1NZFA

T4 phage bgt-d100a mutant in complex with udp-glucose: form ii
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
351
structure length
351
Chain Sequence
MKIAIINMGNNVINFKTVPSSETIYLFKVISEMGLNVDIISLKNGVYTKSFDEVDVNDYDRLIVVNSSINFFGGKPNLAILSAQKFMAKYKSKIYYLFTAIRLPFSQSWPNVKNRPWAYLYTEEELLIKSPIKVISQGINLDIAKAAHKKVDNVIEFEYFPIEQYKIHMNDFQLSKPTKKTLDVIYGGSFRSGQRESKMVEFLFDTGLNIEFFGNAREKQFKNPKYPWTKAPVFTGKIPMNMVSEKNSQAIAALIIGDKNYNDNFITLRVWETMASDAVMLIDEEFDTKHRIINDARFYVNNRAELIDRVNELKHSDVLRKEMLSIQHDILNKTRAKKAEWQDAFKKAIDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA beta-glycosyltransferase
publication title Crystal structures of the T4 phage beta-glucosyltransferase and the D100A mutant in complex with UDP-glucose: glucose binding and identification of the catalytic base for a direct displacement mechanism.
pubmed doi rcsb
source organism Enterobacteria phage t4
total genus 126
structure length 351
sequence length 351
ec nomenclature ec 2.4.1.27: DNA beta-glucosyltransferase.
pdb deposition date 2003-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09198 T4-Gluco-transf Bacteriophage T4 beta-glucosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 1nzfA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 1nzfA02
3VUFA 1JIUA 1B4DA 4CDRA 1Z8DA 3C48A 2R4UA 3MT7A 4F96A 2X0FA 3MTDA 1QKJA 2QRPA 1LWNA 3CUTA 3ZCVA 2SKCA 3BCUA 1P29A 2QLMA 4FZRA 2IV7A 1JIXA 3EBPA 1FTQA 3NB0A 4X6LA 4EJ2A 1O6CA 1SXQA 2KS6A 3L7CA 9GPBA 1GFZA 3S0JA 3OKCA 4WADA 2GEKA 2R66A 2QRHA 2X0EA 5DXFA 2GEJA 1H5UA 4YI5A 3NC4A 1GG8A 2BGUA 2WTXA 2XA2A 2PYDA 1FU4A 1UQUA 2R60A 4RIIA 4WHMA 3OY7A 2F3PA 4AMGA 3CEJA 2ATIA 4M83A 1GPBA 1NLMA 4AN4A 3FROA 4RIFA 1ABBA 2VCHA 5JTUA 3MT9A 2JZCA 3NCHA 3E3LA 4MICA 3T5TA 1IXYA 3HBFA 4BQFA 3Q3EA 1AHPA 1K06A 1HLFA 1M5RA 2C4MA 3HBMA 3UYKA 1L6IA 1RRVA 1QM5A 2QN2A 1XL1A 5TVGA 3CEHA 3C4VA 3OY2A 3BEOA 2O6LA 4N39A 1FC0A 1L5SA 2YJNA 3CUUA 4NESA 4EKEA 1P4HA 2H1HA 2QN7A 4RIHA 3ZCTA 4N3CA 2XGMA 1XOIA 4GYYA 4X7PA 8GPBA 4KQ1A 3NAZA 2BFWA 4X7RA 3MRVA 1J39A 1E4OA 2HY7A 3UYLA 1F0KA 3MTAA 4EKYA 3MS4A 4X7MA 4N9WA 1XV5A 3L7BA 4L22A 3ZCUA 3BCSA 1JG7A 4RIEA 2SKEA 4YI3A 2JJMA 4REMA 3IA7A 3AMVA 4W6QA 3L01A 2VSNA 3HBJA 3NP9A 2X6QA 3T3HA 2IV3A 1LWOA 3DZCA 2PYIA 2IEGA 3DD1A 4EL0A 1GPYA 1L5VA 2VCEA 3BD8A 4XI9A 2FETA 3MQFA 1YGPA 4GZ5A 3ZCQA 3OKPA 2XMPA 3H4TA 3O3CA 5JTTA 3GUHA 5IKOA 4AMBA 3G2KA 2VG8A 4F9FA 1P4JA 4AY6A 3T3IA 2QN1A 4BFCA 4RENA 1A8IA 1L5WA 3RHZA 5D00A 1JEJA 3IAAA 2IYFA 2P6PA 3NPAA 7GPBA 2GPAA 3H4IA 3WAGA 3ZCRA 5HXAA 4MHSA 4MRAA 2F3UA 4YUAA 3MBOA 2QRGA 1WV1A 1RZVA 2C9ZA 3QKWA 4M60A 3DDSA 1FTYA 3BDAA 1VGVA 1Y6FA 1FA9A 1C8LA 1RZUA 3CEMA 2G9RA 3OKAA 1PSWA 1C8KA 3CUWA 1EXVA 3CX4A 3L7AA 2GM9A 1NZDA 2XA1A 3TSAA 1Z62A 1Y8ZA 1IIRA 1P2BA 3WADA 2JLBA 1V4VA 3S28A 4NEQA 1Y6GA 1XL0A 4FKZA 1KTIA 4WACA 1E1YA 3CUYA 1WUTA 3S29A 2IYAA 1FU7A 2F9FA 3TAXA 2PRJA 3COPA 1L7XA 3MT8A 1SXPA 1P4GA 1NVKA 4RIGA 2XCIA 5D01A 2BGTA 2ASVA 3HBNA 3MSCA 3T3DA 2AZDA 3G2LA 1YA6A 2H1FA 2FFRA 5DU2A 3G2JA 3BD6A 3OTHA 2C1ZA 2F3SA 4PQGA 3CV3A 3Q3HA 3MRXA 2GT1A 4N3BA 4MI6A 2ZB2A 2IW1A 2GJ4A 2AMVA 3ZCSA 4LDPA 3DDWA 2QN8A 3L7DA 2IEIA 2QN9A 4NC9A 1Z6QA 3RT1A 2Q6VA 1PN3A 1F6DA 4G2TA 2R68A 3WC4A 2QLLA 3OTIA 2G9QA 3CUVA 3PE4A 5GPBA 5LQDA 3D1JA 3OTGA 2BISA 3VDMA 2GPNA 4CTMA 2QLNA 1GGNA 5ENZA 2XCUA 2AW3A 2IUYA 1L5QA 3Q3IA 4EL5A 2G9UA 3ZCPA 5I45A 1XC7A 2AV6A 1FTWA 1NOKA 3SYMA 2X0DA 2FF5A 3G2HA 2VSYA 4RBNA 1Z6PA 4MHOA 3G2IA 2QRMA 4GPBA 4BQEA 1PYGA 1PNVA 1P2GA 6GPBA 1WV0A 2PRIA 1NZFA 3MS2A 4CTOA 4XIFA 3VUEA 3MS7A 1FU8A 1WUYA 2XGOA 4RELA 4F97A 3T3GA 4LEIA 4KQ2A 2XA9A 2C1XA 1XKXA 4MI3A 1BX3A 4HLNA 3VDNB 4CTNA 2QZSA 2GPBA 3G2NA 4QLBA 5TMEA 5C1DA 5TMDA 4BQIA 4M7PA 1C50A 2F3QA 1JG6A 2QN3A 1WW3A 1NOJA 3EBOA 3OT5A 2PQ6A 3S2UA 4N3AA 1EM6A 4HWGA 3BD7A 4AY5A 2SKDA 3QHPA 5IKPA 1P2DA 3MTBA 4KQMA 3L79A 2R4TA 3PE3A 3E3OA 3NP7A 2ACWA 4Z5XA 3T7DA 1UQTA 3BCRA 1NOIA 3E3NA 4GYWA 4MI9A 2QNBA 3RSCA 1JIVA 2ECPA 3C4QA 2QRQA 2G9VA 2XGSA 1FS4A 3TOVA 1WW2A 3MRTA 2X6RA 2OFFA 3S27A 4GZ6A 5TMBA 1L5RA 1C3JA 4GZ3A 3GPBA 3RSZA 3D0QA 1AXRA 1K08A 1GZ5A 3SYRA 1UZUA 5DLDA 3T3EA 3D0RA 2ACVA 5BNWA 1GPAA
chains in the Genus database with same CATH superfamily
3I2FA 3Q11A 3QWAA 3J7TA 3G8DA 4DV3B 1D3AA 3LDHA 2OGTA 4K03A 4WIAA 5J5CA 3IERA 4IJUA 4FMBB 2VH2A 1QFZA 4MTCA 4OL9A 3AB7A 1VHLA 3D3WB 4OXIA 4PV7A 1K2WA 2QMUA 1AQUA 1QVRA 2PZMA 3C98A 3HCEA 2NSJA 1KQNA 2RGEA 2C04A 5EMKA 4ZO8A 1I14A 3C85A 3NDJA 1BXRB 3PD7A 3GRVA 1JHOA 2HLDA 4KMOA 3ICVA 4HTFB 1I8TA 1QHIA 3I32A 4BBJA 2YX1A 1V48A 3EOZA 1YHZA 2IUTA 4FZRA 1CR2A 3K1YA 3BB4A 3GDWA 2IOFK 3D43A 4R1LA 1J2EA 2UYHA 1IULA 4NV1A 3ZHRA 2GKOA 4HXFB 3E1KA 2HF7A 3QU9A 4WY5A 2BGKA 1J8FA 2XE7A 5HJEA 1BU5A 3NXKA 2RG1A 4RK7A 2NTNA 4YO7A 3ZU4A 1G20B 1M67A 4CLRB 3I2IA 5CT5A 3D3QA 2XWSA 3CW2A 4F38A 2A57A 3OUTA 3RAFC 4LXUA 3FVTA 1S8AA 3U2QA 1XMJA 4HGOA 1Z4LA 2Y6UA 1Y89A 4KYTA 4JLAA 4MV5A 1WBJB 1ZD5A 3AF4A 4LFAB 5GIOE 4WNIA 1GLVA 4M98A 1N4AA 3JQ8A 5KOJA 1DAEA 1XEWX 3GMTA 4GI3A 5EKUA 1DQPA 3PGJA 1ISJA 4NJEA 1CDDA 3OSZA 1ECPA 3LQRA 1ZD1A 2GD0A 4FILA 3AILA 3LBIA 4E1BA 3SHOA 4WNAB 1FNCA 4H6PA 1YO6A 4LNUB 