2A1TS

Structure of the human mcad:etf e165betaa complex
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
248
structure length
239
Chain Sequence
ELRVLVAVKRVIDYAVKIRVKPDRTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEVIAVSCGPAQCQETIRTALAMGADRGIHVEVPPAEAERLGPLQVARVLAKLAEKEKVDLVLLGKQAIDDDCNQTGQMTAGFLDWPQGTFASQVTLEGDKLKVERAIDGGLETLRLKLPAVVTADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPPTTEDLVAKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords Acyl-CoA dehydrogenase, medium-chain specific, mitochondrial
publication title Stabilization of Non-productive Conformations Underpins Rapid Electron Transfer to Electron-transferring Flavoprotein
pubmed doi rcsb
source organism Homo sapiens
total genus 59
structure length 239
sequence length 248
ec nomenclature
pdb deposition date 2005-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01012 ETF Electron transfer flavoprotein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2a1tS01
3ND5A 4NX2A 5BNZA 2HMAA 3CLRC 1PG2A 2PZBA 4KR9A 1IH8A 4HJRA 4TS1A 4HK4A 2E18A 4PBTA 1EXDA 1F7UA 1P7PA 5LLTA 1NUQA 1XNJA 1K4KA 2J09A 4MVYA 4ZCPA 2JAXA 4KKVA 4MUKA 1TQ8A 3F3MA 1WY5A 4ZT2A 5J59A 3MXTA 4EG4A 5TS2A 4MWEA 3RK1A 3AG5A 3S3TA 3COWA 3QE4A 4GRIA 2IP1A 3AFHA 5KCMA 3UOWA 1EJ2A 4JFAA 1N2HA 3Q10A 1WXGA 4EG3A 1T9GS 1ULHA 2J5BA 3H9CA 1ZUNA 1MC1A 4DDKA 2JANA 3CLRD 1JIKA 3ND7A 3CLUC 1IVSA 3ZGZA 1VBMA 2B7LA 1ILEA 1ZH0A 3ILVA 1N2BA 2GM3A 4XSVA 3H9BA 3FDXA 3KT0A 2AKEA 4R2MA 1KP2A 2A4MA 4CQNA 1G8GA 1GPMA 4MW4A 1NUUA 4MWCA 3SDBA 5DASA 2D13A 1K97A 1JEDA 3N9IA 2O5RA 4ND7A 1N3LA 4H3SA 4CT0A 4AQ7A 3ZXIA 1H3NA 1U7DA 2HZ7A 1NUTA 1NP7A 1F4LA 3HGMA 3MUEA 4MUJA 3KFLA 2I1LA 1MB9A 1J21A 1TYCA 1I6MA 2PG3A 1Q11A 1JECA 1D2RA 1O94D 3P0JA 2V0GA 4ZCQA 2H29A 2XRYA 4L2IA 1N75A 3DV2A 1M8GA 1M8PA 2Z08A 1WXIA 2EL7A 2XRZA 2CV0A 1R6XA 4EFKA 5J58A 3SZ3A 2QTMA 4MW7A 1TYAE 1LI5A 4EF6A 3SYTA 3A4IA 5EKDA 2D54A 3INNA 2A88A 1JIJA 2YWBA 4CDNA 2CYAA 4GU5A 2OV4A 1EE1A 3IOCA 1V47A 1UFVA 2QTNA 4ND6A 3N05A 1MOPA 4MW6A 3AKZA 2YWCA 1EFPB 4U8HA 3HV0A 4ZT3A 4ZCTA 2YY5A 1M8FA 3FY4A 3HFJA 3PNVA 4YMIA 5FO0A 3N2YA 5TEWA 2CYCA 1O95C 1IQUA 3PRHA 3VGJA 2A1TR 1KP3A 3AIIA 4J76A 4OJMX 1G59A 4ZCSA 4MUFA 5IJXA 1VL2A 3FOCA 4ZCRA 3RFFA 1OBCA 3CLTC 1Q77A 2PIDA 4L2IB 2CV2A 4MUGA 2AG6A 4QREA 1JZSA 1S4MA 1NI5A 2QUJA 1T9GR 1NZJA 4PBSA 4FZJA 3ZJUA 1KAQA 3G6KA 3IUBA 3P52A 4YP7A 3HMQA 2A1TS 4ARIA 1N2JA 1GLNA 4NATA 4JXXA 3AG6A 3CLSD 3P0IA 3RHSA 1U0BB 3X1KA 3IMGA 1NSYA 3CVUA 2PZAA 3A2KA 1TYBE 1FFYA 3PNBA 2QUIA 4J75A 3D6UA 3CA8A 1DNPA 3IMCA 1T6YA 4G6ZA 4MVCA 3CVXA 4YP6A 4DLPA 1IQRA 1KORA 2BYTA 5FO1A 5K0TA 3IVGA 5HG0A 3RK0A 3IH5A 1J09A 3RBAA 4K03A 1MAUA 3PNYA 2D5BA 1CT9A 2X1MA 5FNZA 1ZH6A 1XNGA 4MVXA 3ISJA 3KT6A 4JXZA 4EG5A 1M83A 4MUNA 3TQOA 4KPUA 1IFXA 5JBNA 1WXFA 2A86A 1YULA 2CV1A 3L92A 2BTEA 1KKUA 2O8VA 4ZT5A 1NUSA 3Q12A 1B6TA 2CT8A 5H16A 4QBTA 2RE8A 1KR2A 2GOYA 1T6XA 1VBNA 1M8JA 3DPIA 3FHJA 4MW5A 1QJCA 1ZJWA 3TZLA 3CLUD 1X8XA 1N1DA 1SURA 4RPIA 1MBZA 4NAHA 2DXIA 1KAMA 1LI7A 1J1UA 4I6EA 4EG7A 2DETA 1I6KA 3K9WA 2X1LA 1KQOA 1OWNA 2VTBA 1QTQA 2A7XA 1YIDA 2J07A 1LW7A 2IELA 3K32A 5J5AA 3Q4GA 1TFUA 5IHXA 1PFYA 1MJHA 1QRTA 2ZUEA 1NUPA 1PG0A 1JIIA 3FG9A 3JXEA 3OTWA 1RQGA 1N2IA 4UZEA 4PY2A 1K92A 2C5SA 4DJAA 2ZP1A 4DDHA 1QQTA 2X0KA 4MWDA 1F7VA 1MAWA 1F9AA 3SP1A 3SEZA 4QRDA 3LOQA 4EGAA 2DUMA 3FH0A 1WZ2A 1Q15A 4A91A 1MB2A 4CDMA 3FETA 1WQ4A 3M5WA 2NZ2A 3NV7A 3IVCA 3N8HA 1QU3A 3NBAA 5KWVA 4HJXA 3UY4A 3KT8A 1IQ0A 2GKSA 1N2EA 2G36A 2X3FA 1KQPA 4EG8A 1O97C 1WXHA 1O0CA 3G59A 2DLCX 4MUIA 1G8FA 2CUZA 2J4DA 4R0NA 2ZUFA 4U63A 1VLHA 1N77A 3FNRA 1J70A 2E0IA 1EFVA 5F23A 3LCJA 3FIUA 3CVVA 1Y42X 3ND6A 4OUDA 1IHOA 3IODA 4YBRA 4DE5A 2OQ2A 2VTBB 3L93A 3FWKA 4ZT6A 1N78A 4Q16A 1KH3A 4MUEA 1U7XA 4I6GA 1O0BA 1X6VA 1KH2A 3CVWA 1WKBA 1PFVA 3SEQA 3A04A 2Z09A 3E27A 3ZJTA 1O6BA 1VBKA 2E89A 3X1JA 2JA2A 3GLVA 1YUMA 5KHAA 3CVYA 3HZRA 4MUHA 2NSYA 1O95D 3FI0A 2WQ7A 3IOEA 1WQ3A 1HYBA 3CR8A 1KQNA 1M1ZA 1K4MA 3I05A 3GMIA 3SZGA 3CLTD 3NBKA 4DDMA 1O96A 1WXEA 1MRZA 2WB2A 1G8HA 4AS1A 2PXHA 2PZ8A 4G5YA 1Q19A 1V8FA 5DEOA 4EG6A 5LM3A 2A84A 4JYZA 3VU8A 3IUEA 2V0CA 3TNJA 1EUYA 3UK2A 2RD2A 4MQ6A 2DERA 5TEVA 1M8KA 1T6ZA 1EFVB 4F4HA 2QJFA 1PFUA 5HUJA 1NYLA 3IMEA 3BL5A 2DEUA 4OUDB 1EUQA 2J08A 4ZT7A 1GAXA 1GZUA 4KR6A 4S1OA 4JZYA 1U3DA 1OBHA 4YP5A 4XFDA 1JZQA 4U7JA 3IVXA 4MW0A 1TEZA 1R6TA 1H3FA 2HGZA 1IRXA 3UC5A 3COYA 2WSIA 4EG1A 2H2AA 3OP1A 4MAFA 3C8ZA 1GN8A 4MVWA 3QTTA 3MLBA 1J1ZA 1O94C 3GUZA 1OWOA 1FYDA 1JMVA 1I2DA 3TZEA 1N2OA 3AL0C 4E1AA 4KR7A 4R2LA 3LE8A 1JILA 1WJGA 1TYDE 5AHWA 1KH1A 1XJQA 1YUNA 1JHDA 1U3CA 1EFPA 3MMXA 1I6LA 3ZIUA 4NAUA 2IJGX 3VRHA 5LFAA 3ZUGA 1O96B 3ELBA 4G5FA 4P2BA 2QJOA 1A8HA 3ZXSA 3X1MA 4HPWA 1YI8A 3COZA 3ZJVA 4WNYA 1COZA 2QUHA 4K0RA 4XFJA 3TQIA 5K0SA 2A1UA 3UMVA 1PFWA 2WQ6A 5DB4A 1QRUA 4NZPA 1OD6A 2R5WA 4MW2A 1XNHA 4MWBA 2E21A 1OWPA 3H97A 4PBRA 3QTBA 3DLAA 4KPUB 1OWMA 2DR2A 2QJTA 3COVA 4MULA 2CSXA 2YXNA 1R6UA 5H7XA 3D6VA 1GTRA 4UZFA 4F3RA 4Q93A 5DK4A 4DNXA 4ARCA 2TS1A 1J20A 4NDAA 2CFOA 3DO8A 1WOYA 2QTRA 1QNFA 3MLAA 4WSOA 1JGTA 3TS1A 2CYBA 3H99A 2AZXA 1N2GA 1OWLA 3A05A 2PFSA 4I6JA 4MW1A 4BWVA 4ZT4A 3HL4A 2Z3VA 4X0EA 1H1TA 3PXUA 1YIAA 3U1VA 3CLSC 3P0HA 3RJZA 1GTSA 1O97D 3KT3A 2VXOA 3IDFA 1BS2A 5TGTA 3IOBA 1QRSA 1JEEA 5HUHA 2A1UB 3H05A 2QUKA 1H3EA 1O5TA 4MW9A 4RUKA 3G5AA 2DPLA 1NURA 2EJCA 4MLPA 1QU2A
