4R01A

Crystal structure of sp1627, a putative nadh-flavin reductase, from streptococcus pneumoniae tigr4
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
210
structure length
210
Chain Sequence
GMKLAVIAANGQAGKAIVEEAVKRGHEVTAIVRSENKSQAESIIKKDLFELTKDDLTGFDAVISAFGAYTPDTLPLHSKSIELFNQLLAGTQTRFLVVGGAGSLYIDETKTTRLLDTPDFPEEFKPLAKAQADELDLLRTKNNLNWTFVSPAVDFIPDGEKTGNYILAGEIFTTNEKGISQISYADYAIGLVDELEKGHHIKERISLLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords putative NADH-flavin reductase
publication title Crystal structure of SP1627, a putative NADH-flavin reductase, from Streptococcus pneumoniae TIGR4
rcsb
source organism Streptococcus pneumoniae tigr4
total genus 68
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13460 NAD_binding_10 NAD(P)H-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4r01A00
2QIOA 2Q2WA 4FFRA 3WGIA 3PVZA 2HAEA 4HX5A 3ETDA 4YJHB 4O59O 1YL5A 3GDGA 3RBVA 1J4AA 1U8FO 3GFGA 3RJ5A 2YQ5A 1I3NA 3G79A 3KYDA 3U4DA 4C7KA 3OIGA 3V2GA 2O7QA 4WJZA 3JQAA 3JQGA 1Q0QA 2G82A 4HFMA 2FZWA 5JAIA 1CQJA 5TX7A 1K2WA 4BKUA 3LQFA 4WOKA 4CM1A 5JNLA 2VHYA 2CMDA 5TRTA 3R0IA 4JQCA 4CMGA 2O3JA 4Z0HO 4RF2A 3L6DA 1NQOA 3BXXA 1UXJA 4CLRA 1E6WA 1PL7A 5DCUA 1NAIA 3FTNA 3VZPA 1PQPA 3ANLA 2ZYAA 1D3AA 1U5CA 2HMWA 2IRWA 2X0RA 3ETGA 1GUFA 2ZQYA 3K8ZA 1G0NA 4R3WA 5ADHA 4IDAA 3DL2A 3NX4A 3MWDB 1HYHA 1ZMTA 2FWMX 2O48X 1LNQA 3NT2A 2VUUA 4GX2A 4B3JA 4CMEA 2JFHA 1XDWA 4Y67A 4RDIA 3U4HA 4AFNA 4BNGA 1LRJA 2IXAA 4MO2A 4G5HA 1X1EA 2WJPA 5I7VA 2VYND 4BKQA 2DM6A 1IHYA 1IYZA 3JV7A 4PZDA 1P44A 2FPIA 4E32A 4Q3CA 2FZEA 1JQBA 1VJTA 5IFLA 1N8KA 1SPXA 4BMSA 1QYVA 3TL3A 4JLWA 3PZBA 3QVOA 5DP1A 2HKIA 4UAGA 1GADO 2X86A 3ENKA 1EQ2A 2Q2QA 4ND4A 3ZWCA 4CM6A 4CMIA 2JFFA 4L4RA 3OP4A 3QIVA 4CM8A 4YT5A 1A9YA 4J91A 4WKGA 4E2WA 1T26A 3FD8A 2NVUB 2QYSA 1QV7A 1WDMA 1PS0A 4TRRA 1Q7GA 1HE4A 2NTVA 4FBGA 5U9CA 3TDKA 3OH8A 4GWKA 1V0JA 3KLMX 5DCYA 4F46A 1BW9A 2VHXA 5JDCC 3IL2A 3VZQA 1R66A 4TZKA 3BMCB 1DOHA 3JD3A 3OJOA 5DOVA 1Y81A 4RDHA 3AJRA 3K96A 1P31A 1NWHA 3KB6A 4HUJA 3TFQA 3KLPX 3UH1A 5KJ6A 3FR8A 3CZMA 3WJAA 2TMDA 3GAZA 2X7HA 1ID1A 3ASVA 2GRAA 3HUDA 3MCVA 1FK8A 3FI9A 3NT5A 9LDTA 3EZYA 1GDHA 2Y1CA 1YBVA 3B20A 1R4NA 1PZFA 3DAFA 1MGOA 2P4QA 1NVTA 1YRLA 5A5EA 1NVMB 5BNFA 4AJKA 1NFQA 3ZH2A 2QHXA 1NAHA 5CPBA 2AEMA 4LCJA 1VM6A 2C07A 4TQGA 2WWRA 1PQUA 3PJFA 2QRJA 3JQAB 3C7DB 3JQGB 4W9NA 1DFIA 3WGHA 3SX2A 1B26A 1VC2A 4G2NA 1IL0A 3KHUA 4IY1A 3WGZA 1YDEA 1DO8A 1PEDA 3BAZA 4RV9A 3RUIA 3A4VA 1OFGA 3PHIA 2EW2A 4RORA 3C1TA 2Q3EA 4LN1A 4WNCA 4CLRB 1N1EA 2CF6A 4ZRNA 3C85A 2O2SA 3AOEA 4ZJUA 1NYTA 1DBVO 4DMLA 2RH4A 1O8CA 2J5RA 3IUSA 3ST7A 3WSWA 4BO7A 2NTNA 5KVCA 1DC3A 1HKUA 3I83A 1CF2O 2PLAA 5DBFA 3WGTA 2GN8A 3H5NA 3AK4A 3U5TA 3PHHA 4R68A 5DCWA 2G76A 2FP4A 3ZZNA 1ISMA 1R12A 3MJCA 4CL8A 1ZO8A 1YQXA 2WD7A 2C0CA 1X0XA 4FOOA 3H65A 2AE2A 3U4CA 4BNIA 1N7HA 2PD4A 3RAJA 2EV9A 4AJJA 3IP3A 1E1LA 4ZHSA 2P4HX 3TZ6A 3PQDA 2JD2A 4KWIA 1BHSA 3ZU5A 4CQMA 2C7GA 2FR8A 4MKRA 1XGKA 5H82A 4YAEA 3K73O 1XHLA 3CSDA 2WE7A 2AQHA 5AXBA 4L4SA 4J0EA 2QYTA 3GF4A 3AI1A 4UULA 4QFCA 1GZ3A 5EINA 4D42A 3GPDG 3FPCA 3I23A 4CMIB 1LRLA 1DRUA 4EDFA 1FF9A 2VWHA 1SEPA 3EK2A 3VH1A 4CM8B 5CG2A 2VWQA 2JHGA 3HN7A 3JYQA 1BDBA 2HMVA 4BO2A 4Q3NA 2DT5A 3I9NA 4J7UA 2JAHA 3HJAA 4QXMA 2C5AA 1L7DA 4WECA 2JAPA 2B35A 2EJVA 4GL4A 3D0OA 3ONEA 1UXHA 2HK7A 4JCOA 1N5DA 1P0CA 1ZXBA 2GZ3A 1JTVA 2J8ZA 1BW9B 4TZTA 3WQSB 5A9SB 3OIFA 2PNFA 4B4WA 3GEMA 1ISIA 2HRBA 5KTKA 1MC4A 1LQUA 1R6DA 3UN1A 5BR7A 2GN4A 4OYRA 1ZNQO 1KYQA 4MIEA 4XDYA 3TZCA 3DBRA 1VSUA 4BMVA 1MXFA 5ES3A 4NR0A 2GN6A 3DBVO 1A72A 4WE3A 2P2SA 4DPLA 1HDZA 4JJGA 1BXGA 1JDJA 2C20A 4Y8VA 5DULA 1IOLA 1EFKA 2X6TA 4ILKA 1R4NB 2O3QA 1HDXA 4FOSA 4JGBA 2XAAA 1WDKA 5ER9A 3JD4A 1DSSG 4ZVVA 3NKLA 2I99A 2WEKA 1WXDA 2QZZA 4DA9A 4FW8A 1BDMA 4E0BA 3PIDA 4OAQA 1X13A 2PGDA 4IZHA 2AG5A 3JQBA 1F14A 4B7XA 4MIOA 3DZJA 3U09A 3HSKA 5LCXA 4EJ0A 5HA5A 3AY7A 4BNTA 2VHZA 2CVQA 2Q4EA 3K92A 3U9LA 1NQAO 1ZMOA 3RSHA 2CSUA 1OBFO 4CV0A 1AHHA 4QECA 2DLDA 4TVOA 3GEGA 1SZJG 3AWDA 2B0JA 1P1KA 3JCZA 3ZWBA 1CYDA 2R00C 1JU9A 1DHRA 4YCAA 3VVBA 5B12A 1FDTA 2EKQA 2VWPA 3IUPA 1FDVA 4M55A 4IS2A 3F5SA 3DZKA 1VI2A 2FSVA 1ENPA 4OXNA 4TMFA 3RI3A 4P38A 2HLPA 2OBYA 3AI2A 3QE3A 4E2ZA 3VDQA 3I4FA 3VH2A 2W2KB 4HXYA 1U4OA 4NZ9A 3O8QA 4NK4A 2DTXA 1K0UA 4PCVA 4ALLA 1LDYA 3RC2A 4Z6KA 4GGOA 2GO1A 5F1KA 2WD7B 5AQ1A 3HWRA 4ZQEA 2O3UA 4RF4A 3PWSA 5A05A 4BO8A 5JDIA 1VLLA 5TIIA 3D5TA 1CRWG 1DJQA 4NH4A 3HN2A 3VPHA 4CQMB 1YONA 4YR9A 3PYLA 3TOXA 3R3JA 3BTVA 2DU8A 4M8SA 2I65A 1PZGA 4LMPA 1V9LA 2BGMA 3CMMA 5JCXA 1AUPA 1HDRA 1H6AA 3R3SA 5C5IA 3DHEA 1KVQA 1GV1A 2C2YA 1PR9A 2DKNA 2PD6A 4WCDA 5DOZA 3Q9NA 1LDGA 4L76A 3HB5X 5CPFA 1KEWA 3UW3A 3DONA 4PGFA 3ZV6A 1EVIA 2B83A 2J3KA 3RBXA 2P91A 3D3WA 1UR5A 3WIDA 4NU6A 4CMAA 3HB4X 3CEAA 1ZEJA 4XA8A 2E6UX 1LEHA 3PTZA 1YJQA 3WNVA 2J3HA 5JO0A 2RCYA 1QORA 1LDMA 1PS9A 1YQDA 4JBGA 3BZUA 1EUZA 4OSOA 1E6EA 1EK6A 3PWKA 1EUCA 3FRJA 4IGFA 3LK7A 3SBOA 1GCOA 4W99A 4D79A 3NDJA 1PWXA 3F6YA 4YBZA 3IOYA 3UVEA 1WAMA 5JMWA 1MB4A 3WS7A 1H9BA 1E6UA 3K31A 1UAGA 1BXGB 5CAEA 2O3TA 