3JQFA

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and inhibitor 1,3,5-triazine-2,4,6-triamine (ax2)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
267
structure length
249
Chain Sequence
b'EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase 1
publication title Structure-based design of pteridine reductase inhibitors targeting african sleeping sickness and the leishmaniases.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Oxidoreductase
total genus 92
structure length 249
sequence length 267
chains with identical sequence B, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2009-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3jqfA00
3UICA 1DIAA 1E7RA 2ZTUA 2I5PO 4R01A 2EV9A 1KEPA 3LT0A 5FYDA 1EVZA 4JBHA 3WYEA 2VYND 3OEYA 1XR3A 5JCJA 2B4QA 3DAPA 4I9UA 3TPCA 4ZRNA 3Q9UA 1R4NB 3E9QA 3ZV5A 3JQ8B 2Y67A 3E48A 1E77A 1Y8QA 4K9DA 4BO2A 2IZZA 1PJBA 1DHRA 3CEAA 3DWFA 3R1IA 3PLNA 3SLKA 5A9SA 3AU8A 5G0WA 3K2EA 4E21A 3SVTA 3HQ4O 1JA9A 2VWPA 1C0KA 3D3WA 1IY8A 3LF1A 1GUFA 1QG6A 3ICCA 4GL4A 3V1TC 3GAFA 1LQTA 1YS4A 1O0SA 4NJOA 1I8TA 4YJHA 2SCUA 4DMLA 5JAQA 3BHIA 2ZTVA 1YO6A 3LYLA 2EW8A 4FSHA 4GKVA 3WNQA 1HDYA 1RM4A 3RSHA 2I99A 3FF4A 1ZMOA 5HA5A 2YJZA 3UN1A 3DQPA 1N92A 3AU9A 4BNKA 1FK8A 2NU6A 4DQVA 4YAIA 3AUAA 2QQ5A 3D64A 3FNGA 4JXKA 4KMSA 1MG0A 4PLFA 3NT5A 4YQYA 3VZSA 3WJAA 3KYDB 1A71A 1BDBA 4UVEA 2QZ9A 2O23A 3JD3A 5KOIA 1W6UA 4BNUA 3G0OA 4XYGA 1LTHR 5H81A 3VHRA 4TRNA 3S55A 4FFNA 1IULA 3ZN2A 1UP6A 3HJAA 1NBOA 3Q0EA 2O3QA 2WE7A 3AY3A 4JBGA 5DF1A 4E2ZA 2C07A 1T1RA 4IBOA 1IZ9A 4UVIA 2PH5A 1R15A 5T6BA 2DUUA 3MJVA 4FW8A 4JJFA 3SBOA 1L7EA 3O03A 6ADHA 4GMFA 3WGGA 3O9ZA 1ZKMA 1LA2A 2ZKLA 4L4XA 4RPGA 4OJNA 4CLOB 5GZ1A 2WYVA 3OSUA 3NT2A 5TX7A 2JCXA 2X58A 1DXYA 4LVUA 5B12A 3GAZA 1WMAA 3K31A 4DIOA 3MOIA 1VRWA 4U0KA 3QA9A 4LMRA 3H3FA 4BNJA 2HMSA 3RQSA 2OFPA 1UJMA 3VTFA 3BMQB 5ILGA 1RKXA 4CM4B 4YA6A 3DEYX 4FPXA 1NVTA 1ORRA 2NUAA 1DLJA 2GCGA 3RVDA 2BGLA 1HEUA 2NV6A 1PTJA 5CFZA 1UAYA 3IP1A 3PQDA 3OJFA 2VHYA 3L6OO 4G81A 1JQBA 3FR8A 2IYOA 3NGLA 5ADHA 3VZRA 3MZ0A 2QHXA 2QRJA 3JQGA 3CUKA 1EDOA 4XB1A 5DN9A 4NNJA 4WE3A 2RCYA 2Y05A 3C8MA 5A1TA 3EVTA 2Z1NA 1LRJA 5HS4A 4ALJA 1JAXA 2PTGA 2NTVA 3IUPA 2D4AA 2Y1OA 4UUPA 1FXSA 1GUZA 1Y8QB 1ZH8A 2FR1A 3I52A 5AQ1A 4EI2A 1NTOA 3V8BA 3GMSA 4BKRA 4BNNA 2VT2A 3FNHA 1P1HA 3GNTA 5MGBA 1JU9A 2HDHA 1SZJG 2CDCA 2G82A 4U8GA 2FR0A 4UREA 3D3WB 4BO3A 4BGEA 4A5OA 4WGGA 4LMPA 3V1YA 3ULKA 3JYLA 2HO5A 3WSVA 1P1IA 5B37A 4QUKA 3ZCXA 4N54A 1B0AA 4YJHB 3X2FA 1CRWG 4LN1A 3PRJA 4Z6KA 2BH9A 3QLJA 5IN5A 4GH5A 1R37A 4GX2A 3OM9A 5IZ4A 2AG8A 5F1OA 1L7DA 2CMDA 3AY6A 4ZQFA 1ADBA 2GGSA 1IHXA 5T67A 4DQUA 3JQAD 1CERA 3HDHA 4J6FA 3HB4X 2JFFA 5BT9A 1RYEA 3H5AA 4HFRA 2B83A 1DOHA 1YL5A 2P9EA 3EGOA 1X14A 3I9KA 4OQYA 1VJ0A 2X9NA 3N74A 4QX6A 1IOLA 2PV7A 3KV3O 2J5RA 2OOSA 1EBFA 1EQ2A 2VYNA 2CUKA 1GD1O 5K9ZA 1Q7BA 2GN4A 3BYZA 4XKJA 1I5RA 2PZLA 4Z0TA 5BQFA 3PDUA 3WS7A 3U09A 1SBYA 2XPCA 4RVHA 4J90A 1JDJA 1F0YA 1G6KA 2DBRA 4IDCA 1Q0LA 2JD1A 4RGBA 1R0SA 2GN6A 1EVYA 3BHMA 4PFJA 3FBTA 1V3UA 4AJNA 4E2WA 3OMLA 4DC0A 5ICSA 1D1TA 4MOWA 4Q3CA 4CLXA 3VH1A 4NDNE 1BMDA 3RI3A 1ZZEA 1ZEMA 4R1UA 4Z0PA 3AUTA 3KYCA 3AOEC 4KTVE 1YWGO 1HDOA 4EEXA 5CG2A 4HNGA 1OBFO 1ZXBA 3DO5A 4FIZA 3UFXA 3VZPA 1T2FA 4AJ1A 5F5LA 4R16A 4XB2A 3SC4A 4I9HA 5DBGA 2VUUA 1SOVA 2BF7A 1HT0A 1XKQA 4A10A 3PHLA 4J43A 2P2SA 3FSRA 3Q1LA 3PJDA 4J2HA 3PYXA 4CV0A 4IDAA 2C82A 5A5EA 4QTZA 4A2CA 3JQGB 2DFDA 3W4KA 2FRDA 4J49A 1U3TA 1F8GA 1MUUA 3RUEA 4WUVA 3A28A 1SO8A 2GD1O 4MP6A 4XQEA 3UH1A 3DAFA 3WWYA 1C14A 4H7PA 3W4IA 4M8SA 4C7JA 1ZVMA 4E2XA 3O8QB 4MP8A 2VWQA 4A0SA 4RQTA 4R5HA 1YGYA 1T2DA 2Q99A 3GH3A 1O6ZA 3TNLA 1NYTA 1LXCA 2B69A 5L7WA 2FHSA 5L4NA 1YDEA 3HB5X 3ZGYA 2PFGA 5T5QA 2AHRA 3JV7A 4BO7A 4EUFA 4OL9A 3WGZA 1W73A 6LDHA 3WJ7A 3B1JA 1UDAA 4CV3A 4UVDA 1PZHA 3DMTA 1CETA 1P45A 3DBHA 1E92A 1JN0A 1LDEA 1MXFA 1ZSNA 1ZNQO 3H9EO 1TT5A 3UCEA 3LC1O 7ADHA 2Y1GA 2YV1A 2OP0A 2D1YA 2NQTA 5DP2A 3DZFA 4J7UA 2EKLA 3PHGA 2VWGA 2WD7A 4M1QA 3UAGA 2C7VA 4B3HA 2WTBA 3JQCA 4GKBA 2BLLA 3K96A 3NT4A 4DTIA 4IDFA 3DZHA 4E3ZA 1IPEA 1E6UA 2X9VA 2GPTA 3PFFA 5JY1A 5KIAA 1TT7A 5A05A 1H9AA 5KKCA 3E5RA 4XRGA 2Y1DA 2YZ7A 3CPSA 1IYZA 1X1EA 4E5KA 1H6CA 1XEAA 3WSWA 3WLEA 3L07A 1GZ6A 1U2DA 3L4BA 3AOEA 1IHYA 3ABIA 3DFZA 2Y1CA 3H3JA 3C3XA 1HZZA 1NWCA 4Q3DA 1P44A 3I6QA 1HETA 5JMPA 2X5JO 4W9NA 4E6PA 2A94A 1X7DA 4NJMA 5TT1A 3GG2A 4HKTA 1CJCA 2BGMA 1NM5A 3GY0A 4WNIA 5L4LA 1UXJA 3U4DA 2I9PA 3ZWBA 2B0JA 4PVCA 1PS9A 4CM6A 1UR5A 2E82A 3HHPA 5DBIA 3NV9A 2FMUA 5F1KA 4BO9A 4PN3A 3QP9A 2EKPA 5JYDA 3QQPA 3RBXA 3GDFA 4K6FA 3WGHA 3GFGA 1GCOA 2JD2A 4WEOA 3WG9A 4OSOA 1PJSA 1GYRA 3OJ0A 2VRCD 1MFPA 1MFZA 1ZK3A 4MVJD 1OI7A 4DLLA 3L4SO 2EHDA 2W2KB 2J3HA 2XF8A 3I6IA 3WGYA 1ULSA 2DFVA 1LRLA 4OKIA 2Q49A 4Z9YA 3WMXA 3RJ9A 1Q1NA 3C1TA 4Z9XA 1PL6A 2PK3A 1PEDA 3JTMA 1Q0HA 3G1TA 1NQOA 5EMHA 4DREA 2P9GA 3DBVO 3HNPA 1YXMA 2WJPA 1OC2A 3BMNA 2AEMA 1HWYA 2UDPA 2YQ4A 1V0JA 1GEGA 1IB6A 1GAEO 1KEWA 4DYVA 4KWIA 5JC8A 1FDWA 4Y6PA 2P5YA 5EIOA 3RKRA 3S2FA 1ISIA 4K26A 2Q2WA 4BKPA 4CQMD 