2A1TS

Structure of the human mcad:etf e165betaa complex
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
248
structure length
239
Chain Sequence
ELRVLVAVKRVIDYAVKIRVKPDRTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEVIAVSCGPAQCQETIRTALAMGADRGIHVEVPPAEAERLGPLQVARVLAKLAEKEKVDLVLLGKQAIDDDCNQTGQMTAGFLDWPQGTFASQVTLEGDKLKVERAIDGGLETLRLKLPAVVTADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPPTTEDLVAKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl-CoA dehydrogenase, medium-chain specific, mitochondrial
publication title Stabilization of Non-productive Conformations Underpins Rapid Electron Transfer to Electron-transferring Flavoprotein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/electron transport
total genus 59
structure length 239
sequence length 248
ec nomenclature
pdb deposition date 2005-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01012 ETF Electron transfer flavoprotein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2a1tS01
1J21A 3K9WA 3SEQA 4QREA 4XSVA 3IOCA 1N75A 3QTTA 3VGJA 2QTNA 2A1TS 1LI7A 5TGTA 2B7LA 4AQ7A 2XRZA 2H2AA 1X8XA 4DDHA 5K0SA 4GRIA 2JAXA 2YWCA 4CDMA 2E21A 2QUHA 1O97C 2Z09A 4MQ6A 3ISJA 3PNVA 3CR8A 4G5YA 1TYBE 2WSIA 3FG9A 4MLPA 1CT9A 1Q15A 3QTBA 2YWBA 1DNPA 4JFAA 1A8HA 3CVXA 5KHAA 4EG5A 1QU2A 4DNXA 1H3NA 2YY5A 4MW4A 1V8FA 4ND6A 1K4KA 1O94D 2JANA 3H97A 3SZ3A 2WB2A 4KPUA 2CV2A 2E89A 3N2YA 1PFUA 3INNA 4U63A 4EG1A 5IHXA 1O96A 3AIIA 1TQ8A 1I6LA 4MUEA 3S3TA 1N2IA 2QUJA 1F9AA 1HYBA 4S1OA 4CQNA 1WXIA 4DJAA 3MXTA 3VU8A 1ZH6A 1GN8A 4MVCA 1U3CA 4MWBA 1JMVA 2A1TR 4YBRA 1H1TA 4NAHA 2DETA 3TNJA 1MAWA 3DO8A 2O8VA 1U3DA 1QQTA 1MAUA 3MLBA 1NYLA 1ZUNA 4FZJA 3IODA 1NSYA 3KFLA 2PG3A 4QBTA 4ZT6A 4EG7A 1J1UA 1YIAA 2RE8A 4MUNA 2QTRA 2ZP1A 4AS1A 4R2LA 1JIIA 3DPIA 2D5BA 2DUMA 1EUYA 3IOEA 4L2IB 3N8HA 5H16A 3NV7A 1OWNA 1ULHA 4OUDB 1MRZA 1MB2A 3A04A 1KQPA 3IH5A 4KR7A 4X0EA 1U7DA 1YUMA 3PNBA 1N2HA 1FYDA 2A1UB 1KAQA 2E18A 4MUGA 2X0KA 1KQNA 1XNHA 4XFJA 3ZIUA 2D54A 3FWKA 3CLTC 1I2DA 1SURA 1KKUA 1N2BA 4PBRA 2PZAA 2VXOA 1EFPB 1MJHA 4HJXA 1GTRA 3I05A 4EG4A 2BYTA 2IP1A 2GM3A 3GLVA 1G8GA 5J5AA 2OV4A 2ZUFA 2VTBA 1MOPA 5FO0A 1WQ4A 3P52A 1QRUA 4MW5A 1OWPA 3HGMA 3TS1A 1WXHA 4P2BA 3UY4A 4Q16A 1MBZA 4K03A 2DXIA 1JZSA 3AFHA 4OJMX 3KT6A 1O95C 1Q11A 2CUZA 3GMIA 3MUEA 4KKVA 2IJGX 4RPIA 4MW2A 2J08A 3E27A 3G59A 1QRTA 2DPLA 4MWDA 4ZT7A 3CLUD 4ZCPA 1IVSA 4ZT3A 1QTQA 1KH1A 3COVA 3CLRD 4F4HA 2XRYA 3IVXA 4I6GA 4ARCA 1EE1A 5K0TA 1NURA 3D6UA 1XJQA 3SZGA 4PBTA 4NDAA 3ELBA 4MVWA 4MW0A 2O5RA 1EFVB 1KORA 3DV2A 4R2MA 1M83A 2CV1A 5LFAA 1JECA 1WZ2A 2WQ6A 3SP1A 2DERA 1YIDA 2HMAA 1KH3A 1NUPA 1N2JA 4JXXA 1P7PA 3C8ZA 3CLSD 2J07A 1TYCA 4ZCSA 2QUKA 1ZJWA 1F7VA 2OQ2A 1TYAE 4KR9A 2G36A 3UOWA 1N78A 1GAXA 5H7XA 3MLAA 4UZFA 4ZT2A 3Q12A 1F4LA 2EJCA 3Q4GA 2HZ7A 4MUHA 4ND7A 4KR6A 4YMIA 3MMXA 5TEWA 1O94C 3LCJA 4MULA 3HMQA 4MVYA 2DLCX 3COWA 3IMEA 1WOYA 3NBKA 4NZPA 3TZLA 2HGZA 2ZUEA 1JIKA 1XNGA 4MUKA 1IRXA 3F3MA 3ND6A 1NUQA 3KT8A 4NX2A 1QJCA 5HG0A 1IH8A 1IHOA 2A7XA 1OWMA 2Z08A 1U7XA 1M1ZA 1KAMA 5KWVA 3IVGA 2J09A 1IQRA 2I1LA 4CT0A 1K4MA 1KP2A 1LW7A 3ZJUA 4R0NA 1JZQA 2J4DA 2CYBA 3IUBA 1T9GR 3ND7A 1NI5A 4KPUB 5DK4A 5AHWA 4EGAA 2PFSA 1T6XA 1VBKA 3CVWA 1O96B 2V0GA 3A2KA 1NUTA 3OP1A 3DLAA 3SEZA 1M8JA 3G6KA 4WSOA 3QE4A 1COZA 4YP6A 3UC5A 1WKBA 5BNZA 1S4MA 4HPWA 3FNRA 3A4IA 3TZEA 1PFWA 1IFXA 3K32A 3ZJTA 1PG2A 4PY2A 3KT0A 1G8HA 2X1LA 3FIUA 4G6ZA 3H9CA 3L93A 4U8HA 1EUQA 1JIJA 3COYA 4MW6A 4GU5A 1N2EA 3P0IA 1TFUA 2PIDA 5DB4A 3TQIA 1KQOA 1IQ0A 1NP7A 3LOQA 1N1DA 4ARIA 4JXZA 3D6VA 4DDKA 3HZRA 4J75A 2QJTA 1TEZA 2C5SA 3H9BA 2R5WA 3HFJA 1H3FA 3IUEA 5TEVA 2CSXA 2CFOA 1XNJA 1GZUA 4EG3A 4EF6A 1ILEA 1WJGA 4J76A 4QRDA 2H29A 2PZ8A 1D2RA 3VRHA 3H99A 1JEEA 2DEUA 4F3RA 2A88A 3G5AA 4U7JA 4JYZA 4NATA 2EL7A 4XFDA 1YULA 4TS1A 3ZJVA 2GKSA 4Q93A 2D13A 5DEOA 1R6TA 3PXUA 3U1VA 3ZUGA 1EJ2A 1R6XA 1VLHA 4MW1A 3OTWA 3AKZA 5J58A 3FY4A 1G8FA 4MUJA 3FI0A 1IQUA 1I6KA 2CYCA 3AG6A 4I6EA 1J09A 3CLUC 3RK0A 1VBMA 1O97D 1JGTA 4HJRA 1WXGA 1PFYA 3CLRC 5FO1A 3RHSA 2VTBB 1PFVA 4ZCTA 3UMVA 3AL0C 1M8FA 1R6UA 5EKDA 1T9GS 1M8PA 2IELA 2PZBA 1TYDE 2AKEA 1BS2A 4A91A 1JILA 5LLTA 5HUHA 3HV0A 1OWLA 3N05A 5J59A 1N77A 3FHJA 3Q10A 1T6YA 4DE5A 3N9IA 1T6ZA 5JBNA 1J1ZA 2PXHA 4E1AA 4DLPA 3FETA 3X1MA 1OBHA 3CLSC 2CT8A 2X1MA 1WY5A 2CV0A 2NZ2A 1NZJA 3AG5A 1M8KA 1Y42X 2X3FA 3RBAA 1Q19A 4WNYA 1KP3A 1UFVA 1J20A 3BL5A 3RJZA 4MWEA 5KCMA 2A4MA 1JEDA 2JA2A 1K97A 3UK2A 2AG6A 1B6TA 1X6VA 2RD2A 1F7UA 3X1JA 1KH2A 1QNFA 4CDNA 1NUUA 4L2IA 1WXFA 4OUDA 1I6MA 5IJXA 3IMCA 1OD6A 3X1KA 1EXDA 4MW7A 2QJFA 3SDBA 3FDXA 3CVVA 4UZEA 2A1UA 4EG6A 1WXEA 4NAUA 3RFFA 4ZCQA 1ZH0A 1KR2A 1LI5A 1EFPA 4MUFA 5TS2A 1O0CA 1YI8A 4YP7A 3RK1A 2GOYA 1O0BA 4PBSA 3PNYA 3SYTA 3M5WA 5DASA 2QJOA 3ND5A 2CYAA 4ZCRA 1QRSA 1PG0A 1QU3A 1FFYA 1N2OA 1VBNA 1WQ3A 2BTEA 2AZXA 3ZGZA 1N3LA 2E0IA 3CA8A 1GPMA 4BWVA 1J70A 3IDFA 3IOBA 4MWCA 4EFKA 4MUIA 3CLTD 2TS1A 4K0RA 3CVYA 3COZA 3KT3A 1OWOA 1G59A 1YUNA 4EG8A 1Q77A 2J5BA 4ZT4A 4I6JA 3CVUA 3NBAA 1MB9A 2YXNA 3L92A 5F23A 4JZYA 2V0CA 3ZXSA 4HK4A 1VL2A 1RQGA 1GLNA 5FNZA 3GUZA 1MC1A 3IVCA 1H3EA 2A84A 2NSYA 5HUJA 3HL4A 1EFVA 4MW9A 2A86A 4H3SA 1O95D 1M8GA 1JHDA 1OBCA 3H05A 3PRHA 5LM3A 2WQ7A 3LE8A 1NUSA 4DDMA 1GTSA 3JXEA 4RUKA 1O5TA 2QTMA 1K92A 1O6BA 3A05A 3P0JA 4MAFA 4YP5A 3FH0A 4MVXA 3ZXIA 1U0BB 3ILVA 4G5FA 4ZT5A 2Z3VA 3P0HA 3TQOA 1V47A 2QUIA 3IMGA 1N2GA 2DR2A 3FOCA
