4R01A

Crystal structure of sp1627, a putative nadh-flavin reductase, from streptococcus pneumoniae tigr4
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
210
structure length
210
Chain Sequence
GMKLAVIAANGQAGKAIVEEAVKRGHEVTAIVRSENKSQAESIIKKDLFELTKDDLTGFDAVISAFGAYTPDTLPLHSKSIELFNQLLAGTQTRFLVVGGAGSLYIDETKTTRLLDTPDFPEEFKPLAKAQADELDLLRTKNNLNWTFVSPAVDFIPDGEKTGNYILAGEIFTTNEKGISQISYADYAIGLVDELEKGHHIKERISLLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of SP1627, a putative NADH-flavin reductase, from Streptococcus pneumoniae TIGR4
rcsb
source organism Streptococcus pneumoniae tigr4
molecule tags Oxidoreductase
molecule keywords putative NADH-flavin reductase
total genus 68
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13460 NAD_binding_10 NAD(P)H-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4r01A00
2IZ0A 1LDMA 2NLOA 1JAYA 1Y81A 3PIDA 4ND5A 4MVJM 4N54A 3WGHA 4AJOA 1MB4A 4KQXA 2PD6A 3CTMA 3SLGA 3GRKA 1DAPA 4U7WA 5CAEA 2D1YA 4KQWA 3JQ8B 5K6AC 2GN8A 2UVDA 2ZQZA 2QG4A 4CQMD 3ZWAA 4W99A 2FSSA 2OL4A 2WD7B 3PQEA 2ZK7A 2BI8A 1HF3A 4FGSA 1X0XA 4NBVA 3ZWOA 3LU1A 3W8DA 4NHEA 3QVXA 3WICA 4CJXA 1PQPA 1PZFA 3RC7A 2GGSA 3KSUA 3QSGA 2C7VA 4U0JA 1B2LA 3N58A 3M1AA 1JQBA 3H8VA 2NU7A 4U5QA 3V8BA 4E6PA 3IDSA 4NU5A 3RJ9A 1TI7A 3U4CA 4BNUA 2DPGA 2HMWA 4BNNA 1J49A 4GMFA 5DNAA 4QO8A 4QECA 4DL9A 1UAGA 3JQ8A 2G76A 2VN8A 3I9JA 1NHGA 1EBFA 3K30A 4E2ZA 3QVOA 1LEHA 4RF2A 1GAEO 3LVFO 4CM4A 3JD4A 5CEJA 2HKIA 2BGKA 3AOEC 5LDGA 3JV7A 2IXAA 5I8WA 1R66A 1HDYA 2DBZA 2GN6A 2ET6A 4UVGA 3UKOA 2YFQA 3U3XA 5AVOA 2ILTA 1XEAA 3QWIA 1NHWA 1UXGA 4J7UA 1F17A 3HHPA 2Q2WA 4QQRA 4PLHA 5IAAA 1I33A 4J3FA 2HO5A 7MDHA 1J5PA 3EAGA 2HRZA 4FFRA 1LDYA 1GEGA 2PV7A 1PJ3A 2NVBA 5T6BA 1UDAA 4FW8A 3TPCA 2PWZA 1SOVA 1YL6A 3GGOA 3OH8A 3MTJA 3F4LA 5TF4A 2C5AA 4PLFA 4ZJUA 3C24A 2GN4A 4PLCA 4X54A 3IIEA 3E18A 3ZCXA 4M8SA 2IZ1A 3NJ8A 2YW9A 3C85A 2XF8A 3A14A 3D4NA 4Z0HO 3TZQA 2G5CA 4TVBA 3VH1A 1R16A 3PGXA 2QRKA 4YEDA 4AJPA 3K8ZA 3AUAA 4J0FA 1Z6ZA 4DXHA 1XG5A 2JKVA 1PU2A 4CUKA 1XYGA 3V2HA 1HE3A 2CF6A 1NPTO 4YQYA 3UICA 4WLOA 5KVCA 3WNQA 4IQ0A 3E82A 3FNEA 4HBGA 1IPEA 1IY8A 3DFZA 3OEWA 4CM9A 4DLAA 4MKZA 3PDUA 3KLPX 3V1UA 1LA2A 4F46A 3GNSA 4O0LA 5L40A 4PLWA 3WFIA 1R4MB 4R1UA 5A9TA 2Y99A 1CF2O 1A5ZA 1IPFA 1E5QA 3NAQA 2IE0A 4KUHA 3S2FA 3WGYA 5CP8A 5BSEA 1RJWA 3NGXA 5IDYA 4IDBA 4RJTA 2O48X 3DHNA 2ZTVA 5L3ZA 4D41A 3KXDA 4NBRA 3NT4A 1EVYA 2H1SA 1XWFA 1YRLA 3KVOA 4M1QA 4OHUA 3PJFA 2FWMX 4MIEA 1GV0A 5KVVA 3HFGA 2WYUA 1P1KA 4CQMB 2PZJA 1KEUA 4Q3BA 4YBZA 4UUMA 3NYWA 4YDRA 1YJ8A 1UAYA 5IZCC 5HTOA 2GYYA 3L4BA 1BW9A 2PR2A 2P9GA 1T25A 1ZK2A 3DZGA 3IKVA 4ZQGA 4ND4A 3LDHA 4XDYA 4BNFA 2Q2QA 3I6IA 5JE8A 3GVPA 3JSAA 4BNVA 3DHEA 4XD2A 3RFXA 2ZB7A 3ANNA 4GL4A 3E48A 2CSUA 1S6YA 3B1KA 2BH9A 4F6LA 5L51A 3KYDB 2BFMA 3CUKA 1XLTA 1CETA 3JQ9C 2B36A 2O23A 4I9NA 5G2OA 4AJ1A 4KOAA 1GYPA 1R4NA 2HSDA 5TNXA 3ROMA 1CWUA 1NNUA 4ND1A 1NFFA 2Y67A 2RHRA 4RQTA 1IOLA 2SCUA 3LT1A 3KRTA 3PZBA 1Q0LA 1GDHA 2J8ZA 2X23A 5IZ4A 4FOSA 3OA0A 1HZJA 2I99A 5JC1A 1LLUA 3PJDA 4DGSA 4XR4A 4RVDA 1BXGB 2HJSA 1U3UA 5DDIP 3C7CB 1XA0A 3Q6IA 4ZGWA 3MJ4A 3FSRA 1ADFA 1XHLA 4GSKA 5ENVA 1QYDA 2NACA 4LN1A 1YL5A 4CV2A 4NFHA 1ZVMA 4GH5A 5A02A 4CM1A 3TL2A 1U5CA 4LVCA 1TLTA 1PJ2A 2WMDA 2NVUB 4XYGA 3GDFA 3W4JA 4B4UA 1B3RA 4RQUA 5B4TA 2YFHA 1JKJA 1N9GA 1DEHA 5K6AA 4OL9A 1Q1NA 3GVHA 2NNLD 1ENOA 4WOKA 1L1FA 1DFHA 1LX6A 3GY0A 2WSBA 5C7OO 1K6JA 1MFPA 3CMCO 3I4CA 4GLOA 3ADPA 3LZ6A 4D7AA 4EDFA 2B5WA 4JBIA 3AOGA 3PJEA 4I5EA 4XDZA 4J7CA 5EMHA 1OI7A 4DMMA 2P68A 4MO2A 1E1LA 3OMLA 1Z7BA 1NWHA 2VRBA 3D64A 3UGKA 1DIGA 2VT2A 5KKAA 3PFWO 1QRRA 2Q4EA 5JCJD 3FTNA 2PGJA 3U4IA 1NWCA 1KBZA 2I66A 3DZHA 4PVCA 1GFSA 1ZMTA 3LLSA 2JL1A 3H5NA 4FJ2A 3AI2A 3GC6A 2PGDA 5COBA 1LQTA 4WPGA 4Y8VA 1E6WA 5EL0A 3WBBA 3EY4A 3AY3A 1XQ1A 4Z3KA 3RUCA 2ZJ0A 2ZTUA 3KOUA 1AHHA 1QV7A 1KC3A 4B8ZA 1UH5A 3E9NA 1MA0A 4IDCA 2X58A 4OKIA 3WLEA 3EZLA 1ZFNA 4B3HA 1NVTA 1DIBA 1YJQA 1ZK0A 2DBRA 1ONPA 4IY1A 1D7OA 1NPYA 4XYBA 2BGLA 4ZA2A 4HV4A 4AJEA 3C1AA 3AWDA 1SB9A 4XX0A 2AG5A 4IXTA 1O9BA 3WR5A 4PN3A 1U2DA 3GMDA 4R1TA 3JQGA 1NQ5A 3TDKA 1XQ6A 3DMYA 2Q1WA 2HRBA 3ZI0A 3RVDA 3AM4A 4HP8A 1W6UA 3DWFA 4ALIA 4L8VA 3Q3CA 5ILGA 1DIRA 1CQIA 1TT5B 2CY0A 2P4QA 2VZ9A 2AMFA 3T4XA 3I6QA 5JAMA 1B7GO 2JAPA 1QMGA 2CD9A 2HMUA 3EMKA 3IP1A 1H2BA 1X0VA 4MVJA 1D8AA 1ADBA 1PQUA 2VNAA 1ADCA 2DBQA 4D0SA 5LDHA 4A27A 2DM6A 1ZNQO 5FF9A 2P4HX 2OGUA 5TJ9A 3C7AA 4BKRA 5BR7A 1LLDA 3NRCA 5A3JA 2OORA 3R3SA 1RM4A 4J4HA 1PTJA 1P1HA 5GMOA 4NH4A 5CPBA 1BSVA 5C3MA 1AN9A 1NPDA 3VC7A 4CLOB 4IQ8A 3D3EA 2Y1OA 4BV8A 1QV6A 4P4LA 6LDHA 3JTMA 4LVUA 3I9MA 4HWKA 2YYYA 4UEKA 1RM3A 2A4KA 3BZUA 3ZHXA 2PA3A 3DEYX 3S2GA 3PWKA 2Z1NA 5CDSA 1PS0A 1TVEA 1DAOA 1UP7A 3QJ5A 1P0CA 4P8RA 2YQ5A 4ALMA 1U5AA 2VWGA 4HXYA 2OMEA 5KKCA 2NWQA 2PY6A 2Y1GA 4YAEA 3RAJA 4BNZA 4ALNA 3BMQB 1D3AA 1JTVA 1ZIDA 1W4ZA 3ZHBA 4ID9A 3BHIA 3BHJA 2VYND 4HX5A 4CMIB 3A1NA 4BO9A 5FI5A 5HS6A 2PKQP 4C4OA 3M2PA 4EUHA 1U3VA 2G0TA 3DHYA 5K0ZA 2EG9A 4P22A 2ZCVA 3OSUA 4R1SA 3JQAD 4I08A 2NTVA 4YACA 2UYYA 3WMXA 3NTOA 4CL8A 1EE9A 1E0DA 2X6TA 4KZPA 