3JQFA

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and inhibitor 1,3,5-triazine-2,4,6-triamine (ax2)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
267
structure length
249
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase 1
publication title Structure-based design of pteridine reductase inhibitors targeting african sleeping sickness and the leishmaniases.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Oxidoreductase
total genus 92
structure length 249
sequence length 267
chains with identical sequence B, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2009-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3jqfA00
3GZNA 1DB3A 1G1AA 1W6UA 2D8AA 3BTSA 3H2SA 4TQGA 1YL5A 4GGPA 3EDMA 1PGPA 1D3AA 4GLOA 4EUFA 3U5TA 3WNVA 4AJNA 4DUPA 1X7DA 1PZHA 2Y0DA 1RJWA 4B7CA 2X0JA 4FCCA 1NTOA 1MUUA 1NBOA 2NLOA 3TN7A 2QYSA 4GSLA 4KMSA 4Y6SA 4PRLA 4WLEA 1E3LA 1IULA 3MOIA 4IS3A 1BHSA 4XJSA 4FFNA 3OQBA 5JAMA 4RDHA 1OC4A 1NP3A 5ITWA 2NU9A 4XIJA 5L45A 4M49A 4MVJI 2O2SA 4CUJA 2XPCA 4JROA 5DBFA 3RFXA 4BNJA 2EP7A 5JCXA 3QQPA 4HFRA 2GN8A 4HWKA 3KETA 4CMIB 4TRRA 1HDYA 2HMUA 4J2HA 1C0PA 3KVOA 2Y99A 3FPCA 2LDBA 3U4HA 8ADHA 1NFRA 1I2ZA 3WQSB 1KVTA 1IZ9A 3QHAA 3NV9A 1EEHA 3Q1LA 2NVWA 3P2YA 3I23A 3QWAA 3LVFO 4XDZA 2ZCVA 1NQOA 5TF4A 3Q9NA 3PZRA 4BGUA 2C5EA 2DQ4A 1AUPA 4YJGB 2EG9A 3VZSA 1A4UA 2AEJA 1JAYA 5JY1A 2C20A 1ZUD1 4ZVVA 1I3KA 4TVBA 1LSOA 1UZLA 4IZHA 5JLAA 5A9RA 3C1OA 3JQGA 5JYDA 4ZN6A 1HLDA 5EL0A 3NAQA 1NFFA 2HMWA 1UXJA 4HUJA 2JHGA 3HSKA 1BW9B 1B2LA 5A1TA 3AUUA 1PJSA 2JAPA 1ADBA 4LVCA 1GV1A 1NXQA 1ENOA 2D59A 3ZHZA 3H9UA 1VJTA 1HDGO 4HP8A 1SOVA 2OORA 2XAAA 3S2GA 4BNXA 3PRJA 4Z6KA 2F1KA 1LTHR 5JW6A 1PS8A 1VL8A 3DC2A 5A9SB 5CDYA 2VWHA 4PRKA 3MEQA 3LT2A 4OKIA 1NQ5A 2SCUA 3A9WA 2OHXA 3O26A 2VN8A 3ZH2A 3WB9A 1NQTA 4WOKA 2ZB7A 1DC4A 2HRZA 3ICCA 4S3MA 3UOGA 2GRAA 4YTEA 1HKUA 1VRWA 5IN4A 2X7HA 5JE8A 1WZIA 3JQEA 3CZMA 5HA5A 4Q3EA 3GMSA 3DTYA 3ASVA 1KIFA 1P1FA 3IUSA 2X1HA 1SNYA 2HK7A 2YHIA 3PDJA 1WNTA 1VM6A 3LSYA 4QFDA 4CLHA 1F06A 3D7LA 4DBVO 1WVGA 5MDHA 1ZK2A 1ONPA 1SMKA 3DEYX 3DHYA 3E8XA 4J1NA 3H6KA 5G4KA 1NWCA 1CQJA 3HN2A 4GI2A 2ZTLA 3KTDA 4J9VA 5C3MA 2O7QA 3ADPA 5CP8A 1CYDA 3TZCA 4EJ0A 3H4VA 1GZ3A 4NBTA 2JCYA 1PZFA 3R0IA 1WDMA 1DIAA 2WM3A 3IQDB 1IE3A 1Y8RB 3WQRA 2GSDA 2C07A 4EJMA 4EW6A 3X2FA 3ZZNA 3L6OO 1R4MA 4NBWA 3RC9A 2VHVA 1ORRA 5L3ZA 3D5QA 3D64A 1EFLA 2P91A 2WD7A 1ISHA 3GHHA 4PLPA 1I3MA 2EJVA 3OA0A 5JDCC 3AOEC 4DPKA 1PJ4A 4JJIA 2J3IA 2UUPA 4MP6A 4U6QA 1BTOA 4TRJA 4OSOA 3HHPA 2VUTA 3U49A 4YACA 4W9NC 2PZMA 1DLIA 1XGKA 1D8AA 1Y8QA 1ZSNA 2WSBA 3I9JA 5TQVA 2ZB4A 4IJWA 3H9QA 1Z6ZA 3NEPX 2GCGA 4PN3A 1WPQA 3C7DB 4LRTB 4D41A 3LT4A 4FDAA 1ZMTA 4HXYA 4MKRA 4C7KA 5CEFA 4J4TA 3K6JA 1ZMOA 1XU7A 1NX6A 1VJ1A 5KVQA 5A3VA 2OOSA 3ON5A 3TRIA 1TXGA 4QX6A 1JVSA 3O8QB 4M55A 4DPLA 3IL2A 1NASA 4KWHA 4ZGWA 3QVXA 2IEBA 5F3RA 4MVJA 3W8FA 2O3UA 2HKIA 2FR8A 1E1LA 2YJZA 1HSOA 1GFSA 1WDLA 2Y0CA 4ILKA 5L4SA 1ENZA 1JKJA 4DYVA 1PQUA 1N92A 1LC0A 4DXHA 2BKAA 2VHYA 4CLOB 4YAJA 1GQYA 1GCOA 1UDBA 2JD1A 3JYNA 3MJCA 3VZPA 3GEMA 3ZWWA 3ZHXA 3M6IA 1B14A 2C7VA 2UVDA 3NGXA 1Y1PA 2V6GA 4IPTA 1FMCA 4PG6A 4IIUA 1UZMA 4RJTA 4NK5A 4OGWA 3LLVA 1WXDA 1QMGA 3WLFA 2I67A 3IDSA 2GZ2A 1DFGA 4CJXA 1MGOA 3UVEA 4OHUA 5CPFA 3MTJA 3A14A 5KCZA 2BFMA 1AXGA 2BGKA 2VTEA 3H7AA 3L9WA 5F5NA 3KBOA 3HB5X 1BXZA 3C24A 3UAGA 5HS4A 1O0SA 1SEVA 2VUSA 3VH4A 1VKNA 3I9NA 3WBFA 3PHIA 2HJSA 1HETA 2EV9A 1AXEA 1YO6A 2GN9A 5JS6A 5HTOA 2WWRA 1FDVA 2AG5A 5HBRA 3SJUA 3CIFA 1W0CA 3HJAA 4PG4A 4IZIA 3JQFA 3MJTA 4Q3AA 3UICA 1QLHA 2EWMA 3H3JA 1E7WA 2B37A 3ZWVA 1E5LA 1P1HA 3C1AA 1WZEA 2IDZA 4PLFA 1YE3A 5JC1A 5IDWA 4XQGA 1T1SA 3ROKA 4QECA 3JQ9C 4BNKA 2J6IA 1V3VA 3KYDB 1S6YA 3OA2A 3RKUA 4J4BA 3JD3A 4TKMA 1IHXA 2P4HX 3DL2A 4IGFA 4NDNE 4CM7A 1EBUA 4IJVA 4P4GA 2CDBA 3GAZA 3CPSA 3KRTA 4E5PA 5EINA 1GPDG 2RHCA 1BXGA 1DPGA 1PR9A 3FNFA 3VHRA 2NWQA 2BH9A 4QQRA 2NVBA 1T2DA 4XB1A 1J49A 5BSEA 4IJUA 3VPGA 1ISMA 3MWDB 3KHUA 2IEDA 4M1QA 3AFNA 4NJMA 3IKVA 5K6AA 4XR4A 4E2XA 1S7CA 1XSEA 3TOZA 3QLJA 3GNTA 4RLHA 4XEHA 1QYWA 3FCOA 4Q3CA 4RVDA 1HL3A 1VC2A 2QRLA 3KO8A 5L4NA 3OJOA 2NACA 3ZU2A 4IMPA 2XF8A 2DTEA 3H8VA 3RBZA 5KOIA 2CDCA 1Q7CA 3KSZO 4D0SA 2G17A 2Y1EA 4JBHA 4WJZA 4WOJA 4L76A 4ZQBA 1H94A 1K6XA 1K6IA 2DU8A 4FFMA 3GT0A 5TX7A 5CHEA 4FGWA 1ZBQA 5DN9A 4I08A 5JSFA 4AVYA 2FPIA 3HDYA 1KEWA 4D45A 3RUFA 4EITA 2QQ5A 5TSDA 3TF5A 4UUNA 3IMFA 3F1LA 3BXXA 2YFHA 4D3DA 3VH3A 3VVBA 1H2HA 8LDHA 3U0BA 1GUYA 4W9NA 1P3DA 5BSFA 4JBGA 4YR9A 1NWHA 4WLOA 2O3RA 4MPDA 3LZ6A 4BNTA 1UDAA 3LLSA 2D5CA 2CSUA 3HDJA 2VRCA 2VZ0A 1HF3A 2YUTA 4NBVA 1Y9AA 2H5LA 4PG7A 3WWZA 1F17A 4YWJA 1KERA 3KB6A 4KP7A 2VWPA 4NFYA 1YWGO 2Q4BA 5A06A 2X8LA 5T5QA 3RU9A 3AFMA 3FBGA 2GN6A 4YPOA 2EGHA 2PTGA 1I5RA 3PXXA 3A4VA 3RROA 4WCFC 1ML3A 2FOIA 4CL3A 3EZYA 1WWKA 3AI2A 4CMAA 1YH3A 3DDNA 3GNQA 1PGOA 1GDHA 4BL5A 4GMGA 4RORA 3W8EA 1NHGA 2C2YA 1B8VA 1YGYA 5B4TA 2Q4EA 1JKFA 2FZEA 1I8TA 2NADA 4NFSA 3OIFA 2C0CA 2PKRA 3ZHBA 4LCJA 4WLUA 4HFJA 3ZNPA 3ICPA 3ONDA 3PHLA 4UUMA 4BQRA 2E82A 1LSSA 2UDPA 1HSZA 1KVSA 1G0OA 