chains in the Genus database with same CATH superfamily
3JQFC 5DHSA 4W1SA 2DM6A 3OJEA 1Y6ZA 3H5IA 3R4VA 1IOWA 3K0FA 2OG1A 4CTJA 1W5FA 4HLQB 2PX0A 2QX7A 1DBQA 1PEAA 5HUQA 2VPTA 2FQXA 3KCNA 3D4OA 1X8XA 4MKHA 1EFUA 3IRUA 1F4VA 2IWHA 1Z8HA 1A5BB 2EIXA 3EPPA 3OPYB 3HBLA 3R3JA 3GNSA 3QOWA 3F3SA 2PJUA 5AW6A 1GNPA 1SR8A 1DMSA 2CHVA 2QSYA 2XJ9A 3AGPA 3OT4A 4U02A 1P3JA 2ERCA 3ZLUA 2X2EA 4A92A 4EHDA 2HK9A 2PS1A 2V7XA 1KFJB 2UU9B 3EUFA 1XPRA 1D2MA 1VG1A 1T26A 5REQA 2HU2A 2PANA 4JT9A 1L3IA 4YCAA 5SICE 3IP6A 3C98A 1XZMA 4P3XA 4PXYA 1I7PA 1Z07A 2H4WA 4HLCA 5EP1A 1T8UA 4LJSA 5K7SA 4XLLA 1IBRA 1YBHA 4B1FA 4LX0A 3W05A 5JJ5A 2B61A 2Q3BA 1H3NA 2XUHA 1SEPA 4B6FA 3G2JA 1S02A 1CRZA 3EIHA 1L7AA 5EWMB 3F8TA 5A5EA 2PMEA 3IPCA 2OOSA 2AYXA 2CN1A 4M38A 1EX7A 3TOVA 1EB8A 1LFDB 1P62B 4IEIA 1RAGA 2IEGA 4U63A 5JSZB 2DLNA 1K88A 4GOLD 1O96A 3PGKA 4YIHA 1BFUA 2ZYHA 1TTHA 3SY8A 2JCXA 2P6MA 2QTZA 2GBPA 4MUEA 5ADUS 5HIKA 1POXA 1F9AA 2O7NA 3L8HA 3M4YA 3MQ2A 4RZ2A 4N6NA 4B83A 1WW3A 2OUIA 1R4ZA 2HKIA 3IOYA 4KACA 4NCXA 4PPFA 3HHEA 1PT9A 2YFKA 3BZWA 3QE2A 1P0IA 3K73O 2Q3DA 2XH8A 1QP7A 1OFHA 4QGAA 3CRVA 2AFIE 4MRRA 3GA0A 2NP7A 1BD4A 1FLAA 3PDCA 3O6VA 1NATA 3EZ2A 4JI1B 3R5FA 4O4HB 1N2CB 3TJMA 1CIVA 1AOXA 1EM8B 4M0EA 2ZFUA 2XIQA 1W88A 3OZCA 4L22A 3WKBA 4DMFA 2CDNA 4HADA 1H0KA 2BT4A 1BW9B 1U5CA 3LNCA 3PUKA 4F2PA 3LFUA 5FAXA 2PBLA 1XV5A 3ESRA 3E5RA 4RMHA 2MT9A 1T4CA 2B8WA 4L85A 5EJ2A 3U4HA 4EF4A 5D51S 2UDPA 4FYIA 3LYAA 4II7A 2V7TA 4XJSA 5GM2A 3TJZA 3UMGA 1J1UA 1ZKDA 4R5MA 2JGKA 4M9XA 2VCEA 2HWWA 1W52X 3HVKA 2H11A 3HYLA 1KDZA 4EVQA 4CKBA 1MN6A 3M3HA 1VJRA 1G1MA 3GYBA 3DL2A 1FCJA 2AOTB 2PIAA 2BKEA 1X38A 4BTEA 2CFCA 5GIOE 1ENYA 2RFLA 4EJ0A 3THRA 3F7MA 5A02A 1U6JA 1C3LA 2D4AA 3F9IA 4H7JA 5C5EA 2JFUA 1DP4A 4QSHA 4KJXA 5H16A 1OWNA 1OXXK 4PXSA 2X5NA 2BKUA 1FP7A 1N0VC 3IEUA 3OPVA 4HWOA 4M8LA 4N5DA 3OZSA 2W6ID 4M0LA 4B4KA 3DMDA 3TSZA 2LE0A 2APJA 3CH7A 1TVCA 3PYXA 3SJUA 3KAQA 3KKPA 1MAAA 1PUIA 1D8TA 1QRRA 4X6XA 4DLVA 4MH0R 3ZTWA 1PSWA 1WTCA 2UV8A 4RTRA 5DVZA 3R77A 1X1RA 4GO1A 4WZBE 1ITZA 5CM8B 4B40A 1IOZA 5CBPA 4XD7A 4EJ6A 4TWRA 3WAKA 5TLSA 2BTOA 3AHEA 4JL5A 4JYCA 2R44A 4OQNA 4UUPA 2P0EA 3KPUA 3PUJA 3FWNA 2V97A 1MOPA 4W8GA 3HVHA 3L5OA 4WV3A 1XZJA 2YMQA 3DEZA 4GP7A 5IJ9A 3RARA 1EQAA 4AC9A 3QPAA 3TLBA 4ZDJA 2CBGA 1U0FA 1FNNA 4D8TA 2DX7A 2QIOA 3E61A 4GXRA 1K7SN 3TZHA 1QCZA 4TS4A 5BN3B 4QUJA 1E6UA 4HWGA 5C7IO 4URUR 5A2GA 1OVMA 4GH5A 2W58A 3WGNA 4B6OA 4KKVA 4AAYA 1YI1A 2OO3A 2QPOA 3KR0A 4CKWA 2C5EA 5K3EA 1T3ZA 3WL3A 2Z2IA 3G59A 2W22A 4EHHA 4EQ6B 2OBLA 4IJ5A 1NDUA 2UVDA 1SXIA 1ZBQA 4URWR 3JQPA 3ANLA 5AVVA 4GQIA 2QSZA 4JHLA 2G25A 2ZJOA 1ZK3A 1P8JA 4Q7LA 2DWUA 4UVEA 2Y1WA 4EA8A 4S1NA 2G5PA 3L7KA 2Y9MB 1Y9EA 4R54A 3CM0A 5JYEA 1FDRA 3CTPA 1NURA 3OX4A 1AUOA 3EEIA 4XYEA 5IBQA 5KDLA 3UJNA 1ZJJA 5TRTA 1F2TA 4Z49A 3ELBA 1T3TA 3GBVA 5KNCH 1DTEA 2JGDA 2O5RA 3I1JA 3Q7TA 4NDZA 1XD2A 4XXHA 5KKNB 2WQ6A 3RSQA 1SHUX 3QKSA 4BQRA 3C15C 1MH1A 1MO6A 2ZRQA 2W6CX 1XZCA 3U7QB 5CG1A 2PKYX 1AZLA 1CY8A 3U16A 3AH8A 1GZ5A 3DHEA 3SSAA 2IYWA 1N5RA 4FXOA 5U9CA 4AJNA 5CIYA 4LNHA 3V8VA 4ARZB 3QI7A 1EP9A 2EX1A 2BGRA 2XXAB 5H7XA 3N5KA 1CRLA 4LF4B 2X2OA 3FCAA 1TZ2A 1HFEL 4ND7A 3KHUA 4AMBA 3PR2B 2ANCA 3SJ7A 5JZ9A 4FFBB 4G1FA 4IHKA 3HWRA 5YASA 2PAAA 3GZ4A 4AM8A 3I9V1 4YJFA 1P7WA 3PCRB 3ZZUA 1QHFA 4P84A 4KWEA 2CCJA 4GEKA 4KQHA 4OPMA 2Q5FA 3AY7A 3ICWA 4NZPA 3U3OA 1NG9A 2P5SA 3GFRA 2O05A 5I7AA 1WMAA 3GRYA 2FPSA 3K7EA 3K72B 5A4FS 3ND6A 1JTVA 5DZSA 5J40A 4ALKA 5TPZD 5T4HA 1KAMA 3DKIA 3L01A 2CXQA 3QG1A 2PHZA 3JPYA 4HQLA 3KC2A 3T7TA 4QULA 5FTKA 2IUFA 5H8WA 4JLJA 3QKRA 1LLDA 3ZI0A 4EKGA 1XZPA 4Q3OA 3RS5A 4A9AA 2PUVA 3GJ3A 4KQIA 4U0JA 2O2YA 4JXKA 2GCEA 2HA3A 3SN6A 3G0BA 2OHFA 2P2ZA 5ALTA 4ZWNA 2IDJA 4RHEA 4N76A 2XE7A 1T6XA 1KSGA 5FYQA 4BNWA 4KXXA 2IKQA 2J7KA 2HQ1A 4LRXA 1GZDA 3DLAA 4WCDA 4X1KB 1DIAA 3K16A 4II3A 4WOKA 2XF8A 5KREA 5TMDA 3T4UA 2AKYA 5CB4F 1T8RA 1PS0A 3V7YA 1Y4ZA 3EXEA 1MX5A 2OO5A 1OROA 2WM9B 4JMLA 4KO2S 3BFPA 1TK2A 1CDDA 2AMVA 4XI9A 4LWQA 3K5IA 3D5QA 5D5QA 4ISBA 1RKQA 4XPIA 5JC8A 2IIPA 2FMIA 4LJRA 3TUIC 2WB4A 1B0ZA 2XVAA 3GPBA 1BXGB 3OCUA 5LBUA 3W1EA 4JJAA 3C0KA 3QNUA 3EVNA 3LPAA 2FWRA 3GGCA 3KUXA 4FOLA 4WL0A 5CB4A 2ZWVA 4AUEA 1N9GB 2OHVA 1GNSA 4E11A 5ELLA 3ER6A 1H4TA 1ECPA 1M2JA 2R86A 1NP7A 4YAWA 5K45A 1E9SA 2BI7A 3KO8A 3SKXA 3O9MA 3G7NA 2QM3A 1JX6A 1R9JA 2PSFA 3ZE0B 1F3OA 5HRCA 1WEHA 5DPMA 4EH1A 3SYKA 1R8YA 2HM7A 4V0SA 5EG5A 3ERCA 3FUVA 3GRPA 2CFOA 1DIRA 1TZCA 2LKDA 3WXMA 2BDTA 1MB0A 2R8XA 2GHRA 4KQGA 1NBEA 4X6YA 5J63A 3VYUB 1H2RS 2CFRA 3A2MA 3CZMA 4FFDA 5FOXA 3SLKA 4TVBA 2AC4A 5FADA 2X0FA 4CL0A 3NT5A 3ULKA 1Q1QA 3NXSA 3GY0A 4G9BA 4U7JA 3SYNA 3QXJA 4DEYA 1ZG3A 2OLEA 3CLVA 3VI4B 2W83A 2PKQO 4R83A 2NUPB 1WABA 4ZMSA 4UDNA 3PX7A 2G4CA 4FFLA 5HA5A 4LYDA 3KP1A 3PPIA 5L3QB 4DBLE 1DWPA 1Z38A 4RZIA 2VTBA 2HU8A 