4R01A

Crystal structure of sp1627, a putative nadh-flavin reductase, from streptococcus pneumoniae tigr4
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
210
structure length
210
Chain Sequence
GMKLAVIAANGQAGKAIVEEAVKRGHEVTAIVRSENKSQAESIIKKDLFELTKDDLTGFDAVISAFGAYTPDTLPLHSKSIELFNQLLAGTQTRFLVVGGAGSLYIDETKTTRLLDTPDFPEEFKPLAKAQADELDLLRTKNNLNWTFVSPAVDFIPDGEKTGNYILAGEIFTTNEKGISQISYADYAIGLVDELEKGHHIKERISLLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative NADH-flavin reductase
publication title Crystal structure of SP1627, a putative NADH-flavin reductase, from Streptococcus pneumoniae TIGR4
rcsb
source organism Streptococcus pneumoniae tigr4
molecule tags Oxidoreductase
total genus 68
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13460 NAD_binding_10 NAD(P)H-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4r01A00
4CM4B 2BH9A 4DUPA 3BIOA 3GAFA 3X2FA 4OKNA 2GN4A 3UOGA 1HL3A 2O2SA 1IY8A 1N5DA 1P0FA 1HLPA 4TQGA 3AUTA 3WNVA 2ZB8A 1EBUA 1VRWA 2E4AA 2YY7A 3EYWA 1Q7CA 3MOGA 4K6FA 3OIDA 4B4UA 1JWAB 1EBFA 2EJVA 1YKFA 4LW8A 4CMEA 1NM5A 3A9WA 3EVNA 4A2CA 3PVZA 4CM5A 3EZLA 2Y67A 2C2XA 3IL2A 3TZKA 4JGBA 2BHLA 2DPHA 5GZ1A 2I66A 3LLSA 1DEHA 1U3TA 3U9LA 1WDLA 2YQ5A 1C1XB 1SPXA 3I9JA 2YZ7A 1U8FO 3NUGA 1DIRA 4HY3A 2CF6A 3FN4A 2X9VA 3MWDB 3PHIA 5AXAA 4CMEC 1M2WA 3NT4A 2PH5A 3KBOA 4A73A 4WPGA 4OSPA 4UREA 3WFJA 5TT1A 4EUFA 3NV9A 4DLAA 1PQWA 3WGTA 4XD2A 2ET6A 4CMJA 2B83A 1EEHA 1A9YA 2GO1A 1JVSA 2X58A 4PVCA 3C8MA 4CM6A 3ON5A 1YQDA 2BGLA 2EF1A 2P91A 4RF4A 4FIZA 2Y1OA 4J43A 3FTNA 1MX3A 1SOWA 3JD1A 3C24A 1E3EA 3K73O 3INTA 4IZHA 1YL5A 3E8XA 3QWHA 2Q4EA 2Q2WA 3HDQA 1Y9EA 4DMMA 2FMUA 1IZ0A 1DIBA 2QG4A 2X22A 3ZU5A 1JKIA 1WZIA 2Q1WA 3WLFA 1Z75A 2UVDA 1K6JA 1L7EA 2PGLA 2X8LA 2YDYA 3HQ4O 4XKJA 2IYPA 1GEGA 4PLWA 1XELA 2EXXA 1TI7A 1QP8A 4KDFA 3TPCA 1RM3A 2VNSA 2V6MA 4M49A 5IDXA 4CUZA 1ZXLA 1Y5MA 3GG2A 1ADBA 2G1UA 3F6YA 3VVCA 1Z7EA 1MC4A 2PZKA 4YAGA 3ETGA 2OORA 3BZUA 1NX6A 3U62A 4FJ1A 1XR3A 2ZTUA 3LC2O 5LCXA 2E82A 3KTDA 2PD6A 3K2BA 4BKQA 4MP3A 3RFTA 4BNUA 1NQOA 2RIRA 4FFNA 3EMKA 2Q3EA 4GGPA 4BQPA 5F5LA 3PHJA 1WVGA 1OOEA 4EJMA 1TXGA 1YE3A 4WLFA 3TWOA 5IDWA 1PS8A 1SBYA 2P4QA 3UICA 4XWYA 4G2NA 3CUKA 1KEVA 1BSVA 3HHPA 2G82A 2HK7A 3RUCA 5KTKA 4E12A 3F1LA 3JQFA 4JN6B 1QR6A 3CKYA 5T57A 3MTGA 2NVUA 1QYCA 3OBBA 2HMWA 4H7PA 4AJJA 1Y8RA 4CLRB 5DOZA 3JD3A 3PFFA 3JTMA 2PY6A 1PQPA 2X4GA 3BHJA 4OM8A 2EP7A 2YHIB 4CV0A 3BMCA 1E3LA 2PH3A 3NT5A 2VQ3A 2CSUA 5IFLA 2XXJA 4Q3EA 5F5NA 3ZHXA 3ROKA 4CR8A 4RO0A 3LYLA 2Y99A 4XJTA 5KJEA 3HADA 3JQFC 4Q9NA 4JCOA 5I7VA 3T7CA 1N1GA 4CMBA 3TQHA 2I65A 3G79A 5C5IA 3GNQA 1OI7A 4MVJF 3INRA 4ALJA 4HFMA 1I2ZA 2YV1A 3V1UA 1XGKA 1UXHA 3OSUA 4JQCA 4GMFA 4WLUA 1E1MA 1K0UA 1HYHA 3L0DA 4DIBA 4ALIA 3ANLA 1NP3A 2VTEA 1K6XA 4EEZA 5BQFA 1XSEA 2DBVO 1U1IA 1JWBB 1YOVB 2O4CA 4F46A 4BNWA 3ADOA 4XIYA 3PQEA 4CL3A 4TSKA 3FBGA 1U3WA 2WE7A 3WR5A 1AHIA 2W98A 1LDGA 3FF4A 4U5QA 1PJCA 2CDCA 1DB3A 1FDTA 2X0JA 4YJGB 4RDIA 2FR8A 1O6ZA 3OEWA 4GPD1 2W4QA 4NFSA 1KY5A 2BI8A 2GPTA 4J7XA 1V3UA 1L1FA 4IDDA 3WGQA 3IJRA 1GCOA 3V2UA 3JQAD 4IQGA 2BFMA 4BNKA 4J49A 2VUTA 1EK5A 2Z1NA 5DP2A 4QQRA 3N74A 3LZ6A 3DAGA 3RUEA 4C4OA 4L0QA 5JCJD 3DZBA 3JQGA 4D45A 2VHXA 3D5QA 1I30A 4DBZA 4B8WA 1EK6A 3MJVA 2GD1O 2NU8A 3PYLA 3UVEA 3DOCA 3SLKA 3PGXA 2FPIA 1V9LA 3GHHA 1H94A 1GYPA 4AJ1A 5L9AA 3DTTA 4GQAA 5HM8A 1CIVA 5A4DA 5EJ2A 3ZNNA 3NYWA 4JX8A 1C1DA 4DQXA 4LSWA 4E13A 3MTJA 4OL9A 3D4PA 4XEHA 5BSEA 4PRLA 5I9LA 3GGOA 3P2OA 4BO3A 1V35A 3BMOA 1PJ3A 1PQUA 3GGPA 5L7YA 5EQFA 4I9UA 4Z3DA 1LDNA 4J2OA 3S2IA 3NTOA 2YV2A 2O3JA 3WOHA 3FWZA 3CPSA 4BMNA 3ZNPA 3ANMA 4YQYA 1GCUA 4GSLA 2VUSA 2YYYA 4L4XA 3JQ9A 3ZWYA 4BNLA 3L4BA 2HMTA 5GZ6A 3GVCA 4KUHA 4N5NA 4CMAA 1K2WA 5F1KA 2B69A 4PG7A 2J3HA 4DREA 1WWKA 1K3TA 3VPXA 1WDMA 1E5LA 5JO9A 3MCVA 5KIAA 1GUFA 1LQTA 3PJGA 4J1QA 1LLUA 1R66A 2FPPA 3NDIA 3G49A 5GY7A 1LRKA 3P19A 1T25A 3GMDA 1JKFA 1V0JA 5TJHA 3RUHA 4AJ4A 3IDSA 3O03A 3ROQA 4HFRA 2HLPA 2I67A 3GK3A 3JQ9C 4FOOA 4NBTA 1LEHA 3L4BC 2ZB4A 3ZHZA 3VAZA 3CH6A 4ALLA 2PTGA 2E49A 1E3WA 4NBWA 5EINA 5ADHA 3GAZA 4FFRA 4KUEA 3TFOA 3V1TC 1ZVMA 4XDYA 3OA0A 1DFHA 4FBGA 4GAEA 5MDHA 3FNHA 4QT0A 3FI9A 1ISGA 4R51A 5CG2A 3IQDB 2DM6A 1SB8A 2P5YA 4CMGA 5TC4A 2WMDA 2PD3A 2G5CA 1SB9A 3PK0A 1U3VA 4Z0TA 1UJMA 3W4JA 1Q0HA 2P2SA 1MXFA 1K6IA 1GUYA 2CFCA 4MVJA 1PZGA 3DWFA 3GC6A 1GD1O 3GEMA 1ZSNA 1CYDA 2VNAA 3JQAB 3GVPA 3VH4A 4H16A 5ES3A 4BO2A 1EVYA 3GG9A 2D3TA 2YFQA 3KYBA 1NYTA 3AWDA 5H83A 3I9LA 4J90A 5TX7A 5L45A 4FJ2A 4UUMA 1GZ4A 5I7FA 1LDMA 3EK2A 5L51A 3F47A 5DBGA 3E9QA 3SXPA 4XR9A 4OOFA 4PGFA 1F8FA 2VWHA 2ZJ0A 5L95A 4TRRA 1E0DA 5FFFA 3WWZA 2HQ1A 4NJOA 2J8ZA 3AUUA 2P9CA 4N54A 2NUAA 1VL6A 4Z9XA 4ZICA 2GR9A 3E6AA 1IPEA 2GNAA 4GH5A 5T5QA 2BKAA 3OA2A 3WG9A 3D1LA 2NTVA 3NRCA 4NH4A 3ZWXA 2A94A 4U8GA 3H8VA 3RFXA 4CMCA 1GADO 3RBXA 3WJ7A 1Y9AA 3UCFA 4EEXA 4KQXA 4CM9A 2R2GA 4DWVA 1KVQA 1KYQA 2D8AA 3TZ6A 4MVJE 3SC4A 4O63O 1NQAO 3RROA 4JBHA 4XQCA 1U7TA 1AHHA 4IDGA 5FF9A 4E2WA 2CVZA 4J0FA 2NVUB 3WTCA 1UXGA 3TL2A 1U5CA 2RCYA 4CL8A 1LLCA 4WUVA 1Y8RB 4RZHA 4AJPA 1GQQA 1DAPA 1GQYA 2OHXA 2W2LD 