2XXJA 4JJIA 3LYLA 2AQ8A 3JD0A 4FB5A 5HM8A 3T7CA 2BGLA 2W98A 2GD1O 3L4BA 3EDMA 1BTOA 1V6AA 1JAXA 2BI8A 2RHCA 4UUMA 1N92A 3DR3A 2HMTA 3E48A 1DHTA 1G6KA 5FEUA 3ZWXA 4B3IA 1ADGA 2EGHA 3NDRA 1R0KA 4WUVA 5COQA 1P74A 1I01A 1I3LA 3HFGA 2QRKA 3V5NA 3N74A 1P1JA 3TZQA 4DBZA 4R1SA 3LT4A 3F46A 1YH3A 3C8MA 1FMCA 3FNEA 3Q3CA 4PVCA 3V2HA 3WGGA 4TRMA 1PU2A 4EEXA 1D7OA 5DN9A 4CM7A 5A9RA 1PJTA 1X7GA 2DC1A 1ZUD1 2FMUA 4XJSA 3ZWNA 3ZNNA 1X1TA 3JQ7A 1EVYA 4Z3KA 1DC4A 3IJPA 2H63A 3KM0A 2BELA 4XX0A 4CUJA 5L7WA 4BNHA 1PGJA 3H3JA 5KKAA 3W4KA 2AA3A 4CLOA 3QVSA 3PJGA 2J6IA 5DT9A 1M6HA 4AJOA 1EZ4A 2DPHA 4Z9FA 5JAQA 1QYDA 4NBTA 3SXPA 1CEQA 1T24A 2GDZA 5TNXA 5K6AC 4PRKA 3PJDA 3BA1A 1HTBA 3BTSA 3ZNPA 1ISHA 1E1KA 1HLPA 4MVJI 4B7CA 2O23A 5A06A 1QLHA 2HCTA 3JQDA 1DC5A 4UREA 4DL9A 3UKOA 3TWOA 3OM9A 5JCJA 4TWRA 4RVSA 1CQIA 3QWBA 1NP3A 1A27A 4HBGA 4OGWA 3ZWVA 2X9VA 4E31A 3E8XA 5CEEA 1JVSA 1GAEO 3ORFA 4OMUA 4PLCA 2I6TA 3LC1O 5TJHA 3WWYA 2B4RO 3D5QA 1U2DA 3QA9A 3NRCA 4RF3A 4YRDA 4OQYA 3PWZA 3W8EA 4BGIA 3KEOA 3I6QA 2CVOA 4IJUA 3D4OA 4OSPA 3PGJA 1DLJA 4MVJD 4BO0A 1I0ZA 3FSRA 3F4BA 3UCEA 3CMCO 4XGNA 4U7WA 4CV2A 2VUSA 2ZCUA 1ZJYA 4ID9A 1R4MA 3JSAA 1ZEMA 2XPCA 1KEUA 1XU7A 1XYGA 4OM8A 1VRWA 4Z0PA 5B1YA 1ONOA 3QWIA 3E9NA 4W7IA 5T5QA 5I9MA 1XCBA 4GMGA 5I8ZA 5LC1A 1SBYA 3P5SA 5KJEA 4QUKA 3BMNA 3VOSA 1A7AA 5A5FA 1RWBA 2LDBA 3DZFA 1TT5B 1SO8A 2G1UA 4IIUA 1NPDA 3KO8A 1T1SA 4U5QA 3PHLA 1SAYA 2GASA 3A9WA 1Y5RA 3I3OA 2ZKLA 3DZGA 1ZK2A 2HJSA 1I30A 2P5UA 4CLXA 5A04A 3ZV5A 3JQFC 1C1XB 4F3YA 3PI7A 1Z45A 1K6XA 3NGLA 4JIGA 4PLTA 1YKFA 1C0KA 2HMUA 3G1TA 3JQ6A 3DBLB 1WW8A 3ZNOA 5CHEA 5JS6A 4CQLA 4PG5A 1I32A 4XRGA 5G0SA 2VN8A 5IXYA 4EGFA 2VYVA 3ZN2A 3OJFA 3GUCA 3RBZA 4YQZA 2D59A 3OEYA 1JWBB 1V3VA 5JC1A 1G1AA 1Y6JA 3I9JA 1RM4A 5U4QA 4N5MA 3DAPA 3E6AA 3PGXA 4GLOA 4RPKA 4DTIA 4MP6A 5K9ZA 2YUTA 1LDEA 2PH3A 4YJGA 2JCXA 3RUAA 3JQ7B 4NDNE 4DREA 2WYVA 5C7OO 3GNTA 1JKFA 2EHDA 4J4HA 4DWVA 2IZZA 2D3TA 1T2AA 1ZXLA 4GQAA 2PKQP 4CLOB 4YWJA 4DC0A 4FFMA 3V8BA 1B2LA 4FD3A 1PTJA 4P4NA 4BO3A 3ABIA 3W1VA 3D4NA 3MJEA 4K28A 2ZCVA 3ZWPA 1JAYA 1OZAA 4OXKA 4RQTA 2I3AA 3CUKA 4CLEA 5IDWA 2EKPA 4E5NA 3FNGA 5DZSA 4BO6A 5HWSA 4QTZA 3F47A 4FFOA 2I5PO 4EZBA 5EQFA 2W2LA 1YL6A 4JK3A 1NWCA 3HE3A 1W0CA 4MINA 1GZ4A 2ZTUA 4JP3A 3M6IA 1NPTO 4JBIA 4KZPA 1TVEA 2FHSA 4PFJA 3M2PA 4WEQA 1X7DA 1Z74A 4S1VA 2Y93A 1H94A 3LT0A 2CFCA 1Z7BA 1UZMA 3QVTA 4WLUA 3C7AA 1C0LA 5F1PA 1L1FA 3LLSA 3ZHZA 1FDUA 1LSOA 2DBQA 5IXSA 3UUWA 5G0TA 2YDXA 1EFLA 3FBGA 3ANNA 3LC7O 5F1OA 1HSOA 3EMKA 4WPGA 2WTBA 4NBWA 4FPXA 1GD1O 4DPMA 3AUAA 4RVUA 4W9NC 3BHIA 1XSEA 2OMEA 2PKRA 3D1LA 1R4MB 2YW9A 5AVOA 1O9BA 1UJMA 1HLDA 2QG4A 4H16A 3K30A 2UDPA 4HKTA 3MTGA 5IN4A 1BMDA 1RKXA 3QWFA 4WLOA 4C4OA 4D3FA 3OMLA 4IQ0A 2Y1FA 1MX3A 3LU1A 2GGSA 1YB4A 5I9LA 2EWMA 3JYLA 3GAFA 1MG0A 2Q1TA 1ZW1A 2X58A 1B3RA 4FC7A 4YDRA 3RKRA 3VH3A 4FJ0A 3S8MA 4OHUA 1T2CA 3AOEC 4RPJA 4BNLA 5JYDA 4J43A 1DRWA 3BMNB 3WICA 3KYCB 1E1NA 4HV4A 4IXTA 4FGSA 4BGUA 4E30A 3GUYA 3T4EA 4LISA 2C59A 1Z6ZA 5JY1A 4U6QA 3W4JA 2B4QA 3OJ0A 3QSGA 5T8KA 1XKQA 3F3SA 4WLNA 3ZHBA 1YGYA 3VPSA 2HMSA 3UCXA 2OFPA 1N7GA 4KUGA 4WCFB 3S2GA 2B5WA 1NTOA 1Q1NA 1S6YA 1WNTA 3Q6IA 1VPDA 5B37A 1W73A 3AUSA 4J7CA 4NMHA 2W8ZA 4BNWA 4NNJA 3NDIA 3MEQA 1H9AA 2D1YA 4XDZA 4CQLB 4BO1A 1EE9A 4DGSA 4RL6A 3UHAA 2W90A 1ENYA 1TI7A 4DBVO 4KP7A 1WMBA 3N58A 1LDBA 4J3FA 4RQUA 4C7JA 4FFPA 3F1LA 4OH1A 4XR9A 2PZKA 1F8GA 4NIMA 3AFNA 5COBA 1R16A 3FR7A 1Q7BA 2ZK7A 4GX0A 3V1TC 5TT0A 1A71A 5JC8A 2JL1A 4NK5A 4OKIA 1UXKA 5JY6A 3H3FA 3KSDO 3RC1A 2VHVA 3QVXA 3E18A 2Q4BA 3F5QA 1GUZA 4CMHA 1UXIA 5JXWA 3GVXA 3ITKA 2PGJA 5L4LA 3EYWA 2EXXA 2O2YA 3BMQB 3PRJA 3BIOA 3HDYA 1E92A 2YQ4A 1IZ0A 3OJEA 4BO4A 5CP8A 2P68A 1GCUA 2VYNA 2Y1DA 5TLSA 4G81A 2JFGA 4DXHA 4I08A 1PJ3A 2GCGA 4QQRA 3ZDFA 4I5GA 2YFQA 3WYEA 2UV8A 5CDYA 4BNFA 3JD2A 1CETA 2GNAA 2ZTLA 1AHIA 3DTYA 3Q9UA 1PL8A 5TQVA 4J7XA 7MDHA 2HO5A 3O4RA 1LC0A 2IEBA 4MVJF 4UEOA 4X54A 3BHMA 1YBMA 1IPEA 5JSFA 4IJWA 2GR9A 3PQFA 5FWNA 2NQTA 1K89A 1QP8A 1D1SA 2DPGA 4AJ2A 4B4UA 3I9LA 2PKQO 3GGGA 1RYDA 3L9WA 1Z73A 1B8UA 1C0PA 1I24A 5AXDA 1KS9A 3RUCA 1TEHA 1GZ6A 1U2GA 1YS4A 1YJ8A 3PDUA 1RYEA 4UEKA 3RFXA 4BO9A 3JQBC 3FTPA 2IEDA 1BVRA 4PLVA 5TSDA 1Y5MA 5JYEA 1DC6A 1I33A 3BYZA 4KUHA 2B69A 3RC7A 3V1UA 1PX0A 2H5LA 3DO5A 1VL8A 1O95A 1B16A 1QG6A 3L07A 1F12A 5L9AA 1DXYA 5ER6A 3NUGA 3GRKA 1RPNA 5G4KA 3I1JA 3KYDB 2NU7A 4NFSA 4O0LA 4PLYA 3GZ4A 4OOFA 1BWSA 2ZJ1A 3AU9A 3RUFA 4GH5A 1U5AA 3KBOA 2EGGA 3W8FA 3GPIA 1KIFA 2P9CA 3GZNA 4ALMA 2EF1A 1TA4A 2DFDA 2C29D 1JA9A 1LUAA 1QSGA 4J1SA 4AJ1A 1PJ2A 1N9GA 1YO6A 3GGPA 1JKIA 3HHPA 4GMFA 3ZU2A 5ILOA 2VRCD 3AFMA 3Q2IA 4ALKA 1NHWA 2ILTA 1V3UA 3AY3A 1ISGA 3OA2A 2YDYA 4CM4A 3WGYA 4BIIA 1IY8A 3FCOA 4ZICA 2PY6A 4ZGWA 3W6ZA 4BB6A 2CY0A 2PZJA 3HDJA 4BNXA 5I7FA 2BD0A 3JQEA 3L6OO 3GN1A 1WLYA 3R6DA 4P4LA 1LRKA 1MUUA 2AEJA 1QXSA 3ZNQA 2X22A 3JQ9C 4TVBA 4ZD6A 3I5MA 3IAHA 5F5NA 4FDAA 3VZRA 1LLDA 2D0IA 4PIVA 4BS9A 1J6UA 1P9LA 1FDSA 1MP0A 5ITWA 4J1TA 2DQ4A 3VTFA 1Z75A 3UXYA 1HZZA 3CPSA 3WQQA 4ALNA 4WLFA 2E4AA 2Y1OA 4ZU3A 4XQGA 1HE2A 5JFOA 4W4TA 2O4UX 5AYVA 1HT0A 3VKUA 