2ZB3A 5TNXA 3LQFA 1M6WA 1ISIA 1X13A 2HMSA 2HAEA 2EKQA 4PZEA 1DJNA 3I9KA 3RUIA 3W6ZA 1M66A 5A02A 3DTTA 3MJVA 3FNEA 1PGNA 3HQ4O 1T24A 1ZK3A 3ZWYA 5B1YA 4AJOA 3I4CA 2DTXA 2Z1MA 4IDAA 5IN5A 4O63O 2X9GA 3D5TA 4BKOA 4LSMA 4Z0TA 3CMMA 4GKBA 5EESA 2OL4A 5CG2A 1A72A 4D43A 3AUAA 3RU7A 4PCVA 4ZHSA 2X0IA 2A92A 1E1NA 4ND2A 3GVIA 1QKIA 1UXKA 4Q9NA 4IS2A 3JQAD 5IZ4A 4PLCA 3LF1A 4R1UA 1XR3A 1YVEI 2QZ9A 3WOHA 1GPJA 2DM6A 4ALKA 9LDTA 1LDBA 2D2IA 2O50A 2DBRA 3B70A 5T8KA 1J5PA 1XQ1A 1U8XX 1EUCA 1YOVA 1U1IA 3FNHA 3L4BA 2WYWA 4G5HA 3NJ4A 4C7JA 3WGOA 2GZ3A 4WUVA 1GZ4A 3UHAA 4R4JA 3DBHB 3ETGA 5G4LA 1P44A 4F6LA 3OHSX 2HK8A 2NNLD 3PJEA 1T2CA 4J43A 1U8FO 4IMRA 3F6YA 1NQAO 2Q1UA 1NPYA 1SZJG 5JO9A 2UV8A 1E3SA 4BB5A 3COSA 2FRDA 5EPOA 2HLPA 2FY8A 5F1OA 4DIFA 3W6UA 3GVHA 2Q49A 4AJJA 3I4FA 2YV1A 3PTZA 4CM8B 3ZV5A 2AEFA 1GTMA 4DA9A 2D0IA 3NX4A 4NR0A 4DMMA 1JKIA 2JL1A 4Y6RA 3PZBA 4Y9DA 4CQMB 2B4TO 3BHIA 1YS4A 3O9ZA 1LSJA 3GF4A 3F9IA 3UCEA 2QX7A 5AYVA 4DRYA 3DZJA 5ENDA 1XA0A 3RD5A 2D1YA 1EFKA 5A4DA 1N7HA 4H3VA 4BO8A 1A4IA 2NTNA 1I33A 3QY9A 3GGPA 4J4HA 7ADHA 1VL6A 3RBXA 2W90A 2AQKA 2YV3A 4FJ2A 4FGSA 1GQQA 1Z75A 5CPBA 2Y1FA 4D42A 5DCYA 4Z3DA 5I7SA 2FWMX 4UUPA 1PZEA 1YL6A 1E5QA 1EK6A 1Q0QA 3PWZA 4BGVA 2X5OA 4QTZA 5GZ6A 4OXYA 3LC1O 3OM9A 1E3JA 1Z74A 2HRBA 3E6AA 1E7MA 3D3EA 4M86A 4YJDA 3U9LA 1T2AA 1HE4A 2Q3EA 3ZU4A 1KEUA 4NFHA 1B7GO 1QR6A 4PG5A 2Z1NA 4I9UA 4LRSB 3HADA 1WMBA 2UAGA 1EDOA 4J7XA 4CQLA 3E48A 5B12A 3OQ6A 4E4YA 5JMPA 1K0UA 4L75A 5L7WA 2NVUB 1N9GA 5IAAA 1EVZA 2R2GA 4IM7A 3KYCA 1H93A 4GKVA 4TKLA 4QO7A 1DAOA 1YBAA 5IG2A 5FF9A 2DTDA 1PQPA 1M75A 2I66A 1PZGA 4YCAA 1C1XB 5FWNA 1IUKA 5EQFA 1T2FA 2X9NA 1N1GA 5AQ1A 2JFFA 1Z82A 1I32A 3MOGA 3ZWCA 2VWQA 5KJ6A 1V9LA 1HTBA 2VTDA 4FOOA 4MDHA 1PQWA 1LLUA 2FR0A 2PD6A 5A5FA 2YDXA 4ID9A 4OM8A 3DZIA 4G81A 1JN0A 2R6JA 4D79A 1LRKA 2P5YA 2EP5A 1FDTA 2IE0A 4YEDA 3Q0EA 1OBFO 1CERA 4KUEA 1EDZA 3VKVA 3BMCB 3GG2A 5ILGA 3ZN2A 3N58A 3RUCA 4YRBA 1LQTA 3PQDA 2RHRA 3GMDA 3I5MA 4Q3NA 1PGQA 1V3TA 2QRJA 4UUOA 3DZGA 4H15A 2W2LD 3ROQA 4PZDA 4JK3A 1O6ZA 2ZB8A 1SBYA 3ZHYA 4ND1A 3PIIA 4CMIA 1PS0A 3DAFA 3D0OA 1OAAA 1Q7BA 3EK2A 2Y68A 3QWFA 4IQ8A 4BNHA 1HYHA 1NAIA 3PYXA 4ND4A 2JJYA 1P45A 1HT0A 1VI2A 4IXTA 2YQ4A 4XZ3A 1R0KA 1PWXA 1KC3A 1DC5A 4FFOA 4UEOA 4D46A 3PK0A 1H6CA 1UP4A 5H81A 4XJTA 4YJGA 5EN4A 2FSSA 5IF3A 3S1LA 3ZV3A 1LU9A 2AG8A 1QXSA 4JQCA 1KVUA 4J49A 4LGVA 5COAA 3RJ9A 3QIVA 1P1KA 3KSDO 1GV0A 3SC6A 4D44A 4N18A 1T4BA 2TMGA 4QUKA 4Q3DA 5FI5A 3R3JA 1X1EA 5IDYA 3K8ZA 1HDRA 3UGKA 5A9TA 1W73A 4RPGA 1B16A 1UAGA 3GUYA 1PJQA 2B69A 4L4RA 3UCXA 3W4KA 1P74A 2BI7A 3QWBA 4J16A 3VH2A 4W99A 4JGBA 1Y81A 2Q2WA 4IY1A 3VC7A 3BHJA 4NU5A 3GOHA 3QW2A 2PGDA 4UAGA 2AMFA 3RWBA 3ZDFA 3RVDA 5A9SA 1MV8A 1V6AA 2GLXA 4DTIA 1MB4A 4OAQA 3TZHA 4BGEA 2ZIZA 3P19A 5IJZA 2B5WA 4NH4A 3CTMA 2CFCA 1L1FA 1DHTA 4CM4B 4CL8A 1H6BA 4E13A 4IBOA 3Q2KA 5FFFA 4IGEA 2J5QA 3FF4A 4F45A 5ES3A 1TLTA 4ESOA 1U3VA 2PH3A 3IP3A 3WFIA 1SPXA 3LYLA 4Z9XA 4RPHA 1HZZA 5I9NA 1U9JA 3PVZA 1TT5B 1U28A 2VUUA 2W2LA 4A03A 2EW8A 3PI7A 3WDSA 4YRDA 3QSGA 1KC1A 2YHUA 5LC1A 4CLDA 4I8XA 1MG0A 3OQ1A 2QZZA 3L6DA 4OYRA 4LMPA 4KTVE 1C1DB 3OEWA 3CXRA 4DQVA 3OF2A 5G0SA 4WCDA 4CV3A 4ZQFA 1DAPA 1JQBA 1V8BA 4FC6A 3S2EA 4BVAA 5FI3A 4XRGA 2PZLA 3FSRA 4J7UA 2AE1A 3JQFC 4OQZA 2FZWA 3F47A 4W7IA 3ITDA 1K5HA 4TZTA 3DHEA 3JQCA 4GH5A 4RF3A 3DMYA 3TJRA 4CLEA 5LCXA 1WDKA 4XA8A 4MJLA 2C59A 1DIGA 4TVOA 3UUWA 5GZ3A 1HDCA 3ZV6A 2I5PO 3ZI0A 1DC6A 3O4RA 1U3WA 1ZCJA 3RI3A 1JTVA 3B20A 2A9FA 4ZD6A 3EHEA 4MVJD 3I3OA 1P1RA 3ENNA 2A35A 4H16A 4XYLA 2D3TA 2VZ8A 2HQ1A 3DBVO 1GD1O 3TL2A 3V8BA 3NJ8A 2Q99A 1DIHA 3PJDA 4K28A 3ZNNA 3WWYA 4AJIA 3GFBA 2C5AA 3GVXA 5ADHA 2G5CA 3GUCA 5L7TA 1E0DA 2P9CA 2TMDA 3ZGYA 4YVFA 3BMOB 1TA4A 2VHZA 1D4FA 4R1NA 2J3HA 4RVSA 4CR6A 3QWIA 3R1IA 1KOLA 1QYDA 4O6VA 5K6AC 1L7DA 1P9LA 1AHHA 5DT9A 3VOSA 1UXGA 3MJEA 2OXIA 2J8ZA 5JC8A 2IODA 3PFWO 1WAMA 1P33A 3O8QA 4N54A 3QWHA 4R69A 1YQGA 4AICA 3GNSA 4OSPA 5DCWA 3TL3A 1DRWA 4CLXA 5HWSA 3QRWA 2GASA 1C0IA 3DZKA 1ID1A 1YJ8A 1JLLA 1DEHA 1C14A 4EEXA 1DBVO 2OZPA 3H9EO 1AGNA 1AE1A 2PFGA 1D1TA 4CLOA 5JMWA 2CVQA 1PL7A 1GYPA 2DPHA 2YYYA 3GHYA 1BRMA 3AW9A 4H7PA 2QYTA 4I5FA 4UEKA 1IB6A 3AUTA 3DOJA 4XGNA 4K6CA 4UVIA 3NRCA 3JYOA 1IYZA 3WGTA 5KKCA 3ZNQA 5I7VA 1NR1A 3FR7A 5EQDA 3OFSA 6LDHA 1UJMA 4HNHA 3ETEA 2BGLA 2O2YA 2X0RA 1XU9A 2I76A 1IPEA 4TRNA 4BO5A 1E7SA 5KVVA 1ZSVA 3RBVA 4BNNA 1C0LA 2VHXA 3RQSA 1CETA 4NBUA 3A06A 4DLLA 4LW8A 5DDIP 4GX1A 1PIWA 4U0JA 1C3VA 5C7OO 4O0LA 4CMKA 2G1UA 3V1TC 3WGIA 1PL6A 3QE3A 3OJLA 2PGJA 1DOHA 1IL0A 1ADFA 1ZO8A 3FNGA 4IQGA 1YONA 2CF6A 1ZSYA 5KVSA 2NTVA 1TI7A 4L9RA 3KYBA 3T4EA 1DRUA 1I3LA 1I24A 3JD4A 1ADGA 1ZEJA 3OIDA 3U4IA 1QYCA 2BFAA 4RO0A 3DONA 3JQ6A 4FIZA 2PD4A 4RPJA 1KYQA 4QO8A 3D4NA 2EKLA 3E18A 1GR0A 3E5RA 3OJ0A 5AXBA 2CMDA 2X22A 3TZQA 4BO1A 1H2BA 2ZCUA 4FFRA 3LT0A 4BB6A 2Y93A 4YDRA 3ZCXA 4B7UA 4ZQGA 4R9SA 4BOYA 1E3WB 2YY7A 3QA9A 3RC1A 3KV3O 3R3SA 2EEZA 2HK9A 3TPCA 5T57A 2NSDA 3RIHA 5U4QA 3PEFA 2Q1WA 5HRUA 4BQPA 1XYGA 1WW8A 3PFFA 3PHGA 3I52A 4RV9A 1X7HA 1NNUA 1ADCA 1UUFA 3IJPA 4D3FA 