4A2CA 3NUGA 2HMSA 1HLPA 1LSOA 2R2GA 1E5LA 4XYEA 3UH1A 4OGWA 3EZYA 3X2FA 4IDAA 2UUPA 3E9QA 4E33A 4LSMA 3H2ZA 5JDCC 3EC7A 1QG6A 3MTGA 4OXNA 4YRBA 1UXHA 3N7UA 4PFJA 2ZB3A 1BVUA 3ZWCA 4DYDA 4RL6A 3V2UA 3FPCA 5AXAA 4ALKA 3JQAB 4OKNA 3KYDA 4BNTA 3LQFA 3KYCB 2FZEA 4BNKA 4J6FA 1HL3A 4BGIA 4YRAA 2BHLA 2FZWA 4MIOA 3WNVA 1HXHA 3HDJA 1JN0A 3KEQA 2XXBA 1HZZA 1L7EA 2AG8A 2I76A 5EQFA 3VTZA 3HB5X 4G81A 3MOIA 4HUJA 1OAAA 3LT2A 3GN2A 4NJMA 4LMRA 5JS6A 3ST7A 2O4UX 3SX2A 3DBLB 1MV8A 5DT9A 4BO0A 4JX8A 2W90A 2ZB4A 5L7TA 2E49A 3UCFA 1HTBA 3F6YA 4B4OA 1BWSA 1N7GA 5FFFA 4TMFA 1VJ0A 1FDSA 4XQCA 2Z1MA 4XRGA 4PRKA 4P4NA 4YJHB 5BSHA 2AQIA 1ML3A 2G17A 4I5GA 4CUJA 1HDXA 3G79A 2CDCA 1NAHA 1U2GA 4GX1A 1KERA 5DP2A 3AY6A 4EYEA 1YDWA 3PPIA 1HKUA 4YTEA 3WQQA 2NADA 2XAAA 3OICA 4IGEA 2PD3A 4NJOA 2BD0A 4PZDA 2ZQYA 8ADHA 1DJNA 5JYEA 1LRKA 3QVSA 1AUPA 4BL5A 2OO5A 3S1LA 1SOWA 3RUIA 3UAGA 1ZJYA 4JP3A 4IIVA 2NU6A 1ZZEA 2BMAA 1K6IA 5ES3A 2WM3A 2VCYA 3GHHA 3TQHA 3VZPA 3X2EA 1N1GA 2B35A 3JQCA 4C7JA 3ABIA 1C14A 3P2YA 3VZQA 4DPLA 3MJEA 2CMDA 3E5MA 3RU7A 3QVTA 2F1KA 4ITUA 3IUSA 4TSKA 5F5NA 3E9MA 2RH4A 4MINA 1KY5A 3JQFA 1P0FA 1DHRA 1EE2A 3C7DB 4CMAA 1ZJZA 2O7QA 3FHLA 1WLYA 4W6ZA 5BNIA 1LNQA 3AM5A 3MJVA 3OQBA 2FSVA 5BNFA 3JYQA 2EKLA 1NR1A 2NTNA 4R5MA 4RF4A 1AXEA 3AI1A 4JK3A 4JJIA 1WP4A 4Q3CA 1EVIA 2CDAA 1Y8QB 3INGA 1DLIA 1BVRA 2WDZA 3GGGA 3L6EA 2VWQA 1C1XA 1YQDA 3QWBA 2JFFA 1DFIA 5KIAA 2NSDA 2GCGA 1N8KA 2CF5A 1H6BA 2OBYA 1C1DB 2GSDA 4LISA 1EUCA 1EK5A 3GPIA 1DIAA 1EQUA 1M67A 2GERA 4ALLA 1E7RA 2XOXA 4MVJP 4FB5A 3IKTA 4II2A 5H83A 3SXPA 4YWJA 3ONEA 2FR0A 3L9WA 1HLDA 1I0ZA 1E3LA 3H3JA 4YA6A 3R1IA 1YB1A 1QYXA 4RV9A 1LUAA 5EERA 1HYGA 2X0IA 1HDCA 4BQPA 5IZCA 2WD7A 4BGEA 4XYLA 4XGKA 4TRMA 3CINA 4K9DA 2PGLA 3EVTA 1H6CA 1H5QA 3GH3A 2YDXA 4LMPA 1PR9A 3KETA 2JHFA 3OBBA 3M2TA 2J3KA 3DZIA 1SC6A 2DPHA 1IL0A 2VYNA 4EEXA 2HK8A 3AY7A 1PL8A 1Q7CA 1C3VA 1C1DA 3ADOA 1FMCA 3OJLA 3RBZA 4QEDA 2DUUA 2OBNA 4BUCA 3AJRA 2Y0EA 1ID1A 1O8CA 1QYCA 4TKMA 1ZBQA 1F12A 1MXFA 1Y6JA 3HNPA 3ITDA 4M87A 7ADHA 3G1TA 3DZFA 4L4RA 3TF5A 1E77A 4E2WA 4QSMA 3DZBA 5JFOA 4Q39A 4WGGA 3JQFC 1KIFA 5DOVA 2H6EA 2Y0CA 5EQDA 4RPJA 4NNJA 3ZV6A 4YQZA 3NT2A 2BKAA 2I67A 4MVJE 5JDIC 5I9NA 4AICA 3H5AA 2PLAA 4EI2A 1ZKMA 3PYLA 4QO7A 1KVUA 1VL6A 3MOGA 4R16A 5AQ1A 2TMGA 3SBOA 4R01A 2VOJA 3PI7A 4NBUA 4FGWA 1TB4A 3KSZO 3DMTC 1H94A 4OXYA 1LLQA 3IJRA 3JQ6A 3K96A 3KTDA 3IAHA 3ZWMA 4DC0A 2GRAA 1XIVA 1DSSG 1UDCA 3T7CA 4HY3A 3EVNA 3IJPA 1I8TA 1MUUA 1HE4A 1QKIA 1XELA 5KJEA 3UOGA 4LCEA 4EUFA 4FFPA 2V6FA 3O9ZA 4CM9D 5CDYA 1X1TA 4Z9FA 2P2SA 1ZSYA 4WASA 4Z0TA 1I2ZA 5C7LO 4BO1A 3WWZA 3L77A 2GDZA 4MPDA 4KUEA 3UW3A 1E7YA 3BMNB 2B37A 5JCJA 1H9BA 1Y5RA 5EN4A 3OJ0A 1CDOA 1X1EA 5B4VA 2W2LD 4TWRA 3U62A 2O2YA 3LT4A 3AOEA 1YL7A 1SCUA 4XWYA 5G4KA 4DBZA 1SAYA 3TSCA 1DPGA 4BNWA 2FY8A 3RSHA 3H6KA 4IJVA 3KEOA 4GVXA 2Y1CA 4CL3A 1PWZA 3D3WB 1YVEI 1H9AA 4GWGA 4IZHA 1YH3A 1GQ2A 4JJGA 1GCUA 3FCOA 1R15A 2ZB8A 4XEHA 3I9NA 3TZCA 1PL6A 3D4PA 4AFNA 4AJ4A 4M49A 3ZWNA 2O4CA 5GZ3A 1ZXBA 5IDWA 2H5LA 4A03A 3EW7A 5C7IO 1I24A 3G49A 1ZK1A 1GR0A 3AM3A 5T5QA 5TT0A 2D2IA 2EGGA 5ER9A 3JYOA 4BGUA 3TOXA 4W82A 1ZEMA 4J9VA 1P77A 2Y0DA 5KJCA 3GLQA 1LC0A 1VJ1A 3FWNA 4OO3A 1SEPA 3K2BA 4GSLA 9LDTA 4D44A 1VLLA 1DC4A 3DAGA 2P9EA 3Q0EA 5G0WA 1C0IA 3VVBA 1EZ4A 1P1FA 4RDIA 4W7IA 3GPDG 3QWFA 4Z0PA 4DC1A 1SMKA 4WLUA 1DC5A 2V6BA 4YCAA 3DMTA 3GZNB 1K2WA 4IZIA 2D5AA 1IYZA 1UZNA 3VPXA 1T2EA 2CDBA 1ENPA 3RKUA 1KEVA 1I5RA 4UVIA 1SEVA 3FNGA 5HS4A 4A10A 1I30A 3L6OO 3QWHA 4YT8A 2Y66A 1Y9EA 4DMLA 4BNMA 3DXFA 1Q7BA 2PH3A 3BMOA 1K5HA 4DLLA 3DBHA 4FJ1A 3K6JA 4KWHA 1WDKA 3RC1A 1YOVB 2GF2A 4CM6A 4KMSA 3WX0A 5A06A 1HWYA 1NM5A 3T4EA 4Y9DA 2W2LA 4J90A 1HYHA 4UUNA 4UREA 2J5KA 3S55A 1GQYA 1NQOA 5ITVA 1B3BA 4NI5A 1HEUA 2Q1SA 1ISHA 1B26A 3KLMX 2EKQA 5I7EA 4XB1A 1PIWA 5HWSA 1GTMA 2OOSA 5A5EA 4CMEA 2LDXA 5TJHA 2AEMA 2X8LA 1N92A 4IGFA 5AYVA 4IDGA 4WEQA 4XB2A 5JBIA 4Y6PA 2YDYA 1P45A 4TKLA 1HSOA 2X1HA 4MJLA 2JJYA 1E7MA 4J16A 2D4AA 3WWYA 2J5QA 3A28A 4ZQBA 4F6CA 4JIGA 3ZNPA 2VHVA 1Z75A 4YT5A 4RVUA 1X15A 1KYQA 3KB6A 3OQ6A 1E92A 1ZUD1 3NTRA 3ROQA 3KYBA 5ICMA 4CLEA 2O2SA 5TLSA 4D3FA 4IJUA 3BMCA 4L0QA 5HRUA 4GX5A 4J1TA 4CMGA 3GEMA 4CM7A 3PQFA 1DXYA 1ONOA 4DWVA 4B3IA 1VRWA 2RCYA 3VH3A 2VQ3A 4UVEA 5AXCA 4IDEA 1HDOA 3GHYA 5L4SA 4BO2A 3ZU3A 1LSJA 3CSDA 5L7WA 4L4SA 3RFVA 2DTXA 4MVJG 4BNXA 4JQCA 3EGOA 3GUCA 1A9YA 5GY7A 1X7GA 2EJVA 1PSDA 2VWPA 4R9RA 2Q46A 5EESA 3PZRA 3RCBA 1O94A 3JD2A 3RKRA 1B8UA 1A7AA 1U3WA 5ILOA 4GGPA 3VPGA 5CHEA 1I2BA 3BTUA 2HQ1A 1OOEA 4K28A 1Y8RB 3VDRA 4BO7A 4QUKA 3GK3A 1E1MA 1N7HA 3K9QO 2OHXA 4YAKA 3P2OA 2X22A 1W8DA 1PS8A 3JQGB 4WECA 3W6ZA 4FOOA 1PX0A 2ZCUA 2W4QA 3FTPA 2BGMA 3ZN2A 2Y05A 1J0XO 1TT7A 3DB2A 3K5PA 3OEYA 4E5KA 3EDMA 1GPJA 3JQAA 3GFBA 3KYCA 4RLHA 5L4LA 3D0OA 2JD0A 3AU9A 4RPGA 5L9AA 5I7FA 4A5OA 4M86A 2QX7A 4DRYA 2Q50A 3JD3A 1M2WA 3JYPA 3QQPA 3R6DA 4CM5A 1WMAA 4GX0A 1HSZA 5JY1A 1IHYA 3QWAA 4DYVA 1PJTA 3WYCA 1RWBA 1SPXA 3ZWWA 2PTGA 4PVDA 3WYBA 2C59A 4RVGA 1HDRA 4Y98A 5JXWA 1YO6A 1IZ9A 1V6AA 3LLVA 2NTJA 1N1EA 4MVJH 4KP7A 2Y93A 3DQPA 4IDDA 4WEOA 3FI9A 4BO8A 