3ZGVA 3SVTA 3V6LA 3WTCA 2J1LA 4WPGA 1ZM9A 3FLMA 2JEZA 1JJFA 4QXOA 2P79A 1WMEA 1IY8A 4AB1A 4CIXA 5A4IS 3O8RA 1Z0UA 1CNMA 1X6VA 4AWAA 4KRGA 3JASB 2C2ZA 1FX1A 1WA5A 4HNHA 1WEHA 2F64A 1YDWA 2YWRA 4WKCA 1RQGA 1TQ4A 4GBMA 3CEJA 2ZP1A 2CUKA 3HU3A 2PX8A 4BLUA 2XUJA 4PZZA 3WGTA 4E4TA 2JS7A 1WXGA 2GPYA 5HZMA 2P68A 4H60A 1PJ8A 1Z06A 4NEHB 3M4ZA 3CNOA 2JAWA 2ZWAA 3OCCA 1MAAA 2ECQA 4LCJA 3GPCA 4N8SA 2H7XA 3A2LA 2QQEA 3B6JA 4P08A 2NU9B 2AFIB 2A0XA 2NTJA 5A7GA 4DSZA 5B58C 2CLKB 1Y4AE 1WXXA 3A05A 4BWFB 1GZDA 5GONA 2AB0A 2C4KA 2WJ6A 1RPNA 1XZFA 3DSRA 4MS4A 4DCGA 1H4SA 4F3YA 1VCIA 2NPIA 1C1DB 3H7IA 1IHOA 2W2MA 1HRDA 3UIEA 3PVZA 1II0A 3ZIUA 1F60A 3DKIA 4A2CA 1UP4A 4LJKA 3ZQ6A 3D6HA 4X8MA 2V7VA 2VDWA 2VUIB 3AKEA 1ISPA 1XTSA 1RPTA 2VYQA 3G0GA 3ZGNA 5BN5A 2BSQA 1LRLA 1A77A 4QXAA 1UWKA 2RJNA 5CUQA 5GTDA 3R5HA 1W9HA 1VLQA 1Y98A 1WCYA 4FMDB 2LGJA 3QVTA 4H0NA 2Z8ZA 1IXKA 2EP7A 4A8JB 1SQSA 3Q3GE 3B5IA 2G25A 1AIPA 1G19A 2A14A 4G23A 4PXYA 5BSGA 5FBZA 1DSSG 4EJFA 1CUEA 1J4AA 5AJYA 3GHHA 1VMIA 1QH8A 1XN4A 2TSYB 2XVZA 4B76A 3ZZ1A 1X1EA 5JNVA 5B12A 1IZ0A 1SVOA 4CV1A 4KUGA 2I6GA 4Z7QB 2DHRA 2DBQA 3QBVA 1PU2A 4PQYA 4LBZA 4FD3A 1FFXB 3HK2A 4I8IA 3NC0C 1O97D 4RMHA 4HDKA 3KQVA 2JGIA 3UOAB 1R50A 4E2XA 3MD0A 3CH6A 4HRAA 4JVNA 2OO5A 1UBCA 3OP4A 4KBYA 3DEHA 4UAUA 2YCLA 2GZ3A 1I7LA 2VZ0A 1GNSA 4M6WA 2H52A 4Q3EA 2P69A 1BVHA 1GNTA 2HV9A 3N0RA 2XGJA 1IQRA 4CKWA 1DKLA 1B00A 2HRBA 4G5XA 1P1RA 1LPSA 3DT9A 4NOKA 5HUJA 4M46A 1FXWF 3O3OB 4RGBA 5A04A 1WZUA 4D26A 1L3IA 3SPXA 5JNSA 4URHA 3R40A 1IZZA 1YTLA 2IEYA 3CINA 4OHXA 2HMSA 3ZNPA 5BN3A 4MW0A 3RJTA 1HURA 1A7UA 1Q83A 1O1YA 1VI5A 5KYYB 2DERA 1C9JA 4XDHA 4YMSA 4RF2A 3I4FA 1GCOA 1GKUB 3CU5A 3O5AA 3QFTA 3QK7A 4RPGA 3UV6A 3VISA 3VSBA 5IF3A 1Q17A 4DSNA 1R2QA 4L08A 2AJTA 4QUHA 1PW7A 4KDEA 1AUOA 3EGXA 1EE1A 4JD5A 2VZ9A 3F4KA 3ZIAA 4CM7A 3HKDB 4TMYA 3TUZC 3JVVA 1F7UA 4GXNA 4M86A 1UPTA 4KH1A 4W6QA 2X42A 4ZQEA 5SZKB 3A4VA 5EXSA 5H9WA 3FETA 1V3VA 2BFDA 2ZBPA 2C3PA 2I3BA 4EHDA 1DAMA 3KQPA 3RYIB 2IS2A 1NW7A 4Y1FA 1Z6GA 1Z75A 1G3MA 3H5TA 2JGLA 3GPDG 3HZHA 4G0MA 2CGEA 3NASA 3VR0A 4DR1B 2OO3A 4MW5A 4CCSA 2ZJZA 2C4HA 2R00C 1L5VA 3M34A 3WXBA 4RHTA 4J03A 4O2AB 1YXMA 5KYXA 2DHDA 4DMKA 1UKBA 5KYTA 1Y3HA 3NFYA 2FTKE 3KB6A 4IIUA 3WMEA 3HFJA 2DKNA 4NBWA 2ZUBA 3A1CA 1L7OA 1ZWLA 1HQCA 3TTTA 3UKDA 1T5IA 3IOYA 3IULA 2BKEA 4EY3A 1NUSA 1WHSB 2DBRA 1K63A 3QWHA 4HX5A 5AVOA 3ICEA 3MB5A 3BA1A 5CLHA 4UTPA 2CJWA 1R0ZA 2I7DA 2X8LA 1V8BA 2IXFA 3CY6A 3L5OA 4KW7A 1IJBA 1FZQA 4W9NA 1TMOA 3TXYA 4FNAA 3W8FA 1D0IA 2NYUA 3M6AA 2GN4A 4IIVA 4R5MA 3ZWVA 4F9FA 3HXOA 2F17A 1V25A 1NI4B 3RDPA 2Q6KA 1U28C 3E2PA 3BPSA 3VNUA 3CLUC 4WERA 2HC9A 4XVUA 1U2GA 1CR6A 2J6HA 3JQRA 1WUKS 3OPMA 3NMUF 5BR7A 1AS3A 3D3KA 4KB5A 2OAEA 3S1SA 3A9RA 5FJIA 2PLNA 2PZBA 4PRZA 3LBAA 4HH1A 4P7KA 1N5MA 2JFNA 5SY6A 5TQ2B 3ZOKA 4B3DA 2VJLA 1NBME 4KSBA 1A8PA 1P6XA 1RDFA 5IDVA 3UN1A 1H5QA 1KJJA 4B73A 5ALHA 3THWB 4Z1MD 1Z4PX 2HBZA 3K1JA 1NVDA 1QVVA 4EYGA 3NOQA 3D6VA 4V02A 1FJ2A 1SWWA 1T2DA 3ND9A 2YV3A 4HDCA 4EQ6B 2UYYA 1CY1A 4RAQA 3CQ9A 2CFTA 2QW1A 1F51E 3AEUA 3PC8A 3R4VA 4HVLA 3C74A 3QEMB 5GMOA 1COWA 1R0YA 2BSXA 2F67A 3LM8A 5IJXA 3OETA 1RACA 1RYFA 2L69A 5K4GA 1FW6A 4D3DA 2VHEA 3H5VA 2OGWA 5LZ7A 3T5DA 3IE2A 4CBVA 1P5ZB 1YS2X 3A8TA 4LV5B 4R2MA 3Q8LA 5JE8A 1Y6GA 2JFXA 3DTYA 4A6DA 4NK5A 2D3TA 2TMGA 5K05A 4H9GA 2Q1WA 5F2NA 3MD9A 3E5MA 1CZHA 3HVRA 2PRJA 4ZVSA 1AT1A 4EGFA 5JMWA 4YONB 3UAYA 2G36A 1V0JA 1J70A 1YJQA 3ZHBA 3EVBA 4EWLA 1PG2A 2P2GA 2AMFA 2VF2A 3IQEA 2OYCA 5JIBA 4XCXA 4PC1A 2OV3A 3T94A 3M1IA 3CLRC 1QVWA 3D2LA 4X95A 2NZJA 2JVJA 3R0IA 4TXJA 1R6VA 5H3LA 4HG2A 3WISA 1WW8A 1Q92A 2CD9A 2EJCA 3UM9A 5BVGB 5F1YA 2JB9A 4IO0A 3EEOA 4UNNA 4XPIA 4PFSA 5CFRA 3MSCA 2RHMA 1T8TA 4HDQB 5ESXA 3LUKA 4UU7A 3RODA 3H5IA 3GDHA 5A71A 4WGGA 2E4XA 2X13A 4Y0VA 3VAYA 3A6PC 2R9VA 2KLBA 4ND5A 3CHYA 3OIFA 1G17A 3QKRA 2C3OA 3C2QA 3ZW8A 3SQLA 1FFSA 1LFDB 2FU5C 3MVEA 4UASA 1TTPB 1RQPA 3NQ41 1UDBA 1WVMA 1TEXA 2CEAA 2H4XA 3UH1A 4DVGA 4MIOA 3MGKA 3TQOA 1Z4KA 4PWYA 2F8MA 1XVVA 2COKA 3OHSX 3P9KA 2QTTA 1K7YA 4BNFA 1U9CA 2FN4A 3EGIA 2GYWA 3DBLA 3FYTA 1H65A 2EZ9A 3A7DA 1W0KA 3CT6A 3NW9A 3TL2A 3UMSA 2BD0A 3DPUA 4YRBA 1PT8A 2XRZA 4YQZA 5DX0A 4CMAA 4KFTA 1KAMA 3HA7A 5L4NA 4BX2A 1Z15A 4LDPA 2E48A 5JJBA 1XDUA 2WOJA 3ABSB 3DCJA 1OE0A 1ZK0A 2DUNA 2MSNA 1RJ9A 4N7MA 4ZVLA 5AKEA 4QUAA 3L1HA 3RGGA 2D7JA 3Q2IA 4AJHA 1UKEA 5D86A 3UJHA 1HQKA 1BCRA 1FJGB 1OT3A 2JLRA 4EK9A 1PV2A 4DCJA 1RMYA 3LL4A 2QLLA 4IZ6A 1Z25A 3CUVA 4KX5A 4L5IA 1RIIA 4KZKA 4LC9A 5CLIA 5SY4A 3E0QA 3K5IA 3LQ4A 4KR2A 3PA6A 4O4HF 2BMVA 2CZCA 1SBIA 2NU8A 1P81A 2ZT6A 2FMTA 5BNZA 5JANA 2QB5A 4M8SA 4N5MA 2XB2A 1BQEA 2QL5A 3GJQA 2JASA 2JZOA 5EJFA 5K9ZA 3EZGA 4QAJA 2FZEA 1U1GA 2JBHA 1LDYA 1JB1A 2XAAA 3OOYA 4US0R 5L3SB 4OX9Y 1DUIA 1ZU4A 1WS6A 3PR1A 4KP7A 4QJ5A 4KLCA 3M3DA 4B8WA 4EI8A 3K6SB 5CFNA 2HN9A 3K8OE 5K0EA 2ZZNA 4HAYA 2G17A 4OJNA 2UU9B 1TKRA 2A92A 2DM6A 3FUVA 3SYMA 1E79D 3VO9A 1OLSA 2BLLA 4JC5A 3S7ZA 2HTEA 5BQOA 1Z6ZA 5HKOA 1ADCA 1ZUNB 5K8IA 3I12A 4CKCA 1NSFA 1FLAA 3T3PB 1ENPA 1C5KA 3TTWA 4MHOA 4K6KA 4AZ0B 4W5TA 1PT9A 2GS9A 3NS7A 3SQMA 2WIFA 4UMDA 4A6XA 1EZ4A 2EF1A 5E1OA 2H16A 4DEVA 