chains in the Genus database with same CATH superfamily
4ZJPA 2ROQA 5HTOA 4BQEA 1PG2A 1S3IA 3PNMA 3RWBA 5BP7A 3ZZTA 1RM0A 1F7UA 3MXOA 4PX3A 3HBJA 3K4PA 2Y1XA 3NM4A 1O4VA 4AICA 3JD1A 2BGJA 3QEMA 1W8IA 2J3JA 3KDSE 3R5XA 4BO1A 4RIGA 2FOXA 3LF2A 1T4CA 1TQ8A 2ZS7A 4A6PA 3O2NA 4G9EA 2B8WA 3HVIA 4BFXA 2YIDA 4C4OA 3AG5A 1ZRNA 3D4BA 2GBCA 3ZDFA 1QWSA 4NARA 1KTVA 4ZZ0A 2A9VA 3ENWA 2N9UA 4K8OA 3ZDQA 4EJ2A 1RRCA 2GD1O 1L1QA 4M7WA 5FKJA 1PV2A 3K2QA 5LQKA 3HWX1 4ZOEA 2CGEA 5FHQA 1G6OA 3UH1A 1XK6A 3N7UA 3ZBUA 1CNFA 4Q9JA 1MC8A 1T9GS 1ULHA 2J5BA 3L6UA 4MS4B 1NL3A 1XN4A 2M32A 3A6FA 1EWTA 3AC0A 4OA8A 4D8UA 4PCLA 4M88A 2PWBA 1Y3IA 1Q0RA 1JDBB 2M6SA 3CLUC 1ZD4A 1PSDA 4JL8A 1JQDA 2BBSA 4FFBB 3SJBA 4C0AC 4IQ4A 5KYWB 4B6JA 2GN8A 3FLEA 4HDSB 3W5JA 4Z5XA 1Z0KA 3PC6A 2NXNA 3RKSA 1L1RA 3AOEA 3L7JA 4GM1A 4NY1A 5B1YA 4TVOA 5KIAA 1N5RA 4AJPA 3ITNA 3K2EA 5K0GA 4DG8A 3LBFA 4FQ8A 3PSHA 3FUUA 4CM5A 2HJHA 4TTAA 2C2ZA 5JASA 2QX6A 3EPJA 5REQA 1FUUA 1RMTA 1JEDA 2R8PA 1JPJA 2VXCA 2PX2A 1RBQA 3TMKA 3LPDA 3H5OA 1IN4A 1S8AA 2HBQA 2W70A 2Q99A 3L06A 1YDEA 2Q6VA 4X6YA 3A58B 3DTNA 1GCIA 3W7AA 3FVTA 3LUHA 2AJBA 1XA4A 3TJRA 2Z56A 1PDOA 2GDZA 1OU4A 2WUWE 5JZMA 4G8BA 2HZ7A 3ER9A 1LSJA 1IZYA 5LP6B 4RHXA 1H6DA 1QF9A 4MDYA 3MUEA 4UNSA 3KZNA 2I4MA 3A0UA 4RKEA 4DR5B 1Y1SA 4TVBA 1JEYB 1XJCA 1IHXA 3CUKA 3GZTB 4GI7A 3CTPA 1BXZA 3OCCA 5GIOE 3GLIB 3OCUA 1O94D 1YZTA 2OFOA 2V0GA 4DDTA 3UH0A 2VHXA 3NDPA 1U31A 4O33A 3P2OA 2ZQZA 3VBEA 2ODPA 2QYTA 2YWJA 3SSNA 3VVCA 1DEHA 4GI5A 1WXIA 4A1OA 1AOXA 1U1CA 1IWBB 4MV1A 4RSRA 3FFWA 2WM2A 4KEAA 3TSYA 3WFZA 3BRWD 5LLDA 2XB9A 1FSPA 1SCIA 2OYCA 3L7NA 3UPDA 2HZBA 4XWYA 5FAXA 1CRLA 1QGUA 1JEJA 3ANYB 4X3CA 5JU6A 3D7LA 3WDLA 1R12A 2AG5A 4PZDA 3A4IA 5EKDA 2DX7A 2LUOA 5JXIA 2PL9A 5FAKA 2A9PA 2G28A 1N0WA 2FETA 3KJQA 5I9TA 1JIJA 2C61A 2D0PB 4NK5A 5ESWA 5G0TA 2Z4SA 4D57A 2BTQA 2FPGB 4GU5A 1X9IA 5CD1A 4ISCA 3OM9A 5J2UA 4AI6A 2G06A 1JVSA 4P3PA 5A9RA 7REQA 1DXYA 2B7CA 2HCJB 3RWMB 1VPVA 1PKEA 4M0FA 2D59A 1C1YA 4KI7A 2FSIA 4B9AA 2XE8A 4DGSA 3NPAA 3N3BC 1CJCA 4V0SA 1UPXA 4YMWA 3EDRA 4J6EA 8AT1A 4X7PA 1I3KA 2IOHA 4EQ6A 4CKZA 3EVEA 4URVR 2F7SA 3R8CA 3NTOA 1V6AA 5AUNB 3DE5X 1CR0A 1AO3A 3JQ7B 2MYTA 5T6BA 2FSHA 4XIYA 2JF0A 2VDKB 1ZOSA 4N9QA 4QPJC 1IBKB 1JYSA 3AIIA 4AKSA 3AVOA 3AHEA 5EJ4A 1JJ7A 1E1KA 3RTAA 2Q50A 1JP7A 4CM4B 3N5CA 1AZTA 2O8DA 2CVPA 3WGUA 1Z45A 2XCIA 1W75A 2IF2A 2WIAA 5EUCA 2QRQA 1G8JA 1MABB 4PPYA 2ZJZA 2Y0DA 5JO0A 4FZ3A 4GNKA 3TLYA 4R8VA 2QRKA 3BK2A 4IGEA 5TPZA 1HE4A 3M7IA 1OGYA 1Z5NA 2QG6A 1NWCA 2QLTA 2ZAIA 4P9NA 3G6KA 1DTWB 2FTKE 5EE5B 2UVQA 2ZS9A 3EHEA 5FUVA 4KCGA 2FX2A 1BGWA 4Z2YA 3A32A 2FRXA 2IZ1A 2FHSA 4YP7A 1F0YA 4DEVA 4G0WA 3M6AA 4BRWA 5CB4F 4UFNA 1GLNA 4YCJA 4YRCA 3T3IA 5C9ZA 2JFXA 4HL6A 1N8SA 3ONFA 4DV7B 1L5VA 1OFHA 1RW4A 3A8TA 3G2LA 4JXXA 3G2QA 4HGPA 2O2JA 4AZVA 1JT2A 4C08A 3LYLA 4E14A 3CVUA 1ZNZA 1ZL2A 1S89A 1I1NA 3FUWA 2GSDA 4KUHA 3Q8KA 1IIBA 2BCGY 2HCFA 2EL9A 4BTVA 3CA8A 1K6XA 3H19A 2XHEA 1VGVA 4KO8A 1BH2A 3MRTA 4MVCA 3OETA 1HF3A 1G4UR 3CW2A 3KWLA 4JJGA 2DSNA 4O1IA 4XLZA 3T15A 4D74A 4AZSA 4KYIB 2O0LA 3CVJA 5CFLA 1Y7PA 4FBGA 4P8RA 1O9HA 1ZBQA 2EHJA 5KHLB 1CYDA 4MAAA 3RBAA 4J07A 2J32A 1SVMA 10MHA 2JLCA 5LDDC 1ZK3A 3BDVA 2ZDHA 3RBVA 1NR1A 2DFNA 3VTAA 4AM8A 4JOBA 1W1IA 1ZH8A 5EY5B 1QUEA 1F2TB 5A3SA 5LMCA 1FZTA 1QK4A 3GUVA 3DV0B 2HGSA 1XUOA 2QI9F 1ENZA 5AKGA 3RJTA 3JYOA 5E2BA 3S55A 1GY8A 3U26A 4Z4QA 1XQVA 1G21B 5BSUA 3ER6A 2A86A 1P2GA 2JAWA 1G7SA 2D7JA 2JFYA 5L3QA 1FDOA 3RFTA 3B13B 2C7VA 3K0FA 3QYPA 3TDKA 2VPWA 4F7DA 1C9YA 3FGNA 2Q2OA 1PKXA 2GKOA 3JCZA 1KFBB 4IHAA 3DLTA 2H7VA 4OB6A 1GPJA 4RLFA 5H82A 3VI3B 2VTVA 3DDWA 3CLUD 1N0IA 3I9LA 2FPMA 2ZYWX 3E9MA 3QLUA 4EI7A 5BSRA 4HD8A 5HMMA 3DOIA 2V7GA 3OJXA 4JJAA 5IJZA 4AQ7A 1PX2A 5JIBA 1SURA 4BB9A 3NJRA 5LQAA 1B0UA 4UCQA 3KFVA 5DTJA 2YFKA 3PIIA 3MS7A 3QA9A 4Y2RA 2WIDA 2YQ4A 3PFWO 4PRYA 3RTDA 4MS3B 3HJRA 2HUPA 2XXAB 4U7FA 3P9ZA 1KJ8A 1U2RA 5LJIA 1NX6A 1BKDR 1C9KA 3BFPA 2J9ZB 3KSDO 3TL6A 1P9OA 1EEHA 3JYNA 1VJ0A 1ESZA 2WIKA 2WD7A 4K9DA 4LK2A 1GL6A 4G0QA 4TXLA 5ENZA 5G1PA 1HOXA 4JQSA 3HU1A 2YZGA 3SVLA 4URYR 1HDZA 1C1XA 4WJKB 1PGQA 1LPPA 3T95A 3U3DA 3CH7A 1NKSA 1T36B 2OKGA 2XTZA 4OO3A 2UUBB 3AF6A 1SBNE 5GWXA 1NRWA 4PSKA 4BO4A 2P2SA 3G6WA 1UQRA 2W42A 3B5IA 2KS6A 2P1RA 1USUA 5HS4A 4OB7A 5CR9A 3WTBA 2BGNA 4JC0A 4KGDA 1R64A 1XTKA 2F59A 2ZWOA 3PTZA 4MRPA 4AB1A 4FCCA 2E9SA 4AJ4A 1HE1C 3AKEA 1UFOA 5TY0A 4QHTA 3X1XA 1Q15A 1QWOA 2IK8A 3IELA 5KPJA 4C4TA 3RYFB 4HB0A 4C7JA 1CKEA 2C5GA 2IYQA 4AJIA 4F85A 4RKQA 2OEPA 2A9JA 1M2WA 1O2DA 3H4IA 1C9DB 1Z4MA 1DS6A 4XJVA 3UY4A 3V8RA 3U44B 2X3FA 1SU7A 4EG8A 3HNPA 5T41A 4F2HA 1RRMA 1RPTA 1ZOPA 3M4XA 1LQ2A 5DLPA 4B74A 2J4DA 4BKMA 4E1VA 5J2TA 3F6RA 1AHHA 4RDIA 1IXYA 4D9NA 1GGNA 1UWLA 4REQB 1UBMS 5BPHA 2IYVA 4FDTA 3BEDA 4MQFA 3FRHA 3H84A 3X3HA 5F23A 2BGWA 4C7OB 5ALSA 4Q1DA 2XQJA 1SOUA 