1PGPA 4MP8A 1FF9A 3PLRA 4NBWA 3SEFA 1T2DA 2VZ8A 1WW8A 5KNLA 5EINA 2QQ5A 4YJGA 4Z3DA 2OZPA 2ZATA 3CPSA 1P74A 4BQRA 3HDQA 2WE7A 4UAGA 2GASA 3BMQA 3BTVA 3HE3A 2XXJA 3CZMA 4DPKA 2C82A 5FEUA 1PJBA 4BS9A 2WJPA 3ORFA 3KM0A 1PJQA 2GN9A 1CYDA 2FPGA 3V1TC 4MVJD 1HETA 2AW5A 4PG5A 5CEFA 1Q2XA 1BTOA 1Z74A 3L07A 4PLVA 3WSVA 2P5UA 4YAGA 4Q3EA 3F1KA 2DFVA 3H9JA 3O26A 1NP3A 2RIRA 2X0RA 1W0CA 3GG2A 1I2CA 2Y1DA 1QLHA 1NVGA 1DJQA 1EMDA 4IQGA 1LQUA 3E6AA 1ZCJA 2UAGA 3RWBA 1KVQA 4BIIA 3KHUA 3PRJA 2O7SA 3U09A 5A9RA 1S7CA 1JKIA 4A73A 3CZRA 1UJMA 4UUOA 2PD4A 1LDEA 2BI7A 3PDJA 4IS2A 1K0UA 4S1VA 2RHCA 1LRJA 3D7LA 1VE9A 4LRSB 4WK6A 4IXWA 4ZHSA 4DUPA 2DFDA 1T1RA 1Y1PA 3WGGA 4AG3A 1NFQA 4Z9YA 3I9OA 4HFNA 3I9LA 4R41A 4EBFA 3WGOA 3SJ7A 1LI4A 4DA9A 3JQEA 4I8XA 4WLEA 3ZWVA 4B7XA 4A0SA 3UHAA 1DDOA 3GVXA 1V3UA 1B16A 4E2YA 3ULKA 4BO4A 1E3IA 1YOVA 3DZJA 4O5OA 3RUDA 3ICCA 4Y6SA 3DAPA 4W4TA 3E03A 4YT2A 4NZ9A 2WE8A 1CEQA 3BIOA 5FYDA 3WIDA 2ZYAA 1HE5A 2Q49A 3AI3A 5C37A 3BMOB 4NK4A 5KJFA 4HNGA 4B8WA 1V8BA 1FDTA 4L73A 3GVCA 4QTZA 2BFOA 3ZU2A 3DOJA 1I32A 3Q11A 4TRNA 2A94A 4ZVVA 3PHHA 3G3EA 1BGVA 2VUTA 5JC8A 3ZU4A 3VAZA 4O6VA 2GPTA 5T67A 3JD1A 4Z6KA 3UXYA 3LF1A 2H9IA 3EUWA 4YAJA 5ITWA 2JHGA 1IULA 1R6DA 1JKFA 2C7GA 3FRJA 1O5IA 2E37A 4XQ9A 3IL2A 3SC6A 3UVEA 2OUIA 3GT0A 3WJ7A 3DR3A 4MDHA 4B79A 3GZ4A 5BQFA 4U6QA 3C3XA 3D4OA 3FBTA 3GEGA 3PYXA 4OM8A 5JAQA 5H81A 5CPFA 4ZQFA 4DTIA 1XKQA 2I6TA 5A05A 1ENZA 1P9LA 4WCFC 1E7QA 3CMMA 2VUSA 5DF1A 3AU8A 1BDMA 1U4OA 1YWGO 3FR8A 3R3JA 2RAFA 1F06A 3QVWA 4OMUA 4IPTA 3DBRB 2EIHA 1PZHA 2J3HA 5I7VA 3HUDA 3LC2O 3GNTA 1ZMOA 2D59A 2EP7A 1LSUA 3GA0A 3H9EO 3I83A 1U4SA 1U8XX 4UEJA 1NQAO 2EHDA 1B0AA 4RVSA 1EDOA 1VI2A 3L4SO 4J4BA 4B4WA 4L76A 4H15A 1D1TA 2A35A 3UUWA 1O95A 1K3TA 1V3TA 1Y8RA 3HFSA 4U0KA 3NEPX 3OM9A 4J2OA 4RPLA 4DIBA 5L45A 4E5YA 2V7PA 3KO8A 4BO5A 4WNCA 4NFYA 4GMGA 3VZSA 3BTOA 2PZLA 3LF2A 4CMJA 4QX6A 1FDUA 1ZW1A 3V2GA 5KWEA 1UUFA 2B4QA 3ICPA 3RD5A 4ZU3A 3TOZA 4CMCA 3GOHA 3ZU5A 3U9LA 3TFOA 1PJ4A 2OP1A 1VJTA 3ETGA 2EGHA 1P31A 4PLYA 4CM4B 4EUEA 4YJFA 3PLNA 1R0KA 3C8MA 4PLGA 4AVYA 4IM7A 2AE1A 5G4KB 3V5NA 2JD1A 1RKXA 2NU9A 4MP3A 3M1LA 2A92A 2RH8A 4ONEA 4PLZA 1KC1A 3LYLA 1IE3A 5GZ6A 4IIUA 2QIOA 4GX2A 4R3NA 4NMHA 3MJSA 2NV6A 3MCVA 3OA2A 1V0JA 3D3WA 5IDQA 1ISGA 3WG9A 1E6EA 3INTA 1V9LA 5HA5A 4J2HA 3NTQA 1XGKA 2C0CA 1QYWA 3PVZA 2PFGA 3RU9A 1F0YA 3R0IA 5A9SA 1YXMA 1EK6A 3KZVA 1I3KA 3JD0A 3QE3A 4KUGA 4S3MA 4WCFA 1R4NB 3GUYA 4YRDA 4AJNA 3ZW8A 4UVHA 3RUEA 3H9GA 4XGNA 5ENDA 3QY9A 3FNHA 4E5NA 2C29D 1H93A 2I65A 3RFTA 2E48A 3LK7A 3U5TA 5AXDA 1OMOA 2CVQA 3JQ9A 5AOVA 3SVTA 2YJZA 4CV0A 3C1OA 4MKRA 2VTEA 4PG6A 3OIFA 1I3NA 4R54A 4CLXA 1ULUA 2O3RA 3AUSA 4R3WA 1QYVA 3DL2A 3MWDB 5T57A 2ZIZA 4PRLA 4YJDA 3WBFA 3ZHYA 1M66A 3QV1A 3WGQA 1E3EA 2LDBA 4URFA 3EYWA 1MG0A 4BNHA 1WNTA 3L4BC 2VHXA 1JWBB 4XJTA 3PHIA 2DAPA 5DCUA 3ROPA 4TRJA 4FFNA 5A9SB 3UCEA 2B4RO 3ANMA 4M55A 1H6DA 5DBFA 1E3JA 1I10A 2X9VA 1U7HA 1JVSA 3WS7A 1GYQA 1YDEA 2DTEA 4YPOA 5JLAA 1UR5A 1R0LA 1DB3A 5KVSA 1OC4A 1Q7GA 1E3SA 4A26A 4XQGA 2QZ9A 3W1VA 1C0KA 3GGPA 1E6UA 2W8ZA 1LRLA 2YHIB 2FPPA 3JQ7B 3ZDFA 2FOIA 1O89A 4CQMA 1WAMA 5A3VA 3U4HA 2C07A 3GDOA 3PWSA 1R12A 2R6JA 3ZWBA 3HDYA 2C2YA 4BO3A 5CG2A 1HE2A 2NVWA 1Q0HA 2IXBA 4FR5A 4CV3A 2GD1O 5KOIA 4KDFA 1A27A 3F47A 4BKQA 5BNTA 2CFCA 2B69A 4RZIA 5I7SA 3TWOA 1LDBA 2FP4A 3GMSA 3I52A 1P33A 3C1TA 1H2HA 3P19A 3ASVA 9LDBA 3B70A 2X0NA 2DBVO 3HSKA 2WTBA 4XIJA 3DTTA 4LRTB 4XGIA 5TGDA 1BG6A 1E1KA 2EEZA 2Q2VA 3ETEA 2UV8A 3NDRA 2E6UX 3HADA 4F3YA 1PJLA 3BXXA 2HLPA 2HCTA 1CQJA 5KJ6A 3GG9A 4DIFA 5U4QA 4N5MA 1Z7EA 5A04A 1XDWA 3I5MA 1Y9AA 5BSGA 5JY6A 3E8XA 2RBEA 3GF4A 3ZHZA 3JYLA 5JDCA 1UP4A 1FDWA 1UXIA 4HFMA 4AJIA 4WJZA 1RPNA 4J91A 3PJGA 1EDZA 2PNFA 4RPHA 5DCYA 2Y68A 4RORA 1PEDA 1SBYA 2OFPA 5TT1A 3SC4A 4CM3A 1RYEA 1LDNA 1YGYA 2CVZA 5B12A 2VRCA 1UP6A 1NFRA 3FR7A 1ZO8A 3OFSA 1LBEA 4F45A 4J43A 2IYPA 2E82A 3PXXA 3L0DA 1A71A 2WYWA 1ONNA 5F1PA 1GYRA 2C20A 1ZSVA 4ZQEA 1F8FA 3S8MA 3Q2KA 4BO6A 1PQWA 3BMNA 1TA4A 1A4IA 3V1YA 4FQ8A 2VYVA 1JVBA 4YVFA 1XCBA 4AJHA 4AJLA 1DIHA 4D45A 5H82A 2DC1A 3ZV3A 1DHTA 3WGZA 4NK5A 4PZCA 3ZNOA 4IUYA 1A7KA 1DRUA 2G82A 4OQZA 2B5VA 3O38A 3RQSA 3ON5A 1MLDA 4JNKA 4GBJA 3JQBC 3RUAA 2HDHA 3N74A 1WDLA 3H65A 4J7XA 3JQDA 3FBGA 3TRIA 4L75A 4BV9A 3ZV4A 4DIOA 1ISMA 3HQ4O 3OHSX 3FWZA 4DQVA 3IP3A 1MFZA 4OOEA 2Q99A 3G17A 5ER6A 3VHRA 4WLVA 4ZRNA 1Y7TA 3W8EA 2I9PA 3I1JA 4LGVA 5U9CA 1Z73A 4CPDA 3OIGA 4WCDA 1YB5A 4NG5A 1KEWA 4RGBA 1D4FA 4D46A 5CFZA 1E1NA 3BMCB 3BHMA 4BNJA 3GRPA 4E21A 3D5QA 1FXSA 2YV3A 2WWRA 5JMPA 3WDSA 3WFJA 2GZ3A 4Q9NA 2YHIA 1GV1A 4B4VA 5TSDA 4B3JA 5KCZA 1LTHR 3ENNA 4FPXA 1R0SA 2X86A 4WLNA 1BXGA 2UDPA 2NUAA 4TRRA 4XIYA 2CVOA 3U0BA 4PG8A 1YBVA 1UDBA 3ASUA 3GN1A 4GPD1 1P1IA 1SB8A 4PG7A 5IF3A 1XSEA 3VVCA 1VSUA 2JFGA 4EJMA 4TVOA 4JJFA 3AFMA 3CKYA 1TT5A 1ZEJA 3K31A 3PIIA 1MG5A 5IFLA 5DULA 2YHUA 3S2IA 3E5RA 3VH2A 3OIDA 3TZ6A 3QP9A 4M89A 3W4IA 4N18A 1P1RA 4ND3A 3DBVO 2DUWA 3Q9UA 3BA1A 3DOOA 5IDXA 3DBHB 2X7HA 4I1IA 1BMDA 1T26A 4I9UA 2QW8A 5JPIA 4IDFA 2D3TA 3Q1LA 1IB6A 1WZEA 1UXJA 1ENYA 4WNIA 1CERA 2I5PO 3PHLA 5AXBA 