3JQFA

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and inhibitor 1,3,5-triazine-2,4,6-triamine (ax2)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
267
structure length
249
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design of pteridine reductase inhibitors targeting african sleeping sickness and the leishmaniases.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Oxidoreductase
molecule keywords Pteridine reductase 1
total genus 92
structure length 249
sequence length 267
chains with identical sequence B, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2009-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3jqfA00
3G1UA 1JA9A 1AHIA 1HE2A 4ALJA 5JAIA 3AY3A 4IJKA 4QO7A 1KEPA 4ZGWA 1E6EA 4MDHA 2VNAA 1CQIA 5B37A 3WS7A 3DMTC 3RD5A 2HRBA 1WLYA 4Q3BA 4JGBA 5TRTA 4CM5A 4D43A 3ONDA 4D79A 1D3AA 4YT8A 2SCUA 2FP4A 4WEQA 1W73A 1HDOA 1HSZA 5DBGA 4EJ6A 1DHRA 2Q3EA 3ZV4A 1U3WA 2HMVA 3WWYA 1I30A 5L4SA 2PH3A 1GPJA 2NNLD 1X0XA 4GAEA 4BGUA 1RYDA 1BG6A 2O3JA 2A94A 2BI8A 1PS8A 4WLUA 1WDKA 1ENZA 3F5SA 4TZKA 3GDOA 3JD1A 5B12A 3P2YA 3KRTA 1QYDA 4E4YA 4N5LA 2B0JA 1XU7A 3PZRA 1ZUD1 1E3WB 4XWYA 2O48X 3FPCA 3JYOA 2JL1A 2RCYA 1UZNA 6ADHA 3GRPA 3TPCA 3U9LA 1B3RA 4J4HA 4B79A 1UXGA 3BTOA 3TFOA 3WTBA 1V35A 2YQ5A 4UUMA 4LSWA 3VDRA 1B26A 4A7PA 5C7OO 4CMIB 4MVJI 2VT3A 1ZXBA 3RBZA 3ZZNA 1G0NA 3ANMA 4E5KA 4XYGA 5ES3A 3KB6A 4E13A 2FPGA 1GUZA 1E1LA 4HNHA 4O63O 1M2WA 3DB2A 4L76A 4WNCA 1A7AA 4BKPA 1O95A 5JW6A 4KTTE 3QWIA 3M1LA 4E2ZA 2I66A 2VOEA 2HUNA 1BW9A 2OBNA 1H2BA 3RI3A 1DLJA 4FOSA 4K6FA 3VZPA 1E1MA 3DL2A 4Z0PA 1J0XO 1QYXA 3V1YA 3WXBA 2D5AA 1I32A 4MJLA 4AJOA 1YO6A 2Y0CA 3JQAB 2EV9A 4QTZA 4FFRA 1IPEA 4A03A 5LDHA 2FOIA 2AQHA 4IXWA 1EDZA 4CM8A 2Q1UA 4PLCA 4M89A 2QIOA 3O26A 2AQKA 1HT0A 3U4IA 4XB1A 1QXSA 4CM4B 4I1IA 5IDWA 3DEYX 4R1NA 2FHSA 3ZHBA 1GU7A 1VJ1A 2D3TA 3PVZA 4NH4A 4EUEA 4XRRA 1DRUA 1J5PA 3BHIA 4DGSA 3D64A 5JNLA 5LDGA 1ADFA 1B16A 2AEFA 3I9LA 3KYCA 4PLHA 4W7IA 5BNFA 3RUFA 5T6BA 3DFUA 3BHMA 3I6QA 4OJNA 4PGFA 1VE9A 4XEHA 3V2UA 4I5DA 4RPKA 2O7SA 3H9GA 4AJ2A 2NQ8A 3FD8A 3O4RA 2EG9A 4BO0A 5IXSA 3WDSA 4JROA 1U2GA 4PZEA 1ADCA 4LMPA 5CHEA 1SZJG 4FFMA 1P74A 4MOWA 3RKUA 1HDGO 2QRJA 1HKUA 3JQDA 3IUPA 4J7UA 3GGOA 3V5NA 1Z45A 4R16A 1PJSA 3OQBA 5CFZA 2YV1A 5JAMA 3ETDA 4ZVVA 5KJCA 1EVIA 4DC1A 1CERA 1LEHA 1L7DA 4AJIA 4CLOA 4Y6PA 2B4RO 4RLSA 1WZEA 1ISFA 5KKAA 3KZVA 1ISMA 1PTJA 2EW8A 2Y1FA 1E1KA 1DAOA 1OZAA 1XKQA 2P2SA 4BHTA 3EUWA 4NFYA 1MXFA 1SEPA 1EQ2A 2GLXA 3I6IA 3S2FA 4I9HA 2PD6A 3K8ZA 4RF3A 3MTGA 3FF4A 1CWUA 4ZRMA 4RORA 5JYEA 3I9NA 1P0CA 3LC2O 1RM0A 4BO6A 1WMBA 2DC1A 2PKRA 4J2HA 3Q11A 3EZLA 1J4AA 3DWFA 3FNEA 4GX0A 1Q7GA 2FZWA 4M87A 2A35A 2J3HA 3U0BA 4WNIA 2NV6A 4MKRA 4FGSA 1XEAA 2CDBA 4BKRA 4MVJE 1XA0A 1VM6A 3JQ6A 3KSDO 2PNFA 4DXHA 3NGLA 1X14A 1PL6A 3WIDA 5JAZA 3WNQA 1YL7A 5ITVA 1A9ZA 1UZLA 1ZK4A 1PJ3A 5H82A 4N7RA 2POQX 2B4TO 1VPDA 4GGPA 4ZQEA 3WOHA 5ILOA 2GNAA 1K3TA 3IJRA 2X0NA 1MP0A 3FSRA 5MGBA 3RUDA 4WGGA 1PQPA 4NDNE 1R0LA 1JW9B 4CMAA 1UXKA 1HRDA 4CL3A 3GUYA 3I3OA 4AJ4A 1E7WA 2AE2A 2HMSA 1UP4A 3HQ4O 5IJZA 3GAFA 5DCYA 4YXFA 3OETA 1N8KA 5F3RA 4DIFA 3RBVA 3JYNA 4ND1A 5JBIA 3AM4A 1KVUA 1Y8QA 5DDIP 1PS9A 3ROQA 2DPHA 1ZVMA 2CDAA 4XGNA 3ZHZA 3Q2IA 3FNFA 2HQ1A 3CPSA 3KVOA 1YBAA 2GN6A 3RSHA 1Y9EA 4HFNA 3DAPA 3DZJA 3SX2A 4OOFA 5MDHA 1LNQA 1X7GA 1AHHA 1X7HA 3E03A 2Y68A 3F47A 1L1FA 3H5RA 2PZLA 1E6UA 1V3UA 2I76A 4NI5A 3VPXA 1LLCA 5KWEA 1X1TA 3NEPX 4XZ3A 3OICA 2VRCA 3DOJA 4CM4A 5IZ4A 3I5MA 1BHSA 4EITA 2WD7A 4DIBA 3Q3CA 2EKLA 4Z3DA 1PL7A 5B4TA 5A04A 2BH9A 4TMFA 3RVDA 3FBGA 4PRKA 3HDYA 2GSDA 1U8FO 1UP6A 1VRWA 3BMCA 2P9EA 4IDCA 3DAGA 2NADA 4HADA 5L7WA 2FZEA 2J8ZA 3WR5A 3JYQA 1B2LA 5ICSA 5CDUA 3CKYA 3UXYA 3WIEA 4RVUA 2P5YA 3JQCA 4O59O 2EJWA 1N7HA 2HKIA 4L4SA 3KSUA 3H3JA 1NVMB 3CTMA 3PDJA 3RBXA 1R15A 4BMSA 3WX0A 5HM8A 1JAYA 5THQA 1CDOA 3L77A 3RJ5A 3HZZA 5TGDA 1TEHA 3C7DB 5JO9A 4GWKA 3KYDA 1ZXLA 2D5CA 4FBGA 4RPHA 5A9SB 4R01A 3ZWBA 1DSSG 1MGOA 5CDSA 4KQXA 1NHGA 1Z7EA 3G17A 2RH4A 3GHYA 1VKOA 1KOLA 2BF7A 1A27A 1I24A 1DJNA 4GQAA 4YAKA 1K0UA 3JD2A 1HE4A 4KZPA 2PGLA 3RU9A 3C24A 3H5NA 4CQLA 4HFMA 3PJFA 2W2KA 4PLTA 5ER9A 1QP8A 3IC5A 1V9LA 2RHCA 5DP2A 5JDIC 3G3EA 2DFDA 4PLYA 5JLAA 3DBLB 4OM8A 2Q1TA 2IZ1A 5A05A 3AUAA 3AU9A 8ADHA 4IDGA 3GZ4A 5IAAA 2HCTA 1JN0A 4LSMA 2YW9A 1Q2XA 1H6AA 4KDEA 3SEFA 3UGKA 4IINA 4YT5A 5JYDA 1EFKA 2PLAA 3DZFA 3A28A 2BGKA 3MJCA 4RZHA 1Y9AA 3JQFC 1EDOA 4CM9A 2DTEA 3KSZO 3F6YA 3S8MA 3FTPA 3PYXA 3K2EA 4DLAA 1E3SA 4L9RA 5KNLA 1SOVA 4Y98A 3GUCA 1UXJA 1Q0QA 2P91A 2Q46A 2ZATA 3VDQA 4ZRNA 4BGEA 3K6JA 3AUSA 1DPGA 2R00C 3U3XA 3INGA 4F3YA 5ICMA 4YPOA 1NHWA 4HP8A 2OORA 3JCZA 1J49A 2PGJA 3DONA 2FPPA 3PPIA 3B6ZA 1B14A 4RVHA 3VC7A 3WQSB 4AJJA 2FN7A 5TIIA 3ZV6A 3R6DA 4EZBA 3QHAA 3EC7A 1UDCA 5TNXA 1ZK3A 5HS6A 4B4UA 2DBRA 4OQYA 4Y8VA 5H83A 1F0YA 4RF5A 4J3FA 3L4BA 3LF2A 3BTUA 4C7KA 3D5QA 3IUSA 1HYEA 2UUOA 2C0CA 3GMSA 3PWKA 1NAHA 4M54A 4FDAA 4L8VA 3DQPA 1RWBA 2VUSA 3DZBA 4PRLA 1QYVA 4NG5A 3CH6A 1R4NB 3VPHA 5EESA 2O3SA 1DIHA 3DXFA 4FIZA 4HUJA 2DBVO 4J0EA 2WTBA 3H9JA 4PVCA 2X9VA 