1Y42X 1ESMA 3H1GA 5D51S 3CVVA 3ND6A 4JJZA 5TQ2B 5CFNA 4GRDA 2OQ2A 4KRFA 2R1VA 4TV9A 2ORWA 1Z25A 3FZEA 3M81A 3PC3A 3TBFA 1N78A 3TGLA 1GKKA 1TT7A 2YXLA 3SC2B 3QU9A 2ZBDA 4BNVA 1LW6E 1SPXA 2WWGA 3N39C 2Q2NA 3IKTA 3R5SA 4IAOA 4BKUA 3OAAD 3TIXB 2PMFA 3WQBA 3ZWAA 3NIFB 3ZNNA 1NQ5A 2X2FA 5CT9A 5CYFA 4P0QB 2FPXA 1CVLA 4OLFA 3CSUA 2IHYA 1UXHA 2X5JO 4MPRA 1E2GA 1Y8RA 2ZUUA 3F49S 4RJTA 3MPOA 4V0MA 1W29A 1T0HB 1K8YB 2QRJA 5GADl 3H0KA 5KJEA 1QB8A 2HRQA 2C2HA 3BHIA 3RRMA 3V3KA 3G8AA 5H83A 5BWMA 1XZGA 5A5EA 1LK0A 2H4XA 4FE3A 4I9NA 1KDRA 4NV3A 1TF5A 2W2QA 3D3JA 3NBKA 1PR2A 3HHPA 3CPHA 1MO6A 1Q1QA 2OPBA 3LA6A 5CM8B 4CN9A 1NVAA 1UANA 4KXXA 1RXEA 1H23A 3L9XA 3AY3A 1TTQB 1GKLA 4C78A 3AMVA 3ONDA 1B43A 1ISFA 1JLKA 3TLGA 5JSQA 2IE0A 3UK6A 2QAGA 4TMKA 1HZJA 1EP9A 3ZR4B 2V0CA 5FPYA 2G25A 3A3KA 2Q45A 2ZJ4A 3TNJA 3U4GA 1K98A 5BORA 1V1RA 1TF7A 3H5NA 3U7IA 2IH2A 2OAEA 1EUDA 3HKBB 5GPBA 3WL6A 4F4HA 3LLCA 4WT7A 2EZ9A 5JZVA 4IOKA 3REQA 1NI4A 1VPWA 1ZGHA 4HGNA 4YWHA 2YS7A 4YFYA 4BATA 2CNBA 1XPUA 2D1FA 3C3AA 1BRMA 3W1EA 2B34A 4I36A 4CUKA 1GTG1 2BGLA 2E2WA 3IDSA 3OIGA 2A9RA 4UHEA 3U13A 2PH5A 4MW0A 1ORVA 1QDEA 2X1VA 3RUEA 3BZWA 3IDAA 2JLBA 3Q2KA 4X63A 3S29A 3W04A 1J39A 1E0KA 1ZHOA 3DEYX 4R1SA 2E1PA 3RRFA 3SYKA 4EI8A 3B9PA 4MGYR 4FNGA 3WFIA 1AD2A 4KDRA 1VMKA 4PQGA 4TTQA 3ZY4A 3V8BA 4RQUA 3EF0A 1M34A 4OHKA 1VLZA 3S1AB 1CS4C 4GPD1 4BX3A 4RWEA 1SHLA 4G26A 2GM4A 4TVKA 3V32A 1GKYA 2H7YA 4BFZA 4MSUA 4M9XA 4E1BA 1N6RA 2DKOA 2YRWA 2ZJ3A 1NFRA 2E82A 3P2EA 4MV5A 3UJHA 3LQQA 4XPIA 2ZJ8A 2P65A 5HBRA 3ZUGA 1O96B 4R9RA 2X9GA 8ADHA 1QX3A 2J9GA 4Q34A 4LMAA 1IJFA 2IX9A 2H4YA 2O54A 1L6RA 1G1AA 1J33A 1HTTA 3E22A 1U0JA 4CCYA 3AR2A 1CQJA 5I7SA 4D3ZA 4DT1A 4Q9HA 1N0UA 4A23A 1BFDA 1JJAA 1FFCA 3OC6A 1M6YA 1Z0SA 4QJ5A 4QVKA 2A5GA 4ALLA 1QTNA 3BERA 4G37A 5IHPA 2FN4A 4BRUA 3WADA 3MRSA 5LPNA 3MJEA 2H2GA 5B58C 4JT9A 2Z43A 4QUHA 1OWMA 3DQPA 4PGMA 4KLZA 3UFBA 4K81B 3O82A 4UM9D 4EWLA 4FGJA 2RAUA 4QULA 4INPA 4RLQA 3PZRA 4PGGA 4N5HX 1TTPB 2O6HA 2BMVA 2Q7DA 1PEAA 4E15A 4OX9B 4AFNA 4DEYA 5LIPA 1YS6A 1A9OA 2ETVA 2ZU6A 1IWOA 4HOYA 4ZVRA 5K7SA 2KI5A 4YUAA 2GBGA 2ECOA 4I55F 3QVLA 5JS7A 4MRSA 2QYOA 3CQ9A 3FNIA 3K8ZA 4MDHA 4M2LA 4O5OA 4C29A 2RB5A 3W5BA 1I0LA 2ZKLA 4R05A 4PPQA 3LX8A 2WKPA 2JLSA 4WWHA 4AJ2A 1ECLA 1EDBA 3WXBA 2V96A 2W6PA 4UEQA 2AZXA 4MS4A 4RY9A 1P5JA 5EUMA 4NHEA 1AZWA 3R0ZA 3SS8A 3ER8A 1HFJA 1LEHA 4OOFA 1GFWA 2WWTA 2XNCA 4EENA 3WA7A 1JPUA 4FFBA 2EARA 2QP4A 4KK3A 3Q5GA 1U1FA 3DTVA 4BVEA 3KS9A 4HEQA 3WGMA 4HDSA 5KYWA 1JFVA 3HUTA 1BHJA 1NKTA 3ZHYA 1AB5A 1MPXA 2TSYB 3MERA 5CBKA 5JATA 3U1VA 2WYHA 1K1EA 2BR3A 3OM0A 4BBZA 2C77A 1VRCA 1ZJ5A 4L5CA 3DOEA 4NU6A 2I2AA 4I1IA 3T9AA 2Q62A 3I9V1 2AIRA 2NVWA 2ZYHA 3L6OO 1QHXA 5GV8A 3SYLA 3H4VA 1RADA 4KVAA 4AUMA 4L8FA 1N2CB 3ZVLA 1ZJYA 1EG2A 2PBZA 4GX5A 3ASZA 2GPAA 2IW3A 4MLPA 1ZA1A 3I53A 1EQAA 3Q3EA 3JQEA 3ZE0B 4H6PA 3WLLA 2W98A 2R8XA 3L0DA 4CJXA 3RT1A 1LBSA 3QJYA 5JLJA 3OLXA 1Q0HA 2A9KA 3AEXA 5LP6A 4YJDA 3AVUA 3BXFA 4P34A 3WBFA 1RXIA 2CEKA 1VE6A 1IVYA 2I55A 1BA3A 3FPFA 3PF9A 4R01A 3W05A 3TIVA 5BXQC 4IFTA 1JEYA 2BHRA 2G4CA 3PKZA 4GI3A 3TG2A 1YK0A 2ZSKA 4ZDJA 4KPFC 5CDTA 1E2FA 1B42A 4D9EA 3AZOA 4JBXA 2P40A 4W8OA 9MHTA 4J90A 5EPUA 4EW1A 3AJ8A 4V03A 3IEKA 3I1YA 3V3TA 3AVYA 4G89A 5AM2A 5IKMA 1C0IA 2O06A 3KSZO 4RORA 2NG1A 4LX0A 1QG4A 3AR3A 4FD2A 1J0CA 2RI1A 3KTDA 1K8ZB 5J1TB 5B4VA 3CXRA 1CB7A 2IYXA 4DCPA 2PSFA 4YMUA 5DYTA 221PA 4N65A 2BI8A 2ONKA 4C0KA 3NRBA 1KZ7B 3BX1A 4NXMB 4M49A 1U9IA 2C2XA 1ZMXA 2J5XA 5LOVB 2WILA 5ECDA 3JRWA 3KT0A 4DMGA 4OXYA 2E85A 2RAFA 3M9WA 1E79A 1TJYA 2HA5A 3B9QA 3AVXA 2OBBA 1OXKB 1WQ1R 2HUNA 1FSSA 4L07A 5DNAA 1UXGA 3I2GA 1U3TA 1XTSA 3ZU2A 1QP8A 1S96A 4FDAA 5IKPA 2EG9A 1M10A 4JVSB 4DLSA 3PKIA 3A2MA 3F4BA 1YB1A 3W79A 2EFCB 4EDFA 5HXAA 2UXBB 4AJEA 4H3SA 3L7YA 1K68A 2EOAA 2PLWA 3GG9A 4PC3A 4JT4A 3JQ7A 3NGLA 3VKFA 3ZWQA 4Q0MA 1NP7A 3TX2A 5ALGA 3DTTA 3ZHUA 4DRXB 1U8XX 3CRNA 3USZA 1JF8A 4HQLA 4L4XA 2C5AA 1XNQB 4NBVA 3UTCA 4CZ2A 5A5DA 2OQIA 2O48X 4GR4A 3Q0TA 4IXDA 4CM4A 3QELB 5FUQA 2YVLA 4N41A 1BS1A 4IDAA 3WDKA 1H9CA 1JKMA 4H1TA 1CUJA 4GEKA 4JJEA 1V1JA 1JHMA 1MABA 2VCYA 1MFPA 2WTMA 1U8YA 3FAKA 1C2TA 3NXKA 2RGDA 4YCDA 3VMMA 2O2XA 2FMUA 3HC7A 1M8GA 3U19A 4F1KA 4WN3A 2FWJA 1J0BA 5CURA 1EFTA 4ENTA 1RWMA 2WB4A 1U7OA 5HM8A 1DTWA 3UJAA 1A9XB 2YVKA 3PQ7A 4RVFA 5A3QA 2JIBA 2XECA 3TFQA 3FVVA 2AOUB 1M2GA 3S28A 9LDTA 3RYCB 3NH6A 2YV5A 3ESRA 3BE8A 1UZNA 3MG9A 2OP1A 4WMLA 2VNAA 1U2ZA 5CLQA 3RAPR 4YP0A 3RF7A 3V00A 2JAUA 3OOSA 4TXHA 5DHAA 1MQ8B 1TZ2A 4XCXA 1FLVA 3HVRA 3W5AA 4QYIA 2G1JA 4HDAA 2CYAA 4QIHA 4DY4A 5B1SA 1FFXA 2W90A 5LL6P 1G8KA 5MGNA 4MVJA 2B1GA 4X9XA 4YR9A 2IGBA 1WULS 2FN7A 4HGOA 5D1HA 3FHTA 3AKZA 3M6IA 1Z17A 4U8HA 3PGJA 3KEGA 1ETUA 1K5PA 2JLAA 4TS9A 5DM70 2UUCB 1VKZA 4WECA 2V7PA 1OFIA 1QO0A 4XKJA 3FM9A 3IO3A 4WLOA 2M6LA 1G7TA 2GK6A 1F2TA 1C7ZA 1YZUA 2FW7A 5IULC 3DV0A 1K7XB 1YACA 3FX2A 5L4NA 3SJUA 1LTKA 1H8EA 3OPXA 3WYAA 4MQ5A 4ARZB 1Z07A 4BKRA 4G8JA 5DI3B 1G21A 4LHEA 1NBHA 4KQWA 1JDNA 2UYYA 2X76A 3IAUA 3VAAA 3DLPX 3HNOA 1P7WA 2AC7A 3QVKA 1RXYA 2DWUA 2A5DA 3CZ4A 3PNSA 4OMUA 4U02A 4WZZA 1L1EA 5CAEB 4F5DA 