4FD3A 1DC4A 4YTEA 4XCVA 4LSWA 4KP7A 1SB9A 1XU9A 2C5AA 4IDDA 4BOYA 5I7SA 4WK6A 4NBWA 1NPYA 5JAIA 1CWUA 1E3WB 3K8ZA 2C29D 3JQ9C 5L9AA 4R1NA 4JN6B 2NTNA 4F6LA 2QW8A 4N5NA 1Q7CA 3PHHA 1I36A 4CR7A 2Y0CA 2YHUA 2O3UA 2VRBA 4DIFA 1RM5A 3ICPA 3RU9A 3VTZA 5DOZA 2D59A 4AJEA 4DA9A 4JJIA 5KVCA 1VJ1A 3N58A 5JCJD 1MB4A 1HZJA 3E1KA 3TL2A 4J0EA 5TRTA 5I9MA 5JC1A 4XYLA 1EFLA 3WGTA 1ZCJA 2Q4EA 3DOOA 3TZ6A 9LDBA 1PJ3A 1PL7A 1IZ0A 2X9GA 1F8FA 1TT5B 4CJXA 1OFGA 5EN4A 1W8DA 3BTVA 5TQVA 2YDYA 3CKYA 4B8ZA 1V9LA 4E0BA 4BNTA 3O4RA 4GPD1 4EEZA 4WLUA 3H9UA 1Z73A 1DRVA 2G5CA 2ZB3A 4EBFA 2NU9A 1HE3A 1N5DA 3JYQA 2CVOA 4ND3A 1KEVA 5A06A 3HUDA 4OIMA 3CE6A 5LDGA 1JLLA 1RYDA 1I32A 4J7XA 2B4RO 4ZGWA 5AYVA 3DBRB 4EITA 4LGVA 4XYEA 3WR5A 2HMTA 4WLNA 5I8WA 3DZBA 2Y66A 4I5DA 3I9JA 4XGKA 3ZNNA 5G0VA 1GV1A 1ENZA 5DCYA 1H5QA 4P22A 5EERA 1B3RA 4TVBA 2IXBA 5CEJA 4OKNA 4IM7A 5JBIA 1WVGA 4MVJG 2WWRA 3KZVA 3WGOA 5BNIA 4YAKA 4Z3KA 4RF5A 5KJ6A 1UXKA 4JIGA 5KVQA 1QXSA 2NQ8A 2PLAA 1HE2A 3DB2A 3FR7A 1RPNA 1P77A 5JNLA 3AM4A 1YRLA 4XR4A 2EW2A 1D8AA 2GF2A 4U7WA 3I1JA 4MKZA 2RHRA 5DDIP 2PD3A 3EHEA 3PZRA 4AJJA 1QYXA 3WIEA 3ANLA 2PH3A 3JQAB 1DLIA 2HJSA 5A3VA 3LLVA 2OZPA 1I3MA 4INAA 4UVGA 2Y1EA 3PQFA 4MKXA 5H83A 4IUYA 1UH5A 4ONEA 2HCTA 4IIVA 2W4QA 5AXBA 1OZAA 1DHTA 4GX5A 2ZIZA 4BO6A 5CG1A 4NH4A 3PIDA 3RUIA 4OHUA 3AI1A 1N7GA 5L3ZA 3OHSX 1XIVA 4BUCA 3GGPA 4EUHA 5AXDA 3IOYA 4PRLA 3CH6A 4XQGA 5IXSA 1KC1A 3W4JA 2BFAA 2WYWA 4KWHA 1LC0A 1KYQA 4WASA 2VZ8A 1WLYA 1E3SA 1PJTA 3FTPA 2BKAA 4YJFA 2Z1MA 2FP4A 4D45A 3KYBA 3M1AA 3ZHXA 4E5MA 1MGOA 2V6FA 4ROSA 2UUPA 2VRCA 5TJHA 1DC3A 4MVJA 1VC2A 1ZSVA 1J5PA 4ID9A 1ZFNA 4J7CA 2RH8A 3DONA 2O4UX 2WM3A 4TKLA 4BNLA 4K1LA 4PLYA 3FWNA 3LC7O 2DU8A 2O3SA 4JROA 2DTEA 2A35A 2CSUA 2ZQYA 2YW9A 3GR6A 5IZCA 3ZV4A 3OIGA 2FN7A 3JD4A 2VT3A 3KSZO 3I9LA 3JD0A 3MWDB 4EGFA 1E1MA 2Y68A 2LDBA 3HDQA 3DOCA 4D3DA 5L4SA 2JL1A 4CM8B 3BMCB 2DBZA 2JHGA 2NVUA 4M54A 3CZRA 5GY7A 1C1DB 3AUSA 1AXGA 4CQMA 3GN1A 1O8CA 4HY3A 3MJCA 1DPGA 4DYDA 3B6ZA 1BXGB 4GLLA 3BAZA 3V2HA 3IDSA 1ZEJA 4BIIA 3M1LA 4RF3A 4Q3BA 1XQ6A 3JQDA 4GWGA 4NU6A 3B1KA 4J1QA 1TA4A 4IDEA 4F6CA 4Q3AA 1B14A 1KY4A 5L95A 4TROA 1GL3A 1PIWA 1E0DA 3AOGA 4DGSA 1H9BA 2YYYA 3F6YA 2UYYA 3E6AA 2Y1FA 5I7VA 1Z7BA 2YUTA 5DULA 4CMKA 4YXFA 3B20A 4H15A 3NEPX 3RUDA 3GUYA 4W7IA 2PGJA 3GG9A 1NQAO 3Q6IA 3PJEA 4CMHA 3P7MA 4WCDA 3PPIA 4CMEC 3WGIA 2YHIA 4H16A 2JCYA 5JFOA 3NRCA 4J9UE 2HJRA 4XGNA 1E3LA 2Y0EA 4YT5A 1EUZA 3RBVA 4E5NA 2AEFA 3GEMA 4I9NA 2HUNA 2FPIA 2HRZA 1UZLA 3C1AA 4NZ9A 2P68A 3IQDB 4RVGA 2C2YA 3VPHA 3I83A 1BXZA 1XCBA 2ET6A 1MX3A 3TZCA 3JYNA 4D46A 3WBFA 2X0JA 3EMKA 4WNCA 3E03A 1UUFA 4YDRA 3V2GA 3ONDA 3D4NA 4BMSA 4F3YA 4CLRA 1K6XA 2ZQZA 3P2OA 4MO2A 1OOEA 4OO3A 5IDQA 3ZWWA 1ONPA 2CY0A 1EZ4A 4ZRMA 2C54A 3ZHBA 5T8KA 4FOOA 3UGKA 2WDZA 1O9BA 1C1XB 1ADGA 1M2WA 5T64A 4YJFB 3RROA 1K2WA 3QSGA 5FWNA 5KJFA 2O3TA 4CMGA 1HDCA 4NK5A 2Q1WA 1HL3A 3HN2A 3L0DA 1LI4A 3JYOA 3VPGA 1VJTA 4NMHA 1C3VA 2IZ0A 3E82A 4RORA 5G2OA 1Y8RA 4M87A 1E7SA 3TOZA 4PLCA 1Z82A 4YCAA 4Z0HO 1TXGA 4U6QA 2I3AA 5HWSA 4OGWA 3QE3A 1NPTO 1DC5A 3ZW9A 4P38A 3KEQA 3IMFA 1B15A 2PD4A 1F12A 1R0LA 3L6DA 1WWKA 3ZH2A 3SJ7A 3KB6A 2FWMX 3KUXA 3GZNA 4O1MA 4IZHA 4R51A 1DIBA 3GVCA 4D0SA 2ZYAA 4IXTA 4YEDA 4D43A 1PGPA 1KIFA 2QYTA 4RCVA 2IODA 4RVUA 4NBVA 5JXWA 3WQQA 4IPTA 4CL3A 3AWDA 4ZQEA 5TNXA 3V1UA 2LDXA 1HDXA 4NFSA 4NK4A 4B4OA 4G5HA 4WPGA 1GTMA 1NP3A 2EEZA 1LRKA 3INGA 3WTCA 1SPXA 1U4OA 4NG5A 3OQ1A 3GN2A 2AE2A 1F14A 2P9CA 1LSOA 2CNBA 2VNAA 2DAPA 4YJGB 3ZU3A 3JQEA 2AMFA 3ETGA 3EY4A 4E30A 5JSFA 3Q3CA 2H5LA 4XYBA 1YJQA 1SEVA 3DBLA 3EK2A 1M6HA 3HDJA 4Q9NA 4CMEA 3LT2A 4YB8A 1TI7A 4P4NA 3FCOA 3NX4A 1A7AA 5G4KA 4D41A 4Y6SA 3KEOA 2JKVA 3ASUA 3PQEA 1D3AA 1UP4A 4GAEA 3H9JA 4CUJA 5CDUA 3D5TA 3HWRA 3QIVA 5LCXA 3VC7A 5IFLA 5A9SB 1WDLA 5HBRA 1LDMA 4P8RA 4BO8A 3WYCA 3BMOA 1Y6JA 1WW8A 2FOIA 4AJ4A 3W8EA 2HK9A 2V65A 2C5EA 1MP0A 1G1AA 1T4DA 2YHIB 3H2SA 3RC1A 5CHEA 1U7HA 3W8DA 5ICMA 2E37A 2B37A 2PGLA 1KVSA 2X0RA 4RF2A 4PG8A 4PLPA 3VAZA 2G1UA 4CMAA 3C24A 1O95A 5JDIC 1DFIA 1Y5RA 3DHYA 4DLBA 4UAGA 1Y7TA 3DXFA 1T25A 3VOSA 4EDFA 3KOUA 4U0JA 2QG4A 3DZGA 4QT0A 4II3A 4FGWA 2IEBA 2ZCUA 1P1RA 1U5CA 1ZO8A 2EJWA 4KDEA 2VHZA 2B5VA 3PGJA 2PZKA 3RUHA 2OHXA 1P0CA 1JVSA 3ROKA 1I24A 1P1JA 3DMTC 4QEDA 4J1NA 3VDRA 3JSAA 2CD9A 3ENNA 4FBGA 3RUFA 4YYZA 4RVDA 4KUEA 3CINA 1JWBB 1H6AA 3GVIA 3Q11A 1OMOA 4XRRA 4XWYA 3S2EA 3VVCA 3VH2A 5TC4A 2DM6A 1UP7A 3I3OA 3IP3A 2R00C 5J23A 4I1IA 4OM8A 1WPQA 4WOJA 4F45A 1Y1PA 1LU9A 4IZIA 1M75A 2VTDA 1MA0A 5I9NA 2ZATA 4UEOA 1KETA 2GYYA 5TSDA 2CVZA 1GYQA 3F9IA 5AXAA 5F5NA 5EINA 5IDWA 2V6MA 1ENPA 3JQ7A 4ZN6A 8LDHA 1BW9A 1E5LA 1YKFA 3PP8A 3L4BC 5KVSA 2OP1A 1H2HA 2DLDA 3OJLA 4E5PA 2WD8A 3TN7A 5ER6A 1Z7EA 4W9NC 3GK3A 3ZZNA 4ALLA 4CM4A 2GUGA 4GI2A 2VUSA 3OICA 3MJ4A 1BGVA 5G4LA 3QWIA 5GZ6A 3LF2A 3MTJA 2W2LD 3UXYA 1HYEA 2EG9A 1WDKA 2VHWA 1YBAA 4J1SA 2NVWA 5ES3A 1DSSG 4ZA2A 2IRWA 1H93A 3A9WA 3GFBA 4YAJA 3EZLA 1ZW1A 4GLOA 4PVDA 5A5FA 1H6BA 1PWXA 3W8FA 3RUAA 2EXXA 3LZ6A 3DBLB 4B3IA 4EW6A 4MPDA 4CM5A 5I8ZA 4GSLA 3VPFA 2J3JA 3WTBA 2V6BA 5JS6A 