3C3XA 4M54A 4K1LA 4J7CA 4YQZA 4JP2A 1SB8A 1VSUA 4J6FA 4E2YA 1YQXA 1K6JA 2C7GA 2VRCD 3PIDA 4YBZA 4GX0A 3ST7A 1MFZA 3P2OA 3WMXA 2O7SA 2V6MA 3DXFA 3FR8A 4KTTE 4MVJP 4Z9FA 5CG1A 4JJFA 1T26A 3AY7A 3GLQA 4ZQEA 1VJ0A 1NVGA 4FR5A 4ALLA 1YJQA 1YRLA 3OEYA 3SLGA 5T8KC 1MA0A 3DR3A 4WECA 1CDOA 4FW8A 3F5SA 3W1VA 4E5YA 3PLRA 3L4BC 5G0VA 3LT1A 3AM5A 5ICSA 3HN7A 4R16A 1B15A 1KEPA 3WMWA 5IZCA 3G1TA 4B4OA 1CWUA 2VT2A 1BWSA 3GC6A 1UR5A 5B4VA 5C37A 1DFHA 1QORA 3G1UA 5A3JA 1GCUA 3F5QA 1N7GA 2PK3A 4PLWA 3BA1A 1ZVMA 4E33A 1GADO 2I6TA 2Y1DA 3QVSA 2I65A 1EUZA 5KJ1A 2J3JA 1PJCA 2GNAA 5K0ZA 2W98A 3B6ZA 5KVCA 1HYEA 3G17A 3WYBA 1M6HA 4INAA 1D7OA 2W2KB 3G0OA 1IPFA 1R12A 2CY0A 1I30A 3HDQA 4ZRNA 3T7EA 5T6BA 4DC1A 2Q46A 2DLDA 1A5ZA 1N8KA 2IRWA 2PZJA 2WMDA 3GGOA 3NUGA 4E2ZA 2EJWA 4XX0A 5ITVA 4NNJA 1BXKA 3HFGA 1LA2A 3SBOA 3GVPA 3JV7A 4XDYA 4L74A 3HUDA 3UXYA 4ZICA 5MGBA 3DBLB 4LSWA 1ENYA 3PHJA 3ZW9A 2O3QA 5ILOA 1PJTA 3BTUA 2AE2A 1EK5A 3IP1A 2ZTVA 3JSAA 2X58A 5A04A 4AJPA 4M8SA 4MVJM 3CEAA 4RF2A 5DP2A 4R51A 5T67A 2C54A 4MP8A 3O03A 4BO6A 3MJ4A 3H5AA 1R15A 3GFGA 5IFLA 3ZWOA 1GEGA 3K9QO 3W8DA 5KIAA 2D4AA 4XR9A 2DBQA 3DMTA 4CMHA 1GQ2A 2VYNA 3QJ5A 4HY3A 5IXSA 4P8RA 3IC5A 4YJHB 5KWEA 2HJRA 4XD2A 4JJGA 1ISJA 2IYOA 3E9MA 3N7UA 4P4NA 3RCBA 1C0KA 3AUSA 3I1JA 1FDSA 5TT0A 5CFZA 4EDFA 1GY8A 2E6UX 5FEUA 3PDUA 3QP9A 4MOWA 3UN1A 4JCOA 3WICA 4R54A 4PVDA 2XOXA 1PS9A 5TC4A 4BNUA 3RC2A 4PLGA 1ZIDA 4F46A 1HDXA 4YAIA 1U2GA 1LI4A 2I3GA 4W7HA 2IZ1A 2QHXA 5ENVA 3VDRA 1MC5A 3DOCA 1Q7GA 4MIEA 4I5GA 3OICA 3KOUA 5A05A 1BDMA 1EBFA 1OMOA 3PQFA 4BNWA 4BV9A 3U62A 1ZEMA 4KZPA 4OO3A 1QP8A 2AQIA 1LDGA 4LMRA 4BNGA 3SX2A 3V2GA 1B8PA 4RZHA 2BGMA 1A7AA 4OMUA 4CUZA 3DBHA 3GA0A 3RUDA 2VYVA 3CKYA 3DZHA 3OJEA 4MKXA 2JD0A 3OMLA 3D3WB 2EXXA 1XG5A 3U4CA 1BG6A 4R5MA 4TSKA 1U3UA 3ETDA 1X1TA 4Y67A 1HE5A 3PYMA 4PG8A 1Y7TA 1LDMA 4TRMA 1JVBA 2PD3A 2XXBA 4FBGA 4BNIA 4QT0A 3WR5A 4JXKA 1A7KA 3VTFA 2FMUA 4DPMA 4KDEA 2DUWA 2Z5LA 4DLAA 2WDZA 5CDTA 4CM8A 4U5QA 5EERA 1FJHA 3NT4A 2B36A 2ILTA 2QG4A 2XXJA 3BMQB 3EYWA 3P5SA 2OUIA 2NUAA 4E5NA 2WJPA 3MZ0A 5B37A 3GPDG 4E30A 5L4LA 2HO5A 4JNKA 4CQMA 4ALNA 3RC7A 4AJLA 1JA9A 4XGIA 4JP3A 3E1KA 2J3KA 1K3TA 1Q1NA 2P5UA 2PR2A 3G79A 3OSUA 4ZQHA 1E6EA 3H2ZA 4FD3A 3SVTA 2Y66A 2NQ8A 1W8DA 3PLNA 2WE7A 3BTVA 4ND3A 5KJFA 3WGZA 1YXMA 4FOSA 3EMKA 1V3UA 4R01A 4E31A 1P0FA 3P7MA 4ROSA 4BKUA 5AOVA 2ZK7A 3W4JA 4TWRA 1Y6JA 1YB1A 1VSVA 3GZ4A 3I9OA 3Q2IA 1NM5A 3TZ6A 1I2CA 3EC7A 4BO2A 4EYEA 1XEAA 5KJEA 4J1QA 2X5JO 4JBIA 4P38A 1T1RA 3WLEA 2ZJ1A 4WEOA 1EUDA 3SJ7A 3KEQA 4YT4A 1LC3A 5C7IO 4RVGA 1H6DA 2GGSA 4BHTA 4YJFB 1DDOA 2HMTA 4GLLA 2NVUA 3AU8A 4GSKA 4E3ZA 5C7LO 4E12A 4KUHA 3ONEA 4ITUA 4ALJA 4IDCA 2H1SA 1RM0A 3NKLA 4FJ1A 5DOVA 1ZJZA 3MTGA 4EUHA 5COQA 5COBA 2VCYA 4Z0PA 4GGOA 3ZWMA 1C1XA 3CH6A 3L4SO 1RYEA 4J9UE 4BNZA 3DHNA 1O89A 4CMEA 4CM6A 1KEVA 2VRBA 1UXIA 3LF2A 1SCUA 1HE2A 4DLBA 4E21A 4P4LA 2RH8A 2AEMA 1GU7A 4OH1A 3H9GA 4UVHA 2EGGA 1XWFA 2ZYDA 2C29D 2FN7A 2HUNA 5L9AA 1U5CA 3O38A 2B83A 6ADHA 2FSVA 4CV0A 3HE3A 1NFQA 4EBFA 1XQ6A 2EW2A 3LDHA 2R00A 4I5DA 3PJFA 2ZYAA 5U9CA 3BMCA 3TFOA 1HDOA 2P68A 3ZV4A 1CIVA 4W82A 1E7QA 1UXHA 1RWBA 4CMJA 4XWYA 1T25A 3JYPA 3STHA 4OQYA 1QV7A 1MXFA 2O23A 1E3IA 4WE3A 3MJSA 1CF2O 1X0XA 2JFGA 3DZBA 2V7PA 3EVTA 4L4SA 2GO1A 3JQDA 2AW5A 2X5KO 5JYEA 1ZZEA 3M1AA 1NAHA 4OIMA 4D3SA 4FFLA 1ULUA 1Y9EA 1PJ2A 3B1FA 5JPIA 1GUZA 1R4NA 1LSUA 4AL4A 1DJQA 2P4QA 4DQUA 1FDWA 3L77A 4ONEA 3VDQA 4LK3A 1DFIA 2X4GA 4K6FA 3DFZA 4J0EA 2JCVA 1EVIA 4YB8A 2BF7A 1HE3A 5J23A 1PJLA 4BMNA 4MVJF 2X6TA 4HV4A 4CLRB 5ICMA 4KQWA 3C7CB 3OIGA 2C2XA 3AY6A 4FJ0A 1F14A 4WK6A 1AHIA 2Y1CA 1K2WA 3KSUA 1FDUA 2UUOA 3FRJA 1B3BA 1M76A 3ABIA 3WQQA 4YT2A 3HG7A 4F3YA 1LRJA 5JCJA 5LDHA 3IIEA 4LCEA 5LDGA 1QSGA 1UDCA 1TVEA 1X14A 3BMNB 7MDHA 1CQIA 1YBVA 4RLSA 3L07A 2OBYA 1E1MA 5H82A 4KUGA 3AWDA 4AFNA 4YRAA 2CDAA 2V65A 3JQ7B 2GZ1A 5L7YA 5JDIA 3JQAB 1YL7A 3ROMA 3ANMA 1JAXA 3HB4X 4WLVA 4JIGA 3NTQA 2DAPA 1RKXA 3AI3A 3FTNA 4GX2A 4CM4A 3JQ8B 4CQLB 1ISGA 2P9EA 4WCFB 3LC7O 4CM9A 3V5NA 2YFQA 2BHLA 3SEFA 1XCBA 3HFSA 3ORFA 3GDOA 2RH4A 1ZNQO 2X23A 4EZBA 9LDBA 1FF9A 1OOEA 3NT5A 1IOLA 2P9GA 4M87A 1E7RA 3IS3A 1TT5A 5EMHA 4RCVA 4UEJA 4CR8A 4IINA 4XYEA 3UFXA 1DLJA 3WYCA 2DUUA 3AY3A 1Q2XA 1GYRA 3T4XA 2BLLA 2AA3A 5FYDA 3DFUA 4XB2A 5H83A 1BW9A 1ONNA 4YAGA 3U09A 4KQXA 2CZCA 1SB9A 2E37A 2WTBA 1NPTO 1C1DA 4URFA 4CMBA 5BNTA 2ZYGA 2B5VA 5TIIA 2BFPA 1LDEA 4BO3A 4YAEA 1TT7A 3G49A 4PGFA 4ZRMA 4I9HA 3AI1A 3JYQA 1EE2A 3ONFA 2BELA 3HNPA 2BD0A 1N5DA 1PL8A 2JD2A 3EGOA 3WIDA 3Q11A 1PWZA 3K92A 5I9MA 2PNFA 1CEQA 1RM4A 3GAFA 1G0NA 3OP4A 3RUHA 3AM3A 3I9LA 1MG5A 3RUEA 4J0FA 4R1TA 3TSCA 1H6AA 2IXAA 3IOYA 5A5EA 5KJCA 4Y6PA 2C82A 3JYLA 3NGLA 1E77A 4J91A 3BHMA 5DZSA 2OBNA 3ASUA 3WS7A 5GY7A 3FBTA 3OBBA 3WSVA 2X86A 2YW9A 4NG5A 1P1IA 3K2BA 3RJ5A 4C4OA 4XQEA 4NBRA 3ZWPA 4O1MA 1PU2A 4XYBA 1MC4A 4BO9A 1UAYA 4BKRA 4PVCA 5BQFA 4RF5A 3DBRB 4B8ZA 3QVWA 2RAFA 2H6EA 2OMEA 2WE8A 3KLMX 3VPXA 3GZNB 2RBEA 4B3JA 3BMOA 4GMFA 3PGJA 2VOEA 1ZH8A 2RCYA 1J6UA 1LXCA 4IDDA 4FFPA 4B4WA 3RAJA 1X0VA 4NMHA 4KOAA 5JXWA 