4R01A

Crystal structure of sp1627, a putative nadh-flavin reductase, from streptococcus pneumoniae tigr4
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
210
structure length
210
Chain Sequence
GMKLAVIAANGQAGKAIVEEAVKRGHEVTAIVRSENKSQAESIIKKDLFELTKDDLTGFDAVISAFGAYTPDTLPLHSKSIELFNQLLAGTQTRFLVVGGAGSLYIDETKTTRLLDTPDFPEEFKPLAKAQADELDLLRTKNNLNWTFVSPAVDFIPDGEKTGNYILAGEIFTTNEKGISQISYADYAIGLVDELEKGHHIKERISLLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of SP1627, a putative NADH-flavin reductase, from Streptococcus pneumoniae TIGR4
rcsb
source organism Streptococcus pneumoniae tigr4
molecule tags Oxidoreductase
molecule keywords putative NADH-flavin reductase
total genus 68
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13460 NAD_binding_10 NAD(P)H-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4r01A00
2LDXA 1DO8A 1LQTA 3B70A 2PZJA 4XGNA 5DNAA 3JQ9A 2Y1FA 2VRCA 4ALMA 1LLCA 1JWAB 2I76A 2VZ9A 3BMQA 5JNLA 3UVEA 4R54A 3UUWA 1HYHA 1SB9A 1SPXA 3HN2A 5TGDA 1PS9A 1MFZA 1CYDA 2HRBA 3FCOA 2A4KA 3K6JA 4UUMA 3LLVA 1UDAA 4IBOA 3UH1A 3A1NA 4BS9A 3I6IA 4E5MA 1PJQA 3P19A 4HADA 4UULA 2IYPA 1GL3A 1DFIA 2G0TA 4W7IA 3UXYA 5KJCA 1BGVA 3ZWBA 3PWKA 2ILTA 3K5PA 3W4KA 1JKJA 4IDDA 4R1UA 1CWUA 2CVQA 3KSZO 2B37A 5LDHA 4EI2A 5CDSA 1O94A 3C7AA 3TWOA 2C2XA 1IHXA 4IJUA 4DYVA 2X0RA 4NR0A 4CLXA 4TVOA 2CDAA 5IFLA 4FIZA 2OUIA 1HZJA 3RFTA 1BRMA 4Q9NA 4E5NA 3C85A 3TZCA 1NYTA 1TXGA 1QLHA 5A9SB 3AW9A 5A9SA 1PJBA 3WBFA 2FR1A 4BO4A 2YYYA 2GZ3A 2NADA 1UP6A 4LCJA 3RFVA 1BXZA 3WXBA 3D3WB 3ZWXA 4DC1A 2B69A 4J9UE 2X1HA 2CDCA 1PZFA 2V6FA 1YWGO 2RBEA 5IXYA 2C7GA 3GNTA 3N58A 2QW8A 1A9ZA 4KWHA 1KOLA 4XRGA 2EIHA 4DPMA 3JV7A 