2HK8A 3I9OA 3D1LA 3WXBA 1QLHA 5G4KB 1QV7A 4Y8VA 1LDBA 5B4UA 4II2A 1R4MA 1LSSA 5JDIA 1TEHA 3HADA 3NKLA 4U5QA 4KDFA 4FC6A 4N18A 4OOFA 4BNYA 3F5QA 4A73A 1KOLA 4I5GA 4BV8A 1KS9A 2FPGA 3BMOB 5CDYA 4RF4A 4KQXA 3L6EA 3GF4A 1ZK1A 2HSDA 3AK4A 3GDGA 1EBUA 1N1EA 2V6GA 3LSYA 1GY8A 3NTRA 4YACA 5BNFA 1PR3A 1LC3A 4FJ1A 3OQ6A 4ZVVA 4TVOA 1K3TA 3IC5A 3S2IA 3F1LA 4UVHA 3PTZA 3CSDA 3LT4A 4XR9A 4GMGA 4BKOA 2VUTA 3TFOA 4CLDA 3JCZA 3IKTA 1N9GA 2C0CA 3KXDA 3G1UA 4W82A 4EUEA 4R69A 4JQCA 2G0TA 2VHXA 2R00A 2QRKA 4GWKA 2RHCA 4XZ3A 5BR7A 3CMMA 2YY7A 3LU1A 4W99A 5C7OO 2OBNA 2X0IA 3LDHA 9LDTA 1HSOA 1GADO 1WMBA 3G17A 3TZQA 1E7YA 3QJ5A 3RCBA 1I2BA 3H6KA 2PKQP 3GVXA 1WP4A 4FQ8A 1K5HA 2J5KA 3ZWAA 2PZJA 1YB1A 2OO5A 4HBGA 3JQFC 3QY9A 2NTJA 3M2TA 4IJUA 3STHA 1Q7GA 3KRTA 2JD0A 2BELA 3FBGA 4B4WA 1B16A 1PGQA 2C20A 3CMCO 1GCUA 4UUNA 3F46A 1T1SA 1LDGA 2Q2VA 2HRBA 2WE8A 1GU7A 4HUJA 4CM7A 3I5MA 2E4AA 3WB9A 1IE3A 3A14A 4KUGA 3JQ7B 3G79A 3KYCB 3O26A 1B2LA 2TMGA 4OH1A 7MDHA 3D4OA 1QORA 3K30A 4ND1A 1H0KA 1ZBQA 3ANNA 3PIIA 1B26A 1CQIA 2NM0A 4TRJA 1GPJA 1PQPA 4IMPA 1QLJA 3I23A 4BGIA 1A9ZA 3ZWPA 3GHYA 4IJVA 1BTOA 1H2BA 1LBEA 3T7EA 4BB5A 4LCJA 1LDYA 4N5LA 1DDOA 3DTYA 4GGPA 2AQKA 3EC7A 1VM6A 1TB4A 4HP8A 1ISHA 4RPLA 1Y5MA 4XIJA 1YOVA 2P5UA 1NFQA 2RAFA 3A06A 3ZI0A 4BVAA 2J6IA 5A02A 4FN4A 1QMGA 3NDJA 1G0OA 4IIUA 3NTQA 1BWSA 3MJEA 1LUAA 2F00A 1NR7A 3DC2A 4TSKA 3U5TA 3ST7A 1J49A 1XLTA 1AUPA 5JCXA 3RWBA 1GR0A 1YQDA 3ZWNA 4E31A 1SB8A 4BO1A 3F47A 3A1NA 4IXWA 3OFSA 2DPGA 3GGGA 4QQRA 4Z9FA 4O6VA 4RDIA 1K6IA 4BNHA 4FFOA 1E1NA 1U7TA 2AA3A 5THKA 1VL8A 1YONA 4D3FA 1A27A 3GEGA 1KVUA 1O94A 2RH4A 3HFSA 4M89A 4R41A 3NJ8A 4XGIA 4D42A 3E18A 4LISA 2NVBA 1BVRA 2IXAA 1PJQA 1JKFA 3DZJA 4FFMA 4ND2A 2O7SA 5ER9A 1E7MA 2ZK7A 1GEEA 1ENOA 2I65A 4PG6A 2J8ZA 3IJPA 1NAHA 3DBHB 4RVFA 3GVHA 4MVJH 4CMBA 4CM9D 2QYSA 1YBMA 4AJLA 1VE9A 2HK7A 2Y99A 3QWFA 1ZJZA 2D3TA 2X22A 4FFRA 4Y9DA 1PU2A 4NU5A 3TSCA 2W2LA 4PIVA 1RJWA 2GRAA 4D79A 2GERA 5KVVA 4XQCA 4YT4A 4D3SA 3JQFA 1NVGA 5DOVA 2WD7B 3KO8A 4DWVA 3SJUA 3BTUA 2O2YA 3KVOA 1SOWA 1IL0A 4IINA 4YVFA 3DAGA 3FPLA 5CDTA 3RC2A 3NAQA 3FNEA 1AHIA 3F4BA 3BHJA 3GDOA 3ON5A 4EYEA 4J4TA 4YPOA 4BKUA 4BNIA 4E33A 3SLGA 1QSGA 3QVOA 4R9RA 1XDWA 4FFLA 3OH8A 5IZCC 1N1GA 2GZ2A 4NFYA 2UUOA 3S1LA 4JK3A 3ZU5A 4PZEA 4B3JA 4MVJP 1QYWA 1PJCA 4AJOA 3AM5A 1DFHA 2NACA 3RKUA 3RUCA 2X8LA 4WLOA 4NJMB 4E5YA 4JP2A 1B8PA 3U62A 4CMJA 1ZMTA 2CF6A 3PK0A 3JD2A 4AL4A 3FRJA 2I76A 4MIEA 4YT2A 4XA8A 5A04A 2PWZA 4FC7A 2BFOA 4TQGA 1VSVA 1GV0A 4ESOA 3UW3A 3INTA 3GHHA 3VKUA 1TLTA 5L51A 3KM0A 2C7GA 2UV8A 4J4HA 4DC1A 4CODB 5HRUA 5DZSA 1EE2A 1OAAA 1RWBA 3D4PA 5G0TA 2XXBA 3SXPA 5K0ZA 3EAGA 4LRSB 1SMKA 1EMDA 1Z75A 2EWMA 1I33A 3MOGA 4GVLA 4EJMA 1VSUA 3A4VA 2G17A 1PS0A 4IDGA 1EEHA 1ONOA 1MV8A 4OOEA 3QVSA 4IY1A 4XQ9A 3ZWVA 5IDYA 5CPFA 1LNQA 3COSA 3OETA 1ZK4A 1CQJA 5JO9A 4BNXA 4J3FA 5JPIA 3D3EA 4B7CA 2VQ3A 3WFJA 1AHHA 1E5QA 4AJHA 1EDZA 3C7AA 3GLQA 3BMNB 3HDYA 2O3RA 3IS3A 3ZNOA 4BGVA 1R4NA 2ZJ0A 4LVCA 2YFHA 4NFHA 2DVMA 1DJNA 4WLFA 3MWEB 1FDSA 1VKNA 5BSFA 1UAGA 2IDZA 2VYVA 3ZWYA 2VOEA 2A4KA 1U3VA 4BQPA 2HLPA 4BHTA 1KC3A 5IG2A 4PZCA 3PLRA 3ZV6A 3VZQA 5C3MA 4JBIA 2VCYA 1B8UA 2ILTA 1ULUA 2HQ1A 3ASVA 1X15A 1GQYA 4PG5A 2VNSA 4RZHA 1NXQA 1HDGO 3UF0A 3V2UA 2EP5A 4KZPA 3TZKA 4ALKA 3LC2O 2WYUA 1ARZA 3B1FA 3K2BA 3OJEA 1GYPA 3HE3A 4L9RA 1UZNA 2TMDA 4LRTB 1PR9A 4EJ0A 1NFRA 1N8KA 3KSDO 5JYEA 3WDSA 1ID1A 4FDAA 4BV9A 2DQ4A 2I3GA 4IGEA 4BNMA 3W1VA 1WAMA 2IYPA 3I9NA 4L4SA 4BGUA 4ZHSA 2FZWA 1PS8A 2WSBA 1T2CA 2EKQA 2POQX 4WJZA 4CV1A 1FDUA 3KYDA 3P2YA 2E6UX 2PA3A 1JKJA 1XGKA 1G0NA 2P91A 4FS3A 2NU8A 2JFGA 5JO0A 1SCUA 4I5FA 1HSZA 3F1KA 4IQ8A 1DBVO 1R0KA 5IJZA 1N7HA 4IMRA 5T8KC 1HYHA 3RFTA 2CF5A 5L40A 4RDHA 1M6WA 1CYDA 2VHVA 4IS3A 1U28A 4BMNA 5KNLA 2DPHA 1Q0QA 1B7GO 2AQ8A 3ETDA 2P4QA 3H4VA 1W4ZA 2X5KO 3LK7A 4NIMA 1YVEI 1X0VA 1GZ4A 1FDTA 2ZCVA 1AXEA 4RV9A 1V35A 3PDJA 1LSJA 4DBVO 2PKQO 2ZB4A 3L9XA 2OGUA 3DTTA 4HWKA 4UEJA 4CLOA 1CF2O 2X6TA 1I30A 1F17A 4FJ0A 1HE5A 4MP3A 4W4TA 4DPKA 4YRDA 1P0FA 4R1TA 4QFCA 1KVRA 2VWHA 4W6ZA 1XWFA 5C7LO 1I3KA 3E5MA 4XJTA 5ITVA 3WGQA 2HAEA 3OJOA 1NWHA 1L1FA 3IL2A 2J3IA 5TGDA 3D5QA 3BMQA 4DL9A 2BGKA 1Q2XA 4ND5A 3CZMA 3DDNA 4R5MA 2QIOA 4RJTA 2VOJA 2XAAA 1ZUD1 3UCXA 4CMCA 4R3NA 4CM9A 4ITUA 3MTGA 1M76A 3O38A 1PSDA 2PR2A 1SEPA 1QV6A 3ADOA 4BKQA 4QO8A 5CEFA 4P4GA 4E4YA 5I7EA 1ZIDA 4DLAA 1D7OA 1I10A 3WICA 4Y98A 3PYLA 4AVYA 1M67A 2HU2A 2BFPA 4YAGA 1E6WA 3EYWA 5JLAA 1QYDA 1R16A 3C7CB 3OP4A 4J1TA 5EQDA 1Y9AA 4ND4A 4E32A 2ZJ1A 3VPXA 1SNYA 4L75A 1SC6A 4GBJA 4S3MA 1PZFA 2RBEA 4A27A 1K89A 4E13A 5AOVA 2GZ1A 4QFDA 2D8AA 1XG5A 1D1SA 2OORA 2PNFA 3OA0A 4HADA 3OEWA 1T2EA 3TJRA 4PG7A 4ZU3A 3SC6A 3ZDFA 3NUGA 1BVUA 4HFJA 4QXMA 1R6DA 3ORFA 1Z45A 2Q45A 1NHGA 4R9SA 5KJCA 5THQA 4A26A 2OMEA 3UHAA 3GZ4A 1H6DA 3P5SA 3VPSA 3ZU4A 5I7FA 4D0RA 3AM3A 3U4CA 1ISMA 3ITKA 3T7CA 3UKOA 4YBZA 1JTVA 1T24A 4ZICA 1GFSA 2O7QA 1LJ8A 1K0UA 2R6JA 3MJTA 3MJSA 3ZWOA 1MG5A 4AICA 1C0PA 3LLSA 3R3JA 3KSUA 1U9JA 8ADHA 3JQBA 4R3WA 2IE0A 1E6EA 5U9CA 4B79A 5JAMA 4TZKA 1A7KA 4MKRA 2ZYGA 3PJGA 2CDAA 3F3SA 