3LF1A 3QWAA 1LX6A 3ZHYA 1I2BA 3I9KA 2HK7A 2VWQA 3GFBA 4J90A 3ZHXA 3LT2A 1RM4A 3D0OA 2P9CA 3PQDA 1QYWA 1OOEA 2NVWA 4TVBA 4P4NA 4I5FA 5JDIA 1OAAA 1GEEA 4NBUA 4CV2A 2GERA 2JAHA 1ZK2A 3PP8A 2C7GA 3T4XA 3WBFA 4EYEA 1U5AA 1SAYA 2YUTA 5C37A 4YT2A 5EQDA 3GK3A 5B1YA 3D5TA 5TS3A 3C1OA 4ZN6A 2H6EA 2AE1A 3OJFA 3KOUA 2NQTA 2QQ5A 3QWFA 4BO3A 1NVGA 3MWDB 1ULUA 1GQ2A 3A06A 1CYDA 2BGMA 3NTOA 2IXAA 1BDMA 5IN4A 5T8KA 3TNLA 2Q4BA 3PXXA 1ADGA 3LT4A 4OSPA 4BO8A 3E8XA 5TJ9A 3H4VA 2YHUA 3EY4A 1V8BA 2GN4A 3KEOA 2HJSA 3L6OO 2GYYA 5GMOA 5A9SA 3WYBA 2AMFA 1NQAO 1Q7BA 4FSHA 5EINA 5C7IO 4R5MA 5TX7A 1E7YA 1X7DA 2O4UX 3BAZA 4GSLA 2ZTUA 3ADOA 3ZWWA 1TLTA 4LVUA 3FRJA 3GVPA 5DULA 5G0UA 4E32A 1MUUA 3OEWA 2IODA 2ZJ1A 1GEGA 4UREA 4ZQHA 3QW2A 3ULKA 2WE7A 1GZ3A 3DZGA 2NTVA 3PJEA 4MKZA 1X13A 1WZIA 3EZYA 4FS3A 3WGOA 4CLDA 4EI2A 3QP9A 2I99A 4NJMB 1Y5MA 1B8VA 1U8XX 4AG3A 1R4MB 1P1RA 3VZQA 4XIYA 2C82A 4YTEA 4BB6A 4CMEC 2BHLA 1YKFA 3CZMA 1NPDA 3JSAA 5CP8A 2CUKA 2UAGA 3NX4A 5BNIA 4CJXA 3ZNPA 4Q3CA 2ILTA 4WLOA 4BOYA 2QW8A 3V2GA 3JD3A 1I5RA 3VZSA 1NFFA 1TVEA 3NAQA 3PRJA 4E5MA 1BMDA 4RZIA 1XWFA 5BSEA 5B4UA 1AXGA 4AJEA 5CDGA 1T2CA 1LDNA 3TJRA 3ETEA 3ZCXA 3KBOA 1U3VA 1IUKA 4WEOA 1IULA 4RO0A 4XCVA 3VH1A 1TA4A 4XIJA 3OJOA 4CUZA 1T4BA 4JXKA 2EP7A 4N5NA 2CMDA 4YAEA 3RJ9A 1WAMA 4RJTA 3V1UA 3HDQA 3KYBA 4BNXA 4ESOA 1JWBB 1YH3A 2X86A 3RFVA 7MDHA 3QVTA 4CM9D 2O3UA 3W4KA 1T24A 4NNJA 3PFFA 1DIBA 2YDYA 3UCXA 5BR7A 4U6QA 3DHNA 1LUAA 2WEKA 4LK3A 3MOGA 3EK2A 3WLFA 3ZWMA 2YY7A 5EERA 5JFOA 1OI7A 1UH5A 5J23A 1O5IA 2X22A 1DIRA 1KY4A 4XQ9A 2GZ1A 3K9QO 3JYPA 4CUJA 5AQ1A 2B35A 4XJTA 4CR6A 3PTZA 2I6TA 3PIIA 2YYYA 4YJFA 5EPOA 3ENKA 3K30A 3BYZA 4OO3A 3GN2A 4E2WA 4AJPA 2QYSA 2GZ3A 2DUUA 4II2A 1MA0A 5HRUA 1QYCA 4GKVA 4F6LA 3WYCA 1XIVA 5AXBA 3DHYA 4PLZA 3BIOA 4YJGB 3ONEA 3HB4X 2CY0A 5C3MA 2XXJA 4Q9NA 3FWZA 3ZH2A 3RQSA 3ZGYA 3U49A 1I33A 3KYDB 3SC4A 1P1FA 1NFQA 4RQUA 1EQUA 5FEUA 4ZD6A 5JAQA 3TRIA 2EW2A 3I83A 1KERA 2YJZA 1GQYA 5CG2A 3GOHA 2ZB8A 3U62A 2RAFA 2W2LA 1U2DA 1NPYA 1PZHA 5IZCA 1DEHA 4DMLA 2WJPA 2RBEA 1ZK0A 1HLDA 5K9ZA 3H9UA 4CV1A 1PGPA 2B37A 2Z5LA 4OSOA 1SCUA 3NRCA 1U9JA 3WNVA 4H7PA 1JVSA 1Z82A 2Q2WA 1IY8A 2UVDA 1SB8A 2YV3A 4DPMA 3KO8A 4BGIA 4M1QA 1GCOA 3M2PA 5BT9A 2CD9A 1T2AA 1HDRA 1FDSA 1EFLA 3GT0A 5F21A 4OIMA 4EBFA 1VKNA 1I3LA 1UDAA 3AU8A 1SPXA 3TSCA 1T1RA 4UUPA 4IJWA 1BTOA 1PWZA 1RJWA 4J16A 1GFSA 2H9IA 4CM1A 4W99A 2IEBA 3ONFA 3HG7A 5AXCA 2Q2QA 3PWZA 2G5CA 2IEDA 4FC7A 4RPGA 4EEXA 1M67A 4QEDA 2EEZA 4CMKA 4GLOA 3Q1LA 1HLPA 1KETA 4HFJA 1EVJA 1ZIDA 3WLEA 4P4GA 5LC1A 1LDBA 1G6KA 2IRWA 3I4CA 4MIYA 4RF4A 1N1EA 4KWIA 4BQRA 4P38A 1C1XA 2LDXA 2DTDA 3JQGB 1P45A 1B15A 2DBZA 1PQWA 1R4MA 1JWAB 2DUWA 5TSDA 1JQBA 3D3EA 4R54A 1NXQA 2Q1WA 2Y1DA 3A9WA 2VN8A 3G79A 1QRRA 3H6KA 1CJCA 2VRBA 4XR9A 1XCBA 2V6GA 4Z9YA 4XQGA 2P9GA 3D4NA 4WCFA 5CEEA 3UOGA 3I23A 1Y7TA 2DQ4A 4EUFA 1K6IA 4Q39A 4IY1A 2C5AA 3OECA 4NK5A 4RQTA 2ZQYA 4RVSA 4U6SA 2Z1MA 3F5QA 5LCXA 3T4EA 1NP3A 1DLIA 1H9AA 1Y5RA 5FWNA 3I52A 4TRJA 1XQ1A 1R0KA 3JQ8A 4HBGA 1IL0A 1ZEMA 2V7PA 7ADHA 1G1AA 3T7EA 3PI7A 1D8AA 1VL6A 4OQZA 1W4ZA 2ZCUA 5ENDA 4U8GA 3TOZA 2HMTA 1ONNA 1JAXA 4U0JA 3Q0EA 1NWHA 3NDRA 4MINA 3ZNNA 2H5LA 1E92A 3QVOA 4NZ9A 2FRDA 4JJGA 1NVTA 2Z95A 5CDTA 1A4IA 3H2SA 5DZSA 4WOJA 5BNTA 5I7FA 3LLVA 4CV0A 4F45A 1T2DA 3KLMX 4E30A 1KBZA 3LQFA 1FXSA 3BMQB 1ZMTA 1GD1O 1K89A 3HDHA 2O2SA 4WE3A 4XB2A 1PGQA 1UAYA 3L4SO 1QV7A 2JFGA 3AI1A 1LRJA 4QFDA 4EJMA 5L7TA 3L0DA 3PHIA 2ZYDA 3INRA 1DO8A 1ZEJA 1GYRA 5A3VA 4BNYA 1GYPA 2W90A 2BI7A 4AJLA 3GRKA 3I9OA 1ZJZA 4BGVA 4CODB 1XSEA 3WGYA 5JC1A 3PGJA 4QQRA 4F6CA 2CFCA 1WDMA 2JD2A 2X23A 2B69A 5FI3A 3W8DA 1U4SA 4PN3A 2GASA 5L51A 3FR7A 5BSHA 1A72A 1E77A 2A4KA 2BELA 2QZ9A 1I2CA 3NT2A 1NTOA 5JY6A 3OFSA 2VCYA 4HXYA 4NMHA 1P1KA 4L4RA 4WLFA 2GDZA 4J6FA 3KHUA 1M66A 3U4HA 1GY8A 2E82A 1HDZA 3OH8A 1DRWA 2VYND 3GH3A 5JXWA 1P1HA 5I9NA 4D3DA 3LU1A 1KEUA 4X54A 3K31A 4BB5A 2FR1A 2I3AA 3E9MA 3FR8A 3PGXA 4R5HA 3ZU4A 4TWRA 1ISJA 2QRLA 3GPDG 2IZ0A 3WGHA 3U4DA 1O89A 2FPIA 1NX6A 4XQCA 5DBIA 3RUEA 4J1QA 1PGJA 2JFHA 4UAGA 5L9AA 4CR7A 3EVNA 1PGOA 4GMFA 4GVXA 4ALMA 1E5QA 1C1XB 3JQGA 1D1SA 4R41A 4DLLA 1ONPA 1YB1A 2OUIA 3AJRA 2X6TA 3IIEA 4CLEA 5ER6A 1I2ZA 5IZCC 2QHXA 4XYBA 1E7QA 5U9CA 1GCUA 2JAPA 3OJEA 3S2EA 2C2YA 1N5DA 1H0KA 1PJLA 3UVEA 5U1PA 1AXEA 4DRYA 3DMTA 1O8CA 1DAPA 3VKVA 3LZ6A 2Y1EA 3LC7O 3DBRB 2XPCA 3N74A 1SC6A 4JBIA 3WB9A 3GDFA 3WWZA 4NBTA 4D44A 4QUKA 4GBJA 3FWNA 5G0VA 2HSDA 3QVXA 1AUPA 3B1FA 1MB4A 4J9UE 1DFHA 1LDMA 3ZDFA 2O50A 4NBWA 2C2XA 2JHFA 4PZDA 1HTBA 3X2EA 2NU8A 2OZPA 4Q3DA 5IDXA 3INTA 4B3JA 4OYRA 1W8DA 2Y05A 5G0SA 2NACA 4IPTA 3TZHA 4CLRB 3S55A 1EK6A 3L6DA 4IUYA 3HN2A 3ROMA 4R9SA 2J5QA 3UICA 4PG7A 1A5ZA 1NFRA 4LW8A 3K92A 1F12A 3UFXA 4RLHA 3BMOA 1VJ0A 4QX6A 3BHJA 3ZWPA 4CQLB 2GPTA 3RIHA 1K6JA 1XGKA 2H63A 2Q50A 4LGVA 1WPQA 3P7MA 4DQVA 4FCCA 9LDTA 1LLQA 2OGUA 3DOCA 1YQXA 3HB5X 1D7OA 3WFJA 2NVUB 3ZWAA 5KCZA 2V6MA 5JDCA 1IHXA 3PLRA 5TJHA 4ZHSA 1YQGA 4JBGA 4E31A 4ND3A 2VRCD 1WVGA 4Z9FA 1NASA 2NM0A 5DF1A 2OL4A 1N1GA 3ASVA 4URFA 4BKQA 4GH5A 4ND2A 4UULA 1PX0A 5CEFA 