1XRPA 1FDRA 3GFOA 3MWEB 5ERYA 1KP9A 2QUJA 3V2HA 1T9GR 3Q3JB 2JFNA 4YREA 2XOKD 1MRNA 3KB2A 1OBOA 2YJ6A 2E5FA 3KKKA 1TCAA 3T99A 3O93A 2DT8A 3GNQA 4F9FA 4NXNB 1ZQ9A 2FPPB 3F5QA 3ISVA 1O03A 2ATIA 3BIFA 3IEVA 3U1BA 2IGTA 4M76B 3DD5A 4QUKA 3CONA 2PUDA 1C8LA 1RR6A 5IEBA 2IC5A 2W2NA 4M9RA 2CCKA 1IN7A 1NQUA 1NRJB 3EGIA 4Z9FA 1G4HA 1ZGJA 1E1RA 2VPQA 3KZXA 2O05A 1UDXA 1V5EA 4QAJA 2IU0A 5AVSA 1NNEA 5KQRA 3MMSA 4MS3A 3BCUA 3G2MA 2XXAA 3AR8A 2FMIA 5LVAA 2C4VA 1CY6A 2R6JA 4ZYWA 4OI0A 2Y6VA 1JFSA 1SY7A 3IQXA 4NF2A 4TS3A 1J2EA 5K3BA 3PX3A 2WWFA 4TLCA 1J42A 3NHYA 1M1YB 3EWAA 4XJTA 3BXZA 5FR1A 3TZ6A 7AT1A 2I91A 1E2DA 3O74A 5EWMA 4BE9A 4JYAB 3FKSD 4TRNA 5HG0A 4ZI7A 1P17A 1GRNA 2QN2A 3EGWA 2D1QA 2O8BA 1GVHA 5D6NA 1EK5A 2HPAA 2IYLD 2DBVO 2W2MA 3C5HA 1SOVA 3GGSA 2D7CA 2ZRIA 3FSJX 3QV1A 4HGZA 1AS0A 2O7RA 4J1TA 3UG6A 4JC5A 3G5LA 4I9UA 1JSZA 4Y9SA 3S5JA 3NT5A 1TKBA 2O3UA 3Q40A 4JT2A 4NDNE 4NNOA 1VL1A 2ZWVA 4OQXA 2MMGA 3ISJA 1ST3A 2CXSA 3UWMA 3VHRA 4EYKA 3K1TA 4KV7A 1M7HA 1M83A 1PR1A 3IIIA 1XWFA 3VYWA 3WSWA 2GBPA 1FNSA 3DFIA 5COBA 2AYYA 3WYEA 1ZCBA 1SH7A 4QM7A 4IVPA 1BRTA 2YHSA 3OA0A 5HKAA 1MU0A 4UBKA 1KDZA 1EVKA 3ESZA 4DA0A 4H1WA 4EUNA 4ER7A 4ZVUA 2AEEA 3LQRA 1NUSA 4GSYA 3I4LA 1HYQA 2RE8A 4QGAA 3IJ5A 1N6HA 2FZCA 1E1CA 1JV2B 2AOWA 5G40A 2E87A 1GILA 2P69A 3PUYA 3MCUA 4NK4A 2C00A 3UWOA 4REQA 3WLEA 4G1VA 5ULLA 3GLKA 4HRYA 1D8AA 2R8YA 2IEAA 3HMKA 1VJTA 3HYSA 1WB5A 1BCSA 3JASA 1PR3A 3Q85A 1ZXXA 5TQ2A 4HTAA 4YC7A 4IUCS 3STWA 1QTQA 2NVUA 2B4YA 3UMYA 1BNCA 1M2HA 1XLVA 4OP1A 3KO8A 4HDRA 4EARA 2J07A 4QDTA 4X92A 3UBTA 3SC2A 1A8PA 4WGGA 5LQMA 4EI2A 3UB2A 1V11B 2C97A 3Q4GA 1CPYA 3ELUA 4R51A 1P9NA 2XZLA 3COJA 5D7NA 4B3HA 3DE4X 1XMPA 3A7EA 3L0SA 4XDZA 5A3JA 5CG1A 4QTZA 3C45A 5KVSA 2LCFA 1E20A 4LAFA 2VJLA 3IILA 3TBKA 4GNRA 3BBLA 1KEZA 2BE7A 4PM4A 4WXYB 3VUFA 4XWOA 4UFPA 4E94A 4BQFA 2VTKA 2E6UX 3A7DA 2HLNA 4UTOA 4CMGA 1AQNA 4ZOLF 5LBTA 3EPHA 2VTDA 3D3EA 2BUAA 3F8TA 4TQ9A 1F9AA 521PA 1HLDA 1EK1A 3NLLA 2GK7A 2JFQA 4QC2A 1M33A 4JUFA 3S1LA 2AX4A 1P0QA 3S99A 3K05A 1UBOS 2XB4A 2PTHA 3F7OA 1FJHA 1YIOA 4MTLA 4XLLA 4LYHA 5FPPA 3WK9A 4ECEA 1V4NA 5KNCH 1SO8A 4RVNA 1QU3A 2PVCA 3NPMA 2WJJA 3UNXA 4PVDA 2A0WA 4RABA 1VJCA 4MGEA 4FW8A 4Z6KA 4Z1MA 1DWPA 1X87A 1XFDA 2CBXA 3C70A 3DNFA 3R7NA 2CUZA 4M21A 3LD9A 3HFSA 4RVGA 2B5OA 1P4AA 3GVHA 3N53A 4YPOA 1IXKA 1S2LA 3HKBA 1U8EA 1HTWA 1R0KA 2Q1XA 3AYXB 3LCJA 4DM3A 1PVOA 2BMDA 1U5BB 3PGXA 4YRQA 2I5PO 5EGNA 3TAUA 1QHNA 3RI3A 3NO4A 1P5ZB 2AOXA 3UN1A 1H2AS 2X6TA 2C3PA 3NWOA 1K6IA 3FWKA 5LN1A 3OTHA 2IPOA 3ZGYA 1RCUA 5I7EA 2P2GA 3GJXC 3MAGA 1SCNE 1QIDA 2H5EA 4P7KA 4Q18A 4EEKA 1SXJB 1R9NA 2I2XB 3O3OB 1KJ9A 3WP1B 1AUPA 1UMBA 3OQNA 1OXXK 3KXPA 2HMUA 2Q5CA 3GRFA 4L5IA 3U0VA 1Q91A 5KNDA 1O6BA 4CQMB 4V0ME 2GJAA 2OLKA 3WKBA 4DKXA 4J29A 1GG5A 3Q7SA 4FBLA 1AQJA 1FQKA 2H51A 2FW8A 4JLVA 3S1AA 5BWCA 3EEOA 4JI0B 1R8SA 2DTDA 1JEQB 1XO1A 1UBFA 2NSYA 2FUCA 5LNK1 2CWDA 3DVLA 4OI1A 2QW1A 5JCOC 2XIQA 4GWLA 4NEQA 3T0IA 1KEWA 2C88A 4JGIA 4XJSA 2XE6A 4TXJA 5I9SA 3EX7C 3L7KA 3DMNA 2VRCD 1QH8B 1ZM3A 3SZGA 5JS2A 1O96A 4OQQA 3A4MA 2GLXA 3MQ2A 3A9VA 3IAAA 1ACLA 1FVXA 2ZBEA 2HC9A 3HXLA 4KGXA 1RRVA 3H42B 4F60A 3CH4B 1W0KA 4WI1A 1JKJA 1N9KA 3OJ0A 5JMWA 1G2PA 3RC3A 4UTPA 3QKRB 4CIXA 1DRVA 4DA7A 2ADMA 2VS1A 3MMNA 1ZR4A 2C3MA 2BM1A 3QRWA 4KQMA 3DC7A 1EBUA 5KWJA 3GA0A 1S0UA 1DV1A 2P79A 2JGFA 4WLFA 3NM5A 3C97A 4IMJB 2J3EA 2XLBA 4CKBA 1W4LA 3OZAA 4Q7EA 1XU4A 5CT5A 3MSCA 2QD4A 2I67A 3KBBA 4BC1A 4KR6A 4WOKA 3RHSA 4B48A 3M49A 3BK1A 3KLMX 5KTPA 1E9RA 1H2HA 3PD1A 2GCIA 2ZUTA 1XTJA 4IIBA 2XRFA 1M34E 3R20A 3TKAA 1P9RA 1E4YA 2K7ZA 2ZWAA 3BDAA 3HUDA 4KDCA 2W2XA 2FPRA 1YHYA 4MJ3A 5LMNB 3A4LA 1E8NA 1DHTA 2ZBGA 2Y92A 3P7MA 2CLSA 2BEVB 3N8IA 4YONB 1DWQA 1VCMA 3NBQA 2G80A 1PD1A 3AVWA 4WK2B 3VJMA 2DE0X 4ZAGA 5I3ZA 5HNKA 3SKVA 1GN9A 2F9LA 5TC4A 3O1LA 2PKYX 3NIWA 2AFHE 2WJYA 1JYFA 2BD0A 3LFHA 2HJSA 4TN1A 5DF1A 1B1AA 2GM9A 2RKWA 4O4HF 1HDIA 5KOJB 4UEJA 2UDPA 1YQXA 1A8HA 3IQDB 4TLLB 4D9JA 4M89A 3KJXA 2IA5A 3O94A 3CWCA 5TNXA 3F96A 1QK3A 3CG4A 3ON5A 3L49A 2Q2QA 4WBNB 1UOQA 2Q9BA 4F96A 3KVRA 4H6XA 3NTVA 2RONA 4BDSA 3EUWA 2Q3CA 4ER0A 3DWFA 3UB3A 1OZFA 1VTKA 3VA7A 2PWPA 4GLOA 1J9EA 1XNHA 3ABOB 1MD9A 5DMHA 1ZRHA 3U0BA 4PBRA 4CFSA 1W5EA 1DO8A 4NAVA 1L9XA 2QQEA 3T5GA 5CEFA 4QG3A 5I7HA 4UUBA 2QJTA 1CUYA 3U4HA 2DR2A 2I1VB 5EG5A 2EZ8A 2R44A 4GPZA 4UJ5A 2Y3IA 1QRRA 1VJ5A 5JAZA 3I9NA 4GI1A 3J81k 1XU7A 2ODAA 2BCJQ 5H7XA 8GPBA 2LR0A 3W5UA 1UM9B 4E4TA 4JJFA 1NYQA 1G9SA 3GJ0A 3MWJA 2PUHA 1B76A 4JEIA 4W9NA 4D79A 2Z83A 4MV0A 4WCFA 3U7JA 4ML3A 3AVPA 3N0TA 4P4GA 4DQUA 4MS1A 4MV6A 3ST7A 5KQLA 1HT1E 3N2EA 4KOAA 2FWMX 1MIHA 2XUAA 4KLNA 4O1MA 3VNSA 2FX5A 4BWVA 2V65A 4B3RB 1JEAA 2B83A 1U81A 1NJ1A 1GZ7A 1MGOA 1Z4KA 2J0UA 4V0KA 1FYEA 1AS2A 3EXIA 1YIAA 4KDFA 3WB1A 5LOVA 3K09C 2O0MA 4KQKA 1H93A 1ADBA 1RYHA 1S3GA 3BICA 4C7VA 6LDHA 1W25A 4EYEA 4HDQB 4OBBA 3H2KA 3IDZA 3LCVB 2HO4A 3FLAA 4GBJA 2CB0A 3H2BA 5JRZA 5FTMA 2R6R1 3AWDA 5EXEA 2Q1TA 3EF3A 3PRJA 2X3UA 2R5NA 3AX6A 1KZ9A 1KMQA 4MVJF 1XIVA 2NWQA 4IJVA 2IBTA 2AMLA 2NNWB 3P96A 4IS2A 3V2GA 1DT5A 2BBWA 3E5NA 3EG5A 3OCWA 4FFPA 5L3SB 4HUQB 1QHEA 