2CD9A 4WNCA 5KOIA 1O94A 3WBFA 1XHLA 1IYZA 3V2GA 1FDVA 3BMCB 3IKVA 2CF5A 2CVQA 4R41A 4PRKA 1LQUA 4E30A 5AQ1A 4RF2A 2I9PA 2JJYA 3RBVA 3GHYA 3VPFA 1Q2XA 1N8KA 4LGVA 1WZEA 5HRUA 2AEFA 3KVOA 3GN1A 4PZEA 3F1KA 2HO5A 4S3MA 5G4LA 4E31A 1RWBA 2OBNA 4IQ0A 1VSUA 1QLJA 2NV6A 4LCEA 3OMLA 2GZ3A 2Q2VA 3G3EA 2Q49A 3HN2A 3QV1A 4O0LA 1I3LA 5LC1A 4CV1A 3GPIA 4LCJA 1ZNQO 1N2SA 3ZN2A 2E6UX 2Q2QA 1TVEA 4OIMA 1O8CA 4DPMA 4IPTA 4CODB 3B1JA 4OO3A 4DXHA 1V8BA 4YCAA 3I83A 4FFMA 3WJAA 1RYDA 3JSAA 2FPGA 3CZRA 4MVJD 1HYEA 3EGOA 3PHLA 1R0LA 4KZPA 3S2EA 1BTOA 4EZBA 3UKOA 1PZEA 2GZ1A 2OUIA 1TT7A 1NVTA 3C7DB 4QECA 4MKZA 3ZWMA 2V6BA 3PWKA 1M66A 1DC4A 3VKUA 5JAMA 1T2DA 1A72A 2CDBA 4D42A 4E4YA 2UDPA 4BO1A 4ZJUA 5A9TA 1BXGA 5EL0A 4XQ9A 4ZRNA 1I32A 3W6UA 3JQGB 4BNMA 1JTVA 4NJMA 3V2HA 4NK5A 1U9JA 4QUKA 4R5MA 1YWGO 5EESA 1E7WA 4RLSA 1P31A 2IXBA 3CE6A 3DZHA 1LDEA 1DHTA 2ZB3A 1ZW1A 1PJTA 1PR9A 5ILGA 5KVSA 3PHHA 1C1DB 2VOJA 4N5LA 1FF9A 1G1AA 2Y0EA 5I9MA 2PFGA 4A10A 1XWFA 3BMOB 3VPGA 1PGPA 4GKVA 1R4MA 2IZ1A 4G65A 2B4RO 2CUKA 3AY7A 4BKPA 1B7GO 7MDHA 3NX4A 3LT0A 5CEEA 4UEJA 2VHYA 4J1TA 4YPOA 3LVFO 2HRZA 4OHUA 3RUFA 3KETA 2OGUA 1NNUA 2B36A 2DQ4A 2DTDA 3P2YA 3ZU4A 3ITKA 4B79A 2PLAA 2VRCA 3RFVA 1UR5A 3AM3A 3NJ8A 4MKRA 1ADCA 1GAEO 3P7MA 4M55A 4WASA 3CMMA 1PS9A 2CMDA 2WM3A 3NAQA 3COSA 3M2PA 5B37A 1ZEJA 1B8VA 1QYXA 5CDUA 4YQZA 2Q1UA 1E3IA 4BGEA 4ILKA 4LK3A 2YW9A 2OP0A 4PCVA 4FSHA 4FD3A 1VJTA 1OZAA 4L4RA 5JXWA 4FC7A 5EIOA 5DNAA 3OIGA 4B4WA 2Q1SA 1E3WB 3HFGA 4CPDA 1KBZA 1IL0A 3H5NA 4PZDA 2PK3A 1KOLA 1S6YA 1D3AA 1PZFA 3C85A 3ASVA 4J7UA 4OYRA 3TOZA 5ENDA 3I5MA 5JBIA 3OQ1A 1XA0A 3K31A 3ZDFA 3F4LA 3DAPA 4ND3A 3RC1A 4BO8A 4A26A 3PTZA 5JC8A 1DXYA 1KC1A 2Z95A 3HWRA 5JDIA 4ITUA 2QZZA 1YJ8A 3AY3A 4JXKA 2I76A 5FI5A 3EC7A 4GLOA 3E18A 4RZIA 2IZ0A 2QZ9A 4FCCA 2P9EA 2BI7A 4I5FA 1ISFA 5COAA 1ZK2A 4EGFA 2Y05A 5JYEA 5T8KA 1X7DA 4TZKA 4YWJA 5A03A 4EUEA 1ZSVA 3VKVA 3WSWA 1SEVA 4BVAA 5A1TA 4JIGA 1PX0A 2DUWA 2ZJ1A 4FOSA 2CY0A 4CQLA 1P1KA 4NR0A 2ZTVA 1YDWA 4RVDA 5JDIC 1AXGA 4W4TA 1N7HA 2GF2A 3PQDA 5H82A 5IDYA 4MJLA 1BWSA 3VHRA 1T4BA 2J5RA 4XYBA 1N92A 5G0UA 3U0BA 2JD1A 1UDCA 1QYDA 1ZBQA 3H5RA 3EAGA 4KWHA 3Q9NA 3HG7A 3MWEB 1A7KA 2DFDA 2BFAA 2ZATA 5A5EA 3ONFA 4ESOA 2AG8A 5G0SA 1TA4A 2EGGA 1P77A 3K9QO 1XU9A 5BNFA 4JLWA 1MA0A 4CM8A 3C7AA 4YJHB 2A4KA 5B1YA 1F06A 2EKQA 3MJ4A 1F0YA 3LC1O 1HT0A 4R69A 4OQYA 2EIHA 1DOHA 1Y81A 1J0XO 5EN4A 4BO9A 1T1SA 2IEDA 1WMAA 3ETDA 4IJWA 1C0IA 1NWHA 4XCVA 3DBRB 4AJ2A 1U8XX 4YB8A 3R1IA 1JQBA 4GWGA 4N18A 3ZNQA 2V7PA 1GFSA 3UCXA 3L9XA 4XX0A 4PG8A 1EFLA 1K5HA 4YXFA 5TIIA 2VRCD 3TF5A 3PDJA 4B7XA 5KJ1A 1YVEI 2X0IA 4E2YA 2UAGA 1H5QA 3RSHA 5TGDA 2HUNA 4TVBA 5TT0A 9LDTA 3S55A 3E5RA 2O23A 5AXCA 1LX6A 1J49A 1WDKA 1G0NA 1HE2A 1QYVA 4GWKA 3GUCA 4I5EA 4BNJA 1ARZA 2CVOA 4BQRA 6ADHA 1UXIA 3M2TA 3M6IA 2ZYAA 1Z73A 2JHFA 1ENOA 4ALKA 1VSVA 4BNVA 5IDQA 5FEUA 2WD7A 3EDMA 3AY6A 3DBLB 3TSCA 3DFZA 2AXQA 4B3IA 3HDJA 2DBRA 4IXWA 3RJ9A 3F46A 1AXEA 1PJQA 1GZ3A 2QRLA 3D4OA 3W4IA 1NHGA 5BSHA 4CUKA 5A06A 3VH1A 1H6BA 4NDNE 3FCOA 2XOXA 1UXJA 4JK3A 3FBTA 4IDEA 1C0PA 4BNGA 4TKMA 2AMFA 1VE9A 3L4SO 3TJRA 3AUAA 5IZCA 1ZK1A 3WIDA 3U4DA 1QKIA 4ZRMA 3DZKA 4FGSA 2UYYA 2YQ4A 5JE8A 4LRTB 2EKPA 2C0CA 3IP3A 5BNTA 2I5PO 3JQBA 4GLLA 2JFGA 1DJQA 1WLYA 3R6DA 4GL4A 3GFBA 3H9JA 5CFZA 1ZKMA 4B3JA 3KZVA 3PP8A 3DAFA 5JO0A 2C7GA 5C37A 4XGIA 3D7LA 3TNLA 1BXGB 4NPCA 3JQEA 5HS4A 2AG5A 1ML3A 2NWQA 5IJZA 2PKQO 3R3SA 4NJMB 5IZCC 1PJ2A 3NDJA 5DBFA 5L53A 3I9OA 5CDTA 3ZWBA 3EY4A 1OMOA 4R3WA 1PGQA 4A27A 1WPQA 2WJPA 1XQ1A 4IXTA 4PVDA 4R1UA 5U4QA 3KSZO 1NASA 4LSMA 1YBMA 1YB1A 2D2IA 1WW8A 2GN8A 4QFCA 1MV8A 5L3ZA 4FJ0A 5DT9A 3SJ7A 2WE8A 1DC5A 1YBAA 4NG5A 4EJ0A 1QRRA 4YT5A 4JP2A 2X5OA 2O3TA 4W99A 2WYUA 2X9NA 1HSZA 5DZSA 1R4MB 1M6WA 3LU1A 4FR5A 2PV7A 2CZCA 1E7QA 1YGYA 3GT0A 4Y6PA 1CERA 3GZNA 1D4FA 2I99A 4E5YA 3O38A 1H6DA 3BMNB 4RVHA 4D41A 3OIFA 4HNGA 4DLBA 1P1IA 3R0IA 3GNSA 4XQGA 4D46A 3PPIA 1P45A 2VWGA 3LT4A 4YRBA 2RH4A 1DIHA 1MFZA 2ZTLA 5G0WA 4DA9A 3AOGA 5C3MA 3PGJA 4YAIA 1BDMA 2UUOA 1XG5A 1ENZA 3CSDA 2NTNA 2VYVA 3PWZA 5HS6A 1KIFA 4XYMA 4ZQFA 1VKOA 2ZCVA 3H65A 2HKIA 3STHA 2R00A 4E0BA 1LSJA 4BKOA 1E1LA 2V65A 1NTOA 1I24A 3WQQA 2GSDA 3PIDA 1MB4A 4RPLA 5H81A 4DVJA 1PTJA 4O1MA 1E1KA 1SZJG 2QYTA 7ADHA 1XIVA 3KYCA 3FHLA 1YBVA 1PWXA 2HJRA 2HDHA 2VTDA 2RH8A 1D1TA 5TLSA 1E6WA 2AEJA 3BHMA 1C14A 2J6IA 4OMUA 1ZK3A 4ZQHA 3JYNA 2IDZA 2O2YA 4Z0PA 5A3JA 1KETA 4XB2A 2R00C 4TRJA 3K6JA 4X54A 3Q3CA 3X2EA 2B4TO 4U6SA 3SLGA 4IY1A 5TRTA 4Q3DA 3QLJA 4Y6SA 1XYGA 3O8QA 2NU9A 3RUDA 3GFGA 4AJKA 5U9CA 1FDUA 3IAHA 3UAGA 2O4UX 4K26A 4LN1A 1U3UA 1ONOA 1BVUA 3IP1A 1ZEMA 1LNQA 4B3HA 3BXXA 2BLLA 4TRMA 4G5HA 4FB5A 2X5KO 4BGIA 1V3TA 2QQ5A 4CQLB 1NBOA 4J16A 2FP4A 2QW8A 3ICPA 5IG2A 5HA5A 5F3RA 2PZJA 2A92A 1YL7A 3CINA 3ENNA 4BKRA 2BF7A 1EVJA 4UVEA 1VLLA 4FGWA 4N7RA 5IXYA 2FZWA 3LDHA 2PKRA 4LVCA 5AYVA 3ORFA 4AG3A 4IDAA 2I3AA 1WP4A 1HTBA 2XF8A 5C7LO 2HK8A 4FQ8A 1NPYA 4FW8A 5KKAA 3HJAA 2QIOA 1LLDA 2JCVA 4OXYA 3WTBA 2D1YA 8LDHA 4I08A 1KVUA 2V6GA 3CEAA 4XB1A 2P5UA 3IUPA 3LT1A 4JJFA 4DQVA 1EFKA 3RAJA 3HZZA 1UUFA 2FR1A 1LBEA 2F1KA 