3IKVA 2WYUA 1PIWA 4CR7A 1SOWA 1FXSA 1T1RA 1UZLA 1HF3A 4LVUA 1QLJA 3PFWO 3QJ5A 4LSMA 2C54A 5B4VA 1HYGA 2B37A 3QHAA 4IUYA 5IJZA 3DMTC 3GVHA 4UVIA 4DQVA 3OQ1A 4D44A 1EK5A 1R0LA 1OI7A 4JN6B 4NG5A 4R1TA 3TSCA 1U9JA 2AXQA 5IG2A 2E48A 2PWZA 1F0YA 4PLFA 4R4JA 5FI3A 2I67A 4O63O 1YWGO 4HFNA 3WIEA 1XR3A 4MKZA 2NM0A 5JE8A 3WSVA 2GPTA 4CM9A 3LLVA 3OSUA 4UVGA 1PJCA 4BGVA 3K2BA 5EESA 4UVDA 3AU8A 4MVJG 2DBZA 4PG4A 4OO3A 1NVGA 4GSLA 5FI5A 1WPQA 1QYCA 3CE6A 3NTRA 4DLAA 2CF5A 2OGUA 4F6LA 1KVSA 3K2EA 3E1KA 2XOXA 2BFAA 3TF5A 5TJ9A 4HADA 3WTBA 1JVBA 3C24A 2X0IA 1R0SA 3PK0A 3CTMA 2GZ1A 5COAA 4BUCA 1V35A 3T7EA 2DAPA 5EQDA 2YV3A 3GMSA 1DB3A 3OIDA 3RU7A 5JDCA 2AQIA 3GZNB 4RVDA 5GMOA 2NQ8A 3ANMA 4JXKA 4MVJM 4DMMA 4XYLA 4I5EA 3UFXA 2J3JA 4Q9NA 1HSZA 4AJ4A 1ZSVA 2FPPA 3D4PA 3DMYA 1R37A 4U0KA 5IDXA 1ADCA 3MJ4A 4E5PA 1DRVA 1N9GB 4FR5A 5F5LA 3KZVA 3WDSA 2NACA 4U6SA 3NEPX 5KWEA 1ZK1A 1UH5A 4CM4B 3MOIA 1UXGA 3DZHA 1SEVA 4BNYA 4RGBA 1X15A 5CEFA 2ZJ0A 2Z1NA 5C7LO 4ZRMA 2VOJA 4RLSA 3AI3A 1P0FA 4PLPA 4NJOA 1PR3A 4WGGA 4IDEA 3ZV4A 5IAAA 3WQRA 3X2FA 2YV2A 2Q99A 1R15A 3P2YA 5IZCC 4CMCA 3ZWAA 2X23A 1P3DA 3GNSA 3JQCA 4EEZA 4XQ9A 1OAAA 1BG6A 4HY3A 1YDWA 3ASUA 3ZU3A 3RIHA 2OL4A 3H9UA 3QQPA 2LDXA 2IYPA 4H3VA 4BKRA 1CERA 1LSUA 2EP7A 1Y8QA 2NWQA 4YACA 1PGPA 2F00A 1VL6A 2XXBA 3B6ZA 4Y6RA 1PZEA 2OZPA 3DZIA 4D41A 1KY5A 1ARZA 2C5EA 4LRSB 3HADA 5BSHA 3SEFA 2NUAA 5EMHA 2ZATA 3ICPA 2AMFA 1VJ0A 1NFRA 4GI2A 2EERA 3RC9A 1RM5A 2BFPA 3WOHA 4FFNA 5ITVA 3QVWA 3C3XA 4J4BA 5AXAA 2R2GA 3IJRA 4UUOA 1WP4A 4XWYA 1EBFA 4IIVA 3L9XA 4Q39A 3I4CA 2VUTA 3NT4A 4WCFC 1PGNA 3E9QA 4LMRA 2X0NA 4BOYA 3WBFA 3WJ7A 3PEFA 3PXXA 2O7SA 3MJSA 4EJMA 1MLDA 4RVFA 2PZLA 4ND3A 3VTZA 4E5KA 4W82A 1QV6A 3DBRB 3G1UA 3ZWYA 4A2CA 3G3EA 4RZHA 4UVEA 1ISJA 5TF4A 2AEFA 3ETEA 3IMFA 5T6BA 4W7HA 1LSJA 1IUKA 3STHA 2X0JA 1OMOA 3EVTA 1VE9A 1UDBA 1ZSNA 2Y1EA 4MIYA 4YQYA 4BKOA 4E6PA 4YYZA 1YL7A 3C1AA 3UOGA 2AW5A 3LVFO 4GKVA 4GX1A 4WLVA 4B4OA 4ALIA 1J0XO 2Q49A 4BV8A 1E77A 1T2EA 5BSFA 5C37A 6LDHA 1H93A 4PG6A 4E3ZA 2BGKA 1ZSYA 5H83A 1UDAA 3DZBA 3ICCA 3M1AA 1JN0A 3ONDA 3AOGA 1V3TA 3A1NA 1AXGA 3ADOA 3GH3A 4WLEA 3CIFA 3GRPA 3HQ4O 5JPIA 2Q46A 2ZQZA 3L77A 1KETA 1U3WA 1YB5A 2BFMA 2ZYDA 1ZK4A 4E33A 5C7IO 5ICMA 2I66A 5TS3A 5A4DA 1IULA 2F1KA 3ZI0A 1F8FA 2D4AA 1GFSA 1JW9B 1LLQA 3CKYA 3ONFA 4TRNA 1ZJZA 4LCEA 1C1DA 4Y9DA 4A0SA 1E5QA 3WNQA 2IDZA 1E3WA 2QX7A 2CDAA 5G0VA 2PD3A 1IB6A 1B15A 1CDOA 3EZLA 4JROA 2J3IA 4KQWA 3U3XA 3VH4A 4R5MA 5HRUA 3ZCXA 4FJ2A 1H5QA 3WMXA 1DFGA 1MG5A 2CVZA 5JAZA 4E5YA 3FPLA 1RJWA 2JCYA 3BMOA 1PJ4A 3O8QB 2G17A 4IJKA 3RVDA 4BNUA 3OBBA 3HDHA 3JYNA 2D5AA 4QT0A 2AQKA 4YJFA 1MC5A 1H2HA 3HZZA 2BHLA 4J1QA 2X9NA 1C3VA 1U3UA 3IDSA 2Y05A 2XF8A 5LDGA 1WDLA 1X7HA 4DIFA 3H9QA 3MJVA 3H9JA 4M87A 1MV8A 1ZBQA 4Q3DA 1SCUA 1ZH8A 2YYYA 2Q1UA 3LDHA 1Y8QB 3OF2A 1W8DA 4GVLA 1XIVA 2BRUA 4PLGA 4XYGA 4J16A 3O26A 3EW7A 3FWZA 3TFOA 3IKTA 2R00A 3ZGYA 4BVAA 5G2OA 2AG8A 3ROPA 4KTTE 3T4XA 2EIHA 1E1MA 4IZIA 3H5AA 1DLIA 4J9VA 4K6FA 3D3WB 3GVCA 4MKXA 3EY4A 4MVJE 1A5ZA 1LI4A 3AUTA 3GFBA 3PLRA 3H9EO 1KVTA 4FGWA 4MVJA 3DWFA 3L6EA 2I76A 2Y67A 5DBGA 5KVSA 5DP2A 3A14A 3RJ9A 4HWKA 1HDOA 2E49A 1T4BA 1Q7CA 4KQXA 4ROSA 1DIHA 3GK3A 1JLLA 2HK8A 1GV0A 2HQ1A 4L75A 4XQCA 1HWYA 1T25A 3QWHA 5L4NA 2BF7A 4JJFA 4RPGA 4R16A 1EE2A 1B14A 1KVRA 2BFOA 4CMEC 1HRDA 2RH8A 4BNVA 3NJ8A 3GMDA 3KXDA 4AJHA 4AVYA 1EUDA 5BQFA 4XQEA 1ULSA 3CZRA 3I9MA 3ZHXA 5DF1A 4BO5A 1ZIDA 1DJNA 2G5CA 2Y1GA 4I5FA 2GF2A 3UCFA 3B1FA 3ZWOA 3EC7A 4AL4A 1DAPA 4B8WA 4ITUA 1DIAA 1NR7A 3U49A 2X9GA 1CJCA 2TMGA 5AXCA 3INGA 4NBUA 1V8BA 3G49A 3VAZA 4IQ8A 3ITDA 1L7EA 2DBRA 1BXKA 1VL0A 2C7VA 4N5NA 3WGOA 3H9GA 4YTEA 4ZQFA 2PA3A 1IHXA 2PZMA 2R6JA 4I9NA 2X5OA 4Q3AA 1KOLA 4AG3A 5KJ1A 4LVCA 4XGIA 1F17A 5EPOA 3GLQA 4PG8A 3H7AA 3GNQA 5CFZA 1C1DB 3Q11A 1EQUA 2V65A 2RAFA 3U4IA 1XWFA 2X4GA 5FYDA 2WDZA 1E3WB 1NPYA 4L8VA 4ND2A 4RVGA 2HK9A 1ZK0A 4TKMA 3RKUA 5CG1A 3NTQA 3DC2A 5LDHA 2D5CA 2VT2A 4PRLA 1PJLA 3IP1A 3GN2A 4YXFA 3BMOB 4K1LA 1I3MA 3GC6A 4NFYA 1Z82A 2A92A 3PLNA 1XEAA 4IPTA 4XYEA 4YJFB 3RROA 1B0AA 2GYYA 5A03A 2EKLA 3TPCA 4J9UE 1BVUA 1XQ1A 1M76A 1NASA 4O1MA 4I5DA 4GSKA 4DQXA 3WLFA 1Q2XA 2NVBA 1DFHA 3VKVA 1E7RA 1PGOA 2NNLD 2Q1WA 3E03A 2PGLA 2VWGA 1HL3A 2VZ0A 5JMPA 4F6CA 3B70A 4GLLA 4K6CA 4MPDA 4J2HA 4CMBA 4RO0A 4YAKA 4KOAA 3DOOA 5BNTA 1TLTA 1GYPA 1QYXA 2PV7A 5K6AA 4IM7A 3E5MA 2UAGA 4YT2A 5KJFA 3BMCA 3TN7A 1E3SA 3O9ZA 2GLXA 1K6IA 1KC3A 3X2EA 3FNFA 1A7KA 4PG7A 5KNLA 4M1QA 1AE1A 2RHRA 1M75A 4P22A 3JQAD 3COSA 1P1HA 4UUPA 4IQGA 1Y8RA 1SB9A 4FFLA 3H5RA 2H9IA 1I3KA 3P2OA 3ZW8A 3M2TA 4KMSA 5MDHA 3VPGA 1OOEA 1M2WA 4RLHA 5L4SA 3I6IA 3RUHA 5GY7A 2CDBA 1KBZA 3GG9A 4FIZA 5ICSA 1U3TA 4H15A 9LDBA 3Q0EA 4K9DA 2X5KO 3H4VA 4QO8A 4D46A 3FHLA 2BLLA 1SMKA 4XIJA 4CLDA 2NADA 4BL5A 2E37A 1WWKA 1DIRA 1W4ZA 4XB2A 1U7TA 2ZB8A 2C82A 2EW8A 1JWAB 4DRYA 3D7LA 2YHIA 5EN4A 4ZQGA 3OHSX 1GPJA 1ADBA 2ZB3A 1N2SA 3LC2O 4WEOA 4M54A 5KOIA 1PSDA 1FJHA 5ENVA 3SC4A 4D0RA 4NJMA 3INRA 4EBFA 3LT2A 5A02A 5K0ZA 3GT0A 4IDFA 2O4CA 3WXBA 4IDCA 2NLOA 3MOGA 4NU5A 4BQRA 4PN3A 5JBIA 2EJWA 1H6BA 3CH6A 4YJGB 1PS8A 3WX0A 3AW9A 