5L40A 5AOVA 2VYVD 2VRCD 3ZV4A 3WTCA 3KSUA 3OFSA 4CR8A 1V0JA 4OAQA 1LTHR 2BGMA 4NZ9A 4EUHA 2PGDA 1E1LA 1X0XA 1YONA 3VDRA 4Z0HO 5JS6A 3ICPA 1LQUA 4KTVE 1P1HA 1UDCA 3FTNA 5EJ2A 3WGHA 5GMOA 3JD2A 2DFVA 1GUYA 2EKQA 2TMDA 3C1OA 3OJFA 5B4TA 2NNLD 3SJ7A 4DPLA 2UUOA 1X0VA 5FFFA 3I9LA 1ARZA 3W6ZA 1LDNA 1MXHA 2FPGA 2V65A 4F6LA 3E18A 1KEPA 2NQTA 1EUZA 1R16A 1SC6A 3EDMA 3QQPA 1HSZA 4IY1A 4OYRA 3E48A 3H9EO 4FC6A 2C82A 1JU9A 5F1OA 1GFSA 1GEGA 2OORA 3O26A 4LK3A 3MJSA 2GR9A 1XKQA 4PLGA 2Q49A 1P3DA 2VNAA 3QHAA 3WS7A 4WLUA 2EG9A 2I67A 4XD2A 2H9IA 3MJCA 4JGBA 1U5AA 3JSAA 3PZBA 1E1MA 4FS3A 1GEEA 1HKUA 1ZXLA 7ADHA 2Y99A 4FCCA 3ZU2A 3ABIA 2ZYDA 2IEBA 5JY6A 4R5MA 1WDLA 3U3XA 4CM8B 5DCUA 4NG5A 3GEDA 1LJ8A 4E3ZA 4O5OA 3NV9A 3BZUA 4GWKA 5T8KA 1YS4A 2BGLA 3L4BC 4ZA2A 2FR8A 3PJFA 4W4TA 3WQQA 3GDGA 4QSMA 1EMDA 2AQHA 5H83A 2P9GA 1QYXA 2X9GA 2NU7A 2RH4A 4C4OA 4D3DA 4XB2A 1YL7A 2SCUA 4TROA 4TKMA 4YT5A 2BFPA 5JMWA 1EBUA 4D0RA 3INGA 8ADHA 1GYQA 4CM5A 1R4NA 3CH6A 3T4XA 4DLAA 1ISIA 5AXDA 2YFHA 4MOWA 1B0AA 3PGXA 5JYEA 1VL0A 5BQFA 1AE1A 4O59O 4JBIA 4XJTA 1ONNA 5I7SA 3D7LA 4PLVA 4LSMA 3NT2A 3FD8A 4TRMA 1HLDA 1DDOA 4J7XA 1IZ0A 4BQRA 2VNSA 5JCJA 2J3JA 2QRJA 1P0CA 4RVHA 1BVUA 1ZSVA 3GVCA 2F00A 4ND2A 3UOGA 4ALKA 2Q4EA 4UREA 4HKTA 1ZK1A 5CEJA 3IUSA 3AUUA 1LSJA 4KTTE 1AGNA 3ONFA 4WNIA 1IYZA 5DZSA 3ULKA 4A03A 3JQAD 1MC5A 3Q2IA 4XX0A 3L07A 4MIEA 3BMQB 4W9NC 4X54A 3C7CB 4CJXA 5K0ZA 4DBZA 1GQ2A 1ZCJA 2FN7A 4YT4A 2H5LA 2OL4A 4I5DA 3GPIA 4XQGA 3IS3A 3MOIA 3ON5A 3RCBA 2HMVA 4PLWA 3JD0A 1P77A 3ROQA 4GX2A 2EGHA 3WOHA 2EKPA 3PYMA 4EDFA 2Q3EA 3DBLA 1YDEA 1DIAA 1I2CA 4NQZA 1LRKA 1Y8RA 1RM5A 3NX4A 4IDGA 3CPSA 4ZHSA 5K6AA 3CE6A 4J1NA 4IDCA 2ZQZA 