2XF8A 1HEUA 1N92A 3NDIA 2GF2A 2GUGA 3ZU3A 1EUCA 1WXDA 4E5NA 4CMHA 1C0IA 1LC0A 2VHXA 1QKIA 1YL6A 3NGXA 3JQEA 4M55A 3D4OA 4XX0A 5G2OA 4J9VA 1ARZA 2HK9A 1HF3A 2W2LD 4OXKA 2NVBA 1ISGA 4JJFA 2A9FA 4Q3NA 3AUTA 3U5TA 3Q9UA 4W4TA 4HY3A 3RROA 1NQOA 2HK8A 1VSUA 3B20A 2E49A 1MX3A 4HFRA 3IJPA 5JMPA 1QG6A 4CLHA 1ZFNA 1I8TA 4J7XA 4JP2A 2ZCVA 4K1LA 2YHIB 1JKJA 1HE3A 5KJFA 2WM3A 1R12A 3HFSA 1H2HA 1E0DA 4TRNA 3WTCA 4IJUA 3ZWOA 4IGEA 3JQ7A 4Z9XA 5CEJA 1HDXA 1WP4A 4BNUA 4WJZA 3JQBC 3QLJA 3E9NA 4BNIA 4W7HA 3R3JA 1F17A 2AQIA 1RM5A 1E7SA 5FI5A 1C14A 2G76A 1HE5A 1SNYA 1MFPA 2RHRA 3DZIA 1O0SA 3PZBA 1H94A 2Y66A 4DQUA 3ZNOA 4K26A 3UN1A 4UVGA 4E3ZA 1SB9A 3UUWA 4GVLA 3MEQA 4IDEA 4ROSA 5KIAA 3JV7A 4E5YA 3A14A 1KIFA 2Q2VA 5I9LA 3Q9NA 1WMAA 2JD0A 3N7UA 3JQBA 2J6IA 4R1SA 4E5PA 4CM6A 3D7LA 1BDBA 1A71A 2PZJA 4L73A 5G0TA 1LDYA 3QA9A 5JS6A 3MJSA 5L95A 3BMOB 1E5LA 1I3NA 2ZYAA 2EGGA 4LMRA 4WCFB 3A1NA 1UAGA 1DDOA 2AHRA 3RUIA 1U4OA 3TZKA 4CLXA 4P8RA 1X1EA 3HJAA 4IS2A 5K6AC 1ZSNA 4GGOA 3TDKA 1XR3A 2CNBA 3DFZA 4K28A 4NQZA 4BNKA 3C1TA 1ADBA 1EEHA 2H1SA 2DLDA 5L3ZA 2VYVD 4YJGA 3H2ZA 1CIVA 2C7VA 3QJ5A 2AQ8A 5FYDA 4BO1A 2C29D 1IPFA 3NJ8A 4KDFA 5JCJA 1SBYA 3D4PA 3E82A 1DC3A 2QRKA 2VWPA 4JNKA 1T4DA 2WYWA 5KVQA 3DBRA 4E2XA 1FJHA 1GV1A 3LT1A 3GVCA 1B8PA 4DYVA 1YGYA 1PJ4A 4YAJA 3NTQA 3TL3A 1YL5A 1IZ9A 3ROKA 1Q1NA 5EQFA 5I8WA 1GUYA 1R6DA 3RCBA 4W9NC 1BRMA 1VL0A 2W8ZA 3TOXA 3G1TA 4RVFA 3JTMA 4DVJA 4IS3A 1A4UA 3UW3A 3HSKA 4UEJA 3OQ6A 4TRMA 4GI2A 5JSFA 1PR9A 3OF2A 2IZZA 4KTVE 4D46A 1YVEI 5DP1A 2FSVA 3ZNQA 5T67A 3QV1A 3KXDA 1P31A 4HX5A 1BXGB 4TQGA 5IXYA 4IJVA 4XYMA 3SJUA 3VPFA 5KJ1A 1KVSA 2FY8A 2I3GA 5CPFA 1J6UA 1U1IA 2ZKLA 4I9NA 1BXKA 2ZB4A 2RH8A 3DOOA 5T64A 3WGIA 3VVCA 3MJ4A 2GO1A 4R3NA 2WYUA 1KC3A 4XDZA 5COAA 2PV7A 5A1TA 5KKCA 1G0OA 2WWRA 1N2SA 2CF5A 4OHUA 1BXZA 4YB8A 3L9WA 1E3EA 1TT5A 3VVBA 4TKLA 1V3TA 5HS4A 1DXYA 4ZICA 3T7CA 3M6IA 4IDAA 5KOIA 2AEJA 1JLLA 4W82A 3GGGA 1YS4A 2W98A 4KUHA 5HBRA 1KYQA 2PY6A 1PJCA 1XDWA 5K6AA 1C0LA 3C7AA 4DL9A 4FW8A 4I9UA 3QY9A 4J4TA 3JQ7B 1NM5A 5GZ6A 5A4DA 4WECA 1Q0HA 1NNUA 5KVSA 3V1TC 2YQ4A 1N7GA 3EGOA 5L40A 3GGPA 4B8ZA 2VZ9A 4YJFB 1PIWA 2YZ7A 1VC2A 5I7EA 1DHTA 4BO2A 3KLPX 4B7UA 1DC4A 2GD1O 5JMWA 3DBHB 4KUGA 5EL0A 4CMGA 1VL8A 1OMOA 3S2IA 3ZI0A 3W6UA 3MOIA 1T25A 3STHA 3W8EA 2GR9A 3GNTA 4B3HA 4DBVO 2WD8A 4W6ZA 2ZB7A 4FD3A 4TSKA 1DIAA 2J3KA 3NT4A 5A06A 5L4LA 1F8FA 4KP7A 1Y1PA 3NTRA 4H16A 1K2WA 4PFJA 2AEMA 2CZCA 2BMAA 2EHDA 3HE3A 1B0AA 3F4BA 3HHPA 2VYVA 3DBLA 3OEYA 4XYLA 5DOZA 4NR0A 2YFQA 3G0OA 1HYGA 1KEWA 1ZO8A 1GADO 3QSGA 2HMUA 2VUUA 4XA8A 4G2NA 4B3IA 1DBVO 1BGVA 4FJ1A 4EJ0A 4GX5A 1GTMA 1ML3A 1I36A 4BNHA 3QVSA 2NTNA 2XAAA 4NK4A 3ANLA 3HWRA 1B8UA 1BWSA 4OOEA 1IYZA 2PZMA 4XR4A 1P44A 2Y0EA 4PG5A 2OP0A 2B83A 3P5SA 5JPIA 4NU6A 3TQHA 3ZN2A 2X5OA 1YRLA 2GZ2A 1F8GA 1UJMA 4B4VA 4EGFA 3C85A 4OKIA 1R0SA 3RUAA 4ZQGA 5T57A 3IOYA 4LCEA 4TZTA 1HSOA 2XOXA 3H5AA 5B4VA 4CLRA 1E6WA 1EBFA 4QFCA 4D0RA 1RM3A 2GN8A 1YXMA 2D0IA 2OXIA 3IQDB 3PWSA 5HA5A 4CM7A 1T26A 4P4LA 1C0PA 3B1KA 4BVAA 3GEMA 4PVDA 4CV3A 4CMEA 2D59A 1MC5A 2NU7A 2EGHA 3QWHA 2ZJ0A 1RKXA 3KETA 3HNPA 3GF4A 2ZTVA 4WOKA 4M8SA 1JVBA 4OL9A 4DREA 3GEDA 3AI2A 4JK3A 4JIGA 5DN9A 2QZZA 4OGWA 1UUFA 2EWMA 3O9ZA 2EXXA 1MLDA 4RDHA 5AXDA 2CVQA 2PKQO 4UEOA 4FQ8A 3PYMA 1CRWG 4HNGA 2JJYA 3AY6A 4IZIA 3ADPA 3K96A 4BNJA 1QORA 1U7HA 3NV9A 4UUOA 3FI9A 5H81A 3JQ9C 3CMMA 4L0QA 2DPGA 3L4BC 4R68A 3UF0A 5CG1A 4BS9A 2XXBA 3E6AA 4JLWA 3GDGA 3P2OA 3ETGA 4FFNA 8LDHA 4MIOA 3ANNA 3IKTA 2IDZA 2GRAA 4EDFA 3SLKA 4MIEA 5CDYA 3FN4A 4YACA 2IXBA 4RVGA 2DM6A 1Y8RB 2O7QA 4M49A 3TZQA 1U7TA 5ENVA 1W0CA 2DFVA 5AXAA 1H5QA 4E0BA 4YEDA 3W1VA 3WMXA 3AW9A 4R1UA 1ONOA 1E3JA 3H9QA 4NHEA 3UCFA 3PDUA 5COQA 4Q3AA 1M6HA 4YBZA 3OQ1A 5JO0A 4INAA 4BNVA 4I5GA 3OSUA 3BTVA 2P4HX 3AFMA 2BGLA 2JKVA 4NU5A 4F46A 1LXCA 3FBTA 3JQFA 2Q99A 4TRRA 2EP5A 5HWSA 1PGNA 4KWHA 2QYTA 2PD4A 4BO5A 1HYHA 4IQ0A 1C1DB 2BD0A 4DIOA 5DOVA 5KVVA 5U4QA 1GZ4A 1Z74A 2E48A 4JCOA 3ZW8A 4JQCA 1FK8A 4IIVA 4WK6A 2VUTA 3S1LA 1VJTA 2TMDA 3LK7A 4XQEA 1Z6ZA 4ALIA 2VWHA 1TB4A 2VHYA 4CM3A 4Y6RA 4BV8A 4E12A 4R69A 3VTZA 1VSVA 2WE8A 5A3JA 1HDCA 4ALLA 1T2FA 4MKXA 3Q2KA 3E9QA 3ZW9A 2R2GA 1ISIA 1NQ5A 4YAIA 3WGQA 5IF3A 1VLLA 3WMWA 1TT5B 4IDBA 2OHXA 4BMNA 3PQFA 4BL5A 2JCXA 3CXRA 4RF2A 4DQXA 4CMCA 4ONEA 1EUDA 3ICPA 3KUXA 4I5EA 5G4KA 2YFHA 3JQ9A 4AJHA 4FR5A 4IBOA 3OA0A 1Y8QB 3QWBA 3GVXA 3JD0A 5I9MA 2NU9A 4YAGA 1XQ6A 4YWJA 5K0ZA 2CF6A 2J5RA 3MZ0A 4PCVA 2B36A 4ALKA 3D3WA 4NFSA 3CMCO 3PFWO 1AN9A 1PZEA 1TI7A 3RC7A 4A0SA 2HRZA 4BNTA 6LDHA 4J1NA 1GZ6A 5L4NA 1LQUA 1DRVA 1BXGA 4J2OA 3AM5A 2FWMX 2Y99A 3ASUA 3ITDA 4IQ8A 3ST7A 3D3WB 1Y81A 1PJ2A 3O8QA 4BNFA 1MC4A 3CE6A 4A73A 4D7AA 1MFZA 1IE3A 4ILKA 5TC4A 1KEVA 2CSUA 2J3JA 4S1VA 5EJ2A 3IKVA 4QO8A 4Q3EA 4R3WA 1UP7A 3VH3A 4Y67A 3GLQA 2O3RA 5TQVA 4CQMB 3TZ6A 4BO7A 3D1LA 1EK5A 1BW9B 1E7RA 3TN7A 1YJQA 2X4GA 1F14A 1YDWA 3AWDA 3OIGA 1D1TA 1CQJA 1XLTA 2Q1SA 3RC2A 1DIGA 1HZZA 5IN5A 2NTJA 2PZKA 3GZNB 3M2TA 2BFOA 4Z3KA 3RWBA 3SLGA 5DT9A 2EIHA 3LC1O 2X0JA 3ZWYA 1PU2A 1UR5A 3DTYA 1IOLA 5TLSA 3LT0A 4A26A 