3JQFA

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and inhibitor 1,3,5-triazine-2,4,6-triamine (ax2)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
267
structure length
249
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Pteridine reductase 1
publication title Structure-based design of pteridine reductase inhibitors targeting african sleeping sickness and the leishmaniases.
pubmed doi rcsb
source organism Trypanosoma brucei
total genus 92
structure length 249
sequence length 267
chains with identical sequence B, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2009-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3jqfA00
3O03A 1H9AA 2GN6A 3KYDB 5TRTA 2GNAA 4I5EA 5K9ZA 4MIYA 3ULKA 4ND3A 1OC2A 4Z9FA 1LI4A 2HCTA 1KVSA 1WXDA 3VZSA 4AJEA 2B4TO 4CJXA 7MDHA 3UKOA 4EUFA 2I99A 4QTZA 4BNLA 5L7WA 4RDHA 1JA9A 4W82A 4BGIA 3FNGA 4OKIA 2AQKA 3C7AA 1ULUA 5F1PA 1Y7TA 4XDZA 3GMSA 5A4DA 4UREA 2AA3A 4WCFB 1HDGO 4XR4A 3PFFA 5HRUA 1WVGA 1XELA 4F3YA 4EITA 1SB9A 3LC1O 3TJRA 3UHAA 1ID1A 1D4FA 2DBVO 4M86A 1JW9B 3KUXA 4XGIA 4CL3A 5JMWA 3INGA 4P38A 5DULA 4GSLA 4WECA 4JNKA 3FPCA 4CMHA 3EC7A 1VI2A 2NU7A 4Y9DA 3KV3O 2RBEA 3RUCA 3PIIA 1YDWA 3K92A 4RZIA 5TJHA 3PRJA 3GC6A 1UZLA 4BMNA 5AVOA 1BWSA 1ZZEA 2QX7A 4A03A 1YH3A 4E2XA 4JK3A 4Q3EA 3GZNB 2G1UA 1G1AA 3WJAA 1Q1NA 3BHMA 4UEOA 2FPPA 3DZBA 5ICMA 2ZB4A 4IQ0A 1G6KA 2YHUA 3ZHYA 1DRUA 4H16A 4DBVO 3STHA 5I7SA 4IDDA 4R3WA 2XF8A 3C24A 5K0ZA 4XX0A 4ND4A 1V8BA 5U4QA 2NTJA 3VTZA 1M2WA 5JE8A 4W4TA 2QRJA 2WM3A 3DZKA 3DOOA 2HLPA 5IXYA 1ZNQO 3RCBA 1B3BA 3TPCA 4AJLA 3M2TA 4CM9A 3OICA 3JD3A 3PZBA 5TQVA 5A5FA 4N5LA 3IKVA 3W8FA 3FNFA 1EFLA 3G49A 4YAEA 8LDHA 5DT9A 1XLTA 3FNEA 1N2SA 1R0SA 3GN1A 4BNKA 2C82A 2NTNA 1KOLA 3G1UA 3E9NA 4FOOA 2C0CA 2X9NA 4YT4A 1JVSA 1KVQA 4BO1A 2D5CA 1FXSA 3N74A 3B6ZA 1K0UA 2YV1A 4QO8A 1Q0LA 2PKRA 2DQ4A 1CIVA 5L4SA 3BYZA 4Q3AA 4J9UE 3JYQA 5MDHA 1BTOA 3JD4A 4PG7A 3WGGA 3PHLA 1GV1A 6LDHA 2VOEA 1V9LA 3WBBA 4OQZA 4IGFA 4CQMD 2VWGA 4WEOA 1NPYA 1ADGA 1OC4A 2DC1A 3E9QA 3LT2A 4DLBA 4DPMA 2A4KA 2VWQA 3AFNA 3DFZA 5G0VA 4PCVA 3UVEA 3AWDA 1PU2A 3BA1A 1XWFA 5J23A 2JL1A 2Q49A 3PZRA 1N1GA 5FWNA 2B35A 4ZRNA 1V0JA 4ALNA 4YJHA 1HLDA 1DJQA 5IFLA 1LDNA 2UVDA 3CXRA 4RL6A 1GYPA 2V65A 1AXGA 1E3IA 1DFGA 3H9UA 3AUTA 2FZWA 4D79A 3PJEA 5GZ3A 2V6FA 1Z7EA 4GWGA 2Y68A 3IS3A 1YJ8A 4FJ0A 3GLQA 3U4CA 2PGDA 5ITVA 5EN4A 4WUVA 1Y8QB 4RO0A 5L53A 3RVDA 4OL9A 1O8CA 1LC0A 3QHAA 3H5NA 4FPXA 4NNJA 3UCFA 3CZRA 3PK0A 1NR7A 1VJ0A 4MVJH 3TZHA 3WIEA 4RPGA 4MVJI 1PWXA 2OFPA 4L4RA 4P8RA 3VPSA 3WJ7A 3MJVA 2O3SA 4LVUA 3BMOA 3CZMA 3ICPA 1N5DA 3NV9A 3JQAB 4CL8A 4L73A 4CUZA 3F1LA 1I2ZA 4UVDA 2IZZA 3NGXA 2PZJA 3PWKA 1BXZA 2B5WA 5B37A 4BQRA 1EEHA 3F4LA 1JAYA 5A9SB 3WLEA 2PK3A 3WGIA 4DL9A 1RYEA 2Y1FA 1VM6A 4NZ9A 4PFJA 5T67A 3ZHXA 2IYOA 3A4VA 3MCVA 3NTRA 4NBVA 4S1VA 3VZQA 1DFIA 4UEJA 4DBZA 1EVZA 4R54A 1C0LA 3GMDA 3KVOA 1HL3A 5BSGA 4XIYA 5IDXA 5KJFA 3ON5A 3ASVA 3Q2IA 4AJ1A 1BHSA 2Y1OA 1ADBA 2B37A 3H4VA 4WEQA 4NHEA 4ZQBA 3FD8A 3BTVA 5JBIA 1H6AA 4IY1A 2O3RA 2NVBA 1H6BA 1XU7A 1ZK2A 1Z74A 4PRKA 1T4BA 4YAIA 3RBZA 4WLVA 1WLYA 2WTBA 5EQFA 3UXYA 3CE6A 3LLSA 3ROPA 1D7OA 5DDIP 3SBOA 2Q4BA 5KVCA 3TOZA 2X86A 3AM5A 4XYEA 5K6AC 5AXBA 4W6ZA 3RFVA 1MGOA 3IC5A 1GZ4A 1EDZA 3GR6A 1WNTA 3ZWCA 1F8GA 3MJTA 3L77A 3PYMA 5LCXA 4CLRB 4WNCA 4NG5A 5T8KA 2C5AA 3C1OA 4LW8A 5U1PA 1E3WB 3GVPA 5GY7A 2NV6A 5U9CA 5G0SA 3JQ9A 2Y93A 3ZWXA 4LN1A 1AXEA 4TRNA 1RM3A 3E5RA 5JS6A 2I65A 2ZYAA 4RF5A 4N5NA 1NBOA 1NASA 4LRTB 1UUFA 1N7HA 4DMLA 1IL0A 1XR3A 3RKRA 4AJNA 4IQ8A 4OQYA 4MVJA 4CV0A 3BIOA 4YRBA 4DUPA 1LSSA 3C8MA 1HE4A 4GX5A 3T4XA 3ST7A 3T4EA 1ZIDA 4H7PA 2AQHA 1UZMA 1R0LA 2DBZA 3NEPX 1FDUA 1CF2O 5C37A 2C54A 1H93A 4IQGA 2Y0CA 3JQ8A 1FDSA 3PEFA 4PVCA 2PGLA 3BZUA 1B8PA 4J4BA 2PZKA 3JD0A 1LA2A 3WYBA 1QV6A 1QYCA 4J3FA 4YACA 3F46A 3AU8A 5ICSA 1Z75A 3B1KA 1E3LA 1V35A 3ONFA 4XB2A 5GZ6A 3H2SA 4CUKA 1E1KA 1DLJA 3AK4A 4I08A 3DBVO 2OUIA 3VDQA 1NP3A 1WPQA 5I9MA 1P3DA 4A7PA 3FHLA 1B26A 3DOJA 3GDFA 2VYVA 4FC7A 4EZBA 3DB2A 4NQZA 3W8EA 4BNTA 5CAEA 4I9UA 2CY0A 1SEPA 5BSHA 4M1QA 4BNZA 2Q50A 4JLWA 4EUHA 2DAPA 3JQBC 5A5EA 1BGVA 2BFMA 2WDZA 3R3JA 1PR3A 4DQVA 4EYEA 5ER9A 1MC4A 4PLPA 3SC6A 1PTJA 1IOLA 4IIVA 2NWQA 4PVDA 4WOKA 1KETA 1A7AA 3ETDA 2H1SA 3DC2A 1X0XA 4HV4A 2O3QA 1NQTA 2FHSA 1E7QA 1XQ6A 3WWYA 2X0JA 1EVIA 3BTUA 2VUTA 1QR6A 1U7HA 3QVSA 4MVJM 3HE3A 4RVUA 3WQSB 3D3WA 2LDXA 2CDCA 3ZV5A 4DA9A 3H9EO 4PLVA 1WP4A 1QYDA 3DONA 3JQ7B 4UUOA 4D46A 4CMJA 5JY1A 1WMBA 1E3JA 2VNSA 1JKJA 3DMTA 1ZK1A 1AN9A 3V2UA 1A71A 2PD3A 3LT1A 4ID9A 4NBTA 3HDYA 2V6GA 4QFDA 4UVHA 1R6DA 4K26A 4IZHA 1X15A 2BMAA 5JFOA 4YTEA 3GEGA 4BMSA 1ISMA 4RF3A 1KEPA 3KYDA 4NJMB 1R0KA 4L8VA 4WCDA 1F0YA 1CDOA 1LDYA 3KEQA 4XRGA 4PN3A 1A27A 4E6PA 1CJCA 1WDMA 3QSGA 4RPLA 3LC2O 3MWDB 2EW8A 2JD1A 4CM9D 5EERA 1O95A 3EK2A 2GZ1A 2GRAA 2PNFA 3VVCA 3ZU3A 1MX3A 1GCUA 1GFSA 2HUNA 4OSPA 1Q0HA 1XIVA 4OO3A 3FSRA 2VHWA 2Q1UA 5KJEA 1R4NA 2DTDA 4YJHB 4XB1A 2UYYA 3VZPA 4Y6PA 1KEWA 4NMHA 2O7QA 1T2AA 2P9CA 3TZ6A 4XYMA 1LSJA 1U3WA 1Y5RA 2EF1A 1ZK0A 3TQHA 3AW9A 3MJEA 3UOGA 2O2SA 