2HREA 3EAFA 1ACJA 4GICA 2WWIA 3RSZA 2AK2A 1L4MA 3LBAA 4PNHA 1KE2A 3VV3A 3VO9A 3JW8A 1G8FA 1BE1A 1SKYB 1U8FO 2H4YA 3BM5A 2DYKA 3RK0A 4BQIA 3GNQA 4G07A 3LXXA 3B1JA 4C08A 3I6QA 2JC3A 1SC9A 2J3QA 4NNPA 4C1BA 3FCYA 3FYUC 3SZMA 3DB2A 4FHCA 2WJYA 5L8VA 1QH9A 5F1PA 3PEEA 3EFOB 1LBTA 4TSFD 3HLKA 1Z35A 1MW9X 3TIVA 1K0FA 1YCFA 3AXSA 1BS2A 1ZUD1 3VR3A 1A1SA 1QYXA 4K9DA 4F4IA 4L16A 5T6BA 1JI3A 4IF6A 3NHUA 5E9WA 3OJLA 1K5GA 4A6EA 3FMGA 3EXAA 4DE5A 3ZK9A 2WF8A 2X77A 1E6CA 1F2DA 4ZCLA 2VRWA 4LISA 4DLPA 3FETA 5AW7A 2XUDA 1J4AA 4AJHA 4G5SA 4XRGA 2C57A 3K3PA 3KYJB 5LUBA 2EFJA 4QD3A 1S2MA 3OSUA 1E7QA 1Y8AA 2D5IA 4JLSA 5DULA 3WYCA 4DFDA 3OZFA 4C43A 3CTMA 1Y42X 2F4NA 3IR6A 4QFBA 3T7JA 3PEYA 1ZD2P 3LPDA 1ID8A 1J2EA 3BL5A 3CW9A 4MWEA 4LYHA 4HV4A 3O4FA 4OXRA 5KBYA 3U4QB 1ZJ4A 3KQSA 2N0SA 2RAVA 5D84A 4BCBA 2RJNA 3ZKWA 3JYPA 2WMNB 2OO7A 1P7CA 3PEVA 5IG2A 1FTYA 2DRIA 4P08A 3PCXA 1JPNA 2R85A 3U61B 3OU2A 4A03A 1UFKA 2EV9A 3S7TA 1G8YA 3K15A 2J0VA 3WV5A 1G2QA 5B1HA 4ENTA 3ODPA 3GUVA 4RIHA 1KIMA 2R8PA 3AFMA 3MINA 5AKLA 4GKJB 4PR0A 2QRJA 3O8QB 4ILKA 1GR1A 5GTDA 3U3MA 3VC7A 5G1PA 3GPDG 4HNAA 4EG6A 3DO5A 2D00A 4DTCA 4OAPA 1TJ3A 1UOQA 4PSAA 3NCHA 5IAAA 5JD5A 5B4UA 2NVUA 1IDOA 2P7IA 2NU6A 4Z4HA 3DWGA 5A0TA 1SCJA 3EA4A 4K9PA 3PD0A 5HJ5A 1G8AA 4YHBA 5AKZA 2QG6A 3L7MA 1RWVA 4QXRA 5DT2A 1FLNA 1J0DA 3SE0A 1UC5B 1WRBA 1YI8A 4G5RA 1U1EA 1P4SA 1O7JA 2AD5A 3C97A 4DPLA 1NJSA 2VAVA 1R66A 4ZCRA 4LF8B 1ISGA 4PZEA 1J99A 4NONA 1N2OA 4DPMA 3EXHA 5EWJB 5FPPA 7YASA 3R3UA 2WA1A 1YBAA 3MTDA 4EAAA 5LQNA 2ZZKA 2JIPA 2W6PA 3CX4A 3ELYA 4MUIA 2I34A 3DW1X 4QJ5A 5JVDB 621PA 1SELA 3HCRA 4XJTA 4Y2XA 1X7ZA 2HXYA 2ZXEA 5F7JA 3VR5D 3KT3A 2FWBA 1KOJA 1U0NA 2JB9A 2ZRAA 3OKCA 3TQFA 2I8LA 2CHUA 5C8YB 2VOEA 5HSGA 2K87A 3PWTA 3ID6C 3EWIA 3N7UA 2LNDA 1NJ2A 1MB9A 2OCGA 3AM5A 4OXKA 2WUGA 3B2NA 3G82C 5KOYA 2QN2A 2OZPA 3DCIA 1X74A 2ODNA 4G0OA 1V0JA 3QX8A 4ND2A 1X1TA 2QTVA 1SKMA 1GLNA 3GUZA 3H4MA 1B26A 3W5AA 1HTBA 4PG4A 1CY7A 1DTWA 1V43A 2EBWA 2BEWA 3BKXA 3DE5X 1ODTC 3IVCA 3NKVA 4QDTA 8OHMA 5CX1B 3HXOA 1J2YA 1C1XB 1UT5A 5CYOA 1XWWA 4Q4AA 4OX9B 4M0CA 4KAFA 2A86A 2PX8A 4H3SA 2CL6X 1FYEA 4RFSB 4ZAZA 2ZITA 3H83A 4JBWA 5EMHA 2YJTD 1MO3A 4IDOA 2J0QA 2ECPA 3DFFA 4IV8A 1HZZA 1OAAA 3W5HA 3WYBA 5FOVA 3B82A 1O6ZA 2ZTHA 3DC7A 3NC4A 3PF9A 3QUSA 4FYXA 4RUKA 4U7WA 4ZO9A 1B8VA 3OPYI 5IPFA 1P1FA 1TVMA 5BSTA 2KJQA 3H5LA 4QOHA 4OJYA 2QL9A 3L1KA 2WWWA 4KRYA 1XIVA 4MYHA 5FPSA 4C0SA 5I8WA 2ZAIA 2XCSB 1ORIA 2B35A 2FW1A 2WUEA 5IT4A 3LP5A 4OLBA 1O8CA 1VHTA 1AZTA 1TQ4A 1P4AA 3GFQA 2BIFA 2VDQB 1X94A 1Z0FA 1F2VA 3QTTA 2PMDA 2VZ8A 3HO1A 1NHGA 4I50B 2P75A 2OB1A 1TAGA 2HMUA 4NFLA 4B74A 2FN7A 4K3VA 4DNPA 2QP4A 2XWPA 3B9RA 1YVDA 4M60A 1X87A 5KNBA 2E4YA 2ZIXB 1DAOA 3E18A 3II6X 2HUNA 4NMWA 4XX0B 5IABA 4BVEA 5TT0A 3P9QA 1IVYA 4EFDA 1X7HA 2X7JA 3AF1A 3IVMA 2JZNA 421PA 3QJGA 5KC9A 4XIGS 2FEWB 1W85B 1I33A 4AUKA 1ULBA 3G2LA 3BN3A 4LSWA 2IGBA 2YWBA 1CR1A 3TZ6A 3WR5A 2PBFA 3O8OA 5LA6B 3GLSA 3AKCA 3R44A 4NCAA 1NJ1A 2RC6A 1Q17A 3CPJB 4ON9A 2L19A 1N6HA 5JXJA 3L8EA 1F4PA 3LT5A 5G3ZA 2WAYA 1E2FA 5HE9A 2Y2UA 1XJCA 4D3DA 3O1JC 4NULA 1N3BA 2DU8A 3TTVA 3WIVA 1ISPA 2JANA 3ZXUB 3ZJVA 2WB2A 5AJTA 5A5VA 2G67A 2QT1A 3KL2A 4JB0A 4OB8A 9GPBA 3QUCA 2V03A 3AR2A 1DFHA 5HX7A 2WNIA 3DTVA 5E4YA 1ZKMA 2XA1A 5B1EA 1TVEA 5A5FA 3BA1A 4CMKA 2J4CA 3V97A 1NLFA 1GPDG 1EGHA 4J16C 1JR3A 2JJ2A 4QUBA 3TNYA 2B4KA 4QHYA 4V38A 1U0LA 2AS0A 3ZDFA 5K0ZA 2GX6A 5B58T 3ZH9B 5KUTA 1UFQA 1KEVA 1JQJC 1KDVA 3RUEA 4XPZA 1IEVA 1NNEA 5BQPA 4ZVMA 1JMVA 3B3AA 4ILEA 4UEQA 1H1TA 3WQRA 5AQEA 3GCWA 2Y8EA 1KIFA 1LJLA 4IX9A 2R4QA 5DK6A 2WV7A 5KQRA 1XZDA 2G4VA 2AMYA 2H4HA 3OZAA 5JO0A 4IDBA 1EUDB 3BWVA 3QVJA 2RGEA 2VWHA 3NT4A 4QSMA 3C3DA 3A6HA 3EGXA 1TUBB 2HNKA 3IODA 3W6NA 3BMXA 5KSYA 3KFLA 1R1DA 2F62A 3AZPA 1GUAA 2QUAA 3KTFA 1NT2A 4FWBA 4HGYA 4L0QA 5G0UA 1JMKC 4RKWA 1NI4B 4NP6A 1IY8A 4ETIA 3R41A 1DJMA 4BMPB 1QGOA 3DBRA 4Q3DA 4ECAA 3B6MA 4V2UA 3IVAA 4X7MA 4BIMA 5KTKA 3VVBA 3IBYA 1E1CA 1S5PA 4FGZA 3T7SA 2DUNA 1FTWA 3EGDA 2H57A 2ZI4A 3GLIB 1YQXA 4ZHQA 4ZU6X 2YS7A 1QHEA 5JNRA 1XRJA 5LP1A 1GR0A 4O5OA 1SBTA 2NNLD 3ZGOA 1S2NA 5E95A 2QVXX 2C3MA 2H7CA 5A9TA 4ZK6A 4DREA 3QFRA 1MRZA 1PDWA 3GQBB 5K6AC 4MGKR 1PT8A 1R0WA 1V6SA 4JL8A 2VDLB 2XXBA 2BFAA 4Z7OB 5FBLB 2NZVG 1OLSA 3DOJA 3WLPA 2D54A 4HQRA 5F5NA 5CJ2A 1SXJE 4DR7B 4EPWA 5BWCA 3I73A 4LC9A 1KKUA 3Q3IA 3CH5A 1GGKA 4RPJA 4BEJA 1EFLA 4ND4A 1ZK2A 2W2LA 3H4IA 4UVGA 1H0RA 2EQAA 2Y1GA 3SM3A 2QNIA 4YR9A 1SXPA 3ER8A 4XVHA 1MFPA 2DBVO 2I4LA 3MCZA 4KC0A 1HFJA 4HQOA 4PCVA 4YDRA 4H35A 5AD1A 4YRGA 2WE8A 1QKKA 3K1ZA 2RGWA 3DFIA 4ENWA 3GUCA 3TRKA 4LZOA 1NR7A 4AUNA 5JZOA 3FVTA 2HK7A 1CIJA 1KGSA 2B34A 5CHEA 5MFPA 2B3TA 2FZLA 3EXIA 3U9TA 5A1JA 4TMTA 5LPNA 1Y6JA 1P2TA 1KPGA 3TB6A 5EOVA 5EHZA 3DOCA 5CB0A 1ZQ9A 3NH6A 3ZWNA 3PEFA 1T9CA 4BVFA 5CLJA 1MFZA 2QLBA 2HTEA 3LFHA 4KAXA 4YAEA 4BVKA 2JJQA 2KWIA 3LAWA 2AJLI 2FA9A 4OJMX 2J45A 3KQHA 7REQA 3OM9A 3AJEA 5C51B 4PG5A 3OIWA 1CJTC 1RWPA 1XDSA 5IC6A 1LBEA 1IYZA 3PNKA 1IBSA 4OLJA 3UQZA 2B36A 1W5EA 4R8KA 2ZT6A 4OI1A 5HQTA 3WIEA 3R7SA 4MWDA 5JNSA 2Z5VA 1TCCA 3QVTA 3UCEA 3VX3A 1AO0A 2DSTA 1GN9A 5J5VA 1ZGHA 