2FP4A 2I3AA 3KYDA 4JCOA 3UF0A 3WGTA 3VH2A 2O3TA 1Y1PA 1BWSA 3BXXA 4YR9A 3IKTA 1SAYA 2QX7A 4Z3DA 2PFGA 2B4RO 4B4VA 1ZVMA 3VPGA 1FK8A 4F6CA 4N5MA 4XYEA 3G79A 3S2EA 1VPDA 2QHXA 2X0NA 6LDHA 2VHVA 2O2SA 5COAA 1OC2A 4BNXA 3FI9A 4IIVA 2BMAA 3A4VA 2PKQP 3OETA 1X7GA 2JJYA 1ADGA 1RWBA 2C2YA 3KM0A 4E13A 1PR9A 4WLVA 4RVUA 3KVOA 3WYBA 3U09A 1ENPA 1MFPA 3I4CA 4FDAA 4R41A 1PL7A 4KP7A 4XA8A 3L9XA 4MJLA 5FEUA 4AJHA 1U8FO 4FFLA 2HDHA 4WOKA 1TA4A 1N5DA 2GD1O 1C1XA 3ZNOA 4NBUA 4AICA 3U9LA 1T2DA 1C0LA 5IZ4A 1PJ2A 1M66A 1Z74A 5TLSA 1GV0A 1LA2A 1RM3A 1U5CA 1GZ4A 3G49A 3JD4A 1NHWA 4CLEA 1VL8A 5B1YA 4O1MA 4CMEC 4RL6A 4F46A 4XCVA 4CM4A 2FSVA 1XLTA 3OIGA 3C24A 2QG4A 3H8VA 1C0KA 3E9NA 1SCUA 3RD5A 3V2HA 2Q1WA 4EJ6A 5IJZA 4BO7A 1HDZA 4LVUA 4DA9A 2YZ7A 4B4OA 1PEDA 2X6TA 3LU1A 3E6AA 1PJSA 3OIDA 3AOEC 4J4HA 4OQZA 5CPBA 1NHGA 5L45A 1JAYA 4ZN6A 3X2EA 4UVEA 4MVJG 4CUZA 4BO2A 1MG5A 3FSRA 5IZCC 1E3JA 2RHCA 2JD2A 1PJ4A 2GLXA 1BXKA 3PHGA 3WJ7A 2W2KB 4N18A 3VKVA 5JE8A 4R1SA 1K6XA 1QSGA 3TZQA 1I3KA 2FMUA 2XPCA 3QWIA 3RROA 4XZ3A 2Y1DA 4RCVA 1YOVA 2O7QA 4RVDA 2JHGA 2HUNA 1HDGO 1CJCA 3K92A 3DBHB 4HUJA 3TNLA 1R0KA 2OMEA 2WWRA 2OO5A 4FFMA 3DBLB 1R37A 1MP0A 1C3VA 5L4LA 1J6UA 3IC5A 3F47A 3NAQA 2NVUA 1A4IA 4Z0TA 1GDHA 3PDUA 1JW9B 3WWYA 1W6UA 2V6BA 2QZ9A 1QLJA 2NV6A 2WEKA 3B1JA 5JDCC 3KYDB 4HBGA 1DAPA 1SOWA 1V6AA 1VKOA 2HJRA 5CEEA 4JBGA 3I6QA 3GMSA 1YBMA 2EF1A 3BTSA 1NQAO 1U4SA 1ENOA 3KV3O 4JJFA 5BSHA 5G0SA 2CY0A 3K96A 1XQ1A 1LEHA 3LC1O 4GGPA 4JLWA 3RC7A 2PTGA 4L74A 2VHYA 4LSWA 1E7WA 2BELA 3V1UA 4NFYA 1KIFA 2IZ0A 1ISFA 1I5RA 2Q45A 4YAJA 4ILKA 3EVTA 3R0IA 1CEQA 3AM5A 1DXYA 1PGQA 3EZLA 5A9RA 2JAPA 1KVRA 1Z7EA 2E49A 1H6AA 4KQWA 1IHYA 2YW9A 