1H0KA 3ZW8A 4R9RA 4LMPA 4YA6A 1UP7A 4MP6A 3RUFA 3QE3A 1W6UA 2P91A 4RVSA 2G17A 4TZTA 3DAPA 4AJPA 5BSFA 5CG2A 3WICA 6ADHA 3ZHZA 3WDSA 3SEFA 1HWYA 2WYVA 5DBFA 4K9DA 5BNTA 5KCZA 5BT9A 3TSCA 2R00A 2BELA 3BMOB 2J8ZA 2UUPA 3Q1LA 4IJVA 4B3HA 4B7UA 5DP1A 1B3RA 1M66A 4XRRA 2JFGA 1D1SA 2C20A 2Y1EA 3QLJA 1JKFA 2JAPA 4YT2A 5L3ZA 4DC0A 1QYXA 5CDSA 3FTPA 3MJSA 4PZEA 1E6WA 3INTA 1DRWA 1YBAA 2ZB7A 1DHTA 2FMUA 3WTCA 3TNLA 5A1TA 3OIGA 1ZSVA 3LT4A 3S1LA 3CMCO 4ZA2A 1F17A 4HFMA 1E6EA 3DEYX 5JW6A 1AHHA 4ND2A 4U0KA 3E9MA 4NBUA 4YT8A 3WMXA 5KVVA 3EVTA 3H5RA 4TKLA 2IZ0A 1J0XO 1KERA 2CSUA 3FWNA 4LRSB 4UEKA 1LJ8A 3OM9A 3CINA 4FFNA 1JN0A 3I9LA 3QY9A 1XEAA 3GF4A 2J5KA 1C0KA 1F12A 3H9GA 5B4VA 2QHXA 4URFA 3K2EA 5JNLA 4WK6A 5JPIA 1I33A 5FI5A 2RH8A 4ZQEA 9LDTA 1R16A 2F00A 4Q3BA 1A9ZA 1HXHA 1B7GO 1DRVA 2VTDA 3JQEA 3KTDA 3MTGA 1PS8A 4IDAA 4JROA 3TFOA 3HB5X 4RVGA 4BQPA 5C7IO 1Y9AA 3TFQA 4KP7A 4RDIA 4D44A 1HDOA 4R9SA 3L4BC 3CUKA 1QORA 3SVTA 4ZRMA 4OXNA 2FOIA 5DN9A 2DBQA 3AOGA 5DCUA 2GN4A 1LRLA 4BB5A 5TS3A 3RBVA 5F5NA 4MKRA 1NFQA 1ZVMA 5T64A 2FWMX 4ITUA 4H15A 1D1TA 4E30A 3RJ5A 3GGGA 4PLGA 1GY8A 1PZFA 4RF4A 4BNMA 4Z0HO 1NVGA 2X7HA 1LLQA 3ITKA 1EUZA 3KM0A 5ENDA 1NTOA 3JQFA 2C29D 3U09A 4CV2A 3RI3A 2O7SA 4DQUA 3VPFA 1SCUA 1PGOA 2I5PO 2NU9A 2JJYA 1SC6A 3FN4A 2EW2A 2QZZA 4KWHA 5JSFA 3VH1A 1TI7A 3JQAA 3U9LA 2I6TA 1YOVA 4XR9A 2NU6A 1DO8A 3ZGYA 3VH4A 1W8DA 1Y5MA 2J5QA 3DBHA 3RJ9A 1KC3A 2IEDA 3OETA 1ADCA 4KMSA 2QYTA 3UFXA 4DMMA 1A5ZA 4W9NC 3LK7A 4E4YA 3HB4X 1E1MA 1P0FA 4GQAA 2X22A 2W98A 2NQ8A 5JC1A 4CUJA 1YBVA 1ZBQA 2NUAA 4ILKA 2X4GA 2HMTA 4MVJD 4BV8A 1XSEA 3FWZA 5KTKA 1DFHA 1ZSYA 3P2YA 4Q3NA 1FJHA 4BVAA 4E2YA 4UULA 3RROA 1GAEO 3CMMA 1K2WA 1EFKA 2GO1A 1ISFA 2GN8A 3RC2A 4JX8A 1YL6A 4IDCA 4KZPA 5DCYA 4ESOA 5G0TA 5HM8A 4BKUA 4XYLA 2GCGA 2VYNA 4ALKA 2DPGA 1MXFA 5JDCA 1DC3A 3GUYA 2EKLA 4EI2A 1I10A 3RFTA 1I3LA 2VHYA 2XXJA 4JCOA 1V3UA 3DHEA 3ZWOA 1YE3A 3GPDG 4HNGA 2OXIA 4YDRA 2NNLD 4DYVA 3OHSX 4CR6A 3WGQA 4OYRA 3RUAA 4CLRA 4PG5A 3NYWA 4M54A 3ZWBA 3GH3A 1C3VA 1E3WA 4TRRA 4IS2A 1IY8A 5FYDA 4HXYA 4WGGA 1E3EA 1UDCA 4J4TA 1NFRA 4FS3A 1UDBA 1KS9A 3A1NA 4J1NA 1EBUA 1JKIA 4TVBA 2QG4A 1SAYA 2X0NA 5A06A 4OXKA 3S2EA 2Y0DA 2I3AA 4KQWA 4FJ1A 4MIEA 3KEOA 2HKIA 3UGKA 1RM5A 4W7HA 4PGFA 4Q3CA 3V2HA 3GVHA 4XDYA 2Y0EA 4R51A 3M2PA 4XJTA 2NU8A 2ZJ1A 3F5SA 4LSMA 3GAZA 4GSKA 3U4DA 4ZQHA 1NVTA 2AHRA 2GPTA 3VAZA 1NQ5A 3D4OA 3DXFA 4CM6A 1Y81A 2YHIA 4QECA 4XKJA 1C0PA 1X1TA 4GX0A 5HA5A 5ITWA 3U0BA 5L7YA 3WGHA 2PWZA 1R4NB 4O59O 2WD8A 3I6IA 4MO2A 1MC5A 3LF1A 1LLDA 3ZDFA 1NYTA 5DBGA 4PLZA 1ISHA 1MLDA 1VE9A 3Q2KA 1ZJYA 1NXQA 2DUWA 4JP3A 3ZWWA 3UAGA 3QW2A 1NHWA 3GEMA 4BIIA 9LDBA 2JD2A 1I3NA 4JIGA 4QO7A 2PD6A 4XQ9A 4BUCA 3UUWA 4EJMA 3GUCA 3PDJA 2X5JO 1TT7A 3PLRA 3EMKA 1DC6A 1JTVA 4PLWA 2D1YA 4BL5A 2ZTUA 3UH1A 3GGOA 1NPTO 1PR9A 5DCWA 1E77A 2ZK7A 2P4HX 2FPGA 3H8VA 1P44A 2GD1O 4O0LA 1HE3A 2DTEA 2AEJA 4HX5A 2A9FA 4RZHA 3RAJA 4ZJUA 3JQCA 3JYLA 2G0TA 2Z5LA 3NRCA 4YWJA 5IDQA 5JAIA 1QSGA 2BFAA 3RD5A 3JQ7A 1CQJA 5ENVA 4EEZA 4ZQGA 3UCEA 1KVRA 1U4SA 1ONOA 5KKCA 3UW3A 4BO4A 4UVGA 5DP2A 4RQTA 3WNVA 5MGBA 4J7CA 2PV7A 4D7AA 4IDBA 4FFPA 4XGNA 4PRLA 3VVBA 3WIDA 5I9NA 3PGXA 1QKIA 3C1AA 3WG9A 1M6WA 1UXJA 1HYEA 2X0RA 2XAAA 1B8VA 3WR5A 2HSDA 2I66A 3VH2A 5CDYA 2O3JA 4NJMA 1LQUA 4XD2A 4CLDA 1Z7BA 1E7MA 4J49A 4E5PA 5CDGA 4J0EA 2OP1A 1DOHA 1LUAA 4QUKA 4MOWA 2X9VA 3N7UA 1VSUA 1EZ4A 4I5DA 1YBMA 3WB9A 5IDWA 3OEWA 3CPSA 2P9EA 1C1DB 1I32A 3K96A 1H6DA 2BFOA 2EGHA 3HUDA 2PD4A 1VC2A 2AW5A 2JCVA 2IRWA 4R5MA 3RC1A 2Y1GA 3U49A 3B70A 3KSUA 2QW8A 4B7CA 4W7IA 3ZNPA 1QG6A 1VPDA 5KVSA 1PEDA 4M8SA 1EQUA 1F14A 4MP3A 4CM8A 1K3TA 2UDPA 4WOJA 4BKPA 5COAA 2AEMA 3A06A 1U9JA 3RUIA 1DIBA 4U7WA 1Y8RB 4BOYA 1DAOA 3B1JA 1WMAA 4BNXA 4IJWA 4K1LA 4II2A 3H65A 5TT0A 2PZLA 2Z1NA 1T1RA 1WDLA 1ENOA 1ISIA 4JGBA 1E6UA 2GGSA 2EERA 4FJ2A 2WMDA 3ZN2A 2ZJ0A 1X7DA 2Q46A 1P74A 2ZTVA 4S3MA 1ISJA 2Y99A 1DC4A 1T26A 2PH3A 1LRKA 3KOUA 4JBHA 3WOHA 1NPDA 4AG3A 1P31A 3I4CA 5IDYA 2CF5A 4R41A 3CIFA 1ENYA 3ZCXA 3IP3A 4D3FA 1U5AA 1W0CA 3WSWA 1MA0A 3RIHA 2J6IA 3SX2A 1U1IA 3OECA 4Z0PA 4ALJA 3MTJA 3ROKA 4AJJA 1KC1A 4FFOA 1E5LA 4ZD6A 4GGPA 1YOVB 4J4HA 5AXDA 2EKPA 1C1XB 1HDZA 3BTSA 1I0ZA 3DBHB 1A72A 3GPIA 2WJPA 2EP5A 3JQ9C 3GOHA 4O1MA 1SZJG 5I9LA 1O5IA 1EBFA 2OBYA 3ZWAA 1GPJA 4FFMA 4KUHA 4B3IA 3JV7A 5EIOA 1BXGB 4MINA 3K73O 4FOSA 5KJCA 3BTOA 3PTZA 1Q7BA 4X54A 4YRDA 3H5AA 3DZFA 2E82A 1RJWA 4BHTA 5CEEA 5ADHA 4GH5A 1TT5A 4Z9XA 1WDKA 4DIBA 4MKXA 2Y1CA 3VHRA 4QT0A 4L76A 1O9BA 1ZK4A 3JQAD 1YL7A 4Z0TA 4XCVA 4N54A 4RV9A 3U4IA 1KVUA 1EK5A 4U5QA 1ZFNA 4FW8A 1YQXA 1C14A 1PGQA 2FP4A 2DFVA 3QVWA 4UUNA 4ZVVA 4B8WA 1DSSG 1U3VA 2O3TA 4BNNA 2C7VA 1LU9A 1I01A 2VT3A 3AOEA 4NU6A 5TIIA 1S6YA 3U3XA 4IBOA 2Z95A 4WLEA 4E12A 1K6JA 4A10A 1LRJA 1RM0A 2ET6A 3E48A 4GX1A 1V6AA 1U2DA 1ADFA 2X1HA 1CERA 1E92A 2ZB8A 4IXWA 4FSHA 5B4UA 4UAGA 5F21A 2JHFA 2O23A 3O26A 2VYND 3ZH2A 4RJTA 5KIAA 2VWHA 4CR7A 3AY3A 3PHIA 3EZYA 4YPOA 4KWIA 4PLFA 4RVHA 3BMCA 1SB8A 4HNHA 3IUSA 4JN6B 2CF6A 3NDJA 4YYZA 1IB6A 1YKFA 3PFWO 4N18A 1P45A 3K6JA 5DNAA 3FBGA 1CRWG 5BSEA 