1NJSA 2JKZA 3K9BA 3CLRC 4GR9A 4C1NA 1SG9A 4TKUB 3CUEF 3SE7A 1BH6A 3OFND 1M74A 4TRMA 2HOQA 2PGOA 4HJRA 4UUPA 4KP7A 3DV9A 1BE1A 4LJ8A 1MB4A 5U4XA 4DRXA 4WOJA 2AMYA 1NUQA 1DAKA 1J5PA 1Q1ZA 4MGIR 3ZWPA 4BMZA 4DPMA 3WAGA 3IUSA 1JS1X 4N0PA 4OM7A 3QELA 3AEKB 5ITZB 1RZUA 2I6UA 4ASUA 3TQCA 1QZUA 1NVVR 2BAGA 2W8ZA 1W46A 4U4AA 5K0NA 5C2JB 1TLTA 3BBPA 3KTOA 3TOCA 1MC4A 3KE8A 2CMFA 2QVCA 3MM4A 6NULA 2VDJA 4CN8A 1G16A 1ONPA 2XKAA 3JSAA 5F52A 1RWPA 1CUHA 2I3DA 3AUKA 5AVRA 2RGNA 2WSMA 4RA6B 1YB5A 1A9XA 3NC0C 4GE0A 3DZCA 1ZVJA 2FCRA 4EAQA 2VF4X 4DR3B 3CFYA 2PUJA 1E98A 2AN9A 2AOUA 3RYCA 1SCKA 2QGNA 5CA1A 2IXAA 3GO4A 1BHQ1 4YMSA 5IK2A 3RGGA 2WHYA 1V6SA 1ZEJA 4HBGA 5EKUA 4R1NA 3RS5A 3TZKA 3WI7A 5TPWA 3A1SA 2AKEA 2WAXA 1Z7BA 3EDOA 2B78A 2G9ZA 1EHYA 1X9HA 2RHJA 2QSYA 3BTVA 1PX0A 1VJRA 1XDUA 3C3YA 2WNHA 3GGJA 5TMPA 2YJNA 2G9UA 3FMVA 4Y9UA 5FLKA 1MJNA 4K6HA 3GNLA 5DIFA 2SBTA 4GICA 4LSZA 5D2CA 3THSA 2ZRAA 3GNSA 4BO8A 4FC7A 3U3KA 4I14A 3PFIA 3NDIA 3KV3O 3KU1A 1P9WA 2ZOSA 4GZ6A 1KDTA 3B53X 1DU4A 5KO2A 2J5QA 1R4NA 1PI3A 3VNUA 3A4NA 1NUTA 4UU8A 4RYLA 2UZIR 4GXNA 4LDZA 1WBJB 1VLVA 3UVEA 2PYIA 5A62A 1U2SA 2B9EA 4IQ0A 1P1BA 4EECA 4I3HA 1OC2A 2LE0A 3R4VA 1KZYC 3OP4A 4O6VA 2EKZA 3L4BC 4BAGA 3O8DA 2FRVA 2Q1WA 4ARZA 4ZYXA 4DSNA 3A27A 1ZCJA 5DI3A 5L3VA 3P9PA 4FHZA 2X8LA 1XVUA 4LV6A 4L02A 4NCXA 4R98A 5AT1A 5EE0A 5CAEA 3TO5A 1W6RA 2X2OA 3SFTA 1ML4A 1RM5A 4KPEC 2F1JA 3GLUA 4RVUA 3OIDA 1FMCA 3OM1A 4JI4B 1SUDA 2PCJA 4UHHA 3ENQA 3WNBA 4KE6A 2DHRA 3KUXA 2FPPA 1MIOB 3EH2A 1OQAA 4O0LA 3LY8A 2C8LA 2GXAA 5J58A 2QTMA 5B5SA 4IEEA 3OJWA 1MQAA 2VF5X 4O2BB 3SYMA 3LRXA 2EDAA 1PNTA 2RGEA 2VYVD 3QKWA 1OHHA 3CW9A 3JRNA 4FCTA 1PQUA 1QIKA 2P8SA 2CCGA 1FFBA 1G9TA 2QLNA 5ILGA 5AKJA 4BNHA 3E5RA 1E2KA 1UC4B 5FHRA 1L4LA 4CL8A 5A9SB 4XPZA 4KPYA 3FPCA 2CXHA 1ZRSA 1PZNA 3FFXA 3GAZA 5JARA 1GFSA 3IBFA 4HLUC 4A5OA 2CZCA 1ZMTA 2XAUA 1KI7A 3E3OA 3GT7A 4JA0A 5L7TA 4ZVLA 3VHLB 1Q6YA 2B6HA 4EJSC 3EW9A 2ACKA 1MO2A 2IHUA 2ZATA 2ZJBA 3F78A 3NNSA 1L5NA 2DQSA 4MITA 1SELA 5LD2B 2YRFA 4QLOA 1VMEA 3H5VA 2YY5A 3NC4A 3QBJA 3CGGA 4O63O 2NU8A 1ZJ6A 3HFJA 2G5CA 4I5EA 1KZ1A 3CN7A 2SKEA 4AY4A 1M3SA 4NENA 5KDLA 4DNQA 4BUJA 1G21E 5AHOA 3ZH9B 3KLOA 3WIDA 4B40A 4Q4CA 3DLBA 1I7PA 3NFYA 1G59A 2Z6UA 1G5TA 2WJ6A 3QYAA 2JL1A 2IUFA 3C6QA 2CLEB 2APJA 2ZCUA 1VL2A 2P91A 3EIQA 2GCEA 1GSHA 2CV2A 4TWBA 4YAFA 3TRJA 1U1DA 3C98A 2E5WA 4LV5B 1YS1X 2OFFA 1KAEA 3UAZA 1NI5A 5AVWA 3DF7A 3RSGA 2JK1A 4JMPA 4YTEA 3WB0A 2X0EA 4V2UA 3VSEA 5A04A 1FDWA 1TM1E 4WNCA 3TECE 1JI0A 2ZI4A 4CMAA 1CJSA 3HLYA 5IAKA 2ENUA 1WTAA 1YE3A 5IH7A 2V9CA 3RAEC 3E18A 3VYVA 3M4ZA 4GLLA 4PIPA 1GCUA 3H16A 4ZV9A 2RBKA 2O3QA 3R7WB 3I1JA 4IL5A 1NMZA 2XWSA 1P31A 1JHAA 1Y89A 1MV8A 3ADOA 4ZPXA 3UK1A 3TTYA 4E2FA 1R88A 1H8HA 4IY1A 4YRKA 1R9GA 1GCGA 2XHZA 4ND1A 2HXYA 3RQIA 3P4YA 2DHDA 3LC7O 2JD0A 3WOHA 4C2AA 2HFKA 1I3MA 1V11A 1I5RA 2MU1A 3F5DA 3D4NA 3OEED 4BFYA 1PBTA 4MV8A 3NTLA 1OZGA 3FOBA 3UHAA 5GVSA 5AWFC 5EZYB 4YP1A 4C05A 1JXMA 4K03A 2OSBA 3GHYA 4LXQA 4S1NA 3GQBB 3P9KA 4MV7A 4TZTA 1RXWA 5JDCC 4BNKA 1PN3A 1HR0B 3N28A 2A59A 3DHWC 3AY0A 1D2GA 4P2GA 1RHRA 2QP3A 1BA2A 2C4TA 4P4SB 1XNGA 2NV0A 3K9NA 4LVCA 5HF5A 1S4QA 1ZOIA 4KQIA 1Y33E 4ESEA 1W35A 4GPAA 1ZYUA 3U1TA 1T5TA 3KQKA 4Z4GA 1EE2A 2XVZA 1IOWA 1WXFA 3EEBA 3OQIA 1VDZA 4D43A 4KWTA 3HDQA 3OJEA 2AN1A 4C3OB 4CU2A 4RY2A 3NYWA 4E33A 4TV8F 3W2GA 3EBOA 5AKHA 3V2IA 2IU4A 3ZI0A 4QBTA 1YO6A 3V2UA 3BE5A 3GCWA 1MFZA 2VN8A 2ZYTX 4HVAA 5IVIA 1NXXA 4QKQA 4JOQA 1QJCA 1B0PA 3AKCA 2IT1A 3L43A 2ZJ7A 1E58A 3Q7RA 4JQCA 4YRLA 1XZQA 1K9VF 4N7JA 2PYDA 4BNYA 1BXRB 1KC1A 4ZRMA 5ECYA 1CQIA 1U5BA 5LZ9A 2NO6A 2JFFA 2ZJ2A 1P19A 3ZEIA 1NVMB 5FOWA 4B44A 2DBZA 4F3TA 1NTOA 3RKRA 1OAOC 3P94A 2QLBA 4PIMA 3GGOA 3ZW8A 2EG5A 2I99A 3AL3A 2HLPA 3OMXA 4ZI7B 3AR5A 4LSWA 5KREA 1SXJA 4C06A 2PH7A 2ATVA 2A2ZA 3EFOB 3WKAA 2Z9CA 1VI2A 3EEFA 2Q27A 3NHUA 4CQMA 1JIIA 1VXOA 2XYVA 4NBTA 5HBGA 5KQGA 2PA3A 1FYWA 3ILSA 4M36A 3TR5A 3EPLA 1H1DA 4HN9A 1B26A 2IEIA 1NTRA 3RBXA 4HGQA 3MMZA 3SXJA 4BLQA 4DCJA 4KQHA 4PGFA 4GOND 2G4VA 1DFIA 2I54A 4DLUA 1C0PA 1GAQA 4HNQA 4FILA 2OPHA 1M75A 2OUIA 2ANBA 1QF7A 3WGKA 1ATZA 1QH8A 1QXSA 2FUEA 3WGTA 4CR7A 1F2VA 3UEOA 4GPBA 4JHXA 1M0TA 4LVOA 3VPDA 4B76A 3U7HB 3DWIA 3UWSA 1EVYA 2HWUA 3NNDA 1Q2XA 3KPJA 3TSOA 4BP3A 3KT8A 2W6JD 3QKRA 4UUNA 1RQNA 3R6WA 1I9GA 3IRVA 2BF4A 1SIOA 8LDHA 3LUKA 2DLCX 5IT0A 5B6JA 4D8YA 3LWZA 4F92B 1TPZA 1WB6A 2G9RA 1I0ZA 3FSGD 4S1TA 1AGXA 2QG9A 4U7DA 2QUZA 2W58A 3AFGA 4KSCA 3WKCA 3N0VA 3GC6A 1YMUA 2I33A 4NZ9A 4RGQA 5CLLA 4N0MA 1JVNA 2IDMA 3CZCA 3E82A 4CHGA 1KVUA 3L46A 4JB3A 4YMLA 2FRDA 4XQEA 4E31A 4ZT6A 2ZM5A 2RB4A 1QZTA 2X8JB 4WH0A 2B4RO 2SNIE 3B1XA 1PW7A 3GPLA 4JENA 1S8OA 4M9CA 4QOIA 1Y8CA 1A72A 4INJA 4DJEC 2Z09A 5LB2A 5BSTA 4K9PA 1L5MA 3E70C 3EE6A 1IM8A 1DJMA 1WL8A 1L7BA 1NVUQ 1PWYE 2BEVA 3FUXA 4FOSA 5E0KB 3DMPA 4N5IX 4OHFA 5BV0A 4EHJA 2OCAA 3ACDA 4BZWA 4PLGA 2NZ8A 5KVQA 4IH1A 1SU8A 1W30A 4LNHA 2Y67A 5CJPA 4DCMA 1X70A 1Z39A 4YCCA 4R2WA 1A0OA 1JG1A 3PS9A 4IMRA 2IYYA 1JIUA 3MWGA 4OHCA 4Q4DA 4CRWB 1U5AA 1WUJS 4MJLA 3QIVA 3DTYA 3WWEA 5C80A 1GGKA 1YU9A 5KOJA 2GGSA 2AZ4A 1R8QA 3RVMA 1ULZA 