3AI3A 4JN6B 4CMAA 4PZCA 3Q0EA 2ZYAA 4YB8A 1ISJA 2RH8A 4ZRMA 2X7HA 1E6EA 1DC4A 3UW3A 4IINA 2X22A 3ZGYA 4B4WA 4ZVVA 4P4LA 4PZDA 4EEXA 3ASUA 5IZCA 2VRBA 3ZW9A 3FWNA 1PGPA 4DMLA 4EITA 4J4TA 1VL6A 5B12A 1ADFA 1ZK0A 4OQYA 3EK2A 4RQUA 4LMRA 4K9DA 3DBRB 3OIFA 4FJ2A 2PH5A 1Q0LA 1ZEMA 4HWKA 3AOEA 3F5SA 4PCVA 3IMFA 1OBFO 2NVUB 3A9WA 3I23A 4A5OA 4AL4A 3ZV3A 4RDHA 5A06A 2BKAA 3AFNA 3HSKA 1X1EA 1AUPA 4M89A 3ZHBA 4DLLA 5DF1A 3ITDA 5KVCA 1NVGA 4YJHB 4QFCA 4R4JA 4EJMA 1WW8A 2HSDA 3H9QA 3RBXA 4CLHA 4E5PA 4GPD1 3E03A 4BNLA 4EUFA 4JP3A 4E32A 4R9SA 2GDZA 3QVXA 3H3JA 4CQMA 1NPDA 2AA3A 3H9UA 5JFOA 3DFZA 1HDXA 1DRUA 3GN2A 4R51A 1BSVA 3CKYA 4HFRA 4BNHA 5KVSA 4Z9YA 3SXPA 2IXAA 3QV1A 2P91A 4OIMA 3WR5A 4I9HA 1LSOA 3V1YA 5C37A 3K2EA 1F8GA 3IIEA 4ZD6A 4XQ9A 1EDOA 3NUGA 4Y9DA 5AXBA 1ZEJA 2UUPA 1O5IA 2HK9A 1YJ8A 3DOCA 1XG5A 2AMFA 1PGNA 2ZKLA 3GGOA 5EMHA 3KHUA 5KJEA 2IDZA 1NASA 3DC2A 4RZHA 2WJPA 1QV7A 4U7WA 3F1LA 1Z75A 1NQTA 3MJTA 3QW2A 1LSSA 1R15A 5A1TA 3U49A 4D43A 1P0FA 2J3IA 3JQ8A 2Y67A 3FHLA 4YDRA 4ALLA 4CM4B 4FSHA 2BRUA 1WMAA 3AY6A 3BMOB 3WDSA 1ZBQA 3OICA 3IAHA 4K1LA 4TMFA 3QRWA 3FRJA 1WDKA 1CIVA 4QFDA 5ES3A 2ZB7A 2ZCUA 2DTXA 2NTVA 3VZRA 1B8UA 4GH5A 1JAXA 3CZMA 3EUWA 3HQ4O 4IDBA 3BA1A 4YAKA 4S1VA 1BHSA 2ZTUA 3HNPA 5H82A 2I3GA 3NT4A 3FNHA 4GMGA 1Q0QA 1YO6A 9LDBA 2EKLA 4E2XA 2WD7B 4RJTA 4W9NA 3S2GA 3Q9UA 4RF5A 1VM6A 2ZTVA 3HN7A 2PZKA 1HWYA 4PLHA 4OGWA 2DT5A 3C3XA 1GZ6A 4PLZA 4YWJA 4CQLA 1YOVB 1VRWA 2E48A 4BNIA 2PKRA 2CVOA 2R2GA 3OA0A 4I08A 3O8QA 3V2GA 5JAMA 2DBRA 3LZ6A 3TL3A 3FPCA 5LCXA 2O48X 3RU7A 1Y9EA 5T67A 3VTZA 3GPDG 5JMPA 4DVJA 2GF2A 1H9AA 1R6DA 3ZNNA 4PN3A 1LXCA 2DBQA 1Q0HA 1FXSA 3MWDB 4CLOB 3BHMA 1T4DA 3GA0A 