3BDAA 3V3KA 4BO1A 4ZYLA 3ZY2A 5D5PA 1I6WA 2JS7A 1FYVA 3VJLA 4A15A 1P44A 3P2IA 2FPIB 3FIJA 3CG4A 2VJYA 2YOFA 1JXAA 3D6UA 4P22A 2WJPA 3L0PA 3AQIA 1QS0A 4MYTA 4DQXA 2X2FA 1ODJA 2NOAA 2VATA 2XGMA 3VOSA 1U7TA 1DL5A 1JIXA 1NSTA 1ID1A 1C0LA 1HT0A 1XLWA 3FJOA 2PH5A 1M83A 3HZOA 3JATB 4NU0A 2ZETA 4QJIA 1I1NA 4ZZ0A 3NO4A 3PX3A 4XTCS 2X9LA 1T3SA 3ORSA 3F4BA 1X39A 4MLZA 3E2MA 3AI1A 3L6DA 4J7CA 4UE3S 5ERGB 4IW3B 4Q6WA 4YWHA 1OAOA 2QTBA 3NHLA 1L6RA 1B8OA 5KMGB 2JAUA 1T2UA 4YJ2B 2OBYA 4C30A 3U3ZA 5C53B 1UH5A 1Y1SA 5IASA 5K3OA 5CLHA 2O8CB 1ZJWA 3ZR4B 4CT5A 4KYTA 3PC8A 3QLVA 5F3DA 3L8GA 3U4MA 2YINC 2YIJA 2NSJA 3W5IA 3GPCA 3PK0A 4PYLA 4D9FA 4UEKA 2RC5A 1WOMA 5KJ6A 1NN5A 2XE6A 1YFJA 3MLAA 4EGCB 3KPVA 3VR6A 1EJ6A 3O03A 4QOJA 3EA5A 2Z4RA 4MUHA 2ABWA 5MHTA 2WYWA 5TEWA 3LUHA 3AV0B 1MP0A 1PNVA 1OLUB 1NZDA 2J5XA 2QRVB 2YHIA 1BJTA 4MULA 4FYVA 4PG7A 4BGIA 1K8RA 4L57A 4ENQA 5IVKA 2A0KA 4IR7A 3W8EA 1F6BA 1X86B 1RE0A 2Z9BA 2QLLA 1ZNWA 2WVHA 4RZHA 4EPTA 2DKFA 5CT4A 2Q0HA 1XNGA 5CT6A 2IGTA 3G6WA 3F3MA 1GUYA 1NKTA 1KARA 3OPQA 5HG0A 3EEYA 4WGFA 1IH8A 1SUWA 3DZCA 1OWMA 3HEMA 2INGX 1SU6A 2WSLA 3OBIA 4DR2B 2XY4A 3NWBA 2B0CA 2PR2A 3R2JA 5G3YA 1WZEA 1KOLA 3JCZA 1P5RA 4DV2B 3GC6A 1VGRA 5CH3A 4BEVA 1W0KD 5E8RA 2CC2A 5BYKA 1QHNA 5CB6A 2RJOA 4PVDA 3Q3JB 3UW3A 1Y5MA 3ZJYA 4JI6B 1Y33E 4R1SA 3QVGB 5BN5B 3ND7A 3UV3A 4BGEA 2GF0A 2XQFA 5AHWA 3SHOA 4Q1VA 5DGCA 3WRVA 3ZOZA 3N0TA 4A8JC 3M0EA 2FH5B 4N01A 5CXXA 3CVWA 2P77A 2V65A 3P9CA 1AURA 2TRSB 1X7YA 1XT6A 3GDHA 4DNQA 1Z0ZA 4LHSA 1XF1A 1U02A 5ECYA 4EB3A 4F7DA 1A4UA 1D3AA 4QNRA 4D0NA 3NZEA 1S4MA 3SIWA 3USES 2R25B 3OWHA 4H6PA 4CXMA 4Y6GB 3M4XA 4OBBA 3JZFA 2CY0A 2WD8A 4RDIA 4WVLA 4OHPA 1G55A 1DX6A 2C94A 3R3SA 3Q2OA 1RFLA 2GUWA 1HNZB 3D8UA 3F3YA 1CQIA 3OF2A 4KI7A 4BVLA 1N7IA 1BD3A 4JJ7A 5GZ1A 3T1YB 4CM9A 2Q41A 3UKOA 4O4IB 3NIWA 5GVRA 2IXAA 2HIHA 3HVRA 2IEYA 3TW6A 3DUFA 4CGZA 4RPLA 1PS8A 1L5FA 2F00A 2B2NA 1ONPA 1QVAA 1G0NA 1KI6B 5KYNA 4UCFA 2AWNA 4CEJB 4LDRA 1W9MA 1MX3A 4BJ1A 4P54A 3THXB 1GGHA 5FQOA 1YOVA 5LU8A 1Y7IA 3OQIB 2YC2C 2FW8A 4C3VA 5GOTA 3BCRA 3UK6A 3ZHOA 1JJ7A 4WRRA 4EO7A 4R41A 4YRIA 3KDPA 1G7TA 4BQOA 1JDSA 3A1EA 1T29A 2QRZA 3UT5A 2ZZNA 1LW6E 5J2UB 1AK2A 2MWMA 3GCZA 3UGKA 4BVJA 4FYWA 2FSIA 1CNFA 3IESA 3NDBB 3I01A 3U31A 2D4HA 5LOVA 2BSQA 1RMQA 5G02A 1YR6A 2VJMA 2PN1A 1JNYA 1Z7BA 2FVXA 3IT3A 2WVAA 2Z8YM 1JH8A 4RENA 3U3DA 2O20A 3UPUA 5B53A 1A9YA 2VDUE 6GPBA 3A1CA 4RJJA 2GBCA 1SA0A 3QQ5A 4BFXA 2Q49A 2A0WA 5D6OA 3HADA 4CQMB 4L76A 3RVRA 3OWXA 3CNNA 4XYLA 5THQA 1E1LA 3ZV5A 2ZRIA 2JJ1A 2P30A 4PAQA 4AUMA 1RMTA 4D3FA 3D8NA 1PR4A 1V16A 1JHXA 3IBTA 1WDKA 1PSDA 1GKIA 1MAVA 2G09A 1XCJA 3HFGA 4YQYA 1BOFA 2D59A 4YV1A 2JLXA 2FPKA 1XTPA 3BS4A 5I51A 3E1KA 4PZ9A 1WXGA 2GPBA 3BCSA 3I83A 5HF8A 4P98A 5AM1A 3MJFA 1UC8A 5MF6A 2WJGA 4DAOA 2Q8NA 3O75A 4K9RA 4B87A 1TM4E 5FWNA 2Z2YA 4P4SB 1T9GS 2IP2A 4XVCA 2AKEA 4IIDA 4DR3B 2O2ZA 4LKOA 4CHGA 4L3VA 4ZQCB 4EHFA 1B76A 1DKOA 4MUYA 2Q99A 4H0NA 2ZUSA 3AV3A 1ULTA 3GT7A 4LDPA 1N77A 1DBWA 1F60A 1YO6A 2XE4A 4CLOB 5KNBH 2W6OA 4ZO8A 5DGXA 1BTOA 3IGFA 3X1MA 1LRJA 1MUUA 1OBHA 3DE2X 3G2MA 2OCIA 2PMFA 4LRQA 5EE3A 4NHEA 4A0GA 4CF5A 4B3RB 1P2DA 1NZJA 4P31A 1G5IA 1E96A 5JH7B 2AYYA 4WXRA 3VX4A 4MV6A 4ZV9A 2YQ5A 1KP3A 2ZT5A 4IMPA 4UPEA 2C58A 3CFYA 4PN7A 1TZMA 3LTNC 4INAA 3WYGA 1KJNA 3TBHA 1UXHA 4MEBA 2G82A 4G8JA 4J49A 5EJ8A 3G5LA 2ODBA 4IKEA 2Y1DA 5F3RA 3CRW1 1QIFA 2NQTA 2NXWA 3QMVA 1SQSA 1XTJA 1XPOA 1YB1A 1C9MA 1KXJA 2PRZA 2VF8A 1BKYA 2YDXA 4KQ6A 4LZWA 4EGJA 1QCDA 2FPOA 5DSXA 1ORDA 2XCOA 1PS9A 3KVOA 4HGPA 3SDSA 2IOYA 1RS0A 1NW3A 3HLTA 3QG5A 4GOOD 4J0GA 4RKFA 2JLSA 1KI4A 4HTFB 3TR6A 4IIYA 3ZCSA 5J3JA 1YAJA 2AV6A 4BGVA 4DRXA 1H2AS 4C0AC 1RYMA 2XT6A 2GBFA 2BN4A 3BEDA 5E6UB 2X0EA 1EIWA 2IRWA 4Y0AA 1WB4A 4AYXA 1BH6A 4F4CA 1IN8A 1W73A 2G9ZA 2XWJI 3LRTA 4ZCMA 5CFZA 2KQUA 3ACDA 5M34A 3WIBA 4KNVA 1J22A 4N3NA 1X7XB 3AM1A 5KOJB 2NT4A 3V8EA 2C8JA 2NSLA 5DBHX 4TKUA 4JCCA 1FBTA 4CV0A 3KWMA 4RVGA 4YRAA 1IXZA 2CKMA 4MUMA 3I6YA 1BGXT 3IEVA 4XZ3A 1SPBS 3Q85A 1ZGCA 3DR5A 3TXYA 4AURA 4K28A 3BBPA 4KLRA 3TCNA 4CIBA 4AP5A 1JDBB 1N5DA 3F8SA 4GBMA 1ZNQO 1ZNZA 2W6MA 4IEFB 1MO2A 2B9EA 1C1YA 1EXWA 2R1TA 3OIVA 2AXPA 4PZZA 3VKWA 1W5TA 1ISMA 4HYYA 1KJ8A 1IK6A 3G2KA 1I4EB 3ENNA 4LQLA 1Q1EA 4JJZA 3V2HA 2NXJA 5BNFA 2Z2ZA 2C8LA 4PTZA 3VDMA 1VL0A 3ZZTA 1HMYA 4AROA 4MHTA 3RS8A 3D6JA 4PGMA 4ZTZB 3OEHA 3WNCA 2PT9A 4DADA 1QFYA 1EP3B 3S2YA 3THYA 3FGPA 2FRDA 5K0LA 2VSFA 1RXCA 3WA6A 1M2VB 1GAWA 1XA4A 2IEZA 3DLPX 4JI3B 4BZZA 1JUDA 3MUNA 4S1TA 1GY8A 4ESEA 1V9CA 1Y8RB 3IQFA 1RXSA 4HRXA 4RL6A 5BW5A 3U13A 5K8CA 1JR2A 3HCFA 3DXYA 2JLYA 1X7WB 4IZ6A 2C3UA 1Z29A 5FL3A 2IYSA 3VU0A 3Q7EA 5COQA 2DZDA 1NW8A 1O95D 6Q21A 2IXTA 2O8FB 2Q5LA 1CUJA 3VZBA 3WWYA 4A8PA 3E5NA 1SWWA 2XZOA 3IAFA 2HMTA 2ZI7A 3UJHA 4TTTS 2H7XA 5P8WA 4MR7A 3JWPA 1R8SA 2X5JO 4U2EA 5IAOA 2EEZA 3TDKA 2IS2A 2AR9A 3L8ZA 4AF8A 1O6BA 2G0NA 3PTZA 4P0QB 4HDOB 5IBPA 1CV2A 4I5FA 2COEA 1AS0A 3ILVA 5ALFA 1N36B 1VPVA 4AK9A 1U8TA 1LDBA 4I1YA 5SZIA 5BN4A 4DLSA 5KVSA 2H1IA 4CEIB 2BFFB 3I6BA 2OWEA 3GDWA 3HFRA 2E48A 4FN5A 4B17A 4R1UA 1ZVQA 2Z4SA 4OQYA 2XI4A 4FFSA 1Y3CE 1Z6GA 3GH1A 