3V2GA 3AUUA 4E5NA 3ETEA 5JO9A 2BGMA 2P5YA 4CLOB 3KZVA 3LF2A 3ZU4A 1YXMA 1BMDA 1PL7A 5BR7A 2RCYA 5JC8A 1ZMOA 3EZLA 4PLCA 5C5IA 5TSDA 1T4DA 3B1FA 4Z3KA 2YHIB 2Q1TA 2YJZA 5KVQA 5JDIA 3I9JA 3DMTC 4IDFA 5THQA 3AUSA 1H2HA 1O6ZA 2VHXA 2Y67A 1PGJA 3QWHA 1SOWA 2VOJA 1HSZA 1U7TA 1YB4A 2GERA 2HJSA 4AJKA 4BNVA 3HFSA 5IAAA 2I67A 1I30A 2ZQYA 4DXHA 2IODA 3IJRA 2A35A 4F45A 1PQWA 4UUMA 3GNTA 1GL3A 4BNJA 4D0RA 2NVUB 1LSOA 2QQ5A 3WNQA 3WGTA 3RKUA 3RBXA 5K6AA 3HWRA 4OHUA 4I9NA 2QYSA 4GLLA 4IJUA 4JXKA 4GBJA 1L7EA 3L0DA 3O38A 1WZEA 4RCVA 1IULA 4RVDA 3A9WA 1DJNA 1DLIA 2O50A 2BHLA 5H82A 3ANMA 3D5QA 4ONEA 1MUUA 4DIOA 3HSKA 3K8ZA 4B4WA 5IZ4A 3KLPX 1RYDA 3EGOA 4U8GA 3HN2A 1MG0A 5C7LO 3NTOA 3FNHA 3SJUA 4BO9A 1VL8A 1HSOA 4WCFC 4TWRA 4YCAA 5CPFA 1ZH8A 1SMKA 4XEHA 3I6QA 1N9GB 2J5RA 3DZGA 4J2HA 1NHGA 2DBRA 3AI1A 1PJQA 3W6UA 4YAJA 5F1OA 2NADA 2OORA 3PYLA 4EUEA 3DZIA 3CTMA 3E03A 1HF3A 2BGKA 2YDXA 4BKRA 3JQGA 3FRJA 3EHEA 2AMFA 4TMFA 4TKMA 3SJ7A 1SBYA 3ZU2A 3NUGA 1U28A 4I5GA 3P7MA 4NBWA 3ZV3A 3K30A 1NM5A 2YV2A 5CEJA 2Q1SA 4MDHA 2DPHA 3UICA 2HQ1A 2NM0A 3QIVA 4R69A 1NR1A 2HK9A 2R00C 1VSVA 5A9RA 2PKQO 3RC7A 4YT5A 4LISA 3RU9A 4UVEA 4D43A 4CMIA 5G4KB 5KWEA 1H94A 3F6YA 3PJFA 3PHHA 4FQ8A 2I76A 4GMFA 1MV8A 1Y9EA 3ROMA 5JXWA 3S55A 4B8ZA 5F1KA 2Y66A 2Q2VA 3IP1A 1JQBA 2OOSA 2O4UX 3LZ6A 4R16A 3CH6A 3KYCB 1YO6A 4PZCA 3Q6IA 3OQ6A 1K5HA 1B0AA 4JJGA 5CPBA 3R0IA 2X5KO 3D0OA 4P4GA 1B15A 3QVXA 4D0SA 2YV3A 1P77A 3IIEA 2BGLA 5IZCC 3U4HA 1PJSA 2NSDA 1NX6A 3QJ5A 4CM8B 1EE2A 2P2SA 4FGSA 5LDGA 3W4KA 1NNUA 3EDMA 4BO2A 1LQTA 5JAQA 1GTMA 3S8MA 3V1UA 3O9ZA 1UXGA 2EEZA 4EDFA 2GZ2A 3FI9A 5GZ1A 3KHUA 5L45A 1DC5A 4LGVA 4A2CA 2E49A 4OMUA 1A7KA 2EV9A 2XPCA 2YUTA 1TB4A 1QMGA 1UXHA 4HKTA 4EJ6A 3AU9A 5JAZA 4MKZA 3M6IA 4GKBA 4L74A 3AUAA 2F1KA 3JTMA 4MVJP 4R1TA 1PS9A 4L75A 3FR8A 3PJDA 3DTYA 2QZ9A 4IINA 1QP8A 4EGFA 1UAYA 1XGKA 1MXHA 3KXDA 1L7DA 4J91A 1MFZA 5FFFA 3W6ZA 3ENNA 1H5QA 5F5LA 3I52A 4CM1A 1PJTA 2Y05A 4E2ZA 5A03A 3DOCA 2DM6A 5T5QA 4ALMA 2O4CA 4WKGA 3L9WA 4BS9A 1R4MA 1GPDG 3LQFA 4Q39A 1GQQA 1XYGA 2QRKA 4KDEA 2EIHA 2EP7A 2BFPA 2X5OA 5ER6A 5TT1A 2D4AA 1E7YA 2UV8A 4R3NA 3ZV6A 3FPLA 3M1LA 4YAKA 3NT4A 4RVFA 1SEVA 1TT5B 1HE5A 3ZWYA 5L40A 1C0IA 3PXXA 1NWCA 3DMYA 1RM4A 3ETGA 4Z9YA 3GGPA 2ZYDA 3A14A 4YQYA 3DAFA 3HHPA 4QSMA 1GEEA 5AOVA 4CMAA 3VZRA 4HBGA 4PIVA 4KTVE 1QYVA 4CM7A 3GG9A 3GNSA 2HK7A 2HMUA 4GPD1 3K5PA 1JLLA 4Q3DA 1I3KA 3HDHA 3UN1A 4AICA 1C1DA 2BI8A 3IUPA 1IZ0A 4CMCA 2EJWA 2HRBA 2FR0A 3PHGA 1PJBA 1U8FO 4XGKA 1LDBA 2NLOA 4PLYA 3HDQA 3KBOA 3TL3A 3HNPA 4CMBA 2FPIA 1DIHA 1SOVA 3VPXA 5HS4A 3H9JA 4L4XA 3AI3A 4AJOA 3FCOA 4DREA 2TMGA 1QV7A 2WYUA 3AM3A 4ZICA 5A04A 4RLSA 1TA4A 3I9OA 2VUUA 3I9KA 3JD1A 2D8AA 4KOAA 5HS6A 1Y8RA 2IZ1A 4FBGA 3V1YA 5JLAA 3VOSA 4NIMA 2PY6A 3C85A 4WLOA 3RUDA 4M87A 1PGPA 4BO0A 5JDCC 4ZGWA 1U4OA 3BMCB 2CD9A 4YR9A 5ILGA 3OA0A 3ZW9A 1QLHA 3IAHA 1Q7GA 2B5VA 1EDOA 1FDTA 3MEQA 1EK6A 1PZEA 1K89A 3L6OO 4ZHSA 1ZEJA 1PJ4A 5HTOA 1EE9A 2AG5A 2DVMA 4MVJF 4B79A 1E0DA 1HDRA 1ZXLA 4CMEA 4OXYA 3E5MA 4EEXA 1P33A 3DFUA 1X7HA 2I9PA 4OKNA 1Q2XA 1T2FA 1UXKA 3SXPA 7ADHA 1C1XA 1YQGA 4BKQA 5A3VA 3BAZA 2Q1WA 3O8QB 4WE3A 2C5EA 5JCXA 1I24A 2VRCA 4YVFA 1UR5A 2JCYA 1H9BA 2ILTA 2WSBA 3GFBA 2ZTMA 4DLLA 4E33A 1BXGA 4ALLA 4E32A 1GV0A 3GNQA 4HY3A 1V3VA 4AL4A 2FY8A 1PWZA 5EINA 4AJ4A 3RASA 5I7EA 2C2YA 1IE3A 3ZV4A 5IN4A 2D5AA 3OFSA 5JCJA 4CM3A 3C7DB 1QYWA 1PL8A 1IPEA 4CQLB 4M49A 2I3GA 4DRYA 1XG5A 2PR2A 4FD3A 5CHEA 4XJSA 5I7VA 3GQVA 5FI3A 5ES3A 4NFYA 4MVJE 5I8WA 3WXBA 4BGVA 1ML3A 3H9QA 1MG5A 4YAGA 5KJ1A 3HADA 4O63O 5FEUA 2FSSA 4A26A 4XZ3A 3AY6A 4J16A 1NQAO 2W2LA 2GLXA 2W8ZA 3ZWPA 3T7CA 1YONA 3Q11A 3NDIA 3ONEA 4OH1A 4E2WA 3F9IA 1X7GA 1PGNA 4BO3A 3Q9NA 5KJ6A 1N92A 1PSDA 3G3EA 2X8LA 3JQGB 3JYPA 2BF7A 4OIMA 1HTBA 2W2KB 3WWZA 3L6DA 1MP0A 4HP8A 1KY4A 3JQ6A 2XXBA 3AI2A 4PLTA 2NACA 1RWBA 3GAFA 4JQCA 3OF2A 4GLOA 5GMOA 1SPXA 1YL5A 3WGYA 1Q0QA 4NJOA 1ZUD1 2AXQA 2H9IA 3SC4A 2JHGA 1FF9A 5AXCA 5THKA 3PYXA 4FFRA 3TF5A 1UP4A 5JMPA 4BGEA 1GD1O 2PGJA 4CMIB 1QXSA 1BW9B 4TZKA 3JCZA 4K6CA 4C7KA 1Y1PA 2IE0A 4CLOA 2P9GA 1MB4A 1T1SA 2RAFA 2JFFA 2POQX 2R6JA 4J2OA 3TL2A 5JAMA 2DLDA 4KDFA 1JU9A 5KOIA 2W90A 4QQRA 3WQRA 1Z45A 3QWIA 4G5HA 3GY0A 4CPDA 5L51A 2WYWA 3LDHA 1GCOA 2FZEA 1B14A 3W8DA 4NPCA 1BDBA 1T2DA 1XHLA 3HG7A 3D5TA 3VKUA 3WX0A 1ZEMA 4CLXA 5ILOA 4YJGB 4CM5A 2O2YA 2OHXA 5H83A 3JD2A 4WPGA 2NVUA 1R15A 3QVOA 4DGSA 1VJTA 1HETA 3BMQB 4LK3A 2CMDA 4NH4A 5CEFA 3KLMX 4D3DA 5I8ZA 2J3IA 4FGWA 3ZI0A 1OMOA 4GX2A 1J6UA 4R1SA 2FN7A 4B4UA 4D41A 4FIZA 2DU8A 1WZIA 3GN2A 1YB5A 3NGLA 4KTTE 2A94A 4IJKA 5AQ1A 2HMSA 2Q2QA 1DIRA 2ZCVA 3ICCA 5F3RA 2YQ5A 5G4LA 3MWEB 4DVJA 1BVRA 1GUYA 2AQIA 5L95A 1IPFA 2PFGA 4CMGA 4IDEA 1GUZA 3Q3CA 1ULSA 1W73A 3OQBA 1LDMA 1N9GA 3LT0A 3V8BA 2YFHA 2HDHA 1A4IA 4HWKA 3A28A 1O0SA 1R4MB 3GK3A 2HO5A 3QWBA 1YJQA 3AY7A 4J0FA 1N1EA 2EG9A 4QEDA 4GL4A 4GVXA 4WLFA 3DR3A 3NTQA 1F8FA 5T6BA 2ZKLA 1O89A 3PJGA 4OJNA 5JYDA 1P1FA 1VKOA 3O4RA 3UCXA 2WE7A 2OMEA 1B2LA 5TLSA 1BVUA 4L4SA 4CMKA 3PVZA 3ROQA 1H6CA 4CQMB 1UJMA 5CDTA 2C2XA 3V5NA 5LDHA 3WYCA 3WFIA 1DEHA 