3AP2A 1KI3A 3S44A 1CJTC 1MENA 4IJQA 1XLUA 4GPZA 1NTOA 2R2AA 2VDLB 1GDDA 1U9IA 4XWYA 3VVCA 1SXJA 4PYKA 2XZDA 3MGAA 4X1YA 1M6HA 1WQ3A 1QFSA 3NETA 4N9QA 2ALJA 5E3IA 3AVUA 2NV2B 4JLNA 3CNHA 3I23A 1XN1A 4JLMA 3A6GA 4KVGA 2VPZA 1ESMA 3TGLA 2C57A 2LNDA 3NI2A 3AJRA 4AZSA 1UZAA 2IUEA 1SN7A 3L8DA 4KKVA 1OTHA 4BCCA 1IBLB 1QQTA 4ZGGA 2FA9A 4PLZA 2Z30A 5I8WA 1GRNA 4FYKA 2OMKA 5C7LO 5HF6A 1JDBC 1FDWA 4DM3A 1M2FA 2REBA 1E2LA 1RKBA 1TAHA 3QMPA 4D02A 4ZFNA 1FXUA 3GLIE 2QUHA 4FP9A 5A4MS 5FFMA 4HPJB 1W4LA 2YXEA 1GKKA 3BAFA 4RD0A 5GOZA 4AMZA 1SOUA 8ADHA 3LBNA 3D1VA 3Q3CA 2IWHA 3S2UA 3LJKA 1VJ0A 2GVNA 2IYXA 2XTJA 2ECFA 3DYBA 4G5RA 4AG6A 1G1MA 4OHKA 2IHTA 4BTLA 2WT8A 1B3RA 5DTMA 4QT0A 5EHQA 1W5SA 5AK3A 3U3XA 3PE3A 1BEEA 3PC4A 1VSTA 5EKTA 1SULA 3K1AA 4XQEA 1CJBA 1JLKA 2DHQA 3I6ZA 3NYWA 5A03A 4DLVA 4GR5A 2BRUA 3HKCA 1EP9A 1QIHA 2AJLI 3BRQA 3EZLA 3LTEA 4EY4A 5T67A 3ILVA 2PMBA 4V2IA 1NUTA 4WESB 4DUYB 3KETA 1WW2A 1ZN9A 4LJSA 1C1XA 1OGIA 3G1TA 1MJGM 5C1BA 2QRJA 3NTRA 2O8EA 1Y5IA 1Z47A 1ULZA 2GN2A 1Q2XA 3B9QA 3TUJC 1YQGA 1VRWA 3M5DA 5I9SA 2IYZA 4J0QA 4CV3A 2ERCA 3F8WA 4HDRB 4FMPA 2ATVA 1LDNA 3D0QA 4RH0A 5CM8B 1W6RA 4HH4A 4JBGA 4OYLA 3TOZA 5LNK6 4X00A 4GT1A 4F3TA 3E9RA 3LCJA 3KDPA 3M9XA 4ZKDA 2IDMA 1RHUA 1VLVA 2VNSA 3DEAA 2AFRA 4U2EA 3DYVA 1P2SA 3L1KA 3UK7A 4NE7A 4I2NA 3FF4A 1T43A 4P4SA 1QCDA 1F9AA 1JZSA 2Y67A 1PR9A 2CB0A 1QUFA 5AVTA 4HFJA 4N65A 1N5KA 3KJHA 6ABPA 3JAKA 1FYEA 3RT9A 1JV2B 2FW6A 3PFIA 1U0JA 4IKOA 2PT5A 4YRCA 3U3ZA 5F7XA 1P61B 1PNRA 1W85B 4LJRA 3RARA 3HGQA 1YB2A 4B32A 1EFHA 1CJSA 4JJGA 4HJXA 4GDFA 2A2ZA 1IOWA 1RLIA 1EHIA 2GWRA 3I45A 1X7YA 4TKUA 4DC0A 2W8BA 1CT9A 4B3BA 3PJRA 2YWEA 3UMGA 2J4FA 1YJ8A 3G0OA 3ZCVA 2PL9A 4RTOA 3FNRA 3QUBA 4HAXA 2G6TA 4QYIA 3Q8MA 2HNBA 2XAUA 2H4HA 4H6XA 4G1UC 4LXQA 1RRCA 1TAUA 3OCZA 4QQFA 4B4UA 1OH6A 5EZSA 1Z74A 4P8RA 1ZUD1 4ZGBA 1YH3A 3ESBA 5B4TA 1IBCA 1FBTA 3FMPB 5CRIA 3WKBA 1V8DA 4HJRA 4CDMA 2VK4A 4U9HS 3O0DA 2HA3A 1IBKB 1Y5LA 3K31A 1G3IA 2HLNA 1RRMA 3L7CA 2DEUA 1GFZA 3IPCA 1UJ2A 4Y2GA 4AC9A 3OIWA 5E8RA 1RWWA 4G9BA 3KTAB 3LRXA 4FUTA 4L4YA 1ICIA 3SDBA 2WUGA 1YFZA 3G1UA 2F1OA 1K98A 2CHGA 2QRHA 4XJTA 4Q1EA 4G07A 3AU8A 5CDSA 4IJVA 1WSDA 2PNFA 3LT2A 4P33A 5LNK1 2OZPA 3DUWA 1N1EA 3EY4A 3NOOA 3OIDA 4KAAA 4XUDA 1WOYA 3TFWA 3MZ0A 1MA0A 1MH1A 1NVMB 5K6RA 1PZNA 1ATIA 5I7VA 5CHEA 1LBTA 1C7ZA 3HM9A 2OO5C 3O90A 2BKUA 1GKIA 3H3FA 1FU4A 4IL5A 5EMMA 3V34A 3W77A 1GSOA 3WGGA 4NCKA 4AKSA 3CX6A 4LZJA 1P2FA 1B3BA 4IKPA 4ER7A 4F3RA 1TO1E 2HQSA 4AY4A 4GE3A 4D9EA 2P0YA 2LR0A 1EESA 1CJMA 4IXNA 3SG0A 5DX8A 2IYVA 3GGPA 3A1NA 3A4IA 3QPBA 4CQLA 1KI4A 1IN6A 4KV9A 3EX7C 4BRWA 4D41A 3QXGA 3BB1A 2ZM5A 1TFRA 2BE7A 2CXPA 1GADO 1Y63A 4Z3OA 3DKVA 1EQAA 1L4BA 5EUQB 4CR7A 1OFTA 3O2JA 2J4DA 3D9QX 4PBRA 3T1YB 2I4TA 2JPDA 4J3JA 1Z88A 3TGWA 1E59A 1T6XA 2JGAA 1NC1A 1WXQA 1ZGJA 3AEZA 1VB3A 5GONF 4QU9A 1PWHA 1SUWA 2QAIA 2WWTA 1DHTA 1UPAA 1VL2A 2G40A 4LHVA 4M7WA 1E6MA 3VTZA 4X90A 3AERA 3DXXA 2VHYA 4KO2S 1KYYA 2PN1A 4LYJA 4RF4A 1TD1A 3QU4A 5DI3A 4IMRA 1E1KA 1R9NA 2CHVA 3R7DA 5MF6A 2O8NA 3B1YA 3HEBA 3A11A 1FK8A 4DIKA 2D00A 4UW9A 1UC5B 2V5VA 1YL7A 4AROA 1L4LA 1PJTA 3TW8B 2BFNA 2WYHA 3ZHUA 3N8DA 4CE6A 1UFKA 3T3NA 4RLFA 5F3RA 2OBYA 2PZ8A 5ALFA 1YI1A 4PO8A 5DWVA 3T7KA 3UMJA 5E9AA 3FZGA 1LPMA 2ZFUA 1AK9A 4BE4A 1G1AA 2IIPA 3RUDA 4BNYA 4NYJQ 4OI2A 3BXXA 3HCBA 1RJEA 5DT9A 4CM4A 2WJIA 4DLPA 2VJQA 4PNPA 3GJ3A 2VF8A 1JMYA 1WZIA 2H2GA 3E15A 2H5EA 1KEEA 3ABIA 1JEOA 4OQFA 1RRFA 5FFFA 5TVGA 4FB4A 3RF7A 1AQNA 2E4VA 1ZSNA 1DLJA 4IXMA 1W5AA 4OMUA 2FP3A 2AHRA 3D81A 3T5GA 4CLEA 3OX3A 1I6MA 4GMHA 4HUJA 4NS1A 3BJMA 4EUSA 4BY9E 4F5DA 1G0NA 3ZBPA 1H3NA 1XTTA 2A9VA 2HMYB 2L42A 2W4MA 3CIFA 3ED5A 3GRYA 3UEOA 3CZ9A 3AUXA 1Z5UA 3EHEA 1GT91 4NZNA 4W9NC 3AY0A 4WY8A 5I9IA 2A7XA 1GEGA 3IUYA 2AZMA 5JFTA 4AJNA 1YZQA 3F4BA 5BRNA 1C3OB 3VPXA 2ZXEA 4HFRA 3BERA 1P3DA 1ORVA 2QD3A 1D4AA 2QTHA 3QBJA 1V4NA 2OHJA 2A3NA 4R9VA 4ZCMA 2FFBA 2VJMA 1U2GC 3WSWA 5G53C 1AG9A 3I92A 4R68A 1KDPA 3MWJA 4AS1A 2GKSA 4HUQB 4OSOA 1J2TA 4YJ2B 2GPSA 4ZMSA 2CEKA 1N6IA 1OH7A 1GPLA 2RAVA 2XVAA 3OIUA 4M53A 4MVWA 3TLYA 1Z22A 3NJ4A 4E88A 3MTAA 1X7XA 3FSGA 2G1PA 1GZ3A 4ZVUA 3KQYA 4CM5A 1UXOA 3QLEA 1DKPA 5A3QA 4F4JA 3F3YA 1PCXA 1X80A 2ZJBA 4UM7A 1EGQA 2OXTA 4ZMBA 2FEAA 2X5KO 5IN4A 1ZMTA 3PC8C 3VR3D 1QIDA 1CF2O 1O96B 1SHZA 2R6HA 1L8OA 2XYGA 4YI3A 3DJYA 3EOBI 4AO7A 1CR0A 3ONDA 4B5LA 5TIIA 2XDQB 4CG3A 3K0KA 1T13A 5C8YB 3D3NA 3EN0A 3HLKA 3SBOA 3WICA 4H1WA 2NVBA 5GVSA 4UFNA 1L7DA 1GRCA 2WP8J 3E0XA 2VSNA 4N12A 1M2NA 4GVPA 3EMKA 4P4UA 3L4SO 4U1RA 3MG9A 2X6QA 1EK2A 1SC9A 3L84A 3JQ9A 5BUSA 2AC4A 2FQWA 3I2GA 4M55A 5JXGA 3PHHA 4YMIA 5KNBA 2X8JB 3AFMA 1KNQA 1V26A 3GJ8A 5JQGB 2VQ6A 3M6FA 3RKUA 5ILOA 1I7DA 4FYYA 3H7AA 1QP7A 3PUKA 3QEAZ 3EGDB 1TADA 2DETA 3L2OB 4YYZA 2VBCA 2FETA 1U99A 1T9BA 2KW5A 4LISA 4C20A 2JFGA 1C0LA 2V5UA 3I64A 3M2PA 4ECAA 3PFBA 4D0NA 3GBSA 3WJ7A 1ZRMA 2GYVA 2SBTA 1N6KA 5LIPA 1LDMA 4XH9B 1CEEA 2BEVB 3O3CA 2ZE8A 4OEHA 2XBMA 4YPOA 2C4TA 2ZWIA 4ZN6A 1RC1A 3LGXA 5C5CA 3DEKA 3AVYA 5C5DA 2I91A 3UQZA 2IH5A 1YI0A 1AUXA 3T3IA 2I62A 2FWAA 3CUEF 5DK6A 4CQNA 3DD5A 3DOOA 3IAAA 1H4QA 4KMRA 2ZATA 2H0RA 2H5LA 1RLOA 3OFKA 2UKDA 