4TZTA 4HXYA 2DUUA 1LSOA 2HSDA 4GGOA 3B6ZA 3ROPA 4GSKA 3PZRA 3WGZA 3HN7A 2Q50A 3DO5A 3KM0A 1BXZA 6LDHA 2DBZA 5DCUA 5KVVA 4JBGA 4S1VA 1YXMA 2JAPA 2X0NA 1E77A 1T2CA 1LTHR 3C1TA 3RU9A 2Q99A 4CLEA 1TEHA 2Y66A 1Z7BA 1O95A 3PFWO 1J5PA 2FN7A 5COBA 5F21A 1HZZA 1I0ZA 2WYWA 3KB6A 3M1LA 4F6LA 3ITDA 2PZMA 4TROA 3TZCA 2Y1CA 3E9NA 3W8DA 4I9HA 1LU9A 2VYVD 3GH3A 4II2A 5L7WA 3I6IA 3GN2A 4ND2A 4AICA 1E7MA 1HLDA 3C1AA 5CEFA 5TS3A 3ABIA 1ADFA 4C7KA 2P4HX 3GNTA 3SBOA 2WD7B 3F9IA 5TQVA 1LRJA 3I6QA 1EQ2A 3B1FA 4JROA 5KJFA 3QQPA 3PZBA 3LQFA 4Y6RA 3ZWAA 3U4IA 3NT2A 1I2CA 4H15A 1DO8A 3PYXA 2H6EA 3GR6A 4RVUA 4ND1A 3QWBA 3G0OA 1HDOA 4EJ6A 1W0CA 1W4ZA 1JDJA 3DBVO 2Y1FA 2IEBA 3U4HA 3PLNA 2AE2A 1EMDA 2NTJA 1YRLA 3N58A 3UHAA 2JAHA 4BHTA 4HNHA 4CLXA 4CR7A 2QX7A 1HEUA 3GY0A 4KTVE 3V8BA 3QWAA 4II3A 1UAYA 3H9QA 4QFDA 5C7IO 2H1SA 2Q4BA 4WECA 4DL9A 5FWNA 1P74A 4IJVA 4RPGA 1EUCA 4K9DA 3UUWA 4KWIA 1PL7A 3PEFA 2X6TA 1Z6ZA 2HU2A 5KWEA 3IS3A 4J0EA 4BIIA 2FSVA 4DYVA 1UDAA 5CAEA 5JNLA 1LDBA 3C3XA 4AJOA 3PQFA 2RAFA 2ZK7A 4PFJA 3GDFA 3JV7A 1ZXBA 5COQA 1HKUA 1GEEA 3FPCA 3QVWA 2J3JA 4E2XA 2O3SA 5CPBA 1P1JA 3QHAA 1D8AA 4PLVA 3ZWNA 4WKGA 4J2HA 1E5QA 3RBZA 4D0SA 5ICSA 4FN4A 3OJ0A 1DC3A 2GYYA 1RM4A 3KSUA 3UFXA 4Z3KA 4RVSA 3KLMX 2AQKA 2WEKA 5ITVA 1I8TA 2P68A 1YL6A 4M54A 2AQ8A 3CZMA 3GZNB 3Q11A 3HDHA 2VN8A 3D5TA 3JQ8A 3O4RA 3QE3A 4JJIA 3SEFA 1JA9A 3E48A 4RJTA 5L40A 1PL6A 4R1SA 5DF1A 4BB5A 2EHDA 2DLDA 5JAZA 2H5LA 4J3FA 3VH2A 4NU5A 1I10A 1H9BA 2BFOA 3WMXA 5KNLA 1UXKA 1R0SA 2CNBA 1LSUA 1VI2A 1KEUA 2O3QA 5CP8A 3H3JA 1OFGA 1ZJZA 1GZ6A 3GVXA 4RVFA 3HE3A 3GDOA 1H93A 4YVFA 1T2FA 1DIGA 1B8PA 1MG5A 1JKJA 1ZK0A 2IYOA 3JQ7A 4D3DA 3VZPA 5KJ6A 4Y8VA 3QVXA 3U3XA 3SVTA 5HTOA 3WMWA 1ISHA 1EZ4A 1X1EA 3ZV5A 2ZKLA 1UZMA 3KYCB 1DLIA 5I7SA 3DB2A 1E92A 5TSDA 2D59A 3OEYA 4BO6A 2ZYGA 4CM4A 1DBVO 2JL1A 2W90A 4Z6KA 5A04A 3KXDA 1SO8A 1LDYA 3IKTA 4ONEA 3ZI0A 3KYDA 4DPLA 1G6KA 1NAHA 2OL4A 3NGXA 4IIVA 3QVOA 4WGGA 3DXFA 1NFRA 1E3SA 3BAZA 4Z0HO 1GU7A 1SAYA 3TOXA 4ZGWA 1RM0A 2B37A 2GLXA 2VYNA 1DPGA 4HWKA 3WNQA 2IRWA 5JW6A 1M6HA 3F5QA 3O8QB 3P5SA 4OXKA 4D3FA 3IOYA 4FDAA 1HF3A 2FR0A 1HXHA 2C29D 3FNEA 2J3IA 4LMPA 1YS4A 3IMFA 3SJUA 4IBOA 3OHSX 2Y0CA 2IE0A 5TF4A 4GX2A 4RF3A 4XYEA 5IAAA 4D43A 3OECA 4U0KA 5L4SA 3RJ5A 1MGOA 4HFNA 4KUGA 1ISIA 2DTEA 3GF4A 1IB6A 1EUZA 3AOEA 1T24A 1N1EA 2LDXA 3ANNA 3FR7A 3TZHA 3AW9A 1X7HA 3LK7A 2C59A 4ZQBA 1Q1NA 3NKLA 1R0KA 2HJSA 3DBHA 4IIUA 2E48A 3GQVA 4UVGA 1HRDA 3K5PA 1B26A 1U5AA 5BSGA 1Y7TA 4E21A 2WWRA 4J4BA 4B4OA 3VPHA 4CLOA 4WE3A 3KV3O 4MKXA 3O9ZA 2NQTA 1XCBA 2W2KA 1X0VA 2C7VA 2H9IA 1B16A 1E7RA 4B8ZA 2VHWA 3KHUA 3I9NA 4O5OA 4WLNA 3I4CA 2PNFA 3AOEC 1YB5A 5K9ZA 4KMSA 4Y67A 3WGYA 1PJBA 2AHRA 3OJOA 2P9GA 4F3YA 4MVJG 1MG0A 4CLDA 3PLRA 1KEPA 1T1RA 4I5DA 4NMHA 1UP4A 4GVLA 5T67A 4BKUA 5A5FA 3H9UA 1NFFA 3ZV6A 5JS6A 4QEDA 4CM9D 5B4UA 1Y6JA 4ZVVA 1EE2A 3HUDA 3OM9A 4KP7A 4OGWA 4NFHA 4CUJA 4EITA 3D64A 1HDZA 4QO7A 1X1TA 1GR0A 1LC3A 2E37A 1ONPA 3BTSA 3DHNA 2C07A 4R54A 4WLEA 2DFVA 4RQTA 2NM0A 4A0SA 4NU6A 4AL4A 4D3SA 3D3EA 1M67A 1H9AA 4K6CA 1YO6A 3F3SA 3CXRA 1E3JA 4ZHSA 2VUUA 4UEOA 1HE4A 1ZMTA 1EDZA 3PYMA 4MO2A 1SMKA 2NADA 4A03A 3ROMA 1XKQA 3HDYA 3RC7A 2JCYA 2BMAA 1ZCJA 4IJUA 2DBQA 1U4OA 2EG9A 4RPKA 4CJXA 4W7IA 5IN5A 4Q3NA 1GTMA 3FD8A 5IZ4A 5GMOA 4MINA 2O3UA 4EI2A 1I3NA 3PHGA 4MVJH 1KC3A 1YH3A 4PG6A 5F1OA 4CMHA 1YQGA 2DU8A 5T6BA 5ILOA 1P44A 4YT2A 1C0KA 2EERA 4D79A 2X1HA 3ASUA 3OQ6A 3DHEA 4BMVA 4XDZA 2XAAA 4FFOA 3KSDO 4BS9A 2HK9A 3JQCA 3ZGYA 1IHYA 2GRAA 3OH8A 1LUAA 3C1OA 4K28A 5ENVA 4HV4A 2VYND 4L9RA 1NPTO 1H2BA 2ZQZA 3FWNA 3QRWA 3WQRA 1ZMOA 2YV3A 3RQSA 1PGJA 4BNTA 3S1LA 3F5SA 4LVUA 2NU6A 5A02A 5B4VA 2NLOA 2AW5A 4FFLA 4WCDA 1UH5A 3QWFA 3LT2A 1Z82A 3AK4A 4MIYA 2IXAA 3WGGA 5CPFA 2VHZA 3L9WA 3WFIA 2WDZA 4Y98A 3HNPA 4O59O 4HFJA 4PLTA 3DFUA 4PLPA 1K89A 5EERA 2Y68A 3EUWA 2QRKA 3VVBA 4Q3BA 3ZU2A 4A5OA 2I6TA 3RVDA 4E2ZA 2GZ2A 3FSRA 3DHYA 4RORA 5TJ9A 3MJCA 1JU9A 4I9NA 4Z9FA 3O26A 4CQMA 1F14A 1YB4A 1P1HA 2HCTA 3H6KA 4K1LA 3W8FA 2YJZA 1FMCA 1ENYA 1B2LA 3ZCXA 5T8KC 2VZ0A 5A3VA 1I01A 4G81A 3Q6IA 1HDYA 2NNLD 5DBIA 1KY4A 3H3FA 1D7OA 1NHWA 1LLQA 3QWIA 4NBVA 3JYOA 3ICCA 4HBGA 3AU9A 4EDFA 4MPDA 3GDGA 1P1RA 4IM7A 4YBZA 4NBRA 3FNGA 2VT3A 4BL5A 1BMDA 1QYWA 1VL8A 5KKCA 4TRNA 1X13A 4R68A 2C20A 3G1TA 1SNYA 3I4FA 3Q0EA 4YRAA 3OJLA 3A1NA 2ZQYA 4HP8A 2QHXA 3Q9UA 4BOYA 3WSVA 2OOSA 2GASA 4XJSA 1EUDA 2EGHA 1R6DA 2YDXA 3SX2A 1JLLA 3ZWPA 1GL3A 2OZPA 3JQ7B 3D3WA 4IQ8A 2R6JA 1W6UA 3DZGA 4J9UE 1EDOA 4PLYA 3KOUA 1RM5A 2DPGA 1FJHA 1RPNA 4KQWA 4ALMA 1B3RA 4YACA 2BFPA 1YJQA 4HADA 1JW9B 5FI3A 3INGA 4RF5A 1O5IA 1B8UA 1DRWA 5FYDA 1QV6A 5HBRA 3KYDB 2TMGA 4LMRA 3B1KA 4P8RA 1IZ9A 4R4JA 5DN9A 3B70A 5CHEA 3RWBA 1PU2A 4UVHA 1NQTA 1Q7GA 1AUPA 2NVWA 4Q39A 4YT8A 2BRUA 1MXHA 2FHSA 1KVTA 3GVHA 4MP8A 2YUTA 1AN9A 4RLHA 4BV9A 1ZSYA 2Q1TA 4CM7A 3MEQA 4JJGA 3RASA 1LXCA 1ORRA 2OXIA 2IZZA 2F00A 4W9NA 1IUKA 2JHGA 3ZV3A 3H2SA 5ER6A 3DZIA 3KEOA 1EVZA 4UUNA 4BNNA 1MLDA 3NJ4A 4MVJM 1KVSA 3WXBA 4BUCA 4YR9A 3DBHB 3UW3A 2OMEA 3MJEA 3ZH2A 4LISA 1UZNA 4TMFA 3HB4X 3SC6A 4KOAA 3EVTA 4IGFA 2XXBA 1X7GA 2B0JA 3RUAA 1A4IA 