3NGXA 1FMCA 1JW9B 2OBYA 1X13A 3LT1A 2BI7A 5EQFA 5AVOA 5CDGA 3WQSB 5JDCA 1FJHA 1V8BA 4D44A 4DXHA 5C5IA 4A03A 1S7CA 3PWSA 3D7LA 3H9QA 3OQBA 5A3JA 4IQ0A 2NVUB 1Z6ZA 1QR6A 4N5MA 1MC5A 4CMIA 4L8VA 1X7GA 2NSDA 4CQMB 5FEUA 3BTOA 3PWZA 1E7WA 4BS9A 2EJVA 2YQ5A 3K9QO 1DB3A 1GZ3A 5GZ3A 4Y67A 5L45A 1PGJA 2B5WA 3BIOA 4FOSA 4NQZA 1KERA 2R2GA 1DC6A 3TWOA 3AW9A 3EZYA 1BXKA 1NASA 3G49A 3I4FA 1XHLA 2CVQA 1VPDA 2BHLA 3GC6A 2GO1A 4B4VA 2W90A 4DIBA 2DC1A 5G0SA 4AJ2A 5G0UA 1X7HA 2FZEA 1AGNA 5BSEA 1LLDA 1PZEA 2Q50A 3L77A 3RAJA 4RO0A 4EJ6A 3Q9NA 2XOXA 3KTDA 4U6SA 4C4OA 4A7PA 2AQIA 4PZDA 3BZUA 4B8WA 1H94A 1WNTA 2EF1A 3PVZA 3ROMA 5BSHA 5FI3A 4PLHA 2V7PA 1VKOA 3DZKA 3X2EA 3RIHA 4TKMA 3FNFA 3KLPX 3HG7A 5DT9A 4OSPA 1DFGA 2ZB7A 3IJRA 2P4HX 5JE8A 2CFCA 2PGDA 5EESA 1CEQA 1I01A 4HX5A 2DBQA 1KBZA 4PLWA 5BSGA 2ZB8A 2I66A 4QECA 1HTBA 4K28A 1NX6A 4K6CA 1GUYA 1PZGA 1T2AA 1DRWA 2FPPA 4P4LA 3KETA 2DT5A 5DCUA 2J5QA 3O8QA 1U2GA 1YB5A 1XELA 4OXNA 4YRAA 4RLSA 1V6AA 1R12A 1HF3A 1VLLA 1P33A 4BL5A 2VZ0A 2AEJA 3EUWA 4BNFA 4TMFA 2RIRA 2F1KA 3AI3A 1YL6A 4Z3DA 1EVJA 2X5OA 3PYMA 4CQLA 1KVTA 4DVJA 1DO8A 3QVTA 3VDQA 5CDSA 4JP3A 1T26A 1YQXA 4J4BA 3DMYA 1T4BA 4M55A 2HMUA 3ZV3A 4CLRB 2NNLD 1KVQA 4HFMA 3VKVA 1CDOA 3NDIA 1FDVA 4XDYA 2X7HA 3PHJA 1J0XO 1LSUA 4O5OA 5CP8A 1DEHA 4F46A 1LLUA 4Q39A 3JYPA 4WOKA 4OYRA 1IUKA 2YDXA 3K6JA 1WZEA 4CPDA 1XU7A 2B4TO 3WYBA 1PJ2A 5IF3A 1R66A 3IAHA 5A4DA 4UUOA 3ZWMA 1A5ZA 1VL0A 1Y8RB 5KTKA 1YJ8A 4NPCA 4MIOA 5AXCA 1AN9A 4XD2A 5F3RA 1FF9A 1GPDG 3WX0A 4YRBA 1HE4A 3ITDA 4RQUA 4RVSA 1J4AA 1DIRA 4G2NA 3GZNB 3T4XA 4H3VA 5COAA 4BB6A 3ZNQA 1MLDA 3ZWCA 5CPBA 4OXYA 1UXIA 5COBA 2NLOA 2AG5A 3MCVA 2G76A 3W6ZA 2Q1UA 4R68A 3ANMA 1P9LA 1ADFA 3GRPA 1JKIA 1JAYA 2J3KA 4BO4A 4CMIB 5I9LA 5IN4A 2PZMA 3I9MA 4JX8A 4YQZA 3GEDA 1X1TA 2I67A 2O50A 3ZWXA 1UDCA 4MJLA 3GNQA 1Z74A 4ALMA 4EZBA 4ZJUA 5L7TA 1EQUA 3ETEA 1EK6A 3S2GA 1HXHA 4IGFA 5GMOA 5F21A 4ZQGA 5HS6A 1HRDA 1WXDA 3WQRA 3QHAA 4J16A 2W2KA 1NQTA 2D2IA 2CZCA 3EDMA 3LQFA 4JNKA 4MVJI 4LCEA 1ZSYA 1EUDA 4LSMA 4JCOA 3DOJA 4HV4A 2GN8A 5TLSA 4TRMA 4BO0A 5A9TA 1XQ1A 5C37A 1A4IA 3GA0A 3T4EA 4AG3A 1QYCA 1BDMA 1ISFA 4WLEA 4YJDA 3F5SA 4BNWA 4DMMA 4CLEA 4ILKA 1ZK0A 4B4UA 2GLXA 1BHSA 1A9YA 2JJYA 4N7RA 3WNVA 5LDHA 3QVXA 1NNUA 1NVMB 4OQZA 2BRUA 1GQQA 3P19A 3RC9A 4PRKA 3U4HA 3DZIA 4Q3EA 5HTOA 4KTTE 1WZIA 3AUUA 4YAEA 4L0QA 3GVPA 3OF2A 2CDBA 1YDWA 1ISGA 4WCFC 2H6EA 4MDHA 2FR8A 4DUPA 1TVEA 5DBFA 2Q46A 2O3JA 5EL0A 3H5RA 4Q3NA 3U3XA 1E3WA 1JWAB 3ENKA 1J6UA 2JHFA 2QZZA 1B8VA 4C7KA 3DFUA 2GNAA 3OECA 3OIFA 3DHEA 1PQWA 3RFVA 4ALIA 1UDBA 3K73O 4KOAA 3C1OA 2WMDA 3SEFA 4CQLB 4NBTA 3ZHYA 2H63A 3H2ZA 2H9IA 4L74A 5KJ1A 2X4GA 2GZ3A 1X0XA 2GR9A 4XYMA 3VH4A 1HYGA 4M49A 1EUCA 4KUHA 1N2SA 4OAQA 3U9LA 2GN9A 1YE3A 2ZYDA 5JY6A 1O5IA 2YFQA 4RLHA 2VYVD 3UCFA 1ZJYA 2Z95A 4FGSA 1DIGA 2E49A 3N7UA 3U0BA 1BSVA 3RFXA 1Y81A 4DPLA 4R54A 3KLMX 4OXKA 4RL6A 4JJGA 1PJLA 4WEQA 4ZD6A 3HSKA 4PG4A 5IXYA 5JAZA 3SX2A 5A9RA 4JLWA 2A9FA 4KQWA 4YWJA 1A4UA 2DBVO 4GQAA 4MVJE 4QSMA 3QWHA 3WBBA 1DRUA 1BRMA 3WWZA 2H1SA 1LEHA 3CIFA 3DBRA 4UULA 4JGBA 4E12A 3MEQA 1E7QA 2D5CA 2B36A 3JD1A 3BTSA 3Q2IA 1BW9B 3W6UA 3AI2A 5KWEA 4CR6A 1VL6A 4CR8A 1LLCA 1GDHA 2DKNA 4HNHA 2BMAA 4B7XA 1I3LA 3H65A 3VVBA 4AFNA 4GGOA 1LDNA 1M66A 2YV3A 1OC4A 3TQHA 3WOHA 3ZW8A 3GQVA 2VN8A 4PGFA 3TDKA 3K92A 3NJ4A 2GSDA 5B4VA 2A92A 2Q1SA 2X23A 5T57A 4NHEA 1P31A 3PJFA 1SAYA 4O63O 5COQA 3PI7A 4O0LA 5FI5A 3WFIA 2ZTMA 5U1PA 4HXYA 3R3SA 4XIYA 3FI9A 1IPFA 1QRRA 1LLQA 4WCFA 4YT8A 3HFGA 1DAPA 2VTEA 4CM3A 4MVJF 1HDZA 1QP8A 1W0CA 3JQAA 1ZK2A 1NR1A 5L53A 3HZZA 1MC4A 4MIYA 3E9NA 2O48X 2O2SA 2O4CA 4PLGA 1LX6A 2PD6A 3E8XA 2BFMA 2DTXA 2VZ9A 1PL8A 3IKVA 4XJSA 2Z5LA 3AFNA 1R4MB 1C0LA 5B1YA 3V5NA 3HN7A 1B3BA 3EW7A 1NPDA 1BG6A 5EPOA 2AXQA 2C59A 2UVDA 1PGOA 2EP7A 1KEUA 3RJ5A 1EK5A 3GRKA 5HM8A 2Q2QA 3NDRA 3QWBA 1NQ5A 3RC7A 4B7UA 3TOXA 3IIEA 3AFMA 4L4RA 3M2PA 3M6IA 1UXHA 1HLPA 3ADPA 4TWRA 5ENVA 4PLVA 5IAAA 3CTMA 3RASA 2QX7A 3DL2A 5BNTA 3OA2A 1I3NA 3C85A 1ADCA 3PGXA 4TZTA 4WECA 5B4TA 1U8XX 4IQGA 4CL8A 4BMVA 1N9GB 3GOHA 1ML3A 2X0NA 4NR0A 1DIHA 3GNSA 4OMUA 2AW5A 3ZHZA 3NTOA 4XDZA 5ILOA 1U8FO 1F06A 5DNAA 4Y6RA 3UOGA 5ITWA 3D0OA 2HMWA 4CUZA 4DQXA 1DAOA 5KCZA 4O59O 1ISJA 3R0IA 3DR3A 4S1VA 1KY5A 4L73A 3KBOA 4MINA 1I2CA 2HKIA 1QYVA 4J91A 2EGGA 4BO5A 4R4JA 4GX1A 2PY6A 1WDMA 3IUSA 3GT0A 2I6TA 3KHUA 2IEDA 1XYGA 4WLVA 3I4CA 1RM0A 1I2ZA 4I08A 3E9MA 5TIIA 4FCCA 1P3DA 5LC1A 2BI8A 4FR5A 4CM8A 1U3WA 3BMCA 4DBZA 3GPDG 2X86A 4DPMA 1C1DA 1YQGA 3DHNA 4PCVA 5MDHA 1PX0A 4GX0A 1NHWA 3JQ6A 1QKIA 4W7HA 3S8MA 1K6JA 4L76A 1BXGA 3EVNA 4GSKA 4TRRA 3H9GA 1E3EA 5DP1A 3Q2KA 5K6AC 1E1LA 3K5PA 4RPJA 1VI2A 1DJQA 3FN4A 2Q1TA 5FFFA 3TRIA 2HMVA 4BNGA 5CAEA 1MXHA 3R6DA 3FWZA 5TF4A 4ZQHA 1V3VA 5JMWA 1EFKA 2FSSA 3GUCA 4AJKA 1CIVA 1C0IA 3CXRA 4MVJM 1AE1A 1D4FA 1LQUA 1U3UA 1YOVB 3BXXA 5IDXA 3BA1A 2EIHA 3JQ8A 1NAIA 3ROPA 2WEKA 1YBVA 4LK3A 3TL3A 4CM1A 5TT0A 3GGOA 4I5EA 1RM3A 4FFPA 4AJPA 2DTDA 1NFFA 4WCFB 4QO7A 3WLFA 2D0IA 2C2XA 4NI5A 3ZU2A 5KJEA 4FJ2A 5JW6A 5L7YA 2B35A 2XXJA 4HFNA 3U49A 2JCVA 3ONEA 2PKRA 2W8ZA 