3SXPA 1PJBA 3W4IA 1SAYA 1HWYA 2GD1O 2G82A 5CDGA 3A28A 3JQBA 2NTJA 1YQDA 1BSVA 4A0SA 2B35A 5BSGA 1YKFA 3H3FA 4JLWA 1PEDA 1Y8RA 5L53A 3ANLA 3JD0A 3VTZA 4YT5A 3ADOA 3F4LA 3RFTA 1WLYA 1UH5A 2B4QA 2EERA 1N1EA 2BRUA 4UREA 1B26A 2FR1A 2BI8A 4CV2A 5IXYA 1QLJA 4PLVA 1E6WA 3TZKA 1O94A 1ONOA 4TZKA 4RPLA 4NPCA 2NU6A 1BVUA 2GYYA 5TS3A 2AHRA 5IZCC 1X7GA 2NV6A 2WYUA 1MXHA 3QVTA 4JN6B 1DIBA 3RUAA 2CNBA 2JKVA 3IJRA 2VZ9A 5KNLA 2B0JA 4WNIA 3CZRA 4BMVA 3GRPA 3ANNA 5IDXA 3SLKA 4MVJE 1HXHA 1MLDA 3GEDA 4S1VA 3VH1A 3VZRA 2A4KA 3PP8A 1NHWA 4MVJH 2Q45A 4HFMA 2HCTA 4E2WA 2JHFA 3OETA 1GEEA 4WPGA 1RPNA 3GK3A 4GL4A 4AJ4A 1OI7A 2Z95A 1H0KA 3GG9A 3WTCA 2EIHA 3S55A 3JQGB 4Y8VA 2H9IA 2O3SA 2QW8A 4I1IA 1Z73A 1QRRA 4AJKA 3MWEB 4CV1A 3HZZA 1YB5A 1R0LA 1U3TA 5TGDA 2Q50A 3TWOA 3GQVA 4R9RA 2DBVO 1LDNA 2AQ8A 1HEUA 4L8VA 2DFVA 2ZKLA 4BUCA 1I2BA 3A1NA 3CMCO 1YDEA 3BYZA 4RPKA 5CDUA 1DIRA 4DIBA 3ENKA 4CMGA 5F1PA 1FXSA 1XKQA 3H5RA 1G6KA 4YA6A 1P1JA 4U7WA 3E82A 4EJ6A 1XDWA 4ND5A 4UVDA 4BIIA 3DAPA 1H5QA 4RVUA 2D5AA 4E6PA 3B1KA 1ZK1A 1HRDA 1HYGA 2I3AA 4BS9A 1E3WA 2JFHA 4TROA 3R6DA 1KETA 1X15A 4MINA 5JAZA 3WBBA 4RQTA 1VPDA 2VT3A 2EKPA 3DMTC 4DQXA 5L51A 5AVOA 2J5KA 4GX5A 3SC4A 2CF5A 3MCVA 4A5OA 4XCVA 1SC6A 4HBGA 4EEZA 2DBZA 4CR7A 5I7EA 3F3SA 4B4UA 5K9ZA 4E5KA 3DB2A 3JD2A 1RM5A 2YHIB 4WLFA 3ITKA 1DSSG 3NDJA 3INRA 1Z7EA 1E3EA 1ZW1A 3FWNA 4FN4A 4A73A 1H9AA 4IIVA 1LLQA 1KS9A 3M1LA 5BR7A 1D1SA 2FHSA 4PFJA 4E5MA 1F8FA 4GVLA 1U7HA 2GN4A 2PZKA 5G4KB 2G76A 4PIVA 1R16A 4II2A 5TT1A 3BIOA 1LBEA 1B8UA 4RVFA 1E7YA 3IUPA 4IDEA 3G3EA 3E5MA 2O4UX 3VVCA 3KYDA 4DIOA 3Q6IA 4Y98A 1E1KA 3GDFA 2V6BA 4A10A 1R37A 1R4MB 4QEDA 1MFPA 1DXYA 5BSHA 1EVJA 4J1SA 5AXAA 5G0UA 1EZ4A 2WD7B 5TJ9A 5CEJA 4CM3A 3GN2A 4ALIA 1Q0HA 4GQAA 4FPXA 4ALMA 2I99A 4D7AA 3TQHA 1I0ZA 1NVTA 1A9ZA 3UCFA 4PLHA 4NHEA 4B3HA 4GAEA 4QSMA 3PWKA 5TRTA 3I9MA 2DKNA 1Y8QB 3FPLA 2W2KA 1GL3A 3IAHA 2FPPA 2VYND 5JAQA 4OKNA 2WYVA 2IYPA 1QYXA 4B3IA 3L0DA 4BV8A 5C5IA 2PA3A 4DVJA 3PGXA 1QYVA 3DBLA 4A26A 2V6FA 1LJ8A 1JWBB 2HU2A 4U8GA 3NDIA 2G0TA 3EW7A 3CSDA 1F0YA 3GRKA 2OP0A 4CUKA 3WXBA 1A71A 2RIRA 4FS3A 2J5RA 4G2NA 2X9VA 4OXNA 3FI9A 2HDHA 3WGQA 3C8MA 4XQCA 3UH1A 4RF4A 1PR3A 4FSHA 1O8CA 3V2HA 1NVMB 3LU1A 1LRLA 1YB4A 1SOWA 3EUWA 1K89A 3I6QA 4A2CA 4IQ0A 4YJHA 1E92A 4IDGA 3DOOA 4MKZA 4HX5A 3EY4A 4KDFA 5DNAA 4Z0HO 5THKA 3NYWA 4R68A 4O5OA 4Z3KA 4HKTA 2VYVD 1WMAA 3WTBA 4PLTA 4DC0A 1EQUA 2ZATA 4BNVA 4GBJA 4NU6A 3VZQA 5HM8A 1O95A 5DF1A 3ZW8A 2E48A 1GAEO 1PSDA 2GDZA 2PY6A 3TFQA 5CAEA 1T2EA 2PV7A 4WNCA 1U4SA 1IHYA 2AQHA 4YAKA 4DGSA 1JW9B 2WD8A 5U1PA 1I3NA 2CD9A 5T64A 1ARZA 1SO8A 2GUGA 4F6CA 4K9DA 3KEOA 3NTOA 3M2PA 1P31A 1UP7A 2NM0A 2W4QA 3E03A 4R5HA 2VQ3A 3H5NA 1BMDA 4CMEC 1LNQA 3CINA 3GDGA 4D0RA 3K96A 3WJAA 4PZCA 4OOFA 1RM3A 4L4XA 1GUFA 4R1SA 1OC2A 4X54A 3AM4A 4CPDA 4UVEA 2OP1A 4CQMD 4PLZA 4RDIA 1WP4A 4MP3A 3V2UA 1Z45A 2DVMA 4MIOA 1LDYA 3D3WA 5BNIA 3ZWNA 1LQUA 5JDCA 3UKOA 3AOEA 4WLNA 3DO5A 2UYYA 2CUKA 3X2EA 2R00C 2WEKA 4FQ8A 3ULKA 3UF0A 2A94A 4U6SA 5GMOA 5I8WA 3QVOA 4EI2A 2E49A 2OGUA 2Y0EA 3C1TA 3KUXA 5JBIA 4QFCA 3T7CA 2VNSA 1KY5A 4IDFA 1XIVA 3FTPA 5DP1A 5I7FA 3VAZA 3VKUA 4NK4A 4Q39A 4XYMA 3I83A 5F21A 1BXGB 2YZ7A 3ZWAA 1VE9A 1ZJYA 1DHRA 4BKQA 1U7TA 3N74A 3WFJA 3K5PA 3BMQA 1ZXLA 2ZTUA 3DAGA 1F8GA 1F12A 4NJMB 3V1UA 4XYGA 3HWRA 1E6UA 1VL0A 4G65A 4OXKA 1U5AA 4I9NA 5JNLA 1DC3A 1M2WA 1DO8A 4XQ9A 3D4PA 5BNFA 2FP4A 2O48X 4UVGA 3WGGA 4BNLA 1VKOA 4J90A 3GR6A 4BNMA 1H9BA 4BNFA 5JFOA 1L7EA 1OZAA 3H65A 4N5MA 4II3A 3S8MA 4JX8A 1MX3A 3E9QA 3VPFA 1JDJA 4XRRA 3TOXA 2YV2A 3PYLA 4L73A 1CRWG 5THQA 3B1JA 4W6ZA 1J0XO 3CUKA 4OJNA 4RL6A 3AJRA 3I6IA 4BNYA 1ZXBA 3RSHA 2F00A 2Q1TA 3CE6A 5I9LA 5KKAA 2LDXA 3KXDA 3U3XA 4CMCA 2QRKA 4DMLA 3WIEA 1LLCA 2EF1A 1V0JA 1ZKMA 1LUAA 1Y5RA 3V1YA 1BDBA 2X0NA 4XGKA 3EVNA 1NR7A 3UW3A 4BGIA 2Y67A 3ROPA 2VWGA 2DPGA 1GYQA 1HDZA 4IJKA 1XLTA 3OECA 3INGA 1HLPA 3TNLA 4R41A 2Y1GA 2HMVA 4YT8A 1HZJA 4YJFA 5JDIC 1NPDA 4BO7A 4IUYA 4NZ9A 3FWZA 3VPHA 3GPIA 1JU9A 3ZWXA 2HSDA 3K73O 1A27A 2PH5A 1MP0A 3Q9UA 1QV6A 4AJ2A 5HS6A 1Q0LA 3H9JA 4IXWA 4EUEA 4AJ1A 3IKTA 1SEPA 5EJ2A 3EZLA 1P77A 1ULSA 4FB5A 2QIOA 3M2TA 4WEQA 1O5IA 1R66A 2IZ0A 1ZK0A 4J3FA 4J2OA 2E4AA 5AXCA 3F1KA 5CEEA 3AU9A 1PGJA 3WSWA 3JQ9A 1I36A 3NDRA 4GPD1 3GN1A 5G0WA 2DT5A 2VHWA 5DOZA 3FN4A 1LLDA 1PTJA 2EHDA 3K31A 1QG6A 3PQEA 5DULA 2BFOA 3LK7A 3GGGA 1NYTA 3S2IA 2Q2VA 4E32A 5L40A 4K26A 3K2EA 1W4ZA 4ZA2A 3KM0A 2IZZA 2BMAA 1LX6A 2YDYA 3WJ7A 5I8ZA 5JCJD 3BTOA 3HDHA 5JY6A 3DZFA 4ZU3A 3FHLA 3WNQA 1U4OA 3VPSA 1EE9A 3U4DA 3RFVA 2Q1SA 4DL9A 2JCXA 4AJEA 1DRVA 1BVRA 2DC1A 2OO5A 3C85A 4RQUA 4XKJA 1IY8A 4Z9YA 4CODB 5A03A 2P2SA 4WGGA 4NI5A 3DQPA 4YQYA 2I9PA 3ZNOA 2ET6A 2AXQA 2Y1OA 2ZJ0A 3S2FA 4OOEA 2ZQYA 4O59O 1ISFA 4IDBA 4DWVA 2O3TA 3GH3A 4LVUA 5B4UA 3F4BA 5G2OA 1YOVB 1ZFNA 4NIMA 4CLRA 1Y5MA 1A9YA 4FC7A 4HNGA 4KWIA 4N7RA 1CJCA 1KVQA 3QV1A 4QXMA 5F5LA 3ZWBA 3EAGA 4A27A 4XIYA 4CM1A 4CM9D 4PLYA 1M67A 3Q3CA 3KLPX 4I5EA 4BMSA 1GZ6A 2GR9A 4R3WA 2YQ5A 3WG9A 1BGVA 3DWFA 3JD1A 4NQZA 4YYZA 1XHLA 2PWZA 3GVCA 4CM5A 3F46A 3PPIA 1B3RA 5TJHA 1N2SA 3BMNA 