3STHA 3OJEA 1GZ6A 3WGIA 1AXGA 3NV9A 1EVZA 3PP8A 2NQ8A 4E3ZA 4CLOA 4BHTA 2VUUA 2V6MA 4JBHA 5T8KA 1PJSA 2XPCA 5HM8A 1GUFA 3UFXA 1MP0A 2TMDA 4E30A 4EGFA 2AXQA 3JQBA 2POQX 5TC4A 2FMUA 5THKA 1XU7A 5F1KA 5EPOA 2P9CA 1AGNA 4EJ6A 4HFJA 5L7YA 1FK8A 4ZICA 4PG4A 1NASA 1VM6A 1I3LA 1Q0QA 2FPIA 3BYZA 1JU9A 1WMBA 5A1TA 5EIOA 4BMSA 4XA8A 4FFLA 3OJFA 3WMWA 4PCVA 1K89A 3HWRA 2A9FA 1O0SA 3PYMA 1GADO 5CG1A 3I9KA 4NFSA 4U6SA 4D3DA 3QRWA 3GQVA 3SLKA 5JYDA 2VZ0A 1DOHA 5DCWA 2R00C 2JCXA 4ALJA 4NDNE 1JAXA 4FC7A 4DBVO 4G65A 4EJ0A 3NDIA 4BOYA 4QT0A 4L4XA 1ISJA 3BAZA 5IXYA 3B1JA 4XRRA 5THQA 4DREA 2YV1A 5GZ1A 2H63A 4O63O 4NR0A 2AA3A 3GDGA 4R1NA 1A9ZA 3D1LA 2WEKA 1KY4A 4MVJI 2ZYGA 1B8PA 1KS9A 2VWHA 3OF2A 2DQ4A 4BB5A 1QORA 4E31A 1BDBA 1VSVA 5IJZA 1Z82A 5JNLA 4HADA 4ROSA 1EUZA 1OC2A 4B7UA 2HK9A 3DZKA 1ZSNA 4UVDA 1IZ0A 4PLPA 4AL4A 4JBGA 1T2AA 3LC1O 4XCVA 3ZNQA 3ZZNA 1PL7A 3QLJA 2ZTLA 2DT5A 4BKOA 3P7MA 3OQ1A 4OYRA 5MGBA 5CDGA 4ND2A 4N5NA 4E5PA 3G0OA 5DOZA 3IC5A 2GNAA 3VTFA 4CMHA 1R37A 4XYMA 1N9GB 1T2CA 2GO1A 4XJSA 1WXDA 3AUTA 5JW6A 5L95A 4FC6A 3AK4A 4FN4A 1M6HA 1WDMA 1T4BA 3IS3A 4ILKA 1EEHA 3NJ4A 1G6KA 1YQGA 2QHXA 4NIMA 4KTVE 3H4VA 3K73O 1H0KA 5JO9A 5IN5A 1NVMB 2HMVA 1JLLA 3F4BA 3DBRA 4BMNA 1H6AA 1O6ZA 1N5DA 1GD1O 2OP0A 4NU6A 4CMIA 3GEDA 2BELA 2AQ8A 1OBFO 3MEQA 4CLDA 4CQLB 4FBGA 2CZCA 4FCCA 1PGNA 4FFOA 4R51A 1DRVA 4GKVA 1XR3A 4CM8B 3JCZA 3KBOA 1YKFA 1C0LA 1VC2A 5I9MA 2JD2A 3NX4A 1GCOA 4MVJF 5B37A 3GAZA 1OZAA 1CJCA 3PFFA 4UEOA 2PZKA 2YV2A 4HNHA 2BFPA 2C54A 1FDVA 3IQDB 1NBOA 3OETA 2HK7A 1NX6A 3WYEA 3NKLA 2Q1TA 4DVJA 2GZ2A 2YUTA 2FRDA 3H2SA 1PJCA 3I23A 3I4FA 5BT9A 3TJRA 5J23A 1U8FO 2G1UA 3RASA 4K6FA 4BB6A 1U3TA 5JAZA 1B15A 1DLJA 4H16A 2EKPA 1ZXLA 4RF5A 4RVFA 4CODB 4H3VA 2B0JA 3TZKA 3L9XA 1AHIA 2JAHA 2O3QA 4P38A 5KVQA 3TN7A 4D42A 1DRWA 5JAIA 3A4VA 2ZKLA 1N2SA 1HDZA 2EERA 2J5RA 4JGBA 5TQVA 1DC3A 5F21A 3VPHA 1WWKA 4YB8A 4IJWA 5FI3A 2EWMA 4E12A 3B6ZA 3ETDA 4Z9XA 4IMPA 1DBVO 2AQHA 4R68A 4LCJA 1KOLA 3QA9A 1HT0A 4P4GA 4XZ3A 4CLRB 3MZ0A 1GU7A 4WCFB 3WJAA 1KEPA 3CIFA 3GVIA 2B83A 4BGVA 3WXBA 2B4TO 3F3SA 3E1KA 2C2XA 2E4AA 1IUKA 5U1PA 4JXKA 1KVTA 1J6UA 4KTTE 2J3JA 3WSWA 1PGQA 1U28A 1GL3A 1NYTA 4J1SA 3FNFA 2D0IA 3H7AA 4OSPA 2FN7A 1PZGA 1Z45A 5ADHA 5L53A 4E0BA 4I9HA 1RM0A 3ZV5A 5G0SA 2JCVA 1ORRA 3HG7A 4AJ2A 4NPCA 4FIZA 4CMKA 2YQ4A 4JCOA 3VZRA 2NQTA 4IJKA 1J4AA 1LLCA 1PGOA 3AUUA 3DTYA 2FR8A 4ESOA 3DONA 3VPSA 4MIYA 4CR7A 4I5DA 3L6DA 3TZHA 2VHZA 2BLLA 3F5QA 3DAFA 3HZZA 1BHSA 1QP8A 1EUDA 5G0VA 3VDQA 2ZTMA 3Q9NA 5DBGA 4O59O 5TS3A 4DQXA 3U4DA 3INRA 2V6GA 4LW8A 5COQA 2O3UA 2W98A 3HN7A 2EXXA 3COSA 1MXHA 2HU2A 1LJ8A 4OOFA 1G0OA 3WQSB 3UCXA 3ITKA 1C0PA 5TX7A 3ZWYA 1GUYA 1V35A 3LSYA 1OFGA 2P5YA 2HMTA 1PR3A 3D5TA 2OXIA 3MJCA 4ZQHA 2FR1A 4AJJA 1WPQA 5CDTA 2Y1FA 3HDHA 3RUFA 5B4UA 4N7RA 3W4KA 2X0JA 3PGJA 5HBRA 5A5FA 5I9LA 1C1XB 3VKVA 4N5LA 5KJ1A 2VRCD 3O4RA 1QSGA 3FPLA 1SNYA 3QW2A 1MC5A 3S2EA 4CMEC 1ZH8A 1FJHA 1DFGA 2DU8A 3WGTA 4YT4A 2O3SA 2O50A 4ZN6A 1F8GA 2I3AA 3W8FA 4GI2A 4AJKA 3PHGA 2NVUA 4NQZA 4CUZA 1P1JA 5A4DA 4PZEA 3K92A 3A06A 1NTOA 5DP1A 2Q4BA 2O3JA 4R4JA 4UUPA 4QXMA 1ZK3A 3W6UA 1QXSA 4OQYA 4TZTA 3KSDO 1VKOA 4I5FA 4OIMA 1TEHA 2JCYA 3VPFA 4WOJA 4BNYA 1M76A 3HJAA 2ZJ1A 2VHWA 4G5HA 2QZZA 4R9SA 2C5EA 1L7DA 3LC7O 3DOCA 3WTBA 2F00A 1YBMA 2NM0A 3CH6A 1E7SA 5T64A 5LCXA 5MDHA 5I8ZA 1PZEA 2D8AA 1X7HA 3NDJA 4K26A 5ICSA 4FJ0A 1YQXA 4J0EA 1NXQA 4XKJA 3RC9A 4MOWA 3H3FA 4PGFA 3KUXA 4E2XA 1LXCA 1U9JA 2YZ7A 4KWIA 5LC1A 3EK2A 3DDNA 4CR8A 1NAIA 5F3RA 3PWZA 4FDAA 4CLRA 4YR9A 1M6WA 4JROA 4GLLA 1JWAB 1LC3A 2X9GA 2IDZA 6ADHA 1YE3A 5G0UA 1E3WB 4OSOA 2FHSA 2UUOA 1GZ4A 1B8VA 1JA9A 1I36A 1T2FA 1YB4A 2IEDA 3HN2A 4JLWA 4KDEA 2WYVA 3JQ7A 4IBOA 4FD3A 1EFKA 1SZJG 3RIHA 3A9WA 1M75A 1YS4A 1GUZA 2VTDA 5IN4A 3OECA 3RJ5A 1BXZA 1T1SA 3AFNA 4CLHA 2X5KO 3IUPA 4BNLA 1GQQA 5DZSA 5G0TA 1LSSA 4BKUA 4CQLA 5L4NA 1UZLA 1QR6A 4OXKA 1T4DA 4JP2A 4EITA 4Q3DA 4J1QA 2BRUA 2V65A 4PIVA 2X4GA 3PTZA 3I3OA 2EF1A 1YONA 1PWXA 4INAA 2HUNA 2QYSA 3F9IA 3IMFA 3QIVA 2X5JO 3RC2A 1R4MA 2J6IA 1Y5MA 1EVJA 4HFRA 1TXGA 1VL0A 1XU9A 2PZMA 4BVAA 5JDIA 5JO0A 5F5LA 1A4UA 4YYZA 5EJ2A 1PS9A 2Y1EA 3FN4A 3WIEA 2Z95A 1I01A 1UXKA 1KVRA 4RF3A 3ZWPA 3O8QA 4O1MA 3CE6A 2EJWA 3G1UA 4H7PA 5DBIA 1QLJA 4EW6A 3ZW9A 3VOSA 1HDGO 1YBAA 2GZ1A 2VHYA 3DFUA 3H5RA 3ONDA 4A7PA 5C5IA 2AEFA 1CRWG 4HKTA 3PK0A 3RUHA 2EP5A 4WUVA 1LDGA 2CNBA 2IODA 2BFAA 4LSWA 2AEJA 4II3A 5G4LA 4CMBA 4D0RA 2VYVD 3Q2IA 4ZRMA 4IS3A 4K1LA 2EV9A 3KV3O 3WTCA 4DPMA 1F14A 3B1FA 4GAEA 2W2KB 4Y6RA 4WE3A 3ZWXA 4W7HA 3K2EA 8LDHA 3VH4A 5CDUA 4GWKA 1BXKA 3MWEB 3GFGA 3DO5A 1G1AA 1KVSA 5JSFA 1VPDA 5B1YA 1ARZA 2PK3A 4YJFB 4JN6B 2X9NA 3U49A 3RROA 4W9NC 3EHEA 4BNGA 4E4YA 1JW9B 4MP6A 2GR9A 2R00A 4RO0A 1GY8A 2Z5LA 3ONFA 3M6IA 4R5HA 2EW8A 3JYNA 4GQAA 1G0NA 2GUGA 1T24A 4ZD6A 2D5CA 2O3TA 4GGOA 4YJGB 1DO8A 1RYDA 4PLTA 1E7WA 4XQEA 2Q45A 1ZK4A 4CR6A 3B20A 3O03A 3AW9A 1GPDG 1DC6A 1ADGA 4J49A 2CUKA 4B7CA 1W73A 4G2NA 4C7KA 1D1SA 2W2KA 3F1LA 3BTSA 5IXSA 1K6XA 3TNLA 1ISIA 1MC4A 3ANLA 4OJNA 4U8GA 2QRJA 1KETA 2QYTA 1X14A 4R69A 1U7TA 1NR7A 3T7EA 4QFCA 5A03A 4E32A 5CEEA 1V3VA 