3R1IA 3PJDA 4I8XA 1OC4A 1XELA 1M6WA 2GN9A 4R1TA 4TROA 2AW5A 1E3LA 5IG2A 3LYLA 3MCVA 4EW6A 1PS0A 1QSGA 3CINA 3TWOA 4M86A 4RVDA 3IMFA 1F06A 1YB4A 3UHAA 1FDTA 4RCVA 3GHHA 3W4JA 3GPIA 4CMJA 4CR8A 2JHGA 1ORRA 1EZ4A 4GMGA 4GX1A 1ZSYA 5I8ZA 3KV3O 3GY0A 2ZTLA 5GY7A 3FPLA 4IGFA 4BNWA 1FDUA 2JCYA 4Z6KA 5JC8A 5KVCA 2PK3A 2Q49A 3W6ZA 4YRBA 3PHLA 1WW8A 3OM9A 4MVJH 3WSWA 1ISHA 3WYEA 3NUGA 2O4CA 2R6JA 1HZJA 1R4NA 2O3QA 1P77A 1PQUA 5EN4A 3KYCB 1UDBA 4P22A 2PH5A 1E7MA 2Y67A 1HXHA 3FHLA 3OBBA 5ITWA 2PTGA 4AVYA 3IS3A 2Q45A 4D0SA 1O9BA 5DNAA 3DMYA 4DMMA 3F46A 3BZUA 1BSVA 4I08A 4NJOA 2VT2A 4WLNA 1GUFA 2DU8A 2IE0A 2YHIA 4CM8B 4JP3A 2OBYA 2I9PA 5C7LO 1YOVB 3PHGA 1YE3A 4IZHA 1O6ZA 4Y9DA 3WGGA 1PJTA 1GAEO 2V6FA 3JYLA 3K5PA 1S6YA 4WCDA 1TT7A 2VQ3A 4UEKA 2ZIZA 5I7SA 4L4XA 4ID9A 3PQEA 4BNLA 3GVHA 4J0FA 4DUPA 4ZA2A 2OP1A 3O38A 3L9XA 3EMKA 2J3IA 1EUZA 2X58A 1C1DA 4N5MA 3EVTA 1C0KA 4ALNA 4IDDA 2WYVA 3GA0A 4XJSA 1EVZA 3FNHA 3Q6IA 2AA3A 2VZ8A 4UVHA 3SC6A 4R51A 1GPDG 3E18A 3FNGA 1PJBA 4H15A 3OP4A 2BFMA 4IIUA 4XDYA 1ZBQA 1CEQA 2VHZA 2A92A 4KOAA 2W2KB 5F1OA 5JCJD 2TMGA 4FJ0A 4IMPA 3OMLA 1Y8RA 4FC6A 5A9RA 4PG4A 1FMCA 1R37A 4FB5A 2CVOA 3UAGA 3OA2A 4BKUA 2Y0DA 4IMRA 3RKRA 2VTEA 1SEVA 1PR3A 3F1KA 2BKAA 3NYWA 3RAJA 1NYTA 4FJ2A 3M1AA 1P33A 4IM7A 4FFLA 4R4JA 3LVFO 3P19A 1XHLA 4RPJA 1V3VA 2VHVA 2DVMA 4PIVA 3MJEA 4A5OA 2ZQZA 3QRWA 2OFPA 1NR1A 5KTKA 3QIVA 4NPCA 4UVEA 1H9BA 3RC9A 2D2IA 3MWEB 1LA2A 2DT5A 3JQAA 4NBRA 3AOGA 4J91A 4YQZA 1FF9A 1JKFA 2NUAA 3VOSA 1I0ZA 3B70A 3SJ7A 3WGTA 5G4KB 1DFGA 5AVOA 1QLHA 3WBBA 3DDNA 3RU7A 3E5MA 1XYGA 4PLGA 4ZU3A 1DC6A 1ZH8A 3AUUA 5L7YA 2YDXA 4XKJA 3COSA 2PGDA 4EUHA 5BQFA 4DLBA 4G5HA 4AJKA 2JCVA 3DO5A 3GG2A 4DA9A 1QV6A 1NPTO 1L7EA 4FPXA 4YCAA 1KC1A 4BNNA 2AG5A 1AGNA 4BO9A 1Q0LA 4B8WA 3ZU2A 3W8FA 4QSMA 2EKPA 1I10A 3MJVA 4GPD1 4J7CA 1DB3A 2RIRA 4WASA 2G17A 3FTNA 3RUCA 4R9RA 4LVCA 3U4CA 4WLEA 3WQQA 4CPDA 5I7VA 4EEZA 1KY5A 4BIIA 1E3WA 1GL3A 5AOVA 3WJ7A 4BO4A 2NU6A 2HLPA 2FR0A 4FGWA 4PZCA 3NT5A 1U28A 3PHJA 3TL2A 3A4VA 5EIOA 2HO5A 1ID1A 2AXQA 4MP8A 3WFIA 3ZV5A 3OHSX 5T5QA 4MVJD 1OBFO 3BMQA 2WMDA 3IAHA 4RPLA 1EE9A 1LC3A 3GN1A 3KM0A 2EERA 1R66A 2X1HA 2X5JO 3F3SA 4Y6SA 4O6VA 4L74A 2E37A 4KMSA 1UZMA 4HKTA 2NLOA 4C7JA 4D42A 3BMNB 2WSBA 1V0JA 3VHRA 1DFIA 1Q7CA 3AK4A 1U3TA 3NDJA 1GDHA 3OJLA 5CPBA 2OMEA 2Y1GA 1ENPA 2C54A 1UXIA 4QT0A 4OH1A 3K2BA 1EMDA 4MP3A 1IB6A 4A27A 3NKLA 4GSKA 4MVJF 4NIMA 4B4OA 2BFPA 2D8AA 4WCFC 1B3BA 3ZWVA 4H3VA 3OJ0A 5JCXA 2GGSA 3OIDA 4AFNA 4LRTB 1B7GO 2O2YA 3VPGA 4XGIA 3RUHA 1MV8A 1LRLA 3E48A 3NJ4A 4BKOA 1K6XA 4E21A 4WUVA 3B1JA 1ZNQO 3KEQA 3VZRA 3WICA 2OO5A 4DBZA 1LDGA 1XU9A 2W4QA 3I9MA 5JDCC 1X15A 2UYYA 2IYOA 3TZCA 3X2FA 3ZWCA 1OFGA 4DPKA 3BTSA 3PIDA 1I3KA 1KVTA 3GZNA 3PLNA 2X0IA 1NQTA 4PG8A 3GAZA 1HL3A 1PWXA 4MP6A 1H6CA 2O23A 4YRDA 3VPSA 4JBHA 2BFAA 3GG9A 3EDMA 4ZQFA 2Y1OA 2X9NA 1YDEA 3I9JA 2ZYGA 3F4LA 4YR9A 3UCEA 4FOOA 4B7CA 2WD7B 2HJRA 3ICCA 4K6CA 2LDBA 4E6PA 4E33A 4BNZA 2EF1A 2VYNA 3GR6A 1LSSA 4U5QA 2O3TA 2X7HA 1T2EA 2FMUA 5A5FA 4GX2A 5BSGA 3BA1A 3HUDA 4D45A 1PEDA 3O8QB 4RL6A 2PA3A 1CF2O 3GFGA 3I1JA 3I4FA 3C8MA 3V2HA 4WLVA 4MVJM 3L07A 3S2GA 2HAEA 4LN1A 1LDEA 4FN4A 3VKUA 1TXGA 1H6BA 2FSSA 1N9GA 2P68A 5F5LA 4BQPA 4ND4A 4XGKA 4UVDA 4YJHB 5T8KC 3DAFA 5THKA 2WDZA 4XYEA 1PZGA 1YOVA 2F1KA 3DR3A 1JU9A 4K9DA 4TKMA 1P3DA 3WSVA 3IL2A 2AG8A 4RDIA 3VAZA 3GVIA 5G0WA 1LU9A 4MVJP 4W9NA 4YJHA 1T1SA 5A5EA 4MO2A 2PFGA 3CEAA 1KS9A 3GNSA 3ORFA 1HETA 3H7AA 1QR6A 1PJQA 2B4QA 4PLVA 3R0IA 3EYWA 4N54A 2I65A 5DBFA 1UXHA 1E3IA 5JE8A 5A9TA 1FDWA 4E2YA 4NBVA 1H6DA 2IYPA 2C59A 5TT1A 3BMCB 3RC1A 2DTXA 2OOSA 3ON5A 3VH4A 2QX7A 3DZKA 4RGBA 1A9YA 3C7CB 3DBVO 4CL8A 2X0RA 1H93A 5FFFA 3PYLA 1ZK1A 3TF5A 3ABIA 1A7KA 1DC5A 4AJNA 1LLDA 3SBOA 3GMDA 4BNGA 1IZ0A 5KJ6A 3LDHA 5AYVA 1ENOA 2PKQP 1JTVA 3HDJA 1JDJA 2UDPA 3CSDA 3E1KA 3IDSA 3UH1A 2P4QA 3C1AA 4DYDA 2R00A 3UKOA 4O1MA 2G82A 4BV9A 4CUKA 3KTDA 2X8LA 1U3UA 4CQMD 3CZRA 2E6UX 4DPLA 3GQVA 5KJEA 5BSFA 2JD1A 4MVJA 4JX8A 1V6AA 4CQMA 1WDLA 4MPDA 2G0TA 3AOEC 4HV4A 5DCUA 4J1TA 5IFLA 1GV0A 1GR0A 3CUKA 2PD3A 1HWYA 3PJGA 1HDYA 9LDBA 2BLLA 3AI3A 1Z75A 2DBQA 4J43A 4CLOB 3N58A 4YYZA 4LRSB 3EHEA 2V6BA 1ZCJA 1M75A 1YB5A 1GYQA 2HDHA 1YBMA 1R16A 1RPNA 3L6EA 1Z7BA 4J4BA 2J5KA 1S7CA 1CETA 1ZKMA 1E1NA 4N18A 4QXMA 2ET6A 4D3FA 1WNTA 4XRGA 1P9LA 1QLJA 1EE2A 1WWKA 4YDRA 3ROPA 1Y6JA 3HN7A 4UVIA 3PK0A 1X0VA 4FFPA 4GKBA 4BNMA 1MG0A 1QMGA 4DTIA 3AM3A 2B5VA 4B4WA 1K5HA 5TT0A 1Z73A 1ZZEA 3DHEA 3HADA 1SO8A 2GCGA 2ZK7A 3HFGA 1SMKA 3BMNA 4B7XA 2PR2A 1N9GB 3H65A 5G4LA 1PL8A 2G1UA 3SVTA 3WG9A 3QQPA 3C3XA 2ZB3A 1P1IA 1EVYA 5COBA 4J49A 4G65A 2C07A 3QVWA 3DZHA 4NJMA 2C5EA 2I67A 1YWGO 4KUEA 4GL4A 2V65A 3LSYA 1MXHA 1RYEA 3VH2A 5IDQA 1ULSA 2UUPA 1LSJA 3V8BA 1BVUA 3CIFA 3JQAD 4OAQA 1FDVA 3W4IA 5ADHA 4OMUA 1XG5A 2VTDA 3PHHA 4Z0TA 5A02A 4U7WA 1P0FA 5F5NA 2QG4A 5F1KA 3E5RA 1YBVA 1LLUA 3IP1A 1LSOA 4AL4A 3QE3A 3WGZA 2E4AA 5ILGA 3ZWXA 1O94A 1I01A 1LI4A 2NVUA 4S3MA 2C20A 2B5WA 5IDYA 2I5PO 4MVJG 4CMBA 3R3SA 2D1YA 3WQRA 4AJ1A 1NAIA 2NWQA 4OXNA 4PLFA 4J1SA 4D3SA 3PEFA 3AOEA 4QECA 5TF4A 