1L7DA 3QY9A 4CLOB 1ADGA 4D44A 1ENPA 2W2KB 4W9NC 4QXMA 4L74A 2NU7A 1A5ZA 3BHIA 1E7SA 4J6FA 4NFYA 4CQMD 4U6QA 1GYRA 1GV1A 3JQBC 4DTIA 1U7HA 3I9KA 4L4SA 1HE5A 4YAKA 4TKLA 5KCZA 1A7AA 4OOEA 3K8ZA 2EJWA 2GN6A 1BRMA 1VL0A 1X14A 3UH1A 5CEJA 4LRSB 3JQAA 4I1IA 4XRGA 3RD5A 1V6AA 3A28A 3UCEA 4DQUA 3VTZA 1UAGA 3T4XA 3PIIA 3PDUA 3WYBA 4GVXA 2D5AA 2Z1MA 1NQ5A 4ZN6A 1TB4A 3PJEA 1CQIA 5JCJA 2GN9A 3GRKA 4FC6A 5A9SA 4RQUA 4A7PA 1U2GA 3WB9A 4AJIA 3GMSA 3NGLA 4RPJA 2YFHA 5THQA 3MJTA 1PL8A 2EV9A 2BGKA 4KDEA 4PLFA 1E7YA 1Y5RA 4R1TA 4H3VA 4J9VA 4WEOA 1ZIDA 1U28A 1O89A 1CWUA 3DMTA 4OH1A 3U5TA 1BW9A 1P9LA 4PG4A 2OBYA 1LRLA 3DR3A 3RUIA 1KVRA 1YDEA 3QVTA 1NVMB 4JP3A 1ZH8A 4IDFA 3UGKA 1A4UA 3U09A 5I8ZA 3W1VA 2SCUA 1DDOA 1KEWA 4XRRA 1TT5A 1LI4A 5B4TA 2B5WA 5JAIA 4M87A 4MDHA 5JY1A 2XPCA 4M86A 1I5RA 3DTYA 3ZW9A 3UN1A 1IULA 1UZLA 3NTQA 1MUUA 3DMTC 2PKQP 2VZ9A 3OJEA 1QG6A 1ZUD1 2AQIA 4EBFA 1M76A 4ALNA 3OJFA 4P4LA 4YT4A 4XZ3A 3H9GA 2C82A 1F12A 4W82A 4Y9DA 3I3OA 1V3VA 1I33A 4OSOA 1TLTA 3L6DA 4M8SA 3Q2IA 1PGOA 3AI3A 1HETA 2O50A 2AEMA 4RL6A 4DPKA 4IINA 4FS3A 1O0SA 4NNJA 2GDZA 4R1NA 1OC4A 2PGDA 4ROSA 4ZA2A 3BA1A 4OQZA 3Q2KA 3JYLA 5I9NA 2X5JO 5EQDA 3LSYA 3WYCA 1N7GA 3VZQA 3AM4A 1E6UA 3F4BA 4J7CA 3TRIA 2Y1EA 3S8MA 4GX1A 1DFIA 4E5KA 2HMVA 4CMKA 5THKA 5T64A 3PJDA 4L8VA 2EEZA 5DCYA 1DLJA 1VM6A 5JAQA 3CTMA 2FSSA 4IS3A 4Q3CA 1PSDA 1NAIA 2G17A 1I3KA 3EW7A 4PIVA 4OJNA 1VKNA 4RPHA 1ZZEA 1MC5A 4CQMB 3DOOA 5KVQA 3K92A 4BNXA 4E5PA 1ZJYA 2X23A 3IUSA 4YAEA 3M1AA 5LDHA 2VHVA 4HKTA 1GQ2A 2Y1GA 3G17A 1JAYA 3EHEA 1HDCA 3GEDA 4WLOA 1DRVA 1GPDG 4JBIA 3E03A 5U1PA 1P0CA 3DONA 4NBUA 2JD2A 2EWMA 4F6CA 4WNIA 2WD8A 1GDHA 1FK8A 4CM1A 4JNKA 2X7HA 4AJEA 1QMGA 2PGJA 1IOLA 4CM8B 4WCFA 2OO5A 3AM5A 3S2GA 1CEQA 1PEDA 5ICMA 1T2AA 2WSBA 3OF2A 1M75A 4AVYA 4DC0A 2PR2A 1WMBA 2Y1DA 1XEAA 1B14A 3DMYA 2X0RA 3L6OO 3AJRA 3WGOA 1XLTA 4B7CA 4YEDA 4M1QA 4BGUA 5IXSA 2ZB7A 1CQJA 1GY8A 3GEGA 3GOHA 2NQ8A 3HSKA 3D3WB 2Q45A 3WLEA 2OP1A 1NPDA 2JKVA 3DOJA 4WCFC 1DHRA 4OKIA 3ZW8A 5I7EA 2ZYDA 3GLQA 2D4AA 3GA0A 4GI2A 2JFFA 3AU8A 1P33A 4RCVA 2EP5A 1E1NA 1GYQA 5G0TA 4PG5A 1CDOA 1X15A 4QO8A 2NACA 5G4KA 5K0ZA 4YA6A 3H7AA 4HX5A 4B7UA 1EQUA 2G76A 1CF2O 5JMPA 5JMWA 1N9GA 3I52A 4ZQGA 1WNTA 4CMIA 5A9RA 4NZ9A 4URFA 3H4VA 1HE3A 2W2LA 2B4QA 3ONDA 4NK4A 1MFPA 2NSDA 3NEPX 4W7HA 2PA3A 2B35A 3RC9A 3OICA 5DP1A 2WYVA 2EW2A 3HB5X 2QRJA 4R5HA 4YJFA 1S7CA 4GX0A 1ZK4A 4RDHA 4BO7A 3GGGA 2AA3A 3VPSA 2HMSA 5TNXA 4AJHA 4U0JA 3FNFA 3FTPA 2AE1A 3LF2A 4MVJI 5AOVA 1FDWA 3K30A 3L6EA 5JFOA 3QJ5A 1YQXA 2VOEA 1F8GA 3ADPA 4J1SA 1R37A 3AFNA 2UUPA 3QP9A 3DQPA 3GPDG 3DC2A 1PJ4A 5JSFA 5KJCA 4WOKA 3ZHYA 5JDCA 4CV2A 4IMRA 4I5GA 1I36A 2CDAA 4FFPA 4ND4A 3R3JA 1JN0A 4XR4A 3U49A 4KTTE 5K6AA 3GZ4A 3TZQA 3LLVA 1NWCA 2DKNA 1P1FA 2YHUA 5JC1A 4BNIA 4WOJA 1BG6A 3H5AA 3HFSA 1RYEA 3PI7A 1H6AA 3TN7A 1J4AA 4E6PA 1PS0A 1SCUA 1A71A 4BO0A 3DZFA 4BV8A 4IMPA 2G0TA 2GERA 4R9RA 1QLHA 1Y8QA 4J91A 1VPDA 1EVIA 2O3RA 5JDCC 4BGVA 2VCYA 3A06A 1Q0QA 4DIOA 2GUGA 3TFQA 3JQDA 3MOIA 5K6AC 4XGNA 1H6CA 4TWRA 3OP4A 5BSFA 3QA9A 5A9SB 3I23A 1F17A 4BNZA 5BNIA 2JCXA 4QTZA 1HYGA 4DLLA 2J5KA 3RKUA 3KUXA 4MP6A 4XYGA 2BD0A 1OBFO 3WIEA 5L4LA 1DRUA 3LC7O 1Q0LA 1XDWA 2PWZA 4ZU3A 5JYDA 1JVBA 4DIFA 2LDBA 2TMDA 1RJWA 1PJLA 1H2HA 1R4NA 1GPJA 2O48X 3IJPA 1XQ6A 1BW9B 1IHXA 3JYPA 5CDSA 1LC0A 4IZIA 2OFPA 5DDIP 1I3MA 4NI5A 3KLPX 1ZO8A 1CETA 4BNYA 4YDRA 1T26A 4DRYA 3BMQA 1B15A 4PLGA 5G0VA 4UAGA 4J4HA 1NR7A 4E3ZA 4YJHA 1TT5B 5G2OA 3RIHA 4F45A 1G0OA 4NIMA 1HZJA 2GCGA 3AUSA 3WWYA 2Z5LA 4IUYA 1GV0A 3PJFA 4L75A 1LA2A 1PR3A 3QVSA 4P22A 1I2BA 3OETA 1DC6A 3BTUA 2VZ8A 4XIJA 5ITWA 1QORA 3DBRA 1IE3A 1JAXA 3QIVA 1OC2A 3E9MA 1QV7A 5A05A 3VOSA 3WYEA 1Z45A 1BHSA 1B3BA 3ZWVA 1NVGA 3DDNA 4UEKA 4BO5A 3WGIA 3ZHBA 4IJKA 4GMGA 3VZSA 5CDYA 2RHRA 3OFSA 3VC7A 3ZV4A 3QW2A 1UP7A 1DAOA 1D1SA 3I1JA 2JD0A 3NDRA 1PGNA 3QSGA 2EKLA 5GZ3A 2PD4A 1PZHA 2RBEA 2I3GA 2O7QA 3DBLA 3WICA 1C1XA 1HDRA 1MP0A 3ENKA 3OQBA 3RI3A 3ONEA 5DCWA 1WAMA 1A27A 1EE9A 1ID1A 4GBJA 5AXDA 3WS7A 3ZU3A 4EW6A 3UXYA 2W8ZA 1DJNA 2A35A 5DOVA 2Y0DA 3K2EA 5F1PA 3D0OA 1ULUA 2C5EA 3AI1A 3FPLA 2D0IA 4ND5A 1BDBA 3KRTA 4GX5A 1ONNA 3DL2A 2IODA 2HMUA 4ID9A 1QXSA 1C3VA 3ZWWA 5DULA 1ULSA 4ZQEA 3N7UA 4BB6A 2FZEA 1UP6A 3KEQA 3JCZA 2PZLA 1U4SA 4CR6A 3LF1A 2DAPA 3CIFA 1LSSA 4QX6A 2EW8A 5JPIA 1P3DA 4PLHA 3A14A 1ZFNA 1X0XA 5CDGA 1J6UA 4WEQA 1T2EA 4IGEA 2FOIA 4OAQA 3ZWCA 4BMSA 4NHEA 4WCFB 2C54A 2JFHA 1SC6A 2X9GA 4PLCA 3WBBA 1O9BA 4QSMA 3G1UA 1W8DA 4RVGA 4E32A 1CJCA 3BYZA 3IIEA 1A9ZA 4P4NA 3RCBA 3K96A 3AI2A 4MIEA 1DFGA 3GUYA 4INAA 4DC1A 4YYZA 3V5NA 4RV9A 1BXKA 4WK6A 2GGSA 2RHCA 3W4KA 4BNFA 3JQ6A 4PZCA 1PJSA 3FRJA 3VH3A 4RGBA 4J4TA 2FRDA 4CM3A 4UUOA 4MIOA 4XYLA 2VRBA 4EYEA 3EZYA 3WDSA 4O6VA 3UF0A 4B4VA 1HSOA 4IDCA 1SOVA 1RKXA 5L4NA 2Q46A 4UVDA 5G4KB 3FR8A 4DMLA 1NFQA 2HRBA 3VZRA 2C2YA 3BMNA 4YJDA 3RC2A 3ZWOA 4FPXA 4GKBA 4WLVA 3B20A 1N9GB 1R12A 4CMIB 2V6FA 3DZJA 4AFNA 5JCXA 3H9EO 5B12A 1HDGO 2POQX 3H2ZA 1DSSG 1IPFA 4D0RA 3PXXA 5C7OO 3WQSB 4TVOA 4L73A 4DBVO 5IF3A 2NVBA 2ZIZA 4YJFB 3D4NA 1HWYA 4J1NA 3BTOA 4R9SA 4CLRA 3S2FA 2QYSA 1NR1A 4N5MA 