1GQYA 4DLBA 5B4UA 1KC1A 1YVEI 4DUPA 3ZW9A 5ILGA 2Y0DA 4IDGA 3JQFA 3VVCA 4E21A 5DBIA 2I9PA 4EITA 1O6ZA 1I5RA 1NX6A 2Y0CA 4D3DA 3GQVA 2HDHA 1QKIA 1O5IA 3GA0A 3S1LA 5L45A 3K5PA 1U28A 4E2YA 3F9IA 4NFHA 2VZ8A 4I9HA 3EGOA 3PYXA 4QX6A 1U8XX 4NI5A 4HNHA 3R1IA 5IDYA 3NAQA 4XEHA 2IE0A 3WYCA 4AJNA 5CDGA 2IYOA 5L7TA 2JD0A 4Z0TA 1E0DA 1X14A 3UGKA 2EEZA 2POQX 4FJ1A 5BSEA 5HS4A 5CDTA 2X1HA 3H8VA 1IE3A 1B3BA 3QRWA 1TB4A 5J23A 4B4VA 4BNNA 2AE1A 3P19A 4PLZA 4BV9A 1ONNA 2UVDA 3DXFA 5I9NA 5A3VA 3VPFA 4U0JA 2CUKA 2VCYA 3EHEA 1GU7A 4XIYA 5L53A 2CNBA 1Y1PA 5A9SA 3H6KA 5T57A 4PZEA 3KYBA 3KVOA 3ZWMA 1XU9A 1E3EA 4CUKA 5DDIP 4RPLA 4BQPA 1LC3A 1E7QA 1GR0A 1YXMA 4YAJA 3GVIA 4D45A 4J2OA 4R51A 4E12A 5A3JA 1HZJA 3DQPA 4R9RA 1LLUA 4FSHA 5AOVA 3WWZA 1I2BA 4YRAA 1DIBA 1ENOA 4CL3A 3QP9A 2W4QA 3ROMA 3VC7A 1Y8RB 2A94A 1CWUA 1BSVA 2SCUA 4XCVA 4IS3A 4A27A 5U1PA 3AM3A 4DC1A 3WG9A 2X5JO 1YB1A 2GN9A 4LGVA 5T67A 3DOCA 2GUGA 3RUDA 2H1SA 4CPDA 1LJ8A 1B7GO 2D2IA 4ND5A 4Z3DA 4CR6A 1KERA 2ZTMA 3L0DA 2WYWA 3V2UA 4E13A 3GY0A 1KY4A 4Y6SA 5CDSA 1D8AA 5JDIC 2RIRA 4WASA 4YVFA 3GEDA 4QO7A 1YBAA 3IIEA 3SLKA 1I2CA 1P1FA 4I9UA 2YHIB 3KOUA 4FN4A 4R1NA 1UDCA 3RWBA 2V6MA 1SC6A 5KVQA 4II2A 5CDUA 1T2FA 1PQWA 3ADPA 4QEDA 3VHRA 3AY6A 3NYWA 4NJMB 3BTUA 3JYOA 3WGQA 3KSUA 4BB5A 4XRRA 1T2DA 2Y66A 4P4GA 4L74A 2VRCA 3A06A 2OXIA 2A35A 3KUXA 4CQMD 5HS6A 1ZVMA 1LU9A 4CR8A 3BHJA 2PFGA 1E3LA 2JD1A 2W2KA 1GTMA 1LQTA 2DFVA 2PR2A 3D64A 4JP2A 4R41A 4BHTA 3AUUA 5TC4A 2O3SA 3IS3A 4INAA 3ZWWA 2VNAA 4FQ8A 3ULKA 2Z1MA 1IPFA 1HEUA 2FR1A 3KRTA 4R69A 4TKLA 4XYMA 1Y7TA 3QWAA 3WYBA 1KVUA 4A26A 2DUUA 4FC6A 4JX8A 4M89A 2FPGA 3ON5A 3S2IA 1BGVA 1NQ5A 3OFSA 4P8RA 4XR4A 3SC6A 2CDCA 1SB8A 5CEJA 1ADFA 5BNIA 4ZQBA 2NVWA 4GKBA 3N7UA 1GL3A 1E3IA 1Q0HA 4YPOA 3RD5A 2E82A 2UUOA 4Z9YA 1YOVA 4RZIA 1HXHA 3L4BC 2WD8A 4BNJA 2QQ5A 1KEPA 4L9RA 6ADHA 1UAYA 1SNYA 3QLJA 5THQA 3MZ0A 1NFFA 1E7YA 2QZ9A 2Q50A 1U3VA 4II3A 4GAEA 1H2BA 2BH9A 4CM9D 1HE5A 1EBUA 3KETA 1WZEA 1IZ9A 2VOEA 3I9OA 5KVVA 4NQZA 4OKNA 1GEEA 4IMRA 5I7EA 1Z7EA 2JCVA 3AM4A 2ZB7A 3HNPA 5L51A 4O6VA 4N54A 1P1IA 2NV6A 2OP0A 1RM3A 5EJ2A 4ESOA 3UICA 4BNKA 1VKOA 2JJYA 4LW8A 3W8DA 5G4KB 4AJEA 4CM5A 4MVJH 3LT1A 3RCBA 3U62A 3WBBA 4DIOA 2OOSA 5FFFA 1I36A 4DYDA 1FDWA 1ISFA 3Q2KA 2VTEA 4A10A 2GERA 2B36A 1EMDA 1HDCA 2DBVO 1WZIA 1P33A 4B8ZA 4JBHA 3G0OA 1GEGA 4GBJA 1EVJA 1EVZA 2Y99A 2Q45A 1GQQA 2JKVA 1GYQA 1Y9EA 2O3RA 1LBEA 2BI7A 5EL0A 1M67A 4TRJA 4BMNA 5GZ1A 1WMAA 2PK3A 4J49A 4ONEA 3WR5A 1MXHA 3DEYX 4UEJA 1NBOA 2QRLA 5JO9A 2P9GA 3ENNA 3OICA 3FBTA 1C0IA 2UUPA 2WMDA 3DBHA 3W4IA 4PLWA 4CJXA 4IXWA 1DIGA 3PP8A 1NHGA 4I1IA 3L4SO 2FOIA 2VT3A 3IC5A 4O5OA 5F21A 5THKA 3HFSA 2IODA 3S55A 2OO5A 4RPHA 1SOVA 4HP8A 4GGPA 4WOJA 4U8GA 4RF5A 5JLAA 3ZU4A 2P5YA 4L4XA 1O0SA 4LSWA 4LRTB 4DPKA 4W6ZA 4EYEA 3V1YA 1K6JA 4GX5A 1CIVA 1UP6A 3B1KA 3VZSA 1G0OA 2Z5LA 4A7PA 1B8VA 1XQ6A 2PH5A 5DNAA 1E7WA 2BMAA 2WE8A 1NR1A 3OJLA 1JKJA 2IXBA 3GR6A 2P9EA 5I8WA 4NPCA 3OECA 5L95A 2I3GA 3S2FA 2HUNA 3UF0A 5BT9A 5FF9A 2IZ0A 4YAIA 1B8PA 3I52A 4IDDA 8LDHA 1H6CA 1OC2A 1M66A 5KKCA 3GDFA 4R3NA 1GUYA 1UZNA 1QR6A 2D8AA 2Q2VA 1PJSA 1QRRA 3JQ8A 1ZK3A 3E5RA 5ENDA 5KIAA 2UYYA 3G17A 4CM3A 4RCVA 4HFJA 4YJDA 1X0VA 1ZCJA 2V6FA 3DAGA 4B3HA 1J49A 2HRZA 5C3MA 3C1OA 4F45A 4D0SA 3TNLA 1Q0LA 5G4LA 2B4TO 5IF3A 4A03A 4BKPA 2X8LA 2CD9A 4CODB 1YOVB 3JQ9A 5BSGA 4YEDA 2HJRA 2G0TA 4CUZA 1DDOA 3NGXA 4J6FA 5TT1A 4EUEA 3KTDA 3OA0A 4KWHA 3WMWA 4EI2A 3PZRA 1UP7A 2V6GA 1LX6A 3MWEB 3GG2A 3ROQA 4MP3A 3K6JA 4CMJA 4E4YA 1H0KA 3FF4A 4YAGA 2YZ7A 3P7MA 1AGNA 3RQSA 1I2ZA 3KV3O 3HG7A 3QY9A 4JNKA 5GZ6A 3SJUA 1TT5A 1GPDG 2VTDA 1H6DA 5L7YA 1NNUA 4MOWA 5IN5A 1DAOA 4FCCA 4OXYA 4GVXA 1RM0A 1ML3A 1HETA 3DMTA 4DVJA 4RJTA 1J5PA 1ENZA 4CV3A 4YRBA 1C1XA 1HYEA 1PGQA 1BRMA 1QYWA 1W6UA 2B5VA 3PHJA 3NJ4A 2PTGA 4WNIA 3JD1A 5G0UA 2HU2A 2BKAA 3AM5A 1PL6A 1LA2A 1P77A 1ZFNA 2ZTVA 4QSMA 3TZKA 4BGEA 2AHRA 4Q3BA 1E7MA 5B4TA 5L40A 3DBLA 1UUFA 4OOEA 1ZKMA 4BNZA 2NU8A 1LLCA 3DB2A 4YA6A 1K3TA 2NTJA 2FR0A 2FRDA 2ZYGA 1QMGA 4K26A 4Y98A 4XKJA 4XZ3A 2J5QA 4IBOA 5KJCA 3DBHB 1VSVA 4E5MA 5IDQA 2JHFA 3OQBA 1ORRA 3ROKA 1GQ2A 4R9SA 4L73A 4DQUA 4J4TA 1PJQA 1ONPA 1EEHA 3NV9A 4CMKA 3DOJA 4XJTA 2OUIA 5EIOA 2IZ1A 3FNHA 2V7PA 1GYRA 3RFVA 4ZN6A 3GHYA 3PQEA 4URFA 3ZV3A 2YJZA 4G65A 5KCZA 2VNSA 5JCJD 2C2XA 3KEQA 3RASA 3Q1LA 1XELA 1E5LA 1U1IA 2RBEA 4J0FA 1AXEA 4LK3A 2Z95A 3DFZA 3EVNA 1EDZA 2DVMA 3JYPA 4H7PA 3EUWA 1MA0A 4AICA 4AJPA 2ZB4A 4DYVA 1KEVA 4CV1A 1ULUA 3LF1A 4EUHA 5JW6A 5A1TA 3SVTA 4HNGA 4KDFA 3OQ6A 4B79A 4DIBA 2H6EA 1YQGA 4XD2A 3OEWA 1MFZA 1A4UA 1NM5A 2GSDA 5JAMA 5H81A 3GVPA 4NBVA 4TROA 4RVHA 4R1UA 4FS3A 3TQHA 1AN9A 3JQ8B 4S3MA 1LSSA 3K9QO 4XB1A 1A4IA 3PJEA 3LZ6A 1XG5A 3MJTA 3DHYA 4OQZA 1WVGA 3NTOA 5IZ4A 2NSDA 2OORA 5T8KC 1PJBA 5IZCA 3TL2A 5GZ3A 3HDQA 1U7HA 5T64A 3PPIA 1T4DA 1UP4A 4QFDA 4OIMA 4YJHA 2YHUA 2QW8A 3B1JA 4AJLA 4CLHA 5I7SA 4Q3EA 4IJVA 3KSZO 4L0QA 1ZZEA 3DTTA 2VRBA 2OP1A 1NXQA 3RU9A 2VHWA 3O03A 3DDNA 3CXRA 1U4SA 1DEHA 3TRIA 5EERA 3LF2A 2V6BA 4A73A 2NU6A 4N18A 4ZA2A 3CINA 3QW2A 5A9TA 2WM3A 3TJRA 1D1TA 4MVJP 4ALJA 4D3SA 1NQTA 2OHXA 4M49A 2Y68A 