3DEIA 5I7VA 2B69A 3G02A 4GPTA 4CFSA 2MOKA 3EFBA 3QVLA 3NAZA 5BNTA 2A5DA 2OK7A 5EA2A 3NBMA 4FJ2A 2H2AA 3ZWOA 3NX4A 4E03A 4QBGB 1J9ZA 3T3EA 2VBFA 3NASA 4Z8YA 4PLCA 3HU5A 4MICA 3STHA 5JFOA 4FYYA 1BCRB 2AOUA 3IB3A 3PHIA 3ESBA 3PJEA 3WK7A 1RYHA 3LP6A 4RZUA 5BY2A 1Z63A 3RIGA 2VP4A 2H4FA 2XTJA 4LZZA 1YZLA 2VUHB 3BGWA 4TLDA 2EF0A 9MHTA 2BR3A 4LXYA 3ZE6A 5GPBA 3OAAD 4FSXA 4X20B 1GUZA 3MZ0A 1QMPA 1ZMXA 2PTGA 3QVMA 2P0YA 4K5QA 4KMOA 5T7BA 1SCQA 1LX7A 3VKFA 2R7AA 4MW4A 4LRTB 2KBFA 2RCYA 2WILA 3EIWA 4GPEA 1XHFA 4JP5A 3H97A 4F4UA 1YAHA 5JQWA 4EAQA 1C50A 3C7AA 3UMSA 3GFOA 1TQ2A 4EG1A 4UAVA 5J4YA 4MPJA 4Z4IA 2OHOA 1P8AA 3UJBA 4XIYA 1PGPA 1ZHHA 4EHNA 5KZMB 5IUJC 2BH9A 1A82A 3A10A 4K9KA 2VSQA 4S1OA 4JODA 4DJAA 2RBEA 3WHPA 1UODA 1U1GA 4CQMD 3WSTA 3LIPA 1YTLA 3MRSA 1CS0A 2QSJA 3IIJA 5HZGA 2XTZA 5F33A 4H0FA 2B82A 3M6AA 1OGIA 2PLAA 4Y7CA 3TW8A 2JW5A 1K75A 4DA6A 1X80A 1D6MA 5K2OA 5IDWA 1WVIA 3C8HA 4WBNB 4BNUA 1HSZA 1P4HA 3ZV7A 4F9GA 1A8SA 2GILA 3AL3A 5LP6C 1J8DA 2FFBA 2WTMA 4XASA 1VMKA 4I4LA 3V00A 5JZMA 3RH0A 3ZE7A 2ZRPA 3GIDA 1XNQB 4Z4CA 5C3MA 4JLAA 2RSLA 2XRMA 2QVGA 3A06A 2Z1MA 5EUMA 1MJFA 1XDGA 3O2JA 4M8IA 4MUAA 2G04A 3EC7A 1FUYB 2X7XA 5TF0A 4EO4A 2Y77A 3FTFA 4WAUA 2YRFA 3A9WA 3L6RA 3W79A 5EJIA 1LBIA 1ISFA 3BDVA 4L1KA 5BNIA 3DDWA 3KYBA 4I81A 2R84A 3ZLTA 4H1WA 1A98A 1W2HA 2YJ3A 1BA3A 1F14A 4CBVA 4D9BA 1QB7A 2P5YA 4PGAA 4F8YA 4Q37A 3IQXA 1LJ8A 1JDPA 1O6GA 2CMFA 3ONVA 1HYHA 2K6GA 3ONWA 1T5SA 2PGNA 3PICA 1RZUA 4HXYA 2F17A 3BWBA 4OO3A 1JDVA 3PSHA 4OUDB 4P3KA 1LVHA 2QN3A 3CUSA 3G2QA 3IH5A 4NBVA 3UJPA 3GWGA 4RE6A 2CZGA 4G1MB 5TE9A 5JU6A 4DDWA 1B4DA 3U1TA 4HNTA 3JAWB 4QWMA 1ECJA 3HCOA 4IWXA 3WSWA 4H1VA 4P33A 1E3EA 1JHRA 3AMVA 3CR3C 3TSOA 5KTOA 4N65A 2OXCA 3AHHA 1MJHA 4FSHA 4LOAA 5JLJA 4JWTA 4XYGA 4JIMA 3SZUA 3A1DA 3MHPA 1QFXA 3T7KA 1HQKA 4LW8A 4BCDA 2BYTA 1FZQA 2YWDA 2FOLA 4RKQA 4DXAA 3W77A 4HH4A 1DBPA 2WWGA 4WVFA 2A14A 3MAJA 1J25A 3M1LA 3MT9A 4ZAFA 4YJ3B 3TW0A 1I0IA 1TW2A 3GG9A 3G5TA 3JR3A 3QEOA 4LN1A 3ZCQA 4FJ0A 3T7RA 4P2BA 1Y4DE 1A2BA 2REOA 1QK5A 2BFCB 4Q16A 4EI7A 4V1CA 3SBXA 2OYSA 3OA0A 4F4FA 4DF3A 1P77A 4JU9A 2I80A 2ZPAA 3RKRA 4AQDA 2QRNA 2W37A 1ABBA 3K1AB 2NU8A 3C3CA 4WOCA 4FB4A 3B5IA 1RWOA 3WKAA 3CYFA 3MT7A 2J48A 1ZWLA 4ER6A 1UMCA 4DWWA 1P80A 3KJEA 1QG6A 2MDTA 2BZSA 4AZSA 4H16A 3CJTA 1QIHA 4TV9B 1N92A 3NP9A 2DPLA 1L5OA 4PSKA 3UJCA 4M8SA 2FEMA 5JAIA 4GLJA 1OXBB 2IL1A 2VCYA 4EPVA 2Q1UA 1ETUA 2I3ZA 3H18A 4BKQA 1THMA 2GYUA 2O07A 2O2GA 3K1JA 4DLUA 4ZJPA 3KEFA 5JS7A 2PWYA 1SVKA 3DCJA 2F43A 3C5CA 4I6GA 1SZJG 3MMPA 4V2IA 3UMVA 2R6R1 4HNRA 3WE7A 4C88A 4PNEA 4HGZA 1TM3E 4XQCA 2Q6IA 5EQTA 3JY6A 1U65A 1A9ZA 2VYNA 3IUJA 2OYCA 2GWHA 2IF2A 4AJIA 2XEDA 2R4UA 3QTLA 1UC4B 2PRKA 4G1VA 2FSHA 4TLMB 5ALYA 3WKEA 4AY2A 3EIEA 2G1AA 2XRFA 1OF1A 3IAXA 3RANA 1ND6A 3PC7A 1G41A 2HBRA 3UXYA 4CU2A 4NFSA 2IYRA 4EHIA 5JYCA 4AKGA 1PZMA 1DRWA 2PUHA 4G8DA 5I7UA 4F2GA 4L9RA 1YF3A 3KV1A 2NLOA 4P92A 4GI5A 1S3FA 1PKXA 4TXJA 1SKUA 3WI7A 4LKRA 3RC2A 2PRIA 4Y18A 3SEFA 4BP1A 1MOSA 5JSUA 1IN7A 2HJGA 3FHOA 4LV6A 4NQRA 4KR9A 3U80A 3W7AA 3EARA 3UOWA 4PN3A 1N78A 2PZMA 3CUUA 1QE3A 3HP1A 4LZAA 1QAQA 1P5HA 4A0SA 4FLMA 3QLTA 4TM7A 4EYQA 2Q4RA 5F21A 1P45A 3G9QA 1BHSA 3VUFA 4B6RA 5KOHA 4HTAA 4X7BA 1GRRA 5KCZA 2J3IA 3RRXA 2C03A 3HP4A 5DYYA 3PPWA 3VNSA 2Q5IA 1HLFA 3T1QA 2P67A 2HK6A 1ACMA 1GCOA 3KSDO 5D7BA 5DOVA 1FRNA 1BXRA 4HDCA 4MGZR 1EHYA 4WKBA 4EYEA 3LDHA 3WMWA 5K09A 4DBLC 1II8B 3SZLA 4Z4FA 1XTTA 2G1UA 2Z08A 4Q39A 5ITSA 4O63O 3HXPA 1J7KA 3E6AA 4RNDB 4QVKA 2E1RA 3OSZA 4INZA 1DE0A 4BC1A 3RVPA 3IBGA 4XTRA 3WRYA 4C3UA 4Z9XA 3PFKA 3UV7A 2X6TA 3ANNA 5C80A 5EZYB 5HNKA 5B4VA 3OU7A 1FQOA 1HEIA 1WSWA 3BF8A 1S4QA 2NAPA 4RETA 4NENA 5LNK6 2FW9A 3QELB 4HY3A 5K3SA 1K3TA 1C30B 1U63A 3IAEA 1AHHA 1LU9A 2NO5A 3CJRA 3GI1A 3MLEA 4W5TA 3G8AA 3JD4A 4XQ0A 1EJBA 3RC1A 3NGXA 3DV9A 3WDLA 5B3LA 2R47A 4CHTA 2QD4A 4JEHA 1JR3E 1G4AE 3P27A 3JQ6A 2QT9A 3HY4A 4QFCA 1KSHA 3N5CA 4MVJD 4YP6A 4ANFA 4GR9A 1IPEA 4DQKA 1PLJA 4E5YA 2ZXUA 3PLRA 1JS1X 4ND1A 2C9DA 2HWKA 4H7HA 2H0QA 2D2IA 2ZSKA 1OFTA 4MK4A 2ZDHA 4ENVA 4ZJUA 3ASUA 4GP9A 3SMVA 4ZTUB 1FIUA 3NB0A 4B3JA 5DW3A 2PMCA 2RDMA 1YKSA 3VC1A 1EDBA 5T6MA 3DVQX 2X1LA 2PFGA 4C4RA 3B6KA 2LCIA 1MJ5A 4NV3A 4MQUA 3BBLA 4WUTA 2WKQA 5AJHA 3DL7A 1H8ED 2WJZB 4RWEA 3HNRA 3M5DA 3EOAI 2VNJA 4KCGA 5HILA 5IAGA 2W42A 1E5DA 3SMQA 2XGSA 1D8AA 3W1WA 3GP8A 3VNRA 3T5DA 1CLUA 4FNMA 4JXZA 5EHGA 1E3TA 4TQ9A 4Q7MB 1RW4A 3VHRA 5B64A 4Z0PA 1BVRA 1C1HA 1EDDA 4FEGA 3NTVA 2Z57A 2LRHA 1MJGA 3QHAA 3GVIA 3FTEA 3HFJA 4UTNA 3WNVA 4CCYA 1P7YA 1ULZA 1W49A 4J7AA 2DECA 4MINA 3CSSA 5AI4A 2PUEA 3S8YA 2GFHA 2XLCA 1AGPA 2BF7A 3RUFA 4I8XA 5A4AA 2O19A 4OA5A 4EYGA 1UOOA 1L4NA 2XDWA 1TTTA 1I32A 3F5FA 2AI2A 5IKMA 3BHIA 4D3SA 4R1LA 1F38A 1SQ0A 4PC1A 5JAPA 3W2GA 3CUKA 3IEXA 2CCGA 3KXKA 1BN6A 1OX5A 5I8PA 4XFDA 3OPXA 3OQ6A 2BUBA 2VF5X 4CZ2A 3AUFA 5K0BA 4RHTA 4U5QA 2GKSA 4Q93A 3T0GA 4K9NA 5DYTA 2GYWA 4JLDA 3QBEA 5DEOA 4P3YA 1OY1A 2BL4A 2P9TA 3A6GA 3A3YA 2BZGA 2PMBA 1EJ2A 3JALB 3ZQJA 2Y1XA 4DSOA 4BXOA 2VBGA 5FBZA 2X9NA 5IC5A 3FY4A 2PGIA 1QSGA 3EXFB 3HRKA 1IQUA 2AG1A 4AZ3A 5F9FA 3FVQA 2CYCA 1ZMRA 2NX2A 2NZ8A 