4P22A 2PGLA 4YXFA 2DFDA 3JQBC 3PWSA 4B79A 1FK8A 2GERA 4BKPA 4AG3A 1PJ3A 5GZ1A 4GVXA 3D1LA 4B4VA 3JQ7A 4B7XA 4OL9A 3ZU3A 3JQAA 3RKRA 3RASA 4DYDA 3BAZA 5G0TA 2ZQZA 5DCUA 1I10A 5IDQA 2JAHA 3D4OA 3JQ8A 2NU7A 5F1KA 5JO0A 4WCFA 1U2DA 2GPTA 1R0SA 1EQ2A 1O9BA 1UZNA 3AK4A 4MIYA 5ER9A 1ZK4A 3FD8A 4RGBA 4RVHA 4B8WA 4ZJUA 1T4DA 4N5NA 4NJOA 3WX0A 5DBIA 3KZVA 5BT9A 1AN9A 1I01A 2CVZA 3JCZA 3WGYA 3ZU5A 3INTA 4BO0A 1VLLA 3WYEA 5ER6A 1JWAB 4EGFA 4GWKA 4UULA 4A7PA 2CVOA 1EVYA 3TDKA 1UP6A 5EIOA 1B0AA 1V35A 1R6DA 3PJGA 4TMFA 1KVRA 4U0KA 2Y05A 3NTRA 5TLSA 2Q2QA 1TEHA 4N5LA 5JAIA 3L9XA 2NQTA 4LISA 1YDWA 2VNAA 3C7AA 4MVJG 1PX0A 3L6EA 4GWGA 3OH8A 1YBMA 2B4RO 1OFGA 1XELA 4R3NA 4MO2A 2O3JA 3E9NA 4AJHA 2O4CA 2PKQO 4HADA 4J1TA 2IXBA 3BZUA 5DBGA 3JTMA 3WGHA 1Z7BA 3GEGA 3LC2O 3NT2A 4RZIA 1KY4A 2NU8A 4M89A 5AXDA 1J4AA 1TB4A 2GF2A 4W4TA 4E0BA 2H63A 2ZTMA 1RYDA 1ENPA 1P0CA 2POQX 1KBZA 3OJFA 1N9GB 4BO4A 3KYCB 3GY0A 5L95A 3K30A 2W8ZA 1LEHA 4Q3BA 2PLAA 4DBZA 2OFPA 5KTKA 4HFNA 4WKGA 5CDSA 2PKQP 4WASA 4DREA 3DBRA 4L0QA 1EMDA 3AOGA 1R4NB 2VOJA 4LN1A 3PHHA 2FPGA 1IZ0A
chains in the Genus database with same CATH superfamily
2O5RA 3GZNA 1TUGA 1W6UA 3GJ3A 3QOYA 2EFJA 3EVEA 3UW1A 2IYWA 3EDMA 1D3AA 3U1TA 4EAAA 3IFSA 3LQQA 1ZCFA 4C78A 1WCIA 4AJNA 2OSBA 2BUAA 1X7DA 1PT7A 4V3BA 4K46A 5E8RA 3CKLA 1JHUA 3O8DA 4FCCA 2J41A 2ZW9A 5DIZA 1MVLA 3OX4A 1RBYA 3HJFA 3RAFC 2RGEA 3CUVA 4WKOA 2QYSA 4PRLA 1JR3D 2XUFA 3L0ZA 1E1RA 1E3LA 4N39A 1M3SA 3SE7A 2EQBA 2HQSA 3MOIA 4IS3A 4XJSA 5CB4F 2GPWA 4HVCA 1U94A 4DLPA 1TU0A 2G7MC 1G20A 1E4EA 3O74A 3U7GA 4M49A 1XEWX 2XPCA 4JIMA 1O97C 4TWJA 1P2SA 2EP7A 2ETXA 4HFRA 4E5DA 4F85A 4HWKA 2JGIA 5CJ2A 1WCYA 1ELOA 1JLSA 3LFTA 3WHPA 4CMIB 4P33A 4GHWA 1R7RA 2NX2A 3QF7A 1GPWB 3G13A 4NICA 1HDYA 1L8AA 2HMUA 4F06A 1GL9B 3O31A 1C0PA 3EQ7A 3KVOA 3N8HA 4TXMA 1TEXA 2HCBA 3AUYA 2FX2A 8ADHA 1I2ZA 1SHLA 3QHAA 3D6TB 3G7SA 3V8NA 2AUMA 3C3EA 3MIIA 3B6EA 3LUJA 5D3KA 3Q1LA 5DTQA 5HF9A 4D82A 4BY9E 1SG6A 1XVVA 3FKSD 1SCBA 4MCAA 2LGJA 3LVFO 5KAMA 3W8NA 1D07A 1GA1A 1QPBA 2DOKA 2O2JA 2ZIWB 3FYUC 3L8CA 1JJVA 3VHQA 1G5RA 4HDKB 2DH6A 3C5EA 1S8NA 4UBOA 2VBIA 2EG9A 4XUCA 4YJGB 2H4FA 3IB6A 4NV3A 4KQFA 4ZYTA 2OBLA 2PWAA 1DAIA 3C6ZA 3TH5A 3LDAA 2AFHE 3LUCA 4BCCA 3KZ1E 3CO0S 1J0CA 3HYTA 2X3YA 4TVBA 1LSOA 3EFBA 5EE0A 1KZYC 2XVMA 5AI4A 3V2IA 3EJ6A 2OV3A 4XPIA 3UFXB 3R77A 1CUGA 3F98A 5KDOA 2WTMA 1MB2A 2ZIFA 1W1WA 1ZGBA 2JHGA 1BW9B 2QUKA 5HEKA 4OUDB 5A1TA 4PZPA 5ANRB 1PJSA 3R74A 4AMZA 5DMHA 1D6MA 1XEFA 2PUDA 3A9CA 4KI0A 5K2MA 3GLVA 3RIGA 3ZHZA 2I4LA 2G8NA 1VJTA 2I4NA 2NYUA 1SOVA 4BNXA 3P4YA 1Z5WA 3M34A 2VPXA 2B6HA 4FYYA 1QPGA 1H42A 3I45A 1CNFA 3KWFA 4FDUA 2WMOB 3NDBB 1GL7A 4J75A 1PS8A 4UM7A 1K86A 2IIBA 1BDJA 3DC2A 4Q9KA 4YFYA 3O0TA 4D74A 3LT2A 2IYZA 2SCUA 3IOMA 2EBUA 2VN8A 2FQQA 5EXEA 4WOKA 2ZB7A 3ERCA 2IH4A 1VCMA 4P92A 3ICCA 1BCSA 4FT4A 1QFZA 1T8SA 2N47A 3UOGA 4ANFA 1HOXA 1OT5A 2ORWA 3O83A 2X7HA 3EWIA 4TUYB 4NXNB 2JARA 1BO6A 4PYNA 4F71A 4TMVA 3HWSA 1NL3A 2MSWA 3NCTA 3GMSA 3PDHA 4IRMA 2FPLA 4QVKA 5BR8B 4R7TA 4D8XA 4O4JB 4DT1B 3K70B 1E1QA 1U1GA 3C3BA 1O95C 3IR7A 5A62A 5F9HA 1E3MA 2WIAA 4YDHB 2Q5HA 2HQBA 4V0QA 3A9RA 2YHIA 2W37A 1VM6A 3LSYA 4KO1S 3QXSA 3PENA 2RFLA 1Q77A 1QE5A 3U7JA 2WB2A 1KH3A 1RHRA 5MDHA 3DHYA 2N3ZA 4BTEA 3UB4A 4RY0A 3H6KA 3NV7A 1EVEA 1L4BA 1GP2A 1CQJA 1PFQA 4IF4A 3HUEA 1MAAA 2J0VA 3GJQA 1V4VA 3O1HB 1BJKA 2G25A 2O7QA 4YN3A 3U2QA 2XMSA 5CP8A 3TD2A 4M8KA 4EJ0A 5C31A 1WF3A 2J87A 4CIVA 4NBTA 4WADA 2W6MA 3CB4A 5IAKA 3WQRA 1N2XA 1JAHA 2QRNA 4PW0A 3ZZNA 2GKSA 4L16A 5T3UA 1GGFA 2ZR7A 3HDTA 4LNAA 1FVXA 2YINC 2G72A 1Z2OX 3SZRA 3VC1A 4X45A 1SPBS 3WB1A 1XMQB 1NC1A 3PLAE 5A2QA 4GMKA 5EZ5A 5IVHA 1ISHA 1XZBA 5A6SB 2F1JA 2FVXA 4ZT2A 1JFTA 1P4JA 2PM8A 4MYCA 4EDHA 1NNI1 4HRXA 4HWOA 3K71B 1Q15A 2DPMA 4ZVRA 4BFXA 4DHWA 2NTEA 1H8ED 1IXRC 1CDEA 4L5JA 4XD7A 1X80A 3KVNA 2WJVA 2KI5A 2HWUA 2KQUA 4UCQA 1SBNE 3CH4B 3ZTWA 3TCKA 3CNOA 2PSDA 2R7LA 2VUTA 4YACA 2I22A 1XWIA 2PZMA 2J5XA 3A10A 1DLIA 1XGKA 2ZB4A 4IJWA 3GCDA 1TZBA 4ZO7A 1F4LA 4PN3A 3NEPX 4MQ6A 4S35A 3QM1A 1VKHA 5GM1A 5BYKA 4DA7A 4ZJYA 1ZMTA 4HXYA 4MKRA 3AKDA 3DNFA 1SCAA 5IKOA 5ICFA 4KXVA 1CVLA 5EP3A 4YQFA 3H2JA 4WDRA 5SY4A 2GD2A 2VJMA 2J9XB 4X8OA 3GYBA 1TXGA 1R9GA 3IEIA 1OE0A 1VMKA 1ECPA 2PFSA 5GAJA 2MCFA 1UINA 1ONBA 2C95A 2HWYA 1KI6A 3OOSA 2RG7A 3NYRA 3R41A 3QVXA 4KWHA 5IVIA 1XTZA 3UWKA 3X1DA 3ZDCA 2O3UA 3PCTA 1E1LA 1WDLA 4ILKA 2BEJA 5CT4A 5K5EA 3H5LA 4I19A 1JKJA 4P86A 2OQRA 3FHCB 4I1YA 5DNDA 1US8A 1ACMA 3GQBB 3H99A 4AX4A 1GQYA 2AFHB 1O0CA 3ABOB 3AXTA 3GFSA 5AM5A 2JD1A 3MJCA 4QBHA 3VZPA 2XCSB 3W2HA 4FCVA 4ENQA 4JI4B 3ONVA 4G0NA 1PUXA 1CS0A 2VA9A 4X8HA 1QGED 4JYPA 1U4NA 1Y1PA 4IPTA 4N8SA 5BV7A 5T7BA 1FDOA 1Z5UA 2JFYA 1UZMA 4MV6A 2IBTA 1QVWA 6ABPA 5EI5A 2I67A 1XVAA 2WZCA 4I6GA 4JWKA 3HA3A 5E3HA 4X44A 4X20A 3FCUB 5ECYA 2I8AA 3A14A 4A2WA 4NBKA 2WIFA 2BFMA 1AXGA 2QSUA 2VTEA 2ECFA 3CIOA 3GJSA 3L9WA 4G26A 3T3PB 5CXSA 4JNCA 2FWPA 1MW8X 3A6FA 3ZE9A 4A6XA 2OFWA 1HLGA 1SZCA 5F5NA 3R4CA 1I4OA 1O0SA 1R8YA 1SEVA 5F9FA 3D8TA 3I9NA 4FW9A 3G9XA 2AXEA 1MTOA 4W1PA 4GKKB 3N76A 3O1IC 