3VHRA 1V3UA 4OSPA 1RKXA 4WLNA 4DIBA 3OSUA 5EERA 5DT9A 2ZK7A 1QYDA 4WK6A 4KUGA 2PV7A 3RU9A 4DRYA 4FGWA 1ISHA 3N7UA 1KVSA 4PRKA 5GZ1A 1J49A 4Q3EA 4MKRA 1HL3A 1PS8A 4XYBA 4R1NA 3TL2A 1VC2A 4PLPA 3WB9A 1OAAA 2AEFA 3B6ZA 5T8KC 2HO5A 5JXWA 2GYYA 1TVEA 4QT0A 1O6ZA 2DUUA 4FB5A 4DYDA 2X0JA 4CMCA 5FWNA 4KDEA 1YQDA 4XDZA 3U4HA 1MXFA 5L4NA 4FJ0A 1QXSA 5KKAA 3DWFA 4PG7A 1E7SA 3TQHA 1LU9A 3RJ5A 4RF2A 3NDIA 4LN1A 2OP0A 2Y68A 4OMUA 3DZFA 2QYSA 1ZFNA 3CUKA 5TF4A 1ORRA 2B4QA 4J2OA 1OZAA 1MA0A 1XDWA 2VT2A 2I9PA 1P1FA 4GBJA 3PWZA 1DBVO 4NJOA 1L7DA 3WIDA 2CF5A 2OBYA 2FOIA 3DAFA 3OJLA 3JYQA 3ICCA 4QTZA 4Z9XA 1U3TA 1D4FA 4E12A 3JYOA 4CR7A 3D3EA 5EN4A 4CMIA 5KWEA 4GX5A 4TWRA 3AY3A 3L4SO 3MOGA 1XCBA 4MIOA 4PFJA 2GASA 3TSCA 3VPSA 4ZQBA 3RUDA 2GPTA 2ZQYA 2Q4BA 5EL0A 4BL5A 4RVGA 3GGGA 3HZZA 1IB6A 4DREA 1R0LA 2PD3A 4QO7A 3GVPA 4DLBA 2DAPA 5CFZA 1UZNA 3VH3A 2CVZA 2Z1MA 3I4FA 2CDBA 1ZK3A 3VVCA 2Q2WA 1ZK2A 5L4SA 3TZKA 2VZ0A 5MDHA 1CF2O 2D0IA 1N9GA 1NAHA 3S8MA 4P8RA 4D79A 1PGJA 1PJTA 3H6KA 4GSKA 3QA9A 1X1TA 3GAFA 1EQUA 3JQ6A 4AVYA 1UP4A 5DP2A 1YL6A 5JAIA 4DIFA 3GRKA 1GY8A 1C1DB 3TF5A 4IJWA 3DO5A 1I0ZA 2W2LA 1U1IA 4DMMA 4E5KA 4D46A 4YJDA 4YAEA 5A9TA 5ER6A 1ONOA 1RYDA 2RHRA 1HDOA 1U7HA 2OFPA 4LISA 1YXMA 4J1TA 3PPIA 5U9CA 1M67A 2YUTA 3IQDB 3RBVA 3G1TA 3BMCB 3LYLA 4BNYA 1MV8A 4PGFA 3PJEA 5CAEA 1RM0A 5T5QA 3LT0A 2XOXA 4TRRA 5HS6A 4TQGA 4L73A 5TNXA 3GG9A 8LDHA 4PVDA 4XQEA 3IDSA 1FF9A 5JC8A 1KEWA 4UAGA 1A27A 5JAQA 1MGOA 5I7VA 4GAEA 1KS9A 2E6UX 4ND5A 4BNJA 2TMGA 2WD8A 3ZWVA 4G5HA 3BMNA 3OH8A 4NNJA 4AG3A 3FN4A 1K2WA 4A73A 4J1QA 3KYCB 4ZQHA 5ENDA 1LDMA 3COSA 2O3RA 3I3OA 4FPXA 2WD7A 2B35A 4XKJA 5HA5A 3ZWOA 5F1PA 4XEHA 1CRWG 1U2DA 4BNTA 