1BRMA 2HJRA 4TZKA 4TQGA 3GNQA 3NT5A 4RVHA 5T8KC 1EFLA 5JCXA 1IHXA 1ISFA 1ULSA 1AE1A 2AQKA 1X7DA 3DBLA 3RBVA 4BMVA 4TROA 3QHAA 1B14A 4M54A 1BW9B 3LT0A 1A72A 4BKPA 1CIVA 1I3MA 2DLDA 5TRTA 2EW2A 5DN9A 3H9QA 3OP4A 3WB9A 4D3SA 4YJHA 5TIIA 4YAIA 4MKXA 2X5OA 3CEAA 3PQDA 3ZH2A 3RBXA 4D79A 2HAEA 2DTDA 3ZGYA 3UN1A 5FWNA 2JFHA 4NBTA 2IZZA 4RDHA 5IG2A 1EQ2A 3WQRA 4IINA 1LU9A 2DVMA 4LK3A 2PKRA 4E5MA 4GKBA 3SJUA 4FFMA 4L74A 2YY7A 4J4TA 4Q3NA 3PEFA 1HYEA 2P91A 2VT3A 4DLBA 1MX3A 2IYOA 3ROKA 1GZ3A 1SO8A 4Y67A 2Q1UA 3HB4X 3H9UA 4L9RA 1NQTA 4OH1A 4Q3AA 1EBUA 3TFQA 3CXRA 3IOYA 3UF0A 3FF4A 1HRDA 4EEZA 3O8QB 3WOHA 4YXFA 4WKGA 1GEEA 4QFDA 4K6CA 1P3DA 2WD8A 3DC2A 3RI3A 4D43A 3P5SA 1JDJA 4RCVA 1RM5A 3GR6A 3PHJA 3ZNNA 3NGLA 2ZYDA 5COAA 4DQUA 4EZBA 3VKUA 4GVLA 3MJTA 5KTKA 1P44A 4XR9A 3GZNA 5F1OA 1WZIA 4E13A 2BF7A 3GAFA 2J3IA 2IEBA 1VKNA 1PGJA 4RZHA 5K9ZA 1MGOA 2PKQO 5BSFA 4J1NA 1WVGA 3ENKA 4W9NA 1VL8A 2Q3EA 3TL3A 2IRWA 2I3GA 2AE2A 3FD8A 2QRLA 4IMRA 1U1IA 2PH5A 1Y8QA 4NJMB 2NU8A 1UZMA 3F5SA 1E3WA 2AHRA 4OAQA 3WLFA 4CV1A 2VNSA 4CM8A 2DKNA 3F46A 4FS3A 4RLSA 2VOEA 2GLXA 5JMWA 4FSHA 4RPKA 3OJOA 4J9UE 4BNIA 4WLFA 1X13A 4UULA
chains in the Genus database with same CATH superfamily
1YJAA 3A27A 1S2NA 2QNBA 4FXPA 3QPDA 4I66A 3U44A 1XPOA 4MUKA 1MD9A 3B9RA 4MA5A 3EVCA 4ND5A 3PIDA 5IJ9B 2WB2A 3NC4A 3PD1A 4HDCA 5CCDA 1NW6A 3H2IA 2QN7A 4KQXA 1CNEA 2PD6A 1OLSB 1KDVA 1SBIA 4DHWA 3GRKA 3OPNA 3NHZA 3SN6A 5C5DA 3UT6A 3ZDAA 3KKNA 1EFUA 1T36B 3JQ8B 5K6AC 3OO1A 2VBIA 1QTNA 4IOMA 2ZQZA 1VLMA 4EHIA 3ZWAA 1D2GA 3PQEA 4AZVA 2ZK7A 3HEAA 3P2KA 4FGSA 3IO3A 3RRNA 2UUAB 1X0XA 2HL6A 5ITSA 3WI7A 3ZGLA 1S8OA 2I6SA 1TD1A 4L95C 2ZI9A 5K99A 2IJGX 1SHZA 3DLBA 3PC6A 3WICA 3AFHA 3DCYA 4CJXA 2ZRGA 2ZR7A 4U8HA 2BT4A 3I6MA 3RC7A 3KSUA 4DCUA 2C7VA 1NX9A 1B2LA 1DKOA 1PFKA 1H2AS 4W1RA 2ASVA 2NU7A 3MERA 4FFBB 4MPRA 4U5QA 3V8BA 1CULC 4Q12A 4LC1A 3R8CA 4ARUA 1TEVA 2BFDA 1Y3AA 4U4AA 3URKA 1KK2A 2ISSD 1WR8A 1TNDA 1QNFA 2QMOA 3U3RA 4BNNA 4R8LA 2ZE6A 4M6WB 4TSRA 5DNAA 4J8PA 3VU9A 4YMSA 4QRIA 5C1OA 4JAVC 2OORC 3NXSA 3SYLA 3B48A 2J0SA 1YI8A 3DYVA 1T36A 3JQ8A 4N0MA 2XZLA 3P96A 1KRXA 2OG1A 3UWKA 3TLAA 3KT3A 4LJ8A 4NICA 1LEHA 3PFNA 4D74A 1ZISA 2FXIA 1TC1A 4PU0A 1N9KA 4YH1A 4CM4A 5HIAA 2CUTA 3I5AA 2HKIA 2UUCB 1GPYA 2IXAA 2OV3A 2AOVA 3AVPA 1HDYA 3IIJA 4M1ZA 1K4YA 2CXQA 2ISQA 3PKIA 5FTMA 3UK6A 3GCDA 6AT1A 5JTUA 4ZAWA 2XUQA 2C2GA 3EVBA 2ILTA 1Z12A 2QX8A 3K1JA 3HKBB 3NV7A 4URUR 4J7UA 4D4KA 3K7EA 2FZKA 4EKGA 4J6EA 5LZ2A 4J3FA 2HO5A 3OCCA 2Y76A 4V0LA 1JXQA 1M2GA 7MDHA 4IHKA 3EAGA 4FFRA 5HFJA 5EHQA 2ZJFA 3FNRA 4FFBA 1QP4A 3F5DA 2ZSHA 4UAUA 2NVBA 3TW6A 2V9PA 2J30A 2CNWA 2KSQA 2XADA 5ALPA 3ZC3A 1O0BA 2PWZA 2O8EA 421PA 3GGOA 1OAOC 5BN4A 1RACA 1U0JA 1LS6A 4MQ6A 5YASA 1UMBB 3K9CA 4I36A 4YONB 1C7FA 4PLFA 2GN4A 1TU3A 2GMWA 3DLIA 1JSZA 3IIEA 5E1MA 2QVZX 5BO5A 1T5TA 4GR9A 4KPUB 1VG8A 3CLTC 1FFDA 3A14A 1MHPA 4WNAB 4YDHB 1VG0B 2LP4Y 2OCLA 4YEDA 1TTQB 1FLNA 2FGKA 3VR6D 4OGLA 4DXHA 1ZD3A 4DCMA 4CUKA 4M46A 1PV1A 5JATA 1YR7A 1CEEA 4ETMA 1NPTO 5EXEA 4YQYA 5KVCA 4WLOA 4E07A 1C30A 5K4GA 4HNTA 1XN1A 4IQ0A 3E82A 4FXOA 4LZJA 2EZTA 3F97A 4JLAA 3OCVA 2VHCA 4DLAA 4MKZA 3PDUA 3STXA 2FA9A 4LXQA 3V1UA 4AZWA 2GYUA 1IJBA 3T38A 3KS9A 2JGAA 1SRRA 2P79A 2PS0A 3MWKA 4M0MA 4MUNA 4O0LA 4X71A 2LBPA 5E9JA 4OYYA 5I7OA 4MJ7A 1ESMA 2PH7A 1QH1B 4HL6A 3Q7TA 1R4MB 4YXWD 2PZGA 1EIZA 2ZR9A 3FJOA 1A5ZA 2Z8YM 3HRHA 3NHMA 4MEBA 5CT4A 5CVJA 3OY7A 1IY0A 3S2FA 2V45A 4DLTA 1R0YA 5CP8A 4MYDA 3GXBA 2PLRA 4IDBA 3ESXA 3OX3A 5IDYA 1CVLA 2W4IA 3DHNA 4NOKA 3UT5B 2AZ4A 8MHTA 3U7EB 1QVAA 1OXKB 3NT4A 3FKQA 1XWFA 1YRLA 4G1BA 1R18A 2YWJA 4XCXA 1RCFA 5ARCA 4EGSA 4RA6A 1GV0A 1D2HA 4LHWA 1E5DA 4CKBB 3QSYA 4JL8A 2YTZA 4ZYXA 5CB4B 4N3CA 2DR3A 3F90A 4G5QA 5IZCC 1YJ8A 1UAYA 1T5LA 2AC4A 2GYYA 4OHYA 3TGWA 4BVHA 1ZCZA 3WK5A 3BOSA 3PNQA 1KU0A 3DZGA 3K9GA 4FKMA 2P1DA 1K4KA 2GXAA 1ZW6A 3T5BA 4ME6A 2JFOA 1TIBA 3UK2A 2Q2QA 4QBTA 4FT4A 3I6IA 4W8HA 1U8EA 3QE0A 2XSZA 3WK9A 4YREA 3BD8A 3LUKA 3KPVA 4YUYA 2BFMA 2WT8A 1IQPA 2EFHB 4A82A 2LCIA 4GT1A 3MAGA 1MOQA 1MTZA 1XL0A 2GPAA 5DX8A 1Y80A 3RQIA 3JQ9C 5G2OA 4HUQB 2JLSA 1DAMA 1NNUA 4KAFA 3TNJA 3DUFA 1HRKA 3ETCA 1XTKA 2AUMA 3ZLTA 1ODSA 2KHZA 4FSDA 2CJPA 1TQHA 4A1FA 3NTLA 5LWHA 3N6XA 4DQLA 1QG4A 3PZBA 3IKLA 2IZ5A 3AF2A 4YRPA 4MI1A 1E3DA 4CGZA 3RVSA 1NBAA 1QVVA 5JC1A 1LLUA 3BZBA 1FEZA 4DGSA 1J0CA 1FNSA 4XR4A 2H3EA 4XTCS 1U3UA 2HA4A 3QY0A 1RFGE 1E4EA 3WC4A 2ZRDA 3NNDA 3T99A 4A8TA 1AKEA 4QJIA 2WZDA 4MULA 4O4JA 4UFNA 2LV8A 2AHOA 4ABYA 1QYDA 3TBFA 4QTUB 5KREA 3CH7A 4UEQA 2J7KA 1JFLA 4JJ4A 2G83A 3OQMA 1ZNYA 2AR7A 1N4AA 1Z37A 2B61A 4AP6A 3KK0A 1GKUB 1ACJA 1YVPA 1N1MA 1T29A 4ARZA 1CB0A 2J31A 3OT1B 1JKJA 2RKWA 2YFHA 4ZCSA 1DEHA 1KFEB 5FWDA 3C3CA 2NNLD 1ENOA 4HGYA 2IZOA 5LZ9A 1DFHA 2OC9A 3DQZA 4H7FA 4HH1A 3PXGA 4MR7A 4AX4A 4DCPA 5FX2A 5IAOA 3NI2A 3IEKA 4Q0MA 2UXDB 3ZIDA 2C4VA 3QENA 3C3KA 1MFPA 3CMCO 4B3BA 1BO6A 2WIJA 3ADPA 3K4QA 3IBSA 4EDFA 4MWOA 3JVDA 4RFSA 5TB5A 3T1VA 3SFZA 1A97A 3AOGA 5A5VA 1U6KA 1JR6A 4L3VA 4PS0A 4MO2A 1W96A 2V7UA 3A25A 3OMLA 3NOQA 4KBYA 1Z7BA 1NWHA 2M9MA 3EZXA 3I04A 4OY3A 4BVFA 4D26A 