5LOVF 1D6JA 1MRZA 4OL9A 3DFMA 4WPGA 1IPFA 5CM2Z 1BDJA 1VKNA 4EIWA 2QMEA 1UUFA 3CUTA 3DPSA 3P4XA 2DQKA 3OE5A 4G2TA 5FADA 5JW6A 3HXQA 2VPTA 4TLDA 3AESA 3P5BA 2ESRA 3C6BA 3CF4G 4WBNA 3O0TA 3WLQA 1JR6A 1L7QA 2D1RA 5ALIA 4LRWA 2PTGA 5EMLA 4DY6A 4EKGA 3FNQA 4R3WA 3RSSA 1IULA 1NVXQ 2QQFA 2H16A 3ANMA 4MRNA 4ZDIA 3TR6A 4RHCA 1JFFB 3G5UA 4Y6LA 5DN6A 9ABPA 3P97A 1ZZEA 3I1IA 3PCXA 4KH0A 4V38A 4N8SA 4LWZA 2Z5LA 2C0PA 3JR3A 1XE3A 2JZNA 3JV7A 2OVFA 3CVOA 4OLHA 3BL5A 3ZH2A 5JR3A 1CUXA 1FEZA 4FYKA 5PNTA 1WUYA 2VZ0A 3NJ4A 4B9EA 4MIEA 3MTIA 1N92A 5C7YA 1JZQA 3CJTA 1PV4A 1EBFA 1VXRA 2CB9A 5FT9A 2WZCA 2EZUA 1GXSA 3NHFA 4C7XA 5BMVB 3TM4A 2YXBA 1PIWA 4OEHA 1GN8A 2DWOA 4I9GA 3BIWA 3ZQ4A 1IQPA 4V39A 1AHPA 1NZFA 2IX3A 4JIMA 4GECA 3AY6A 1LSUA 5JSUA 1U6KA 1VHQA 1NY5A 4C4AA 4A5SA 1U2EA 3ESQA 3X44A 2PGDA 1F20A 4Q1EA 1HQKA 2Z6VA 3BGOS 1R3UA 3PT9A 3DQZA 3PWKA 4LJ6A 4YCSA 2DJ5A 1LPSA 3IQHX 4WKNA 2I4TA 2AFIA 4ZO7A 3UWKA 3CM0A 4KMSA 3SFZA 3VRHA 4C4PA 4RL4A 3Q8LA 2PZEA 3N2IA 1JWLA 3T0FA 1WUKS 3HADA 2RHWA 3U7QB 1GCOA 3PEFA 2Q6IA 3RG2A 1UP7A 4M37A 4ZAXA 4YT4A 2W6CX 4NP6A 4YV2A 1QGOA 2QX8A 1CUSA 1PYGA 4K0RA 4UNRA 1T35A 1ESNA 3NIGB 4U2CA 5FNVB 5JQGB 4CI9A 3R4CA 2BRUC 4QHSA 4JYCA 3T5TA 2O5VA 4C4SA 1JXQA 4V1CI 5L3SA 1UAAA 4HUQA 1MVLA 3VR2A 3L7CA 3E8SA 5ALFA 1T5DX 1Q50A 2PSHA 3QTBA 4TKUA 4AYXA 3SHVA 1DQSA 1XEWY 2ZIZA 3COVA 1KKMA 1UBKS 4E03A 1OTYA 3SHQA 1JSXA 5F21A 1RJDA 2ZRPA 3G23A 4MO2A 4ZQGA 4EA9A 2J5KA 4K6KA 2P1DA 1GU0A 3LWBA 3DBHB 4N0QA 5ABPA 4UZFA 5D1NA 1JA0A 1OX4B 2I78A 1P1JA 3AEKA 5FV7A 3TW4A 4Z7OB 2VBCA 2II6A 4MUMA 4RXTA 1F0PA 3DO8A 4E07A 2Q5LA 4DV0B 2QTZA 1TA9A 6ABPA 4YLYA 4IHQA 5FNVF 4Y2XA 3V48A 2ET6A 1BC5A 2XTJA 3I42A 1R9MA 4W5WA 4WLNA 5F77A 3WZMA 4FB4A 4Z9XA 2YJ3A 1W52X 4RA6A 1GR1A 1ZVMA 3A05A 3BWMA 4LZJA 5CTAA 2BFOA 2QVXX 1QHFA 4E2ZA 1DLIA 3A2NA 4ILEA 2FX3A 1G3IA 5FWXB 3CEHA 2OC9A 4X0EA 5ERGB 1L7NA 3TINA 2Q2WA 2OAQ1 3DMGA 3L7IA 4PZEA 2WM9B 4D8VA 1Y4SA 1IB0A 5HJEA 1ZOOA 1KI1A 1QLJA 1T26A 3A4YA 4MLCA 5DLYA 4BX9A 4LF6B 2ZB2A 1LBEA 1P9LA 3KSAC 2QA5A 4FM9A 5MGBA 4HPXB 4IQFA 4JBGA 2P9FA 1O08A 2FMXA 4A8HA 3O9MA 3TWOA 4PEVA 4XTRA 3OURA 2CNWD 4MQBA 1Y3CE 2M98A 4W4TA 5J63A 4M7PA 3DT9A 1J7KA 5DLDA 3CRRA 1X1CA 3IQGX 2EJCA 4JP3A 4OA5A 1AN0A 3C5EA 4R81A 3RRJA 4DILA 3D8TA 4EELA 5BNZA 1P75A 4QUGA 2WV7A 3AR4A 2HMYB 3EA0A 5IN4A 2Z1NA 3MTDA 3FWHA 1ZEMA 4G41A 4Q24A 1LQTA 1Q3KA 4JB8A 4NE2A 1CR2A 4HWSA 4UFOA 3EZGA 3VC1A 3PXEA 1QPBA 1II0A 4AZTA 2OZPA 2V6MA 3F3MA 1QR6A 4ZI2A 5HSGA 1ZJJA 1AXGA 4X7MA 4MRAA 3IKVA 1AKYA 4RJLA 2AEJA 2YJTD 2ZG6A 1X13A 5J40A 3SM9A 3TFOA 5CDFA 1E9SA 1HZZC 4G81A 1BKYA 4KFSA 3QVSA 4X20B 4BAUA 1EP1B 4O5AA 4D0SA 4GX1A 2XCTB 5ENDA 3MBKA 4N5MA 4OI2A 1A96A 2X4GA 2ZW9A 3K9FC 1C3XA 1ZAYA 3ITKA 2GRUA 4FZ5A 2I87A 1ZUIA 1DQNA 3ZGLA 5AM4A 1MIOA 1MC1A 3AB8A 4FYWA 4DDKA 2ZRDA 5HDBB 4EPVA 1U3WA 1OGIA 4L1KA 3ACCA 3CU5A 1DB3A 1IATA 2QTHA 4KV9A 4O2BA 3ZGZA 3MN1A 3SE0A 5K4AA 1IK6A 1WBDA 3LIPA 1OH6A 2BISA 3AETB 4QQ8A 4BP1A 4N6GA 4ENPA 5ES4B 2V6GA 4AU1A 4LFBB 1NLZA 3W6NA 1S8FA 5IN5A 3ZLJA 3DONA 4U2BA 5TJHA 3BRQA 4FXPA 2A4MA 2ADFA 5A9SA 3B1FA 4CM7A 1ZD8A 1DMSA 4BNZA 3FBWA 1QJ4A 1K06A 3HKEB 5WRFA 3NATA 1XDGA 1ZA2A 2ZIWB 3R5JA 1I13A 1XZLA 3I2JA 4UM9B 1M6NA 1Z5VA 2PFGA 3ZDAA 3I09A 1E6KA 1XDZA 2L18A 3GFRA 4CKEB 3KJZA 5I9NA 1DDOA 1PLKA 3IOYA 4G1FA 1A50B 4FDUA 1CEXA 1N5KA 2E4VA 5DGDA 1FE8A 1P7ZA 2ZETA 4JJ4A 1JTVA 5B2ZA 1L5GB 4RSGA 2RGGA 4A2PA 1FFHA 4WKCA 3OPYB 3O7MA 1N2SA 4HQRA 4Q47A 4RYDA 1Q11A 1Z6QA 5C32A 2NO4A 1SUIA 1J90A 4Y6QA 3EIFA 5EMNA 5ER9A 4DBLC 4NSNA 1W581 4P83A 3WGZA 3TNDA 1DAHA 3QXGA 4WOPA 2W8BB 2AUMA 3DV2A 5JNUA 4F1WA 4IDPA 3D3WB 5LZ8A 5JADA 1M6EX 3KHUA 3L9WA 5E3JA 1T34A 4LJYA 2FSUA 5JYCA 4F2DA 2WTUA 1I4TD 1OTHA 1Z5PA 2AI2A 3BJMA 3BXEA 1KGSA 4KO1S 4YQZA 5JZOA 2GZAA 2RK6A 3DF9A 3TOXA 5CT6A 3DKRA 4EFKA 4ITRC 4N3NA 4TMTA 3KOZA 2J5RA 2P3QA 3R7WA 4FMCB 1M6WA 2WG2A 5DNWA 5E2IA 4V1CA 4G24A 1KU0A 3N58A 1KYXA 4OYYA 2KQUA 1OU0A 4GW3A 1TEXA 2X5KO 1EPUA 2JJYA 3O0DA 4KIFA 5FLXA 1PK7A 4D8WA 4QOFA 2A0UA 1N5DA 2BFEB 4R31A 4D5GA 2RI0A 4XVHA 4OB8A 3OTOB 3DO5A 4G9GA 3IIKA 3OMWA 5H0IA 4A4DA 3W90A 2E5LB 3MAJA 1ECCA 1YZKA 2R2GA 3JQ9A 3A31A 3B7PA 2OO5A 3SHWA 2OV1A 1IUKA 2P5SA 2WT8A 3OO0A 1GJRA 1LLDA 4HF7A 2I6GA 4UNQA 1XKLA 1WUTA 2DT5A 2O1XA 4Z8XA 5EZYA 2VHQA 4CBVA 1M5RA 4ZT3A 4ZQHA 5ESDA 5KNLA 5JNRA 3A6PC 2FE1A 3GQBA 3U3MA 3A9WA 2IYZA 3G2IA 2WWYA 1O94A 1U3UA 3WGHA 3PRHA 1U04A 2N75A 2PY6A 2Q28A 3EBLA 2JVJA 2V5VA 1WDKA 3PA8A 5BNFA 3A06A 4DSOA 2EP8A 2ASVA 1VL0A 5I7AA 4EMBA 4EZBA 2CJXA 1CD5A 2WG0A 3B6JA 4G67A 4MYTA 1FF9A 4BVBA 2PIDA 4L2IB 2R1UA 3HABA 3WLSA 2IHTA 2W43A 3BRWA 1C41A 2CJFA 1NVWQ 4JROA 4HFMA 4ZGGA 4J16C 1WSBA 1ODKA 4Y6SA 2IYFA 4HGRA 2WM3A 1JI3A 2GZ3A 2P5UA 2O0JA 5C81A 4ECAA 2FY8A 1B8OA 3HBMA 4IWNA 1RHUA 4X97A 5KTMA 1H2RS 1RJ9A 2F9MA 2XWBF 1MR3F 1DO0A 3C43A 5F1OA 1BXRA 2N46A 5AVQA 1RC1A 1U1EA 2IIQA 3NHPA 3MGCA 3AH8A 3W4IA 3ZE8A 4F93B 2L17A 3L8HA 4QJIA 4Y7DA 4BNWA 4RXMA 2WICA 2ZSBA 4DNFA 3ZC3A 3RSOA 2H9IA 4EL0A 2FN9A 2MR6A 4A8JA 1JWAB 4J75A 3YASA 5F78A 3OF5A 3USCS 1PK8A 1DNPA 5GQSA 3IMCA 5ALPA 4N5DA 2M1ZA 4J9UE 5KTOA 4AVYA 4BQSA 3EFOA 4LJKA 