3E9MA 3E82A 2OBNA 2Y0EA 3KYCA 4KTVE 3U0BA 1M6WA 4AJIA 4EW6A 3A28A 3FWNA 4ND1A 1E3JA 4KUEA 2J5KA 2VZ9A 3EAGA 3QV1A 2FN7A 3TZHA 4D7AA 8ADHA 1P45A 4NBRA 4YB8A 3RFTA 4IINA 3D3EA 2VYVD 3F1KA 3DHNA 1Y9AA 1O89A 3ZHYA 4Y6PA 3BTOA 4EJ6A 4EUFA 2A9FA 4WCFA 4D43A 1LXCA 3DFUA 4IGEA 4TSKA 1HE3A 3WFJA 4OL9A 3VDRA 2YFHA 4M86A 3SLGA 3O38A 1S7CA 2GZ2A 1C14A 3F4LA 3PYMA 2Q1SA 4KDEA 1TXGA 3S2EA 4ZQHA 1LTHR 3SJ7A 1MFPA 1XA0A 4MP8A 4N7RA 3GDOA 5F3RA 2A4KA 4GPD1 2VQ3A 4E2XA 2WSBA 4I8XA 4XGKA 1LDNA 3IQDB 5G0WA 1HDYA 4R5HA 3H2ZA 1TT7A 4PVDA 3PFFA 3GGOA 2CZCA 1PWZA 2FSSA 3W6UA 1EDOA 1VJ1A 4J90A 2W2LD 3PHGA 4A5OA 1K5HA 2O50A 3VPXA 1OC4A 2NU9A 3FN4A 3INTA 3WFIA 3C7CB 4R54A 2DTEA 3JTMA 4BNMA 4MJLA 1O94A 7ADHA 4Z9XA 1DPGA 3BMQA 3UAGA 4PZCA 3WLEA 1A9ZA 3H2SA 3M1LA 4PLHA 3PIIA 1E7SA 5L3ZA 3WB9A 5MGBA 3GOHA 3I9KA 2HSDA 2YY7A 4XYBA 1YE3A 2NVUA 3PDJA 1I10A 4N5LA 4HFRA 1F06A 5HTOA 3MTJA 4UUNA 1VKNA 1D4FA 4OJNA 5HBRA 1XLTA 2YV1A 3OETA 1I8TA 1HDGO 2ET6A 4NHEA 4WK6A 5TGDA 3GHHA 3LSYA 4YT8A 3TOZA 1PZHA 1GY8A 2DTDA 4GWGA 4MDHA 3RUEA 4YT4A 4UVHA 1P1RA 2EG9A 4IMPA 2FY8A 4B7UA 4DLLA 4IDBA 2DUWA 2ZIZA 1N1GA 4J1NA 3WTCA 2EP5A 4R01A 1BXZA
chains in the Genus database with same CATH superfamily
4XDHA 5IULC 2Q2WA 2PCJA 5AM0A 4ZK6A 3PVZA 3GCWA 1F3LA 2GRUA 3AILA 3O74A 3C4QA 2IXEA 3REGA 1RQRA 3AEUA 3B7WA 3KALA 2C9ZA 3HYSA 4U3JA 5F5XA 4AKSA 3UAVA 5HKOA 1ZR2A 4R2XA 3ETDA 3CH4B 3WAKA 4C7OB 4MR8A 1P18A 1K68A 1RRVA 3HNOA 4ZARA 1EB9A 3LLCA 4WBNB 1XVVA 3GDGA 4CKXA 3A6FA 1U8FO 2SNIE 1TLFA 4C14A 1PJ8A 1GNPA 3CEPB 3TCKA 1I7LA 2RC5A 4BQOA 5LL6P 3KYDA 3R8XA 1SM4A 2GHRA 1CIJA 3KJFA 2FFBA 2XKAA 4Q9JA 1GZDA 2FZWA 4O4IA 4EB3A 4HH4A 4P7FA 1TAQA 3HJFA 1Q19A 5FUMA 4UNPA 4ZIRB 2PRJA 3KTFA 4WOKA 4X20A 4CM1A 2CMDA 3LP5A 3CX4A 4LRXA 1SUSA 4CMGA 1UKVY 3M9WA 1TCBA 2O3JA 4J03A 5DK6A 1G21A 1SCBA 3L6DA 1M6VA 3G5AA 1EFPA 1XVUA 1UOPA 3LVQE 2OXTA 4K40A 3RYCA 5KNDD 4X1YA 4RUKA 5LFAA 4X3OA 1MC8A 1DOZA 2HCRA 2PANA 1Q16A 5F4BA 1P5FA 1XZGA 3RSQA 3GDWA 4LWQA 2CV1A 1TKCA 4NFLA 1D3AA 4ZTZB 5ANRB 1KI6A 3UMMA 3NBQA 2JJ2D 2IYXA 4K2AA 1J2JA 3KQLA 4NXNB 5FUWA 1E62A 1ZW6A 3SFZA 3K8ZA 1K4YA 1RYFA 5CVVA 2XVZA 5AI8A 1P72A 4X62B 2PL5A 3MRSA 4R3WA 1XNQB 4IDAA 3DL2A 1ZWLA 1XDDA 3PJRA 1CDEA 3BIXA 1MJHA 3I61A 4LWPA 2H7XA 4W5NA 3HBLA 4DGQA 1JGTA 1CNFA 2JFHA 4RJKA 3RVNA 1JL3A 4AFNA 1HLGA 2FEKA 3X1WA 4N0DA 3JZIA 3PNKA 4OK3A 5ARDA 3Q98A 4UMFA 3R7WB 3TTWA 5I7VA 3SQWA 3JZFA 1IHYA 3QE0A 3E9YA 4PZDA 1GG8A 3HZHA 3RSSA 4A6XA 2NP7A 4Z4GA 1YIOA 3V4SA 2IITA 5FFNA 4ISCA 3K70C 3UHFA 1A82A 3TG2A 5DIZA 2NU9B 3TL3A 4K6HA 1S8AA 2P4EA 2W6CX 1Q0SA 1O6BA 1V1MB 2BBOA 2WAOA 2IXTA 4UAGA 2Y27A 3ZBQA 2EBUA 2PO7A 4N01A 4CM6A 4CMIA 3GEHA 4PONA 3L5OA 2OBBA 1YB2A 3QIVA 4I1SA 4CM8A 1ODTC 1A9YA 4J91A 4WKGA 4E2WA 3A9VA 5JCOC 2E5FA 4YMTA 1T26A 2GJKA 1MAVA 3MYRA 2JANA 2QUBA 3BA6A 2A1TS 5SY9A 1QV7A 3LL4A 4QXRA 2Z3ZA 4TRRA 1TKBA 1J7JA 1I6WA 1Q7GA 1C3JA 1FU7A 2NTVA 3HGQA 5U9CA 2NSHA 2ZI5A 2XSZD 3IPCA 2BFCA 3OH8A 3OMXA 3TDKA 4EPWA 1V0JA 3KLMX 3VTAA 4F46A 1BW9A 1CUIA 4JX9A 3LIPA 3P2KA 3A8TA 4RX1A 3FJYA 5EGSA 5H3CA 5JDCC 4BLOA 4EECA 3IL2A 1M2OB 1AQYA 5GADl 1JEYB 3A3PA 3IUYA 3OU7A 4WN9A 2QD3A 5KNCA 3AJRA 3K96A 1P31A 4XH9B 1KJJA 1V9SA 2X7XA 2YTZA 3KB6A 3MMSA 3PC6A 3KLPX 5EE1A 3JPWA 3HM2A 3FFTA 4M76B 3GAZA 4XIFA 2WM2A 3R3UA 4CDNA 2XE7A 3BXOA 1T6XA 3MCVA 2BFEA 2V7XA 3M5WA 1QPBA 3OCZA 3L7IA 1FXUA 1W93A 3NT5A 5DU2A 5DWVA 4CQNA 2JFWA 3VV2A 2YN0A 4WZAA 3QVUA 1CXZA 4LXIA 3B20A 4GP9A 4KFRA 3DAFA 3ZD6A 1MGOA 4HQ6A 4JB8A 4YMLA 4L8WB 4UTRA 1SBHA 3HH8A 3BG5A 3ZX4A 1R6AA 4PPFA 1Y1QA 1P6UA 1Z0ZA 2IX3A 5J2UB 2V4ZA 3KJHA 4HLNA 3SHTA 1VKJA 1OE0A 1YNSA 2I1WA 2XUIA 2C07A 4O0MA 4YRNA 4HDAA 4L22A 1JIJA 1XN4A 2QXUA 3M82A 1W8IA 4ZI2A 3OX3A 4D5GA 2CL0X 3R3WA 3JQGB 1YJBA 3SYLA 1DFIA 4F92B 1YOBA 2X40A 1XZIA 4LJ6A 1B26A 4EGAA 2Q3MA 3WGZA 1EAMA 4D97A 4GZ5A 1RHQA 3L0OA 4X7MA 3F74A 1YDEA 2P3OA 2C99A 2BL4A 1KKUA 2GEDA 2R97A 1RZ3A 3PHIA 2FOLA 1QMPA 4R9NA 3TBFA 3FOWA 4RORA 2P9HA 3MMXA 4CLRB 1N1EA 2CF6A 2X0FA 4XGRA 3C85A 2O2SA 3BD7A 2GPBA 3MLBA 3SFVA 2G9UA 1DBVO 1U0BB 4DMLA 2RH4A 1NX9A 3IUSA 2FPUA 4WL0A 5BSTA 4JBLA 1XCOA 3THWB 2WTXA 3BQMB 1CF2O 2FK8A 3O3CA 5BSMA 4MVWA 4XIGS 3WGTA 1PWHA 1U0GA 3RK1A 4KQ9A 1C9DB 4LHYA 1J07A 2B8WA 2PX0A 3ZZNA 1H05A 3ECCA 3FHJA 2C84A 2VYQA 4R7TA 4NY1A 4JBYA 4GBED 4HJXA 1KO1A 3ML1A 4TSFD 2HT6A 1N9KA 2VBGA 4BMDA 3CVXA 3QLEA 1R9GA 3A2LA 2EV9A 1Y5IA 2JBAB 3BWXA 5A2QA 2EOAA 4ZHSA 2P4HX 3DMHA 3H6HA 3KB8A 3LVBA 3TZ6A 4FWBA 2DUNA 2KPOA 2P8SA 2VPZA 2NN3C 2R7KA 4JUBA 2C7GA 3HN6A 1R8SA 4MKRA 4QUDA 3WZMA 3L93A 3UAWA 4A73A 4N5IX 1WBJB 5EIEA 2DETA 2PZFA 1MAUA 2BBWA 3NI2A 4J07A 3FZQA 3X1XA 2Q9UA 2NNWB 1NW4A 1Z0UA 2VF8A 2J0UA 5DTJA 5AXBA 3ZLUA 4BZWA 3A4NA 1RIIA 2D1RA 5EWMA 1IU9A 4OBBA 3A0UA 1Y4DE 4ZI3A 1WSDA 5DIFA 4ZAGA 3C3DA 1DPFA 4QNMA 5JVDB 3QBEA 1GZ3A 3R9KA 2A0XA 4D25A 2PIAA 3A1WA 1L5KA 3WWPA 2FB9A 4BP9A 4CHGA 5TPZA 3SZLA 2EBHX 3VU0A 2OXFA 3MD0A 1DRUA 4AK9A 5BVGB 1GGMA 3MWLA 3V48A 4XTCS 1L4BA 2VWQA 4QFBA 1I4EB 2HMVA 2HMAA 2ZDGA 2DT5A 5DYGA 3A1UA 2JAHA 4ATNA 1L7DA 1IOVA 3HHEA 1QWSA 2IDJA 1ACMA 2OESA 4PHTA 1YKSA 2B35A 2EJVA 2XHEA 