1MGPA 3TNDA 3V7YA 4YMGA 5C7OO 2CBZA 3ZQUA 4B6SA 4B80A 2G08A 1BXGB 1KMCA 3EVAA 5JQWA 1JU4A 2IYUA 4XQGA 1F2DA 3EC1A 4PRLA 4X71A 5AKIA 4ZAXA 2EL7A 3JVUA 3HEAA 2YZGA 2BKAA 2XZTA 3KHUA 1GR0A 2H7VA 2AOWA 4P1ZA 3VKGA 2PJUA 4UZEA 2DTXA 3LECA 3RYTC 1EVJA 4MKGA 4OQDA 3ZDAA 3R24A 1ZY2A 4JT4A 3A9UA 5LA6A 4HNSA 1YA4A 3W4IA 2ECOA 3PQ8A 1P19A 3PT9A 1GL3A 3NUZA 1X1TA 4QU8A 2YYAA 5DW3A 4YP7A 1Q5PA 4G8JA 3TUIC 5ITSA 3REFA 4W1QA 1G3RA 4PTLA 5JRZA 2FPUA 3NHRA 1MO5A 3UMMA 3D8UA 2HJVA 2QM7A 1WLSA 1XZEA 3HCRA 3TSAA 3VBEA 3ZDZB 3IA2A 1TTHA 1V7QA 4DA9A 3BXHA 4PPQA 1UAAA 4IH4A 3L46A 4F2HA 4FQ7A 1UDAA 3N8GA 3TKYA 2JL1A 1YZYA 1V41E 4PFKA 5KTYA 4FOOA 3QSYA 4J07A 4QGFA 5TARA 1W4BA 3OF2A 1WXWA 4C89A 5IAEA 1FU7A 4R8RA 4WXRA 1SRQA 4BN5A 4DHEA 1UXGA 2JJ1A 3WNBA 5KBYA 1K97A 3A1VA 3T52A 5ALUA 4XDGA 3RJ9A 1UJMA 4P5DA 2MSCB 2V4ZA 1EA7A 3NLLA 4AJ4A 1TAGA 4ZICA 3FB4A 5AXCA 4G1FA 4DV2B 2QQGA 1P4GA 1WG8A 5FADA 3UY4A 1JVNA 2FPXA 4MH0R 5GJBA 4DA7A 4R5HA 4AYTA 4ZO6A 1QFYA 1O9HA 3RUPA 4Q15A 5E2IA 5E6SA 1A9QA 4B75A 3DW3X 5AVJA 4PCAA 5AXDA 5LYYA 3HMQA 5J58A 2IU3A 1XTKA 3EWNA 3P2KA 1M1NB 3PQ4A 4RMGA 4Y2HA 4ARSA 1LTHR 3L6OO 3GJ0A 2IYNA 4JXXA 3VO2A 2Q0SA 1U9IC 1SXJC 3J80A 5JNTA 3GLFB 3E61A 5TT1A 3BD6A 1P0QA 4OPMA 3L43A 3U1TA 2ZXUA 1ZKMA 1IY9A 1VPDA 5H0IA 1K6EA 2C9YA 2Q50A 1WZ2A 2B4KA 1WSAA 3VNAA 3MRXA 2VHCA 3W9YA 1HORA 1UMDA 2ZJ5A 1N7IA 4ASUD 1O57A 2P9FA 3DC2A 4Y0NA 1MVNA 3X1KA 2BHRA 1KOLA 3Q7PA 4Y6PA 3FNBA 5K4HA 1VLMA 3G68A 1W581 2E1PA 4CKEA 1JHAA 1K1EA 1N8SA 3OM8A 4Z7JA 4PZLA 1Z2EA 5EJ6A 2MSLA 3IJRA 2NPFA 4ZVMA 3JVIA 2RGYA 1GGMA 4P53A 3G0CA 4QULA 1OLOA 3HJHA 4IEEA 1RU3A 3RT1A 2EAUA 4US2R 3ENNA 2G70A 5ADVA 2ZUSA 4YJHB 2JLQA 5HS4A 3OSUA 3KVRA 2IC5A 3JAMA 2FUCA 5ETJA 3UJCA 1YK1A 3CBQA 5C5EA 3BXZA 4RNCA 2EW1A 1POXA 2FW1A 1PFWA 4R1PA 1SIUA 4UTVA 4Q9KA 3INRA 3QP9A 1WMAA 2BRUC 5G1PA 2JLXA 2GCGA 3QNUA 3VFDA 4MCJA 4TOIA 3DAGA 4MGKR 3LLVA 2JBAA 2QX4A 1L5QA 3ZHZA 4BMNA 1OXKB 2O2GA 2OE2A 4FDVA 3I1JA 4MQEB 5DSTA 2EFYA 2I80A 2P9CA 4BNNA 4FK8A 2WNIA 3HP1A 1PZGA 3L7IA 2WW8A 1ECLA 4Y6QA 4PO3X 1YJCA 4PSDA 3EULA 3I2HA 5LUAA 1TUIA 1XKLA 2DWUA 1Z2PX 2FF5A 3TLZA 2BR5A 2FN9A 1E9AA 2XE4A 1USWA 4HPWA 4IWNA 4QELA 3OLXA 2I34A 3FCSB 3M7IA 1Z6PA 5KNDD 5CNMA 2H3HA 2PMDA 3G2IA 2V6GA 3VV2A 3ZN2A 4XM0A 1YR8A 2WDZA 3IPXA 2VP4A 4YC7A 1N75A 5FBLB 2A35A 3F71A 1QIIA 3MWKA 3RSSA 1F3LA 2CBGA 2VWPA 4L85A 4GW3A 2QMYA 4FJ0A 4AJPA 3SEQA 2O5CA 2EBHX 3ET4A 2COUA 2OK8A 2XMBA 2ZCJA 4MPDA 1YJBA 1S8FA 3IVRA 5LC1A 1CHNA 3B13B 1XKXA 2FSIA 1KZ1A 5K20A 1NXSA 5BSMA 3I04A 2VTDA 4ZWNA 1GN9A 4DLUA 4RVFA 2V0CA 4LSMA 5GV8A 3UNXA 1RI2A 1R12A 3LG2A 2Y99A 3RTCA 1YQWA 3HVHA 1DJPA 4Q01A 2IEAA 1TPYA 2Z3VA 4HO1X 4L4RA 3L3BA 1OYWA 3I6MA 5CFOA 5KVAA 4AKGA 5JD3A 2F2TA 3C7AA 3CN9A 2WE8A 2MSEB 1SUPA 4HTAA 1H8HA 2K4MA 1AV7A 4PHGA 1R4AA 3ZQJA 1YDHA 3GO4A 1SK8A 3KPJA 1DE0A 3GEBA 4JUAA 1NR1A 2J7PA 4IF6A 4MUBA 1WY5A 2W2TA 3W3AD 3AR4A 4DHWA 2J59A 2PIAA 3GH1A 4LXYA 3PEVA 2EX1A 1KP2A 4W63A 3QYPA 2Q8PA 1ZI6A 1N6RA 2PPLA 2R1ZA 4JK3A 4Q19A 3MMPA 1A9XA 4F84A 2IL1A 4GRAA 3TPCA 4OHMA 1SWVA 2YL2A 3VMMA 1EVZA 5I48A 4MI9A 2JFZA 2QVGA 4OAOA 3RSCA 4URVR 2BEUB 1KH1A 5EHGA 3ZDQA 4OYYA 1JIVA 1G63A 2IP1A 2W71A 2WVJA 5EERA 5FEMA 2ES4A 2I9KA 3TOVA 1W0JD 1UT8A 3IDFA 2C8LA 4PPYA 1G6OA 3OPYI 3RWMB 1ZJ4A 3D3WA 1CIJA 5AVQA 2JCYA 5JXWA 1TO2E 3IHTA 1KK2A 2MOKA 2QVBA 3VVLA 1D4ZA 2QWXA 4Q4DA 4JN6B 4EFMA 4WZ6A 3H9QA 4Y2PA 4EYEA 4AKTA 1T1EA 2HBRA 4J0CA 4IIHA 5JCOA 3WLMA 1BXRA 1GL7A 1NULA 1Z0SA 2VSOA 5KIAA 4YO8A 3HRIA 2ZE5A 3SIXA 4AZVA 4IDEA 2FPMA 4UVDA 1P75A 4K7JA 5B1HA 5ELMA 5G3ZA 4FZVA 1E9BA 1KDRA 1T1GA 2I2DA 3ZLUA 2BEWB 3H1GA 5CB6A 1KO4A 2W6JD 3B7PA 4ZD6A 4JVOA 4DILA 2C98A 3N87A 2GAAA 3K73O 5DCYA 4EG5A 4JJKA 1DDGA 1C9EA 3QPUA 1G20A 4YEDA 2AD1A 4NU0A 3K09A 1RI1A 1Q1BA 1K3FA 3W7BA 1WVIA 2NU6B 2BKLA 4P7GA 1R9GA 1E7QA 1GQQA 5CNKA 3DO5A 2X86A 2KSQA 1GA6A 2CLMB 3MTDA 3PPVA 4ML3A 1EFDN 5DX1A 5EEHA 1Z18A 3DZ8A 3KUKA 3FOFC 1PTJA 4IOKA 4P3XA 4KC0A 2DQZA 4ZK2A 3K71B 1GUYA 5L3ZA 1SHTX 2VPYA 2X1HA 1H2FA 3I4CA 3LW7A 4QVKA 5IP5A 2BI8A 4QASA 4D2IA 5DASA 4EPRA 2C0PA 3V4ZA 4A8PA 1EQ2A 2POQX 4NP6A 4JJEA 4RH3A 1MO2A 1G2OA 1DX4A 3AEXA 3OTWA 2Q2OA 3WWZA 2W98A 1Y5MA 1WTAA 4WNAA 4LNUA 4P0TA 3NB0A 1SQGA 3O3MB 3HLYA 4XYBA 4QGHA 1O08A 3A3OA 1LQUA 1WB6A 1WB4A 1P39A 4U7GA 4BZZA 3OU7A 4HXYA 1ZIOA 2AFVA 2OWEA 2RHOA 3FDJA 1T3TA 4RABA 2IV2X 3JASA 4EVSA 4ER5A 2ZJ6A 1YS7A 3HA3A 1GPKA 2G7ZA 4WLOA 5AWFC 4DTIA 2VDUE 1FE8A 2BFCA 1E2UA 2R6GA 1Q7TA 2QIOA 4PWZA 3L1IA 3GD5A 4PG6A 5DI9A 1K7SN 1T5HX 4B33A 3KPUA 4RF3A 5HHTA 2ODPA 3GGCA 4IIGA 4EG3A 5MN6A 4HMQA 4TMZA 3NIFB 2PFSA 4H18A 3T5MA 3DQQA 3NWBA 3FPLA 4E7PA 2V4MA 2VPWA 3RC8A 2NU9A 2AFIA 2UAGA 3H16A 5EKXA 2MT9A 3MLEA 1BVUA 3MFQA 1GVNB 5JW6A 3FBTA 1MH9A 3C5WP 2DLNA 5K0ZA 1GTJ1 2BGUA 3OQJA 4LZZA 4O1MA 4R40A 1C1DA 5LMZA 1S4QA 4NZPA 2Z83A 2QT9A 3AJDA 1ZBDA 5LZ4A 1QG0A 4LJYA 1HM5A 3SN6A 2VIIA 4E03A 1WCIB 4DADA 1OUMA 1C1YA 1RRPA 4AMGA 1JALA 3FKSA 4YAJA 5JLJA 2FUKA 4IDCA 4R84A 4AN0A 1FSZA 2YWXA 1U8ZA 2WD9A 2QAGB 4TTVA 5EHNA 1EX7A 4AN4A 3CUKA 1ZLYA 1MAHA 3PP8A 4Q18A 2HRDA 3K6JA 3FIUA 3UOWA 2IH2A 3AHGA 4R8SA 1I6LA 1CC1S 3BHNA 4Y2VA 2BJWA 4ZYTA 2BFMA 1NJ8A 3MT9A 