3HN7A 1M75A 1XDWA 4XYGA 5DBIA 3FBTA 5G4KA 3MOGA 4E3ZA 3GZ4A 2Z1MA 5L4NA 3DHNA 4CODB 3QRWA 2C07A 1OI7A 2DKNA 3VTFA 4GAEA 3ADOA 4D42A 3KYCA 1VLLA 1OFGA 1P1KA 1X13A 1LDGA 3E82A 4OOEA 2JKVA 4Q9NA 4O6VA 2VHZA 4L0QA 4AFNA 4BKOA 2ZYGA 3LLVA 1I3MA 2X0IA 3I4FA 3IDSA 4DYDA 2P4QA 3LU1A 1LDEA 2IYPA 1ENZA 5EMHA 1QLJA 2CZCA 4WLNA 3D3EA 3OEYA 4M89A 1Z6ZA 3LYLA 4P22A 2HU2A 3NKLA 4R4JA 3PWZA 2XOXA 2YFQA 3KRTA 4HADA 3E8XA 4IGEA 4B4VA 3I5MA 4F6LA 3K2BA 4OGWA 3T7EA 2Q99A 3H3JA 2DTXA 1LC3A 1HDCA 3H6KA 3QQPA 3DQPA 2D2IA 3PPIA 2BI7A 5COBA 3GHHA 3KSDO 1R37A 1ZW1A 2ZB3A 1P1HA 3R6DA 1LTHR 3SLKA 4YEDA 2HJRA 2HAEA 2NQTA 5EL0A 3RWBA 4E31A 3C3XA 3AOEC 4LCJA 8ADHA 2D3TA 1UP6A 1ZJZA 3M1AA 4WLUA 1CETA 1Y6JA 1J49A 3BMNB 1ZXBA 4DPKA 2VWPA 5T8KC 4A27A 4ZN6A 4HUJA 1GYQA 3GRPA 2CDAA 1T25A 4K6FA 3GDGA 2RIRA 1WW8A 3L9XA 2CFCA 4P4LA 5HWSA 5CFZA 1OAAA 1PZHA 1ZSNA 1JWAB 2D0IA 4RF2A 1HDYA 4L9RA 4XQCA 3FF4A 3RUHA 1EQ2A 1GYRA 1T2EA 2VZ9A 5BNFA 1HE2A 3DBRB 3GA0A 1E7RA 3K9QO 3OJ0A 4OSOA 4R1NA 5C3MA 1CQIA 1U5CA 3PIDA 2FR8A 3AFMA 4G2NA 2QRLA 3NAQA 1G0NA 4N5MA 2SCUA 4E21A 4N7RA 3DTTA 3NJ4A 4LSWA 4MJLA 1D3AA 4CM4B 1HT0A 1M76A 1UZNA 1YGYA 3P2OA 2WD7A 3ASUA 1BSVA 3E6AA 3AM4A 2J3KA 4IM7A 2DFDA 1FK8A 1LSUA 2HMVA 4HFJA 4C7JA 2ZTLA 3DZJA 3OBBA 4KUGA 3OA2A 4DLAA 1CWUA 3OIDA 4BNIA 2VRCD 1Q7CA 1IYZA 3DWFA 3S2FA 4BV9A 5JDIC 4NK5A 4TVOA 4M55A 4XQEA 5IJZA 2GSDA 2J3HA 2O3UA 3CEAA 3DO5A 4K28A 1GUFA 3WTBA 2P5UA 1BG6A 1BDMA 5EJ2A 4YJFA 4BB6A 1B8UA 1K6XA 3D7LA 5JCJD 2VZ0A 3OQ1A 2GN9A 2FSVA 2NVWA 4TQGA 1VRWA 2H63A 3ZZNA 3BHIA 1X1EA 3H3FA 3TZKA 3ADPA 3NJ8A 1PJ2A 1UAGA 3L07A 1JVBA 1ZMTA 1ENPA 1HDXA 1HZJA 3H2ZA 2AG8A 4BNWA 3D64A 4XWYA 1HYGA 3EVNA 5T57A 2CVOA 4BO6A 1LEHA 2YY7A 3PQFA 1T2CA 3INRA 2IEBA 1EUCA 4INAA 4FB5A 2GDZA 3QA9A 4FCCA 4PG4A 1DAPA 1XU9A 1ONPA 4QXMA 1MFPA 5I7FA 1QRRA 3LSYA 4Y6SA 2YDYA 3KB6A 3OJLA 4YQZA 4WJZA 5B12A 2W2LD 2BD0A 1DB3A 1I36A 3WYEA 2AE1A 5JYEA 1I5RA 1U8XX 2BKAA 4BGUA 3PI7A 1XA0A 1J5PA 1WAMA 1E3SA 2P68A 3BHJA 3D4NA 4PG6A 2EJVA 4FN4A 4PLHA 1PZGA 5EPOA 4DTIA 5CG1A 3IL2A 2HMWA 1CEQA 3OJFA 2HK8A 2EWMA 4CLHA 1TXGA 3ONDA 1HRDA 2AQ8A 3O8QA 3E1KA 4JP2A 4NFHA 2V6BA 4P4NA 2ZCUA 4GVLA 3QV1A 3X2EA 4BO7A 3WMWA 3NX4A 2B4RO 2VHVA 4J1QA 4J9VA 3GVCA 5G0WA 1YDEA 3PGJA 4CV1A 2E48A 4GWKA 4JJFA 3QVTA 2GUGA 2H5LA 3QP9A 4BMVA 1P1IA 3PHJA 4W99A 5EESA 3ZNNA 2B69A 1YVEI 5B1YA 3DBLA 3F4BA 1NQOA 1ORRA 4CQLA 3OP4A 2R2GA 3N58A 1DDOA 3WGZA 3CSDA 2GF2A 3FR7A 3PQDA 2G82A 1SO8A 4PZDA 3VC7A 1NWHA 2E4AA 1BRMA 2J3JA 3RFXA 2VZ8A 4MPDA 2EGGA 1TEHA 3PQEA 5A05A 1VL0A 1HKUA 1GADO 4NK4A 2GZ3A 1XQ1A 1YWGO 5FF9A 1N8KA 1XKQA 3JYOA 4E5YA 4AJ2A 2FR1A 3G79A 4WNIA 1M67A 3ZNOA 1IHYA 4RQUA 3HFGA 4I9HA 3ZWMA 4B4OA 3U62A 2VCYA 2AE2A 4FC6A 3ANNA 3F1KA 1W4ZA 1HZZA 3VDRA 4IXTA 2LDBA 3COSA 1LNQA 5BNIA 1VL6A 3WSVA 2W2KA 1KEVA 1Z82A 1VKNA 5DZSA 1PJLA 2HRZA 2X9GA 3I1JA 1UXIA 4F6CA 5IG2A 3RU7A 3SLGA 3ITDA 3ZWVA 4D45A 1LLCA 4U6SA 3ORFA 1GR0A 1DIGA 2PLAA 3D1LA 4XA8A 3LVFO 1FMCA 1S7CA 4R68A 4JJIA 3ZHBA 3F47A 3L4SO 4IS3A 5TGDA 1RKXA 1PQPA 3KETA 1TVEA 3DL2A 3EYWA 1A4UA 1GZ3A 1BW9A 3X2FA 1VJ1A 1DBVO 1D8AA 3IQDB 1E7SA 4TSKA 4U6QA 3RC9A 3QWFA 3KYBA 1PIWA 1YS4A 2BH9A 1PS0A 3VKVA 5KNLA 3I23A 2V7PA 4A5OA 2ZIZA 4UVIA 3OIFA 4EBFA 5DOZA 4BNUA 2PA3A 4I8XA 2PZMA 2X58A 4B3JA 1LX6A 3C7CB 2W4QA 3GEDA 3H7AA 1DIAA 3S2IA 2OGUA 3GG2A 3HDJA 3JQBA 3GVXA 1EMDA 3I9MA 1IHXA 1GEGA 1E5QA 4EJ0A 4D3SA 3F5QA 1GQ2A 3R1IA 4YJGA 4ROSA 1N7GA 1X14A 3E18A 4Y98A 4E0BA 4YXFA 4MIOA 5IXSA 3BMQA 3HZZA 4CLEA 5TX7A 1DPGA 1KVTA 2QIOA 4RLHA 1GDHA 3DHYA 4NR0A 4WCFA 1J4AA 3JSAA 4G65A 2X6TA 1YRLA 3S2GA 1KEUA 2D59A 3TZQA 2IDZA 3TWOA 5AYVA 2RH4A 3G1TA 3DAGA 4Y67A 1LLUA 3WS7A 2PTGA 5G0UA 2VT2A 3BXXA 1ARZA 4DQXA 1U2GA 1ZKMA 4KQXA 2DT5A 2GR9A 2YYYA 3EAGA 3PWSA 1AE1A 1E1NA 4O5OA 3TOXA 1I8TA 2GASA 3FTNA 5TF4A 3GZNA 4G81A 2OP0A 4NDNE 1KIFA 2OO5A 2CUKA 4NBRA 2A92A 4FR5A 4R1UA 3TZCA 2Q2WA 4C4OA 1NAHA 5CP8A 5C7OO 1P1JA 2TMDA 3GHYA 1R12A 4NFSA 3WQQA 1NVMB 3NDRA 4UUPA 4JBIA 1L1FA 3K31A 5G2OA 1P1RA 3W1VA 1ZK3A 1ISGA 3CKYA 1DHRA 4RGBA 3D4PA 3B20A 5CDUA 3Q0EA 2VTEA 3I83A 4QX6A 1PJ3A 3W4JA 4EW6A 1GQYA 1ZCJA 3JQFC 1R66A 2OL4A 5AXAA 4XIJA 2WD7B 1O94A 3WLFA 4CQMA 4OOFA 4RPHA 4BO5A 3NT2A 3VPHA 2Q45A 3EW7A 1PJCA 1P0CA 4IMPA 2E6UX 4CMEC 3G0OA 2JFHA 2RHCA 1OOEA 4QFCA 5IZCA 2CNBA 1T24A 3WFJA 5L4LA 2Q3EA 2UAGA 3ZNQA 1SNYA 3C1TA 3V1TC 3F3SA 1KY5A 4PG8A 2JD0A 3IMFA 3ZWNA 1ZO8A 3GFGA 5L7TA 4Y8VA 4YJFB 5DOVA 2GYYA 3G17A 4B7XA 4RPJA 1G0OA 1P9LA 2EKQA 1FDWA 2Q4EA 3QWAA 4RORA 2VRBA 4BNYA 4CR8A 2B83A 3P19A 3HJAA 4DIFA 3RSHA 3WGOA 4WASA 2B4QA 1LBEA 4GGOA 1V3TA 4J90A 4MVJG 1TLTA 3JYNA 1YQDA 1OBFO 4LMRA 2CVZA 4I5FA 3GRKA 3RUEA 2UUOA 1PX0A 1BXKA 3L6EA 5B4TA 2DUUA 4XQGA 3W4IA 4Z3DA 1U3UA 4E5MA 2BRUA 2FRDA 5H81A 1OZAA 3GVIA 2BLLA 3IJPA 4OAQA 4BNHA 1Z73A 5HBRA 4DC1A 2RHRA 4GKVA 4AJHA 3GDOA 4F46A 4KUEA 2EXXA 1A9YA 1EUDA 1EVYA 4BNFA 3EY4A 3TDKA 4YRAA 3DZHA 4IIUA 3IKTA 4ZU3A 3DDNA 1AGNA 3KO8A 4Y6RA 1GU7A 3BMNA 4YBZA 1FDVA 1E1LA 2B0JA 2YQ4A 4IPTA 1Y8QA 4JBGA 2YW9A 1PL6A 2YZ7A 1UH5A 4J6FA 3I9NA 1F06A 1B16A 4GI2A 1JAXA 1XCBA 4YJDA 2C7GA 2JAHA 