5I4KA 4GL4A 3BDIA 4RZXA 4LX0A 4WZ6A 2IU6A 3MMNA 3AF1A 4YMWA 4A1FA 4CF3A 2ZVQX 3HEAA 5IPFA 1ZXBA 2FUKA 2GZ3A 1Z5OA 2GN0A 3EISA 4ZREA 3OQVA 5FQNA 5HCNA 4YUYA 5CVJA 4B4WA 4ID3A 1L4EA 1ISIA 2R8OA 3RRNA 5KTKA 1MC4A 3G5MA 5L8VA 1E1QA 3T5GA 4AQ7A 1L5QA 2D0PB 2IYYA 5CH5A 5BR7A 4BQFA 1QCYA 4BNDB 5TQ0A 1L4HA 3IUQA 4MIEA 3ORQA 4B82A 3TW0A 1PYGA 3IIKA 3TZCA 2CN1A 2Q7XA 1U5BB 4QRIA 4C7BA 4Y9RA 4TXJA 2XKJE 4NR0A 1A72A 3NVMB 2P2SA 1WXEA 4K1XA 1F5NA 1HDZA 1XL1A 1JDJA 1JDZA 4Y8VA 1ZR4A 3P26A 3AF6A 4HVAA 4F4HA 2VJNA 1F48A 3DC7A 5JAUA 1B74A 3EAFA 4ILKA 5D3MB 4C0SA 1J7KA 1OYVA 4RTMA 2P9QA 1HDXA 2C5HA 4OREX 2XAAA 4MW5A 3GLIE 4MA4A 5JQGA 3TW6A 1GRQA 3ACCA 3JD4A 4NEGA 2ZUEA 3R0VA 4ZVVA 1TUBB 3ZBPA 2WEKA 3CZ5A 2QZZA 3SLRA 3C0KA 3MTEA 4WVFA 4XM0A 2AG5A 3SKXA 4M37A 3A3NA 2DMRA 1M1YA 5CHYA 2J32A 4ZPXA 5CB4A 3DZJA 1G4UR 2HCJB 5LCXA 2VF4X 4IYRA 1Z18A 2CVQA 1GA4A 1T8UA 3K92A 4DNPA 3HB0A 4B31A 4FGJA 4M7RA 3M4JA 2VP0A 1AC5A 4F4UA 3RSHA 3G0GA 5DX1A 1OBFO 4PGGA 2W2MA 5FBHA 2QROA 3AWDA 2B0JA 4TTQA 2C61A 1EGVB 1HFEL 3SBDA 1VP3A 1JU9A 3P27A 1YHNA 5B12A 3K9HA 2GBLA 1Y3CE 1Y1SA 2R1UA 4MR7B 3UV7A 1HNNA 1FDVA 1ZH4A 3EDCA 5JAPA 3PX2A 2RIPA 4KRFA 3KR2A 1OX4A 4Z1MA 4TMFA 3RI3A 5HKKD 4PPGA 2JGLA 2HLPA 2JGDB 4I3GA 4YCJA 1RWVA 5GONA 5C18A 3VH2A 1DAEA 2W2KB 2EZ9A 2FP4B 3GEPA 1KDYA 1JFLA 4NZ9A 4Z4HA 2PWYA 3O8QA 5IXJA 1F1BA 4R1QA 5CIQA 4P0QB 4INJA 2NO9A 2J9XB 1NMYA 4LNUB 3UTCA 3KQHA 3HWRA 4ZQEA 3ED1A 3IX7A 1OXKB 3CUUA 2OOKA 4KQJA 5HRCA 4RF4A 4BO8A 1U9CA 4PICA 3KWJA 4TS1A 2HEIA 4AX4A 2I1QA 3D5TA 1THMA 4D92A 1DAGA 1QHSA 2CLOB 1H2EA 4DLXA 3PGA1 5B1SA 4DLKA 2FPGB 4CQMB 1QS0A 1YONA 3EXAA 3A6PC 2BR3A 4MDYA 1BKDR 4W63A 1UKAA 5EMNA 1QOPB 2CXNA 3I8XA 1WBBA 2QGZA 3AQIA 3OT1A 2I65A 4HB3A 4P83A 1S2GA 4UJ3A 2D1SA 4HEQA 1P19A 1V9LA 2PPLA 4FDLA 3CPJB 1AUPA 2FE4A 3DHEA 2HDWA 3GT7A 5EJ6A 1H4TA 2C2YA 1MIHA 2DKNA 4ZQCB 3TW4A 2FWRA 4L76A 5HX7A 3TNJA 2RG7A 5CPFA 2UXBB 1JDTA 1K63A 2JJ1D 1YCFA 2VTKA 2MJLA 5DM4A 3K8QA 2Z3WA 1EVIA 2NG1A 4DG9A 3ANTA 4JYAB 2IDMA 1H8EA 5HMMA 3AKCA 1CB0A 1U98A 2O1SA 2YASA 1XK6A 2C96A 3IUEA 2O8DB 1VDZA 3PTZA 2HUPA 3DTNA 2FDCA 3K5HA 1JQ3A 2Q5QA 2EFJA 1OLSB 2NXWA 3CUTA 1O5TA 3PC8C 4WNYA 5LYJF 2ATXA 1REQB 2GZMA 3KWLA 2JF0A 4RKQA 5KX5B 1JFVA 1OY1A 2AG1A 2PSSA 3KKPA 4I55F 4KPUB 4JBGA 4R9VA 1CD5A 1FRVA 3IPXA 4IVPA 4IQ4A 3BKWA 5CUQA 1Y8AA 3DWIA 4ON9A 1EUZA 1JIXA 1E18A 1MX9A 2HM7A 4N8SA 3C14C 3FRJA 3O4FA 2IZ7A 3F2IA 4TKVA 3SBOA 3DVLA 2ATEA 2RI1A 4S1WA 1TF7A 2C3OA 4C4PA 4FSDA 1CR4A 1Q0PA 1KF0A 1WAMA 3GAMA 2I80A 3C3PA 4X41A 4ZAWA 2O54A 4EBBA 3WS7A 4OBWA 1IY9A 1KMHA 2DFNA 1H9CA 1HNZB 5A2GA 3GLGB 2QNBA 1UAGA 2NQ2C 3GI1A 3WLMA 2XXJA 3Q5DA 5TB5A 2AQ8A 3JD0A 4FB5A 2VPWA 1QZUA 2CNOA 4TTRA 3T7CA 3VO2A 2G3YA 3ZS8A 4BBJA 4EABA 5JZOA 4PX2A 3FMGA 1BS2A 1JAXA 4ZV4A 1Q22A 3DR3A 4I81A 3H84A 5FEUA 1ADGA 1IZ7A 3CX8A 4WUVA 3AEQA 4ZT2A 3KPJA 4AZ3B 2E5WA 2FVYA 3M0EA 1IUPA 3N74A 1Q1GA 2FX5A 4XWTA 4R1SA 3ERCA 5BWNA 2B2NA 2OQ2A 3WGGA 5BN3B 1COZA 1OX6A 1VQ1A 2ZJAA 3Q7RA 4JL5A 1TYAE 2JAWA 5E4TA 3SEZA 3TRDA 1BOOA 1MW9X 1U8CB 2Z5FA 3IQFA 4Y1FA 5A9RA 3OUTA 1TM4E 4XJSA 3KQQA 5FXMA 1NW3A 2QTTA 2ZIVB 3EGDA 4HNAB 1JIQA 2GM5A 5LKRA 4MWEA 4Z3KA 3IIJA 1OH5A 2ZIXA 3IMCA 1XVLA 1A5TA 4CFYA 1O6GA 1P9RA 4CLOA 5DT9A 4YAUA 1H69A 1ZD3A 3TK1A 1QG4A 1XLTC 4NBTA 4TTTS 2QLBA 4PM4A 2BN4A 3A7EA 5EYPB 4AO6A 1PE0A 1T24A 2V3WA 4CKWB 4OFZA 1EP1B 2BONA 2GDZA 5HDBB 5TNXA 1C9KA 3KQPA 1QONA 1SUIA 1RACA 1ZOIA 2BAGA 3BTSA 2X3UA 2AJBA 1HLPA 2DX7A 1DQRA 2NZVG 4MVJI 1OWOA 3Q3IA 2OEPA 2O23A 3GLHA 1RD4A 4JC8A 4XVRA 5K4HA 1DC5A 4DM4A 1S9HA 2QOEA 4FZJA 2J3DA 2VP2A 1L5HA 4TWRA 2ODAA 4P82A 3VVMA 4Q66C 4RVSA 4TGLA 5LUAA 1NW7A 3Q72A 1A27A 4HBGA 3QU2A 3ZWVA 4DADA 2C4VA 1KAEA 5B2EA 1VTKA 4L8GA 4O4JF 3VNUA 4FXPA 4H3HB 5K4GA 4FYJA 1GAJA 4AECA 2FK7A 3W5SA 1GAEO 5TJHA 1ZIOA 2IT1A 2B4RO 3B6MA 4RF3A 2B3DA 3RC8A 1EFRD 4NEQA 3AX6A 3W8EA 3M6UA 3GJ3A 2R8RA 1NE7A 3D4OA 4YECA 1C2YA 3U48A 4B71A 2IH5A 1AMNA 2FFAA 3BGWA 3UCEA 1HDIA 4PZZA 3PDWA 4XGNA 3SSAA 1B1CA 4RTSA 1QX4A 1GSOA 3CEHA 2OY0A 1V2GA 4XAQA 2BISA 4K9KA 4F84A 1VGRA 5FNZA 3V7NA 3KKOA 3NVKI 3O8BA 1Y3DE 2VJAA 3ER8A 1KEUA 4KQMA 1K97A 3ISVA 5DN6D 2IWHA 1PKEA 2QR2A 2K2QB 4Z0PA 4M1SA 2NPOA 3FLBA 4EI7A 3LUFA 3E9NA 1GO2A 5I9MA 1EEXB 4GMGA 1T0PA 2UVPA 4MCIA 1E1CA 4MWCA 3T3PB 1S02A 1SBYA 1Y5NA 4RNDB 3HU1A 4KAFA 4ODIA 5LC1A 4BEVA 1US8A 2Q0SA 5KQLA 3LK6A 4UAJA 4QUKA 2A5GA 3ZYCA 4IFEA 2XMSA 3BULA 4YQFA 1DKOA 1Z6GA 3CH5A 3DVRX 1P2BA 1VFNA 2H57A 1E61A 3M6AA 5KNCH 1I3OA 4HNVA 5CXUA 1NULA 1SBTA 2CNKA 1A97A 1OHHA 4HK4A 4MUJA 1FTYA 4U5QA 3PHLA 1N3IA 2GASA 4E09A 2Q0QA 1W4AA 1TD1A 3CUVA 1U90A 1NLYA 1T43A 1UMBA 4LDPA 1ZK2A 2C4UA 2GETA 2ID7A 4Q9KA 3U3RA 4CLXA 1JMYA 3TLXA 4E4RA 4F3YA 3G88A 3HLYA 4QSHA 4B48A 3NGLA 4HRXA 3GIWA 3OD1A 4P5DA 1NI4A 1ZGGA 4E03A 1U0TA 5EGNA 4DARA 4DB4A 3G1TA 4F96A 5AKLA 2CLEB 4B2PA 1QH1B 1U28C 3N3BC 4KBYA 5FO1A 2HNAA 5FUBA 4HNTA 5JS6A 3HXKA 5AESA 2ZE8A 1X77A 2ZJ6A 3DDUA 1OYYA 1II8A 2ETVA 1HTWA 1NN1A 1CR6A 3CPEA 2FLKA 2O6LA 3CCFA 3EPRA 3T52A 3FYUA 3B8EA 3QEOA 3IUJA 4YQZA 5JC1A 4GPBA 4Q00A 1ZJ6A 5LJIA 3I9JA 5U4QA 4YPFA 1IXRC 2AVNA 3PGXA 4GLOA 