XQ9A 1LF5A 4FILA 3MERA 5AXDA 2IWHA 5CCEA 1Z63A 3NPAA 1DFHA 2ZROA 5K8JB 1EZZA 1E5QA 4UEQA 1TGYA 1QTQA 4M8LA 4IJUA 1JHRA 5CX4A 3M3PA 3F5DA 3K0FA 2I1VB 2EL9A 5L51A 1STOA 1IUNA 3CXUA 2D3WA 2ZVJA 4R31A 4JBYA 1O95A 3IVCA 1P2BA 3ORRA 3QKSA 1QWOA 3RYFA 1M0EA 4F1KA 3N0RA 2RC5A 3PF9A 1FF9A 2BLNA 1J0AA 2J4DA 3HJRA 2X5JO 2XQJA 1FFHA 2PKWA 2X15A 3DZHA 5AD1A 3TF5A 3II6X 1REQB 4G8BA 1R0CA 1Z6AA 4KDRA 5I7VA 1JJ7A 4TV8A 3AQIA 2J67A 3PNMA 1O6BA 4NJEA 1Z2AA 1EXMA 1VB5A 4DCSA 2C0CA 1NXSA 2HK9A 1PT8A 1TF2A 2MSDB 2CV2A 1X3SA 3RGGA 4JOQA 3URMA 3UPUA 5HP4A 5IAGA 1XMQB 3DOEA 4KJZA 5HKKA 2VSFA 2WU4A 3AP1A 3RQIA 4DVGA 2MT9A 1UMBB 3FCUB 3MJVA 4FZRA 1L3IA 4P5PA 4CQLA 4V38A 4KVFA 4US2R 5JPDA 2AH5A 1N7IA 2XCRB 4CQMB 1A88A 1ODIA 1PEYA 4K8RB 5DZSA 2C2ZA 3QA3E 1XJWA 3IQEA 4L22A 3WDLA 2GO1A 5AUPB 3ZD6A 3GLHB 3UJNA 1E2PA 4RWZA 1QB8A 3EW7A 2DWPA 1TQ6A 1DQSA 3L0SA 5BN4A 1QG6A 4KN9S 3DMHA 3E2IA 1EUZA 2ZUWA 1GG8A 2O2XA 3OZAA 4RYDA 3QLVA 1LWNA 3O4JA 1GNQA 1J97A 1JKJB 1ARZA 3OE1A 1C2YA 1V26A 2OV1A 3HHPA 3WB9A 1CR4A 4BIIA 2B2NA 1WG8A 3HR7A 2JI4A 2WEKA 3P9ZA 3W2TA 2C9OA 1CJCA 3GAFA 1H2BA 5L3VA 2GS9A 1E0KA 2NSYA 2C4VA 3JSXA 5DRTA 3Q3EA 3LDGA 1MEOA 1S3FA 5FUMA 4QX6A 4WOJA 4AUKA 3JAKB 1DXOA 1RNLA 4J6FA