5TC4A 3I3OA 3OH8A 4ND5A 4II3A 2VUSA 1HLPA 2IXBA 4AVYA 4J7XA 4LCEA 1GZ6A 5KKAA 2PH5A 3TN7A 4RPKA 3VH3A 3OMLA 2E37A 1KBZA 1X0VA 4ALIA 3P5SA 2ZQZA 4Z6KA 5A3JA 3DBRA 4J7UA 4OM8A 1I2BA 3LC7O 3HQ4O 2OZPA 3JQ8B 4HFRA 4ND1A 1DXYA 3OSUA 3ENKA 3PLNA 2OBNA 4ZQFA 1HEUA 3DBLB 4FFLA 1AUPA 1HYHA 1NAIA 4CM4A 5LC1A 2H6EA 1PQUA 3WBFA 4DWVA 1EVJA 5A9SA 2JCXA 2G76A 4E5KA 2X23A 1UDAA 2WEKA 1RPNA 2WWRA 2C59A 3L4BA 4MP8A 3TRIA 2ZATA 4TROA 3Q9UA 1E7WA 3PDUA 4I1IA 3U5TA 3EUWA 2PKQP 4U0JA 1IUKA 4LVCA 4AJIA 3MZ0A 1H2BA 1U3TA 4A73A 1NFFA 4BO8A 5L9AA 1JDJA 1K6IA 1CYDA 3PP8A 2CDBA 4GMGA 3OJEA 4IMRA 1JWBB 4H3VA 4J1TA 1IZ9A 2O48X 4NU5A 4IUYA 4R01A 4BNGA 5A02A 3MOIA 5EQDA 5JO0A 3ANLA 5BQFA 5IN5A 4J43A 1KYQA 3VPGA 3ZU5A 3MJ4A 2B36A 2EHDA 2IXAA 2V6MA 3UF0A 3KSZO 5COQA 3D3WB 4NI5A 4IZIA 4DPLA 2CVQA 2VNAA 5TJ9A 5TNXA 2VYVD 3OJOA 2AEFA 2WE8A 2G5CA 4TRMA 3NT5A 4XYBA 3R3SA 2VN8A 3RQSA 3AJRA 4IDGA 4R5HA 4HFNA 4YB8A 2Y1DA 5JY6A 3MJCA 4J1SA 5A9TA 1WWKA 4A0SA 1LXCA 4CV3A 2NTVA 3ABIA 4TRJA 1AHIA 4W9NA 3JQDA 4E13A 5IF3A 4FDAA 1ONNA 1I2CA 1M6HA 2VQ3A 3GT0A 3IOYA 1YB1A 5DF1A
chains in the Genus database with same CATH superfamily
3Q1KA 4KB5A 1GAXA 2E4ZA 2OXCA 3VJKA 1A3CA 1E1DA 2ZJBA 2GNAA 1J0AA 1AURA 3QXCA 3ULKA 3OZXA 1OC2A 1GHTA 3VZSA 1WXDA 1R64A 1RJFA 1TPYA 2AOUB 2ETVA 2IY7A 3UKOA 4TMVA 1AF7A 2QVLA 1YRBA 2ADMA 3K15A 4JVSB 3RIYA 5L7WA 5JI2E 4RDHA 4WXHA 2REBA 2Q6VA 3UK1A 1KRWA 3FNGA 2L42A 4BJ6A 2AOVA 1EBBA 1W5AA 4YCLA 2OT3B 1JG4A 3DEZA 4G37A 2R0QC 1ULUA 3KR9A 4NWIA 3UEOA 1OIWA 3SZ3A 5J5AA 3FYSA 3GD5A 2ZM5A 4WCFB 3C6YA 4XR4A 5SY9A 4EITA 4EJSA 1E2PA 2OCYC 1GP2A 1SB9A 2R1ZA 3LC1O 3JWHA 4LHVA 5FKJA 4IH1A 1ID1A 5LYYA 2EYUA 2DBVO 4TL8A 1JEYB 1MORA 2M6KA 1HLGA 3PCRB 4M86A 4CL3A 1CZOA 3GA5A 2DGDA 4XD7D 2WQ6A 5DULA 4CKWA 1H4TA 1SOAA 4NOLA 1KZGB 3FPCA 5IJ9A 3KQHA 2O2IA 5TPWB 2ENUA 2XRYA 4HWPA 5AJHA 4AP5A 2RBEA 2BE7A 3F74A 1S8OA 3J7TA 5HE8A 2ZIEA 3RUCA 4PS1A 3JQRA 4H7IA 4RZIA 1DINA 5TJHA 2OC4A 3PRJA 1KAEA 1NL3A 5T4FA 4HNAA 1NSYA 4JK3A 1N6HA 4OK3A 1Y8CA 1J39A 3HU1A 2FPPA 1Z0UA 4MYHA 3WP0A 4TQ9A 2ZUWA 4P1ZA 5J3JA 2YHUA 4RCYA 4H16A 4EA6A 3STHA 2Q8PA 3TIFA 5LMCA 3LUHA 1NMSA 2C5HA 1Z4JA 3ABSB 5KPJA 1X80A 2FKNA 2G07A 1SG9A 3GJ3A 2DRIA 2O9JA 2XLCA 4G56A 4EKNB 5JE8A 1XAJA 5DI3A 5DLDA 4TKZA 4YMUA 2V59A 1EHCA 3PIRA 2QZJA 2O8CB 5AH0A 1GNQA 1YAJA 3MF4A 2HSGA 4QICA 2IUTA 3RCBA 1HPLA 3F5MA 1L4LA 3R0JA 3TPCA 4EX6A 4PZLA 4Q37A 1T0JB 5LQMA 3ZZMA 1TFRA 3IKVA 3UMSA 2XITA 3FNFA 3OWOA 4DUGD 5KOHA 3THWA 4ENSA 4ZKEA 3D7SA 5CURA 3K53A 4S12A 3PDWA 2ANBA 3TKLA 2HCJB 3EFOB 4BJ1A 4GXRA 1CQWA 4BBZA 3G1UA 1ESZA 3L41A 1C3XA 3MMSA 4GI1A 3MYYA 4IFTA 4NOKA 3M3HA 2C0CA 3CZ5A 3EJ6A 3HEMA 4Y2VA 4WIAA 1JWLA 5LQNA 4NCNA 2HJGA 2D5CA 3ZDRA 3FKSD 3D0QA 4JV5B 3TMAA 3B6ZA 2VP4A 4YMTA 3N0WA 1FVOA 4UHKA 2YIDA 1OFHA 1REQB 1Z17A 2GJ9A 3CFYA 4J9UE 3NO4A 4QWMA 3TW8B 3P4UA 1AXRA 1NBAA 2O2ZA 1BTOA 4WTOA 1RXWA 3WGGA 3PHLA 2WIKA 1XP5A 2J7KA 5GGYA 2HU5A 2VOEA 3AEKA 4G97A 3VA7A 4PR0A 4JI4B 4OQZA 4WZAE 2FUEA 4I50A 4X7MA 2FR8C 3I58A 3W1WA 1O94D 1NPYA 1ADGA 3LT2A 4D0GA 3QVGA 3WKAA 4EHAA 4F84A 2ORWA 2CDNA 3AFNA 2W58A 3N0TA 5BW5A 2PO5A 3V4VB 1PU2A 1M5RA 2ZYWX 3ILHA 1IBRA 5CVVA 5HKKD 1JSRA 4KXQA 3FY4A 3T3HA 5J23A 1CY8A 3DTVD 1N1GA 4KGXA 1MW8X 3TRKA 1HNWB 3FXAA 4D0LB 4JJ7A 1C1YA 1L5FA 1HLDA 3AV3A 4YJHA 3WB0A 3IAAA 2XX3A 5AW9A 2ZIWB 3DPIA 4LWPA 4FMDF 4H4CA 3AUTA 4F2PA 2QQFA 1P7VA 3PC4A 2C8KA 1G6OA 2GBPA 2RC5A 2WU3A 3ND7A 3LCRA 2JIPA 2ORVA 1KK1A 1ZOOA 3V7FA 1BRTA 4NV1A 3U4CA 4EKGA 1VHWA 5FJJA 2H1OA 1JXMA 1L5YA 3ODGA 2P6RA 3D8NA 2IS2A 4C5CA 1E89A 1Q12A 5L53A 5TGZA 3MG9A 3TUZC 3C39A 5D5HA 2ZULA 4JLSA 1ODTC 1LC0A 1HTWA 2WF5A 2ENWA 3NXKA 1ZA2A 4NNJA 3NDBB 1QDEA 2VTBA 5DM0A 3GDWA 4XWWA 3G0HA 3BERA 4L9AA 3SQWA 2JA2A 1VJ0A 2ZBVA 4MPPA 3TZHA 2I80A 3WIEA 1JG2A 4YRKA 3OE1A 2ZYSA 2AKEA 3IB6A 4P8RA 4WZ6A 3WJ7A 1RXVA 4LVUA 2O3SA 1ZCAA 4XPZA 4IG9A 3QYFA 4M0LA 1DTWA 4CUZA 3MFQA 2DE0X 3IKMB 1A5AB 4D9BA 1SD5A 2B1RA 3LP8A 3LQ4A 3F96A 1F4PA 3PCTA 2JBHA 5C9ZA 2ZUEA 1Z16A 1YDHA 2FI1A 2PZJA 3N9IA 1BXZA 2NYUA 4KZKA 1ICEA 3CUSA 3F4LA 2FZCA 3I2IA 2C8JA 3LDFA 2C5SA 2PK3A 2PSHA 1V1RA 4REQB 4WXMA 4BV3A 2Y1FA 1TW2A 2GUWA 4NZMA 5EZYB 4F72A 4QUAA 3ZHXA 3HCCA 2QJFA 3CH7A 1Y1QA 3MCVA 4UTVA 8ATCA 4DF3A 1DFIA 2NUAB 1EVZA 4R54A 1C0LA 3ZCVA 1X7WB 4HSGA 3CPEA 1JQLB 4KN5A 2FPWA 1DKNA 3ASVA 1STOA 2NUPA 3BRCA 4NS4A 1G8PA 2QRMA 3DULA 3Q7QA 4WEQA 4NHEA 3G0BA 3ZXSA 2NUBA 4LYFA 5JVDB 1L4MA 2ZBUA 2O3RA 2NVBA 3D7MA 4HEA1 4PC7A 1H2FA 1ZK2A 4LV5B 4NABA 4P31A 4U6NA 1Z0ZA 3EIXA 2PZGA 4DY6A 4FCTA 3RU3A 1VIMA 3UXYA 1XNQB 2AXEA 3QPAA 2EZ9A 3P0JA 1H1LB 5DDIP 1OX5A 3ZK7A 1QU2A 2Q6KA 2BFFA 1P75A 2Q4BA 1YZVA 1GPMA 3I2GA 3Q0TA 3WVNA 3A3NA 3PCXA 1F1JA 5J47A 1OR8A 1GZ4A 1KHTA 3WJ1A 4JKYA 1LZLA 3GR6A 5DK6A 1XMQB 3V34A 1FUIA 4QYIA 5BOVA 3OOEA 4TTAA 3EDOA 2C42A 2G5TA 4Y1RB 1UBMS 1FP4B 2QUBA 1DXQA 1EXMA 1VJGA 3PXGA 5TDHA 1VCOA 2JASA 5GAJA 5T8KA 3C1OA 4NE7A 3UWOA 1V25A 1JJBA 2SHKA 5GY7A 5GPBA 1UBKS 2CXXA 3K1AB 1CDZA 3VR2A 3UMJA 5LZ8A 2P4UA 3GT7A 4EUSA 3LXXA 4MHTA 1WBBA 1IUNA 2BKEA 2ZUTA 3R6TA 2E21A 3E5RA 3AERB 3C5HA 4G5QA 4JLKA 