4EVSA 3FY4A 4L57A 4M0EA 5EUQB 2EV9A 1P6XA 2BZ1A 2GN9A 3L1KA 4JCCA 5FOVA 5LQSA 5AUNB 2G5TA 5HRAA 1P2BA 5HTOA 4DB4A 1A8IA 5K3BA 2IIQA 4NKRA 4X97A 3EPRA 1X9GA 1GPYA 2Q6KA 3HJAA 4MQUA 1LPOA 4HB4A 4WL0A 1D4OA 2PSSA 4CKWB 1NVBA 1M8KA 3MJTA 4YMVA 2EWMA 2RBGA 3A2KA 1E7WA 2JGAA 5FOSA 3RR2A 2TRSB 4HMQA 3ZVRA 4RK1A 1WZEA 4KQ9A 3K0AB 1USKA 4XXHA 4YALA 5JC1A 5DLPA 4HEA6 4QAJA 4F4UA 3TGWA 5IDWA 1AHPA 3I2JA 4AJ9A 1CT9A 1T1SA 1XUOA 1EFRD 1G3IA 4RVOA 1FNDA 3UC5A 4RK0A 1G8AA 2ODWA 1MGPA 3ROKA 5JMTA 1IEQA 2IXFA 2WLSA 4LEIA 4Q7MB 1FSZA 1PR1A 4HLQB 3D8HA 4FLMA 5G02A 4EJSC 5K3OA 3LL7A 1UF9A 5FR2A 3MOSA 3RKUA 2EFEB 1XROA 3JD3A 3UG7A 2JRCA 4P4GA 2OR3A 2PS3A 2CDBA 4J0CA 3GAZA 4HDOB 4MJXA 2ZJ2A 2FETA 1T0HB 1W581 3MPOA 1MNAA 4UM9D 1GPDG 4KYIB 4IFBA 5G1PA 3ZGNA 4WGFA 3N0XA 4HNAB 4BZXA 4D3XA 3U5ZB 2XGJA 2E0IA 2WF9A 2JLZA 4DJTA 4RZQA 3JQRA 4UU8A 3VPGA 1EXVA 5JVDA 3CU5A 1WRBA 3AFNA 5K6AA 2I3DA 6Q21A 1K68A 3QLJA 4YUAA 3IR6A 1ZVJA 1UFKA 1S2NA 1GZSA 4N3NA 2WTNA 4IHJF 2VDPB 3FCOA 4JC4A 1CZUA 1R64A 3TLZA 4IMPA 2XF8A 1EXNA 1R8SA 1VFPA 1YBFA 2DTEA 4G6ZA 2M6KA 5A4AA 1MOPA 2XB6A 3R5KA 3KSZO 4J2TA 4C4RA 5JEDA 4P4SB 2PWPA 2QPAA 4WOJA 5CYPA 4BTVA 1WQ1R 4YAUA 5J1TB 2DU8A 4F6RB 1VG8A 4H31A 3GFQA 4G5YA 4ICIA 2QPLA 3EGEA 3B48A 2C3UA 5EQTA 4DMRA 3I0MA 2NP7A 1UC9A 3AL2A 1T9ZA 3TQCA 1JT9A 2FPIA 3HDYA 3EZGA 5FYQA 2ORVA 2PT9A 1FMLA 4D45A 3TD9A 3FNBA 4TTQA 3DLCA 5A4JA 2PVSA 5DHTA 2XWQA 3WJ1A 1HOTA 1TF5A 4UUNA 4UD2A 4BVJA 4Q05A 1JX6A 1H2HA 3ESQA 1GUYA 4W9NA 1P3DA 3B1WA 3B2EA 4PNZA 1HO3A 4BFLA 1IIRA 2R25B 2O3RA 1FS6A 2GT1A 4C4XA 1M8PA 1J2YA 2LR0A 5AKLA 5E9WA 2JLBA 3HDJA 3OTHA 4O4IB 2VZ0A 2JNWA 2MMCA 2ZANA 4NX2A 5HMMA 1GLNA 2ES4A 1X2BA 2FZLA 1C81A 3KIPA 1Y37A 5K8VA 3E7DA 2F48A 4KLNA 2NP6A 3PXCX 4V2IA 5DO9A 1IIBA 4YWJA 3GA7A 3WWZA 1KERA 2GK3A 4C3ZA 4C6SA 5BV1A 3MT0A 1G7TA 4MI9A 4US2R 4KP7A 3Q98A 2ID7A 3KTAB 4HDAA 1YWGO 2GI4A 1P1BA 1CKEA 2Q4BA 2VAWA 4JJEA 5CFMA 3GNLA 5A06A 2FW7A 3Q12A 5CLHA 1RBQA 2GYWA 3ZGXA 3QVKA 2F1HA 2PTGA 1BEEA 3H0KA 1U2DC 2B3TA 2CLFB 2DHRA 2C3PA 4RD0A 4WCFC 3RROA 3GRZA 3OPXA 1H23A 3HLYA 3W5JA 5I4IA 1LI5A 3BXGA 4DR3B 1YH3A 2GEKA 3L7JA 4RHFA 4P81A 1W25A 4B09A 1L4FA 1NKVA 3KNZA 1JT2A 1NHGA 5DCLA 3WRYC 1P5FA 3ZBPA 2Q4EA 5JBQA 2QTZA 1I8TA 4MHTA 1NQVA 4ZAZA 2Q3BA 1UKEA 3HBFA 5J4VA 4N49A 4QDUA 1ULZA 4LCJA 4Y2SA 4A92A 1B0ZA 1P4GA 1Z4LA 3ZNPA 3ONDA 2EFDB 5TV2A 4E70A 5FEMA 3EHDA 3RG2A 3RRJA 1I7LA 1LSSA 2UDPA 3KQHA 5TNXA 4UZSA 3VU0A 4CE6A 4DV1B 1OUMA 3EXHA 3Q1KA 1SBHA 4D4JA 5JD4A 5ED4A 3OT1B 3CZPA 1M0WA 4ES6A 3C3DA 2IXTA 1T8WA 3IUYA 3LT5A 3QUTA 3R3ZA 4OUKX 2BP7A 4MUKA 5A02A 1M66A 1FQJA 3DTTA 1P7CA 1C7FA 3FNEA 5IT0A 4EUNA 5EHIA 1T24A 5B1YA 4AXXA 1NRJB 4DIMA 3TSOA 1BE8A 4IDAA 1ODKA 3QOWA 1MZPA 2PMEA 4V1CB 3CH5A 4Z0TA 2XH8A 1L8OA 1II9A 1KPGA 2OL4A 3GROA 1U0NA 1AUXA 4F3RA 2OXFA 3AUAA 3RU7A 4RD2A 1Z62A 3UC9A 3CLHA 4R0MA 2XBMA 5M7EA 1TJ5A 3CJQA 1GRVA 4S0ZA 3C70A 3EZ9A 2YBEA 2VH1A 3PC8A 3SS8A 1ECJA 3LF1A 4GDMA 4C7OA 1I6MA 1XR3A 4DDVA 3RTBA 5JH7B 2QZ9A 3E7WA 4M88A 3OPYB 2V7QD 5G3YA 1WBDA 2QAJA 2ZBPA 2EWWA 9LDTA 3HB9A 2O50A 4GM0A 5T8KA 4D0GA 1QTQA 1N0VC 3CT4A 1DEOA 1YOVA 1SVLA 3L4BA 4IJQA 2KPOA 4UBIA 5DBEX 5EJIA 1P75A 4X5OA 1DO0A 4LV8B 2B8JA 3BICA 3IVGA 2R65A 4HEA1 4U3JA 5ELMA 3TXYA 1E9AA 1X3SA 4R3UC 2GZ3A 1TL7C 4NDAA 1OLUB 2J4CA 4CLOB 4IDOA 5G4LA 1WMEA 4JSYA 3KXLA 1FX1A 1HRKA 3VR6H 5KOHB 3SNHA 1Y3HA 4NEQA 3LCRA 3GLIB 1R0BA 3T54A 4CBVA 5LP6F 2O8DA 3LUDA 3W7BA 1TGVA 3SYRA 2YWJA 4B7AA 1KMHB 5CVDA 2CE2X 2XQKA 4RZ2A 3ZVMA 1NQAO 3C6QA 3KFLA 3Q3IA 2X6RA 3UPUA 1D2HA 1ZX1A 2ZU6A 1NUPA 4C2AA 1ZOIA 4ZXPA 5CT9A 4ZCIA 2Q3MA 4LXXA 4K86A 3LYUA 3OZSA 3TIGA 4XCQA 4B48A 1S2IA 4PSCA 2Y6VA 4Z9BA 1IK4A 2NUTB 2GK7A 3HKBB 1F8YA 1DZIA 2QL6A 4B47A 2XUDA 4BRUA 5B7GA 2DR3A 2QUJA 1GR1A 1O8BA 1UKBA 2D0IA 3GPCA 4NR0A 5AW7A 5D6OA 4P82A 3AFGA 2WPDA 2XCRB 3E70C 2XVYA 1YS6A 3EA5A 1YS4A 3O9ZA 3MBIA 3ADCA 3MRTA 3UCEA 1VPEA 2Z2IA 1Z6TA 1AURA 1ZINA 3C3CA 3IAS1 1U9YA 5FUVA 2W6ZA 3UK2A 2WTUA 4JV5B 3SZ3A 3GIDA 3LWNA 4UTOA 3K6SA 1VCOA 1KY2A 4PZYA 2EL7A 2EDAA 2H29A 2WB4A 4XH9B 4DFDA 2B1JA 3PT5A 7ADHA 2VAXA 3GGPA 5AJUA 2YXEA 4I2VA 2HEIA 3G2MA 4HCJA 3WP0A 1TO2E 2A7QA 4IG4A 1F48A 1LF0A 4R84A 4Z3DA 3MB8A 2HL6A 1OY1A 3UT0A 1CUXA 4UUPA 4DADA 5B6PA 1EK6A 3AB3A 2H2HA 4RYLA 1Z74A 1Z0FA 2R8ZA 5CJPA 3D8SA 4N3BA 2CBZA 1HE4A 3DR5A 2Q3EA 2VJCA 2QDKA 3WYAA 1C30A 3ZU4A 5J2TA 4OGFA 1J07A 4W8GA 3SPXA 2XDWA 4MAMA 4DXDA 1M7BA 1XCMA 3D4BA 2NO0A 1EQAA 1XZPA 1DUSA 2GETA 4XWGA 2XHZA 4I46A 3SG0A 3TTXA 2JLXA 1GTRA 4LRSB 2YKGA 2UAGA 2WM8A 3BGIA 4J7XA 1WVIA 3E48A 2FUCA 5DBOA 5AKYA 5ALMA 5ITZB 3EEQA 3I62A 3CRVA 4W5OA 3V7WA 4AM8A 5K2OA 3OQ6A 2B30A 1N6HA 3KOXA 4IDQA 3ZU6A 1NNEA 1OQAA 2EBFX 4L75A 1NGSA 3PPYA 4KE6A 1TOAA 1DEAA 1H93A 1QB8A 2RONA 4DSAA 4TKLA 4QO7A 1YBAA 2FLKA 3CUYA 4AX8A 3FCAA 2BGWA 4QBIA 3R7AA 2Z6VA 3ZJTA 2VCEA 4TV8B 1WR8A 2DHQA 4YCAA 4AKHA 1P5ZB 3T9AA 5EQFA 1T3GA 2ZS8A 4IH1A 4WHMA 4KFSA 1KK1A 1N1GA 5HGXA 5DLQC 3F73A 4BPBA 3P26A 2JFFA 3MOGA 1DTEA 4MQ5A 4NU0A 1IZ8A 5KZMB 3NHKA 4XQ0A 4BTLA 2VTDA 1HTTA 3NHWA 4X7BA 2VNHA 1B4DA 1PQWA 4BLQA 5JQGB 1YR1A 3QFTA 