3WGHA 4NQZA 4HUJA 3VDQA 2YHIA 1PWZA 3GRPA 3JD0A 1B0AA 4IDBA 1WXDA 1R15A 4E5NA 3JD4A 1KERA 2B5VA 4UUPA 8ADHA 1U2DA 4Q3AA 1ISMA 5LDGA 3ULKA 3W8EA 4MVJP 2FWMX 3A4VA 4IS2A 1YONA 5ER9A 4C7JA 4YTEA 1VC2A 1NXQA 3C7CB 3JD2A 1R16A 3PWSA 4M89A 5AXBA 4OXNA 3AFMA 3Q1LA 2J3KA 2J5QA 3I9MA 4DYDA 1QSGA 4ZD6A 3T4EA 3TL3A 2UV8A 3V1YA 1KS9A 2DTXA 4DGSA 2X86A 5EMHA 3RU7A 3ST7A 3WX0A 5L7TA 1AE1A 3DEYX 1HDXA 1XU7A 4R01A 2BELA 1Q7BA 1YOVA 2WTBA 5J23A 1E6EA 3MJSA 2Y93A 4CV3A 2VWPA 9LDBA 4MOWA 2C5AA 3U4CA 1C0LA 1CRWG 1UDBA 3CMCO 2H63A 3GVIA 4CLHA 2FY8A 1Y8QB 2DC1A 3IC5A 3ZNOA 2BGMA 5CG1A 4AJLA 1BGVA 4YJGA 4R16A 4PN3A 1SEPA 5BT9A 1Z74A 4U7WA 4YRDA 3JYQA 3ETEA 3L07A 1LJ8A 3ZZNA 2A9FA 3L77A 5MGBA 4I8XA 3JQ8B 4XA8A 2O7SA 2D5CA 5HWSA 2ILTA 1FXSA 4E33A 2AQHA 3W6ZA 4AJNA 3NTRA 4EUHA 1OAAA 1GUZA 2ZCUA 4YAJA 4BNHA 4E5MA 3VTFA 4WJZA 5IN4A 4W6ZA 2ZTMA 4D7AA 4L76A 3RKRA 1VJ1A 1R4NB 3E1KA 2DT5A 4Z9YA 1AGNA 3MZ0A 3T7EA 3PRJA 3E5MA 5KVCA 5JY6A 3BMQB 1BVRA 2HAEA 4PLZA 4R3NA 3VDRA 5JLAA 5BR7A 3E82A 4P4GA 5I8WA 4XGKA 4P38A 1ISJA 1FDSA 4XQEA 2VT2A 5AVOA 4BO4A 2DVMA 3BTVA 4UVIA 3TDKA 1Y1PA 5EPOA 4UULA 3KO8A 1W73A 1VJ0A 2VWQA 1T4DA 1PIWA 1H0KA 1DIAA
chains in the Genus database with same CATH superfamily
4RMIA 1ZJ5A 3BIOA 2SHKA 4QBIA 4X1OA 1G98A 3P27A 3QUTA 5CD9A 5GJBA 3EYAA 3QYPA 1IY8A 1P0FA 4DCGA 4TQGA 3DF9A 3AUTA 2R6GA 4V24A 4EYQA 1RP7A 2XMZA 5LBTA 3JWGA 1EBUA 1VRWA 3IUBA 4BP3A 4UM7A 3AR4A 1TPYA 1JEDA 4K6FA 1ZMXA 3LC0A 1TECE 2ST1A 3ENQA 1EBFA 1SXHA 3M4ZA 1IN6A 3ZLVA 5ESXA 1YKFA 4A2CA 3MD0A 4GNRA 4BXOB 2Y67A 2C2XA 2VEOA 2EC5A 1YACA 3BN3A 3REQA 5IYZB 4YJ2B 4KITB 1DOAA 3LL7A 1ORWA 3FPBA 1G42A 4O4HF 1JR3D 2BHLA 2EYUA 1J0EA 2DPHA 2Q5IA 4PGHA 3GEHA 1XJQA 4IH9A 4OYLA 1C1XB 4IHJB 3TRHA 4MTLA 3VO1A 1EFTA 2VKTA 2Y27A 4L57A 5FOUA 3RYFB 5E95A 3U7EB 1GKKA 2IEYA 4HY3A 2CF6A 1OJ7A 1OLSA 2I4OA 2PL3A 4JI1B 1M2WA 4EMUA 2J9GA 4C88A 5EXSA 4UREA 4P53A 3X0DA 3NUQA 1ND5A 4CKXA 3CUVA 1AUVA 4XFKA 1PQWA 3TQQA 1T3SA 5CB4F 2BZ1A 2BP7B 3WDKA 1I14A 1Z4QA 2QX8A 2B83A 4CMJA 2HDOA 2WTNA 3BEDA 3R41A 2X58A 1B1CA 3C8MA 2H5JA 3ON5A 1YQDA 3PRHA 4PVCA 3EEOA 1MW8X 1WLSA 4FIZA 3FTNA 1MX3A 4DUYB 3FLBA 3MT7A 4OJKA 2DZDA 3LTNC 4DT1B 4FNOA 3C24A 1E3EA 3H11A 3INTA 4UDOA 1R7RA 1K6MA 3RJTA 4N3AA 2HF8A 1GT6A 4H17A 2AN3A 1E5DA 3HDQA 1E0AA 3X1KA 1Y9EA 2FP3A 2PIAA 2YRWA 3IQZA 4I55B 5FR1A 1Z13A 3M4NA 1QVZA 3OT1A 2QG4A 4O1HA 4XUCA 5EJGA 4DCSA 1WZIA 5KYXB 5KQMA 3KLNA 2X8LA 3RABA 2YDYA 3HQ4O 5D3QA 4WKCA 1Q1BA 4AZ0A 1O3YA 1RJGA 1O0BA 2FWRA 5HILA 1YHNA 1I3OA 4KDFA 1J0DA 4M49A 1V41E 2V6MA 2RC6A 1GRVA 3ZS9A 4X20A 1B6TA 4O4JF 4UEWA 4AIRA 1D2NA 2I33A 4AKTA 1W8IA 3FDIA 3QF7A 2A9QA 4RVNA 1CF9A 2ZJ8A 4H6VA 4EA9A 5AW7A 1MC4A 1OILA 1QX4A 2FX2A 1CP3A 5EZYB 2FN8A 1XR3A 4KLNA 4EPVA 4FYKA 1FLNA 2H16A 3KTDA 5JXWA 4ADSG 3HB9A 3K2BA 3TSWA 5FTNA 3ZYZA 1F0KA 1ODJA 5E8RA 3E81A 4LZZA 2ONKA 4FFNA 3VR5D 4C5AA 4KXVA 4GKKB 3B6JA 4C0WA 3G8BA 3L1UA 1WVGA 1XWWA 2HDWA 3W5SA 4HVTA 4ZVSA 4OQDA 3BA6A 5I51A 3V8EA 5E7MA 2XA2A 4N6OA 4IEFB 2OCLA 4EGCB 1G5IA 2P4QA 5BN4B 3UICA 4EPXA 1XVAA 1V8OA 1OZFA 1QRAA 2CMGA 3CUKA 3OAAA 5KZMB 2HK7A 3ODPA 5F7XA 2VJYA 4E12A 3PGA1 1IBMB 2XQJA 4DQKA 2RGWA 1QGZA 1NUSA 2JJ1A 3CKYA 4OV6B 1L4GA 2NVUA 1ECJA 4BU0A 4LJ7A 2NP7A 3WNCA 3OBBA 4IQFA 1XMVA 4KR9A 4IV0A 5A4IS 1AJEA 4CLRB 1ZKDA 3NPMA 1VHWA 5DOZA 3E5HA 2FQWA 2LBPA 1D5WA 4XX1A 2TYSB 3IELA 3PFFA 4FHFA 4IFEA 1PQPA 1NF2A 3BHJA 4OQLA 3CYFA 3ZS8A 3U16A 3NM4A 3THWA 2IEIA 4CV0A 1FJGB 2MSEB 5JJCA 3BJRA 3NT5A 3OQIA 1GGEA 2W6JD 2CSUA 3Q0IA 4NL4H 4S05A 4PO1A 3L02A 4LF8B 3NDBB 5BQOA 3ZHXA 4WKBA 1TQ8A 2QSZA 1AKQA 4OP1A 4WGFA 3RYFA 1UDWA 3LYLA 5CLLA 2XRFA 3VDXA 2J9YB 4XJTA 3IAM1 3DLIA 4D4MA 1M33A 4AKSA 5JV5A 1ZAKA 2AZMA 3COZA 1X7YA 3ET5A 3O2QB 4XD7D 1CJKC 2FFBA 4J0DA 4CMBA 3PCXA 2A0WA 5H16A 1FDIA 2I65A 1WUTA 3OG9A 1WJGA 4P4UA 3UKJA 5TMDA 1EI9A 1CFJA 1XZGA 4HAVA 4U7DA 5AW8A 1Z22A 3KOMA 1JEEA 1XGKA 1UXHA 4JQCA 4ARUA 1X1RA 3IBYA 1K0UA 4JL5A 2UZAA 4QXOA 4LBWA 3ILSA 1EWKA 2XWJI 2I7CA 3ANLA 3HI4A 3COYA 4POOA 2Q0HA 5J43A 3SNKA 2VP5A 2GXQA 1V16A 1RT9A 1J24A 1U1IA 3A4TA 2BDUA 4C6HA 3Q3EA 3W34A 5BPHA 4BNWA 1J0AA 1RAAA 5BV2P 1ZN8A 4G3XA 4WK4B 1ORIA 2J07A 2VDUE 5B30A 1DBPA 3MUEA 4JGIA 2C2WA 3FF4A 4M98A 4ZOQI 2GMWA 3ZDCA 2IDJA 2X0JA 1RI3A 4MWTA 4PZAA 1NUPA 4KMRA 2FR8A 1O6ZA 1IB0A 2D1SA 3BZBA 3D8BA 4YRFA 4NFSA 1B23P 2CLLB 3KKQA 3L0IB 3QBDA 4J7XA 4LY3A 5FL7D 2ZSAA 5LMNB 2VSXA 3IJRA 1OGIA 2I8AA 3JQAD 3V2UA 1SZDA 3SGLA 5JISA 3WK9A 3OO1A 4J49A 3IGFA 2XMPA 4X94A 4ND8B 3CZCA 4RVCA 4NSNA 1EWYA 5DP2A 2NYVA 2HIGA 4QQRA 3N07A 2GKSA 1QE0A 4GOND 4BTVA 1V1JA 1EM8A 4F3CA 4L0QA 5JCJD 3DZBA 3JQGA 5K3EA 2VHXA 3C3JA 3IOEA 5FJIA 4D9MA 2DGDA 1EK6A 1F9EA 3QBEA 1FTNA 4HTFA 1XAGA 2P67A 1ZGAA 3DOCA 2Q1YA 3GP3A 4FQ7A 4GQBA 1X42A 3PITA 5P21A 4DQDA 3SY8A 4AWXA 4AJ1A 4TWZA 1KSJA 2WAXA 3DTTA 4GQAA 5EJ2A 1OH8A 1OIXA 1EXWA 1TMOA 1XJWA 1H8ED 3DJYA 2IHTA 4YHBA 1XMIA 3C3EA 5DI3A 4C7OA 1QFZA 4XEHA 4HEHA 3GGOA 4C0JA 1ZCZA 2XV1A 3M7IA 1PJ3A 4C0XA 2AG6A 5L7YA 4ENTA 3KE9A 4I9UA 1UPTA 2Q4TA 2FZGA 4QYXA 3S2IA 4AMYA 1SXJD 1X7ZA 4ZVKA 2WKPA 3OVMA 4V3CA 1I4LD 4XPIA 3WMGA 2XMRA 3FB4A 1NOJA 