2P5UA 3EW7A 2CVZA 4AICA 4LCJA 1EBUA 1LJ8A 4L75A 3AY7A 3LLSA 4UUNA 3RFXA 1NWCA 1W6UA 5GZ1A 4ND5A 4FFOA 2VHWA 1SOWA 1KVRA 3RASA 1C3VA 2F00A 4G81A 4KQWA 2NSDA 4DC0A 1LQTA 5HTOA 1D4FA 5CAEA 3ZU5A 5L53A 2EKQA 4YVFA 2VOJA 4ZJUA 3K73O 3DC2A 4XD2A 4GLLA 4U0KA 4ITUA 1YJ8A 2JFFA 2Q4EA 2EJVA 1AE1A 5L45A 3TFQA 1IHYA 1YQDA 3F9IA 3O03A 1LBEA 4TVOA 1ZW1A 1ZMOA 3GNQA 1P1JA 3MTJA 5C5IA 4BMVA 1I3MA 4JN6B 4BUCA 1JKIA 2CDCA 4PG6A 3JD4A 3ZWNA 5EMHA 1OC2A 3ENNA 3F1LA 4LISA 3GC6A 2VWGA 2BRUA 2Z1NA 3OIFA 5DCWA 2HMWA 3H3FA 4GWGA 2X9GA 1ZSVA 1YONA 1U5CA 1ENYA 3GEGA 4WKGA 3H8VA 5GZ3A 3DTTA 2Y1CA 4YA6A 3DBHA 5A03A 4CMIA 4YRAA 4II3A 4YT4A 4D41A 3U09A 2FR8A 4HWKA 1DJQA 1PSDA 1MG5A 2YV2A 1PZFA 4PLWA 1NR7A 4IQGA 4WPGA 2DKNA 5F1PA 4O0LA 4PLPA 4A2CA 1NBOA 1ZJYA 2DAPA 3ITKA 4DWVA 2VZ0A 3SXPA 4A10A 3WJAA 4Z0HO 5JY1A 3AFNA 1VI2A 4NFHA 3RFTA 2X5KO 2UV8A 2D4AA 1KVQA 1LRKA 1DOHA 4YQYA 4OKNA 4O5OA 4C4OA 4ZQBA 4RV9A 1LTHR 2PWZA 2VNSA 3H9EO 3JQ8B 4OXYA 2Y93A 2ZTMA 4YJDA 3BXXA 4IXTA 1BVRA 1LSUA 1M76A 3G49A 4JJIA 5FF9A 3VTFA 4IDFA 3FCOA 3ZV3A 3MJTA 1GQQA 3IP3A 2HU2A 3EAGA
chains in the Genus database with same CATH superfamily
4FU0A 4IHKA 5IX8A 1N7IA 1CIJA 3A3NA 3DDSA 1E2QA 1G21A 1YB7A 3NBXX 4M0FA 4QO7A 3LOQA 4ZGWA 1E6EA 4MDHA 3EEFA 3MMNA 1H2RS 2FPXA 3AF3A 5B37A 4RA6A 3WHLA 1OH6A 1J2JA 3DMTC 3GWGA 3T9CA 5D00A 5TRTA 2C92A 4D43A 1QBKC 1TVMA 4D79A 1YNSA 1HI9A 3O8LA 1W5AA 2KLBA 2YBEA 3IXMA 3R3XA 1HSZA 2JZNA 4WEQA 3VHXB 3ERCA 2UKDA 3PC8A 1I1OA 5G3YA 4Z2YA 3ZV4A 4EJ6A 1L5GB 5K7SA 1FP4B 1P0PA 4LYYA 1O54A 1IIBA 1X0XA 4GAEA 1RYDA 3PXBA 1RJGA 1DQPA 1YNOA 2HNAA 4WOBA 5A4FS 4HG2A 2HLHA 1PS8A 3KSBC 1Z2DA 1A04A 4HB3A 1AZSC 1ENZA 1TGVA 1W87A 3RANA 2RGGA 2HV8A 5B12A 2I4TA 5DX8A 1FCJA 4E4YA 4LJ7A 3LCMA 3L7DA 2R62A 4QOEA 4ARBA 5I4IA 4QPDA 4XWYA 1FQJA 1P91A 3FPCA 3CZCA 2JL1A 2QVBA 2ZSFA 3TPCA 1FVFA 3U9LA 2ZM6B 3PI6A 3MTAA 3IAM1 1ZHFA 4UFOA 3F3YA 2FSFA 2GCNA 4OHKA 4LSWA 3ILVA 5JI3E 1YASA 4I2VA 3HVUA 3WWDA 2IS1A 4HH4A 1MT3A 4IP0A 4MVJI 4ZOEA 3TLGB 3HYNA 3IQWA 5C1IA 2JBWA 5C4MA 2JGNA 4QFMA 2Y77A 3ABQB 3N76A 1W0JA 3KB6A 1GDDA 3KYJB 2YIMA 2I2BA 4Y1RA 1Z0DA 1GUZA 4X1KA 2FW7A 1E1LA 2PRIA 3D6HA 4XE5A 5F33A 1R64A 1FFGA 2VQ6A 3R9WA 3SSAA 2LXNA 5JNWA 4TQUS 5JW6A 3AEKB 3PL5A 1LKZA 1GPBA 2C2KA 3P8ZA 2WIBA 4D4LA 2B0CA 2JAUA 4E2ZA 4DUZB 3EIFA 3OAAA 2VOEA 2OBNA 1KDYA 1WCV1 3WMGA 3WRXC 1I13A 1QVVA 2QVXX 4YCJA 4FYKA 3VZPA 1E1MA 3ANTA 4Z0PA 1J0XO 3U1BA 3V1YA 3SZLA 4MJLA 2R7LA 3JQAB 3PGKA 1PZNA 4F93B 4L78A 3GUUA 4J3NA 5TARA 5LZ4A 1J1ZA 3G5TA 3IH5A 4B6QA 1G3QA 2FOIA 4MAMA 2CT8A 1EDZA 3E8MA 3EZFA 3R5TA 3I73A 2VJMA 3AINA 4PFKA 1EFPB 3ESXA 3V1LA 1QM5A 4P2BA 4LQ4A 4XB1A 5IDWA 4G1MB 4X00A 1N3IA 3DEYX 1FSPA 3GAAA 1AT1A 4DIEA 4DLTA 1NI4B 1JGTA 4HEJA 5AO9A 3QK7A 3R2JA 4XRRA 1TL7C 3ITNA 3PE3A 4AYXA 1J5PA 3BHIA 5DI3A 3H5LA 2RK3A 4AG6A 4AY4A 2ZDQA 5JNLA 1FNBA 3ZV7A 2PLFA 2GZAA 3A58B 5AHXA 1EXVA 4RS4A 5EJ6A 2DWCA 4JMLA 5K0SA 5K99A 4OJNA 3KLNA 3RSGA 4XEHA 3V2UA 4AF8A 1XPOA 3HKDB 1X19A 2IQ5A 4ZP1A 1SCDA 2FW1A 4JYPA 4C5AA 4UJ3A 4PZEA 1YS1X 1Q1EA 3HN6A 1HV8A 4D82A 4FFMA 5ERYA 3LTNC 2O8FA 1MQAA 1KJ9A 4MOWA 1WBBA 4JVOA 4ETMA 5LZ2A 4P6VF 5G3ZA 4MAAA 2H4YA 5ESXA 1H2YA 5JCOC 3BUSA 3GXBA 1Z45A 5LKRA 1Z4JA 2Q3MA 1Z07A 3RREA 3UA3A 2YV1A 2EFEB 2YWBA 3AP1A 2HMAA 5C3UA 5JCPA 5KJCA 1GPMA 1SVMA 1EVIA 3DF9A 4TYPA 3TE6A 4YPFA 4X63A 1WCWA 2WU0A 4NECA 3UGTA 4Z8YA 1B73A 2QSJA 3B52X 3AJ8A 3CNLA 3MCUA 1M1ZA 4RLSA 1WZEA 3I05A 3MUFA 3CX8A 5KKAA 2XQFA 3GFFA 5FNVF 3UC5A 1ZMRA 2EW8A 2JIDA 2Y1FA 1DAOA 2P2SA 1LJLA 4ZJZA 5KYWB 3O47A 3TAHA 4PANA 2Q5EA 3BVPA 4I9HA 5HDQA 3AQ4A 2RFLA 3KKPA 1JQEA 2C94A 2FMXA 1F2DA 5DM70 2HBYA 3K8ZA 3THXB 1J2UA 3MTGA 3IQZA 5HFAA 3MQ4A 4DCMA 2IHBA 1G3MA 3P9RA 3B78A 5FWAA 4B2IA 1N8NA 2BZGA 1AHPA 3LC2O 5WRFA 2XAUA 2B78A 1ZM4A 2PSSA 3BCHA 1JZTA 5FJIA 1VHTA 5CH3A 2I3DA 2FZWA 4GX0A 3BAFA 2A6PA 3U0BA 3KKQA 5MN4A 3JRWA 2NV6A 1H8EA 4HXGA 2VP0A 4KX3A 4N01A 1XA0A 3NC0C 4QGFA 4U7TB 2PNFA 3TG2A 1K7EB 1A9QA 2R44A 3VOAA 4XFDA 1X14A 4PYKA 5ELMA 1YL7A 4EVRA 2FZ4A 1PJ3A 3T9AA 1WDWB 2POQX 2B4TO 2PUCA 4TT3A 1EFRA 3GI1A 2K6GA 3H97A 1M5RA 4TTRA 1K3TA 3CN7A 3ZHTA 1W1IA 2WMOB 3FCCA 1M7GA 1VCMA 2DJIA 3PHCA 2IZOA 2FW6A 2IYEA 3E22B 4MULA 5DM2A 3OQPA 5E4TA 1PQPA 4I99A 5E1BA 3DE2X 1FNCA 5FPTA 4LTNA 3FMFA 3KJFA 4CL3A 2O9JA 3KCNA 1C9NA 1JEQB 4AJ4A 4UASA 2J0QA 3HA2A 2GT1A 1P2GA 5C0OE 3FPJA 5J5VA 1UP4A 4PZYA 1RQGA 3GAFA 1IG3A 4JJKA 4MVCA 4YXFA 4JWKA 2E5LB 1PKEA 5F3RA 4OP3A 3RBVA 3JYNA 1FP2A 4ND1A 3N9IA 2OLJA 3AM4A 5DDIP 3PPYA 5JBIA 1X7XA 5BN4A 2Q5FA 3Q7SA 1O6CA 5ALQA 2DPHA 1DTSA 3GRZA 3T7KA 3ZHZA 5PNTA 4BBZA 1JV2B 4YV1A 3EGXB 4LOIA 4JP8A 3MERA 1AA9A 4TLDA 4LSGA 2F7SA 3KVOA 5J47A 1G2QA 1Z6GA 4B3CA 3PEYA 1YB6A 1TCAA 3RSHA 3TQCA 1Y9EA 4G2TA 4HFNA 2X8BA 1FNSA 1D7AA 3T3DA 2V5UA 4ZCRA 1CY1A 4M0PA 1X7GA 2QLBA 1NU8A 1X7HA 2DOKA 2Q1YA 3TTWA 2JJ8A 4AKSA 2PZLA 3EAQA 3VPXA 3CNNA 5CDHA 3ZJ5A 4EB3A 4KR7A 3AHCA 1TU0A 2DETA 3N53A 1IZ7A 3DOJA 3R6LA 5B58T 4YAUA 1XMSA 1BHSA 2R8OA 3W5SA 3HCAA 4DIBA 3Q3CA 5AVXA 5D6NA 4CT4B 3CX6A 3ILXA 5LZ5A 5BPHA 3HGQA 3FBGA 4R9NA 3DAOA 4P33A 4PRKA 4G89A 3LA8A 