1O6CA 3VR4A 5KKAA 2PZFA 4GOOD 2JCBA 1LK5A 3I2IA 1JLMA 2Q4EA 1P0QA 3FTNA 1UBJS 2PUAA 3U4IA 1NWCA 3KOYA 4CTJA 1Z63A 2I66A 2PUCA 4OUDB 2J7PD 5I9TA 2JAQA 1JFFB 2JLXA 1V8DA 1GFSA 1CQPA 1X80B 4N41A 4X0EA 1GRNA 5LQKA 2VDPB 3OG9A 4FJ2A 1TVMA 1JIKA 1SVOA 3OZAA 2PGDA 4QL3A 2O8FA 2AJTA 4WDRA 4WPGA 2CMKA 2QTBA 4Y8VA 3OT1A 5HIMA 5KYKA 1KEEA 1LZLA 1QRAA 3WMGA 2HWUA 1DKPA 3QYAA 4B7AA 4YV7A 4A3SA 2ZTUA 4Y2TA 5AI8A 3DEFA 4NRDA 1JJBA 4HXEB 1KC3A 2G25A 1UH5A 4KOEC 5HF8A 4IDCA 4MB6A 3OC0A 5GM2A 4EGCB 1W5SA 1DIBA 1ZK0A 1U0BB 3BF7A 3JWGA 1VL5A 2DBRA 4B46A 4B76A 5K3OA 1TKCA 1GQRA 5K0FA 2X2PA 3CGWA 3OPYI 3AZQA 2C4WA 3C1AA 3AWDA 4C6TB 2AG5A 2L17A 4NMWA 2Y1XA 3AEYA 2HMAA 2C78A 2H5IA 3DO6A 1PK7A 1PUIA 1V45E 2DHQA 3LIPA 4IF6A 4R1TA 4XUGB 5BMVF 3E8SA 5DBHX 1DTSA 4Y0VA 5C1PA 3SR3A 1QGUA 3U5ZB 1U0OC 1F1BA 4PPYA 1ORHA 2J67A 3M5WA 5KWIA 2LWIA 1CQIA 1K4MA 2NXCA 4UHFA 1XOIA 3GRFA 3OZTA 4PO3X 2VZ9A 5JAHA 2AMFA 2C4KA 3TXYA 2F2TA 5JAMA 1NN0A 1EB8A 1EBBA 4EKIA 4JUBA 2OGZA 1LPMA 2QSUA 4D0SA 2VVTA 2IX3A 2DM6A 5HCIA 2A67A 3GV0A 4PHFA 5FUQA 1V41E 2DPYA 5K3AA 4ZHQF 2P4HX 4RK6A 5BR7A 1FDRA 2OORA 1TA0A 3Q3IA 4J4HA 2DHDA 3CUWA 2IIQA 4RMIA 1KAOA 1BSVA 3E05A 3ICVA 1NPDA 1ACMA 2YV5A 5C3MA 5G1PA 2Y1OA 3FHCB 1QV6A 4PHCA 3JTMA 4EJSB 4LVUA 3ADDA 1G3QA 4ZIRB 3N9IA 4H6XA 2YYYA 5KQLA 1G6HA 4MQLA 1C4XA 3FCCA 3AEKA 1XKTA 1NJ2A 5LQCA 4QG3A 2A4KA 1DXHA 2HIGA 2JGIA 2Z6VA 3E0QA 5LMZA 3DEYX 4TL8A 4EI9A 3PWKA 3VZDA 3GPCA 3MM4A 2X0EA 1DKRA 4KYIB 1DP4A 1PS0A 2H4WA 3W8RA 1CSEE 4MS4B 3GBPA 4WK2B 3O83A 2VWGA 2JC3A 4D4MA 4D3ZA 5KKCA 5FD8A 1LW7A 2Y1GA 2HSWA 4H0CA 5DH9A 3WYGA 1YFJA 3BMQB 3SKXA 1D3AA 1FCJA 1JTVA 4KLAA 3ZHBA 4ID9A 2COKA 4CMIB 5JRDS 1QC5A 4BO9A 3FOZA 3I61A 3MBKA 1XMQB 3VO2A 3NAGA 1FSGA 2ARKA 4D2IA 2EG9A 2FSPA 4BMYA 3CN9A 1ZM9A 2ZCVA 1ZUIA 1ZOIA 4R1SA 3U4MA 4N7JA 1G5RA 2P4SA 1DAHA 1T3ZA 3I39X 1JQKA 4HDNB 1SKYE 1JV2B 4PC6A 1NY5A 1DDGA 3SG0A 3L1HA 3F5FA 1P2UA 1U80A 3DEIA 4M22A 1L8AA 1E5LA 2F67A 2GK4A 3KE9A 3EZYA 3IP7A 4PHGA 3UH1A 4FM9A 2UUPA 1SURA 1W4AA 4LSMA 2JLYA 4DR6B 1O6BA 3RJTA 4ZU6X 4OXNA 3VSBA 2OZLB 1I7SB 3H9BA 3P9QA 5BSMA 4AMVA 3SF8A 3DVAA 2FQQA 2QXTA 4L27A 1W1IA 3A6KA 3W0LB 4RL6A 3RH0A 3W78A 1Z88A 5AXAA 3ZWCA 1BFUA 3S8YA 4WX2B 4MW6A 3CVYA 3FWKA 3GW8A 2BAGA 2EJUA 2H08A 4BNTA 4UDYX 1MABA 1VBFA 3U6KA 1SFRA 1HL3A 3G7NA 5ALDA 4WY8A 4X8LA 3HDJA 4HYQA 4RK4A 4TTQA 1V5GA 1L7EA 3VTZA 3VSEA 3W5DA 2ZRBA 4WHMA 1P0PA 2VCEA 1DT5A 3PNSA 3LT2A 3SIXA 2UUBB 2PXHA 3GN2A 1UF9A 3AL3A 4AY3A 2J0VA 4FYMA 3SX2A 1TE2A 3CR3C 3DBLB 3MB8A 1KRWA 5HMLA 5ICGA 4KRFA 1H3NA 1MV5A 2ZB4A 1SXGA 5L7TA 1HTBA 5FUBA 2C2MA 4YN3A 3GCGA 5GVSA 3PPYA 3NTXA 4QHYA 1D2AA 1ML3A 1Z22A 4MS1A 2CUZA 3LQRA 5KYTA 1FVXA 1HDXA 2W2XA 3Q8WA 3UMMA 2CDCA 4EYKA 2PLWA 2AOXA 3AY6A 3DKRA 3G2OA 3L0PA 3DVRX 5FADA 4EYEA 2O1XA 3QPWA 1WMEA 3WQQA 3OICA 3R8XA 1DXQA 2MJLA 2NZXA 2OKCA 2BD0A 2PD3A 3BJMA 3C1UA 3EQ2A 4PZDA 4B74A 8ADHA 1P8JA 3MTEA 1W2HA 3QVSA 1PJRA 1CHNA 4I1VA 4UNNA 2F3RA 2B1RA 1W29A 3KKEA 3V4PB 3UK7A 2JANA 3O6VA 2FFQA 1U5BB 5CB4A 5FNZA 1SQ0A 4KJXA 1GRQA 4HI0E 3RUIA 2XZPA 3UAGA 2NU6A 4F5EA 1YJBA 1PK8A 2PUBA 3IT0A 4UTVA 3GHHA 1E2FA 1Z56C 1DEOA 4A8HA 2WA1A 4N4AA 1K92A 2YJTD 5LP6A 1JLSA 4P31A 4A91A 1DWQA 2X42A 2W22A 4A36A 2FPXA 1MNAA 1C14A 2OHIA 5CB4F 4NOMA 3VZQA 4KXXA 5C4IA 1N5KA 2C3OA 3C48A 4IIYA 5FUWA 3I34X 1YCDA 4TSKA 3VJMA 3EG9B 3K5WA 3LBIA 1THMA 4MINA 3JQFA 3FYUA 1P0FA 4KVFA 4O1IA 5K0SA 1A9OA 2O7QA 2PMFA 5SZJA 4YLYA 4FYYA 1R6TA 1WLYA 4E08A 1T5HX 1Z8HA 1VHQA 1ZM7A 3EAQA 4KQCA 4QHTA 2FLVA 3EUEA 3UXHA 1VA4A 3I5XA 3KV1A 1Z4OA 4CRWB 2WWIA 1LBTA 4G5RA 3GLGA 1ZESA 5AJTA 4O3MA 2KB0A 4LXYA 1EXMA 2EKLA 1M2NA 4R5MA 1G8HA 1XNGA 3BKWA 3CSUA 4KEAA 1AXEA 3GEHA 2D13A 1WP4A 4BB9A 1HYBA 1V7CA 3PEEA 1KZ6A 1VMIA 2EJTA 2YJ3A 2CDAA 3B36A 2GBGA 2LD4A 2RGRA 2KLHA 4QA9A 2I33A 4IH1A 1CS0B 3HYRA 4AY5A 2HF9A 2ZEJA 5C35A 2FEXA 1C1XA 1PT5A 2GPWA 3NFRA 4AY4A 2NSDA 3K3PA 2DCMA 3UAOA 3SZMA 2LNDA 5FR2A 1SELA 3UV3A 3U31A 3RSGA 4C2UA 1U7DA 4GI3A 1DIAA 4H18A 4JR1A 3LXUX 5D01A 1M67A 2GERA 1T5DX 2RGNC 2XOXA 2SKDA 3G8YA 3IKTA 4QDZA 2FRXA 4II2A 1Y9ZA 2XNDA 3SXPA 1B0PA 3L8EA 1W19A 2FR0A 4J0QA 4UBLA 3ZCQA 4DGQA 3VFDA 1IMJA 2HB6A 2FMIA 3D31A 5IAGA 4RV9A 1QYXA 1T9ZA 3T3MB 1U0GA 1J22A 1RLUA 3GFQA 1C3JA 1VYVA 2VSYA 5EERA 4CIWA 4LA4A 1HYGA 4HTAA 3TVYA 1TC2A 4D3XA 2Z0MA 4OMCA 2VHEA 1WJGA 3EMBA 5LXTA 5F64A 3NH9A 5FDFA 4Z7QB 1EVLA 2R85A 4EX6A 3HACA 5A4IS 1ABBA 2Z8ZA 4L57A 3D8RA 2BEUB 1H5QA 4FYWA 3BRCA 2BC9A 2HPAA 5AHWA 1PR9A 4S05A 1A3CA 1LY1A 2JHFA 3FUWA 1VKJA 3OBBA 1NATA 2O14A 5E38A 3QX3A 2O0HA 2Y92A 3ESCA 4FGLA 1LF0A 2XCTB 5KDLA 1KJJA 2ZPUA 2RARA 4Q1AA 4DMKA 4AMBA 3F73A 5CNKA 4AK9A 2UYHA 2XUAA 2OBNA 2P78A 1MOSA 3BM5A 1S02A 1DMSA 3DW1X 1Y48E 4RD2A 5G40A 4BUCA 2Y0EA 1Q1AA 2VYQA 3SE0A 2I91A 2VJYA 3EN0A 1KQGA 3M1IA 2C97A 2JBAA 1T2UA 4RY2A 3VU9B 4M87A 4WCVA 2KW5A 3DZFA 1IC6A 3JASA 1TZBA 2PUGA 4PAQA 4KR3A 5A0VA 4N3BA 1KIFA 2H6EA 3HY6A 3TCXB 3TOVA 2H9YA 3D81A 4P81A 3ZV6A 1L5HA 3DE4X 3NT2A 1AT1A 4L28A 4MVJE 5KTOA 3HZOA 3Q40A 2HF7A 3DZDA 4HZUA 5EXPA 3W9BA 2BE9A 4C88A 3ENWA 2VP3A 2C77A 2HT6A 4QO7A 2WQ6A 5LQAA 2DSNA 3SICE 2DH6A 5AQ1A 