5BSWA 3A4NA 4JX8A 4AKEA 1TYCA 1P77A 3PEFA 2UZIR 1J7KA 2ZCUA 3ETHA 3RS4A 1DWPA 1U8YA 1KQPA 3OZUA 1K7FB 4IS2A 3LO8A 2QZJA 4E2YA 4IVNA 3WMGA 1ENYA 4RWEA 2Z8XA 2GM5A 1ZGGA 1YASA 3ZDRA 4D56A 3IVCA 3I72A 1XNQB 2VBGA 1T0HB 2AWNA 4UHFA 4TS1A 4C87A 5C53B 1SXQA 1CW2B 1FUKA 4JC4A 4Q3OA 3EMDA 1WPGA 3DTVB 1YRHA 1O77A 1M6VB 3IRVA 1ORDA 4GGMX 1SVNA 2WU1A 2V9CA 3AI3A 4J4HA 4JBLA 5FLYA 3VZBA 3H2IA 1C7JA 2I22A 3JQ9C 3OCUA 4QHTA 2JGFA 3UMBA 3ZVNA 1H23A 1XP8A 2ZPAA 3DJFA 3AHEA 4HMOA 4KXFB 2WTUA 5FOUA 4ARZA 1MTOA 4V1CA 3R9XB 3CZCA 4CZ2A 2FPOA 1L6IA 3EVGA 4BO6A 1VJDA 3ZWMA 1HX7A 3DDHA 4GYKA 1OPRA 3G0HA 1I7NA 3WGLA 1NFFA 3DAPA 4O29A 4Y6RA 1MB3A 2CCJA 2R65A 3QQPA 3WL8A 2Q3LA 1T0PA 2Y2VA 4ZT5A 5FH9A 3DOFA 1L5SA 4GH5A 4ENTA 2ZBUA 3V9AA 5KYYA 1BE6A 1CUFA 4BKOA 2XUPA 3Q3JB 2UUPA 3EH1A 4JUIA 4MKZA 4QDKA 4L4ZA 3RIYA 2E4YA 1NATA 3W78A 1BE0A 2M2IA 3LY7A 1CKEA 3ZK9A 3ZPXA 3ZJYA 1RWNA 3EEFA 4BV3A 1XRMA 3KZXA 4P81A 1E98A 3HKDA 3HUDA 5LQNA 3H2HA 3DHWC 1DJOA 3FF1A 5DP1A 1ZAYA 4LDRA 1ZNQO 4ZZ2A 2FY8A 2HXSA 2XZPA 4LMAA 1E89A 2QV0A 4MIEA 3UGKA 1V9CA 3ANMA 1UC9A 4R01A 3O0TA 4O5OA 3S55A 3RYIA 5IEJA 3ZTWA 4J7XA 2VJCA 3H2SA 5AIAA 3UYLA 3UAOA 1SUDA 5U1PA 5J9FA 1Z0DA 5K2MA 5A4AA 2ZJ1A 2PUTA 3P5BA 4ITUA 2YHIA 2CHQA 3OWOA 5ALKA 5L40A 1JFRA 3DLBA 4O2AA 1UM9B 3BGSA 1K7XB 2E85A 1JR4A 3ANTA 4AJOA 4LZAA 4B2YA 1J8MF 1KGSA 1PLJA 1P0IA 2WA1A 3OE4A 1MOPA 4QXMA 1M2KA 2AEEA 3GLHB 5IBPA 3X1XA 2QP3A 3EIQA 2I3AA 4Q1BA 1DAFA 2JIZD 3HYTA 1WHSA 4RIEA 5AMXA 1YFLA 3GN2A 5DM70 3RTGA 5DWDA 4D81A 3IA7A 2JLVA 4X1IA 1IE3A 4Y2TA 4E1AA 2P9TA 2P6UA 1B0AA 2ZTHA 1REQB 5CURA 2FMUA 3CJQA 1OFGA 1EH5A 3BWMA 3P4UA 2PL5A 5B2EA 3ZJTA 3HBJA 5GM2A 3GLGE 1H2RS 3TNYA 3USCS 2J07A 5K3CA 1I9GA 2B9VA 1T8PA 1T0BA 1NYTA 3K1TA 2IWRA 1U0BB 3F2VA 5CT9A 3TK1A 5JAPA 4BVBA 1EUDB 3G5LA 4TQUS 3WLIA 4G0UA 1ZM2A 4QLAA 1BDBA 1RJFA 1M1YB 2Z1MA 4LTNA 1Z5WA 2D3WA 5GVRA 2EWVA 5TQ2A 5GQSA 3SBEA 3B1ZA 4OSPA 4ZVKA 1VG9B 4IIJA 2GN6A 4QTTB 4BNDB 3THWA 1IHPA 1FFCA 5E6RB 821PA 1R15A 5HNKA 2XB8A 3OPXA 4PHTA 5FPYA 3MUEA 5DBIA 2WAYA 4IO1A 5TQJA 3ZWAA 2IH4A 3PSAA 2WOOA 4EQ6A 2DHEA 3OQOA 3KL2A 3ECAA 2EG5A 3GV0A 1U6JA 3SWWA 1GNQA 1XCLA 4H2DA 2BZSA 3ETJA 5L3RA 5CU7A 2QN1A 1I3NA 1DTSA 2A0WA 4KO1S 3ZXXA 3AF6A 2JLCA 3C5HA 5DTQA 3QVJA 2QGNA 3SIRA 1LSJA 1RNLA 3W5VA 3KQUA 4RK0A 5TT0A 1A9TA 2J09A 2O2ZA 1SRRA 4HEJA 3WAGA 3O8LA 3ZCRA 5HXAA 2PKXA 2ZWPA 4Z9YA 5LP6B 4MRAA 3EFEA 4A27A 5HA5A 4V0MA 1WV1A 2B1QA 5IT4A 5AUNB 2VXOA 4CPDA 3KD3A 4II7A 4DJAA 4P3OA 4E4RA 4L4SA 3CE6A 2ZAYA 1DXQA 1ZK4A 2KHZA 1FTYA 2VNJA 3I0NA 4FPXA 4FYPA 1G3UA 3IMGA 3COSA 2O7RA 1RSZA 1SCQA 4PHHA 5LA6F 1J99A 3SAJA 3LQFA 4BGDA 1N2EA 3IUMA 4P4LA 1IDN1 2GSDA 2HIGA 3OG9A 4TTQA 1V6AA 4CUKA 2F8TA 4NU6A 5L45A 2PRSA 3CPHA 3IBSA 4IJ5A 4ZVQA 2Y93A 6Q21A 5IJ0A 1SJ9A 1J42A 3LLCA 1E66A 2KJQA 3A14A 3CRRA 4MGEA 1U2DA 1TLLA 3H84A 3Q40A 3WGNA 5KTNA 1U2PA 3H8JA 1T3LA 4DTCA 1L7BA 2BH9A 1U3VA 3ETEA 2DUUA 2P5TB 4FKZA 2VN8A 2YWFA 3I5AA 1LY1A 3MWGA 3W5JA 4DG5A 3KJQA 4UBJA 1YL6A 3LBHA 4Q12A 3PC6A 2NVWA 4DCOA 1G38A 5DOVA 4IJMA 5K3BA 3C6MA 5HQ3B 2YJTD 2GZAA 3C7CB 1BW9B 2FP4B 2X76A 5JWRA 3PPXA 2FF7A 2GZMA 4YAFA 1OX4B 2EQAA 2QI9C 1U0FA 1N2CB 1NVTA 1SPBS 4LQLA 4ZI2A 2WABA 4RIGA 1E6KA 1PDOA 4C78A 2PTGA 2X4IA 5AR1A 3VPHA 4M9CA 5DRTA 1Y6RA 3DPIA 4NMWA 2QL7A 3LHFA 1U11A 4CMKA 4G1VA 1AOXA 1L5HB 3QF4B 4AW9A 1M2WA 3LBYA 1GRVA 2QTFA 1Z0ZA 3F3KA 4TWRA 3VH4A 4ZU1X 1R5BA 3R9IA 4BJ5A 3G6KA 4XKJA 4TWBA 2Y4NA 4DDKA 4Q1VA 2P6NA 4S2EA 1E92A 4JEUA 3YASA 3AYXB 1PWYE 4ACAA 4M0LA 3CNQS 3CV3A 3LWNA 4ZCQA 4BLWA 1LC3A 4E5VA 3OLVA 1GUDA 3GFPA 5JAIA 4LDQA 7MHTA 4ZVPA 5IULC 3IODA 1RAEA 4OKSA 4US1R 2Y9MB 1YJ5A 3CVJA 3EGOA 3EF1A 4XB2A 1VGRA 1Y7PA 4Y7CA 3VOAA 1DCTA 4PLYA 2RK6A 3FNEA 4V39A 1F12A 4QUIA 4HNGA 1OI2A 3T61A 3T9BA 5BWBA 3VZSA 1TYBE 3K92A 4QA9A 4KIGA 4G0VA 2ZTUA 3CLVA 2J08A 1SURA 2V6FA 1GPH1 4F4UA 1AN0A 4G2TA 2R68A 2CE2X 2FLVA 2QR2A 1G8AA 1LPPA 2O1XA 5EZ6B 3KEGA 3EG5A 3TD9A 2I4NA 4AZ0A 4FHCA 4RL6A 2YOGA 4DABA 2IZ6A 4HZUB 3GXBA 2QORA 2O2SA 5JU6A 1TC2A 1YQ9A 2DHCA 4P2GA 1MRSA 3ZDYB 4UUMA 1I24A 2OCPA 4PM4A 4L28A 5DGIA 4C07A 5I47A 4J0JA 1M34E 3IBCA 3L0OA 5KUTA 1ZP6A 4QOHA 1ECBA 1NHWA 2G5PA 4DXHA 1K68A 1GGNA 3IO5A 1D8AA 5CLJA 4RDXA 1P17A 3ANLA 3LXRA 1M2OB 3DOIA 3TSYA 2XYHA 3HJAA 3Q3IA 4Y2QA 3E9YA 2O14A 3BMQB 1PW5A 1G8HA 3BH6A 3KHKA 4DB4A 1G59A 3AFIA 3IAUA 3L41A 2QI9F 5HCIA 1IEQA 2HRZA 1GUAA 3I28A 4OBEA 4OIMA 4JUBA 4C3OB 2BZ1A 2HL6A 5BW6B 2HEIA 3G2HA 3BILA 4LPKA 1YZUA 2ZKIA 5GGXA 3FHCB 5KJ1A 2HKIA 4WGFA 4RBNA 1FF9A 1ODLA 4TT3A 3VJMA 1K9SA 1WQ4A 4GX2A 2GNOA 5KQLA 3B36A 1VJTA 5J43A 4CDGA 3E3AA 4KR3A 1YTUA 4WDRA 5JCOC 2QSUA 5JD6A 2K6GA 3G49A 4DLXA 1HKHA 5H80A 6GPBA 5ILQA 1E4VA 1FZTA 4PE5B 4YJ3B 4F0JA 4XOIA 4B4VA 4NNJA 2GESA 1NMXA 3U40A 1K6JA 1RJWA 4CM9D 2XT0A 2PANA 2ZWMA 2A84A 3KUCA 3Q88A 1MP0A 4O4JB 2QUAA 4I1YA 4LEIA 5ERXA 2QR3A 3EXG2 4JLSA 4RD1A 1V47A 2SCUB 2RKBA 3QNMA 5KTSA 4ZZ1A 3THXB 2BFFA 3VKWA 4X54A 1E9EA 2CVHA 4AFNA 4Q3LA 3UHPA 1BWQA 3K09C 4OLJA 1I2MA 1XZGA 1GA4A 2X4LA 2IHKA 2UZAA 3PJEA 4RFVA 3BDIA 4FE3A 5KWEA 1DXOA 4NECA 2GZDA 3B1FA 2XCQA 3N59A 5J3JA 1WB9A 1YB6A 1QVZA 2WM8A 1WVGA 1RS0A 4M0CA 4RKRA 5BP7A 1PTJC 3WFZA 4N0DA 