5JPCA 3I34X 2ZJ7A 4GOMD 3QUBA 3CN9A 5FPHA 1KE2A 4DGQA 4C07A 3ZR4B 3ER6A 4LRTB 5FPSA 1YR6A 2VC2B 3RSGA 4B6PA 1HZZC 1N7HA 3R74A 3Q85A 4M8KA 3FBWA 4DMLA 3U19A 4JQSA 4Z86A 3P9PA 1WCYA 3CUYA 1XZJA 4YRBA 1JBQA 1QVVA 3T9DA 5CT4A 5ED0A 1L7PA 3MFYA 3V9PA 2OE2A 4GX5A 3T4EA 4D9NA 1H2AS 1KARA 3IP6A 3W2EA 2AQHA 4UOEA 2CUNA 2FWIA 3BULA 1OBOA 1R0WA 3OX4A 4ZANA 2O0LA 4KPUA 2P6OA 5AW0A 4OQXA 2C54A 5KKNB 2FB9A 3D8HA 4C0QC 3PEFA 3B36A 1OGYA 3L40A 2DCUA 1XQVA 3UK2A 4QJ3A 2H5JA 2NO6A 2LXNA 2HDWA 5D51S 1W52X 1QV6A 2ZBRA 1NQUA 5EWJA 3NH9A 3F46A 1FRVA 3LDAA 1T5TA 1A1VA 5HUHA 2D1FA 3B1KA 4IEIA 3ENZA 3IOMA 2IU4A 3H2SA 1HK7A 1SUCA 1DLJA 3PNPA 1IHOA 1JX6A 2WVAA 2ZIUB 1BGWA 3B1VA 2ZYRA 5I9MA 4A7PA 4CKWB 3SC2A 1B26A 4LVNA 5L3VA 1KYTA 3DB2A 4EZBA 4DBLE 1WVIA 4CCWA 2QMZA 4FHZA 3W8EA 1D6JA 1E2QA 3VQTA 5BURA 4EPRA 1BA2A 1LLFA 5KNCA 1YZLA 3C5EA 4AMUA 4DCVA 4UJ3A 2E4XA 2P9QA 4RESA 5E4TA 3VXKA 4BNZA 3S8YA 4JLWA 5SYMA 1QPZA 4DNFA 2QTNA 1JU3A 4DIDA 1IBKB 2XE7A 4RXTA 4NZYA 2XVMA 1GT91 4EYEA 3GT4A 2P4SA 3NW9A 3P9IA 2FPPB 4H0CA 5DGTA 1JIIA 1JMVA 2DFKB 2IDJA 3D6AA 4PLPA 3L06A 1PTJA 2DB3A 3RHFA 1ECGA 3OZCA 1A7AA 1IEXA 1RQXA 3QY0A 3R4CA 4JUCA 4RIHA 3DC2A 3T4UA 1X0XA 4EY5A 5CB6A 4BFYA 2GA8A 2GM5A 1QTQA 2H1LA 3BDAA 5K8CA 2FHSA 2VUHB 3R9XB 1VHQA 3AX6A 1PLLA 4RZSA 4QODA 4UNSA 3BTUA 1S3IA 1QR6A 1U7HA 4KC0A 5DIZA 3U7IA 4OVKA 1ZMXA 3O1JC 3D3KA 2CDCA 2QDKA 2RGGA 3PGLA 1A8QA 1FVFA 2GS9A 2KPOA 1KZYC 3JQ7B 1CQJB 5I7AA 3VTAA 4QQFA 4RU1A 3FA2A 4B9EA 2VNSA 3GJQA 3OQPA 3PA8A 3THWB 2VF8A 5IM4F 4US2R 4CHGA 1U2GC 1VE1A 3V2UA 1A71A 4KR7A 3QBDA 2PD3A 4ID9A 4NBTA 4U63A 3NM5A 2VA8A 1U7PA 2WF8A 3AL3A 4IQ4A 3K70C 1WCIB 4E03A 3PNVA 3CLUD 1QS0A 4XH9B 5CYOA 5K6AC 5KC9A 1ZYUA 1JDTA 4N41A 3NEYA 1Z37A 3EQ2A 2XECA 1N5JA 1YUBA 3GEGA 1DEXA 4MUGA 3RODA 3S2YA 1Y4SA 4NJMB 2G1JA 2XB4A 2OCAA 2LR0A 4G0WA 3KEQA 1DS6A 4DQ0A 3RRFA 5J43A 1Y89A 2AB0A 1CJCA 1SXHA 1WDMA 4Y18A 1NN1A 2GCOA 3E5NA 2O1EA 1FBNA 1WF6A 3AEKB 4ZC8A 1WR8A 3L43A 3UV3A 1FTSA 3BXFA 3FZYA 1P6UA 3IO3A 3UTDA 4EWLA 3U4MA 4F2WA 2ZE6A 2V5AA 5EERA 1AIPA 3EK2A 4QOIA 5C4GB 3SLRA 4CCAA 4AO7A 2JGMA 4ZAYA 1GCUA 1DIOB 1GFSA 1OLXB 4M1EA 4OSPA 5AVUA 1ZR2A 1RJEA 2RGRA 1Z5VA 2O1XA 1O97C 4ETMA 5BT8A 3K72B 2ZAIA 3PUVA 1ZWKA 1R4NA 3VR5A 3E9CA 3ENQA 4YJHB 5BV0A 1DJLA 1JFLA 4C88A 4EMSA 2UYYA 2BMEA 2BTOA 3TW6A 2J0EA 3SSOA 4XIGS 4NMHA 3HR8A 5KNDD 4WJKB 2P9CA 2PUEA 1GTJ1 3CVXA 3TW0A 3FOAA 1ZK0A 1TM3E 4M0KA 3TQHA 5M34A 3PQCA 3MJEA 1VHDA 3Q7SA 5AOCA 1V8OA 4R9RA 4LMPA 4PQGA 3KPWA 2PJZA 4EPXA 1RWXA 4IL5A 4CTOA 2G17A 4L0MA 3ILYA 4AJPA 2H65A 1CY7A 3CKMA 4PZAA 1S2DA 2VTBB 2OMKA 4MEJA 3KFVA 3EZFA 4GBED 3K0FA 2PMDA 2FDCA 1ODCA 1HWYA 3DKIA 1AKUA 4WMLA 4X6LA 5HF6A 3PTLA 5ADUS 2PXCA 4OGFA 2PLNA 4K9DA 1ML4A 4A4DA 4UM8B 4UBNA 1N75A 3TSCA 3A6PC 2R00A 5M2QA 2BAGA 2R1TA 1OFIA 1NVKA 3VR1A 2J8ZA 3PNYA 2SICE 4FLMA 4DANA 5EP2A 1DTWB 2WLSA 4GR9A 1QHEA 1EG7A 1QOQB 1NI4A 4US0R 4UXJA 5CH5A 4HGOA 4RXMA 4MVXA 4PE5B 1OPXA 2Y1EA 3EC1A 3SQOA 3JY6A 4UU7A 1W75A 1Y8AA 4LQ4A 2I2DA 4OA5A 5EHNA 4YT2A 3FW1A 1Z39A 3UJ8A 2OGSA 2R5NA 1K7EB 3SJZA 1KWGA 3MJSA 1V1RB 1YE8A 4PZEA 3AKZA 2ZRFA 3KJXA 5LP6C 3TNLA 2OQIA 1OXVA 1WCWA 4PX3A 3S1LA 4G24A 3CMCO 1GKKA 1F17A 3W05A 2G8NA 2X4DA 2ZIXA 5AHRA 4C76A 1JIVA 2JJQA 4ND2A 3DDOA 4U0KA 3A3KA 2A3RA 4K03A 4RD4A 3WMXA 5KVVA 4DDTA 2CSUA 3ORSA 1M8FA 1UDWA 5JCPA 4FI3C 1Z6XA 1LJ8A 3HJGA 3CINA 3UAZA 3OLWA 1UPTA 1XEAA 1RXIA 2PGOA 3D2BA 3AKYA 4I1UA 5HJ7A 3GCZA 2ATIA 4CTKA 5CK4A 1MRNA 3K2EA 4H17A 4YLEA 2AK2A 2BFFB 5JPIA 2XVZA 5BV7A 1GSAA 1E66A 1E96A 2F00A 2FPXA 4CDNA 3SDBA 5K3SA 2PS0A 2O0JA 4TLEA 2YOGA 4IMJB 2VTDA 3C14C 3MTGA 4IDAA 4EO9A 4ZJYA 2PYIA 3DEHA 4MI9A 3RVKA 1AU9A 1TTTA 3TRDA 4QYIB 4NMWA 1Y9AA 3RJTA 4JOCA 1J00A 3LLUA 2JDID 4RDIA 3MTDA 3FCSB 1GKIA 2AZTA 3BORA 2CXTA 2D5LA 1MA3A 4R9SA 1UPCA 3DL0A 3T6KA 1N5IA 2VQFB 13PKA 2ATCA 3FLMA 3QOFA 1ELOA 2VPTA 2FOIA 3U31A 4R2IA 3HBFA 4IFEA 3AOGA 1HFJA 3NI2A 3R0XA 4QGSA 1E63A 5DCUA 1XRJA 5C52B 3FAZA 2O07A 2O5CA 4RH1A 3RBVA 3G2JA 5CJPA 4F91B 1OBVA 4B3DA 1V8PA 2BTQB 2YWRA 5KTMA 3DOFA 5KEIA 1Q3HA 2C5LA 2WLTA 2Y27A 3UJ7A 1W44A 4ITUA 5GJVC 4C89A 1D1TA 4IWYA 4E30A 1CR2A 1R8QA 2K6GA 5DT2A 3RJ5A 2AN1A 1KPIA 5FQOA 2PEYA 4BNMA 4Z0HO 1Y6GA 2QG6A 1IIBA 3I61A 1OWLA 1NVGA 2WFZA 1LLQA 4FR2A 5H3HA 4DRZA 2CB9A 3WHKA 2MYPA 2C7RA 3IEKA 3GFOA 2C29D 3JQFA 4IVQA 4C7VA 3R77A 4ESEA 3RI3A 2O7SA 4DQUA 5JNUA 3W90A 3HACA 3VPFA 1SCUA 1DQPA 2NU9A 5BVGA 3PNQA 2JJYA 4YRIA 1S0UA 2PR7A 4FYIA 1SC6A 3FN4A 2VQ6A 2PS9A 4XLLA 3REOA 2PBLA 3VH1A 2X15A 4AWBA 1RQ7A 1XTBA 2Z5GA 2ZAMA 1TQ8A 2I6TA 2QYHA 4CIWA 1JR4A 4CEJB 3OJWA 4MGYR 2YS7A 2CHEA 4CHTA 3H3XA 4BQIA 3DBHA 4BQSA 4MCHA 4XB6B 1ADCA 1NF3A 4KMSA 3LT5A 2E4YA 1V8ZA 2I03A 2J33A 2A9JA 1X1CA 4NTZA 3UFXA 3I5YA 3DXYA 3N6RA 4OUDA 5EKSA 1ZKDA 2XIJA 1J9EA 3T9BA 3UJPA 3LPAA 1OPRA 5AHXA 4EMTA 4PXAA 1A9PA 1UEJA 2X22A 1E94E 3UFBA 2BL4A 3F6EX 1ZBQA 4JA2A 2XGSA 4ILKA 4CUJA 4AROA 2EQAA 2NYVA 3DJYA 1J0EA 3KKPA 2GHQA 3KAJA 4NZOA 4QNNA 1FFWA 2GARA 4S24A 1ZSYA 2D2FA 3GQBA 1QTIA 3P2YA 1FJHA 2WUGA 5ARBA 3K1YA 2HA0A 4UULA 2XCRB 1ISFA 1AOXA 1P5JA 3DYVA 3MILA 5D1NA 