1U8FO 2YWEA 4JQSA 4UDOA 2P9EA 1KMHA 3N2LA 4IDCA 1E1QA 1EINA 1XCLA 3DAGA 2DLNA 5L7WA 4BU1A 3F73A 3N70A 1NJGA 2H48A 2QW0X 2VJPA 3R0XA 5CDUA 3UXYA 4P36A 1Z5ZA 4LY0A 1Z7YA 3JQCA 3B89A 4O59O 2A30A 2FWNA 3O92A 2O8VA 3CH7A 5BNWA 5F9FA 3H3JA 3PFBA 3RVSA 2AOVA 2MMCA 3KELA 1M33A 1SWVA 1R15A 1U3CA 3H0CA 5CM9C 5AJVB 1GTJ1 3RBXA 4PFSA 3W5IA 3WX0A 3PUYA 1JAYA 1KI2A 4AJ9A 4Z1MD 5THQA 2X14A 1N2HA 1CVRA 5AW6A 3HZZA 3I64A 4JWTA 3EA5A 1ZXLA 4FBGA 4JLVA 4RPHA 3OM0A 2SCUB 5THXA 4M7PA 3KJGA 2A5DA 2YR0A 4R01A 4FYVA 1AKWA 3R0JA 4Y0VA 1OXKB 1NHGA 2IXDA 2HBRA 4KODA 1ZGAA 4KMMA 1USVA 2LTAA 1JQ5A 1EP2B 2PFKA 3GHYA 1VKOA 4WFQA 2Q7DA 3WKBA 5HRAA 1A27A 2JGFA 3O21A 1KHHA 4YAKA 1DJNA 3CF2A 2LR0A 3B36A 3ESQA 1H8HA 1K5DA 2RKWA 3C24A 1VJ5A 2O57A 3DEZA 4YXWA 5SY4A 1AMOA 2BM8A 3L01A 5EE0A 5EIFA 1E69A 1I6KA 1CUAA 1OLXA 5FV7A 3DXXA 3S1SA 4RWEA 3G3EA 2XT6A 1CQZA 2XD4A 4YCCA 1PBNA 4ZOAA 4PXYA 2MSKA 4OM8A 1FNNA 2IZ1A 2ATXA 3W3ZB 3AUAA 4B6PA 4ETWA 2YWJA 1NF3A 2H59A 4ZGGA 5DNVA 3PWTA 3OZIA 3G0GA 4F5ZA 2HCTA 5CYPA 5KSWB 2MYPA 3NATA 1Q2XA 5T41A 3SEFA 2W9XA 1UDRA 1XZJA 4IINA 3ITEA 4WL0A 5E38A 2JLQA 3QX8A 3UGKA 5JYDA 4QU5A 3HCPA 2BGKA 1IJFA 3MJCA 1SD2A 1JMKC 1T9HA 4GIBA 4P82A 1Y9AA 3DLTA 4MR9A 3WWCA 3OQMA 2O8EB 4GW3A 2CL7X 2BMEA 4KAFA 4WDRA 1FQWA 1JQAA 3DWIA 4G86A 5LQSA 4D4GA 2F3SA 4Q16A 2Z04A 1DX9A 1ZA2A 1SOVA 3GZTB 5LQJA 1XTVA 2WWHA 1ZYUA 3GUCA 3GQBA 3L8FA 3NS7A 2BFWA 4LY6A 4BGEA 4DSZA 3K6JA 2FZLA 1DPGA 1XCPA 2D1SA 1WD5A 3L0CA 4D0GA 2XMDA 1R0BA 1FMTA 1K7FB 1YUMA 4Q9KA 3TTYA 2YUIA 4EPVA 5HM6A 5ICMA 3O3MB 5IC5A 3E7PA 3A6GA 1VGRA 5IJ9B 1VRCA 3JASB 3VDXA 5BQ5A 5AW7A 1J49A 1EB9A 1PTJC 4JVNA 1ZJJA 3B6ZA 2QN3A 1F2UB 3EFEA 1YQWA 4TLCA 4AJJA 4PYJA 3QHAA 1ZKDA 1VSTA 1CS4C 2FWJA 5AM0A 2GZSA 4OF4A 3L8DA 3A4YA 5U4XA 2LPMA 3MTDA 1TADA 2DBRA 5IW8A 3BXOA 2P8SA 1JFVA 4J3FA 3REQA 1EUYA 1EVKA 4UUAA 1Q7TA 2FNAA 3BL6A 1WXIA 4MDEA 1LD3A 3MWFA 1GNSA 4HDRA 3HLKA 1P18A 3PWKA 4JNCA 4RJIA 5T4FA 1NAHA 2DE0X 5I7UA 5LMNB 1J8YF 1EVQA 3PEEA 1GFWA 2PNJA 5FJJA 3QG1A 5AUQA 7REQB 2J9RA 4MUFA 2GXAA 3ZVRA 2R4UA 2HA3A 2IHYA 5C1OA 1FSSA 3EMVA 2XY4A 5EKUA 2UZ0A 3A9TA 3T38A 1Q1ZA 1DOAA 1EU1A 5DT2A 2WTBA 1DOZA 4PVCA 3ZHYA 2C99A 4DLRA 2VWQA 3GFBA 1GLNA 2W48A 2BMFA 4J90A 3N87A 4EKEA 4ZAZA 4W5RA 1X8KA 3PQDA 1OOEA 2NVWA 3GJRA 2FQWA 3DEJA 1Z3IX 1OAAA 2R68A 3DDZX 3JVVA 4NBUA 4NCIA 4BVEA 2JAHA 4CV2A 1NKSA 5IKOA 3T4XA 3RAFC 4Q82A 521PA 2ZPUA 3FVVA 5C37A 1SGWA 4YT2A 1G7CA 3N0TA 5E6UA 4YJ2F 1KFBB 1XZKA 3NIBA 4PO8A 4GXRA 1ECPA 2ISQA 1VDZA 5CCBA 3SP1A 2QQ5A 3M9WA 1NVGA 1ZN8A 3LW7A 5DK4A 3TIGA 1XJ5A 1SJ9A 1CYDA 1Y1TA 3A06A 3EGEA 1W52X 4PY2A 3BBLA 4GOND 1GPWB 5IN4A 3N8GA 1KF0A 4PSKA 3M7IA 3QF4B 2V0CA 3PXXA 4OSPA 5HVNA 5TPWA 3E8XA 1UXOA 3CWQA 2W6QA 4KQ1A 4PPNA 4Q9DA 1CZKA 2GN4A 4IHQA 5CA1B 1C3XA 5A9SA 5HKOA 3IIIA 2JGLA 3WYBA 1E99A 5JXHA 3IOMA 3ACBA 5SZKB 1T8UA 1TJ5A 3BL5A 3Q87B 1GPLA 1THMA 2OESA 3L8EA 4JBYA 4W1RA 3SKXA 1M1YE 2ZI4A 1KSFX 2O4UX 3BAZA 1JEJA 4HNQA 4KIJA 3TLBA 3TR6A 3R3WA 4ESHA 4HH0A 3F8SA 4LVUA 3LCRA 2GVDC 2K4MA 1NBWB 5G0UA 3C74A 1MUUA 4ZFNA 5JAPA 2IODA 3RYCB 2JAOA 2G1KA 3WE7A 3DZGA 2QM7A 4ZT4A 3M33A 4MQFB 1NUHA 2ZFUA 4G9EA 1X13A 5ALWA 4N3GA 4HLQB 3T06B 3W5VA 1REQA 4HWGA 4KR2A 4QRIA 2HU8A 2IYSA 1FA9A 2WG1A 3GLFE 1MENA 2A7XA 3ZLVA 3H5TA 4Q4AB 1Y5MA 4MV5A 5BMVA 2G6TA 3CA8A 4XIYA 2BL4A 3F78A 2GESA 2BHLA 1XVIA 3TLAA 4OXIA 3WMFA 1SFRA 2NXWA 3QHPA 2FQ1A 3O4GA 3O1HB 1DCTA 1C9EA 3NX4A 1MJ5A 4CKCB 3ZNPA 2WG0A 3AL2A 4C7MA 1QPZA 3D8BA 8OHMA 3G88A 1CJSA 4Q48A 4R7GA 1US8A 1T1GA 5K0NA 3W5DA 1GCIA 2QW8A 2YJ5A 3V2GA 3JD3A 5JPDA 2DT8A 2Z2XA 4EF6A 3QYAA 3VZSA 3NAQA 4E5MA 1YMUA 4AC9A 3GCDA 4H1TA 4XUEA 1XWFA 1OXSC 3RSSA 2F3PA 4XUCA 3VPCA 1U0HC 2PWBA 2ZRCA 5K45A 2X13A 1W49A 3ISTA 5FBKA 3ETEA 4IG4A 3KBOA 3DOHA 1IUKA 4XCVA 4I50B 1AZWA 1ESNA 4PXSA 3T9EA 1Y6GA 2LD4A 3DNFA 4CUZA 4KR0A 1P7YA 1T6XA 4P54A 4G23A 2N42A 2XODA 4JT9A 3IQFA 4BNXA 4ESOA 4HMPA 4HQFA 3R8FA 2ES4A 2X86A 2X9QA 4MKIA 2GHQA 2GK3A 3LA6A 3SE0A 4KO3S 5IMBA 4CM9D 3TXAA 4NNJA 3VR3A 1E2LA 5CA0B 3PFFA 1M34E 1DIBA 3R20A 1X2EA 4U6QA 3H1BA 4MWZA 1E1YA 3KPYA 3QEMA 1OXUA 3V7FA 2DUJA 3PPVA 4HB4A 4M9XA 3ZWMA 1IB0A 4E7PA 2WJGA 5JFOA 1S01A 4Q4HA 2ORWA 3F71A 3LY9A 3E1SA 2OTCA 2VHCA 3LBHA 4XQ9A 3EUEA 4CR6A 4XXHA 3ZD9A 5KX5A 3WISA 1E2BA 1HMYA 1VMIA 2Z0MA 3WP1B 1E59A 3SFVA 4ZYWA 3K30A 2PMFA 2WSMA 1UK9A 3H1AA 2PPLA 3L7LA 1U3FA 1EIWA 2A3RA 1YZ3A 1RCUA 3VU9B 4II2A 4AJPA 4BRZA 1BMFA 4F6LA 3KWMA 3G2HA 1XIVA 1XQ9A 3DHYA 4NDZA 1OAKA 3ONEA 4DN6A 2Z3VA 1KY3A 1RBMA 2C77A 3I2JA 4NCXA 4HYYA 5C3MA 1D04A 2XXJA 4KPGA 4Q9NA 5T6MA 4W5NA 4FEAA 4GP6A 3K09C 1JTFA 4IDPA 2PT6A 4XVRA 3RQSA 4DR7B 3CBQA 2ILVA 4ZU6X 1J8MF 1XNQB 2P67A 2QR3A 2VK4A 3CM0A 1YCGA 1O87A 4EO9A 2CCKA 2KMLA 3I83A 4BPRA 2P30A 2QVZX 3KVVA 2ZI3A 4HWTA 4KIWA 1YAHA 2PAAA 2RAFA 5HCIA 4DM7A 4F4FA 1NPYA 4ZDWA 1QU2A 4YV2A 1XTQA 1BJRE 1MOPA 1FMFA 4DG8A 2BMJA 1QZZA 2R79A 2WP0A 2XSZA 3T95A 5DHAA 5KDDA 4XVCA 3D4LA 5D84A 3BFJA 3QLVC 1FOEB 5CMLA 2VO1A 1OROA 5DV9A 4JDPA 4XGRA 3NFYA 1SCUA 2QZPA 3MTIA 1V48A 2W4IA 2GI4A 1NSYA 3WNBA 1JVSA 4RMHA 1POXA 3PNVA 4U3JB 4DILA 2UVDA 5AI6A 