4RPKA 2ZIFA 4DTIA 1Y1TA 4JYBA 4YJGA 1FEZA 2NXNA 5K51A 4DREA 2ERCA 4NVRA 4D5EA 4LFAB 5LXTF 3AUJB 4UBMA 4NDZA 3PQCA 4FFVA 4J4HA 5FL7D 2IZZA 3L7KA 3ZPXA 1T4CA 1ZXLA 2BMVA 2PKQP 2Y9PB 3MFYA 3N07A 4FFMA 1LPBB 4KKVA 3RT9A 1G3MA 4NZOA 4ER3A 4UFNA 4ZQIA 5DX0A 1CDZA 4QLBA 3W1VA 3B13B 1W30A 2H3HA 4HDRB 3HA5A 4KXWA 3FKJA 4MW0A 4K28A 4WKNA 3ZWPA 1CQPA 5EMKA 4OXKA 3EZ7A 4RQTA 2EKPA 3V6MA 4E5NA 5JNWA 3BM5A 1RMYA 2HTEA 4NZNA 5DZSA 5HWSA 1Z4IA 2AVDA 2I5PO 3F47A 1QU2A 2W2LA 4Q5IA 3WKBA 1GGJA 1VBFA 1RFLA 4GOLD 3SXUA 3LPMA 1GZ4A 4Z2YA 3UZUA 1CQIB 3T5MA 3O1IC 3O8DA 5DT2A 3AJEA 2XB2A 4EY5A 2O8EA 2FHSA 4WEQA 3M2PA 1X7DA 4TZ0A 4Q9DA 3SF8A 1JB9A 2B4YA 2P67A 3NGMA 1JZSA 3CG4A 3LT0A 3QHQA 1QB8A 4KXUA 1YUNA 2CFCA 3N9IA 3G2IA 1DKUA 4H3SA 4IO1A 5NLLA 3QTLA 3P9KA 3WGLA 4S12A 1G2PA 5F1PA 1NBIA 1AKMA 4RK0A 3WWDA 3ZHZA 3AKZA 4G24A 3FBGA 1OJ7A 3ANNA 1SBIA 3W77A 2N1BA 4WPGA 2DY1A 2J6HA 3UA4A 4BZQA 4RVUA 2VQDA 5K8UA 5HM8A 4BAUA 2OMEA 1NI5A 1LI7A 1R4MB 2JDID 1O9BA 1UJMA 1HLDA 2YW9A 4TTAA 1M7BA 3MTGA 5CYPA 5IN4A 2C83A 1BX3A 4G0PA 2G0AA 4GOJA 3WMRA 4MQMA 3VHXB 2EWMA 3FWPA 4YLEA 3ELDA 3JYLA 2Q1TA 5I47A 4D8YA 1ZW1A 2Q9AA 1B3RA 1P91A 4RHXA 5DXJA 4GEGA 3VH3A 3ZDEA 3ZI7A 1SCAA 1RAAA 4G8CA 4ARCA 1O7JA 1Z5NA 3T9EA 1PZNA 1DRWA 3BMNB 1RMQA 2BEUB 1V4VA 4B3FX 4DZZA 3WICA 2A88A 3P2EA 3NHJA 4N49A 3VOTA 2XKKA 2EFHB 5DNUA 3OLWA 1HT1E 3DM9B 4LYEA 2R79A 5GJWC 4AKHA 3NM6B 3LFUA 4FGSA 1VGVA 2WW8A 4E30A 1W0JA 3T4EA 5C8XA 4LISA 2QI9F 2C59A 3LZCA 4QC2A 2AMVA 2GEUA 4OMCA 3FNIA 4JMLA 4J94A 3W4JA 3OJ0A 4M21A 5D5QA 4NCHA 1OB5A 1O77A 4L4UA 1XKQA 3F3SA 4WLNA 3SNHA 2HMSA 3UCXA 2VAMA 2OFPA 3GRFA 4OLHA 5F77A 5J4HA 4PU0A 4JH0A 1OLUB 3IDFA 2G9VA 3QKIA 2FEAA 3FH0A 1IMOA 1WNTA 3Q6IA 4DEVA 1VPDA 1NOKA 3QPAA 4H35A 3QW4B 1FVXA 1SA0B 2GTIA 1WD7A 3MEQA 3NDIA 4OHCA 4BWGA 3K5WA 1MIOA 3K2IA 10MHA 1H9AA 2FN8A 2P0AA 2RHGB 3CO0S 4X3CA 4XE5A 4CQLB 3EGVA 4DGSA 2UYGA 3ZG6A 4BQSA 3UHAA 2VZEA 3SYKA 2HJWA 1ENYA 5GGXA 1XL0A 3IQZA 3NBZC 2GMWA 4J0KA 1KMIY 1KEKA 4C7JA 5IWAB 4RQUA 1YA6A 4FFPA 3MAJA 4ND8B 3ZDRA 2PZKA 4P4SA 1DT3A 1V8OA 3DTVA 1S96A 2FPOA 1R16A 2ZWOA 3P9NA 4NMLA 5KDLA 4QNNA 3TAXA 5JJ5A 2ZK7A 5JATA 3TRHA 5EHZA 3IH5A 5LMZA 2EP8A 1SUAA 2X0EA 1P2FA 1RVV1 1QHEA 4LYYA 2IV2X 2Y1LA 3KZNA 2VHVA 3HJGA 3MRTA 2QJOA 3HS3A 4QIHA 3NUZA 2PV0A 1GUZA 4MPTA 4MUGA 4LDZA 1CHDA 1GQFA 1LJLA 4CCWA 3I1IA 4CMHA 2PGJA 4RJLA 3DAOA 3GUHA 3PRJA 2CB0A 1ZL2A 5D7NA 4MYSA 5JZ9A 4Z2AA 2YQ4A 1WDTA 4GXNA 1W36B 1V1RA 4IHJB 2VYNA 4YJ3A 4DXHA 1X2EA 1PJ3A 2D1TA 4OHBA 3E9DA 4QQRA 5M34A 2FFRA 2HL6A 2C3PA 4I5GA 4N0PA 4Q05A 1XXHE 3T3GA 3TQFA 4MGHA 5BPFA 3FMVA 1XRLA 2ZTLA 3RTAA 3VVLA 4ZMRA 1QGED 1UM8A 1Q6YA 4JQSA 5TQVA 4S1TA 2A78A 5FBZA 1VMKA 3CKKA 2HO5A 4KN6A 4ZEVA 1Z8FA 2CSXA 2X1MA 2CK3A 2IEBA 3KOYA 3EIHA 4X54A 3BHMA 1ABBA 1YBMA 4RVNA 4IJWA 4ZCPA 2GR9A 4HAIA 4ZVSA 2NQTA 4AY2A 1I2AA 3AR7A 2HF8A 1D1SA 1D2MA 1Z6AA 2DFKB 4ND6A 2ZBPA 4B4UA 3I9LA 4MA0A 5AOAA 4ZYTA 3JW8A 1KIAA 2PM8A 3GGGA 1CJVC 1Z73A 3V6LA 1C0PA 2DECA 2VUHB 1V5GA 1I94B 4YUXA 2QW1A 4P35A 1GZ6A 1YS4A 4FZ5A 1YJ8A 1UEJA 2X8WA 4P33A 3RFXA 2WWYA 3FTPA 2IEDA 4MGZR 3HP4A 2YWDA 1BVRA 1FIUA 3UMSA 4PLVA 4OA8A 5TSDA 3KZXA 5JYEA 1T9BA 1DC6A 3HYNA 3BYZA 2BM0A 3O4GA 5BN1A 1PX0A 1W34A 3K09C 1DKNA 3SVLA 1B16A 3Q3GE 1QG6A 3F3YA 1F12A 4YV7A 4C0LA 1DXYA 3MGBA 5DW3A 3ORHA 5ER6A 4GP7A 5C5EA 2HNBA 2WM8A 3KFXA 5LBIA 5H02A 3TOCA 3KYDB 3RVPA 4YRQA 3HUTA 2NSYA 2OZLB 3B82A 5JSZB 4NFSA 2P8JA 4O0LA 4PLYA 2GBLC 2OLKA 2I4NA 3T4PA 4YRGA 2CJYA 2QUIA 3SE0A 2O0LA 2QY6A 3RUFA 4CETA 3KBOA 1L7QA 1IK4A 1Q1ZA 2G5TA 2HV9A 3HB1A 2P90A 2OCXA 1U6KA 3RYHB 3BXZA 1TA4A 4X8LA 1C4WA 2ZG6A 2ZBDA 5A5DA 5BV1A 2R8YA 5C1OA 3VR3A 2H4ZA 4IYJA 4Q16A 3RS4A 4XB6B 4OU4A 1P0MA 3D8UA 1QSGA 4TMXA 2DSNA 1CQWA 2XLBA 4JUAA 3GGPA 2WHXA 1N4AA 4QL3A 3ZU2A 5JMOA 5ILOA 3KKZA 4FDUA 1PF7E 4KAXA 1KI6B 3AY3A 5JNUA 4Z4IA 3OA2A 3BJRA 3WGYA 3FOAA 4BIIA 3FCOA 2EQAA 4XTRA 2ZRPA 4IKOA 4BB6A 1EHYA 2X9LA 2PZJA 4UKDA 1ZITA 4BNXA 1IXSB 3V4PB 1PR2A 4I6GA 4IVNA 1CW2B 1M34B 4I1VA 5BMVA 1D2CA 4LMAA 4NICA 2H65A 1Z3IX 2J7PA 3R6DA 4P4LA 2AEJA 4HUTA 1SKMA 4RABA 1V41E 2XNCA 3RTDA 5H0IA 3SJCA 3K70D 2Z43A 3BHNA 2X22A 1IH8A 3WWEA 4U8HA 3GJ4A 1W2GA 1Z8NA 3I5MA 1QGDA 4JBNA 1JHYA 4FDAA 1YZGA 4NPHA 3VZRA 1HYQA 4NZZA 1Z6TA 3GAAA 3GX1A 4MCJA 5CLFA 1J6UA 3T3HA 1P9LA 3T54A 3HM9A 5ITWA 2EFCB 2G04A 1L7NA 4J1TA 1G3RA 1JIUA 2JBWA 3W5IA 1EX9A 4MLPA 4WLFA 3WMGA 1CSEE 1NT4A 4C1BA 1GPLA 2MSLA 4XQGA 1R1DA 4LDQA 3I28A 4HXEB 2I03A 4KH1A 1E8NA 1ESZA 1L1QA 1VMIA 3F9RA 2HK6A 1AUVA 4R0VA 2WYUA 3S2YA 3L8YA 3LOUA 1ZIXA 3L40A 2W2QA 1XUOA 1TF5A 5REQB 3E22B 4EMTA 3PKIA 4DMHA 1FY2A 1NL3A 2QMEA 5IAJA 5B4VA 3R3ZA 1D6NA 1FFWA 3OQIB 3CH7A 3QHAA 4IUYA 5E9WA 4UVIA 2P78A 2AFVA 1B6TA 1R0LA 2JLCA 3G68A 1DMSA 2BFCB 1BHJA 3RVMA 5ALKA 3WLAA 1T3HA 5EY5B 1HPLA 2XTZA 4OEHA 5SYNA 2Y76A 4EI9A 1JBQA 1F2TA 4G4JA 1SRRA 4UNRA 4GPIB 3GT3A 2FWPA 4WN9B 2FEPA 4MLCA 3VR2A 4OLBA 4MCHA 1F0YA 3EARA 2I67A 3HPRA 3T7DA 4RVOA 1YWGO 4QAJA 3WIEA 1DKQA 4MGKR 4Q82A 3REFA 1KK0A 2CMFA 5BOSB 2BFEB 2ZSBA 1DAMA 3OSUA 3HB9A 4NRDA 4BTVA 1PJCA 2AR9A 1IZZA 4FEGA 5EP4A 1O2DA 1G5QA 5L3SB 4NATA 4WZAB 