5DCYA 5J1TB 3RC2A 1N7JA 3ZBUA 2P4EA 3UUEA 4MYDA 4TXLA 4XYLA 1FXWA 5TMPA 1KH3A 2O2HA 5B3LA 4IFIA 2GOYA 2UZIR 1HM5A 2RARA 3KKOA 1X1DA 3ZE0B 1I3LA 3MJHA 3ORQA 2EIXA 1K63A 1A5SB 2EVWX 2JW5A 2XXJA 3L49A 1BAPA 3PR3A 4JCOA 2ZT7A 3V8QA 3A4MA 1ESDA 4OI1A 4TLLB 1EFRD 1YE3A 4HNGA 3IB3A 4EG4A 1XNRB 2NNLD 1V5EA 3BGWA 2RJ3A 5JZOA 2XTMA 2VO1A 2HU7A 4POAA 4I8IA 3KZMA 5AM5A 4PAOA 2VP2A 4B6RA 2CL6X 3K09C 3CYFA 2EWVA 5F3DA 3RUAA 5J5CA 2BLNA 4M54A 3IUBA 2Q0XA 1PHRA 3NWEA 2CW5A 1P4AA 4OQEA 4HXYA 2VJMB 5LXTB 4Z1OA 3TMYA 1F2DA 1K8XB 2AN5A 4TYYA 1C7IA 2CBXA 1NFRA 2RMKA 1J7KA 2O8BB 4O4HF 3AT1A 3H04A 5C5CA 4KGZA 1SAYA 2X0NA 4HDCA 5C35A 3DYBA 1BVHA 4ZHSA 4NL4H 2Y0DA 5C1DA 4FJ1A 2BISA 3ND6A 1KTIA 2ZSEA 3CO0S 2YJTD 3FFAA 1NSFA 1WKCA 1B8OA 1DU4A 1WKBA 4MZDA 3WHIA 3Q15C 4H7DA 4UUQA 2OCLA 1IAQA 4JOSA 4Q3CA 5AICA 5H68A 4CKXA 1SD1A 4TTQA 4XDYA 4AF8A 2ZJ1A 2E5LB 3F5SA 4LSMA 1T8SA 3GAZA 4HX9A 1AN0A 3TQSA 4MDYA 1UC8A 4QJ4A 3B8EA 2GPTA 3QBJA 1NQ5A 4P2BA 3EG9A 3D4OA 1X1RA 2XUGA 4ITVA 3TBFA 1T35A 4CM6A 5IWAB 1ODJA 1ZX1A 3JR7A 1RBMA 3IV6A 4QOHA 5A0FA 4C0HA 2HZ7A 1IQPA 4TKUA 3HJCA 5HKAA 1XBTA 4ZC1A 1C0PA 1VA4A 3JZIA 3K8OE 4EHDA 4L5JA 3WGHA 1XLTC 2PWZA 3A8TA 1JMKC 4XVCA 1QYIA 1R4NB 2G25A 3RQIA 1S96A 2AJLI 3E3AA 2ON6A 3FUWA 2WD8A 2DY0A 1QK4A 3R5XA 5DASA 4F3NA 1KSJA 1NT2A 2A5JA 3D54D 3I6IA 4MO2A 3T7RA 1JILA 1V16A 5KDLA 1NYTA 2UKDA 2G3YA 3KFXA 5DM70 1ISHA 3CPJB 1VE9A 1U98A 4ZT3A 3MK31 1NXQA 3HTXA 3S4YA 1I14A 2IGTA 1KSFX 2QAJA 3UAGA 4EGAA 3GEMA 3OFVA 1E1QA 2HFKA 1NP6A 4GKAA 4QO7A 4RHYA 4K9KA 4NOJA 5HCNA 4BFTA 3IA2A 3UUWA 3M1IA 3BG5A 4K6GA 4ZOQI 4G1EB 2O7NA 5IKOA 1IXYA 1XLUA 2VSXA 121PA 3EMKA 4PLWA 3EGEA 3H4MA 2PKCA 4D96A 2J9YB 2ZTUA 3L92A 1SVIA 1EAYA 2IC5A 2XWJI 1OFUA 4OV6B 4WI1A 1NPTO 2C7PA 5BOSB 2BEJA 4QBTA 1X9HA 4KITB 5K6RA 2LIVA 2Y0PA 1QAQA 2FPGA 2XUDA 1P44A 2GD1O 1U2PA 2QL7A 2R1TB 1FRQA 3INYA 4KQFA 3SS8A 4C78A 5F77A 3WISA 1FNMA 2L69A 3U81A 2IH5A 3QTTA 4RZHA 2G80A 2PX0A 1HQKA 1NI4B 3G0IA 3WWPA 3VYUB 2G0TA 1X39A 4YWJA 1W7AA 1QSGA 3BJMA 5F9MA 4G5XA 1QPGA 3AEQA 3BILA 3CF6R 2WJGA 4WZAB 3VPDA 1KVRA 3KELA 5CIWA 2V7XA 1JB9A 3QVJA 1T15A 2AS0A 1Z88A 1NJ5A 1ZESA 2HJWA 5A5GA 5KKCA 4DA8A 2UUAB 1MQSA 4LOHA 2CLSA 2WNSA 3TLBA 3M89A 2VLIA 1VXRA 1C30A 4C1NA 2PT9A 1NE2A 4DR3B 4B8YA 1Q0RA 3A6HA 4R0MA 1IEVA 4H18A 4RHEA 1SKMA 1L5GB 4AJ1A 3WG9A 2R65A 1M6WA 1UXJA 2I66A 2HF9A 3ZQ4A 4A8JA 2IIQA 1KU6A 4DKXA 3UMRA 1FNBA 2IOYA 1TZJA 1F6BA 1GTG1 3W5AA 5IS2A 4QUKA 1Q0ZA 2VH1A 2O05A 2PSFA 4H7JA 2VSOA 4C4XA 5JHHB 1W4BA 3N7UA 1Z5ZA 1YBMA 1GZDA 3STTA 3CNLA 3DV0B 3ZCPA 4CF4A 3WB9A 4F3CA 4YASA 3G6KA 1XPOA 4EVRA 3FPFA 2I4MA 4LNAA 1XN4A 2HREA 2PX6A 2CB0A 3H99A 4Q15A 5G3ZA 4TVKA 4PF1A 2IUEA 4HRYA 1K86A 3EPJA 2BFOA 1OFTA 2ID7A 5D84A 4HXGA 2PD4A 5HK9A 2JJ2D 2QM3A 2QSYA 3RC1A 3ZGLA 2P41A 4OD0A 3U49A 3GFFA 3M9XA 1MO6A 3OURA 3F49S 4MRNA 1JFFA 4TUYA 4C6TA 1EQUA 2VAPA 4MP3A 3UHOA 1BFDA 5ALMA 1R6AA 2P6UA 2G9NA 4C7XA 5EIFA 3HVJA 1DIBA 1JUDA 3P94A 5JZSA 3GJXC 4BOYA 3B1JA 1WMAA 1J24A 1RQNA 4FBLA 4K1LA 3B8HA 2JFNA 5FV7A 5DHQA 2VDLB 1WY7A 1WDLA 4JGBA 1E6UA 1FS4A 2GGSA 2YOFA 2WMDA 1Y7PA 5EKXA 3ROXA 3TLCA 4K0RA 3AJAA 3UXMA 1SBIA 4HWSA 2Q46A 4NP6A 1R5BA 2ZRLA 1RPTA 4ANFA 2PBFA 5HCUA 3QM1A 4GLJA 1WW3A 1XMJA 2XQIA 2BI4A 3JAKB 3WOHA 4AG3A 4KXNA 3TLJA 4KYIB 2MINA 1SCUB 1TECE 1P7WA 3PS9A 3CIFA 3A9VA 1WCV1 2HEGA 1CEYA 2C94A 1OHHA 1OU4A 4EG0A 1K7XB 2OR3A 4PGGA 4WN9A 1FSSA 5AKEA 1E4EA 1G16A 1J0CA 4ON9A 1ZOPA 1ZM9A 3ZQJA 5M7EA 1DKPA 3I9V6 5EHZA 4QM6A 5A4JA 2VSFA 1A8PA 1GG5A 5AXDA 2A9QA 2EKPA 1C1XB 1HDZA 3BTSA 1TU0A 3M9LA 2XMZA 3DBHB 3PUXA 4ER0A 3WGLA 2D06A 2AD5A 2O0MA 4EA8A 3FB4A 3QJYA 4MTLA 4PHGA 4QYSA 3VR3A 1O5IA 2WAXA 1EBFA 1PLJA 5KDOA 4FFMA 4OUDB 1JVNA 5EUQB 4B3IA 4BBAA 3A6EA 2RB5A 5ALIA 1XEXB 2WUDA 3P9YA 4RTSA 4R6XA 2HHAA 3DF7A 4P7GA 4P98A 3RM3A 1YZGA 2ZRNA 1RAFA 4LOKA 2P3OA 1WETA 1Q7BA 2BSXA 5LA6F 5ADHA 1RJWA 2JFVA 2OHJA 4QXQA 1TT5A 4PZ9A 3HLYA 4Z9XA 5DNCA 1WDKA 3DZDA 3ESQA 3GQBB 1GJRA 2PZ8A 4B3CA 4BTEA 2K7ZA 4I36A 1S2MA 5BYAA 1QFMA 4P08A 1DO2A 2ILVA 3C8HA 1RWVA 4TKVA 1O9BA 1ZK4A 1LVGA 3JQAD 4B44A 4MCIA 5HF5A 4CE6A 2F3SA 5HR5A 5KSYA 5KOYA 1RFGE 2VR1A 4LXXA 1XK6A 3C74A 2O20A 2DWUA 4U5QA 4YRJA 1YB6A 5GJBA 3L7JA 1UBJS 1PGQA 1BU5A 1GVHA 1TU3A 2R8PA 4K8OA 2FP4A 2VDJA 1G4HA 2DFVA 4P4SA 3QVWA 3FKQA 5TMDA 4AWXA 1DSSG 1YBFA 2ROQA 3IAS6 1U3VA 3IEXA 4BNNA 3FCEA 5BSWA 1EINA 1FQJA 2IYEA 3O9MA 3OTIA 1LU9A 3BF8A 4L5AA 1I01A 2VT3A 3AOEA 4R2KA 5TIIA 2V9PA 3C6QA 1JKXA 4NYMR 1U99A 4INJA 2ZWVA 1KDZA 1UKZA 5LQUA 4INOA 1RM0A 4L28A 4GX1A 3B3JA 2EW1A 3ROZA 4N8EA 5ALRA 3KDPA 2A57A 4NDZA 5HG0A 1CERA 1E92A 5JH7A 3K9FC 3A1CA 5JBNA 1SOMA 3WAJA 2B7LA 3FTEA 3LS2A 2RK3A 5IKEA 2JHFA 2O23A 3O26A 4EMBA 1UBCA 5KIAA 4M7PA 1F9AA 2M6RA 2XSZA 3LY8A 5FA8A 1VLMA 4OHRA 2O1WA 5D3ZA 5FPQA 2VZEA 2DPXA 1XKXA 5J40A 4KWIA 821PA 4MDFA 5AM2A 1DJPA 2B8JA 1G19A 2UZ3A 5LD2C 3BMCA 4B34A 1FUYB 1V4VA 4E3WA 4GRIA 1MF7A 1RTKA 2C4MA 2F4NA 3IUMA 1IB6A 3G5TA 3PFWO 4N18A 1P45A 2J32A 4OPMA 5DNAA 5BWCA 3HYTA 1VHJA 3OEEA 3QKUA 4N5HX 3LP5A 3FZGA 2D5IA 3V2GA 5LUAA 2QY9A 2CHQA 1YRHA 2KE5A 2ONZA 1YXMA 1BMDA 