3E5MA 3ZNPA 2HU2A 3JYNA 1BTOA 1N1EA 3JQ9C 1I30A 1TLTA 4FJ1A 1QMGA 1DFGA 5B4VA 3V5NA 4IJVA 1ZSNA 3HHPA 3TDKA 9LDTA 2X5KO 3NDJA 4AJKA 3RBZA 3NTQA 2YHUA 4RVFA 1U4OA 4CV1A 3OQBA 2Z95A 3BAZA 4ONEA 4KDFA 4FGSA 2NVWA 1C14A 4E5YA 4DL9A 1N92A 2B5WA 4D42A 3AY7A 1ZUD1 3RUFA 1J0XO 1A7AA 2YQ5A 2VZ8A 2CFCA 3GOHA 3ORFA 4YACA 3GNQA 5IDYA 4B3IA 3GHHA 2BD0A 2IRWA 3E82A 4L4SA 3KLMX 1HRDA 2DVMA 2AW5A 3AK4A 3HB5X 3ROPA 1VJ0A 3RC9A 4MVJP 4YT8A 3ZV6A 4D3SA 3E1KA 4XR4A 5G4KA 3W4JA 5EQDA 4D45A 1H6CA 3D4OA 1U3WA 4YA6A 1E5LA 4MDHA 4DQVA 3E5RA 3RUEA 2BLLA 1DRVA 4L9RA 3KLPX 3RWBA 1E5QA 3A28A 4HP8A 4BGEA 4CMHA 4RPJA 2J3KA 3CTMA 2BH9A 1I01A 4J4BA 1JA9A 3S2FA 1GYRA 1PS0A 4OXYA 4TSKA 3LT4A 2FZEA 3RJ9A 1TT7A 5JCXA 2C54A 5K9ZA 2BHLA 4KOAA 3ENKA 2Q1SA 2DU8A 4XDYA 4L76A 1A5ZA 1NXQA 3I9MA 3VC7A 4UVIA 2BGKA 2A9FA 3ONDA 1B15A 1H93A 1QR6A 1V3VA 3HUDA 4YT2A 4ZRNA 4J6FA 2EXXA 1TI7A 3BYZA 3Q2KA 5JDIC 2JFHA 2Y66A 4EJ0A 4BNGA 5EQFA 4DTIA 5JPIA 4WPGA 1F0YA 3DXFA 4W99A 1UR5A 1LDBA 4AJLA 2VOJA 3CIFA 4UEKA 3VKUA 1ZKMA 1GADO 3TZ6A 4D44A 1GD1O 3MTJA 3WGIA 2D1YA 4B7CA 1IL0A 2W2KA 3NTRA 4WCFB 5L95A 2DTEA 3A14A 2FZWA 4GLOA 1BXGB 1VLLA 2R00C 3D4NA 4RQTA 2GUGA 1MX3A 1RJWA 3H7AA 4M87A 2YV1A 3O38A 5T6BA 4BB6A 2O3SA 3E8XA 2C07A 4A2CA 4NU6A 1F06A 4HNGA 4BKUA 4RF4A 5CDYA 3D1LA 1QYWA 3GLQA 4K6CA 1C1XB 3PHHA 4E21A 4CUJA 4Z6KA 1Y9AA 3DZHA 4FFRA 1MG0A 2OZPA 4XYGA 1B8VA 4PLFA 1GCOA 1R4NB 1JVSA 2YQ4A 4FOOA 3WG9A 5J23A 3IKVA 3JQ8B 1WXDA 1LC0A 3ZDFA 4Y98A 3OF2A 2YV3A 1AN9A 1UH5A 5EPOA 1NNUA 4N7RA 1P1KA 1YB4A 3TOXA 4FFNA 4D41A 2GGSA 3MCVA 3MZ0A 4ZQFA 1DJNA 1F12A 3UICA 5CDTA 5C5IA 4BNUA 4B8WA 2GO1A 4BGVA 5ITWA 1PIWA 3NGLA 4BNVA 1HE2A 1QG6A 3AUTA 4WLOA 4AJ4A 