5FXMA 2I4MA 3K0FA 1JRLA 1MU0A 4HXGA 4OM8A 4M1WA 4HAYA 5C5CA 4BFCA 1A2BA 2P5YA 2EP5A 4FE4A 4XM0A 3UJ6A 3W06A 5JT1A 3CG0A 4YEDA 4QBGB 2I6QA 2J3EA 2G67A 4LBZA 1QS0A 4DR2B 3QE9Y 1QM5A 1HQDA 2FF5A 1U2RA 5FA8A 3VKVA 4DTCA 4QWMA 3RUCA 1ZOPA 1PDWA 3PQDA 1M2GA 2RHRA 3DLTA 1A9PA 5AOAA 4F4CA 3PUYA 1VKRA 4UUOA 2B8TA 2QPOA 5IWCA 4QHYA 1NN1A 4F97A 1L5HB 3PICA 1O6ZA 3C48A 4H3KB 1QZXA 5L8VA 5KO2A 4ND1A 4Y2JA 4LNUB 3F9CA 4M1KA 5DSTA 5AW5A 3VR5D 2W22A 4LJ9A 3JVDA 3VV2A 4CCYB 4DG9A 2H5EA 4R2MA 3GP8A 4UBLA 3QUAA 1NLYA 2BEWB 1WD7A 2OG1A 4IQ8A 3B60A 1HYHA 2H65A 5CUQA 3MT8A 3RS2A 2ZBUA 1RZRD 3K6RA 2JJYA 2GDJA 1XT6A 1XRLA 3AVPA 3KELA 3G2IA 3N59A 4ZI7F 1P45A 2AMYA 4XZ3A 2PJDA 3GLUA 4OF4A 5KNDA 1VG9B 2KM1A 4KQ6A 2CCGA 2XLBA 1HNNA 3EGWA 2GHRA 4XJTA 4ARVA 4C7XA 4ENSA 1HC7A 1RXWA 5EMNA 4X41A 3OE7D 1OU4A 4LJSA 4V38A 1ZAKA 1QXSA 4H60A 3QE0A 5AVVA 1YZUA 3HBJA 5COAA 1BYUA 1Y1SA 4O4HB 5HQJA 2ARKA 3QIVA 1P1KA 4A8JA 1NUSA 4NENB 4TKZA 2H7YA 1HPLA 1T4BA 3Q9SA 2D6FA 5BV0A 3GEEA 5FI5A 1X1EA 1ZGJA 5IDYA 1DUIA 1HDRA 3M4XA 1YCHA 2OV1A 3OQJA 1XKLA 5A9TA 2XB2A 4E15A 1F51E 4HZIA 1K06A 2DFLA 1RQXA 1DL5A 1SGWA 3HCNA 3T34A 1BH6A 1FDRA 5HDQA 3WLRA 1IVSA 4Q6BA 1QQ5A 1P74A 4JDPA 4ZHQA 1F4PA 1V6SA 4IILA 4J16A 4X95A 1J8DA 4B3DA 1HDEA 1YVRA 2H7CA 3LK6A 5AVZA 2VXOA 1CRLA 4NU5A 1QG0A 4XUDA 3G0GA 4ZFNA 1N0UA 2X2FA 3LHIA 3QW2A 3RTAA 2B8NA 1VA4A 5EKDA 2IYYA 3PR1A 3SF8A 5A9SA 2AOWA 3LWZA 2FWAA 2XA2A 1ZESA 4TSRA 4W5RA 1YHYA 2A0XA 2AEEA 1MB4A 2R8EA 3CLSD 1UFRA 3HYRA 2ZIZA 4G4JA 3P19A 1DEXA 4I0WB 3IULA 3ZCTA 4DCJA 4EHIA 4NH4A 2CXNA 3CTMA 2QMUA 1CZHA 4CM4B 1KU6A 1PUJA 4HK4A 4MEBA 1IHDA 4P3YA 3NKFA 5K6RA 3SFTA 4FWIB 2E21A 3MWGA 1T9KA 1KNQA 3FWHA 2P6RA 4HAXA 2PH3A 3IP3A 3PVSA 3WFIA 1SPXA 1TYCA 1Y5NA 4I50A 2GVDC 3HYNA 5AFSA 1ORIA 3LQ2A 1HZZA 4UTXA 3HMKA 3EH2A 5F98A 1V1MA 5BN4A 3C6MA 3PVZA 4AKTA 2TS1A 2W0SA 2W2LA 4IIJB 4R1MA 4V3CA 5CNMA 2UXBB 3D8NA 4UBNA 3WDSA 5K20A 2O7NA 4JVLA 3WFZA 3DVAB 1QVZA 2H4JA 3O7MA 3T5TA 3WL8A 3B82A 4EUKA 3P9SA 2OBXA 4TTVA 2QZZA 5EZ6B 4CCAA 2FEPA 4BASA 3OFKA 4DRZA 4ZZ3A 1BWPA 3W3AD 3OF2A 5IBPA 4WCDA 4XCXA 4TTSA 4ZT7A 1JQBA 4BVAA 3TR5A 1E5TA 2SECE 4RA9A 2Q5JA 2AKEA 2V3WA 2JZCA 1M10A 4IV8A 1XYVA 4BMZA 1PDVA 4J7UA 5H3LA 2WWHA 2LVBA 5AI9A 5GPBA 3F47A 3UV3A 3OZWA 5L3QB 4W7IA 4TWAA 3ITDA 2A0FA 2IYQA 1A9SA 2XUJA 3DMYA 1G5TA 1JP7A 3ABZA 2HK6A 1TAGA 3C5HA 4D0NA 1A77A 2KLHA 3EIWA 2I33A 1N6KA 1AXRA 2B82A 3R3HA 4LY0A 3UUWA 1RLOA 3QXXA 3NQ41 1SBZA 4JZKA 4GGMX 3NWEA 4QM6A 1QF6A 1TZJA 4GG1A 4RULA 2Z83A 3ELWA 3RI3A 5LSAA 1QX3A 2JCBA 2MTBA 1JHRA 4LSZA 1II0A 3V4SA 3H1GA 3I3OA 2Y76A 1H5NA 2A35A 1MH1A 1HMYA 2QTRA 3M33A 2ZBEA 2VZ8A 2HQ1A 3R6LA 3UMCA 2O8FA 5NLLA 4N3CA 1R5JA 2Q99A 4U1RA 1DIHA 1QDLB 2PMWB 3GJ4A 3GVXA 2JFQA 1V48A 3P2IA 1ZOOA 3A4MA 4IQ4A 4PXYA 5JSKA 3TX6A 2TMDA 3KKZA 1TA4A 1D4FA 2CLSA 2Z1DA 4R1NA 1ICIA 5E3JA 2DQYA 3OM8A 5FULA 3RYIA 2ZI4A 4IJMA 4CR6A 3KG2A 3ONNA 2QUHA 1E4OA 3FTDA 3QWIA 5J4LA 1QYDA 3IAEA 1EU1A 4J0QA 4O6VA 4JMLA 4R0NA 5K6AC 5HJ2A 5DT9A 4HLDA 1BX1A 1XAJA 4I9GA 2F8LA 1CJMA 2ZPTX 1SC4A 3PEVA 1UDXA 3MJEA 4D0LB 1JDBC 2D06A 4M21A 1ZNXA 3O8QA 3QWHA 4I1RA 4NATA 3OE4A 5AOCA 2JJMA 3D6HA 3DUFA 5FPTA 2E5WA 5DCWA 4CEJB 2QI9C 1FTSA 4QFBA 1KWGA 5A4FS 4QNRA 2OCXA 4HLNA 3QRWA 2I91A 2IYNA 2GCPA 3AHJA 1ID1A 5IT5A 3SD7A 1M2VA 2IUSA 1X3LA 1DEHA 1N6NA 2BM1A 1A9TA 3P71T 2NPFA 2OZPA 1YJCA 5IHXA 4GFDA 1E9DA 1U0TA 2D5LA 1D1TA 4QTXA 1XCLA 1PL7A 3PX2A 2ZULA 4KR9A 2L19A 3OFJA 1WDTA 3OZGA 3FMIA 4PZAA 2BONA 3EEIA 3GT3A 2C03A 1OHHD 1T36B 2BFEB 5BQPA 1U0OC 3Q0TA 1IB6A 2CC2A 3AUTA 4L6IA 3MMNA 3PCXA 3ITNA 1QUEA 1W49A 2P77A 4PM4A 4PS0A 1VIYA 2YJ6A 1UWCA 4HATA 5BSRA 1NR1A 2H9YA 3GLSA 3TLBA 1N2HA 4I4TA 3QELB 3SLRA 5FUWA 4B0PA 3DKVA 2ANCA 2EEPA 3ETEA 2C4VA 3KQQA 1R5BA 2WA2A 1ZD5A 4MW1A 1QQ6A 5TMBA 5IYZB 4L3VA 3WRWA 3Q5EA 2I76A 5BSWA 5JATA 4FUQA 4IP0A 2IH5A 2YXPX 4JITA 4I99A 2H1OA 1PG5A 1Z5NA 2WSSA 1KZHA 2B99A 1CY4A 1J97A 3ISJA 3SFVA 4EQ6A 1CNEA 1V11B 4AQDA 1DQSA 3WKAA 1O9HA 4LHEA 4US1R 4DSUA 1YFLA 2G1UA 4B2IA 1ULHA 4Q37A 1S8AA 2UU9B 5CRIA 3TTYA 2PGJA 5LMCA 1ZO8A 3OU7A 5ESRA 1NBME 1I7PA 1UKVY 2PMFA 1YHZA 3T0FA 3WLLA 1LTQA 4MVWA 2HA5A 1O6BA 1HY3A 3URKA 1TI7A 1BJRE 4H7FA 4Q12A 3DTVD 2W6OA 1I24A 1ADGA 4LZLA 1ZEJA 2UUAB 4W9MC 4PYKA 5FLKA 2X5XA 2BFAA 4G9EA 3JQ6A 3ZI4A 3A2MA 3VKGA 4XSGA 2A88A 2PD4A 1JEYA 2GPJA 3OIYA 2ZIUB 3D4NA 4NG4A 3GI1A 4OHPA 1DADA 3U3DA 5KTPA 2EFGA 2ZS9A 4P7JA 2YYZA 4JFAA 1F7UA 3VXKA 1IN8A 3VR2A 4TKVA 5AXBA 3FUVA 1IMOA 4KDCA 4I14A 2X7JA 4LYFA 2X22A 1ZITA 3T3IA 2R9VA 2ZCUA 4R05A 1JMYA 2QN9A 2ZGVA 4BO1A 4BB6A 1H0RA 5K8LA 4YDRA 4B7UA 2E4ZA 2OZKA 3A58B 2ZYIA 3EXHC 2NO9A 2NAFA 3QA9A 3RC1A 1JQDA 1NRIA 2PKEA 2ZJFA 2EEZA 5IAGA 3P52A 4YRQA 4QAQA 4NOKA 3WV5A 2OUKA 3RIHA 2A5DA 1JR4A 1T9CA 2RJ3A 3KX2A 3QH4A 1MT3A 1DKLA 1WDWB 3I3SR 4GRAA 2Q1WA 3ESZA 1F60A 5IULC 1X80B 4F5WA 1A9OA 3PFFA 4UHEA 3CF4A 5LLSA 3AERB 3KAPA 2PS1A 3TLGA 3CX8A 4KHZA 2DHCA 2H4WA 3KLNA 5D3MA 1W0KA 2NUPA 5DWVA 5DXJA 4Y1FA 1KFEB 4DR4B 3QEAZ 2D7JA 4J6FA 3MAJA 1D2AA 4YRNA 1OGYA 2C7GA 2O14A 2VRCD 3AJ9A 1VYUA 5CYFA 4E2FA 3LZDA 5D1NA 1MFZA 3DE6X 3KDSE 