3BTOA 4AY2A 2Q5IA 4KHZA 3RT7A 1I1OA 3GJRA 1G7RA 4PZ0A 3G9XA 3SC4A 1IG3A 3WHPA 4ENVA 1QQAA 3HNRA 3CBQA 3ED1A 3B6KA 1NM5C 5TE9A 2GN9A 1Y6GA 2VDVE 4ZVQA 1CULC 3AHIA 1W4ZA 3MJFA 4AJLA 4D2IA 1Y0BA 2G6TA 4ZVOA 3WISA 1NW9B 1CE8B 4BJ6A 3ZKWB 2ZRNA 4JU9A 3I12A 2FN3A 1GGVA 5AW5A 5K6AC 5HPYB 1JHQA 5AKEA 3LZ6A 4Y9DA 1O6FA 1OV4A 1GHTA 3RC7A 3ZZNA 2YASA 4YAEA 1QR2A 4HWPA 1II9A 4FFWA 1YL5A 4HN2A 4LC0A 1BDMA 4N7BA 3FBGA 4KXWA 1YULA 3DR3A 3IBTA 1RCFA 3EMDA 3HB1A 1OFUX 4QDJA 5JJ5A 4M7RA 2QYHA 4MOWA 4UAGA 4DVJA 5SY6A 4WBNF 3ADCA 1IB6A 3RSFA 3S2GA 3EVZA 1J99A 2ODEA 1OPRA 4IJKA 2QLMA 2P0YA 3DKKA 4GOXA 3EPRA 3TZLA 5LXTB 3ILXA 4OGKA 4H27A 1D6NA 1JJFA 3PC8C 3T4UA 1AGPA 3GJ5A 4J1SA 5TSDA 2F55A 4CM9D 2VI5A 1BZYA 3UJPA 4YJKA 3KVVA 1D2MA 1PBNA 2VNSA 2QXYA 1LU9A 3KOYA 1A2OA 1J2JA 5IAGA 1AKRA 1DG3A 1SXJE 1Q74A 4U7GA 3GMTA 5TQVA 2WE8A 3DHEA 3C14C 2X8JA 1LJLA 1A9SA 3C8MA 2CXPA 3H5RA 4DG9A 1H1LB 2E4YA 3FPKA 3P9RA 2GAJA 1BXGA 1GAEO 4GVPA 4RVOA 3PHCA 3VPCA 4AROA 2F1OA 5L95A 1H4QA 2J0QA 3MTQA 3V4FA 1XEWX 2JASA 2YHUA 4HADA 5F51A 2H1HA 5C31A 4AC9A 3HRKA 3ROMA 3HWWA 2HTFA 3OTWA 1RQGA 3UQZA 1N2IA 2FZKA 3FWPA 2CLFB 4K28A 1PL7A 4LQ4A 4MV9A 4WACA 1UDRA 5TQJA 1ZS9A 4ADSG 1E62A 1N5MA 2EXXA 5E9JA 4TPKA 3GP8A 121PA 3DXYA 1GRRA 3LQ1A 1G2OA 3DBLB 5DISB 3OEWA 4E6PA 4EGAA 4QRDA 1WE2A 5BSKA 3QFTA 1FU4A 1CEYA 5EN4A 4NE9A 4EGCB 2BL4A 3HYLA 1KBQA 3R3UA 3E9ZA 3LGAA 4MIOA 1II8B 3DDUA 1P3DA 4FUTA 2Z3WA 3OZUA 3QKUA 3GFGA 1EWYA 3I3OA 2YMLA 4ZU1X 4TKMA 5FL7D 5GGXA 4DLVA 2DFLA 3OZCA 4X44A 5AM3A 4OGWA 4YALA 1O54A 1YQEA 1K86A 1ZK2A 2XMBA 1UKZA 3MGGA 3ORSA 5F7XA 1EK6A 2WMDA 3OU6A 1EGQA 4OHWA 2IS6A 4LDRA 4X45A 3V7FA 3L7LA 4IWYA 1SRQA 4NMMA 1JFFA 5IZ4A 3B2NA 2PGAA 3FIUA 3RRNA 1UMKA 4LKOA 2FMTA 1C1HA 1RKUA 3G0GA 4YBRA 2QN6A 3GPBA 5I8PA 2G83A 1FFSA 1AK2A 4LOJA 5B7GA 3CSSA 4L3OA 5A03A 3FCAA 1GEGA 3EYWA 3EY4A 2V7QD 5DM2A 3VYSB 3SR0A 2FLWA 3BGDA 2AWNA 3A1UA 1Y63A 3MF4A 5BMVA 5EJ5A 2OTCA 3N3AC 2N1BA 1E3WB 1FJ2A 1GNVA 1YJXA 3JALB 1E2QA 1UFQA 4L7VA 2PZJA 4KXUA 3GLGE 4KK4A 3WX0A 5E95A 1V4BA 4TLBA 3QX9A 5MN5A 2WWIA 3IHLA 3L0ZA 4F8EA 1S2DA 5KHAA 3W9BA 4ENRA 4DLXA 5GM2A 3IIEA 4LQCA 4B71A 1HFEL 5AI9A 4CMCA 3FI0A 4BO9A 4UD6A 1W0JD 4A8TA 3GMSA 3WJ2A 4ALNA 1XXHA 2Q6OA 3VKGA 1HE2A 4G4SO 4X95A 2B92A 3Q3IA 3U48A 1N3YA 4YXFA 1N6LA 3IVAA 3UT6A 3W2TA 3E23A 4M8NE 2HBRA 1YOBA 2Q3FA 5HIJA 2VHJA 2OD7A 3KUCA 3UKDA 2G1PA 4ETWA 1ODLA 5F7JA 2O2DA 3NDBB 4PSDA 3HKDB 2ZRFA 3NT4A 3OT1B 4PG4A 3ZE7A 3X2SA 2WU3A 1T10A 3F6EX 1OZHA 1ODCA 4RD6A 3STHA 4ACBA 5FNVA 1R0XA 1SXHA 4YO7A 1MX9A 3HFGA 3DMTC 4XYGA 2QQ5A 2R4UA 2WKQA 4L95C 4R8MA 3NOQA 3M0EA 4YQYA 1EFVB 3JD4A 3K0CC 3SJZA 4FIDA 3L6DA 2F1RA 3HCOA 4KAXA 1NYLA 4DREA 4DMMA 2PGJA 5L45A 1ZD9A 1S9HA 3ITEA 5DBFA 1ADFA 2I22A 3QXJA 1EM6A 3OAAA 1U3DA 1TEZA 1P2FA 3Q0EA 2E6KA 4LRQA 2JIQA 1H3FA 4RMNA 1Y9AA 3T5DA 2ZTUA 1F9EA 2JIPA 4XA8A 5CLHA 5KYUA 3OP1A 1OX4A 3GJSA 4O0MA 1CZNA 3FJ1A 5DPMA 1GAWA 4FD3A 4AMGA 2WZDA 4EBBA 2RH8A 3LP8A 5KYTA 3OTGA 5GOTA 4EYSA 5JROA 5LU9A 2R96A 1P5RA 1ZM2A 2VO1A 2AFIE 1Z0IA 4NBNA 4KR7A 1PAUA 1Z68A 3LUAA 4YRAA 2ZSFA 1IZZA 1PJAA 1SBZA 2PA0A 2ASEA 4JLUA 1RWVA 4H7HA 3C3XA 4OP2A 4O2BF 2BGTA 3BHMA 2GVNA 5FWXA 3EDCA 1Q7CA 3BMOB 1I3CA 3EGDB 4UHFA 2GHQA 1EESA 3WLIA 2Z5VA 3OZGA 3SX2A 4L8WB 4R8LA 1RM3A 4DFDA 1WUHS 4P2BA 4L15A 3WLKX 2D7DA 4JWTA 3II6X 4GRAA 2CXTA 1Z73A 3HGTA 3OPMA 4CT5A 4BPRA 5T8KC 1HE3A 1AGNA 4E7OA 5JFGA 3SZOA 3PC7A 3VPBA 4QEKA 1Q1AA 5IKXA 1D4ZA 3THYA 1Y37A 1T4MA 2QGFA 3ZQKA 3MLEA 5BNIA 1SBQA 1V1MB 2FEOA 5E0OA 4MV3A 3ZD9A 5CB0A 3JQFC 3MOIA 3NR2A 2HPVA 4W5NA 4ZARA 3SNKA 4PTLA 3R9IA 4XCVA 5D85A 3OY2A 4B4DA 4MB6A 3HPRA 4QO8A 1N9ZA 2QRVB 1UKEA 4MICA 5AW9A 3CLVA 3R5HA 1H2WA 1PW5A 5ALJA 4P7BA 3BL8A 2QLFA 4NDZA 2CSXA 3PDJA 4FGZA 3CNEA 1PEDA 2YBDA 2G0TA 2AG0A 2VDWA 1PS0A 3IVMA 3D6VA 3LXRA 4H31A 4CI0B 4NKRA 4YS6A 2GTPA 4EOGA 4F3RA 2XUDA 3KUKA 2DHEA 3RYHB 2VOEA 2CFOA 1WEHA 4JQZA 1IN1A 4C0HA 4RBNA 2VYNA 1XCPA 3DDSA 4HDNB 2JJ1A 3EXAA 1LBIA 2CKMA 2ONYA 4X20A 3SDZA 1E7MA 3DYVA 1V8OA 5IM5A 4E30A 1QIIA 4KZPA 4NBWA 3WDSA 2C54A 4I1UA 1JU3A 4KH1A 4PONA 1W85B 1MX1A 3PICA 4UVDA 2H1IA 2JLXA 4C2UA 5CFPA 3A4VA 1MXHA 4JBLA 2QENA 3EN0A 3OH8A 1V2HE 3FOEC 2Y0PA 1CRZA 4G0YA 2BTOA 1XLTA 4AURA 4BO6A 3AETA 2VJYA 1M67A 1B6RA 1KETA 5HKLA 2HYDA 1T4BA 3KT3A 5DTEA 1SZJG 2ODQA 2CNLA 4EQZA 1NOIA 2OQRA 3H9UA 5HUHA 2DPXA 4HVLA 1F8YA 3HKEA 3JWJA 4RMHA 2QMQA 1Z0DA 1ACJA 3KC2A 2H63A 3H7AA 4OJQA 3VZSA 1H42A 3ZYCA 1UMDA 3BYZA 5CVEA 5EZYF 4CKEA 3DJFA 1YFZA 2JFOA 2EQBA 4LCEA 4YJHB 4JY7A 3D5EA 1TLFA 2R5FA 4ZAYA 4BQPA 1MMFB 3PLNA 1WW8A 1EGHA 3BAZA 1EP3B 1SCJA 1RFLA 4UVIA 2J09A 1RBYA 1V3QE 2VF2A 4XQ9A 3VFDA 1S01A 4FFNA 3TSAA 4ZHQA 1T6NA 1GQYA 3OPYA 1BE0A 1R10A 1D04A 1U0OC 4ZT2A 1LX7A 4IUYA 5CDFE 2PT7A 4W5QA 1NVBA 2NX2A 3TH5A 4MWEA 3LHKA 3GGGA 3QEAZ 4DCGA 4EB8A 1YVRA 2A30A 3VPSA 1KARA 3KV1A 4GRIA 2WJ4A 2W8BA 4ZVSA 3WWZA 2A4KA 1JDUA 4BLUA 1YJ5A 1WXXA 3D3WA 1DG1G 3A1EA 3T38A 4KRYA 1C5KA 5EHIA 1QP7A 3MGKA 1WXGA 2GILA 4DMHA 2JFGA 5GZ3A 1U7ZA 5LDGA 2PUFA 2AI3A 2XVMA 5AM0A 2GPYA 4DSZA 2AFVA 3BAFA 3K8OE 3S8EA 3L4SO 1TYEB 4IIHA 2WWVD 4DUGD 1Z2NX 1JQBA 4D6XA 2C92A 3EFEA 3KQOA 