1ZWKA 2Z6AA 4GSLA 1W0KD 3DW1X 3ZWYA 4PO9A 4BNLA 1BD4A 1WTAA 4Q7JB 4ZOCA 4FCVA 2WIJA 1DCKA 2H2GA 1UMDB 1K92A 2XODA 3IQWA 4URYR 4Y6OA 4CBVA 3QELA 3KV1A 1H2AS 3NXKA 3VPXA 4MV7A 2R1ZA 1F4VA 1E5LA 3TTSA 2P7IA 4L08A 5KIAA 3PSHA 1WW3A 3OZIA 4J1QA 4LDZA 4R40A 1LLUA 4J03A 3RLFA 3R5SA 4C01A 3THYA 3I5YA 1LRKA 3IOBA 3ZOZA 1T9ZA 4RD6A 4JXXA 1L2TA 2AUMA 5ECGC 3HVUA 4MW0A 3JX9A 2IYXA 1N5OX 1A1VA 4OI2A 4ZTBA 3R9IA 1OWMA 1MH9A 1YI8A 3KJNA 4WXYB 3D54D 2WHPA 1P5HA 1TDJA 5JMOA 4ND7A 5J2UA 1YTUA 1VXRA 2XZPA 1FYEA 3ETCA 4KGXA 3ETJA 4G37A 2PTGA 2E49A 1UKYA 3LQ2A 1YHYA 2VXCA 5EINA 1XF1A 2GCPA 2XUKA 3R9KA 4FX2A 4KUEA 2EATA 8ATCA 1FDOA 3TQFA 2O6LA 4HN2A 3PC2A 4NAUA 2GSWA 4Q4CA 4XDGA 2YC4C 2BE7A 4X6YA 5BWOA 1CRQA 4QT0A 3TMYA 2BAGA 1NSYA 1R5NA 1C9NA 1XOIA 421PA 3IQDB 1G8AA 5C2JB 3C4VA 3EWAA 2FCAA 2Q5JA 4FOLA 4U7PB 3AF0A 2NTYC 3EZ2A 4JLKA 5TC4A 3IV6A 3Q88A 4GM0A 1SB9A 3PK0A 3IEVA 2O8FA 4L5AA 3SIPA 4BFWA 1DAGA 4O08A 2OG2A 1MXFA 2CFCA 1GPUA 3AVOA 3B53X 2YXEA 1S2LA 3ESZA 1YRHA 3HFRA 2I87A 1U2PA 3GC6A 3HWX1 3SLRA 1RAEA 3ZHTA 5L8VA 1TEXA 2I4NA 3X1DA 1K9SA 1BQEA 2IVZA 3GEMA 3DFKA 1CYDA 3JQAB 3NM6B 5C5CA 1NOKA 3GVPA 3DEAA 3DS8A 3VH4A 5ES3A 3GFSA 1EVYA 2REQA 1L7BA 3UMGA 4FXPA 4C03A 3H2JA 1P73A 2YYAA 3SYKA 1A9PA 2IXEA 1QHHB 1WZCA 2XGGA 3CURA 3QVVA 4Q7EA 4BFXA 2Q0SA 3O90A 2V3CC 3QU9A 3GPBA 5CW2A 4CKYA 1V5FA 3L7MA 3TUJC 4HEJA 3WL4A 4OQQA 3PR1A 1QZZA 1SU6A 3O6VA 1ZI9A 2D2VA 5JVDA 2G8LA 3KZXA 4ND6A 4XLTA 2HRRA 1TZMA 2ZJ0A 2K6GA 1XZMA 2VP4A 5FFFA 2HQ1A 4NJOA 2J8ZA 2Q2OA 5AKKA 3U1VA 2P9CA 4N54A 4YAWA 1VRCA 1N4DA 5JATA 1SKYE 3L4EA 1JA1A 5BVGB 3DVQX 2XVAA 2OESA 3ECCA 3I12A 5CNJA 3RRFA 3G5TA 3V7YA 4NF2A 5EP3A 1Y3HA 3KQQA 5LZ2A 1ZMRA 2XB8A 4AKIA 5AKIA 3HWWA 3V8RA 1OYYA 3L84A 3OA2A 3WG9A 3ZWXA 4UPVA 1MDFA 4ARAA 2WIFA 1SXJB 3RBXA 3TLGA 2YWGA 4H2DA 5ALMA 2PZEA 2QZ4A 4KQXA 4QTTB 2IEAA 4RPCA 4D9KA 5HGJA 1EFRD 1K1EA 1NF8A 1GZSA 3BXPA 3FYUB 2GJ9A 4ENSA 5F9FA 2J0UA 3OCJA 3G7UA 3TZ6A 4Z1OA 4KFUA 3F8SA 3I6MA 1E4EA 5I9IA 1GAJA 2GPYA 3OHMA 4O63O 1YIDA 4X1IA 5A6SB 1TQ6A 2B1QA 3OZAA 4G5SA 4KH0A 4E2WA 1L7PA 2DY1A 3A6HA 3DKPA 1MH1A 1Z3CA 3JWJA 4PXSA 2WT8A 3ZE9A 3CW9A 3GNLA 2Q7DA 3OZRA 3EVZA 5TEWA 1GQYA 2OHXA 2FW7A 3PBKA 2W2LD 1KOFA 1O94A 1IYZA 2AOUB 3QE2A 2VJAA 1Z6YA 4WV3A 3TTWA 1W34A 2FFQA 2VXOA 2WDPA 4IDPA 1CU1A 2PCJA 2FQ1A 3BREA 4II7A 5DHFA 4HLNA 2YWEA 3VO2A 4E30A 4GP7A 1FU8A 4BE7B 4CWAA 1TYZA 3AUXA 1TJ4A 3GXBA 4TXNA 4ZO8A 1FP2A 3W5BA 1T0IA 4QJ3A 3T4PA 1JX6A 3UQYS 1Q21A 4YP0A 4Y0AA 4ZANA 3TIGA 5HRUA 1EX7A 2X5XA 3U7HB 1WUHS 4Q7QA 1S4QA 2A0XA 4G01B 3IR7A 3VR4H 3G89A 1O9HA 2H4ZA 4IQ0A 1P60A 3U3DA 1T9KA 5JSHA 1OE0A 3OMLA 5ALIA 1AQNA 2D8MA 1OAOA 2L42A 2Q2VA 5E4YA 2Q49A 2E2WA 2AJTA 1L4EA 1XD2A 2FQXA 4PAWA 3G2MA 4QWWA 3DLBA 4AU1A 1WMEA 4LCJA 2ZRIA 2WU8A 1SVNA 4PW0A 1QC5B 1N2SA 2WQ6A 2RBGA 3EPPA 4OIMA 1O8CA 4RD4A 2CYAA 2RB4A 3TQIA 4OO3A 5ICFA 2YY5A 3R6TA 4U5XA 2YVLA 3HO6A 3I83A 4FFMA 3UMVA 1R0ZA 3L0OA 4YCMA 1CIJA 4MWBA 5I7UA 2FPGA 4QGBA 2EHJA 2NT4A 1GRQA 3U48A 2G06A 1C4XA 2IUTA 3HUTA 5AIBA 3PHLA 3F7NA 1R0LA 3DE4X 1HQYE 2C98A 4KZPA 5K0NA 5DWDA 1JAHA 1RACA 1IM2A 4WXHA 1PZEA 2B1RA 1P4SA 4M76B 5TXGA 2GZ1A 4P0TA 3LHKA 2A1IA 2N9UA 3UAZA 4MKZA 4OB8A 1GQFA 4AZTA 1SU7A 1KMIY 3KU4A 3PWKA 4H1HA 4IRUB 2XD4A 4GR4A 2X42A 5JAMA 3EX7C 4X8HA 5TQ0B 2BTQB 1M5TA 3BXHA 4D42A 2UDPA 4BO1A 2HA5A 2QTGA 3CZQA 3F49S 3OLXA 5DT2A 1U90A 5A9TA 2QTMA 4I0WB 4M99A 6PFKA 3TG2A 1I32A 1KK0A 3M49A 3FHCB 3V2HA 3R24A 2DPMA 4ID3A 4KGZA 1A96A 1HK7A 1TU0A 3AUFA 5JSQA 4QUKA 4KIWA 4PQEA 3U4QB 1YWGO 2O2XA 1E7WA 4MUHA 2VPYA 3NU1A 3QOYA 4PZ9A 4MMYB 4RLSA 3COPA 1ETUA 3Q9LA 2YYZA 1GTSA 3NBYC 2C2BA 2PKXA 3CX6A 3DZHA 3G59A 1PJTA 3LXRA 1XLUA 3OKFA 1NXPA 3K72B 4JP1A 4X44A 5KVSA 2VT6A 1C1DB 4M36A 2ZSUA 4KLCA 1A5TA 4UTZA 5E7QA 1CVIA 2CVFA 2Y0EA 1Z6GA 5I9MA 4B0PA 3DDHA 4OK5A 2J41A 4ECEA 4O2AA 5I45A 1R4MA 2IZ1A 5LA6A 1NW6A 1QG2A 2IZ7A 2HXSA 1XA3A 2LR0A 3DV0B 1CXZA 2B4RO 4G65A 1VZ2A 4BKPA 1B7GO 3BXEA 1Z0KA 3QEJA 1T8TA 4X1KA 1OBCA 4IILA 3ZDYB 3AHCA 1AUOA 1QMPA 5AW0A 3NIGB 7AT1A 1P5FA 3LVFO 4NCXA 2VYQA 3HTXA 4R98A 3ZHCA 4EJFA 3O2JA 1WBDA 1B8OA 3E4DA 5EMLA 4B79A 2PLAA 3FUCA 3U80A 4RV4A 2ZVJA 1OKKD 4IDHA 3P7MA 2V3WA 4Q05A 5BP7A 2HJHA 1KTIA 2WM3A 3NAQA 4LE0A 3W2HA 5ICCA 4KQFA 5DYYA 5B37A 1QVRA 1X8LA 5CLJA 4LC9A 2XEDA 2R47A 2IHVA 1QYXA 2XY4A 4TV9B 3FWPA 1E3IA 4FFBB 3EBLA 4XWAA 1T0HB 4QPDA 3AEYA 4G8BA 4LK3A 5LFAA 1I2MA 2YW9A 4URXR 4RNDB 4WACA 5LN1A 2OT3B 5IC6A 1K8QA 1ODIA 2I7VA 4FD3A 4FSHA 1XP5A 1RLOA 1SBHA 1UPAA 1KDOA 4L4RA 1ZVQA 4P81A 2W2OA 3ZOKA 3MGBA 2CFSA 3P2KA 2HWYA 5AUQA 3HFGA 2C2KA 4FZVA 4X65B 4HNTA 5JHHB 3H5NA 2C7PA 1UKVY 2VA8A 3QENA 4PZDA 4CL2A 2XGMA 2A5GA 1G5QA 1D3AA 3RW9A 4AKHA 3K70C 3R0ZA 2BY4A 2EFDB 1RZRD 3K3PA 3ENZA 4IGAA 2XJ4A 4MW7A 4OYRA 3UJDA 4DCMA 2ZLBA 5HZMA 4KNYA 5DSZA 1QRDA 5JBIA 3DVAA 1XA0A 3HFJA 2G9RA 2LZ0A 4Q82A 1FFAA 3F4LA 3RC1A 3UHJA 3IERA 3RH0A 4YV1A 3IEMA 1UMKA 2CWWA 2HI0A 3RVJA 2AF3C 5JC8A 3HWRA 5JDIA 1KHTA 4ITUA 4MUJA 4DXAA 5FI5A 4N82A 4AQYB 1RU3A 4RZIA 1YD7A 3CEHA 2DMRA 1XBTA 4P35A 4D3ZA 1G18A 1U0EA 5CYGA 1YBFA 1XNHA 1ESMA 1KI1A 2HNAA 1ZK2A 5COAA 1Z36A 2I4TA 4EGFA 4IO1A 