3DHYA 1GQQA 5KOIA 4GMFA 3OMLA 4PG6A 4PG5A 3PIDA 1ZJYA 3RI3A 2Y1CA 3DR3A 3EVNA 1SOVA 3GVXA 3OQ6A 3WFJA 4JX8A 1OOEA 4R16A 3H2ZA 3DOJA 3U4CA 4LGVA 5KJ6A 1CDOA 5EIOA 1HDRA 2GZ2A 4DQUA 1F17A 3DAPA 3P2OA 1KY4A 1H9BA 2O23A 5F1KA 4J2HA 2P68A 4KMSA 1N9GB 2PZLA 2GN8A 1E6UA 1TB4A 2F1KA 3F9IA 1KETA 2NSDA 3KTDA 1UXHA 1QKIA 1ZMTA 2QZZA 4Q3BA 1IPFA 4GKBA 1Y8RB 3DMYA 3RAJA 3PP8A 5TT0A 3EMKA 3HJAA 1M2WA 2BI8A 2E82A 3AUSA 3VDQA 2WYUA 1EUDA 3AFMA 4UVDA 3ZHYA 4II3A 4EBFA 4BHTA 2GN4A 2E4AA 1EVZA 4G65A 3HDQA 4B7XA 2ZATA 4CL8A 2CNBA 2X5OA 3I9KA 4MVJI 1XQ6A 3PTZA 4R3NA 3RFXA 3TFQA 2PNFA 2P9CA 3OA2A 3RKRA 1V9LA 1A72A 4ROSA 1YB5A 3ANMA 4WCFA 4CQMB 2BFOA 1BXGA 2EJVA 5ER9A 5L3ZA 4GWGA 3WGQA 5TX7A 4E2WA 3PQEA 1Z82A 3JCZA 3L77A 3VPHA 1LDEA 3ONEA 3A06A 4CM9A 5L9AA 1BDBA 3HB4X 3LSYA 2PLAA 1EVYA 1Q7CA 2ZJ1A 1PJLA 3JQGB 5H81A 1DRWA 2JCYA 3FR7A 4BKRA 4LCEA 1KC1A 3PYXA 2D3TA 3LLSA 1GYPA 2QRLA 2NACA 1ULSA 4OL9A 5TRTA 2EWMA 1HETA 1L1FA 3ASVA 4YJGA 3GMDA 4QQRA 4IUYA 3MJVA 3F6YA 4OM8A 1MUUA 2O3QA 3EC7A 1LNQA 1IUKA 4QECA 4RDIA 4FD3A 4N5NA 4ITUA 1AXGA 3BTUA 3E9MA 3IOYA 3WGYA 2QRKA 1JKIA 5COQA 2HRZA 4WLEA 4E33A 1E3WA 4NJMB 1KVUA 3JQDA 1HT0A 1SMKA 5ILGA 4YQZA 4RPLA 1K3TA 3RIHA 4BNMA 4CLRB 3I1JA 3GNSA 4Y6RA 3K31A 4JROA 4PLCA 4AJEA 2C5AA 1M6HA 1ADCA 1W0CA 3NJ4A 3PHJA 4MKXA 5JC1A 1WZIA 5AVOA 4BMVA 5HRUA 3DQPA 4IQ8A 4XGIA 4TKLA 4HFJA 1GUZA 3LVFO 3K9QO 5IN5A 3PHIA 4ZQEA 3UCFA 4AJ1A 3NKLA 4E2ZA 4GI2A 4CMJA 1WNTA 4HNHA 4R9RA 4ZJUA 5IF3A 3RVDA 5EESA 4RVSA 2NU8A 3UCXA 4FFPA 3JQAB 4ALIA 4BQPA 3ADPA 3F5QA 5BNIA 3QY9A 5G0UA 1I3NA 3B20A 4CQLB 1P45A 3U0BA 1EEHA 3QVOA 4R69A 2Q99A 1A9YA 4BO0A 3QWHA 3DTTA 3PXXA 4B3JA 3H4VA 4BNZA 4BIIA 1ZK4A 4GLLA 