3KO8A 3KB1A 4TV8F 4KMRA 4MWTA 1GCOA 5FBHA 5H70A 5BT9A 3WC4A 5I4KA 5LU9A 1FDSA 4BIMA 1COWD 5IH7A 1NJ5A 3G89A 2I6UA 1MB9A 4NYJQ 3WL7A 1VKNA 4WCVA 3A1VA 1NP7A 3DXZA 1GAXA 1Q57A 3WB2A 1QFYA 1Y5IA 2ORED 1AMNA 4G25A 1XMOB 1RJWA 4X8OA 1ZI9A 1W9HA 1GFSA 3R5JA 4QLOA 1FQKA 2I4MA 2P2CA 2YRWA 3QLTA 4FMDF 5JHHB 1ECCA 2YCLA 1DCFA 1KKMA 1VI6A 3HG7A 4PU0A 5AXCA 3PWZA 1IRIA 5DSXA 4BTEA 3O3NB 4Q3KA 5JSKA 3PQ3A 4F97A 1GHTA 3WS7A 4DLVA 1YJBA 1M67A 2ZWAA 3IOBA 5GONA 1XE3A 3SNHA 2VDOB 4MWDA 4N8SA 2FX3A 2BGNA 4JS0A 1LW7A 1EVJA 4QFBA 3L6UA 4FLEA 4Y6QA 5TMBA 2XB2A 1QHXA 3DP9A 1AQLA 5LC1A 4G4GA 4YUYA 2B6NA 4MIYA 5FB3A 4C14A 4F4DA 1YR2A 3OD5A 1N1EA 2I6GA 4OA8A 3HB9A 4KWIA 4MUGA 4BQRA 5AW4A 4P38A 2LDXA 2DTDA 3BQNB 4BJ6A 1C7ZA 4BEVA 3ADDA 4DEVA 1F0PA 1M8KA 2VAXA 5JXIA 1R4MA 3F96A 4Z4GA 4HDRB 5B3LA 3CZQA 2Z8XA 2Y1DA 2HQSA 1QRRA 1EFHA 3OKAA 4ER7A 2V6GA 4Z9YA 1L8OA 3D4NA 3HMQA 2HF2A 2FEWB 5JJLA 5DW3A 3I39X 1ZJWA 3LOPA 2R6GA 1SKQA 3MN1A 1IAVA 3LKVA 2DQ4A 3GEPA 4Q39A 4J07A 2VKQA 1YK1A 1E0KA 1G8KA 2Z1MA 3E0XA 4KQFA 2FRDC 1NBMD 5LCXA 4DB4A 1IEXA 4M53A 5C53B 1DRJA 2HRDA 1Y6QA 1LS6A 3I52A 3L7MA 4N6OA 4TRJA 1F6WA 3W0LB 2AWOA 4JD5A 2CC2A 5DTRA 1IL0A 1HG1A 3EPJA 2GAOA 7ADHA 3MYYA 1TOAA 1H23A 3PI7A 1D8AA 1U8UA 1WLSA 1VL6A 5AP9A 4FM9A 4AN1A 5ENDA 3UATA 3ZCQA 3I0MA 4O8CA 3DZDA 3TOZA 4TVSA 1GIAA 1ONNA 2B7LA 3DVRX 4DHEA 4LF6B 4JA2A 1A2OA 3CSUA 3EF3A 5J4LA 1V1RB 2H5LA 1E92A 2SHKA 1N2EA 4NZ9A 4JJGA 4Q4JB 2JI6A 2PRSA 3GLRA 2WKWA 3IO5A 4DIKA 4Q02A 2Z95A 5DX0A 1L5NA 5CDTA 1A4IA 3H2SA 1FVHA 3B9BA 4N0PA 5DZSA 1P2SA 1UPXA 1EXNA 5BNTA 3NAGA 4QPCA 5K0CA 1HOTA 3N05A 4JUFA 4RD0A 4DQ0A 1C7IA 3KLMX 3E05A 2P3QA 4V3BA 3N8KA 4PPQA 4UOEA 4BGDA 5IYZB 2NU8B 4ITVA 4UU8A 4OQLA 4DYHA 1FXSA 1CS0A 2HT6A 1K89A 1Z2EA 1PGQA 3PENA 1JSXA 3T54A 2CLCX 4HO1X 4YRNA 4E15A 4EQ6B 1CQIB 1OIXA 1KYVA 1Z7GA 3PDHA 1UQTA 3RK0A 3VQTA 1ZEJA 2V7GA 1IBCA 5JRDS 1GYPA 2F59A 4FTWA 2O2JA 4WZBB 4WY2A 4ZARA 3GRKA 4XD7D 1ZJZA 3DT6A 4JAVC 4AJLA 1GUBA 3EEQA 1NLZA 3H5OA 3SHOA 5JC1A 3PGJA 1I51A 4QQRA 4F6CA 1UQRA 3CEMA 2CFCA 4KXNA 1DQSA 5E2AA 1WDMA 2JD2A 2X23A 5FI3A 5D5PA 4EI7A 4OQMA 3N3BC 3UHPA 5L51A 1R74A 1WMFA 3LZDA 1A72A 1U0RA 5BN5B 3TI7A 3CB2A 4RHXA 3PLAE 2QZ9A 1J07A 1I2CA 1QYIA 1NTOA 4HLUC 3ASYA 1K4YA 3CEPB 2Z9BA 4NMHA 2FJ0A 2RG1A 3RS2A 4J6FA 1DV1A 3LJKA 1ZVVA 2CJYA 3OH8A 4UMDA 3RTAA 2IPNA 2HGSA 1GKKA 4B7ZA 5M04A 3R5SA 2AZ4A 4MDFA 4KNYA 1P1HA 1XF9A 3LU1A 3PNMA 4D3DA 1U2EA 4RK7A 1QOQB 1NVBA 1YI0A 2ZVPX 1PYDA 1KARA 3K31A 1XZGA 4O3MA 1E2GA 3KKLA 1CDDA 2FR1A 2I3AA 3NTXA 1PNVA 4HZGA 4O4IB 2WOOA 3FR8A 1N6KA 4Z2AA 4QNRA 3A2MA 3A4LA 2QRLA 4OYHA 2NMVA 1XZLA 4JP1A 4IXMA 4G41A 3RUEA 1XK6A 4UBIA 1CRZA 3FCYA 5EJIA 5FTLA 4X61A 2RMKA 4UAGA 1Y9ZA 1XPRA 3ND7A 2FR8C 4ZOCA 4ALMA 4LDNA 3ZCVA 621PA 3JQGA 3RKSA 1ONPA 2XYQA 4FKBA 2NSHA 4CLEA 3FRIA 3ME5A 1JJ7A 1H2XA 4MR9B 3B8EA 3D8UA 5ER6A 3S5UA 2IP1A 2ZIAA 1I2ZA 1UEXC 3KQPA 5IZCC 4TYMA 1E7QA 5U9CA 2XA2A 1XDSA 9ATCA 3O0DA 5A7FA 2C2YA 2WA2A 1Y89A 1PJLA 3NTLA 5DGDA 4EHAA 5ETJA 4ZZ2A 2P9YA 1KI8A 3N75A 1AXEA 2HA5A 4PSVA 1ITZA 4OHWA 1XDUA 1DAPA 3OF3A 3Q3HA 1SVUA 4IKOA 2Z4RA 3TMKA 4B0OA 1Y1KE 2OHFA 4D9HA 3LZ6A 4I3HA 4EP1A 2XMQA 5CFQA 2PMWB 2QLMA 2AFVA 4B46A 5JBQA 2FJPA 3WB9A 1SC6A 3WWZA 3GDFA 4NBTA 3RPEA 5ED4A 1GA6A 2IT1A 1AUPA 1ZD4A 1F2TB 1KZ4A 1MB4A 2PKEA 4J9UE 4K9RA 3V00A 2ZS8A 5YASA 5DLYA 4DKJA 1SUIA 2O50A 2C2XA 2AFRA 3NTUA 4Q3DA 2YYAA 3M5PA 4OYRA 4B3JA 1NW6A 1Z6QA 4XSVA 1VSBA 5G0SA 2OHVA 5KOJB 3ZCUA 4NOLA 1WG8A 4PWZA 3O3CA 3L6DA 1A5AB 3R0VA 2X40A 4IUYA 5AI8A 5C8YF 4ZCSA 2HHJA 1M2EA 3ROMA 4R9SA 1TJ4A 2J5QA 4KQGA 2V1UA 5ABPA 2AN9A 1SCUB 1IBSA 5PGMA 1OLXB 2AOWA 2AJDA 3BGWA 1YMQA 5E7JA 4BXOB 1CW2B 2Z2JA 2QT0A 5CM2Z 1P6XA 4LV5B 5CBPB 3BHJA 1AKQA 3ZWPA 1OYYA 2C1ZA 3ETLA 3RIHA 2VYFA 1YT5A 3TUIC 4D56A 1Z5GA 4BZWA 1X38A 2V9PA 2D5LA 2ZUBA 3PRHA 4UFPA 1JYEA 4XSGA 2H16A 1VE1A 3T35A 3IHTA 4BJ1A 4EB6A 2CJXA 3UKJA 1X1CA 1QGZA 3RVJA 3ESAA 3ROEA 1RPTA 3BJMA 3U26A 2R5NA 2V59A 2DFLA 5TJHA 3WNDA 1VA4A 1EJ2A 2FXVA 1K68A 3PRKE 4ND3A 3HU5A 5EP2A 4KDCA 3W3AD 4FMDB 1XL0A 1N1GA 3V48A 3UAXA 4PS0A 2QTWB 2HIAA 1G2PA 2ZS7A 4UULA 4V3CA 2VP6A 1ZCBA 2PMKA 5KQMA 2XF8A 1YRWA 3OT5A 2WIGA 4R9VA 3UOWA 2GUGA 4PQEA 2ZJ8A 4L3OA 1Z0UA 2OK8A 1QNFA 4POAA 4RVNA 4X0EA 2D3WA 3D4OA 3OURA 1SKYE 3SQNA 1VP9A 4XX0A 4Y0AA 2AT1A 2HK9A 3UJAA 1HF3A 1R8JA 4N1AA 1P2DA 2NVBA 4YUWA 1ISGA 1L4GA 3IFSA 4EG3A 3VKGA 1H5UA 2H06A 4JJFA 1M2NA 2BAGA 3U5TA 3AERB 3MRVA 4B75A 4HL6A 1SG6A 4WN3A 1VSUA 4RZ2A 1JBKA 1BQ3A 1WSAA 1MX3A 2I7DA 1GM5A 4JI2B 2LKCA 1E9EA 5CIYA 2CB9A 2Y3IA 5DNWA 1CRPA 4N9QA 2PGOA 4AO6A 4JC4A 1I8TA 4JP2A 4K1LA 3O8OB 4OSEA 1SHZA 2YHIB 1JKJA 2X3FA 3QA3E 1HE3A 2Y6VA 3TTXA 2WM3A 4X7PA 2JFWA 1H2HA 3GXOA 5ALDA 2HZBA 1TUBB 2E3JA 4IGEA 2P9JA 1L3CA 4IIJA 4Z9XA 5GGYA 5CEJA 1WP4A 4HQ0A 3BKXA 4WJZA 3CISA 5AKZA 1ZPDA 2XKJE 1I6WA 4W7HA 2AQIA 1RM5A 3BGIA 1BS1A 1E7SA 1JXAA 3GLHE 3HUEA 4KHZA 4MS3B 3ZX5A 3DO8A 5LMCA 2RHRA 1T36A 4ZKDA 2CVFA 5E9AA 1QAOA 3ZNOA 2RAVA 1K4KA 2VNHA 3IEUA 4TWIA 3R74A 1US8B 3JW8A 3FNQA 4OHBA 4OHRA 2BKXA 1SB9A 3HB7A 3UUWA 1K88A 3MEQA 2YTZA 3OTWA 3H4TA 3JV7A 