2ZJBA 5JYEA 3O8RA 4TZKA 2RAUA 4BNNA 1BE8A 1V1MA 2WTAA 4BFSA 1ZSVA 1PWYE 5K2MA 2II6A 5DN6A 1SEVA 5DHPA 5I4IA 2P9BA 2P2YA 2CY0A 3L8ZA 1OBOA 2OWDA 4MEJA 4RFLA 4NR0A 5JDIC 1BX0A 1RC1A 4GYKA 5JWRA 5LZ4A 4TXHA 1N7HA 4W4TA 5I9SA 3INNA 3VYTB 1DBWA 4BRZA 5B57C 5MFPA 5J1SB 4C7VA 3L43A 4MR8B 4R2HA 2PXCA 3VHRA 2B1JA 1GFWA 3C3DA 2V9ZA 4CFYA 1BMTA 3HBAA 5G0UA 2W4MA 2JD1A 3AT1A 3UATA 4L4YA 2QD5A 3GCXA 3EAGA 3JZDA 4KWHA 4NCBA 1YJXA 3VJKA 3F90A 5FUWA 2ID4A 1IRIA 1M0TA 2TECE 5YASA 4DLUA 1HT3A 5CM8B 1P77A 1TF2A 3K9QO 5BNFA 1KYVA 3D0QA 2QP4A 3DE3X 1UBLS 3W5JA 2GEBA 4LFBB 2VSQA 1F06A 1QHYA 2OC9A 3OE1A 3MJ4A 4JUFA 4US0R 4Z9AA 2BTEA 5J3JA 3VR0A 5FUVA 3L82B 1FXWA 5ALZA 1RAIA 1UZAA 1Y81A 2FEWB 4EVQA 3VR3D 4KBFA 4BO9A 4BVKA 4JOBA 1J9GA 2C8KA 3MM4A 1U0FA 4JC5A 2ZSEA 4JP5A 4MS1B 3RF7A 1C0IA 1NWHA 4G0WA 3DBRB 1U8XX 2VP9A 4ECAA 2PJZA 3DP7A 5J2TA 1N3IA 2W37A 3ZNQA 2V7PA 1GFSA 4N5HX 3DD5A 4XX0A 5GAJA 2AFHB 2ZUBA 4DMGA 2VRCD 1BKDR 2PGOA 1G4UR 3K1ZA 3IAXA 3HGQA 5EZQA 1YMVA 5KJ1A 3K9HA 2WUFA 1YVEI 2X0IA 2M6SA 1H5QA 2HUNA 4TVBA 2I2WA 4JXJA 5TT0A 1YZFA 1O6CA 2C1ZA 3E5RA 3FZYA 4I3HA 5EJEA 1LX6A 3DH0A 5IX8A 4Q4LA 4YRMA 5LU8A 1WDKA 3NBAA 1Z5NA 2EX1A 1HE2A 4TSFA 1P2SA 1FOEB 3PEYA 3NXSA 3VO8A 5BV8A 3UQZA 2CVOA 1P9RA 2XMCA 4D26A 1URPA 5ECWA 2PL9A 1TIPA 2QN3A 3M6IA 3AUKA 1E2KA 4ZO9A 3AHJA 3K0EA 2JHFA 2Z9BA 2FZCA 5KWIA 3DM9B 2P11A 3OFND 4YJ3A 2WD7A 3HNRA 4Q4HA 3QEBZ 3F78A 5E9JA 3A1FA 4PM4A 2O8BA 5I7HA 3OO0A 1DAEA 2AXQA 4B3IA 1XRNA 3TI9A 4KZKA 1PJAA 1MVOA 5CLGA 1F3OA 2X8BA 3ES9A 4MWOA 4CUKA 2XLCA 3NHRA 4F8YA 3VH1A 4JI0B 1I4WA 4AY6A 4WA7A 1XTSA 3FCOA 4NDNE 1RFLA 3LH5A 3FI0A 4HLCA 4AW9A 4DQ0A 6REQA 4C22A 5B3JA 3P97A 1WZUA 4ZEOA 3SQLA 3DHVA 1R6XA 4PAQA 4TKMA 1O0CA 4GQIA 4N0EA 2DR0A 2AZTA 3AUAA 1Z2OX 1ZK1A 3WIDA 4BECA 2GTIA 5JXJA 1RJDA 4A92A 1DXOA 4ZRMA 3O3MB 3TQSA 4XCQA 4FGSA 4XXHA 2OC4A 2BFFB 2VDNB 2Z8YA 2JGEA 4LIPD 4GLLA 5JNWA 4DV5B 3KOOA 1DJQA 1WLYA 2Q5FA 3R6DA 5D87A 2L69A 1OLUB 3FNIA 4OCZA 3ZIAA 1ZKMA 4EVRA 5LOVF 3KZVA 4UHDA 3E35A 2BISA 3OZWA 3WLHA 4DS3A 2NYAA 1ZNZA 3PC7A 3L7JA 3MF4A 3EZ9A 5B3JC 3H9CA 3D7LA 3MB8A 3QITA 3N3AC 1II8A 2BBOA 3A4LA 3FMVA 2AG5A 3N2KA 4K9NA 4HH0A 1I1QB 1PJ2A 3NDJA 4JU9A 3TTYA 1CK4A 1LY1A 2ARKA 3X43A 5K3CA 3HSSA 1JZQA 1NW8A 1C81A 1P6QA 1V9SA 1BU8A 2R6HA 4OP3A 1FVHA 2BFBB 5DHSA 1QAMA 3CB2A 4UD6A 2HJGA 3KE8A 4R3WA 5DXAA 4U7FA 5TPZA 2PX8A 4A27A 4KO4S 3SHVA 2JIQA 2PVSA 3PXUA 2PUFA 1B0ZA 4R1UA 2GNPA 2HD4A 2QT0A 2VJMA 2QL6A 4LSMA 1YBMA 4O2BA 3Q9SA 4R8MA 2HNKA 5D2CA 1MV8A 1SD5A 1X1BA 3ABRB 3VSCA 4A6EA 3OTOB 1DC5A 3G68A 5KYTA 3RAGA 1QRRA 1TTPB 2B21A 4EJ0A 4F8JA 3CGWA 4YT5A 3VU1A 2QLNA 4JP2A 3FHJA 4QC2A 2QENA 3EVEA 5DZSA 1QG4A 4MYSA 3LZDA 3NBUA 1C9EA 3C97A 1VPVA 4PWYA 4LS3A 4MUMA 4WKNA 3QLEA 3BWBA 4F4JA 3B48A 1V4BA 1CERA 1D4FA 4Q01A 4XIIA 4PONA 4RVHA 4G9GA 3LNTA 4RHXA 4HNGA 2SNIE 1V96A 3U5ZB 4H4DA 1V26A 3L1KA 5CVEA 1JFFB 2BHRA 2IEGA 3LT4A 1KL7A 4B48A 2IOYA 4L4UA 4DA9A 1TAQA 3ZVKA 3AOGA 3H99A 3KKNA 1TKAA 4O25A 3Q40A 4Q1AA 3K0AB 1ZG3A 2AOTA 3PGJA 1BDMA 4P93A 3TNFA 3LP5A 2CK3D 5ALYA 2KLBA 4DY6A 2QVYX 4KXQA 2FB9A 1AB5A 2AV6A 3EGVA 3EEQA 2QJTA 4D9IA 4V2IA 3WRYA 3THXB 2CLIB 4WXEA 3FA2A 4XYMA 3DFMA 2IKQA 3WL7A 3H65A 2WSMA 3STHA 1V9CA 3GLRA 2PWPA 1BN7A 2R00A 1VB5A 4JLVA 4BKOA 1TEZA 1J0BA 4PPFA 2OM6A 3MMPA 4E5VA 4K46A 3WQQA 2DERA 3HCFA 4TS3A 1E1KA 2BWJA 1EFAA 2OXTA 4KV7A 1XIVA 5ALKA 3TOSA 4GKJB 4JOQA 3NP9A 4C21A 3FHLA 2RGBA 1RDFA 1YBVA 1VIYA 2BJHA 1C7JA 3CF0A 4OU4A 3DAYA 3V4VB 1MJ5A 4NXMB 1D1TA 2RSLA 1BDJA 4COKA 1OGJA 1IK4A 1N2CB 3GLHA 4WXMA 2XR1A 1E6WA 4G1EB 1VB3A 3WRYC 4EPTA 4OMUA 4ZQHA 2OSBA 4C04A 3JYNA 4D8VA 4ARCA 4M0MA 4A82A 4PQRA 5EHQA 2R00C 1O1YA 1SIWA 4UHJA 4F84A 4FP9A 3Q3CA 5DLEA 2RGCA 3QXCA 1PW5A 1U7PA 2CW5A 3BCUA 4YI3A 1RS0A 4L6CA 3O92A 4EUSA 1EXDA 1SVSA 3CSUA 3DKIA 3GXOA 4PO8A 3DE2X 4ME6A 4G5YA 4D25A 1ZMBA 1BJTA 3M89A 2IS1A 3HZHA 3RE1A 2L18A 3GFGA 1KPIA 3SKXA 4DADA 2QNIA 3ESQA 3AEKB 3UAGA 2O4UX 4MQLA 2PBFA 2V4ZA 1ACMA 1KDYA 4LN1A 5EJFA 4ETNA 2O1WA 1QHXA 4IGIA 2Q9UA 5F1PA 3BC1A 3HUFA 1BVUA 1Z9BA 3N0TA 2X4IA 4D9EA 4LJ6A 2YICA 3K0HA 3GELA 5ITZB 1LNQA 3FUWA 3AERB 1KAOA 2B92A 2F3QA 1I1NA 2BLLA 2OZKA 3HCPA 1P5ZB 4G5HA 4I5IA 4W8OA 3TD6A 1FUUA 2X5KO 3W5AA 4L9AA 4Q1CA 1V3TA 2ZIVB 1E8DA 3CLVA 5CK5A 4J16A 5EIBC 4CQLB 1XDZA 3BGIA 4RKYA 3CLTD 3CINA 1YR9A 3KFXA 5JTTA 3PLAE 1KFJB 2BF7A 3MN1A 4PGGA 1EVJA 2A1UB 4FGWA 4N7RA 1W2GA 2RCNA 3L0YA 1ZOPA 4HH3C 2PKRA 5AYVA 2GPNA 3R09A 2NXCA 2VP6A 4ARSA 5GINE 3A9CA 3ZQUA 3GLHE 2XF8A 5KPJA 3GRCA 3QKSA 4I50B 1CUXA 4HDMA 3WWPA 5KYVA 4FW8A 3KKPA 3L0SA 3A10A 2D1YA 2IY7A 1F8XA 1IBCA 3RSSA 8LDHA 2PBZA 4I08A 5BXQC 3BF7A 5CX1B 2G8NA 4BP8A 4CCSA 4XB1A 2P5UA 3PQ5A 3P0RA 4UTRA 1I9CA 1LBEA 2P3SA 3L79A 3NHBA 1E66A 4R8LA 3FDZA 5E3HA 3B1WA 3CX7A 2V58A 1THTA 3PZRA 5BVHA 1P6XA 1GFZA 2O8EB 6LDHA 2AK2A 2FLKA 2M1XA 4YASA 1DG9A 5KVVA 1WD7A 2G4LA 1YXMA 5IAGA 2FDRA 2JAPA 5B58C 2IHBA 3C1TA 2Q99A 4FBLA 3GJXC 3WJ1A 1LNSA 1O95A 4GM1A 3K53A 4EBBA 2FZLA 1EFVA 1KBQA 2WYWA 3KB6A 3ITDA 3ITNA 2I2CA 2PZMA 2HQBA 1NULA 3TZCA 1O97C 1MN6A 2AT1A 2R25B 5BSRA 3K0SA 3E9NA 2CNNA 3W8DA 2MMGA 1AS3A 2AC4A 2EOAA 