1FL9A 4IS3A 3STTA 5BVHB 1JDJA 4RF5A 4EX7A 4FFBA 4S24A 3JD4A 1KZYC 5HWSA 3U4MA 1XRLA 1I10A 4NAUA 2BEKA 1FFYA 4FCWA 4MAFA 1GGHA 2PQ6A 3NBKA 4LYGA 4MGHA 2Z2XA 4ZV9A 4BYMA 5JNLA 4K9PA 4C4ZA 4G4SP 4M9SA 1VPEA 4HDRA 4PZ9A 3MUNA 4Z86A 1ECGA 1B6TA 1NNLA 1L4NA 2B1IA 4JEMA 1O6BA 3CSSA 4CCYA 4F11A 4ZC1A 3AG6A 3BWBA 2YZ7A 3VC3A 1EAYA 2FWJA 1MX5A 4IIFA 2B5OA 4PYQA 1WD5A 3WBFA 4MA4A 1QVAA 1NNSA 2ZSJA 1K7CA 2XKJE 4KUHA 3SZOA 5B3KA 1FP2A 2IQ5A 2RAFA 2DWOA 3AH8A 5JCPA 5I7RA 1ZH2A 4BNXA 2A9OA 2FWMX 3I9OA 4TSKA 4E1VA 1PBNA 1RYBA 3BIOA 4IDBA 3USES 4V3CA 5KKNB 2LDXA 2CK3A 4QYWA 2P2DA 5FOVA 4M2LA 3F6BX 1NVFA 2XUOA 4YGYA 1QCCA 2ENUA 5LMCA 1XU9A 2DYKA 1E9VA 5BOVA 1OWOA 4G67A 4LF5B 2JLSA 3AXSA 4J43A 1Q77A 3EGVA 5JWHA 1N0IA 1W85A 1KORA 3IBYA 4B4WA 3IHWA 3SJCA 4MW7A 2TRSB 1ZGHA 1SY7A 2P1RA 2PBRA 2I7TA 5FL3A 5H59A 2ZZKA 4MV8A 5K7SA 2XUKA 2GYYA 3EGWA 1L5OA 3I2KA 2B5WA 1Q2UA 2IPXA 3JU3A 1Z7WA 2LXNA 4UHKA 1YVEI 1PFQA 5DNYB 1EZ1A 2PD4A 4JLDA 2QTBA 2DTDA 3F5DA 1ZNZA 3LXMA 5FUBA 4FKBA 4M3NA 3R76A 3PICA 4HRXA 1XRQA 2PSHA 5TX7A 3TLMA 3JQ7B 4PG5A 4WNYA 1AA9A 4D7AA 4GRIA 3GMIA 2FZVA 4W5HA 2G7MC 4Q82A 2GEBA 1G5HA 2IPNA 3G2OA 3PGMA 2F62A 2PD3A 4CLOB 3HB4X 2FPWA 4R1TA 1ZVVA 4OATA 2JGRA 4C2BA 2ZGVA 1P0PA 1QIJA 1I2DA 1YBFA 4R9SA 5AUQA 3RSFA 3OJ0A 4MR7A 3EMBA 3R7LA 2D8MA 3D8SA 2BUCA 2AQIA 2G9ZA 2GB4A 1IBSA 4L51A 1I0ZA 5CB0A 3X1JA 5HIJA 2CVPA 4Z7NB 3QU5A 1I1HA 3NHUA 4IW3B 4KXQA 4ZXPA 1MNQA 4HS4A 1XEWY 3MJCA 4ZVTA 1KJIA 4N5NA 4D9HA 4DMGA 4MVJE 5B58T 2DFLA 1GGFA 1R4MB 4MVJM 4PBSA 3HVUA 3JD1A 3OZIA 2Z4RA 1E64A 4YRMA 1I0IA 1ZD8A 1QIGA 5E7QA 3UMRA 1Z34A 1LF0A 4WN9B 5BSHA 6CHYA 1GSAA 1O6CA 1R6TA 4YP5A 1M7BA 1Y4UA 2VQFB 4Q16A 3C7DB 2QDXA 1KYXA 1DG3A 1CZLA 3JVEA 3WHIA 9GPBA 2RC5A 4ZQGA 1NDUA 1EK6A 5J63A 2FQXA 2FOIA 2WSSA 4PNEA 3HNRA 3T9CA 4E7OA 5IDQA 2VH1A 2XNSA 1RVDA 1E1DA 1RQXA 1TVKA 4MQMA 2RGUA 3RABA 1WBDA 3GEIA 3PR3A 4CKBB 4OXQA 4DLNA 3FPAA 3EZFA 3TSOA 2ZI7A 1HEIA 1XROA 4E13A 2HNKA 2QTWB 3DE6X 3QLTA 1HDCA 5J4LA 4YRZA 6LDHA 1Q0TA 1JWLA 3MTGA 5IJ9B 1N5IA 1VFNA 1FFAA 2GPJA 4PQEA 2O8CA 4OCZA 4G41A 5FTNA 3ZGOA 1Z17A 3EDMA 1OBHA 5JSZB 1L7EA 1QGYA 4GL2A 1D2AA 4PC2A 3K94A 3OPVA 2R6CA 3ENQA 2ORYA 2PQMA 1OFVA 3TW8A 1R5NA 4U7PB 1H9CA 2Y1WA 2YW9A 4Z4CA 1OFUX 2GD1O 1I33A 2EKLA 4R2JA 1SZCA 4FMDF 3RFFA 3I34X 1IQ0A 3M6IA 5F21A 1VE1A 4ZV7A 3WZLA 1HNXB 5D51S 1HF3A 4EG4A 2VF5X 2I4RA 3K2IA 4INOA 4AICA 4OP3A 4M9RA 5A3VA 3SE7A 1NRWA 4K2AA 3VR5D 4CMJA 2E4UA 5A5EA 3P2OA 2VH5R 1NUPA 4JB3A 4U9UA 1WP4A 1ZGAA 4DB2A 2B3TA 1EDZA 2ZVQX 2FSHA 2MWMA 2OESA 3FY4A 1H05A 3CLUD 3KKOA 4JOQA 4OGLA 1Z26A 4WKGA 3WIEA 2LIPA 4IV0A 4PYMA 1U4SA 4TTPA 5CDGA 2PBFA 4MUMA 4PGAA 3HR4A 4LZOA 4N0MA 3WGOA 4KWTA 3L7YA 3T4EA 3ZZ0A 5HKKA 1ZR2A 2YR0A 3R6TA 1DBIA 2FPGB 4CDNA 2YJZA 5J23A 2Y9PB 2JHAA 3R0ZA 3FGPA 4H27A 2D1TA 1U0LA 1FUUA 3G13A 1XBTA 1GLNA 1MFPA 3FE2A 1SBZA 3PITA 1C9YA 1W46A 5IJAA 2P0AA 3H05A 3UFBA 1F0NA 1TCCA 1XL1A 1Y9EA 2LUOA 3HGTA 1OLUB 1KKLA 3L05A 4E5NA 2GYUA 4YBRA 5HE8A 2ABWA 2Q3BA 3N2YA 3GQBB 2KB0A 3O74A 4Q00A 4DQDA 2E5FA 4F71A 4UJ5A 1QBGA 4HEA6 5JO9A 2Q49A 1FQKA 1X8LA 3SCZA 5BV7A 3BFJA 1KK3A 4DZRA 2DWQA 5JCZA 3AI2A 4HD8A 3K53A 3L8MA 4F7DA 3RF6A 2PS1A 4Z2AA 2FWNA 2H1HA 5TF4A 1O96A 3W7AA 4B4KA 1W88A 2WFMA 3TRFA 3TVDA 1L1FA 1B73A 3DMDA 2C31A 1CQXA 1TZCA 3JVDA 4JIGA 5F52A 3EJWA 2OCIA 1OYYA 4WT7A 4M99A 4GGOA 4XYMA 3OCYA 2QN6A 4OQPA 3RRMA 3HNOA 3GJZA 4KPYA 2JH9A 1RXYA 1WZNA 2BI4A 3K32A 4R7TA 2DAPA 3VX3A 1ZC4A 4OF4A 1FTSA 1KK1A 3RC7A 3ZGXA 1NP6A 5DHAA 5HYVA 1SXHA 4O2AF 4GL4A 3WKDA 4TMTA 5KHAA 1SVMA 2ONCA 1O89A 3UB4A 1A98A 3RC9A 2C59A 3CH4B 3V8NA 4UM8B 2H65A 1R5JA 4L22A 1QS0B 1AKRA 1U2DC 1USVA 5T3UA 3EYWA 3ILSA 3INNA 4WLVA 5G4KB 2GBFA 2YS6A 3QPDA 5IN5A 3MYYA 3VPFA 2ZJ4A 3V4FA 1KP9A 1ULAA 5DHRA 3KB2A 3LLMA 4ZODA 4RD2A 3KJFA 3VZCA 1B0UA 2GXUA 2H48A 4I50A 5IWAB 2XY4A 1BMDA 1KIFA 1YU6A 4GFDA 2X8AA 3KWMA 1JSCA 5EIWA 4RULA 4URWR 5ARDA 3ENZA 2GILA 4LY6A 1E3DA 2DOKA 1AGXA 4EW3A 1BXGA 3CJTA 4M1WA 2R1VA 2VCEA 1EBBA 3FOCA 4KXMA 3OE7A 13PKA 1BXKA 4QNMA 4V24A 3WRYA 1BWPA 3IAHA 3SYTA 4EZIA 2C5HA 3CLTC 4HEA1 1VL1A 3ONEA 1W19A 3CTMA 4IIJF 1F4VA 5KHLB 1GQFA 1U0HC 2BY4A 2V96A 4OOFA 4BO0A 4GQIA 4C7BA 2PUDA 7MDHA 4D44A 2F7SA 2XR1A 4GD3Q 2A9KA 1SR8A 4FFOA 5AKZA 1HYEA 2WYUA 4E5PA 2PUJA 1DJQA 4LHZA 4J0EA 2BM8A 4J3FA 4OA5A 3DHEA 1CS4C 5G41A 3KU4A 2BAGA 3UK0A 4C7VA 4KL8S 3KTFA 3H6GA 2BF7A 3EH2A 3NBZC 3EISA 1E3TA 2UUOA 2QGZA 2CXNA 2Y66A 1ULSA 2I87A 3RASA 2FG6C 4HNUA 2HMWA 1VBFA 2IHYA 3G2PA 3NATA 4RSGA 4E70A 2IYFA 3BQ9A 1KXZA 1USGA 2AN1A 2FWPA 3AWDA 4P93A 5FPSA 4C0KA 2OFOA 1ZH0A 2X0NA 4UJ3A 3WAKA 2GN9A 3TEFA 3TE6A 3ME5A 4V0OA 4XX1A 1B8NA 1VBKA 2E4AA 2WJAA 3B6IA 4QG7A 4TV8B 2VDMB 2IXBA 1L0BA 2VLBA 3E81A 3DE3X 1XQWA 4GICA 4KXNA 4Q4AB 1SBTA 2C2OA 4WUVA 5ALXA 3UCFA 3HADA 4HPXB 2LTAA 1YZKA 2CMFA 3MOSA 2OOSA 1IAVA 1FA9A 1J9GA 3LS2A 5AHRA 4K0KB 1VC2A 2G9RA 5KNLA 1NJ1A 1UPFA 2ZSAA 3CUWA 3NONA 4NU8X 1KY3A 3CX4A 1T6YA 2CE7A 2GCIA 1FOEB 4M7RA 3MMZA 2IX3A 3UJBA 3VR5A 1VP3A 1V37A 1XMVA 1OAOA 2DSNA 4OO3A 2HWYA 2O8DB 2OY0A 5CXSA 3W5IA 1X74A 2XQGA 1M1NA 2WFLB 2QUZA 3AIOA 3AF5A 3CNLA 4Z7OB 1D6JA 2RB5A 2F43A 2I1VB 3ZIDA 1LLFA 4I9HA 3A58B 4BWGA 5KDDA 