2EHJA 3L7OA 4GVLA 4AROA 4DNFA 3KR2A 1Z0SA 3KQMA 5I9LA 1VMEA 4HYQA 4NC9A 3HKCB 2J6IA 4DV0B 1ZN7A 4RQAA 1IDN1 2ZAMA 4NOKA 1A71A 3HZOA 4L73A 5KDLA 2CV1A 2Q1XA 3QA9A 3GAMA 3MJSA 1A9OA 1Y7LA 3G0DA 2BR4A 2QQ0A 3BMOB 3D7SA 3HJCA 3IMGA 4WCFB 1J8QA 1MGPA 2BDEA 1NX9A 2UZ1A 4OCZA 2POCA 3LTEA 1UAGA 3TZEA 4C7OB 1IN1A 1UFQA 1DDOA 2AHRA 2PMCA 4EHHA 2G5TA 4GR4A 1DUSA 4M9QA 2G5GX 4Z7JA 1AQYA 2WWIA 3HWWA 1AS0A 1Z13A 4L9WA 2XGMA 4FEYA 1ZU5A 2CNBA 4GPAA 2QJWA 3L46A 4GNKA 5EY5B 2XNCA 5INTA 3IUNA 4JDUA 1HLGA 2E6KA 1XU4A 5EZQA 1CIVA 2C7VA 3TGWA 4WGFA 3REOA 3GEEA 1CU1A 3QTTA 5GAJA 4JJAA 5KHOC 1EWQA 3C5HA 1SBYA 5AESA 2G9NA 4JNKA 4RULA 1WU7A 4ZOLF 1EAMA 1QO9A 1T4DA 1Y8AA 1ZN2A 2FF7A 3O2SB 5KVQA 7GPBA 1M7BA 2QXTA 4MW1A 1E3MA 1J8VA 2YMMA 2GJKA 1B8PA 2RHTA 3UNXA 4B9EA 4DYVA 1P8AA 1F0NA 3ROZA 1RAGA 2CLDX 3C5CA 1L7VC 4E7OA 2HJVA 1FYEA 1N2BA 1T2UA 4IIJB 2IV3A 3H2KA 2C84A 1COZA 3TOXA 1R6UA 2PWYA 4R2WA 2JH3A 3VBEA 1E5TA 3TH5A 2FPWA 1T8WA 4JOCA 5DE3A 3RWMB 4DVJA 3UW3A 5ICEA 4GI2A 5JSFA 1QH1B 1PRYA 1RWXA 2VZLA 3E3AA 3LRPA 3ZBPA 4ARUA 2MCFA 3T7IA 1P31A 4BE7B 4DC9A 5JR3A 3BIJA 4G8JA 4XYMA 3SJUA 2B92A 4EFMA 5JRJA 1QIIA 5JPCA 1OBCA 3T1QA 4QUJA 1KI6A 2AKAB 4G5RA 2ODTX 5CB8A 1YZNA 2CBXA 1LV7A 5DNUA 1JEOA 2NZYA 3B9QA 4ZJYA 2GTHA 2HQRA 1NA5A 3QI7A 4I9NA 3UYLA 1R5NA 3AV0B 1BXKA 3A8TA 2QD2A 4NE7A 2E4ZA 3ZXUB 3VVCA 1AU9A 1UBFA 2PSJA 3IPCA 1KSJA 4MZXA 1N3LA 3T7JA 4P3OA 3E84A 3WDMA 2O8DB 2EBUA 3VSAA 1E3DA 4WBSA 1DBRA 4WACA 5SYAA 4BFWA 2QI9F 2D74A 3SBEA 3ZZUA 2PV7A 4IVPA 4OGKA 2QN6A 4RHYA 4YIHA 4C6SA 1XVUA 5H4HA 3K4HA 2ZPTX 3P9QA 4Y2SA 4OHUA 3VU0A 5MGNA 1BXZA 2G04A 1QQ7A 2KHZA 4LJAA 1QQAA 1ECLA 1E3EA 1T4GA 2PIAA 1TT5A 3D2BA 3ZQJA 4KDRA 2R66A 2GXQA 3U13A 4Y9RA 3TMYA 3VVBA 1TDJA 3GCWA 2PXHA 4YI5A 5K4HA 1WZ2A 1KQNA 2GK6A 2VNIA 4BLOA 4LV8B 4F92B 4Y2XA 3QTLA 1IUPA 4MYUA 3KXLA 4F9GA 4W7SA 4IQ4A 2SBTA 2FPKA 3M6UA 2M2IA 4YAFA 3SX4A 4BFVA 2I87A 3C7AA 3ZJTA 1U7WA 4TTIA 3QY9A 4B47A 3TJMA 4YDQA 1XDZA 3JQ7B 2HPAA 1M2VA 3PR3A 5A4DA 3PD1A 1VB3A 4YJ3A 3RRNA 3W1WA 3NM6B 5KVSA 10MHA 3Q10A 3PQ7A 4JVMA 5JXJA 3J7AC 1H42A 2VSOA 3H7IA 1ONBA 4L2IA 3SYMA 4US2R 2QZSA 1ZGHA 1MJGA 2OPBA 3GYBA 1XMQB 1RWWA 2YNMD 2GPWA 2YOFA 4GE0A 4KUGA 5EWJB 4LF8B 4JI6B 1V95A 5IEBA 4ZIRB 1DP4A 4Q1DA 1SBHA 3WJ2A 1SQGA 3TNJA 4ZANA 3KKZA 3KR1A 4QUDA 4TSKA 1YA6A 1YGPA 4DMGA 4ZVQA 1PLJA 1FJXA 1ZR4A 4H16A 4JXJA 1K2WA 4LECA 4CG1A 2I2CA 2GNPA 4FCWA 1UFRA 1JJBA 1B0AA 3IURA 3F4BA 3OEYA 3P4YA 2PYIA 2H85A 1ABEA 3H3XA 1OJLA 1RCFA 2YFQA 3CT6A 5HF5A 2SICE 2O2DA 1KEWA 4Q1BA 2DPMA 4KQJA 3MD9A 4OUKX 1UQUA 3QSGA 4MW9A 2NO6A 2VUUA 1PP4A 3I2GA 4Z4QA 1A2BA 2G8LA 1YHNA 4G2NA 4XTRA 3P0EA 3QM1A 1N6OA 1BGVA 3VC1A 4B3IA 4GX5A 3TCNA 2VDNB 1G4AE 1EDEA 2WA1A 5IJAA 1Z4MA 3L05A 3TAUA 5FDFA 4P81A 4ZYVA 4H6WA 1L5YA 2QM0A 3DLPX 5KTOA 3F9CA 1KRHA 3EZXA 3I30X 2QX6A 3HWRA 4R05A 2UUBB 1IYZA 1M6NA 2PZMA 3CNQS 1O6BA 3F67A 4HN2A 4HQRA 4QBKA 4PG5A 3VR3D 4UCFA 4L15A 5JVDB 1C4OA 1K8XB 3T1OA 3IT0A 1SVKA 4C2UA 4IDNA 3MF4A 3MELA 3AZOA 1OD6A 3P5SA 2Z5VA 1VG8A 4K3UA 1I4TD 3TQHA 3LQ4A 2B4AA 3R8CA 3C4JA 5LZ9A 1YRLA 3EIQA 1F8GA 5LP6B 3HDVA 4B4VA 5CVEA 1QTRA 3AJAA 3JWHA 1Y4UA 1KDVA 1BH2A 3R24A 1HOXA 4U2CA 4DWWA 1NYQA 4JQOA 5DN6D 3FKJA 4F2HA 1U3DA 1XRPA 4MYRA 3IOYA 1M2GA 4LF4B 3RYHB 3GLUA 1HSOA 2BM9A 3H5AA 3P2EA 1CV2A 1EBFA 4I66A 4QFCA 2ZYSA 5JMTA 4C30A 3G8CA 4HVCA 2Q0XA 2DYKA 4Q5IA 4R8VA 3T3EA 1J25A 1VLHA 2ZPAA 3HABA 3PWSA 4ZYYA 1G8FA 4TLAA 5EQJB 2VQDA 5HA5A 1AIPA 1C0PA 2R96A 3UJHA 4BVAA 4HN4B 1M74A 2CLEB 4FDTA 4PVDA 2Z57A 3V6LA 2QG6A 5FADA 4P98A 2D59A 1MC5A 3V42A 2ZJ0A 1TMOA 1OASA 1RKXA 3A3PA 1K6EA 3B51X 3KT8A 4LTDA 4UHEA 2F62A 2OB2A 1Y63A 1UM8A 2ZTVA 4DQDA 5A1JA 4NNOA 4IAOA 2GFIA 3CRQA 4DEXA 5C1DA 4JIGA 5IBRA 3C3YA 1W35A 3C3DA 2P2YA 1H3NA 3VYWA 2VZEA 4UEOA 3HA5A 5LYJA 4KPYA 1N33B 2P4SA 5JOQA 2QSZA 4WV3A 5CLJA 4NBLA 4UUOA 2AF4C 2H2DA 3U9TA 3PF9A 3JQ9C 3CMMA 3TM5A 4R68A 4KNVA 2XCIA 3GLFB 1ZITA 3HSYA 5BSRA 5LNK1 3F6CA 4FFNA 1WKVA 1IUNA 2VCHA 1ZNWA 3DCJA 3LT5A 2Y9PB 4MIOA 4O4LA 1EK2A 4PO9A 5AM1A 1F0KA 3WKEA 4DXDA 3J81A 4AS1A 2W00A 5HZHA 4AULA 2GRAA 2MJLA 3OOYA 1PFVA 1Z0JA 1E2IA 4ZO4A 2HXSA 3ER6A 5KI6A 3E9YA 4YACA 4KVAA 5KPJA 5IYZA 1SXGA 1TJPB 1JXQA 3UWMA 4UHFA 2OCPA 2WAOA 4KGZA 3BE5A 3W1VA 1ELOA 4R1UA 2ZT6A 1E3JA 1K8QA 4BQOA 4NHEA 3HGMA 3THYB 2CUNA 4YO8A 3OPYI 5JANA 5JO0A 5EP3A 5F51A 3D59A 3N2KA 5HK9A 2JHCA 1KJZA 1UMCB 3ED5A 2JHAA 1CNFA 2CXHA 3OOEA 2P4HX 3OSUA 4OQNA 3IESA 3QEKA 3FBTA 3JQFA 3FHTA 3SKYA 5EP4A 4BQFA 5HWSA 5K20A 1PGNA 2EFDB 3NHBA 3NFRA 3OQHA 4BO5A 1MB2A 4L9AA 3SICE 1N3YA 4DIOA 2HDOA 2JH9A 3BSWA 3GMIA 1P73A 1Z25A 3P45A 4KQCA 1SCIA 3TRHA 3B12A 5FQOA 3ZW8A 5IVPA 2IQIA 3LX4A 4HDSA 1H4QA 2AKEA 4JQCA 2JGIA 4EX7A 4L6IA 1YOBA 2RHHA 3H0EA 4AIIA 4BLUA 2B5OA 2VPXA 2E4XA 1GTRA 1Z6ZA 2A9OA 3T5BA 1FBNA 1ZU4A 2VHYA 1KAHA 3TTVA 1OI2A 4PIPA 4Y6RA 3V4ZA 5ALLA 3EH2A 3UMSA 2B1IA 1XLWA 4H4EA 5AK0A 4ALLA 4LG1A 1L1RA 3Q41A 2OA0A 3Q2KA 3SYRA 1A5SB 2CEAA 5JIBA 1VCHA 4BBAA 3JWIA 1NQ5A 1JSRA 2L17A 4D81A 1AK2A 5C4GB 5CLHA 3WGQA 3IV9A 3AGQA 1VLLA 3Q98A 4GYKA 5FLEX 3WMWA 4PEVA 2ODWA 4U00A 1TT5B 3OIYA 2OHXA