3AY7A 3PWKA 1ENYA 3RU7A 1HKUA 3JQ9A 1YB4A 4XEHA 4D7AA 3TF5A 2Y93A 4RZIA 5F1PA 1U5AA 4XX0A 4RPHA 3H7AA 2AQHA 1UZMA 3FD8A 3FHLA 3PHIA 2Q4BA 3ROQA 4J0FA 3GPIA 2FSVA 1A72A 1P1KA 2FY8A 1ZXLA 1E1KA 3INRA 2AE1A 3RD5A 5CEEA 1P74A 2DUWA 4I8XA 2W98A 1XA0A 4PLTA 4WKGA 4PLZA 1I0ZA 1U1IA 2QRLA 4RPKA 4X54A 2GASA 1GQ2A 4BQRA 2OL4A 2YV2A 5H82A 2OXIA 3WMWA 3PZBA 3FPCA 3H8VA 4R1SA 1C1XA 4IS2A 5DCWA 2NU7A 1PQUA 2UAGA 1PGNA 3AJRA 1S6YA 1Y9EA 1PJ4A 2BD0A 4UEKA 4IJWA 2E48A 4AJIA 3JQBC 3OIDA 3QV1A 1U4SA 1HLDA 3QWAA 4J2OA 1YH3A 4IDBA 2OUIA 4J9VA 3TFQA 5TS3A 4BNZA 4URFA 3F4LA 3GMDA 1HDRA 1EE9A 2JFHA 4ZQBA 3LVFO 3ZNPA 5K6AA 3FTNA 1YL7A 4M86A 3PFWO 4CV2A 1PWZA 3G3EA 3OBBA 1E3JA 4GVXA 2X1HA 3QVWA 4UUMA 2EGHA 5A03A 4G65A 4BNVA 4YR9A 1E3IA 2NADA 5JDCC 1EVIA 3UVEA 4ALNA 5FF9A 2Q3EA 3ONFA 4CUKA 3PXXA 3WIDA 2ZTLA 4DRYA 2NWQA 3B70A 3VH3A 3NYWA 1V3TA 1P1FA 4LW8A 4IJKA 3L9WA 5U4QA 2JAPA 3QRWA 1ONNA 2D5AA 3H5NA 1UXGA 2Y0DA 5TJ9A 5EJ2A 5ENDA 3C7DB 3UUWA 3U4IA 2IZ1A 3QW2A 5C7IO 4E2YA 4CLHA 4YJGA 2EERA 2JAHA 3TZHA 3PEFA 1O89A 2GDZA 4NBUA 3RBZA 4NBRA 1XSEA 4FB5A 1JVBA 5KKAA
chains in the Genus database with same CATH superfamily
3I09A 4WXHA 3U44A 4E51A 4S1PA 1I4DD 3BD7A 3ISTA 4MHOA 4R01A 3U7QB 3GLIA 4EABA 2BEWB 2EV9A 2AOUB 2SKEA 3SHQA 3CY6A 1KEPA 5D6NA 1TD9A 3R24A 4MQ4A 3WYEA 3OEYA 1XR3A 2B4QA 3DAPA 3L8MA 4QUBA 1RHUA 3Q87B 3R0ZA 4ZRNA 2WWGA 5EHNA 3L92A 3E9QA 1WHSB 4PR3A 4HX2A 3UKDA 2FAXA 2WAAA 4OFBA 3E48A 3TLBA 1Y8QA 3PPWA 3TZBA 1I94B 2HA7A 1RKQA 3AJAA 1JVNA 4P4TA 4PYNA 3NEYA 5E2AA 2UZ1B 5A9SA 2E1PA 2PMEA 5JSZB 4K3UA 4DR3B 1CLUA 4E21A 1UT8A 2J9GA 3FMOB 4K81B 4PYRA 4QYIA 3RFFA 1JA9A 2HDWA 4KHPB 1C0KA 2VDNB 2WTUA 3B6KA 5JJ5A 1IY8A 4JEUA 2UUAB 2B25A 1MQAA 2FNAA 3K5HA 1NN3A 1GUFA 1HT2E 1WL8A 4CNQA 4D5GA 1QG6A 2LIPA 3V1TC 2XDWA 1S3FA 2WG1A 3PXGA 3SYLA 1LQTA 4YJHA 5JANA 1I8TA 4RD0A 3UT5A 2HEIA 3JASA 4OI1A 4JI0B 2ZTVA 2WTEA 4UHJA 4B3MB 5J3JA 1LFAA 2FZ4A 4PRZA 5IC4A 2E5LB 4AWBA 3SZRA 1ORIA 1T9GR 3VAYA 3RT7A 4D4MA 1AA6A 1U7UA 3FPHA 4QT4A 1NW7A 3K0AB 1CZNA 4V24A 3S99A 4XARA 3CLRD 4LE0A 3UN1A 2R8PA 2IT1A 4PYQA 4R9NA 4IUBS 3UHPA 5JSHA 3F3YA 5KNBA 3AUAA 2NUTB 3FNGA 3AMVA 2J3DA 4KMSA 4WKCA 1G3RA 2RIPA 3LQ1A 3NT5A 3SCZA 1H23A 2CMHA 3HV2A 3FB4A 4LOHA 4UAVA 4UOZA 1GTRA 1H2RS 1T3SA 4I6GA 5KOIA 3JD3A 1PR2A 1W6UA 3MS2A 3VHRA 1FJGB 3IRUA 4OJYA 3S55A 4F8JA 1RQXA 5A5GA 5J2UB 5HBGA 4MRVA 2OZLA 3B9BA 1XNQB 2HYDA 4IH4A 4YRFA 1I9GA 2QRMA 3ESDA 4HQNA 2QVGA 4MUYA 1QMPA 4EHKA 4O2BA 3TL6A 2O3QA 4WKBA 3VBEA 4IBOA 1IZ9A 3PICA 1F7UA 1MAWA 5IM4A 2XT0A 1R15A 4FW8A 1E9AA 1L7EA 2R8RA 4P1ZA 3ZY2A 3OQJA 4XAQA 4A23A 1NVWQ 1BRTA 3IE0A 3O9ZA 4F8EA 3HZOA 4YUZA 3O93A 2GWRA 2XGGA 1JTEA 1MEOA 2ZKLA 3FPBA 3I92A 3KSMA 3L84A 1T4CA 4L4XA 5D6OA 3UJ3X 2PUEA 4MULA 3TXYA 2X58A 2C9OA 4LVUA 2YNMD 1QKJA 1U1CA 3TG8A 3DZCA 4DIOA 1VRWA 4Z8YA 3RR2A 3EUFA 3RQSA 2A1UB 4RA6B 2AR0A 3GEBA 4H7KA 3DA8A 1EHIA 1YJBA 5JS2A 2HPHA 1WUYA 5KYXB 1RKXA 1K86A 3AKYA 3EC2A 4RY2A 4YA6A 1ULHA 1ORRA 3KUUA 2GCGA 3NVDA 2XBMA 3I42A 1PTJA 4EB0A 5CFZA 3RQIA 2WHQA 3QLUA 2ZR7A 2P9JA 2WJYA 4INOA 2VHYA 1W88A 1X80B 3L6OO 3NGLA 4G81A 5B7NA 1P4RA 5JYCA 1Y5IA 1N7IA 3EFHA 1DAMA 3OJCA 4GOJA 3ZCQA 4YMHA 1SHJA 2X0DA 3JQGA 1J42A 3CUKA 5A2GA 1EDOA 1HI9A 4V0SA 2AHOA 3IUBA 3U3OA 1NU6A 3P4YA 4B75A 2FWNA 3OTQA 4RE6A 2F2TA 5FLEX 5GIPE 4MWOA 1U9YA 1U3CA 1K4KA 1RW4A 4RWZA 1NMQA 3EVTA 5DNDA 4QUJA 1RXEA 2PVCA 2RGWA 2FUCA 1FFSA 2GAIA 3OY2A 3QE2A 3DEFA 3OLVA 5G02A 8ATCA 1RXSA 3IUPA 2AN9A 3JWIA 3LWBA 1E4YA 4RYDA 4FN5A 5AQ1A 1KO8A 2JASA 4MGZR 3BPSA 3V8BA 1P4GA 4D9EA 3GMSA 4GEGA 3KK0A 3BXPA 1IEXA 1AKQA 1S3SA 1P75A 1V1MB 2O2HA 1FP2A 3IELA 4WZAE 2VT2A 2Q29A 5LP6B 3H0EA 1UBEA 4COOA 2XDAA 2FR0A 1HMYA 1X7XA 4LSGA 5AKZA 4UREA 3BIFA 2F3QA 1WMDA 3KFVA 5B37A 1U0TA 4LOAA 5DLQC 1B0AA 1MMFB 2ZE7A 4X0EA 1JQ3A 2V7UA 3X2FA 5FTKA 3ZI4A 2YYZA 4LN1A 3EH2A 4RY0A 1F2UA 1XYYA 4BQQA 1TECE 2OCGA 3MCAA 4HPJB 5JS8A 5LU9A 1XKTA 3OM9A 2AG8A 4YLYA 3IIIA 1YR3A 2CMDA 3AY6A 4WK4B 4ZQFA 2HGZA 4J3NA 3AIIA 1Y4SA 1JG1A 4DQUA 2H7YA 3RFCA 5DISB 5F12A 5HQTA 3HB4X 4ZARA 3SC2A 5I3CA 5BT9A 2BBWA 3ILXA 3QPWA 2M6RA 3SYMA 4F71A 1OX6A 3HVIA 1UKYA 3HXKA 1X14A 4OQYA 1VJ0A 4QX6A 3N5CA 1DBRA 3Q72A 3T7KA 2PV7A 5LYJB 3EEQA 2VUIB 2J5RA 1LWNA 1DMSA 2RC6A 4PZ0A 5C80A 1E6CA 2ZBRA 2CUKA 4EF4A 3H6HA 1Q7BA 2GN4A 2DFNA 4P83A 3ZK9A 1X86B 1DMRA 4TTJA 4GE3A 5HK8A 3SX0A 3PDUA 3VTAA 4BB9A 3U09A 1SH7A 1TIBA 4U7DA 1WETA 1Y1TA 3ESAA 1QLWA 3K16A 3CH7A 3PS9A 4UBKA 1P9WA 2QTLA 1KHTA 5AI4A 5CA0A 3S1AA 2YW2A 2G8LA 4J90A 1JDJA 1G6KA 1JXQA 1Q0LA 2JD1A 1PFVA 4EY3A 3BHMA 4K05A 1J90A 5D86A 4FYJA 5F2KA 1KDOA 3VHXB 3ZH9B 3ZGLA 5JNRA 2ACVA 5CDHA 2I87A 4QSHA 3WZMA 2GETA 1Z4PX 2WPDD 1P18A 3ZBPA 4EY6A 2H2IA 2QRVA 3RG8A 4CCWA 1D1TA 2YQZA 1L7XA 1N6OA 4MOWA 4DLWA 4CKWA 4N3GA 2IEYA 3VH1A 1T8PA 2WMNB 3EOBI 1DBIA 1DJOA 3BT7A 2RH9B 2C3MA 1RMTA 4LA4A 3STWA 2O07A 2INGX 4RMIA 2IPNA 4L51A 4RMHA 3AOEC 3NHMA 4NESA 5CXSA 1DZIA 4D9HA 1KWGA 1HZZC 2J32A 5BR8B 2ADFA 5E4JA 4EX6A 1VPWA 2H59A 1VGRA 1BE0A 2XAUA 3GDWA 5LBIA 3ZGOA 2X8BA 4Z51A 2NSLA 1F9EA 1QHHB 3LGXA 1KZGB 3LRPA 1T2FA 2VPIA 1OVGA 5F5LA 