3HA5A 3DB2A 3LU1A 1G6HA 1VSBA 3WV4A 5LYJF 4RULA 2PS1A 3BG5A 1H5QA 1C1DB 3UOGA 1PJCA 3GT0A 1PVVA 4FK8A 2ZWPA 1Z3IX 2BFEA 3DMDA 5ALNA 3VO1A 1NQVA 5FFFA 5ESXA 4KXYA 2PEZA 2J6HA 1Y8QB 4J0CA 2JFBA 8ATCA 2JKYA 3RS3A 3ZVRA 1XZDA 4DBVO 1K9SA 2BFDA 4FZRA 4H60A 2HCBA 5IFLA 3JQ8B 4X1KA 5GZ1A 3OA2A 1Q22A 5LQUA 2QE7D 2R79A 4ND7A 5HKOA 1JT9A 5ED0A 1UJ5A 1UJMA 4ZJYA 5ER6A 1EJ6A 3KLBA 1MEJA 1U7TA 3CMMA 1X1QA 1ML3A 4CT0A 2PUBA 4G5GA 4GUDA 1ZJ4A 2V8BA 2J33A 2YIMA 3G8DA 2UYGA 3GFVA 5EP4A 5BYBA 4DRYA 2VQSA 4RHTA 3U5TA 1P2UA 1AM4D 2EP5A 1N6KA 3FR8A 3HG7A 3EOAI 4OQNA 4JYPA 5EJ7A 2GF9A 1WTCA 1D2RA 1IL0A 3CT4A 4LDQA 3AB7A 3O2QB 2H2IA 3SEFA 2O59A 1W1WA 4L2IA 4B5LA 2HHJA 1Y5NA 3WL4A 3N0RA 3DFUA 5L51A 4WA8A 4BRZA 4ZANA 5DMXA 2B99A 2NADA 4IV8A 4K6MA 1BDIA 4S1WA 3WC4A 2P77A 5HVNA 2H52A 3PYMA 4BN4A 4G1MB 1WKCA 2L2QA 3KJNA 4IVNA 5D84A 2CL7X 3BL6A 3FTDA 4MKXA 1G3QA 2CV0A 1WCYA 2YW9A 1ID1A 2GPBA 3CRZA 1LDBA 1TPYA 3LY9A 4UC0A 2MYUA 3KB1A 4HV4A 4LJ5A 3OKPA 2IOYA 5DM0A 1E9BA 2WTEA 3VJLA 5ALYA 5A9TA 3JAWB 4JUDX 1RFGE 4HR7A 3UXHA 3ZE1B 3BREA 2EEZA 3INNA 4XH9B 3GELA 2BKAA 1O7JA 2PFKA 1P91A 1M6HA 1PL8A 2QN8A 2Y66A 4PZLA 4DLNA 4WTOA 2DZDA 4WUTA 4LXTA 4B09A 2FWPA 3RG8A 3RSQA 1DBSA 4C1BA 1WBBA 3FTFA 3QVGA 1IBCA 1JW9B 2Y1WA 3OF3A 2HXSA 4CIYA 3K6SB 5I4CA 3DE0X 1CSEE 4MW6A 1YRAA 3E2IA 2OLJA 3DL0A 5DHSA 5K0EA 4PPGA 4KYUA 1TL7C 1RLOA 1M8FA 3ZWWA 1RWXA 5ICSA 1E18A 1DHRA 1RQPA 1XELA 2ICAA 4BLTA 4JP8A 4KDEA 2DC1A 2IXDA 1DKRA 1CE8A 2J1LA 3L5KA 2AEFA 2J46A 5GJCA 3H1TA 4QD3A 3WSTA 3CS3A 5HCNA 4DHWA 5LZ5A 2CXUA 2R9VA 4ZO8A 4ZCRA 2XUGA 3IULA 3KOOA 4DB2A 3PR3A 1W96A 1U2TA 2Y1LA 3G0DA 1XVAA 3N07A 1EZZA 4FHCA 4GX2A 2QTBA 1ZM9A 3CX7A 4LW8A 1LZKA 4IDFA 1Y6ZA 1IJBA 1SFRA 1SWWA 1YAHA 2ZVDA 4LOIA 1YL7A 4Z54A 2EWWA 2FPLA 4FINA 4K1LA 4ZZ2A 4UBOA 2VAWA 3Q6IA 4YFVA 5AW7A 4YRIA 3DW1X 2Q0SA 3SQNA 1FYFA 2LIVA 3IPAA 5LXTA 1PHPA 5IUKC 1HE8B 3RNLA 5AUPB 1SUPA 4S05A 3J81A 4X65B 4RM3A 1KSGA 5HWSA 5HRUA 2C7QA 5JY6A 3H17A 4X91A 5ESRA 2ZXUA 2OV8A 1V48A 2ZTHA 2XT6A 3VPHA 4ZMSA 1C14A 1QIJA 2X5XA 2PH3A 3ANLA 3EGVA 4XOIA 3ZDYB 5BMVF 4RK4A 1H1LA 2VVTA 5FWYB 4ANFA 4ODIA 4D9CA 3UXMA 3O8NA 4B3DA 1V26A 1J8FA 1CUFA 1OMOA 1VHWA 1IQRA 3JATA 5EMHA 1KDPA 1PT8A 2BYTA 2BN4A 3BCHA 3GFBA 3NWBA 3T5AA 2DAPA 2ZI6A 3DZIA 3I9V6 5EEHA 3BIJA 4PW0A 1XMXA 3LPAA 3W2FA 1POWA 2GAIA 2XTNA 2PX8A 4EY4A 3DAHA 4LHWA 1KY4A 5EIAA 5BSFA 3E9YA 4PQFA 1DXHA 3ETHA 1CT9A 1SB8A 2GFQA 2ZWMA 4PYOA 3V1NA 4Y2QA 2OHHA 4IJUA 4B6PA 4Z86A 4PPFA 3ZV6A 5B7QA 1QAOA 5KU7A 2ILTA 5AI5A 2X19A 1XYYA 3PR1A 1T0JB 2RIRA 2PDAA 3HCPA 1CW2B 1DBWA 1LTHR 2W11A 4D7AA 4QQRA 3TQOA 4QTUB 1D0SA 2XOKA 3OY7A 3RVBA 5BN4B 4XGQA 5C51B 1II8A 3PX2A 1EIZA 5JBNA 3TD2A 3IA2A 2ONJA 2HCRA 3FPBA 3BGVA 3VU9B 4WOBA 3LC1O 4CODB 1FRVA 2GD6A 3QXXA 1EFDN 2O8VA 2QD2A 3EOZA 4NV0A 2ZAGA 4PCUA 4AP9A 3Q9UA 1VKHA 3QY0A 1MAHA 1F4VA 1T6XA 1Y9DA 2FEMA 2V7UA 2ZB4A 1F8XA 2DHCA 1DSSG 4IZIA 3RYTC 3ABQB 4DIDA 4U0JA 4ZEWA 3ZJ5A 2WD9A 3LDUA 5KOHB 2H7XA 2XB2A 3FHLA 4RPGA 1HY3A 3RS7A 2PUAA 4JC8A 3G7UA 1TJ3A 2D0IA 1VSVA 1OI4A 1VPLA 3GA5A 4DM4A 1LI7A 3ZD7A 2NUAB 2BMEA 5LC1A 2XKJE 4X7RA 3SMVA 1KQOA 1E59A 1FS6A 1SHTX 3WBKA 2HMTA 2H2HA 2PXCA 3FKSA 4CEHB 3FZQA 2QTAA 4KACA 1NBWB 2CLOB 1BN7A 3F71A 3ZS8A 1VGRA 3CT6A 5J4VA 4JYMA 4JLNA 1E3WA 1U1GA 3JALA 3KQWA 5CVCA 1MOSA 2R7LA 4M1QA 4P4UA 3WLJA 1PG0A 1AT1A 3LYHA 1E5XA 4IDGA 5FFNA 3H5TA 4QYSA 4AS2A 4QLBA 4LJ9A 1Y6QA 1NMYA 3FCSB 3JTEA 4B83A 5FUXA 4DDHA 1NW4A 3TEJA 1X0VA 2PYZA 3PIRA 3R3ZA 1GTZA 4PLZA 1F7VA 1XQXA 1UDWA 4I1RA 3R9KA 1KJNA 3ZOKA 1Z56C 4D46A 5DHPA 1GAJA 4KWIA 1EWRA 2AR0A 3VR5D 1KE1A 2F4VB 2CL6X 2BLLA 4DAEA 1E5VA 2A0FA 2CDAA 2CZGA 1ZNWA 4WKPA 1CETA 2IOQA 3OT1A 1CY1A 3OIYA 3T94A 4O2AF 1WV1A 3TEFA 4R0VA 4B4WA 3PG5A 1UT8A 3T5MA 1NU8A 3B60A 3P19A 4NMXB 4QUBA 1ECPA 4YJ3F 3TKYA 5C1DA 1HNZB 1FS5A 4TMFA 4L5YA 3C1AA 4IF4A 2CHUA 4EPYA 2ZUFA 1A88A 2O3TA 4DR4B 3B1VA 2D1YA 2CXNA 1FUYB 1QVVA 3ZDBA 1F1BA 1BS9A 1EFVA 2HH9A 3L8CA 1P61B 2YJGA 4OCZA 5ALOA 2IXBA 4LV8B 2OBXA 1DDGA 2Q29A 2OCBA 3EC7A 1Z2EA 4LDAA 3LGXA 4D99A 2CK3D 3N1UA 1SHJA 2H65A 1E9AA 1PR6A 3HDTA 2BEUB 4ZFNA 3AF5A 3EQ9A 1KK3A 3GN2A 1Y3FE 3MT7A 4P22A 1RPAA 4WVLA 1ISJA 2AW5A 5CUQA 3ZHQA 2X23A 5E1DA 1OBFO 2H6EA 2O8EB 3I52A 1A3CA 3A04A 3I2YX 4WXHA 5JOQA 2X7HA 3PEUA 4QX6A 2ZTMA 3E2PA 3FPJA 3RYIA 3R40A 2CNDA 4S12A 4TL6A 2L19A 4LNUB 4OQPA 5TQ0B 5HIIA 2NYUA 1XXHE 4QGGA 3T7AA 4C0XA 1D1SA 3HHEA 2D5IA 4YXWD 4COKA 4ETIA 4K9QA 3C4VA 1GG9A 4XX0B 5IUNC 1G2QA 1AJEA 1JXAA 1U2GA 4RY8A 1DFHA 3GLHB 5THXA 5F5LA 2PRSA 3W8DA 2ZBPA 1CJKC 2AOTB 2XH8A 1SIBE 2J3LA 1FP4B 3BMOA 3EGDA 1UJBA 3D6FA 4CV2A 2IW1A 3PGMA 1SUAA 2O14A 5DX0A 2XWPA 1C30B 5DW0A 4CMEC 2AWOA 5K0BA 4NEHB 3C15C 2VJMB 5E7IA 2WVGA 4ZCMA 1IE3A 1ST2A 2WYOA 2BJVA 5GZ6A 5FTJA 1JTFA 2Q3LA 4RIHA 5A0TA 1Y98A 1QIFA 3ZY6A 3ZZ0A 421PA 2OGWA 3ETLA 3FGOA 4LS3A 4TTJA 2V1XA 1PWZA 1E3MA 4Q7JB 1CJUC 2D4HA 1V1MA 4UAJA 2GUGA 2GLUA 1P5HA 2MYNA 2J3DA 2X3YA 3GGCA 1HV8A 3ORQA 3NFRA 4P80A 4Q9IA 2BEKA 4I1VA 4QU5A 4G4JA 5KKAA 1ECJA 1NX9A 3H8VA 3WAJA 3U6BA 1QO9A 4CXMA 1EQ2A 3QVXA 3GW8A 3WFJA 3ESBA 2QRVA 4OYRA 4OUDB 2IOFK 3TUIC 1JIQA 4MDFA 2QSUA 1W7AA 4ZI5A 1DARA 1