5F7ZA 4MVJG 2VPTA 3SOZA 4PG4A 4OO3A 3HKEA 4DLAA 3LCJA 4O4IF 3DP7A 2OBLA 4ZO4A 1KVSA 2HWKA 2XOXA 4D3XA 3KT3A 5FBWB 4D9HA 1JVBA 3UPUA 2X0IA 3PK0A 3WNZA 1NXTA 3OE1A 4ENTA 2OZKA 1GZUA 2RJNA 2QENA 3CSUA 3QY0A 3TBKA 3R74A 3DL7A 1JLMA 2DAPA 3HJNA 1UAAA 3GMSA 1JSCA 3KOXA 1FLDA 2AJLI 3AFGA 5T41A 3ZV7A 4ZZ3A 1ZD1A 2LW7A 2CNWA 3MBIA 3PFHA 2VHTA 3GD7A 2AQIA 1MVNA 1JDNA 2GESA 5AM4A 1NMXA 3GZNB 3PF9A 3CBQA 4D9BA 1K7CA 3KP1A 2IUSA 3H83A 2IHTA 2JH8A 4KQFA 4IRUB 3AETA 5CT8A 2IV7A 3D7KA 4DMMA 3TRKA 4I5EA 3UFXA 2J3JA 3IGFA 2EJCA 5FAKA 2CLLB 3AEXA 3DMYA 3R6GA 4EY8A 3GQBA 3K9GA 5DLYA 3VZCA 1YU6A 5IDXA 2QVCA 4MUXA 1YQQA 4BFSA 3WLLA 4LFCB 3JRWA 3SSNA 4P08A 4GI7A 1BE8A 2ZSAA 2CXSA 4UMDA 3HFRA 4GI3A 2GCNA 1LD3A 4PANA 1YVPA 1FS6A 2CL7X 2VH2A 4HH0A 4INPA 4CM4B 1NN5A 1UXGA 2GEFA 1H3EA 5AJUA 1FQWA 4BVJA 2WJIA 4PY2A 3NNNA 821PA 3H18A 1E2EA 1BWPA 3AI3A 5IKXA 3D4BA 3R23A 3KU1A 3ROTA 2JI7A 1PR3A 3ZV4A 4B84A 4B81A 3VZQA 2QZPA 1R15A 4ZTUB 3JQCA 4FMDB 4EEZA 2W8BA 3RG2A 3RWMB 1BG6A 4XWAA 1RQGA 3ASUA 4N3BA 3U17A 3RS0A 4DG5A 4L95C 1WVMA 1L5OA 1RABA 2KS6A 2AC4A 2WWXA 3KZKA 1PVVA 4YXWA 1L7OA 3C2QA 4AY4A 1X86B 5GM2A 5M2QA 1JEOA 2ZRLA 2NWQA 3KT6A 4YACA 2HYDA 4KSCA 4B2YA 5BV7A 1PGPA 1CULC 2F00A 1ECFA 3B6ZA 2CLDX 2J4FA 1YI8A 2R65A 1CZOA 1NJ5A 2ZXFA 2AN5A 2C5EA 4MB6A 2XWSA 2VVTA 4PQYA 2B1JA 3I0MA 2QLTA 5B3JA 4WW0A 3IAFA 2AMFA 3FPHA 2A1TR 1GM5A 2EX4A 1NFRA 1M0TA 4GI2A 3EA5A 1L8AA 1S3IA 2TSYB 3A31A 3WOHA 1XN1A 4J4BA 4CDMA 3D6UA 5K3FB 1KK3A 3Q8WA 3R6WA 3X3HA 5F4ZA 3T1QA 3ECAA 2EKBA 1C3XA 1N6LA 2R48A 3K4HA 2IYNA 1VPEA 3LJKA 2OV8A 1D1QA 2G07A 4WCFC 4P53A 3ZJYA 3P8ZA 4L50A 3O2JA 1KI7A 4AWBA 4TV9A 3E4DA 2OK7A 4JVSB 1JECA 2QD5A 2ZUDA 3BF8A 2LGJA 3QU5A 1CUSA 5BVHB 3MJSA 4EJMA 1MLDA 1MQ8B 3EB9A 1Q83A 2O8VA 1O58A 3DP9A 4KXMA 4E5KA 5KNBD 1GAWA 4O2RA 5IEJA 1QV6A 4A2CA 1Z17A 2E3JA 2JZNA 3PNLA 4RZHA 4UVEA 4A16A 3IMFA 4MVYA 2IHVA 1SCQA 3HKBB 4FN5A 3STHA 2XCUA 4RV4A 3IO5A 2ZYTX 4TYPA 4ZXFA 1VE9A 3ZTTA 4PR3A 4Y6SA 1J8DA 2C4TA 3GMIA 4RADA 4YYZA 1YL7A 3C1AA 3IE1A 4N40A 3IT2A 4G0WA 1ZY2A 5ICEA 1KZ7B 3A9CA 4ALIA 1EHIA 1QGUA 1Q0UA 3U1BA 1J0XO 4H2DA 1NUTA 4RCZA 5ETJA 5F7JA 3UUFA 3P71T 3I01A 5E3IA 5BRNA 6LDHA 5JYCA 4KMMA 3HCRA 1K75A 4PG6A 4E3ZA 4JQYA 2BGKA 4KQ1A 4Q9AA 4BLSA 1GAXA 5EZQA 4TUYA 2GD6A 1UDAA 2QAGB 4JHLA 3DZBA 3WE7A 2IDKA 3EW9A 3CCCA 3ICCA 1M1YB 3M1AA 4DCCA 5CB4B 3KVNA 1C29B 1CY2A 2CFTA 4OV6B 4N12A 2IYAA 3QELA 4L5YA 4ARZA 1EGQA 1AXGA 4RC9A 2CCKA 3CGGA 3GH3A 4WLEA 2XZPA 5JPIA 2Q46A 1KJ8A 1U3WA 4TV8F 2ZYDA 5DSZA 1ZK4A 4F3RA 4JU9A 2VEOA 4GLBA 4WXHA 4D8TA 1QH9A 5TS3A 1GLGA 2O20A 4ZAYA 3W90A 5A4DA 5B1EA 5B57C 4LQLA 2AFHE 4Q47A 1LLQA 5IC4A 3R41A 3V80A 3OO1A 1ZJZA 1C1DA 4N8DA 5HK8A 1E5QA 2ZBEA 2IUUA 4OGLA 4A0SA 5AD1A 3PNQA 3QU9A 3FJOA 5CITA 2NV0A 3MCWA 4YBRA 2CNNA 1YUBA 4FCWA 1P2SA 4JROA 3EZLA 3VH4A 4O2AA 1COWA 4G0QA 4R0NA 1H5QA 1N57A 1DFGA 4K86A 4PO3X 3VNSA 5JAZA 3EPJA 3BMOA 1SXJA 3CJTA 3O8QB 4IJKA 1FRFS 1ZCAA 2YOHA 5EE9A 3DLBA 1T6BY 3OBBA 3ZVKA 1C3EA 3JYNA 1FPQA 4PZ9A 4QT0A 1XROA 3EG5A 2I2WA 2YYZA 1GPBA 2I22A 2BHLA 4E94A 3H9CA 3SYRA 3PUIA 2X9NA 2FUG1 1E99A 1JZTA 3FSGA 3HWSA 4M9RA 1IWPB 4L2IB 3KK0A 2ZJ3A 3D8NA 3LQQA 3NWBA 1SC4A 5HFNA 4DIFA 3PGLA 3Q3VA 4KO4S 1Q17A 3MJVA 2FG6C 1KQOA 3P9RA 1DKPA 4F2WA 3K9LA 4G0ZA 4Q3DA 1H2XA 1ZH8A 2DEUA 2P11A 4FI3F 2LTAA 3OF2A 3OT1B 4JI4B 1Q77A 1XIVA 1NQUA 2C42A 1QHIA 3D2LA 5E7JA 1BEZA 3ELBA 2GA8A 5HE8A 2G1JA 3FWZA 2ZLBA 3R7FA 1K3UB 2R00A 3B3AA 4DCMA 1EFVA 3IKTA 2ANCA 1SG0A 2F8LA 2X6RA 3NZEA 3T1HB 3C3AA 2WJAA 1CUFA 4HXFB 4KTTE 4M1ZA 4BYGA 2DQYA 1SIOA 3GH1A 4JODA 2FF7A 4PZ0A 4LOKA 1CPYA 1W87A 3MQFA 4K6FA 4DMGA 4EB6A 3V42A 4X97A 1U9YA 4IJ5A 1O54A 1E2JA 4NC9A 3SQLA 2EYQA 2HA5A 2HJ9A 3GVCA 1EUQA 1RIFA 3AC0A 1BE0A 3EY4A 3ZJVA 5F12A 4MVJE 1A5ZA 3D7MA 3DZDA 1IK6A 5AP9A 4BYMA 4FWTA 1MDBA 1MOSA 4YLGA 1TO6A 2XUFA 3PUHA 1KVTA 2V7WA 4G0UA 3LNCA 5LYJB 1ODCA 1VDMA 2ZI9A 3OU2A 2VSXA 4JR2A 1TZBA 1HGXA 1IFXA 3DWFA 3I12A 4EEKA 3AL2A 1O1YA 2FEXA 1X3LA 5DP2A 5EWLA 3AVYA 1K66A 1L6RA 2E49A 3K0FA 4X24A 1NW9B 1SULA 2IYUA 2E4ZA 1DIHA 1W25A 1JLLA 1M8GA 2GEVA 2HK8A 2BBTA 1F51E 1FB5A 2GXUA 4AN4A 1VE3A 4S24A 2HQ1A 1DOAA 1JA0A 2MSCB 2P9FA 4ZI7B 3QWHA 5BSWA 2ORYA 2BF7A 2OMKA 3IAS1 1KMHB 3R09A 4CU2A 4ARAA 3ZIAD 4PYJA 3EEFA 1HRDA 1QQ5A 1J23A 4HAUA 2VRWA 3GMDA 3X1DA 4NQRA 3HXPA 4QTTB 4D56A 4AJHA 5ALDA 5HF6A 8GPBA 5H70A 5JR3A 6Q21A 1ULSA 2R8EA 1OREA 5DF1A 5BORA 1ETHA 4H3KB 3HXLA 3VRHA 2RK6A 1ABFA 1BS1A 3AEQB 4ITUA 4ZEMA 1DIAA 1PP4A 1QFMA 5DHTA 2F1RA 3U49A 5MN4A 2TMGA 4X65B 1W88B 4UM7A 2VJQA 2PQ0A 3GJ0A 3DOFA 4O4HB 1MC1A 1E4OA 4Y1GA 1QH0A 2WF6A 5FTKA 1XCLA 3G2PA 4C06A 1GHTA 4ZKDA 5HW0A 1ZKDA 1YR8A 1VL0A 1DMRA 2C7VA 5T7BA 3HDTA 2MT9A 1XDZA 3LXRA 3KE9A 3QPWA 1CEXA 2R6JA 4X71A 3PUYA 1YMUA 5ALEA 5ES4B 3T5PA 1PNOA 5GONF 3W2IA 4CVNA 1F17A 4MTLA 1T8SA 3GLQA 4NOLA 3GNQA 5EPOA 5TV2A 4N03A 1XTPA 4B3XA 5CFZA 5I4IA 1E4VA 2BGTA 2XTJA 5IH7A 1ODFA 3U4IA 1NVFA 3D8HA 5FOXA 1D0SA 4FDTA 2FN4A 4L7QA 2PSJA 1E3WB 3TIVA 4KK4A 3WL6A 5JV5A 3SHFA 1QVAA 4ZZ1A 5K0CA 1WF3A 3T35A 3RKUA 4IRMA 1ZK0A 2C3UA 4QGGA 3NTQA 4AZ0B 4EA6A 3PR1A 3IP1A 2PUTA 1ELOA 3GN2A 5IAEA