2GN1A 4H3SA 4I9FA 4Q6BA 4Y7CA 5AK6A 1FVFA 2H2FA 1SKBA 3GN2A 1XCJA 2FG5A 3S7TA 3X1WA 5HRCA 2EDCA 1IUPA 1UPBA 4AICA 2VLIA 4WZBB 4HDCA 1AKYA 1Z17A 3ZLTA 4B3TB 1IK6A 1HLDA 1NN0A 3C1AA 4GBGA 5TS3A 2EEPA 1FP7A 1Q15A 4L16A 3GNTA 4RVOA 1EG7A 1NVVQ 3F9IA 3F6CA 2ACWA 3OEHD 4DIKA 2DY0A 4OHYA 1LRJA 3FOFC 2ZPAA 3CR3C 3ZJ5A 2PU7A 3PZBA 4ERXA 4J0KA 3V8MA 3PD1A 4UE6A 2ZBPA 1M0WA 5FUXA 4MRNA 2OQ2A 4TN5A 1AQJA 1SCBA 3S4YA 1H2ZA 3OTHA 2NNWB 4E14A 1K9VF 2LW7A 3O3NB 2CDNA 2FQYA 2QV0A 3IHLA 4FFWA 3NALA 1OD6A 4ND1A 4RVUA 4AJPA 4EJ6A 4TMZA 1DC7A 4KAJA 3RRMA 1ELOA 5KCMA 3LUBA 5LP6A 1YRLA 1SPBS 4O4IB 3D3JA 4RFSB 3R20A 4PS1A 2WRZA 3ZCVA 3RVPA 1D7AA 1HEUA 3DLAA 1A4RA 4PU0A 4KTVE 3T1HB 2WG1A 4EG4A 3G0BA 1PZXA 1YS9A 3R3VA 1C8LA 2X8WA 1T5SA 3SZUA 2OENG 4LYAA 4ARVA 3F6BX 5FWNA 3KEGA 5LMUB 3NOOA 1KEKA 1OLXB 4K9DA 3CKMA 3UWPA 1PL7A 4R8KA 3DEIA 1WPRA 3PEFA 4HYQA 3DL7A 2HU2A 3B51X 3OU6A 3FHTA 3IS3A 4YO8A 2IXGA 4DYVA 1W0JD 4FWBA 5KYUB 3IT1A 1UDAA 3U17A 3ZDXB 1VG1A 2OXEA 3HCWA 3C3XA 4LF9B 2XUZA 3WE7A 4PFJA 3JV7A 3T9CA 1ZXBA 4JYBA 1HKUA 4L02A 2ODQA 1RYNA 4J0QA 2ZYWX 5A2GA 3M4YA 1Q95A 1JLMA 1OXMA 1DAMA 1JU4A 1OYOA 1VE3A 2JFXA 3WLSA 4PYMA 4PAMA 4D0SA 4FN4A 1RXVA 3OJ0A 1DC3A 2XMBA 1CUFA 3AVQA 1V3QE 3N2YA 4F1WA 4O4LF 1DADA 1D2CA 3MXOA 5EC8A 2PX4A 5H9VA 4AP9A 5I8PA 4GVPA 2PUCA 4NZOA 5LJIA 4YRQA 1YL6A 4M54A 1JPUA 2AQ8A 1RHKA 2DUNA 5EJIA 3DGEC 3H1TA 3JQ8A 3TDMA 3C45A 3SEFA 4QDOA 1VL2A 3E48A 5M7EA 1DMRA 4TLCA 3U60B 2JNWA 4CDGA 4TUYB 2MSKA 3RR2A 1W85B 2OCKA 1K8ZB 4L0MA 4OJTA 4KQ2A 1OA1A 5DF1A 3BD7A 3ELWA 5JAZA 4FCTA 4G0MA 3SJAA 3K9CA 2VDPB 4QRDA 2CZGA 1PR4A 3DPIA 2CNBA 1R0SA 3QNUA 1PLJA 1LSUA 3K4QA 1VI2A 4U00A 1KEUA 3K0FA 1K86A 5B2EA 3ELYA 2EBWA 3WKEA 1GPH1 4FMDF 3GVXA 1ZJZA 1BGWA 1GZ6A 4Z54A 4Q18A 2ZBRA 3UMYA 5DLDA 3KSBC 1B8PA 3JQ7A 3I39X 2ACVA 2V97A 1RRVA 5KJ6A 2ZU0C 3LQQA 3GFVA 2WVGA 3KZ1E 4WVFA 3SVTA 3CR7A 4XRGA 4ZRDA 1IHUA 1IAVA 3F6PA 1DLIA 3MGCA 4OIFA 5BNZA 3GCGA 5I7SA 3GLIA 1N2HA 3P9SA 1A9QA 2D59A 2J33A 2PAAA 4KFTA 3TX2A 4GYWA 4CM4A 2JL1A 2W90A 4Z6KA 4ZYWA 4ASUA 1JFSA 4M46A 1LDYA 2J48A 1KZHA 3HB0A 1IATA 3TIVA 5FTWA 4UUAA 1G6KA 1W5FA 2RG1A 3L7AA 1IWOA 4LZOA 5FPYA 1LW6E 3PQ2A 1FMLA 1H2RS 1NFRA 3GLTA 4OGFA 1GU7A 4Z0HO 1XZDA 1UCFA 1EFUA 4UE3S 3DO8A 3TOXA 3T1OA 4ACBA 3AHHA 2IW3A 2O2EA 1HG1A 2FUNB 2QBYA 4B4DA 3O84A 2OFOA 3I42A 4BB0A 4HWKA 1KK2A 1PR1A 2IRWA 1DRJA 5C31A 3RG2A 3O8QB 4TXMA 3D4IA 4GW3A 2NU9B 3IOYA 4LMPA 3O3CA 2FR0A 2C29D 1ULBA 4J75A 5AW2A 3NPAA 4HB3A 2Y0CA 4IP0A 4REQA 1OIWA 1T5HX 4FZRA 4QBTA 5HE9A 2Q6VA 5DEOA 5E0KB 1N2OA 4Y2RA 4QBHA 5FBKA 1I7QB 3T5AA 4JV5B 3LCRA 3RJ5A 5LD2C 2PUBA 1OT5A 3OX2A 3PUHA 4RENA 4WDQA 1T9HA 3R9XA 1T24A 3AYZB 3FVRA 1N1EA 3L7LA 4ZMSA 3MCTA 4U1RA 4ZVLA 3LK7A 2F1JA 3EPLA 2DYKA 1CNFA 2ZJ2A 2M6KA 1V7CA 1W4BA 1XTTA 3N7TA 2PVPA 2QPTA 2EU8A 2VPQA 3GLIE 1D4ZA 4JENA 2QPAA 4M1MA 2I6FA 4EFMA 1MKYA 1SR8A 3LP6A 2MT9A 1DZ3A 2WWRA 5GJCA 4J4BA 3FCCA 1TQ2A 4B4OA 1F2UB 1ECFA 1XJ5A 4X1YB 4EARA 3HS3A 3KV3O 4YP1A 1FVXA 2GVZC 1KAHA 1JLRA 1XCBA 1NV9A 1GGMA 4HL6A 3L1HA 2WTMA 4PZYA 5IM4A 4HN9A 3ETLA 3RREA 4KYUA 4HUTA 4FWTA 3HKCB 3N0VA 1BXRA 4GXTA 1PSZA 1USKA 2QSYA 3VBCA 3I9NA 4O5OA 1MC1A 3I4CA 4KN8A 4WLNA 1WM1A 3SYTA 2GAJA 1KSHA 1N2IA 5IT5A 2IH5A 4ENVA 1EWVA 1PJBA 3OJOA 2A0KA 1XU4A 4E11A 3A1DA 5FHRA 1WXHA 1NI5A 3DFFA 3TAUA 3WAJA 4DB4A 3C3WA 2V5UA 1MVNA 4DV3B 1MHPA 4S2EA 1D2EA 3NNNA 2VSYA 2QL9A 3GUVA 4GXQA 1CB0A 2WJIA 2H9AA 5CB4B 3QOFA 4EQZA 2KYRA 3LLCA 4BKUA 4UTPA 1WR8A 5A5FA 2O20A 3H9UA 1NFFA 3CCBA 4X3CA 3R8CA 3E27A 3VMMA 3ZV6A 2JLYA 2ZBGA 3SR0A 3EIUA 4J29A 5B4UA 4CEHA 1Y6JA 3N8HA 1KYIA 4KFRA 2EFYA 4AP5A 4MQFA 2WFAA 2HCRA 4CUJA 4NFHA 4FNAA 3RTAA 3D64A 4PGMA 1ILWA 1VXOA 1V47A 1ZESA 3OTWA 3LL4A 3D8NA 4R54A 1DAKA 1ONPA 2VAMA 2C07A 1Y8CA 3LHFA 4HZUB 4YJ3F 5DGHA 5JH7B 5CYFA 1ZR2A 3P4XA 2ZRKA 1E1RA 3CLUD 4YRJA 3RVSA 4B81A 5KNDA 2C03A 1H9AA 5A4AA 4K6CA 2WHXA 3F3SA 2W93A 4TS4A 4XVQA 1PD1A 2RJOA 4HMPA 1EDZA 1N8TA 4OXXA 1SMKA 1TZBA 3BRWA 3E5NA 4CF4A 4A03A 3KDPA 4Q03A 5B58T 5BUQA 2DFNA 2DBQA 2VKQA 2BMWA 1QWSA 4IUBS 1TA9A 3CBQA 2CNWA 4TLEA 1FUIA 3QE4A 2BFEA 2R44A 4MINA 4TM7A 2PJDA 4HAIA 4D9GA 5F1OA 1JZSA 5AVWA 1FYFA 4YT2A 1I1HA 4GYYA 4G5OA 4NCIA 5T3UA 3ASUA 4ZYLA 2YHBA 1AZWA 2PSEA 3DHEA 4GOMD 3IP5A 4GI1A 1U8TA 3UT6A 2Q7XA 4WT7A 3A4YA 3LXMA 3N75A 4XDZA 4QDZA 2D06A 4IWNA 3NVMB 1X8JA 2HK9A 3AQIA 3JQCA 4M88A 2NYRA 1FBTA 4CDMA 1JHXA 1HKHA 4UTNA 4IIGA 3QPUA 1E5TA 1V45E 5KDOA 5K3OA 1RQXA 2JLRA 2VYFA 3U37A 2BGIA 2QAGA 2FW6A 2VYND 1NPTO 1J2YA 2BM8A 4M9SA 5EHNA 1I7PA 2YV3A 3PKZA 1L7QA 1NRWA 1IONA 1EP2B 1H22A 1ZI6A 2QJFA 3S1LA 1Z26A 4B9EA 5A0TA 2G1JA 2NLOA 3EGXB 4ZOLF 4WCDA 2QLTA 2ATXA 2ATCA 2C5LA 3LT2A 1OXXK 1WU7A 2P9ZA 4MIYA 2OO7A 2AMLA 3WGGA 1Y9DA 1T6ZA 3BXOA 4FFSA 2F4NA 3L9WA 3IEXA 3AV3A 4ILEA 4YUWA 2HSZA 4MNTA 1MJNA 4MGZR 1NJ8A 5EMMA 3UGTA 4PHGA 3FAKA 5EEHA 4ZYXA 2BL4A 1XZCA 2FCRA 2L17A 2J7KA 1G2PA 1T9DA 2QAGC 4OQNA 4Q3BA 3VVBA 3KPYA 5KYYB 4RIHA 1JQ3A 1VMKA 2HBZA 2GZ2A 1P2BA 2R1UA 3FSRA 1GGKA 4RORA 5DYIA 1JU9A 3NHKA 3NIDB 4TMYA 1Q83A 3ME5A 2VQ6A 1E2HA 4DJTA 5AJVB 2UYQA 5TPWA 3ROTA 5LNK1 1R9MA 4D3YA 3L0PA 1MIHA 1ESZA 1FQJA