3PI6A 3A3PA 4R01A 1C0EA 1T4MA 4YQEA 3AIIA 4WN3A 2IYZA 4FYHA 3DMTC 3KD3A 1P6XA 4OXYA 1I7QB 3IJRA 3DGFC 2JAXA 1E5TA 3IAHA 3DOHA 4DC0A 1A9RA 1XIVA 1J23A 1ZRNA 2ECQA 2R8EA 4HY3A 1T43A 4D9HA 1D8TA 1I8TA 1MUUA 1XUOA 2AZMA 2ZYSA 1QKIA 5IBPA 4UCWA 5IAKA 4GKJB 1V1MB 4V0OA 2CMFA 3O9ZA 4D6PA 4RULA 3ZD7A 4IMJB 1RWVA 4IJ6A 1O5OA 3IDQA 3VYTB 4G41A 2GDJA 2N0SA 1XLTC 3VOTA 5AKXA 3JZMA 3L77A 2GDZA 3C3JA 1N5OX 1U94A 4OXIA 4KUEA 3RS9A 3PUWA 4IGAA 5E6RB 2VDOB 3NWPA 1E7YA 2GBLA 3BMNB 1G19A 3VUFA 2B4YA 1B23P 5IDVA 5EN4A 1CDOA 1TKRA 4ZT3A 3OWXA 1WDWB 5B4VA 5K1ZA 2W2LD 3WLSA 2AFIE 4P5PA 1RCTE 3PFGA 4DHEA 4MGKR 1U1EA 5H5JA 3WWEA 4CEJA 3AOEA 3MD0A 1I7DA 5A6VA 4V02A 1SAYA 1EKXA 1WSBA 2R65A 3H6KA 3TM4A 4IQFA 1WKBA 1CDDA 2WHRA 4DV2B 2HRRA 4GVXA 3NHKA 1QDEA 2O8DB 1WB6A 2ONJA 2E4UA 4G4SO 4Q7JB 3SOPA 2V6JA 1G66A 2OLKA 1YVEI 1H9AA 1V16B 1ZGHA 1YH3A 1GQ2A 4GWGA 4PPQA 1WETA 1ONBA 2GKGA 2HTFA 1SULA 2QX9A 3I9NA 4TKUA 1Z8FA 2P5SA 4HDSB 4UOQA 2FYTA 1O8BA 1WHSB 2H2GA 2O4CA 2O05A 2OFWA 1CUHA 3HMQA 2BZSA 2DMRA 2OK7A 1HGXA 3R3ZA 4OG2A 3EW7A 1NI5A 3FX2A 5C7IO 3OFNA 5KYGA 3EOZA 4XD7A 3DFMA 5TE9A 3AM3A 2HOQA 1PVVA 3GJ5A 3JYOA 2IU3A 4KK4A 2D62A 1PNVA 4W82A 4QGHA 1SXJC 1IBRA 2VSNA 1P77A 1ZU4A 5DM2A 4CNQA 3GLQA 3V7UA 4CCAA 2OO3A 5EWMA 2Q5QA 1EVQA 3R5HA 4GOKA 2PUTA 2IUTA 3FDFA 3IPYA 3GRYA 3K2BA 4GSLA 2J33A 1H2EA 2C2HA 1FMLA 2CXPA 3DAGA 4KDRA 2Q4OA 5G0WA 4ZZ3A 2XUFA 3PUIA 4UNPA 4BB0A 4LBWA 3K1TA 3GA5A 2ZXUA 4I9FA 1KP9A 2XWBF 4X92A 4DDVA 4N65A 3QWFA 3MHPA 2I2CA 5F9MA 3UJBA 4ZMRA 1F8UA 3PNYA 4IZIA 2OBLA 5CFNA 3O91A 5K0LA 1IYZA 1KSJA 4WERA 1AVTA 5J5VA 4RETA 2CDBA 4PQYA 1CUBA 1EVKA 1YR1A 1WSAA 1I5RA 3RKUA 4Y2RA 1KE2A 1RAHA 1YQTA 4UBMA 3TK1A 4A10A 3L41A 4YT8A 4MDEA 1FDOA 3OD1A 3CNQS 2QTFA 3HXKA 3M89A 5C3UA 2IYNA 2WQZA 1Q7BA 4YP1A 2W8BB 3EEIA 3TZEA 4UC0A 1R00A 1W93A 3QKRB 4FHDA 2X0DA 4FJ1A 5MN5A 4KWHA 1NZFA 4C0WA 1T6YA 4OLJA 2DSTA 4QD3A 5H68A 2V4ZA 1NF2A 1M8JA 1Z2EA 3IR5A 2GF2A 1N6IA 3KZNA 4RY0A 4BNUA 4KQJA 5LLTA 1X7ZB 1HWYA 1NKSA 3ECCA 3PEVA 4IIEA 1EP9A 2W2LA 3UW1A 2ODPA 4DCNA 1AV7A 2Q5LA 3LOQA 1BX3A 1SCQA 3A31A 4JJKA 4MCJA 1ODFA 1EGAA 2J5KA 4NYIQ 4UUNA 1NQOA 1BCSB 2QYOA 2FEKA 3EZNA 2VDJA 3LC0A 3OM1A 2Q1SA 5IH3A 3RSZA 1JDVA 2OK8A 2P67A 1OA0A 3A3YA 2DQSA 3V4ZA 1LJUA 4BFWA 5IS2A 1L7QA 2C00A 1WF6A 2GESA 1J8FA 1H1DA 4PSUA 1K68A 2WF8A 4MROA 1GTMA 3M5PA 4AXXA 4Z49A 3TAXA 3FY4A 1PR0A 2LDXA 1Q22A 2AEMA 2AR0A 3E1SA 3G9UA 3HY4A 4IGFA 2WY2D 2NU7B 4XUEA 4IDGA 5FL3A 4BWVA 1L5OA 2YHAA 3UMYA 5A1JA 4Y6PA 2E2WA 4PM4A 2O19A 4WBXC 3LP6A 3SVLA 3CLHA 1I3CA 1J7KA 1VP9A 2JJYA 5IASA 1AKQA 3TIFA 2PGIA 1FFXA 3A28A 1QQTA 4F38A 1OILA 1IM5A 1FVFA 2WAYA 1ZUD1 3A6FA 3O8NA 1AKYA 3SMVA 5BR8B 1NVUQ 4MI9A 4XM2A 3V8QA 1YE8A 1IXKA 4LJAA 4DLPA 4R8SA 3UIEA 5TLSA 1GM5A 4J07A 1RW4A 3OF3A 5KX5B 1E66A 4J1TA 3W06A 4P7JA 1XDSA 2RK6A 2Y2UA 4CM7A 2P77A 5TQ2A 2MMGA 3PQ3A 1BCRB 3G8AA 1ZICA 1KGDA 2Q27A 1EK2A 2GF9A 1UEJA 3G0CA 1VRWA 2BGUA 4B3IA 2OT3B 1P9OA 3VH3A 4J3NA 2O2HA 5ANRB 2ODNA 3ORYA 3KOOA 1U0HC 2MSNA 4IDEA 4I4CA 5AXCA 2D6FA 4BO2A 2HRCA 3HC7A 5LP6C 3ZQJA 3GRZA 1GQOA 4L4SA 3RYTC 4YRKA 3FAZA 2AZXA 3CRMA 2PKYX 4U6NA 3VV3A 3HR8A 3WIUA 3RRYA 1YA4A 2DPLA 3PU6A 1VJ5A 2J9ZB 1JIQA 1X7GA 2EJVA 4V24A 2TRSB 4AWAA 3EA0A 5TMEA 1XRMA 3C87A 3PUVA 2PT5A 2X1VA 3OZXA 3QVGA 5D86A 1W46A 3JD2A 3BZWA 2YS6A 3RCBA 3KWLA 3CZAA 4FYXA 4N5IX 3RKRA 3SFTA 4QKQA 2V59A 1WF3A 4PYKA 2YRFA 1N9ZA 2X0FA 4PYIA 3WBJA 2OB2A 1ZH6A 3O1LA 1YS2X 2V74B 2XBMA 3WIVA 5IJXA 2ZVQX 4E22A 4TXMA 1OOEA 1Y8RB 3GEIA 3IGFA 4KQIA 4PSCA 3VDRA 4RU1A 5F5XA 2CKDA 3VR0A 2RHJA 3PFCA 1E1MA 4CFYA 3P20A 4I1RA 3W5HA 2WWHA 2WMYA 4YAKA 3QNUA 3P2OA 1FIUA 2X22A 1EH5A 3PE3A 3JQGB 4AKIA 5IBQA 2IEIA 4H4DA 4WECA 3DEJA 4FOOA 4EW3A 2ZCUA 1V43A 3I5YA 2W4QA 3IBFA 4WVFA 4A6EA 1ZMXA 3M3HA 5BVGA 2XNDD 2O7VA 1B73A 3OEYA 4UUBA 2ZIGA 4F4CA 2OXTA 5KDDA 2HO4A 3MYYA 4UJ3A 1I6WA 4YIKA 3D1VA 2B1JA 4INJA 2Q41A 1M0SA 3D0OA 1I94B 2MWMA 2R8YA 5J47A 1T0UA 3ZX4A 2JIRA 3PQ2A 3ZCSA 1ULAA 5L6LB 2IKSA 2IBSA 5CA1F 3JD3A 1RE0A 1M2WA 3JYPA 3RS3A 2QSZA 4RCZA 2BFNA 2XQJA 3QFTA 4CM5A 3AVWA 5JD4A 4QQFA 3H6HA 5K4HA 1HSZA 1IHYA 1KI8A 3BB4A 3F7NA 4IUDS 3JARB 4FINA 1A9QA 1SPXA 3L7YA 3WYBA 2C59A 3H83A 3OZBA 4RVGA 3NWJA 1ND5A 5FPKA 1RXVA 3A4YA 3UTCA 1BOFA 2EWWA 3RRJA 3TLGA 3LLVA 3UANA 1HLGA 3NOOA 1D2MA 3NBKA 2QPLA 3P4UA 3FI9A 2C3YA 3GX1A 5FBLB 3P9IA 2CFSA 4QBKA 4UQOA 1OSNA 2JIQA 3CPJB 4WMLA 4YAFA 3RVQA 2FFJA 2UVPA 5JAPA 2II6A 5EINA 2PRIA 3JAMA 3I8XA 3N8HA 5GM1A 3CPSA 2L0XA 4G0XA 1S2OA 2WKQA 1UANA 4M7OA 4UD2A 2GASA 5C4MA 4KQ9A 3HE3A 1JALA 4GNKA 1OVGA 4PFKA 2CNOA 2HA5A 3K0CC 3E3MA 4B44A 3I1FA 4MSUA 3FVWA 3ORFA 2OG2A 1DE0A 1V5WA 3HXLA 3KM0A 4MICA 1NE2A 5CX1B 1OLXA 4FMCF 3E3OA 4KR6A 3D6VA 1KAQA 5TMBA 1HETA 4TVSA 1EFVA 1H23A 1V1RB 1BTOA 1Z74A 2P9YA 4PLVA 3VU0A 2CFTA 1K8YB 1T8TA 1ZH4A 3T0GA 5JS2A 3N5CA 4TXLA 3ZYZA 1JFRA 1NP3A 2IP4A 1G98A 2E4YA 2RIRA 3PIRA 1GLNA 1AQNA 4B3XA 1LPSA 3CBGA 4MGIR 1NVGA 3VO8A 3IL2A 5A0TA 1HFEL 2IU6A 1ZCJA 3RWBA 1Z9BA 2XA1A 3HCWA 3KHUA 3LW8A 4BIIA 5B2EA 5C53B 2Z09A 1MDBA 3C8UA 1SU8A 4EO4A 3G02A 3E70C 2HDNB 4PXYA 2PD4A 4INPA 2ZJBA 5JD6A 3I0ZA 1KTVA 2H57A 5GOZA 