3CLUC 3ZBQA 2YN4A 5K8UA 4EZEA 4OXNA 1YQDA 3L0SA 2W2KB 3RHSA 1NI3A 1PYDA 1XPJA 4F2HA 3T7EA 2GBIA 4DLXA 4KX5A 4X24A 1BWRA 3AL0C 2ZVPX 1KEUA 1Z6TA 4HGOA 4R2IA 1KYVA 5A1TA 3NBZC 2Q2WA 1UWLA 5DGTA 4IDDA 5HUHA 5I4CA 1NVEA 2HAEA 4DIEA 3B89A 2RI0A 4BP3A 5DX8A 2D6FA 2F9MA 3PD7A 4YRKA 2EFEB 2H1RA 5J59A 3K70B 3NHYA 5EJMA 4MRMB 3D6HA 3T34A 4JA0A 4F2DA 1AQNA 3RT9A 2I8AA 1U0GA 1G5QA 2XXJA 1IZ0A 1KRHA 1TT5A 2RGCA 2WUWE 3ZD8A 4WJLA 5JAUA 3RC3A 3RSLA 2Z30A 2CT8A 4UCQA 2CV0A 1UXJA 2VT6A 3BJRA 3H1GA 3IE0A 3H1BA 5JNVA 2FUKA 5JT1A 5BSGA 2QY6A 3FYSA 4Y2HA 3EVGA 1E64A 3R5XA 4M37A 1XDDA 1ZD8A 4IO0A 4P3PA 4YVFA 1WBJB 4HQKA 2RARA 4WY5A 3I8OA 4LFCB 2JA2A 4XUEA 2BUAA 2PD3A 5BWNA 3BORA 5KVCA 1VE5A 3MMZA 1R8QA 3NWPA 4QBHA 3CNEA 2RHGB 2WI8A 1J56A 4F1JA 1HXHA 2VP9A 3LK6A 1PEDA 4GBGA 2PNJA 2GK4A 4RF4A 3L02A 3OT1B 1LC3A 2D2VA 2EW1A 5A05A 3U4IA 5EPOA 1B3BA 2YOGA 4MW7A 2EVWX 2MSDB 3DZFA 1M1UA 4HAWA 2O7RA 4EYKA 3BTUA 3KJHA 5JECA 4LBWA 1QG0A 4PZPA 1E2KA 4HYEA 2P41A 4JGGA 4MXDA 1PJBA 4HBZA 4X90A 5GJCA 4D9JA 1JT2A 3F2VA 4I2NA 4G4IA 4IIBA 1RJWA 2CSUA 4WE3A 1Z36A 3PL1A 1K2WA 3HP7A 2NZWA 4GUDA 3BC1A 1EYZA 2FXVA 2DPGA 3K31A 3ZDZB 1RHKA 1U3TA 3HGTA 1TLFA 3JQDA 3AY0A 1RE1A 2Q3JA 2Z4TA 3CW2A 4JR1A 4H77A 4YP7A 1V4BA 3PB3A 2A9KA 3R8XA 4EDFA 2BGUA 1IC6A 2F8MA 4XGIA 3VZCA 4AN0A 4DMGA 5AM2A 5CXQA 2EAUA 1S2LA 2ERYA 3QOYA 2HPAA 1CZLA 1WUHS 2I78A 3I6MA 1ZPDA 3VFDA 3GAMA 3P2EA 4TMXA 1VBNA 3PFWO 4W99A 2BTEA 3RVSA 3ZBUA 1NQTA 1OYYA 1RJFA 2A9PA 1I7QB 3RUPA 4BZPA 3IHLA 5E0OA 3H3JA 3X44A 3IS3A 3JD3A 4UBLA 4D6XA 2YV3A 3CLTD 5CA0A 3X3HA 5JZSA 3BYZA 2RI1A 5TJ9A 2FN3A 5FI3A 2D1TA 3GRVA 2A8YA 2BEUB 3EVEA 1AKEA 3MVEA 5E3HA 5BWLA 1B73A 3DMGA 1ESZA 2GI4A 3N53A 2XUIA 1VA5A 3MK31 1H2ZA 3BKWA 4J0IA 4RJ2A 4B85A 2H1WA 4PIPA 2JLUA 3SC2B 4YPOA 1OPXA 2C7RA 2ZB3A 1JLLA 4XIJA 1JHUA 1RPTA 2H2IA 4YY3B 4N03A 2O1XA 4OXIA 5DCLA 4FCCA 1ZMOA 2JCBA 3OTQA 5COBA 1VL2A 4C0HA 2B94A 4UHBA 3JQ8A 1Y98A 3RVLA 5EJ9A 3BGSA 3ABIA 4OGKA 2REXB 2ISQA 1NRJB 4I9UA 4UXIA 5D8DA 2QL7A 4KJZA 2P2DA 4CDRA 1KZ9A 5HF5A 3M2PA 1SHZA 5GP1A 3HCAA 4XB1A 2NO0A 3BZUA 1T25A 4FMCF 4W9MC 2J85A 4L3OA 4POOA 1NUSA 1R6BX 5G4KB 2GM4A 1FTNA 2O2CA 3AHGA 4B2LA 1LPPA 2VHJA 5E6RB 3TINA 4BUZA 1AX9A 3KJQA 4KU4A 2FFHA 3C7TA 2N47A 3FROA 1II9A 5AIBA 3LU1A 4COOA 2BBTA 3LA8A 3GP5A 3EEBA 1P2UA 5FLKA 4RVUA 5EXPA 3MXOA 1Y9DA 5IYZF 4D9KA 2HFKA 4IDHA 2Z8YA 3BXPA 1RBMA 4KODA 1PJRA 2I9PA 4YJHA 2XTMA 1QTRA 5LLSA 3FOCA 4MS1B 3REOA 2IYFA 3ZY6A 1JBEA 2CXHA 2X41A 1BIFA 2Y1CA 2ZCUA 1DJPA 1YBFA 1N75A 3K9WA 3KWLA 3OQBA 4Q02A 1LF0A 2GESA 3I5YA 2BMVA 1P4RA 2VDWA 4XDZA 3QYJA 5C1OA 2HCFA 3E9MA 3LX6A 3DJYA 4YGXB 4BLPA 5L7WA 3IAM6 1YRHA 2KB0A 3AOGA 3NGLA 5K0SA 3AYZB 3LSYA 3R6GA 1Z4OA 2WFLB 4HEA6 1O97C 1QIEA 1DU4A 4YAOA 2OXRA 3RGWS 4BRWA 1SXJC 5FOUA 1N8KA 2HI0A 5CNMA 1ECBA 4I8IA 5BVGA 2UUPA 1DAEA 1ZH8A 4TLLB 4YJGB 4J0JA 4LEIA 5EMNA 3VQTA 5B6PA 2QG9A 2FPRA 3M34A 2W2MA 1I2BA 3DL4A 1ZLXA 1QFZA 2NTEA 2NVOA 3ANYB 1XZBA 4P35A 1VGQA 1WKVA 3KYIB 1CDOA 4PHGA 1IZYA 4DNXA 2YYAA 4LJLA 2FEKA 5EIBD 5FWYA 4R2KA 2RAPA 3QGMA 2XNKA 4RK7A 2CV2A 5LIRA 1T36B 5LMUB 4KNWA 4FZ3A 1PFUA 2RGXA 1N6OA 3C3WA 4EKYA 4KWCA 1BHQ1 1U2QA 1GVNB 1TM5E 4IHJA 3RU3A 5CW2A 4B3FX 5INTA 4ERNA 4BNDB 2VJLA 3AEKB 3JRWA 4QGHA 2WJAA 1WXIA 5E0KB 3PBKA 1Z39A 2ZR7A 5J2TA 1EZZA 4X54A 1XLUA 2I7TA 5AM0A 2XVYA 2C5FA 3ASVA 3EEQA 4IS2A 4QUAA 1T5BA 1Z8NA 4O4JB 3RWMB 3RS4A 3T1TA 1FFXB 1FX0B 1G7SA 1JALA 3B1FA 4H3VA 4MWBA 3RD5A 5C5DA 3DOOA 2F4VB 4QOGA 1P1CA 2NZYA 1C3EA 1J23A 3OJ0A 1JEQB 3X2EA 1L8AA 2GNPA 1NJFA 2GPJA 1EGMB 5HZKA 3C1OA 3KZVA 1ZWKA 2QR3A 3WA7A 3SHQA 4CJXA 1JRLA 2QYTA 3MLBA 3WLRA 3B60A 3FKSD 4FZJA 1W5AA 4EW3A 2ZUVA 4XCXA 5CDYA 4W5OA 4C7BA 3V6MA 1N8TA 3UFBA 2QD3A 2WD7B 4BYGA 2DVMA 1C7RA 4Y2QA 4EKNB 2V1UA 1U9IC 3ESXA 3H8WA 3K70D 2XAAA 1PUXA 3R0IA 1CFZA 1Y4UA 1G2IA 1WX1A 1JIIA 1HYEA 1XRNA 3LPNA 1KI9A 3MF4A 1PAUA 1FK8A 2N42A 1PJSA 3GNTA 4RMGA 3ZU4A 4CM4B 1ZIYA 1Q0ZA 2QZJA 4FHDA 2RGNC 2WHEA 1O58A 5AVXA 5IRCD 4FOPA 2RIRA 2HMYB 1PQ4A 2VDMB 1E9RA 3JVDA 4C4ZA 3NBUA 2PEZA 1P2FA 3KU4A 2IU4A 2FPMA 2ADOA 4FQ8A 2P8JA 4ZO7A 1QPBA 3CCBA 1HZJA 3RM3A 1BVUA 1N2HA 4PZCA 1Y1TA 3HY3A 4CN8A 5IWCA 2CNWD 4YRRA 2ZDQA 3O9ZA 4DSZA 3AERB 1JTEA 3ABZA 1M73E 3BXXA 1WDTA 2VQDA 3LQFA 3MTEA 2Y1FA 4ZU1X 1KAOA 3L4BA 3MQ4A 4WXPA 4XM2A 3N59A 5G1OA 1XDWA 3GL9A 2WJ3A 4ZVOA 2QDXA 3HM9A 5FI1B 2P91A 1QGZA 2QK4A 4GOKA 3JZAA 4IQ8A 4PQYA 4B84A 2B4TO 2RHHA 2WDPA 3FDJA 3LYLA 2BW0A 4EG4A 5B6IA 3RW9A 2R6HA 2XB4A 3LVFO 1V7PC 4WXMA 5GOZA 2OXTA 3NI2A 5K20A 1HL7A 1EFDN 1GGNA 1XZAA 5KJEA 1WQ4A 3O1LA 3F78A 4FIZA 3O82A 3D4BA 4M0PA 4AWAA 2EFGA 3KLPX 2W8ZA 3WL6A 2CSXA 3F8WA 4LCBA 1PT5A 3UWPA 2I4RA 1Z4NA 1E4EB 3DD1A 4KTVE 4NZOA 4OHMA 1A9XA 1JKFA 2BMWA 3I23A 1KJQA 1YNSA 3G8CA 2ZJZA 5DBGA 4BX9A 4DQDA 1QKJA 2I03A 4FEYA 1SNYA 5JNLA 1GG5A 1CVIA 3EJWA 4NU5A 4I55A 2IJGX 4JQSA 2WAMA 3HC7A 3H5OA 4JGIA 4U9HS 4GGMX 1MPXA 4OLFA 4GKVA 1PFQA 1SY7A 2Q4BA 5EUCA 3AX6A 4JI0B 3DVAA 5BSWA 2BGGA 1C8VB 4QM6A 1Y1QA 1RNLA 1G6HA 4R68A 4H4EA 1UK9A 1AMUA 3MHTA 1JE1A 2XVZA 3BB1A 4AVYA 5A6VA 2IP4A 3B5EA 3CCFA 3NTLA 2H54A 2GKGA 4KGDA 3L7CA 4WJZA 2R68A 3EH2A 5T3YA 3SZGA 3P4YA 4ITUA 