2WYIA 4HT3B 5LQAA 1W25A 1NM5C 2F3TA 3K6KA 4X92A 3SC4A 4BFLA 1KQGA 2NUAB 1FSGA 1SCIA 3E7WA 4UCQA 3PHLA 1E61A 2IYTA 5E8JA 2XI4A 1U5BA 3PYXA 3R7FA 2C82A 3LKVA 4A2CA 1Z2PX 1VHLA 2A14A 3AHDA 3HXTA 2NO6A 2PUVA 4XW2A 4CG1A 4DXAA 1XK6A 3CPEA 4J49A 1VIYA 2DECA 4ZVNA 1NW8A 4MCHA 1F8GA 1KJNA 2J9ZB 4WUVA 3A28A 1YCFA 1SO8A 3UGQA 5KPDA 3M1YA 4MP6A 2EDAA 3DAFA 5TXGA 3UH1A 2DERA 5LVAA 1SRQA 3W4IA 1G4UR 3VR6D 5BYAA 4MP8A 4Q03A 1U0FA 4RQTA 1D1QA 5BUCA 4R5HA 3L7KA 4BJHB 4EL0A 1T2DA 1CY7A 3GH3A 1TRKA 2PMCA 1P5JA 5IEBA 2B69A 1VI5A 2JGLA 5JCPA 5F9MA 2ODNA 2CNDA 3GFOA 1LPNA 1T8RA 1YDEA 3DLIA 3HVUA 4HTFB 4LZPA 2BCEA 5T5QA 2QAGC 1G3UA 5BSVA 3BHNA 4Q37A 1VIVA 3I0MA 4NX2A 3NXSA 3PL1A 4MQBA 1M74A 4OL9A 4X1IB 2YV5A 3WGZA 5CFLA 1L2TA 1N6NA 3R5JA 5D3QA 5KTRA 3B1JA 4JKYA 4B6EA 3WVNA 1Z7YA 2AL7A 1T1JA 1P45A 1VLMA 1V7CA 3C3MA 1E92A 4O02B 1JLMA 1C9YA 3UCEA 1JE0A 4N12A 4U2CA 4F4JA 1G8PA 3L1JA 3NWOA 3QYJA 5LBUA 2YV1A 2AD5A 2D1YA 1ZVKA 2NQTA 2X76A 4RIFA 5A03A 4LBZA 4J7UA 4N0EA 4HEA6 2HZ7A 2Y1KA 1V71A 1FRNA 1GO2A 3PHGA 1WCV1 4JVMA 4DCNA 1QFYA 3GUHA 4GP9A 4MQUA 3B9PA 3UAGA 1UWLA 3U4GA 3K96A 3NT4A 3ZBTA 3IQWA 5JHHB 1XMSA 3WB2A 3DZHA 4HGPA 4QLOA 3ZDEA 3PFFA 2XT6A 3CRMA 5KKCA 5A05A 3GCGA 4YMTA 3OOSA 1BEZA 3VYVA 3E5RA 5CIQA 1NZJA 1JHOA 2GB4A 2Y1DA 1N0VC 1VPTA 2PXAA 1IYZA 1X1EA 3C5HA 1H6CA 3CPSA 2ZWIA 3S2YA 1QWOA 4F7WA 3M9LA 3VR3D 3WSWA 5JEDA 3IQEA 2YHSA 1GZ6A 1U2DA 2R751 3IP7A 4FB5A 3RKSA 4BWFB 3PE3A 3UMYA 3ABIA 3TSOA 2ZPAA 3C3XA 2AZDA 4B3GA 1MOSA 1P44A 1W5EA 2N47A 3PKJA 1HETA 1MB3A 1PE0A 1SQ0A 2AC7A 2X5JO 4W9NA 3ESYA 3GMIA 5I9MA 3KXIA 1DXQA 2A94A 4E6PA 4Z9BA 5JH7F 4DUYB 2WP0A 4RD6A 5FLKA 3CLUC 1AGRA 2QYHA 2ODTX 3BFXA 3QF4B 5IJ0B 1Z18A 3WKDA 1K6MA 2DQSA 1DI0A 3GY0A 5FV4A 4CRWB 5B58T 2CK3D 2OLKA 2B0JA 4OA5A 1J23A 4PVCA 1PS9A 3QZUA 5DYGA 3H4MA 5DBIA 3NV9A 3AHHA 4GWLA 3S40A 3SJCA 4BO9A 2BGWA 2G1AA 1N5OX 5JYDA 4GDFA 4P3OA 1EG2A 2DOKA 4G1UC 4HDNA 5E4TA 5F1YA 4AZTA 3VOBA 4E70A 1WY5A 3I5UA 2GBGA 3GPLA 1YFLA 4OSOA 3PQ5A 2XR1A 5HKKA 3OJ0A 1GYRA 1SXJD 1ZK3A 1IONA 3KVYA 1OI7A 4MVJD 4DLLA 3V8EA 4FUTA 3GP8A 1A04A 1YHZA 4MIKA 3WGYA 2EBWA 1V5WA 5CLLA 2DFVA 2XXAA 4HDSA 4MYDA 1TU4A 3BKWA 4H3KB 4Z9YA 4F2GA 4HF7A 5CFOA 3WMXA 1SWWA 2PFKA 2OCKA 2QYOA 5GOZA 3C1TA 1W7AA 4I4CA 3TCXB 1PL6A 2PK3A 4QUAA 1ZUNA 3JTMA 4L16A 3EN0A 4PSDA 4RD1A 4S0ZA 1Q1GA 4X6UA 5EMHA 3ZXUB 1EB8A 2WJPA 3HA5A 4RK6A 1NXOA 3BMNA 1TU0A 2QTTA 5B6JA 5CFPA 1XTBA 2GKSA 1NL3A 5JUWA 3AFIA 1Q92A 3UJHA 2Z2IA 2OXRA 4QDUA 3I72A 4QPJC 4KWIA 1QF7A 4BEWA 2A0KA 5JC8A 3D7NA 4YRJA 5DLYA 2RGYA 3A70A 1BYIA 4R1MA 4L0MA 5JHGB 1MZPA 2ZSBA 3RJTA 2Q2WA 4O4IA 1Y5LA 2J9RA 4FD3A 5I9BA 5K3DA 4KLAA 5B3KA 1MX9A 4LSWA 1SB9A 4BOYA 2H9AA 1I3CA 2PSDA 2YR0A 1XNJA 2W93A 4IDDA 5BXYA 3KKOA 3EX7C 3AUFA 4NBWA 1NPYA 2A0FA 5JAIA 3BOSA 3U19A 1M8PA 3K8ZA 3O8OB 1TW2A 4F7DA 3W2IA 3HY6A 1VSBA 2HXYA 4DG9A 3HSYA 2QW8A 5EZYF 4IILA 1N3LA 3U80A 1N2EA 5HIKA 4HQOA 3RRFA 1ZJWA 3V34A 3I2JA 2MJLA 2PM8A 4FXPA 2D59A 3VTZA 4DA9A 4AZ0A 4GE0A 2VL7A 2MSEB 1RMQA 3CS3A 3DNPA 4IGAA 2QU8A 4JJIA 4ZHQB 5JCJD 5IYZB 3TL2A 2IYEA 4IRMA 4LZJA 3HGTA 4UNPA 5E1MA 1EAYA 1NX9A 2I8AA 3QQ5A 4IH1A 2DY0A 4LYFA 1VDMA 2Q4EA 3DOOA 4MDYA 1UODA 2FUKA 2J7PA 1VPLA 4CJXA 2BW0A 3FBWA 2LCIA 3G2OA 1A4XA 4A8JA 4E1AA 3F96A 2V74B 4MRRA 2HT6A 3CKYA 3G2QA 1P9NA 5CLGA 4G8JA 4OAPA 3II6X 1IZZA 3EXIA 4ABYA 4H6VA 4BNTA 3EQ8A 3TO5A 3KKLA 3JRXA 1M2FA 2WFLB 1L4BA 1Z73A 3AEZA 2QT1A 1AF7A 1EJ0A 3D59A 1Z6GA 3G9ZA 4QFBA 4EBFA 3O4HA 2CZGA 4LI3X 4ZAZA 3JYQA 1N5DA 2QGZA 3EVEA 3SX4A 1Y7PA 3H1PA 4OIMA 4WY5A 2ZYVX 5H4HA 2EQ5A 1OBHA 1ZMBA 2VNIA 2W2VA 4EITA 3EGDB 3P9YA 3WR5A 2YINC 2Z5VA 2HMTA 1QIEA 1V4BA 2QRNA 5EZ6B 2J7KA 2V4ZA 2PHZA 2Y66A 5I8WA 3UYKA 4ER3A 3SNKA 3TGLA 2NOAA 3U7FB 3DEIA 3U3MA 1GV1A 2HSJA 3ASYA 1W36C 3DM9B 2D7DA 1H5QA 5EERA 1CLEA 2X3FA 4YJKA 3A9RA 1IVSA 1XJ5A 3QVGA 4K9MA 5DSXA 1T3ZA 1Z6PA 5JBIA 2H7XA 1DKLA 5E9JA 3R7SA 2COEA 2V7WA 1Y48E 3KZVA 4INPA 3O4IA 4MQMA 3IDOA 3ROZA 4NLLA 5JQGF 2IH2A 2J0SA 3F8TA 2P1ZA 2ST1A 3QMVA 2PLAA 4ZTBA 3GT7A 4X9XA 3FR7A 4FMBB 2C9CA 3C6BA 4BFUA 5LA6A 1RRVA 5I48A 2O5CA 1MO4A 2UXDB 1QIIA 4BLPA 4DJ5X 3U7HB 2Z2JA 3JVVA 2HSEA 5E1DA 3ZCSA 3N6VA 4F3KA 2NP7A 4XR4A 1ISRA 1KZYC 4HAYA 1D8AA 3CNNA 3KJGA 4HBZA 3CQ9A 4P80A 4MKZA 3VKGA 2YS7A 2I4NA 2HEGA 5IAKA 1QYXA 1S9DA 3NIWA 2IV3A 3TAHA 2BDEA 3AXSA 3WGMA 4YLGA 1HG0A 2HJHA 5AK6A 3L04A 1XTQA 4F2DA 3J81k 1FQWA 3SBDA 1YDMA 4S2UA 2YN4A 3K0CA 5JXJA 1RWWA 1CE8B 3R3UA 1H9CA 2C3PA 4UVGA 1WW2A 3ZUGA 3LUJA 4MKXA 1BJRE 1UH5A 2OV3A 3DMFA 1Y34E 5L8VA 1XXLA 1W5TA 2FSHA 5AXBA 3KQUA 5LU8A 3I45A 3OQIB 2OFOA 2BTQA 4H77A 4IHQA 3RT1A 3TIGA 2ZIZA 5K01A 5LJLA 4DBLC 2JGFA 3VU3A 4JMLA 5DYNA 3S5JA 4OX9Y 4WFIA 4DKJA 2DKFA 5H3CA 2R5WA 1XIVA 1LF5A 2IW1A 2ID7A 2Y1LA 3HB7A 3IPRA 2QU7A 2PZAA 3IOYA 1QGED 3X3HA 2O54A 2D06A 1XJCA 1I5EA 2ZJBA 2QG9A 5DHRA 5FJJA 1EIZA 1QP7A 2GK4A 1HBJA 1PLJA 2IYZA 2WV9A 4TPKA 1QNLA 5DBOA 1KJJA 1KYQA 4Y30A 5IW8A 5LMCA 4G26A 4B3TB 1XRSB 2A58A 1E3SA 2D2EA 4TV8F 4HS9A 1N2BA 4M1EA 4YJFA 3L8CA 2UUBB 2FP4A 4D45A 3KYBA 2Z83A 3DVQX 4OGGA 3QPCA 1QS0B 1LQ2A 2FMFA 3LMKA 4GEKA 5TJHA 5MFZA 