3IOEA 2BI7A 4ITVA 1LRJA 3RSOA 3D7LA 1WMFA 1VE9A 1XRLA 4IXWA 3O1IC 3SQXA 1O08A 1KP3A 1SOMA 1UKYA 1GO2A 1Y1PA 1YMQA 4C07A 1T0BA 1AIPA 2MHCA 2W43A 4OJMX 1RZRA 3S3TA 3SCZA 4EBFA 3EWIA 1SXJA 4MWZA 3S4YA 1LI4A 2W6OA 1H0HA 5CA0B 3WGKA 1JKJB 3IR7A 4JP1A 3OKPA 3ZWVA 1R1DA 1S5PA 3T3EA 4RTKA 1DDOA 1TUIA 1QO7A 1DJMA 1G6Q1 1VJCA 1KZ1A 4FMPA 4O2AB 1BGXT 2IP1A 4HTFB 3AR6A 3ICCA 3EZ7A 2XCLA 1V37A 4WL0A 2KBEA 1BH2A 3E03A 4RK1A 2P3LA 5JOQA 2X13A 3EFEA 4L02A 1IK4A 3UC5A 4AP9A 3E9CA 1YB6A 3LQYA 2YWHA 4QBFA 5CM2Z 1X86B 1IWOA 3K94A 4AO8A 3K0CA 1Q0SA 1C4KA 3TIGA 3KPYA 2JAWA 3KQYA 2VDUE 4R81A 3AERA 2EQAA 2ZS7A 1BE0A 2QN3A 4HNGA 1C81A 3LXMA 4JP5A 2BFOA 2OCIA 3LKBA 1J99A 3EFHA 1R6UA 5ETJA 1NNI1 3VAAA 3GLUA 4P54A 5ALHA 4AS2A 3DOJA 1I32A 3RU2A 3Q11A 3T3OA 1TUGA 1URPA 5HZHA 3G8BA 4TRNA 2B9VA 3B52X 2A94A 4UU8A 3K32A 2ENUA 2O0MA 1KDTA 4YLEA 3S1AA 3T9CA 2DULA 1FSFA 2QMQA 2VUTA 1DOZA 4FGUA 1OYOA 2DYKA 1C29B 2GPTA 4RZQA 3JD1A 3B3AA 3LF1A 3EUWA 1OKKA 4MJ3A 4JEHA 1IULA 2FG7C 1R6DA 1U0SY 2BHNA 3LPLA 2ABWA 2CEKA 4QOEA 3UJDA 3UVEA 2MIIA 3UUEA 3UMJA 4RXTA 5C1DA 5JAOA 1OLOA 2QP4A 2O8FB 3G8DA 1O94C 1UMKA 1IZ7A 5KUTA 4LZZA 1HLFA 1KFCB 1AF4A 2A0UA 2FSIA 1WL8A 3GEGA 3IYLW 3PSAA 5H81A 5JZBA 3SYTA 3V34A 2WSMA 4DLZA 2PBFA 1ENZA 5CYPA 4KWEA 1KWGA 3C14C 4QYIA 4FDMA 4TN5A 3UT0A 1WPGA 2G7ZA 1F8YA 2VUSA 5DF1A 2UYGA 2OV4A 3KTAB 3T9DA 3DJYA 3MD9A 3FR8A 1YJCA 2CMHA 2HJHA 3LHKA 3PNOA 3DBRB 3IQHX 2EIHA 3LO8A 4XWTA 5LQMA 4RD3A 4DSTA 5I7VA 3GNTA 3HB0A 4NCKA 3ZLUA 2B20A 1XCMA 1ZMOA 3HJHA 2C84A 2EP7A 4TYQA 1LSUA 3TKLA 4B83A 3D4IA 3OZVA 4UEJA 4JBNA 2FG6C 4YMTA 4YV2A 3U19A 2VEOA 3FVVA 1OUMA 1YDGA 2BUBA 1JI0A 4OB6A 4COOA 3B1XA 1JQJC 1M2FA 4U0KA 4O8ZA 1ZNZA 5ERXA 3OM9A 4KODA 4BEVA 2XTAA 2AJCA 4E5YA 2Q6IA 4DA6A 4QTYA 3EPJA 2B5OA 2RHWA 3KO8A 4J75A 4IIBA 4MUEA 3RREA 3T94A 4BO5A 4GMGA 2PZEA 4UZFA 5EE9A 1ZPDA 4JBXA 3EPHA 4UPVA 1LVHA 3KPJA 4GWLA 3GT3A 4QX6A 1IXRC 3HA3A 3V2GA 5KWEA 4ARCA 3I2HA 2B4QA 4CMCA 4Q19A 1XEWY 4ZU3A 4OK6A 1HQCA 3K0FB 2J1LA 3BIXA 1QONA 3TFOA 1PJ4A 4ER3A 3ETGA 4EUEA 2EGHA 3KKQA 4WXMA 1FNMA 4LTDA 3C8MA 2XMDA 3Q3VA 4BMPB 3BL6A 4IM7A 4YRQA 4QYSA 4HB4A 4ICIA 3BGWA 3V5NA 2JD1A 1RKXA 2NU9A 1EI9A 1T8YA 2A92A 4GHWA 4RGVA 3JAKB 5J40A 1IE3A 1PJZA 1UFOA 1Q77A 1VP3A 4GX2A 1FYFA 3X0DA 5B64A 3WO0A 3IUNA 4PYRA 3MCVA 3OA2A 1K88A 1LBQA 4TMVA 4EAAA 5JY6A 3UWDA 4CG1A 4YMUA 3KWJA 5CX4A 5CYOA 1E6EA 2ADOA 1EXNA 4TLBA 2WUDA 3WV5A 4YJ3F 5C18A 3R40A 3PC7A 4FX2A 3ZS9A 2IHVA 2G67A 5D6OA 5HJ7A 1T35A 1W44A 5A9SA 1I13A 2AMYA 1S8AA 1OW3B 1ZP6A 2I4NA 1I3KA 2XA2A 2BOVA 3KZVA 3Q15C 1EFDN 2QZJA 2ZYTX 4K5QA 3NU1A 1OGIA 1YZFA 1DCKA 1K98A 4FZ3A 5HF6A 2QAGB 1DTWA 2WIDA 3GUYA 4H3HB 4PTYA 1ZHHA 5DCLA 3TH5A 3AFOA 4DDTA 2QQ0A 1UOPA 5I47A 3RSFA 4UE6A 2FF7A 4BBPA 4US0R 4IUBS 3HB9A 2AF3C 1YCHA 4MUGA 5E4FA 1M5TA 3C6YA 4C0JA 1ZWLA 2I65A 4HVAA 2AF4C 3LK7A 3SYKA 1H65A 2R60A 2PQ0A 2WMOB 2CVQA 1DBPA 2XKAA 3JQ9A 1SCKA 3QXSA 4MAMA 2RONA 1YAHA 4P0TA 1I2AA 4B4DA 4HWGA 1U02A 4KIWA 2XRYA 4CV0A 4K86A 4E5SA 3ZY4A 3KEFA 3A8TA 3OPYA 4IQ4A 1G3UA 1T9GS 3OIFA 4ZAZA 1AHNA 4DWJA 2PMKA 3NW9A 2WZCA 1I3NA 4TQAA 3WDMA 2PX8A 2ATXA 1NNEA 1ULUA 2O3RA 3B7GA 4J0IA 1C1YA 1Q50A 3BRWA 3MTBA 4PRLA 3WBFA 2CEAA 3ZHYA 1M66A 2AKYA 3D54D 3NNSA 5LOVB 1WCXA 2X77A 3IHWA 3SIWA 2QX6A 1MG0A 4RV4A 1F7UA 3L4BC 1DQZA 1HURA 1RQGA 1W581 2X6QA 1JWBB 5BOSB 3KJHA 2DAPA 2J9GA 2GXSA 5DCUA 4JOQA 4LJKA 4TRJA 4FFNA 3MCWA 3LYHA 1VXRA 1Z0DA 1DAEA 3P4XA 1WKCA 2ATIA 3AH8A 5DTMA 1I10A 2DTEA 2HNKA 4UDOA 4YPOA 2Y4OA 1UR5A 4LX0A 1G2QA 4R1PA 3FTEA 1R0LA 1DB3A 3QBVA 4M60A 1OC4A 1P3Y1 3D4LA 3OZIA 4OHFA 1Z25A 3GDWA 2GLUA 2YNMA 4MUYA 4C0HA 3MQ4A 3F49S 2QWXA 2EDCA 3OC6A 4IEIA 3W1VA 4CKWB 3H4TA 4IZ6A 4F5YA 2UVQA 4YO8A 2A7XA 2WMNB 5IANA 1FYDA 3ZDFA 5JFTA 4YAUA 3I1YA 1W94A 5JALA 1NVBA 4CQMA 4X93A 3J81A 1Y5NA 1O4WA 2ANCA 3U4HA 2FRDC 1R12A 1R7RA 2VAWA 1QHIA 1W34A 2C2YA 3HDYA 3U7QA 1HE2A 4RJKA 4OHOA 5CJ2A 3GUZA 1EM6A 5F2NA 3GFFA 4ZOLF 4PV7A 5EKTA 1ECFA 3ITEA 4KDFA 1Q5PA 1ZVVA 4QU0A 4C3OB 5I7SA 1K6MA 2XWPA 1LDBA 1M10A 3FSEA 4EPRA 5BV2P 3FSGD 4G8CA 3C1TA 1H2HA 1W4BA 2FUKA 4PGMA 4X3CA 5IUNC 1EESA 4JI5B 1CVRA 3B70A 3EZFA 1OX4B 3ZZUA 2OV8A 2ZSBA 3A2NA 3HSKA 3I76A 4RW0A 1JWLA 5IKXA 2Z2XA 3SQLA 4HK4A 2G71A 1E4VA 3DTTA 2XGOA 4LRTB 1RXCA 3ZHUA 1NULA 5F2KA 3H97A 1JR3D 3KWFA 3WRXC 1JJAA 2MYNA 1UKAA 2Q2VA 3DOEA 3ETEA 4KFRA 1DO2A 2FX3A 3HADA 4OHBA 2HCTA 3EIEA 5GQSA 2XDYA 3GG9A 4MARA 4EY5A 3STUA 3LQQA 1Z7EA 2CJXA 2C2BA 2IEAA 2NAPA 2VRNA 2XHZA 3FVTA 1ZLXA 5CXSA 2FI1A 1KMMA 1XDWA 1WXFA 3GLHE 4AUMA 5IC6A 2O8CB 2AB0A 2X5NA 4YP6A 3A26A 3GF4A 5BSGA 3FPFA 4IVNA 3AF0A 4JB2A 1R74A 4JWKA 3V33A 5JDCA 2FFRA 2XUIA 1Z7YA 3GFSA 3AVQA 2BHRA 1ZGGA 2Q6VA 2GKOA 2VK1A 4G86A 5KQSA 4G0UA 1RSZA 4L9SA 2IOFA 4R1MA 3DXYA 5A3SA 1TU4A 2PNFA 3HYCA 2DWCA 1L6RA 3ELUA 3O9VA 4UMDA 4EUNA 5C81A 5K01A 3SC4A 1PEDA 1TF7A 2VP6A 2CVZA 2E4XA 5B12A 1UP6A 3SQNA 2G28A 2REXB 5EP4A 5J1TB 5ED0A 1A71A 1IUPA 5FUVA 3T5PA 5CNJA 1GYRA 2BCGY 2C20A 1ZSVA 2ASEA 1REQA 1DADA 4KSYA 3F74A 2WJZB 1HNXB 3T35A 1TA4A 3K9WA 2QXYA 1A4IA 3V1YA 2D1SA 1Q1QA 3E35A 2ZT6A 3I5UA 2VYVA 1XDDA 3WBKA 2XA9A 2Q2OA 2ZS8A 5DNVA<