3GRKA 2VK2A 5IM5A 4E5MA 3AVOA 2VT7A 1NX9A 3LUGA 1LVHA 4LRTB 2D54A 1U0OC 3B7WA 3QBDA 5CFZA 2G63A 1E2IA 3COPA 1I51A 1B6SA 4H7PA 3L1UA 4W7IA 1YE3A 3DR3A 1YHNA 2IW3A 1O0BA 1GLGA 4I46A 4JJ6A 1I5EA 4ZJYA 3QELB 2VPXA 2O8BA 4TS4A 3FTNA 2V7PA 4Z9XA 1N7GA 1SQ0A 4N4AA 2XXAB 1GFIA 2JC3A 3GW8A 2WNSA 2YMMA 4BKUA 9LDBA 3LPCA 3EWAA 4NFYA 5JJLA 3U7GA 3OQBA 3T3DA 2P8JA 1NXTA 2PGNA 1DFHA 3RW9A 4ZHSA 2LRHA 3DFKA 3ZKAA 4BL5A 4CKEB 1JR3E 1LKZA 2RAUA 3OJXA 1MXHA 1PNQA 1BWSA 3HXTA 3S40A 1DIRA 3KSUA 5TNXA 1XTPA 5F5NA 1HQYE 5CCDA 3RAJA 4EG6A 5D1HA 4YJHA 1L5ZA 2HEGA 1T5SA 4U2DA 3SBXA 2Q3CA 2ZB3A 4ZREA 2QRVB 4HSGA 3FN4A 1HNZB 2A0FA 2VOEA 3NTUA 1ZJYA 2RAPA 4D74A 3SHFA 4DC9A 1KAEA 5IKEA 1Y0BA 5IVIA 2XB6A 3WA7A 2OBMA 3HCAA 2JGMA 2ZB2A 1U0GA 3LX6A 5KSYA 4PYNA 3PXGA 4A0FA 4YAGA 3UJ6A 3RUFA 9ATCA 1COZA 5EE5B 3I53A 3QXHA 3LXUX 1RTTA 1L4EA 4JP3A 2C7OA 1V39A 2H31A 4MQEA 2BMAA 1E61A 1V7ZA 4GKAA 3FB1A 4Q4JB 4EB6A 3SDZA 3PQ2A 1JE1A 1ONPA 5K3FB 1NL3A 1M1ZA 4OTZA 5ICGA 3DMPA 3FI9A 2YIJA 5IASA 2R3SA 1UJ6A 1D6SA 5E3HA 4I5IA 5LQDA 4YQFA 4FR2A 2R8RA 3AHIA 1JHDA 2DY1A 2YUTA 1L6RA 4B3HA 2M6RA 2YW2A 3D1JA 3TF5A 5LDHA 2CL5A 2VRCA 2OXRA 3ER9A 3L0YA 4BMSA 1NF8A 5TGDA 3ZU6A 1H5NA 3NNSA 5MGNA 2GPNA 3LT1A 3LCVB 3NHJA 4JBWA 4R9NA 4NE2A 4Y9SA 4MPRA 2NM0A 2X9QA 2OENG 3QZUA 4WZAB 1G0OA 3ISTA 1C81A 4MVCA 2UUCB 1QTQA 3IOCA 2A3RA 3BIJA 3RS8A 2D13A 1PLLA 4H0FA 1GY8A 1QSGA 2HSDA 2PZJA 4XPZA 4AMVA 1G8MA 4BVGA 5U9CA 1XC7A 3FDZA 3IS3A 3NVKI 2BBWA 1G4AE 1W49A 3O2SB 3N53A 4CNBA 4ITVA 3N3BC 3ZX5A 1JAYA 3D7MA 3KV3O 4C0BA 2AJDA 2JEYA 4H15A 4DJTA 4W5OA 2PJDA 4Z51A 1WNFA 2X2FA 1NQXA 2HBYA 2WHEA 1G9TA 4R1MA 3RUEA 3ESDA 2CCKA 3ZKWB 4UE3S 2RK4A 4GPBA 4MO2A 4C30A 1YS6A 1BGVA 1FSGA 1CQIB 1E7MA 1RIFA 3MUFA 3N0TA 3O21A 2JGDA 2AZTA 4YROA 4A9AA 2REOA 4Z4FA 3BWEA 2Q4BA 1U3UA 4DZTA 3AR7A 4WH0A 4CTOA 4O0LA 4K88A 5B3AA 3GT7A 3QRWA 4MYDA 1TMYA 1X15A 3SP1A 4DCVA 3NTQA 1HGXA 4LGYA 2RCNA 2UVPB 3GNQA 1FXSA 3G3EA 3R0VA 3UXYA 4YRGA 1U5BA 1XHLA 4BB0A 3PGVA 2OMEA 1XZ8A 1BX3A 3LP6A 1MEOA 3O4FA 4ZOEA 1VIVA 3G8BA 1YT5A 3VAAA 5BORA 1HE1C 1CLUA 2ZAOA 4I7EA 1I3MA 3DR5A 1PL8A 3PNBA 4J9VA 2GZRA 4J7AA 1B0PA 4J29A 2MSKA 2ZIZA 3CKLA 4YVFA 2BEUA 2XX3A 3P9RA 4Q24A 1YQEA 2O7VA 5IC4A 5I4CA 4MW2A 5HM6A 5AVXA 1XCGB 3OZVA 4AAYA 4ZQHA 1QTIA 5LXTA 3AP3A 4ETMA 2Y1GA 5AW8A 3M4XA 4CETA 1NW6A 2Y0BA 4Y1GA 4F9GA 3LUBA 2WTNA 1U3TA 1YA8A 4KXYA 3TQCA 1PJCA 1Q0ZA 2CFRA 5H4GA 2WPDA 1SKMA 2XJ9A 1KRWA 3NM6B 2WRZA 1EDDA 4Y6GB 5KQSA 5AHOA 5FNVB 1OSNA 3CFYA 3ND6A 4BQSA 3S1AA 1ZFNA 1QRSA 3GLSA 4WDQA 4LWOA 2R8XA 4R41A 4C14A 3OCXA 2Q3EA 1UFVA 3CKYA 1L7PA 3IDZA 4M21A 5A7HA 3WLLA 1NOIA 2XH8A 3X44A 4AL4A 1LX6A 3PJGA 2PO7A 4MZDA 2RIRA 4CR8A 5HKAA 2J3MA 2C42A 2AA3A 2BEWA 3LFTA 1X39A 2ECPA 4PTZA 2GZHA 4DWOA 5KNBH 3WQSB 1JMVA 2WE7A 4MS3B 4HV4A 3ZIAD 2A9JA 3U39A 5JPDA 2EW2A 4W4TA 5DBFA 3AOGA 1ZGCA 2WM3A 2NU6A 4MUJA 1FMJA 3NRJA 4FLFA 2OORA 5FUMA 1PR6A 2WB2A 4ZZ3A 2IXEA 4Z4IA 3IIEA 3OECA 1XZAA 5GV7A 3PT5A 3TYXA 4LVUA 5C1OA 2VP3A 1PVVA 4WAUA 4F8EA 1GFWA 3A4MA 5B1IA 1DRUA 2A9FA 2YXPX 2G72A 3LT4A 5D5QA 1M2EA 3ASVA 2JW5A 3L6EA 4G5SA 3L92A 4K0RA 2UXBB 2ZRKA 4Q05A 1UPBA 3OWXA 2TMDA 2XUQA 5ESDA 4X1OA 3F49S 4NZOA 4EENA 2Q5JA 3A1TA 2EERA 4ZDWA 2FMFA 4L0DA 2O57A 3DE1X 2ACVA 4ID9A 5DDIP 5JG7A 1ZNXA 4PS0A 1YVDA 1Z38A 2O3UA 3VR2A 1DAKA 1AUVA 3Q87B 4KKXB 4Z6KA 2HCBA 4PVDA 2WMYA 1GFSA 3KOYA 4G0OA 4LTMA 2Y68A 3I9KA 4EVRA 5SYAA 1Z8DA 3QMVA 3N28A 1JT2A 2ZTSA 1JMKC 1TQ6A 1ES9A 1R0SA 3JWGA 1T1RA 1NQAO 4DC1A 4F2GA 5CA1B 1X1QA 5JATA 2CNDA 5EP2A 1L8QA 2QSJA 4EZBA 1FSFA 3CUTA 2H2AA 1V7CA 3F6SA 1ZINA 3BCUA 5AM3A 3NM5A 3CVOA 2X7HA 3ICQB 5BW4A 4DCSA 2DP4E 4XSHA 2QJWA 3NWPA 3SZRA 2G1JA 3VJKA 4BVKA 4DQXA 3JZIA 2W2XA 1ANKA 2IIVA 3ZWDA 4X61A 1XKQA 3EE6A 3QQ5A 3VBCA 2ODEA 3HCCA 3HZOA 5JS8A 1GWNA 4HWRA 3TE7A 4RPCA 3RFUA 2VJBA 4REQA 3UHJA 1Z2OX 3GELA 1WCIA 2BI7A 3IJPA 4GBJA 4ND4A 1CULC 3IEKA 3V80A 4HDNB 3S0JA 5L3VA 1S7GA 3IESA 4QT4A 2ZBDA 5J2UB 2QAGA 4Z8XA 3WNCA 4DARA 4KSCA 1TTTA 1COWD 2Y05A 2R7NA 4EITA 2YVAA 1QP4A 1YNSA 2Q1YA 5DM1A 3JWHA 4JSRA 3AZQA 5ARBA 1FSPA 1U8UA 2UDPA 1H0SA 1UBRS 2JIOA 3ASZA 3V00A 2QMOA 5DV9A 3FAZA 3H9BA 2PGXA 1U90A 2WTBA 2ILTA 2RHWA 5AP9A 1Z8FA 1A8QA 2FI1A 4MVXA 2P3QA 4O2RA 5D3ZA 3PWSA 3TJMA 1Y82A 4Q7QA 1HFEL 3F7TA 1QB8A 3A9TA 4D97A 2QG6A 1A9RA 3LFUA 1UBNA 5CPFA 1GG8A 2NNLD 1QYDA 3L18A 3LY9A 2XDYA 4HWSA 1VE3A 5KYNA 1NA5A 5EE9A 1DG1G 2JCVA 3DTVA 2R60A 4JLJA 4S1VA 3NT4A 9ABPA 2D1RA 1M6VA 2QM8A 5IYZB 2F3PA 1EZZA 4JC0A 3DO8A 5B4UA 1LLQA 4TVBA 4B7XA 4JJFA 1F3OA 5TXGA 2B0JA 3WP0A 4HEQA 1F0YA 3EDYA 4OHPA 1AZTA 1ML3A 1YACA 1Z7GA 3SX0A 1WDKA 4DKXA 3R9XA 1UBLS 1VJCA 2CNWA 3N05A 4GF5A 4GVXA 4RZQA 2D1YA 2FHPA 1O95A 3OO0A 3SJZA 3Q72A 1C7RA 1S96A 2X19A 3ZE6A 4I8DA 5E4YA 4HBZA 2BYTA 3QOYA 4ILEA 3ZD6A 4DIDA 1PRYA 5B57C 3VR5H 2JG3A 1WDTA 2IYLD 1TQ8A 3B89A 3DYIA 4LI3X 1A5AB 5K8JB 3RRBA 4WOPA 4PU0A 3E3LA 3S2ZA 3LGAA 4RO0A 2X40A 3KJEA 4YB8A 4RHUA 4EAQA 4MWOA 2N46A 1KQOA 1LQTA 1SC1A 4B46A 1NN5A 4FBGA 4P7BA 4RAOA 4UOZA 1I4LD 2QZ9A 3IR5A 2R25B 2QD1A 3AK4A 5LBUA 1V6SA 4RHCA 3W6OA 3EIFA 2BBSA 1M0WA 2O6HA 4OMCA 5A0FA 4D25A 2WV7A 3DMFA 1LZKA 5LD2B 3IBGA 1GQOA 2OVBA 3WRYC 5E8JA 2P3OA 4D43A 