1HY3A 3OOWA 3W4IA 2V45A 4DV0B 5AHKA 4GEGA 2B37A 5CFPA 1NVTA 1VHWA 5I4BA 3IQWA 5EQDA 5IEBA 1EA5A 2QVZX 1H1LB 1TC2A 1EDOA 1AG9A 1T8SA 3COJA 1SGWA 1V37A 3GYGA 4RIGA 3ZZNA 2F1JA 3USCS 1ESCA 2ZSFA 1V3TA 3GHHA 4O2AB 1DEHA 5CFQA 1AQ6A 4YB8A 4YO8A 5ECWA 4TVSA 3PNMA 3KD2A 4PX2A 2AW5A 3TG8A 1SUFA 1VIDA 2NIPA 1J2UA 4P93A 4GX5A 4ZANA 3AJRA 4PG6A 1WCWA 1U3WA 1SMKA 2BE9A 4PO9A 4R81A 3UJ6A 5IEJA 3ADBA 3PKIA 2VZ0A 4OD0A 1TADA 1TUEA 2FU5C 3MWFA 1V11A 2CLSA 4ZRDA 3OEED 2BM8A 5HJ2A 3RRFA 3AUTA 3FWHA 2H2HA 2I6SA 3DCNA 3GGOA 5FUWA 4QLBA 2IZ7A 4BN4A 2VHQA 1RPAA 4RIFA 1X77A 3LSTA 3VTAA 4KR6A 5FFFA 1VDZA 2GGSA 2K2QB 2DLCX 3B1ZA 3ILSA 3K0CA 3D3WB 3HE3A 2BWJA 3TKLA 1Z4QA 1E89A 3S28A 4JC4A 3AVVA 1RLJA 1Q1NA 1SU7A 1FDUA 3GFTA 3WGUA 1JIKA 1HQCA 2ZUEA 5JEDA 1VMAA 3LWZA 4G5QA 2VXYA 5CYFA 5F51A 2ARKA 3H6GA 4N5NA 4ZVKA 1IN4A 4MJ7A 4W1RA 1E4VA 1XLVA 1A8PA 5ICGA 1DTSA 2HPHA 3NETA 1T24A 4NE7A 2FKAA 3AINA 1DOZA 5DYIA 1SB8A 2NWQA 4FHZA 4XWGA 1IY1A 3FWZA 1NVBA 4CT0A 5GVSA 3F6SA 2C5GA 1Z88A 1IY2A 1MU0A 2D0PB 3A1WA 1E8MA 3K0AA 5CA0F 3GEPA 3CO5A 1PF7E 5BOSA 1KJ9A 1ZUWA 5JISA 2CXOA 2IEIA 4EGAA 9LDBA 2YVUA 2D0IA 4OHWA 3Q15C 1DKUA 1NQXA 2IH2A 4LECA 1PSZA 2FPPB 3S70A 2GFIA 1JG2A 3EF1A 1PVVA 3PC6A 4R9RA 3HS3A 3ZQ6A 1PZEA 1XO1A 3ZY3A 4WQMA 4WY2A 3WK4A 3L8FA 1OKKD 1WKBA 1Y82A 2EZ9A 4D8UA 3KTAA 1Z2PX 3T06B 1MC5A 3MGBA 3HXQA 2VK8A 2PBZA 1XKQA 4NVRA 1I0LA 3DCYA 1NXPA 2O6LA 2GJ8A 3CONA 3I12A 4PY2A 4MYDA 5KSPA 5IKEA 3KAKA 3UENA 4Q7EA 5ANRB 3W9SA 3LX8A 1JYFA 4QVIA 2OL4A 4NESA 2H6EA 1NA5A 2RHOA 1J0AA 4KQ9A 4TTJA 4W8HA 4WZBB 1R64A 3DDNA 1YE3A 3VHXB 3DZHA 1WHSA 3P0IA 4DCNA 1NVWQ 2PIDA 4EKDA 4HNHA 4MAMA 1I7DA 4PYRA 3WK6A 3TFWA 1NBIA 2IHTA 1VE7A 2OENG 1FFAA 4DDKA 4DKXA 2W2NA 4FGSA 1NRIA 2B4AA 3H9BA 4BVGA 4E09A 1S8NA 5AVJA 1XTKA 3BREA 4WJKB 3WB2A 2RGAA 1JZTA 6LDHA 3DE6X 5AVRA 3TAHA 3CF4A 1KR5A 2WHXA 3VRHA 4ENRA 1FW8A 4PV7A 1L4LA 1CZRA 1VPTA 1UPUA 3WLHA 3F6EX 3JZDA 1XZFA 4NARA 1LF5A 5IKPA 1ZW1A 4KPFC 5C7LO 2GXAA 3Q3GE 1DRJA 1RYDA 1U0EA 1ZL2A 2VLIA 4K9SA 3DNMA 4TLAA 1EH5A 2F1KA 4OQMA 3JWIA 5EZ6B 2JI9A 4ZOEA 3UJ3X 1FNBA 5LP6B 1N6KA 1NC1A 3CSDA 4KYVA 4ZVNA 1HEUA 4BU0A 1PL7A 1CF9A 1K8YB 5ALDA 1FVOA 4FLEA 2ILTA 3LGSA 4XQEA 2HWXA 3WLKX 1M2OA 2PV7A 4MR9B 1PL6A 4AX8A 3FNQA 1E58A 1WNTA 1RABA 1VBMA 4BV9A 3UPTA 3MB5A 1JGTA 2WVGA 3F49S 2VWGA 3RG2A 4ZO6A 3T6KA 3KKEA 5M3BA 1PFVA 2WT9A 4NBSA 4U2BA 1SK9A 3LYHA 4DV1B 3CNBA 4QNNA 2Q3EA 3LHDA 2VNKA 1M8FA 2G7MC 5K05A 5ICEA 2CD7A 3H2YA 2AQHA 3QSGA 4GVPA 3ZBTA 3A3PA 4IHJF 1U3VA 4DUGD 3KB6A 4OSEA 1GVHA 3HV0A 5ALVA 3NLLA 2CVZA 2P4SA 2PT7A 2Q1WA 5ESRA 3RKUA 3SSNA 5I6DA 5K01A 4V3BA 1XNRB 1NV8A 1CTQA 3HI4A 5J2TF 2QE7D 1SUBA 1YH3A 2M6KA 1DKNA 3UKJA 4HDMA 2GZ3A 4JZKA 3ZIAA 4ZU3A 3UTDA 4AO7A 4KVFA 1S96A 2MSCB 2D2EA 3ZGXA 1LWNA 4OIFA 4YC7A 4L7QA 4F97A 1M8KA 2CXRA 1WB9A 4RPHA 5K8TA 2XMSA 1CY2A 2VG8A 3I2YX 2OO5C 3R3HA 1A0OA 4L8LA 5AW2A 1YK1A 2WBLC 4LK3A 1UAGA 2FR0A 3EOBI 2HJ9A 5GAJA 3LH5A 4E51A 2FN8A 1OGYA 2PQ2A 3PIDA 4UVHA 5TS3A 3AYXB 1PFKA 1TIBA 5TF4A 1C3JA 1KH2A 2JLCA 3T3PB 1URPA 4JGBA 3CNLA 3OJCA 1KO8A 1IEQA 3K9CA 1W2GA 4ZI3A 5HRUA 1DRUA 1EXDA 1DJOA 1OBFO 2JZCA 3ZDCA 2QY9A 2R6GA 1Z7YA 4OMFG 1OI3A 5KX5F 1Y3HA 3OZBA 5GADl 4ZVPA 4RD4A 3VC3A 1IE3A 4OB6A 4BL5A 3ZQKA 3D6NB 1ZNXA 4ZZ3A 2GJ9A 3STWA 4DMRA 2JLVA 3KU1A 2WMYA 5FPKA 5JASA 2WW8A 3EQ9A 1YMVA 4QGBA 2PXXA 4WECA 4PZUA 1E0KA 5TS2A 2PSSA 2C1XA 2I7CA 4JI8B 2ECQA 5H68A 3WL7A 5M29A 2I65A 2PU7A 3W3AA 3RRJA 3SFZA 1C4OA 4FHFA 3FPFA 3M5WA 4YQEA 2O2SA 1NSFA 1DWUA 2QLJA 5B2FA 3R8FA 1F8UA 1U5AA 2Q3CA 3GJ5A 2IYVA 4YUXA 1E63A 4GFDA 3KALA 4ZDIA 5KYUB 2V4ZA 3FMVA 5T3UA 5HF9A 5EIOA 3FN4A 1AKMA 2GS9A 2JK0A 4RLFA 3WB0A 1ZM3A 5AESA 1TKAA 4DCOA 4ER0A 5BWOA 4CL3A 3M82A 1T5OA 4PQFA 4WLVA 3V4SA 4D42A 4F45A 3N2LA 4W5RA 4UNIA 3CX7A 3N0RA 1UXGA 2P27A 2JKZA 2EYQA 2IXEA 4B33A 4EHKA 3KB8A 1GQRA 3A2NA 2PUDA 2W0MA 1V6CA 4L5IA 3OT5A 4M1EA 5AWFC 1NN3A 3NBAA 4WLFA 4ZAYA 4XGKA 2VIIA 4LBYA 4JZYA 1RM0A 4FU0A 4UM7A 4RULA 3RI3A 1CU1A 3E5MA 2HHLA 4I5GA 3RR2A 1I5EA 1TKCA 5EMKA 4NWIA 2Q46A 2ZULA 4C29A 1MC1A 2Y92A 4AMYA 3AEQB 1NN1A 3BE8A 1XEXB 3D3KA 3UANA 4L4ZA 4RSGA 1UKEA 3HCPA 1N1GA 1IDN1 4EFLA 1TC1A 2NSYA 2EKPA 2FPUA 3FSGA 3GJ4A 2DG2A 4BX2A 3FVVA 3TRFA 3VVCA 2VDKB 3DEKA 4F6RA 3CKKA 2QYOA 5HQ3B 2XOKA 2UXBB 2VDOB 3I45A 2JGEA 3G49A 4LYJA 2WU0A 4ZMRA 2I1VB 2QW0X 3IILA 5B7PA 2HF2A 4F86A 1R74A 1QMGA 1MA0A 1BNCA 1FSGA 2QW8A 2VTEA 3KZ1E 1JYSA 3NBFA 1TO2E 1QPGA 3LBHA 4QEZA 3VR6D 3A05A 4B34A 4QHTA 2B0JA 2ATCA 3B70A 4MVXA 4NMLA 5J23A 4MQEB 3ED1A 3TZCA 1MA3A 4BMYA 1WSDA 2H5JA 3CW8X 3I5AA 1MQ9A 4DTIA 1F3LA 1WQ1R 1Z7EA 3PTLA 5KDDA 2ZYUX 1DO2A 2JASA 3LG2A 1Y5LA 2GA9A 4EWLA 2WICA 5AW0A 1G1AA 2WU3A 3M33A 4XSVA 5IT0A 5AOBA 3PHHA 2ZRJA 3IAUA 1RJEA 4YACA 3RVOA 4IG4A 1JR6A 4KGZA 4ZDWA 4ER3A 4KLAA 3NC0C 1E3IA 2YH2A 3T35A 3DKKA 3V9PA 3MJVA 4IIEA 4DR4B 3WSVA 4QEDA 2DMRA 3NALA 1O9GA 3KLNA 3AVUA 3C7CB 1OREA 3MTGA 4HAIA 1AKQA 2AA3A 2BHLA 4LNUA 4O0MA 1ZD1A 5AP9A 4MV5A 3CURA 3KLBA 3QP9A 2WSIA 3EZYA 3ZYCA 2Y05A 4WA7A 1VKJA 5AKYA 3SWWA 1R18A 4TTQA 1D1QA 4Z2AA 3THOA 2JATA 4EM6A 2QV7A 4NZZA 1UDXA 3IP1A 2GHQA 3FTCA 3GEMA 4OKSA 1A8HA 3IV9A 4J29A 