1VC2A 3E9EA 3T9EA 1J5PA 1E60A 4ID9A 3GRUA 2GVZC 5BV1A 4XWAA 4HNVA 2HF8A 1AKRA 2JJ1D 4G9GA 4FZVA 4K1LA 4TKLA 5INTA 4O4LB 4KVAA 4I9GA 5LIRA 1EP9A 1WIWA 4LWOA 2KLHA 2ZQYA 5DTQA 4JXZA 2OOKA 2XBUA 2HA2A 3R7AA 16PKA 3FKQA 3PRHA 4N7MA 7REQB 1WB9A 1N9ZA 3KKKA 1NI5A 1WE2A 3KSZO 3A6GA 1R27A 2FFJA 3I9LA 4RJJA 4G5QA 3MWDB 4OMDA 5EIFA 3MMXA 4EGFA 1VCHA 2C5FA 4Z4EA 3LZCA 4N7BA 2H2GA 2AJDA 3F9CA 3QX8A 4ZO4A 5IABA 1PFKA 1OGIA 4D3DA 4YP0A 2JL1A 1EK2A 4PC7A 3BMCB 1AQ6A 3KQOA 1JLLB 3LX8A 3CZRA 3SSNA 1CS0B 1UEIA 4YJ3A 3T1HB 3GEPA 1AXGA 2DF8A 1XNHA 4U00A 4BVJA 4CQMA 2CN1A 4FYPA 3F3MA 2GCNA 1P0PA 2VLBA 4LHWA 5D3ZA 5DFAA 2ZPUA 1DPGA 3VPBA 1OXUA 3WB1A 2FW8A 1BXGB 2YFYA 5FLXA 1SELA 1E1YA 5ALWA 5CYPA 4YPVA 3PSHA 1Q3HA 2JLXA 3O1HB 1MX5A 1FIUA 4N8DA 1Q0SA 3M1LA 2PPVA 4Q3BA 1XQ6A 1C30B 3PITA 5IASA 4GWGA 1R6BX 3FUTA 1TAQA 2RONA 4EHBA 1G5RA 3RTCA 1TO2E 3WNCA 1A2KC 5EPEA 2EW1A 2GAFA 1BH6A 4IDEA 2IZOA 4J3JA 5E9WA 1E9DA 1B14A 4TROA 3VKWA 3KKMA 2ZIVB 3NO4A 2RC5A 2OKCA 2VBCA 2VDWA 2XCIA 2XVXA 3DDWA 3ISVA 3REQA 3OOYA 3TRDA 2X2PA 4DGSA 1ZONA 2Q1XA 4FSDA 1QGYA 1M1XB 4E07A 4J0KA 5FUXA 4B7ZA 4BVKA 5LWQA 3LQQA 1Z2AA 3E6AA 2P9TA 3W06A 3VXKA 1F48A 2QE6A 1FS4A 2FPOA 4PXSA 3MQ2A 3MINB 2C03A 4RX1A 4C6TA 2QSYA 5IU6A 4UZFA 4LGCA 3RUDA 4JXJA 2PGJA 1IOVA 4N65A 3PJEA 3I8XA 1GA4A 1CYEA 1IHDA 4UOQA 3W6NA 4UM7A 3OCXA 4P0PB 2D2VA 4UQPA 4H16A 5JFOA 2JCYA 1O77A 3NRCA 4ZEWA 1EQAA 4MVCA 2J4DA 2W2MA 1E3LA 2Y0EA 1M6VA 3TUIC 3RBVA 3URKA 2IUUA 3IOMA 3GEMA 4CKEB 1IBLB 4YCJA 3RO7A 2HRZA 2WZDA 2XQFA 2MOKA 4S0XA 5TMBA 4DOMA 3C1AA 3MJFA 4G09A 5SY6A 4EW3A 4ED9A 4XUDA 1I0LA 4C43A 1XCBA 4OGKA 2ET6A 3UB2A 3ORRA 3UOAB 1MX3A 3JYNA 4L4YA 3PNQA 1ZCFA 2W4MA 3L7DA 2CXXA 1I6LA 4O2AB 1GSIA 2D1QA 3ONDA 2XQGA 4N76A 3E7FA 3LX4A 5KAMA 3AR5A 3IAFA 3ANSA 4IWXA 3RK1A 3N07A 1K6XA 1KO1A 3AIKA 3DWGA 4MO2A 1OOEA 1BA3A 1K27A 3PA6A 4BDSA 4ZZ0A 1ONPA 4KB5A 1SUAA 3NP7A 1CU1A 4TSFD 5T8KA 1KKUA 4KV9A 3TMKA 3UGKA 1AHNA 1D9XA 1SZCA 2IUEA 2WDZA 5T64A 3RAGA 1XLVA 2JCSA 3OQVA 4CFZA 3IAEA 3ZDZB 3NANA 1JEJA 3QSGA 5DGCA 1FFHA 3C6QA 2O3TA 4CMGA 5EXPA 2HREA 1S2OA 1CUYA 2Q28A 5ENZA 1BCRA 4BFXA 4MR7B 3L7AA 3L40A 3VPGA 4P32A 3ZQ4A 1BFUA 4WL0A 1AF4A 5GVRA 4BRWA 5G2OA 3ANTA 4M87A 3BSYA 1EHCA 1NKSA 4KE8A 4KO3S 4IF6A 1TXGA 1TADA 2I3AA 2R6ZA 3IOBA 3PFIA 4GPAA 4NU8X 5E6RB 3Q6NA 4A82A 4KIFA 1NPTO 1DC5A 4AB1A 4P38A 1BZYA 3IMFA 4EA7A 1B15A 1U8EA 3OT4A 2PD4A 4JFRA 4XB6B 2W2XA 1R0LA 5TPZD 1AZWA 2OFXA 2D2XA 3KB6A 3MHPA 5BRNA 2XB4A 3GJXC 1S0UA 2ZDGA 3KUXA 3NHPA 3CO5A 2BEVA 3L7JA 2JI7A 1VLQA 3OZSA 4L5AA 2X4IA 4R51A 5AMXA 2DX7A 4FKBA 3A1WA 1G3IA 3RTAA 4CTMA 4IXTA 4YEDA 4D43A 3LTNC 1MB0A 1FFAA 1P72A 2IODA 1R6UA 1YMVA 2H4XA 1ICIA 2FLVA 4IPTA 4RVUA 4IFEA 4M8LA 4CL3A 3AHEA 1ZIOA 1T5OA 2G63A 3V1UA 1TLLA 3BWMA 2YWCA 1VYVA 2M1XA 1PD1A 5CCEA 3ODGA 3D4BA 4A0RA 5B55A 2EEZA 4J7AA 2K7FA 1JIXA 2IYYA 2JGJA 4C4PA 1JBQA 2WTMA 3ZY4A 4FHFA 4OHXA 4G01B 2VNAA 5ECDA 2HADA 4C4ZA 4YUYA 2DAPA 2IE8A 2AN3A 2DJ5A 4JLJA 2HF9A 4GPTA 3VR5H 3Q1KA 3R9KA 4EG6A 3KQNA 1JXAA 3Q3CA 4ZAFA 2H5LA 5KDDA 3DBLA 1K97A 3HDJA 4RKYA 3FRHA 5AW0A 1JT9A 2BKXA 3ICQB 4MRAA 1IJBA 4GPIB 4Z99A 5FOUA 5B36A 4YECA 3CFYA 4NBNA 1U0HC 4K9RA 1CZHA 5G41A 4P4NA 1M54A 2WJ4A 3C0KA 3FCOA 4V02A 4EG4A 4KR9A 1QK3A 1QZUA 2UUCB 3KEOA 1VRVA 3AHCA 3TAXA 1D3AA 2ZUEA 1GLGA 5CB8A 3QU7A 4MX8A 4BB0A 3T9DA 2IY9A 3CNHA 1K92A 1EGAA 1RWPA 1AIPA 3D5TA 3K2IA 3IQXA 1C7QA 5LCXA 3T15A 3I5AA 3VC7A 3D9QX 3N2GA 5IFLA 2B8EA 4G2TA 3JZFA 4LJKA 5CK4A 3TTYA 1LWOA 4EZEA 3G7SA 3B89A 3WYCA 4F21A 3IQHX 2FRDC 1X70A 1T9DA 1WW8A 5CXXA 4ENRA 3HP4A 2FQYA 1HR0B 3I2YX 1T4DA 5J59A 2IFTA 2YVUA 3A25A 1U7HA 3W8DA 2QGFA 5HDBB 1I13A 2PGLA 2JEYA 4NULA 3EA4A 2SCUB 4RQBA 1JFFA 1ZRNA 2YWFA 3K20A 4Z4HA 4NC9A 4PYMA 4PLPA 5AKIA 5E7MA 5JATA 4EZIA 1KWKA 2YS6A 2NO1A 4A15A 1PWEA 3PL5A 2XJ4A 1DFIA 3SLRA 3K1AB 3DHYA 1DAEA 2O8DA 4UAGA 1XKLA 4X44A 2Y1WA 2Q3BA 1SD1A 1EPUA 1YRBA 3DXFA 4QXQA 4U0JA 4WBNF 5I7OA 2QG4A 5IBRA 1HQDA 2GSWA 2QR3A 3IE1A 2ENWA 1AGYA 2ZRIA 3M6LA 3RSZA 4C3OB 4S24A 4LYYA 3RABA 4EVSA 1P1RA 2JLCA 1VBKA 1WXXA 5TQJA 3D3KA 3R3YA 2HHHB 2PZKA 1MQSA 2OHXA 1P0CA 2C83A 5LXTA 1P1JA 3DMTC 2AK2A 1P81A 2XTMA 3MRTA 5TR9A 2ZUCA 3ENNA 4FBGA 3VU0A 1USUA 3RUFA 2ZULA 2DXIA 1QIFA 3B9QA 2D5BA 4QG7A 4XRRA 1H6AA 3GVIA 4LHXA 1NQWA 2J3LA 3UXHA 1R6AA 3MWGA 5KDLA 3NMUF 1KMHB 2DM6A 1F5NA 1UP7A 4TV9F 1QH8A 2EJTA 2FV8A 3ENQA 1M2JA 4RMNA 2OZKA 5TPWB 1AZTA 5E3IA 1QOQB 4OQPA 4ZVKA 1GG5A 1TKAA 4L5CA 5I9NA 4UEOA 2IYRA 5EJ6A 4MW1A 4PZPA 3B51X 1L4YA 1SK8A 1KAEA 2CVZA 3DVAB 2R8EA 4BQFA 3LK6A 4G6ZA 3IVXA 5F5NA 5IDWA 3LWZA 2V6MA 1BW9A 4UW9A 3UBTA 6AT1A 1V11B 5KVSA 4LNUB 4N3AA 4KXNA 4I55A 1E79A 5J4YA 1H2HA 3EXG2 2DLDA 3FYTA 3OJLA 3QUCA 4HGRA 4JR1A 2QR5A 5AH0A 3KZCA 2XDQA 3GLGA 3GK3A 4IKOA 4OIFA 2R1UA 4CM4A 2B8NA 3G2HA 2VUSA 4FS8A 1U2EA 1Q0RA 4NEGA 4PW0A 3HN6A 3OICA 4Y2VA 1L5SA 4MRPA 1O9HA 3HEMA 1TM3E 3W78A 3MTJA 2JGEA 1HYEA 4YP9A 2EG9A 3S0JA 1WDKA 2G36A 3HVJA 4I4LA 2Z56A 3QH4A 2G9NA 3SM9A 2PSJA 4BE9A 2ZRPA 4J1SA 3ILSA 1U7ZA 5IH3A 3A9WA 4YAJA 1QX4A 2AJCA 2ZT5A 4PVDA 4HZGA 1H6BA 2HRDA 4Q0MA 1M1YA 3BIXA 4G85A 1E9VA 4MUJA 