3LUHA 4KN9S 1Y9AA 4NBNA 3G5AA 2JFUA 4O02B 1PQPA 1JEDA 1PWZA 2QVLA 3QA9A 5F9FA 3E22B 2BTEA 2QD5A 1KIAA 1IL0A 1UMKA 2XUZA 3IP9A 5LZ8A 3PRJA 5JO0A 3PLNA 5A0TA 2QYOA 2VDPB 2Y76A 3LVFO 2NSLA 3AHCA 1S0UA 1OXUA 1UM9A 3E8XA 1ZJ6A 3LZ6A 4TLCA 3V7UA 4NV3A 3F1KA 1D0VA 2IYQA 1GG5A 2B99A 3HWWA 4WZBB 4A10A 4A2QA 1RM5A 1DRWA 4IOMA 5GIPE 2Q6TA 2EF0A 2QTGA 3STXA 2H2IA 1ACLA 1XEXB 3IIKA 4NAVA 3SOPA 5A6SB 2C29D 3UJPA 3WGVA 4DA0A 5K8UA 2WA2A 4X7PA 5I6DA 1ISHA 3MWEA 2ZUUA 4S1WA 1G21B 4UREA 2E89A 4MMYB 1CNEA 1REQA 1VIYA 4YT5A 4BKRA 5JADA 1EB8A 4WW0A 3FLAA 2G5TA 4GM4A 1WDWB 4PFJA 2L2QA 4M0FA 1ZMXA 1EG7A 3P96A 4LY9A 4QYTA 2ZIEA 3QFRA 5JD4A 4L2IA 3UPTA 4K6FA 2A67A 4TKVB 4EYQA 2EJVA 1F5NA 4ZDIA 1NTRA 1QIMA 2IS1A 2IXGA 3NZEA 5JQGF 1JQ5A 4ARAA 4N6GA 3WMWA 1M1YA 2JCSA 4HXEB 1Y1PA 4R8KA 3ROGA 2AW5A 3AGPA 2VUSA 2C82A 5L6LB 1SXJD 4XX0B 1KWKA 3L7BA 3Q9LA 4CTJA 3SLGA 3PDIB 4P6VF 3RO7A 3G0IA 1FB5A 1V8FA 3JRXA 3I1YA 1JG7A 1E2NA 4A0SA 3WS7A 1BHSA 1U8EA 2Q3FA 4J0HA 5HCUA 3TSCA 2C5EA 1GTMA 1P33A 4FFLA 3DVAB 3HN2A 3NT5A 1FCJA 4I50F 3P2MA 4W8OA 1YMVA 3H9EO 4JOCA 3EFOB 4KFCA 3MWYW 2JAUA 3LH5A 4MW4A 8LDHA 3CO5A 1P62B 2IV3A 4B3RB 3DZCA 1Q3HA 3OQHA 4HB2A 3DMTA 4C0JA 1MO3A 1YGYA 1TECE 3EGCA 2CDRA 4P9NA 1VQ1A 5LP6A 1WOMA 1Z13A 2I29A 4BRSA 1KMMA 2PQ0A 4H3VA 2P2YA 1EBUA 2H7CA 3AF0A 2V7TA 2XHZA 2VTKA 3IT1A 1TT5B 2B1JA 4DIEA 4WXMA 3L0ZA 5EP3A 4RCYA 1Y6JA 4JI2B 2RGBA 3GP3A 1QHSA 3IBFA 4GI1A 1JQEA 2D5CA 3OLQA 4AJIA 4H0CA 1E99A 1G4HA 2AF3C 2ZEJA 3QTTA 5IDWA 1TMKA 4JNCA 2C4UA 2YMQA 2V7UA 3KR9A 3CRNA 1U94A 3NRBA 3GRUA 1E8DA 3C39A 3A6DA 3TS1A 4FU0A 2HPVA 2HA6A 3U7RA 1SOWA 2D7CA 4MVJD 3DB2A 1ZCBA 3I61A 4WV3A 1PNOA 1WF3A 2Q6LA 4GAEA 2GEUA 4U0KA 1UDWA 4UEKA 4EP1A 4B3FX 2DULA 3BK7A 3Q8XB 4K8OA 4U7DA 4Z4QA 3NOVA 2QU7A 4MV0A 3K70B 4UNIA 1EX1A 4O2BA 4L8GA 2VYCA 4X6XA 3CN7A 1XZDA 1DKRA 2FKAA 2AE1A 4CYMA 1MJNA 2RMKA 2RONA 1USUA 3P32A 3W8NA 4DSUA 2VS1A 1Q14A 2FP4A 4OP2A 4FYWA 2XDWA 4YN3A 4QTZA 1YR1A 5LQSA 4YRAA 1OX4A 2G8NA 2WV9A 3A6FA 3TM5A 1N2CA 4OHRA 1EXVA 1JH8A 3BICA 2B8WA 3R6WA 2OXIA 1EE9A 2PJZA 2W90A 1B6RA 4O5AA 4DR4B 1I4TD 1D09A 4G1BA 1RAFA 1SUSA 4IDQA 3TIIA 3STYA 5JH7B 2PR2A 1RW4A 3QY9A 1HMPA 3EEBA 1JVSA 4RXTA 1L5HA 4A16A 2GTHA 3M4JA 3R3UA 1IMOA 1UBSB 4KAJA 1V4VA 4Q7LA 1TC1A 1GAEO 1Q0RA 3TOSA 2ZIXB 1K6MA 4PYJA 5AVVA 4OLHA 1RWKA 2CLLB 3EZXA 1G291 5TV2A 1E3WA 2ZRGA 4JITA 3I5XA 1JUDA 2RJOA 1GTVA 4JHLA 5AYVA 4BLOA 4FGUA 1V6CA 2H8GA 4PPFA 1IY2A 1DEAA 3LPMA 2H85A 2XOKA 4H7DA 5BUQA 1KJ8A 3AZPA 5A4FS 3Q7EA 4FSHA 3PCXA 1RI5A 1B8PA 4G09A 4HGPA 1G98A 2OCXA 4GHWA 4LJ8A 4EA6A 3TXAA 1T10A 1KYTA 3A1WA 1D4OA 2IYWA 1HYHA 4JB8A 4O8ZA 5T57A 3ZHCA 5BPFA 3RVRA 3C70A 2B7LA 2XCIA 1GDHA 5A1TA 3VJRA 4WXYB 4F04A 1RADA 4XWWA 3MCWA 5EWMB 3S5UA 3SNKA 3C6XA 2GKGA 3WGQA 3TJZA 3RLIA 1QDLB 1A71A 3UXEA 4KNWA 2XYQA 4S04A 3G8YA 3WFJA 1R6DA 3MC1A 2AOVA 4KQCA 3GFRA 3SYLA 1Q57A 1YUNA 1YZGA 4MKFA 4XGNA 3G2JA 1TMGE 4V0ME 1TVMA 2XBLA 1CLEA 2QHXA 1FDOA 1R4ZA 1KO5A 1V11B 2JIQA 1ARZA 1Q1QA 3F47A 4HZUA 4BNIA 2C8KA 4HEHA 3RFVA 1UBOS 3IEIA 1Z28A 2PBLA 4TTRA 4ZARA 4IXTA 4R54A 1DRKA 5JYCA 3L02A 4G4GA 1M1XB 3PTAA 3I8OA 1RYDA 2W0MA 2J0EA 1M2OA 3VZRA 2I55A 4B85A 4ZC8A 3BMQA 4NL4H 3V2GA 4BO7A 1BIFA 1SCDA 1PGJA 2J3KA 1G6Q1 5DO9A 5IDYA 3S7TA 5FTWA 1A1VA 4G9EA 4E46A 1RCUA 4JYZA 5TS3A 1IDOA 4L6CA 3PDJA 3GFVA 4N5LA 2VT2A 3JQGB 1ND6A 3NXSA 1CCWA 2EBUA 2NP6A 4BFYA 4JR1A 16PKA 4UARA 5J2TB 4TS3A 1DHRA 2ZR9A 3RU2A 5FA8A 2BW0A 2RGDA 1U1DA 1KVRA 1Y5RA 3BYZA 3T1NA 4EH1A 5KU1A 3ONFA 4KDFA 5KC8A 5CAEA 2X3UA 5ADHA 4N3NA 1PT7A 2AE2A 2A58A 1RXCA 4MB2A 5KQMA 4YJ3A 1E1LA 5JNWA 2W58A 4W5JA 2HU5A 5KDOA 5B6JA 1A8SA 1DC3A 2M98A 5FI5A 1IK4A 1XFDA 4BLQA 4EJSB 4UZFA 3JS5A 4JNKA 1G8PA 2EP5A 2FK7A 2OVFA 4RJIA 3L8GA 1M72A 3MTQA 4TL6A 3THXA 1FPQA 1D2CA 2YZMA 3K9BA 1HDXA 1JXQA 2B8NA 1BRMA 1CZRA 1XCJA 2QZPA 2WZDA 3H2JA 2XCRB 4C04A 3GZTB 5BWCA 4B3CA 3LX4A 3W6PA 4X6YA 4JBYA 5KZMB 4LW8A 4YRJA 1YZTA 4YRIA 3PJFA 4QEDA 2OORC 3PFHA 3DL2A 4X20B 5D5PA 1EM8B 1SKYB 2VJOA 1ZYUA 2YHBA 3A2MA 5AM4A 5I7EA 4W5NA 3RYHB 2NXWA 5BVHA 3KKLA 4RSHA 5C2JB 3AR3A 3FTDA 1MF7A 4AURA 1AD2A 1E9FA 1X3SA 2QUKA 5IMBA 2W6QA 1PNVA 3H0KA 4FGSA 2Q41A 5DCLA 4I08A 4BO5A 1WZEA 1KZGB 1ZPDA 2BDEA 2YQ4A 4CGZA 1NZFA 3DVSX 2VEDA 3CH5A 4DUGA 5BUZA 2JLUA 4N76A 4HGZA 1E1RD 3CGWA 3W1EA 3TNJA 4UMVA 1OX5A 2CNOA 3A10A 4HFNA 4NPHA 1XZLA 5KDLA 2ZKLA 3ZC3A 1BS2A 1GPUA 3GAMA 5CK5A 3A04A 2XA9A 4WCVA 1GTSA 2QQ5A 3B3QA 4J0GA 5KMGA 4C6RA 1WUIS 3PNOA 4HLNA 4U6NA 4EKIA 2F1IA 3R7SA 4MDYA 1OLXA 2X3YA 3QVWA 2GZSA 3HHPA 3K8ZA 2Q27A 3P9YA 3ZG6A 5TPWB 3RG2A 2DZDA 2GCOB 2QVYX 3BVPA 1CYDA 1GQYA 5BWMA 2GX6A 3OZFA 1CWUA 2I3GA 2PU5A 2ZIGA 3DQPA 1E58A 1C50A 1DIHA 3ZHYA 5K3EA 2PWPA 2D1QA 4F2PA 5LXTF 3WIUA 4Y2XA 4NBKA 3PHLA 1W1WA 4L6AA 4BBPA 3OJEA 5F4ZA 1Z36A 4WLFA 1KY2A 2LVBA 2VLIA 4QPPA 3ITKA 5M2QA 3R0QA 1CUSA 3BHMA 3FKQA 5DGTA 5C52B 4JELA 2RGGA 5F33A 4KSYA 1GPNA 2JLZA 2XF2A 3L06A 2QT0A 2X0IA 4DRXB 1DOZA 1Z73A 3MTBA 1ZH4A 1U7PA 3IELA 1JI0A 4UUNA 2RD2A 4MQLA 2VWQA 2FX3A 4JZKA 1JSRA 2C7GA 2WYWA 1E2FA 1XA0A 3AV0B 3N2EA 4F3CA 1TI7A 2V59A 4KN5A 4B7AA 1T5DX 5JDIA 3UHFA 5DN6D 3ZVRA 3NEPX 1Q3TA 5LU8A 2BWJA 2P62A 4RGYA 3F90A 5HIMA 2HSJA