4YMUA 1THGA 3BHNA 1N5KA 3EPRA 3WL5A 3WLLA 5HW0A 3JPWA 3DMRA 3ORFA 2ZIWB 2X8BA 1GRNA 2PX4A 3EULA 1IN1A 2J41A 4MB2A 4K2HA 3EGIA 4QNMA 1UBEA 1CZNA 2A59A 1OZFA 2A9FA 2HLDA 2ZQ5A 3DE0X 2JIZD 3EXHC 3KWJA 4KI0A 2RIPA 4L9AA 4LI3X 5BQ5A 3EH1A 3T9FA 3DDSA 4Q1DA 3CT4A 2VSXA 4M88A 3HPRA 3V5NA 3WBKA 2IPAB 2PGOA 1ECFA 2DCUA 4M4SA 1SQ5A 4A36A 2YFHA 2ZWAA 3D81A 1UP7A 1SCNE 2VAXA 1JEYA 1PI3A 3VYTB 1QUEA 4KRXA 1H23A 1NDQA 2QMYA 2QPTA 1B2LA 1DC6A 5TY0A 3P45A 1VIMA 2VEDA 4H1HA 2BBSA 3MBOA 4IPTA 4M99A 5AT1A 4LS3A 3ROZA 3WMRA 4B4OA 5FUMA 4K8RB 1FS4A 1SEVA 1XL1A 2GAOA 4UAGA 3DO8A 4Q4HA 5D86A 5G40A 4OGGA 1XAIA 3ETHA 2OYRA 1TO6A 3NONA 4HEHA 4JA2A 1P61B 1EZ1A 1JPUA 1L7XA 4F6LA 3QENA 1HPLA 1MAUA 1MDBA 2A1IA 3WQQA 1NYLA 2V3CC 2GSWA 1ZUNA 1HUQA 1W0JD 3BSSA 3GBSA 3PKJA 2BFDA 4QDJA 2D8AA 4CCSA 5JPDA 5L3SA 1O1YA 1UDCA 1QBKC 4MWGA 4Y0VA 1SG6A 3MQFA 4B7XA 1Q0TA 4ZT6A 1QIGA 3FCXA 1G5TA 4XLZA 1YQTA 5F7ZA 1UZMA 1DXQA 1O5IA 3KPWA 3AF2A 4GYYA 5DXAA 5ULLA 3I0ZA 2QTRA 3Q9SA 4M1QA 4J3NA 2GSDA 1FVHA 1M6VB 2A58A 3ABQB 2RHJA 4HDKA 1N2ZA 4HB3A 4UQPA 1NP3A 2PSHA 1HZZC 1SHLA 3H11B 3LT0A 2JEYA 4ASUD 1B0AA 2OM6A 1T4DA 3OJOA 1JMYA 2JI4A 2C97A 3LX4A 4KIGA 3MJEA 1QF6A 1U0RA 3ZIDA 1OHHD 1Z73A 1I0ZA 1JDZA 2NQ8A 2IXBA 4K6HA 1IHYA 1VP9A 3DDHA 4L2IB 4OHXA 4CV3A 1ZN9A 3CINA 4B6GA 5LMNB 1CYDA 1U5BB 4DSTA 3B3JA 2PTHA 5DO9A 5E9JA 3VO1A 5K4HA 3FOWA 4CRWB 1R6DA 3ABSB 4R1OA 2JJ8A 4FE7A 4LOHA 3SS9X 3DPSA 3JQEA 3ZIUA 2HQRA 3EIXA 3EK2A 5IAEA 4PRKA 1D7AA 2MTBA 2PKEA 3H5WA 2C04A 2DY1A 3O4GA 3OPNA 3TQQA 5K8VA 4DA4A 3OKFA 1QQ5A 2XB9A 3ICOA 2QQFA 4JUDX 1W8IA 3WRXA 3GEBA 1F48A 4MIYA 1SVOA 3G88A 4HVAA 5BRNA 1COWD 4IXNA 2EF1A 1ZESA 1ZUHA 2HDNB 3HXLA 3P9NA 3ZWYA 2PGLA 5JMWA 4HPJB 1Y81A 4KO1S 5JNTA 3NDPA 2VAPA 3ONEA 4TKVB 4Z9YA 2GM3A 2X42A 1MZPA 4G5HA 4IX1A 1J07A 1G8PA 2NV0A 1HA3A 2VRCA 5KJFA 3UHOA 1LFAA 2H2FA 3PGJA 5JHHB 3KKZA 3P52A 3PQ3A 1VMEA 3PV0A 3SIXA 3LUBA 2PKQP 4H17A 5A71A 1CJKC 3OURA 3EODA 3L0YA 3HA7A 3RVBA 2C4VA 3FA2A 4YS6A 4CEHA 1WMEA 4FYPA 1CY6A 1QZUA 1E92A 3ZYZA 5EIXA 1CE8A 1Q11A 1OMOA 3FOFC 1J00A 2BI8A 2CHFA 3TBKA 1TVKA 4MROA 1F6DA 3PU6A 4CM7A 1SIWA 1NY5A 4WBXC 2J08A 3QUAA 2VFAA 2FLVA 3C70A 5DTEA 5B37A 5IH3A 2WUFA 4MB0A 1OX6A 5JMPA 3DS8A 5THXA 4UBJA 1IXSB 1LS6A 4LVOA 4NY1A 1XQWA 4QO8A 8AT1A 5I4KA 2YXLA 1Y8QA 3IP9A 1QFSA 1ANKA 3FYDA 4MMXB 4D81A 3FB4A 4TN1A 2WVJA 5BO5A 3ZE1B 2A57A 1XQVA 2VUTA 3BZBA 4JP1A 6YASA 3CWZA 5L6MB 1H69A 1XZQA 1ZA2A 1W93A 2PRYA 1LNSA 2VN8A 2W6IA 4XEUA 1XJQA 5AJVB 5AJZA 3SR0A 4M0UA 1UOPA 3MWYW 1ZVJA 1NJ8A 3FDZA 4HAOA 2XBLA 2BZ0A 3FYCA 1U7PA 4I4TA 2EJUA 4QPZA 5E1OA 2BHRA 5TC4A 2I55A 3ZU2A 3AETA 2X4LA 3EC1A 1JECA 5AM3A 3DAHA 2EDCA 3DGFC 4RZQA 3EG9A 1KH3A 2DUJA 3O1IC 1NMZA 1R4NB 2A9OA 3B8EA 1LSJA 1TM2A 1NBOA 1JU4A 1VZ3A 1WCIA 1YQ9A 2H4JA 2R6JA 2VHVA 3AY3A 3C8ZA 3OCWA 4KFUA 1IL0A 1CY1A 4KIWA 5EERA 3TZBA 5AUPB 4QZVA 3A3KA 4GYKA 2VTDA 1FNMA 5GZ3A 5B3AA 4LDAA 4RK5A 4GLFA 2WFZA 2AUTA 3D3JA 3HDHA 2R96A 4A3SA 3N0XA 5KNLA 1U6IA 2SCUA 3OFNA 4J0KA 1QBGA 4RKYA 4BNNA 3VVLA 1YRYE 2D06A 3WYNA 2H3HA 4I9HA 4D98A 3T15A 1X9HA 3L7JA 3U7EB 4JJ8A 4AS3A 2HYDA 2EZTA 3DHNA 1P3Y1 3N2ZB 2LW7A 4MVYA 1KJWA 1QQ7A 5DCUA 2B4YA 1PGOA 3TZLA 2WYIA 1T9KA 4GOXA 4AJEA 1PEKE 1YCDA 3KXLA 5BP7A 1FSZA 1TMOA 3S2SA 4GNKA 1MIOB 4AF6A 4MUKA 1BQ3A 3UAOA 4B3GA 1SOUA 1JFFA 5F1KA 1W48A 3E7WA 3ABOB 2A7XA 2J6BA 4HDNB 3ZCUA 4D4JA 4B3TB 4BU1A 3CQ9A 3RTGA 3OH8A 4PFQA 2ZSEA 4N4AA 4LYFA 4HLDA 2FQWA 2YNMD 4Q5IA 5EWLB 2BLLA 1QHIA 4CI9A 4IG9A 3LQKA 3A1SA 2H1HA 1N57A 3PE3A 5HJEA 1KJZA 3LT2A 1YR8A 3HUFA 3CUYA 4ZJYA 3ZWKA 2V7WA 5BR4A 2OWDA 5C35A 1DV2A 3VKUA 721PA 1DBRA 2FZ4A 5KYVA 3WTBA 5JJIA 1VBKA 1G17A 1ZLYA 4R4JA 3TVDA 3OP1A 3LHIA 3QEKA 2FQ1A 4UBOA 1H65A 1M8JA 5FEMA 1Y34E 2VBIA 2PD4A 5AKHA 1FLVA 4O1IA 1AJEA 4GZLA 3MJTA 1OSNA 4DN6A 3KOOA 1QANA 3PCTA 4RW0A 3W3AH 3TZEA 1AB5A 2DBZA 5LDGA 5IVPA 5AVSA 2J6HA 4URYR 4IFTA 3OTGA 4H4CA 4HZUA 4K9MA 3S5JA 3Q2KA 1YJXA 4C0LA 4C5BA 1KDRA 1SQGA 2HJSA 3KT0A 4IOJA 3H9EO 4KVAA 3K30A 2OV6A 1G8HA 2B7CA 4PAGA 3ZE2B 5C8DA 3CZAA 5LMCA 3MRXA 1DKLA 1NW9B 4PIVA 3UW1A 2P5UA 2PAFA 1H94A 3HN6A 3R0XA 1BWQA 1G9SA 1LLCA 1U31A 1TFUA 3T0IA 1SIOA 1AGRA 3NIBA 2ODWA 4RABA 5LB4A 3E3OA 1NQWA 2XZPA 5PGMA 2BP7B 4J4BA 5GV7A 1DADA 1NYRA 5JRJA 5EP2A 5TPZA 2QJTA 3DOIA 2HEGA 4LTMA 5IP5A 3GXBA 1KZ1A 4ZAWA 4EATA 3A9CA 3H2HA 3BH0A 4TRMA 2B30A 2ZS7A 2QRKA 1OX4B 2IIBA 1OAOC 1RHQA 2R4TA 3OPYA 4MCIA 1UK6A 2HCJB 2OR3A 2Z9DA 3PIRA 5BQ3A 5HBRA 3SXJA 3ZV6A 2V0NA 2PDAA 3VU9B 3W6OA 3OQJA 3RE1A 4XR9A 5IVHA 2QTGA 3R3ZA 3PC8C 3QLVC 2XR1A 5ECGC 2A88A 4LZLA 1YB4A 2O3QA 3G13A 2J3EA 2WNSA 3D5EA 3L7NA 5LWQA 1KU6A 1N7HA 2FF7A 3FX2A 3PGMA 4KAAA 4CTOA 3L6EA 4UTVA 1X8KA 4MQMA 3IJEB 3U3JA 4F3TA 2CLKB 1M72A 2NO9A 2B1JA 3HDVA 4MA0A 3A3OA 3NC1C 4RADA 3VNVA 4EEXA 1Y3BE 1R6TA 1R4AA 3MS7A 3GZTB 3O73A 2DHRA 3IE2A 1ZH2A 1SBCA 2UZ1B 3JVVA 1W94A 1EVKA 2EU8A 3O1HB 3B78A 3PPXA 4MW1A 2AWOA 2VAWA 3RFVA 2D7CA 3OCCA 4IJKA 1JJIA 2ZSUA 1JVSA 3AF6A 1NULA 5EKUA 4Q1EA 4DUYB 3Q7QA 2ZWPA 2BMDA 2ANBA 1ARZA 2OD7A 3GEHA 4YAUA 2C9ZA 4B3CA 5C1PA 1D1PA 3WADA 1X3LA 3DZDA 3MMSA 4JP8A 3NYIA 5C1BA 2VHUA 2IELA 5JY1A 4MGEA 1U9JA 1JEJA 4V3CA 2ZBEA