2R6AA 1KAOA 1IQUA 1D2NA 5BN3A 2FDXA 2FKNA 4EW6A 6CHYA 4QFMA 4CM5A 3MA0A 5A5EA 4BP8A 3EFOB 2EJBA 2JH8A 4GSLA 3THSA 1A1VA 3MWYW 7YASA 1SVWA 1H0RA 3QUSA 2JAQA 1P0MA 3I9OA 1QLHA 3SMQA 5JPCA 1QV7A 1YA8A 2BUAA 4LJ9A 1LDBA 4RELA 5B4UA 3PKIA 2YN2A 1HNWB 5AJHA 5JDIA 4X7BA 5KNDH 1TEHA 1EYZA 2WU0A 3HADA 2JZOA 1ILEA 4V1CA 2ZOSA 4Y7DA 1WQ4A 1WU7A 1F0NA 5K0NA 5TGZA 4A73A 4CEIB 3GFVA 3SF8A 3V7NA 3DXYA 4I5GA 4B3RB 1MJNA 1KI8A 1PSWA 3NDBB 3M9XA 4Y1EA 3LE8A 3NYIA 4KREA 2YWDA 1DWUA 1BA2A 4JL5A 1MR3F 1ZK1A 3AK4A 4KCGA 4CN9A 3LSYA 5JARA 4I81A 1H3EA 3A05A 3P2IA 2ATVA 1C2YA 1T9KA 3EEYA 4B0OA 4CHGA 2PUJA 1X42A 2NO4A 1MF7A 2CB9A 3G2KA 3IC5A 4PYIA 4TVOA 3S2IA 3TOSA 3UMBA 1I7QB 1W4LA 4UVHA 1SXGA 1DCKA 3CSDA 1ZC4A 1ZJ6A 1OZFA 2AFRA 5E6SA 4HMPA 4GMGA 5FWAA 2IWHA 2MSWA 2IYQA 2UZ0A 4C5CA 5GIOE 3DE4X 1IZYA 3RF6A 4EL5A 5JAHA 3MCUA 3AERA 2AI2A 2GARA 4B32A 3B1YA 3EIHA 3KKQA 4P5EA 4I4IA 5FP0A 1EGHA 4WFKA 1M2EA 1RXCA 3AR9A 4HNRA 1RYFA 2CFOA 2AFIB 2O8NA 3LHFA 4R69A 2G0TA 2VHXA 1RC8A 2R00A 3HA7A 5KTNA 4P9NA 4ZMBA 3ID6C 4MKFA 3B82A 4LBWA 2QRKA 1QJCA 2YXDA 4LUCA 2NW6A 2CGEA 3CMMA 4NVRA 3OD1A 4P86A 4Q05A 4W99A 3T7JA 4CCYB 2OBNA 2X0IA 1KDYA 2NUPA 1GADO 2G70A 3TECE 4LF7B 2D1TA 1PEYA 3TZQA 3CX6A 4RKWA 4XUEA 4QTYA 3H6KA 3QHQA 2I71A 2GXUA 3GVXA 3ZGVA 3D6MA 3HJBA 5DIFA 1P2VA 3DNMA 4FQ8A 1GNVA 1K5HA 1HT3A 4RKQA 1GG2A 2J5KA 2CE7A 1NBIA 5LOVF 2R4QA 1SUCA 2OO5A 3VPCA 2R4TA 1DT5A 3KL2A 4E1BA 1IM5A 3WIBA 4G0WA 1NBHA 3H1FA 4B4WA 1PGQA 2P77A 2C20A 5B58C 3I6ZA 2ZSAA 4UUNA 4BWGA 3LWNA 2PRIA 1NBMD 2BFBB 2Z8XA 2WU1A 3UJDA 4MR8B 1IE3A 2WHRA 5IAEA 3I01M 4RW0A 3JQ7B 5I51A 3G79A 3MK31 1Z0AA 3PNYA 3NAZA 3O26A 4CIVA 1WZ2A 3SQDA 1F38A 1ZBQA 3IPLA 1EGVB 4G5GA 4B40A 1CEEA 3A1SA 3PIIA 4IIBA 3HXMA 2NM0A 2W6JA 4I4TA 1Y3HA 3I23A 1A9ZA 3AR4A 3LJKA 4IJVA 1X87A 1A9TA 4P7BA 1J1ZA 1CEYA 2R6GA 4M38A 1LDYA 1U2SA 5J2TB 1MOZA 2BEUB 2JIQA 4TM7A 3T34A 4XPIB 3V80A 2RHHA 4L02A 2R8XA 3OTIA 4HP8A 4X6LA 1NN1A 4D1YA 4P81A 4LJRA 2QXYA 2ZIWB 4U9IS 1RZRA 4XIJA 1YOVA 3LD9A 3LX6A 2P5UA 5C2JB 1NFQA 2FE4A 3PKZA 4X95A 3U4QB 1BS1A 3PDIB 1KDVA 2J6IA 4OK5A 2FLWA 1QMGA 2WSMA 4IIUA 1TCAA 4TS3A 3FI0A 1BWSA 2Y3IA 1NR7A 1OKKA 3DC2A 1U2ZA 4C04A 1B0UA 4LS3A 1FCJA 1XLTA 2GJ8A 3D2AA 1YQDA 4BKMA 1YDHA 4NEHB 3BCSA 4TT3D 3A6ZA 3RNLA 1OILA 5ALTA 5IVKA 4JOSA 3CEMA 2VJAA 3FOAA 2AR9A 3IUEA 2FMTA 3OFSA 2M6SA 3GGGA 2PQ0A 4Z9FA 2ZFUA 4O6VA 3D3NA 5TVGA 3L7YA 2CL5A 5K0FA 1GCGA 1YNOA 2GILA 4BNHA 3B3GA 4FFOA 2AA3A 2BBOA 1VXRA 4R2KA 2EG5A 3FWHA 2JLYA 3A4IA 3Q3HA 1KVUA 3HFSA 3UTDA 3K8QA 4D42A 3G9QA 3SE0A 3WGVA 5K7SA 2DR2A 4ZOLB 4LISA 2I54A 2ZJAA 1MRZA 1PJQA 1OBOA 2NO9A 2XF2A 2I4LA 2O7SA 3FIJA 3HXPA 4Z4QA 3RHSA 1JHDA 1P91A 3R6WA 5F76A 3QKSA 3RSGA 1E7MA 1JPNA 2Q5CA 2I65A 1EFVA 4K03A 3ZPXA 3EQZA 4B6FA 1V43A 4BTEA 3IJPA 3NEAA 3DBHB 4LWPA 1RT9A 1U0RA 3WDMA 1EM8B 4CM9D 4I1UA 3NBAA 3NHSA 1QOZA 1G1MA 1YB2A 1YBMA 3PDCA 4ZO8A 1Z7GA 4JEIA 4Y1GA 2Y99A 3ACDA 3QWFA 1YACA 1ZJZA 4FFRA 4MUHA 5EFOA 5BSWA 5K3EA 1C29B 3BH0A 1Q15A 2DLNA 2W2LA 1Z5NA 3ND8A 3Q9SA 2GEFA 1QBGA 1Y9DA 2IIVA 2IOYA 1Q95A 4TQUS 3UJBA 4D3SA 1NVGA 1XHEA 4H0NA 4UMEA 1YZGA 4TMXA 3BTUA 3MGBA 521PA 3RHZA 4EGSA 1IL0A 4IINA 5FTMA 3UQZA 2VR1A 4JB3A 3A6HA 1OXSC 4K6KA 3UT6A 4K86A 2WIGA 3CT6A 3NUQA 3NAQA 4AF8A 4H7HA 1V3QE 1E64A 1SXJC 2CW5A 4ESHA 3BHJA 4LXGA 1C9NA 1UBOS 3N0WA 3DPIA 3P94A 4KR0A 3QLVC 4EYEA 4YPOA 3KHSA 4MDEA 4KG7A 2D54A 4QOHA 3R9IA 3DDHA 2H48A 5EWLA 4IJ5A 1H0SA 3I62A 4LEIA 4WZ6A 3ZGZA 1T3GA 4P3YA 1N1GA 5IZCC 2UUOA 4B6SA 4WI1A 5LZ8A 2VHQA 1F6WA 1GN9A 4B3JA 3BWBA 5BP7A 4MVJP 1QYWA 3C3AA 5HF6A 3G5MA 4NK5A 5CURA 4AJOA 1BVHA 1DFHA 2ZIEA 4RFVA 3RKUA 3T0IA 4EHNA 4E5YA 2OAQ1 4O29A 4RK4A 2HT1A 3BSWA 3ZD8A 1FDRA 4CMJA 4EAQA 2BYTA 4AL4A 4X1KA 5KI6A 1D2MA 1CD5A 1U28C 2PX8A 3KXKA 1KBQA 1O5TA 4TMZA 1W85B 2CXUA 5A04A 5LL6P 3KZ1E 3ITNA 4MUFA 4JI7B 4FC7A 1U0GA 4YONB 1GV0A 2OXCA 3F6BX 3UW3A 2VTBB 3INTA 2G9UA 4ADSG 1CZOA 2QZ4A 3LH5A 2P7HA 2C7GA 2VP9A 2UV8A 2AF4C 3UMJA 4CODB 4CQJA 5HZKA 1J5XA 4KO1S 5HJ2A 3RS8A 3P2JA 2PYDA 4L5IA 5ICCA 2XNJA 3UTCA 2C77A 1TUGA 4JJEA 1SMKA 2DMRA 3SYTA 1OLOA 2ZVJA 4EATA 4FE3A 1I33A 1VSUA 3A4VA 3UUFA 1EBBA 2CNKA 5AOCA 1EEHA 1ONOA 4A8TA 2P2CA 2V7TA 1E69A 1MV8A 4GZMA 1MCZA 4W6QA 5CB4F 3R8CA 4IY1A 3EW9A 3ZWVA 5BYJA 2PU5A 4DQLA 5CPFA 2Z98A 2WM2A 3U7QA 1SGWA 4UTOA 2AOUA 4EGJA 1NJ1A 4J3FA 1O03A 3D3EA 2VQ3A 4JR0A 5DIZA 4AJHA 4MJ3A 4NV3A 2A8YA 2X3YA 5BSTA 1EDZA 2XOKD 1IATA 1JRLA 4LDZA 1ZGGA 2GWHA 3ZNOA 1JR4A 1E1RA 3OOHA 2YFHA 1WHSA 4WKOA 1DJNA 3HS3A 3MWEB 3OZFA 3S2ZA 4X41A 2NMVA 3GLUA 1PUJA 1VKNA 3I6MA 4TTQA 1UAGA 2IDZA 3U7JA 2JA1A 5HZGA 4FHGA 3SJBA 4AS1A 1KXJA 5EMNA 1RP7A 4O2BF 4GC5A 1T5IA 2G7ZA 2UZ1A 4BHTA 4DDMA 4PZCA 1DTWA 2GBFA 2G8NA 3GGCA 3RREA 1WO8A 3WO0A 3ZV6A 2ORWA 1ZPDA 4Y2UA 1U1GA 3M1IA 1ULUA 2CJYA 2H1CA 2HQ1A 1W4BA 2OM6A 3O3NB 1X15A 4L8GA 5EJ5A 3KT8A 3T1YB 1E9CA 2VNSA 4CYMA 1QK4A 3PUWA 4AIRA 2IHYA 4ZVQA 3NTUA 3F98A 3VZCA 1DGQA 4AMGA 3DOFA 1VB3A 3OJEA 3A3YA 3EPRA 1X1AA 2J3QA 2X77A 5KS2A 1WR8A 1A4RA 3TLXA 1GYPA 3SS9X 1MT0A 1VGVA 3VYSB 3S1SA 5SZHB 1MDBA 4G37A 5SYMA 4TWZA 3K0AA 2ECKA 1A69A 2I4OA 3ORSA