3P2OA 4LC1A 3WMXA 4KTTE 3FVTA 4D96A 1QO9A 1XLWA 4G0MA 4QHTA 2Q41A 3PGLA 3MILA 2A5GA 3SI7A 4DNFA 1I7DA 3PC8C 4MWBA 1JPJA 5I7UA 2UYCA 4N9WA 2G88A 1VJ0A 2V3CC 2MJLA 1NVGA 2JKZA 2VJMB 3O2QB 4L9AA 2D00A 1QHEA 1YJQA 1YRLA 4KPUA 4MS1A 4OGGA 5DX1A 1QJCA 5REQB 4WECA 5T8KC 4FW8A 3W1VA 4O0MA 4OHKA 3HZHA 3L4BC 2QLMA 3PLRA 5KQRA 3TGPA 3LFHA 5ICSA 3V4PB 4IKPA 2VYQA 1QH1A 2QG9A 1GAWA 1JKMA 1SKQA 1R4AA 2EJBA 2EBHX 3HFJA 5CB4A 2FI1A 1BWSA 3E4CA 2C5SA 5E7JA 3N7TA 5KTSA 2BUCA 1DFHA 1UBKS 3UXEA 2G9ZA 1US8B 5A3JA 4Q4DA 1GCUA 2W2NA 1FRVA 1N7GA 2PK3A 3G85A 4PLWA 5EIXA 1ZVMA 3WHIA 2WAYA 4EPTA 4CG2A 4B4KA 2ISCA 3PUXA 1L3CA 3UT5A 3M4YA 1NBEA 1PJCA 3BRSA 3TW8A 1MBZA 3MMXA 3B6ZA 1CJBA 2NQ2C 3W77A 1GN9A 4CIYA 1FVFA 3E0XA 3DVRX 3TUZC 2ODNA 3T1NA 1NUAA 5KVCA 1MIOA 5E1OA 2P9HA 3WYBA 2I71A 4X20B 1GCGA 1V5WA 1D7OA 3LUAA 4RD6A 1TYDE 2BC9A 4QASA 1O0BA 3F5DA 1VBMA 3T7EA 3KJQA 1WXIA 4AU1A 4JC5A 2F55A 4KYVA 2WA1A 1Z8HA 2Q46A 3HV2A 3G9TA 4PAGA 4UNRA 3GDHA 4XX0A 4Y2GA 4LGMA 1ADYA 2JGDA 4Y1GA 5D5HA 3F4KA 4KXQA 2B2NA 1LA2A 1GPMA 1G7RA 3SBOA 4QYTA 3GVPA 1YTLA 3NONA 2FG5A 4W5WA 1IZZA 2GZRA 3GRUA 2AC7A 1U6JA 4XDYA 4ZICA 4LSWA 2Z6AA 1T8YA 2F3QA 1IWOA 3PHJA 5IKEA 3OPMA 3EDQA 2O3QA 3O4IA 5KNBH 1PJTA 1IBCA 4D02A 4BU1A 1E0JA 4B73A 2VDOB 4AJPA 1Z7WA 3CEAA 4G1FA 2RK6A 1XK7A 2I78A 2IS1A 2ICAA 4MRMB 3DL0A 4DEYA 1XMXA 1Z06A 3OLVA 4HRVA 4EFLA 1AMOA 2E4WA 4RNCA 1HUQA 2DBQA 1X1RA 1N4DA 4HY3A 2FFHA 3TNJA 1MN6A 4GE3A 5IXSA 3DFFA 421PA 3DLIA 5JV5A 3IC5A 1T4GA 1RWXA 4HN9A 1H2AS 2HJRA 3F2IA 5ETJA 3O75A 3FOEC 3JTEA 1DOAA 1PT5A 3N7UA 5EAIA 1Y1KE 1C0KA 1C3XA 3AUSA 3WKCA 4UBJA 4AAYA 4WXRA 5DM0A 3PDUA 1EVQA 5E0KB 4HN2A 2WOOA 1KDRA 1PS9A 3PQ2A 3RC2A 3Q15C 1XHEA 3IRVA 3BK1A 3WYDA 2I3GA 5SV2A 2GM5A 2BSAA 4W7HA 1N57A 4RTKA 3DO8A 4HNVA 1ODFA 1VPTA 2R7KA 3A6HA 3USCS 3OICA 1JAIA 3ZK8A 2IV3A 2JAWA 5A05A 5B7QA 1BDMA 2YQZA 1X7ZB 2ONKA 5LQAA 3QMMA 1TAUA 1S2MA 4PO3X 2YHSA 1L4UA 2FV8A 4TZ6A 4DDUA 1N8SA 1LDGA 3NATA 5IK2D 2QN6A 3SX2A 4F2WA 5CVVA 4RK6A 2JVIA 1B8PA 1XDZA 3IDZA 3HP7A 1AD2A 2DCMA 3OCWA 4OMUA 4IFTA 4IIYA 1TAHA 2ZSDA 3MRVA 5IAEA 1E9SA 3DBHA 3MMPA 2IBMA 1Z5ZA 4G9GA 3RUDA 2VYVA 4IGIA 4DC9A 3CKYA 3DZHA 4L7QA 4HGRA 2H9AA 4BEWA 2JD0A 4I8DA 3OOWA 3SYNA 2P6MA 5JWRA 4EECA 5B3JA 3MUNA 2D1FA 4P54A 1A2KC 1W88A 2FF7A 2Q5LA 4QEZA 1MCZA 3B38A 4M6WA 4MCHA 3DOHA 3O82A 4R81A 1J2TA 1BYIA 2GVZC 4H0CA 3THXB 3AR8A 1LDMA 1IBKB 3EVZA 4TRMA 1JVBA 4ZT4A 1UJCA 2TECE 2K7ZA 1ZCZA 2XXBA 3UFBA 2POCA 4BNIA 4QT0A 3WR5A 3DMHA 2R97A 2XIQA 1A7KA 3VTFA 3V1LA 4DPMA 5B2EA 1GPH1 4Y30A 2DERA 5G1OA 2WDZA 5KC9A 1E2NA 2FUG6 2C78A 1C3JA 1FJHA 3CGGA 3DDHA 2QG4A 2RHWA 2ZB2A 4UHDA 3BMQB 4C4ZA 3K5IA 2QRHA 3DV0B 5NULA 2OUIA 2R4UA 1M54A 2NUAA 1IEXA 4HPJB 3DMNA 4RHUA 4CWAA 4B0OA 5CBKA 2AW3A 3TEFA 2BMDA 3RC7A 4AJLA 4QJ5A 4EHKA 5DK4A 1MJ5A 1BC5A 1FPMA 2FP4B 4JP3A 4M98A 3FCCA 1SZDA 1G6Q1 3W9YA 1Q5PA 3FMGA 2VATA 2PR2A 4C0BA 3NHPA 3ZVKA 3Q7TA 3PUHA 3P5BA 1QRDA 2NQ8A 4TSFD 4ZCRA 4D81A 3L79A 1F7VA 1DCTA 1FFXB 1PO7A 4YRTA 2ZI9A 2IV2X 1Z33A 1M34E 4RHXA 4QPCA 3WGZA 4ECAA 3FOFC 5EGSA 2JFUA 3BXPA 4CIWA 4A8JC 2Z4SA 2UUBB 2XA1A 3HV0A 1V3UA 3CZ5A 4LOJA 4OJKA 5DRTA 3DEJA 2P2YA 3P7MA 4GR9A 4KQGA 4MUAA 2W6JD 4ROSA 5AOVA 4BKUA 1XXLA 1QAOA 4BECA 2XMQA 3II6X 1UPAA 3U6KA 3QOXA 3DXZA 1Y6JA 3OTGA 4KPFC 2YXDA 5E3IA 2RIPA 5E95A 1NA5A 1OFUX 1RJEA 2VDJA 4J16C 5A7HA 4WBXC 4JI0B 1C41A 3P2EA 4ZEVA 4U7PB 5KJEA 1JEAA 4N41A 5JNWA 5ALZA 1IOVA 1U0HC 1T1RA 3CCCA 1AKTA 1RVV1 4HWPA 4W8OA 3WLEA 4CDNA 1V7ZA 4EHDA 3SJ7A 5C51B 3KEQA 3V4ZA 1UM8A 4BLSA 5C7IO 1H6DA 1VMDA 2GEFA 3OSZA 1BZYA 4BHTA 3FOWA 3DGFC 4N5IX 3HGMA 4YUWA 3M6UA 2D5IA 4GLLA 2QVXX 3CJTA 4L5AA 4KUHA 5AESA 3QU2A 3UMBA 1E79A 3KB1A 5C5EA 4DG5A 4H6PA 4UHKA 2OENG 5DOVA 2QE7D 1GCAA 4B33A 4EUHA 3ZS8A 2ZRNA 3BSYA 4GGOA 2WVHA 1C1XA 1AVTA 3IUQA 2P9BA 4J9UE 3G82C 4R0VA 3WL5A 1JF8A 1A9XA 4BNZA 1O89A 2PQ2A 3CZ9A 1IXSB 1KEVA 3BRWA 3NRBA 4CM6A 1RCFA 5K99A 4DG8A 3H11A 2O2IA 4J3NA 3LF2A 1HE2A 1K2VN 5JR3A 1HZZC 2GCNA 3ODPA 4P4LA 4Z86A 3M6VA 3QEJA 1BXRA 5EKXA 2DB3A 1AGYA 1BE0A 1OKKA 1N2BA 1V16B 2ZYDA 3AEKA 3NC1C 4JU9A 4B6SA 5L9AA 3N70A 3RV3A 1SVMA 3PU6A 4OJYA 2E7ZA 3O38A 4AY6A 2FSVA 2XCUA 3H86A 3HBMA 3HE3A 4UD6A 4D9BA 4V39A 4DCTA 4EBFA 1HE8B 5IF9A 1K7SN 3LDHA 1Z2EA 5I9TA 4EKEA 5EE1A 3M83A 4LOIA 2MYTA 2ZYAA 2XDQB 4UMEA 3ZGLA 4F3CA 2WQ7A 1QGUA 3LGAA 2JI9A 4R2XA 2X0KA 2X15A 4ZO4A 4AKIA 4Q4HA 1ZS9A 1RWBA 4HTFA 3A25A 1SUAA 4CMJA 4XWYA 1T25A 2CW5A 5ECDA 4FYJA 1SXJC 4OQYA 2O23A 3JAWA 1E3IA 2XSZD 5IJXA 5JHGB 4QC2A 2PLWA 4IVNA 3FVWA 2AIRA 4P5DA 3SR4A 1JDVA 4HRAA 4JHLA 2JFGA 1U90A 2FDCA 2I87A 2PAAA 1HQKA 1IEWA 4UE6A 1RTKA 2WUWE 4B87A 4MO9A 1MF7A 2ZRPA 3VKFA 3GCXA 3PPVA 3RVOA 1NAHA 4TOIA 3T7TA 3NVMB 2YVQA 1AOXA 1PJ2A 4OYYA 4K2AA 3U3MA 5JPIA 4XEUA 2FSIA 4MR8B 3CNQS 2BMVA 2YIDA 3WLIA 4AL4A 5EJ7A 5KMGB 4CI0B 1TMOA 2P4UA 3LV8A 3ESXA 4QOHA 3CNEA 4M9CA 5A5GA 1NXXA 4QPNA 2AN3A 3DVLA 4JBYA 1CR1A 4NFLA 3V8PA 3VDQA 4DMHA 1OJLA 5B5SA 1P0MA 1NOJA 2ZETA 3WK6A 3OFND 1LPBB 4GZMA 1GAXA 5I45A 1JDZA 5EEGA 1BWRA 2BHSA 4J0EA 1MO5A 4P34A 2JCVA 4YB8A 4RDXA 4BMNA 4HTAA 4C04A 1P8AA 1EJ6A 4M1TA