1PL7A 2HBYA 3EG9B 4OXQA 5BNZA 1B0UA 1ZMOA 2BONA 2FEOA 2YJ3A 3ONWA 2XBLA 2BFEA 4N39A 2QE7A 3PXEA 4KNWA 5DYIA 3M6FA 3RS9A 4EI8A 1EEXB 4DXDA 4OU5A 2C99A 2C2MA 3LUJA 3N53A 1M8PA 4CXMA 4UD6A 1NZDA 5ETJA 2Y9PB 3RVJA 4AJKA 3UJNA 4LF5B 4NCAA 2ZQYA 1PDWA 2A35A 3R0ZA 1KXJA 4BAGA 1MB3A 1GL3A 1RPAA 4P53A 3K7EA 5EHQA 2Z6AA 2ODEA 4G1VA 3VSEA 2KI5A 1LSOA 3V00A 4IWNA 1NNI1 3AP2A 3AR7A 3WNQA 3ROFA 3WGTA 3RKUA 1OFUX 1P4GA 3HWRA 3EULA 5FJIA 3RS3A 2PRYA 4L07A 3AP3A 4ROTA 1ECPA 4GLLA 4Y2XA 1INLA 1ESCA 1FTGA 1KP9A 4HXEB 4RTPA 2IOFK 3CLVA 3DL7A 3KPJA 5EWMA 2FN8A 3P9CA 4LJKA 3GAAA 3IA7A 4KIJA 5KHLB 1KEEA 2O50A 5ILQA 1J8MF 1E2EA 3IDZA 3UK0A 3E3LA 4DIOA 1ANKA 3IX7A 4CU5A 2OYSA 4D82A 1J5EB 3L7LA 5IZ4A 3KLPX 1Q7EA 2HPAA 3OQVA 4PNEA 2B5OA 3EGOA 3DW1X 1FFBA 4MS4A 4ZZ0A 4E1VA 5C7LO 1CFZA 4L7QA 3NTOA 2JI4A 5HRCA 4DB2A 2PRKA 3K0AA 3R6LA 4FOPA 3SJUA 2O54A 9MHTA 3HWX1 4V3BA 5EE5B 3KJHA 5I01A 4KR2A 4WCFC 3RFCA 2UUCB 1ZH8A 1CK4A 3BH0A 3MSXA 3HXTA 4UD2A 5HPYB 1SMKA 4LZJA 3IO5A 1SBTA 4B0OA 2VH5R 3EGVA 4CG0A 2J5RA 2RAUA 1UIMA 4Z99A 3AEQB 1NHGA 2DBRA 3UIEA 5A4IS 3MWLA 3IBCA 5LNK6 1GCAA 3VZDA 2XB6A 2BE9A 3V9AA 4EUEA 1ZRNA 3DZIA 5CB8A 1A9SA 4JT2A 4BKRA 3JQGA 2A78A 1GAJA 3W9SA 2QB5A 3EHEA 2W5UA 4HO1X 2XNDD 2AVDA 1YJBA 1BROA 4WNYA 4ZYXA 3M82A 4V3CA 4C0XA 4NBWA 4L6CA 3ZV3A 3ZWQA 2PUWA 5CTAA 4KNVA 5B53A 3YASA 5CEJA 1OJLA 2Q1SA 2DPHA 4G8JA 4L5BA 2VXCA 5JNWA 4H1WA 2HQ1A 1VYHA 4HVTA 1VXOA 4IIHA 1DEAA 2XGMA 3QELA 3F6RA 4XWTA 4Q7LA 4QFBA 3ZBQA 1LPPA 1CUJA 3MWJA 1AGYA 4XCQA 3RU9A 4L5YA 4D43A 3G68A 1NJ1A 4DG9A 4MK4A 4D4IA 2UXCB 3PVSA 4FGKA 4C22A 1RQGA 1WHSA 2OCBA 2I76A 3BHNA 4ZTBA 5A1JA 1Y9EA 4CKZA 2ZKIA 1VE7A 3NBZC 3E9RA 1QZZA 2QLLA 2VZLA 3V2IA 2G36A 1H2XA 2IA5A 3VYSB 4H2DA 3DD1A 3LZ6A 3KYCB 5CM2Z 2ZZMA 3K2QA 3I1FA 3A7DA 3GFRA 3WL7A 1RYBA 1K5HA 3AF3A 3PKJA 3A36A 1JF8A 3OTHA 3PFGA 2X5KO 4JUAA 4P4GA 4ZDWA 1R4ZA 4IHQA 2WB2A 1DBIA 4D0SA 1CQPA 2XKAA 4PEVA 2BGLA 2IZ6A 1JFFB 1MX1A 3QJ5A 2NSDA 1NX6A 3F8WA 4IRXA 4TLAA 4TUYB 4FGSA 5LDGA 1JTEA 3W4KA 5JAQA 3S8MA 1GTMA 3O9ZA 2GZ2A 1JEJA 1FCJA 1A82A 2FU5C 1EFPB 5L45A 2WJWA 1KK2A 3QU9A 2XWBF 4K9SA 4A2CA 5AVXA 1PYDA 1OGJA 3OSZA 2EV9A 4OMUA 1RJGA 3CR7A 2ZJ2A 4PZZA 5ELMA 4B48A 4BDTA 3M4YA 4QYTA 3SMQA 1C8KA 3W78A 1QMGA 3DMGA 3WV5A 3O93A 1UXHA 2ODTX 3SF8A 5ELLA 5FBRB 4YR7A 3AL2A 2F3QA 2OENG 4GKBA 3AUAA 3EG5A 2F1KA 1W35A 2OAP1 1A04A 1N1MA 1PS9A 3CQ9A 3PQ4A 3IPAA 2QVZX 2MMGA 2P7HA 4PY2A 3BXPA 3ZWDA 3DD5A 1V2GA 1QP8A 1KFBB 2LCFA 4WN9B 1XGKA 4G1BA 4MQFA 4XFKA 4WOPA 1FMJA 1MFZA 1RWWA 2BRUC 2FRDC 4AW9A 5FFFA 3W6ZA 3ENNA 4DUZB 5IT5A 1SELA 4DS3A 3O8OB 4V1CB 3W9YA 1B00A 1HNXB 5BW8A 1T2NA 2ZDHA 3LY7A 5T5QA 1BD4A 3W5JA 5KX5B 3TQIA 1NRXA 3R8CA 3N6VA 2C77A 3LQFA 3G9ZA 1EU1A 4Q05A 3TLEA 4PAGA 2INGX 3VNAA 4UPDA 1QHNA 2O8FA 1UADA 3KALA 1AZSC 2V5UA 2J5BA 2D4AA 2ODPA 2QT9A 4C4AA 3FPLA 2YINC 4G0PA 2Q5JA 2ZLBA 4TSRA 5F64A 4HGRA 4RMHA 1J5XA 4LF8B 1PJ8A 3QTLA 3RIXA 4HH1A 3ZDDA 4Q9LA 1TT5B 2Z58A 2H16A 3N8HA 3N87A 4CIYA 1IBLB 5CMLA 5K7SA 3O4VA 2C1ZA 3C16C 3NHJA 1NG9A 2FWPA 4Y9SA 1JPNA 3DAFA 2OHOA 2WIAA 4MWBA 4QSMA 1Z2CA 5AOVA 4F2DA 2X3UA 4HBGA 2V97A 3EYAA 1H22A 5DU2A 5JPDA 1FMLA 1RWPA 1UANA 2RHBA 2QZ4A 1JGTA 2D0PB 4A8TA 5JAPA 2ECKA 3OPYA 1NKTA 1ZA1A 2FP4B 2GKOA 4L95C 5F7JA 1EXWA 1JLLA 2BMDA 4M1WA 1XZPA 4Q3DA 1SFRA 2ODQA 2KLBA 2Q4TA 1I3KA 1L7MA 1ZMBA 4Q9DA 1C1DA 4CMCA 4KQ1A 3EJWA 3MUNA 4PTLA 2OYCA 3U7HB 4QU5A 3OZSA 4J0IA 3J81k 4PXSA 1TYDE 1XHEA 2YWJA 2ZRAA 3QYPA 2D7CA 3D7NA 2XUZA 1DJOA 4OLHA 3VPXA 1F8UA 3HMKA 4AY2A 3AI3A 5I9SA 1H42A 3IAUA 3SQXA 1HFKA 4CETA 1QV7A 2WYUA 5CX1A 2E85A 4DOMA 5A04A 1G38A 3UAVA 3WJ2A 3LXRA 1OV4A 3PUYA 3I9OA 2IH2A 1E0SA 3DMHA 3ZIAA 2FLVA 1ZJ5A 2C9DA 2VUUA 2I29A 2ZRHA 3RARA 4KOAA 4D8TA 4DCNA 1I1HA 1Z18A 2JEYA 4JYZA 1Y8RA 1XX6A 3PUIA 4QOEA 1GG8A 3COYA 3GUZA 3LG2A 5JLAA 3OD1A 4NIMA 2YWDA 4O5AA 2OVFA 4MVWA 3R5FA 4QRIA 1I9CA 2EAUA 2CN1A 4BLRA 2D1RA 4M87A 1TKCA 4BO0A 4MUJA 2C58A 3IPRA 4YECA 5JDCC 2LE0A 3BMCB 4AI6A 1PFKA 3GWGA 1FPMA 2BM1A 5G1OA 1G3IA 3MBIA 5B3KA 1KORA 1WUYA 1VKRA 1UFKA 1Q7GA 3K16A 2DT8A 1CQXA 1FDTA 5HDBB 1UFOA 4A6XA 2IL1A 5BQPA 1QO0D 1PZEA 2COUA 1V1MA 1E1CA 1II0A 1T8TA 2GEUA 3ACCA 1ZEJA 3L6OO 1PJ4A 2PVCA 1QF7A 1T3SA 1A8HA 3GRUA 3Q2OA 2OK7A 1QQBA 2RBGA 2ZG6A 2OM2A 3K0CA 1BXRB 2I9PA 4J3JA 2W93A 1RZUA 1Q2XA 1YRYE 2BFEB 1P18A 1T2FA 3CEPB 3EASA 4P84A 1RCUA 2PLWA 2ADOA 3LHIA 1XZHA 2IDKA 2GAAA 2R1UA 4P3KA 1YQGA 3UG7A 1J56A 3BAZA 3O8QB 2WVJA 2YCBA 1XVUA 1JEQB 1F3LA 4L2IA 1I24A 1TIBA 2ZSUA 2VRCA 4S1OA 4Y2HA 3TQFA 1CY1A 1ABBA 4RULA 4MI3A 4DR4B 4OHKA 3GFBA 3OZDA 1GLGA 3NBUA 4JLMA 4DLLA 1V11A 4HEQA 4TS3A 1U6JA 1PFYA 4F4FA 1Z4LA 1OH8A 4H31A 4KAJA 3ZXUB 5IYZA 3ZYZA 3F7OA 3VBCA 2C2YA 3U7QB 2UU9B 5CA1A 5IN4A 4EF5A 1YU9A 5JCJA 3T1TA 1GTZA 4CM3A 5LUBA 4KPEC 3C7DB 2OBBA 1QYWA 3KZOA 5K2MA 1JA0A 3V4ZA 2I3GA 4J6EA 2AW3A 3RG8A 4DRYA 6REQA 2HIAA 2XEXA 3AFGA 3ECCA 3FPHA 1JR3D 2FX5A 4DT1A 3MGBA 3PL1A 2C00A 2JFOA 3IR7A 3PD7A 2F9LA 3EXAA 4RYLA 4ZI7F 4UBIA 3AKDA 5ES3A 1SVMA 3ZCSA 1YNOA 3C43A 2QSJA 3BD6A 4MS4B 1S3SA 3DP9A 1SK8A 1CE8B 3PEEA 5I8WA 4YMVA 2QTVB 3MT0A 4A92A 4ECEA 5EJ5A