4DPKA 3Q11A 1NQ5A 2AG5A 1DIGA 2ZB8A 3Q3CA 4K28A 3WSWA 1DC5A 1KEVA 4OSOA 1B26A 2I65A 3ROKA 3KEOA 5KJ1A 2D5AA 2PK3A 2WYVA 1K6IA 3WFIA 2Q1UA 4WUVA 5A04A 1N7HA 2VN8A 1DJQA 3ANLA 1KVTA 3C7DB 3W6UA 1N8KA 2NU9A 4OO3A 2Y05A 3FBGA 1JN0A 2J5KA 3KZVA 1WWKA 4J90A 4Q3AA 4CM9D 4TZKA 1C0IA 1PU2A 5COBA 2O4UX 1XGKA 2J6IA 3NYWA 4YQYA 1ZH8A 3WYEA 5F21A 1VI2A 4EGFA 1PL6A 2EJWA 3ANNA 4BKOA 5DP1A 4EZBA 2EP7A 4YVFA 4CMIB 2J8ZA 2VHZA 5JCJD 1OMOA 2R00A 4JNKA 4O6VA 3KYCA 2FPIA 4K6FA 2EHDA 3LDHA 3OBBA 2VCYA 5BT9A 1PZHA 3GY0A 5I8WA 5I7FA 5L51A 3H5RA 2IODA 5AYVA 4OOEA 1HDYA 1WZEA 4L0QA 2O50A 1T4BA 1YKFA 2C59A 2GERA 4GL4A 1PSDA 2RIRA 3E9QA 2HKIA 3ITKA 3LC2O 5I9MA 3OJOA 3OP4A 3LT1A 5JY1A 4CM6A 3QWBA 2FRDA 4RZIA 5I7EA 1JQBA 1NR7A 3KEQA 5KVVA 1DC6A 4CMGA 1T1RA 2CUKA 3ETGA 1O0SA 3GC6A 5BNTA 4Z3KA 4P38A 2DLDA 2Z1NA 4W7HA 3TZHA 1JLLA 1EFLA 5ICMA 1F14A 1BW9A 3AUAA 2HMSA 3BMOA 1D1TA 5DOZA 2WE8A 3F46A 3FNFA 4EUEA 3JQBA 1DOHA 1FJHA 4TVBA 3ZZNA 3JQEA 5JSFA 2JHFA 1HLPA 1NAIA 2EP5A 2DC1A 4UUPA 3HDJA 1U7TA 3PZRA 3BIOA 1WAMA 3QLJA 3GAZA 3RKUA 3TRIA 3RUAA 1ZMOA 3BMNB 3OJEA 4CMKA 1K89A 3DONA 4IIUA 2D8AA 1N7GA 4D3FA 3ZHXA 3AU9A 5TT1A 3F4BA 1WDMA 5AXCA 1E3LA 3PFWO 1DIHA 3FF4A 3ST7A 5THKA 1EFKA 2PY6A 2EW8A 3H5AA 2I99A 3ZU4A 2DFDA 1SBYA 3JQFC 1HE4A 2O3UA 1VE9A 1L7EA 1NP3A 3BMCA 2V6MA 4PVCA 1LRJA 3DOOA 3G1UA 3X2FA 3LF2A 2VYVA 3GR6A 2H1SA 1PR3A 1PJ3A 3B1KA 4PG4A 1DLIA 1E3WB 4J49A 5A5FA 4UUNA 5I9NA 4DGSA 1Y7TA 1LI4A 4CLRA 4Q39A 5I8ZA 4QXMA 1J5PA 1XEAA 4U0KA 5L7WA 4HV4A 2P9EA 5DCYA 1M75A 2WM3A 5A5EA 5FI3A 2Q1TA 2VTEA 3DMTC 3DEYX 3QJ5A 4E31A 1BW9B 2ZB4A 3TPCA 1Y81A 3VH4A 3LC7O 1UP7A 1BG6A 2G5CA 3SC4A 1YRLA 3SC6A 2UYYA 2V7PA 4MVJD 2AG8A 1QV6A 3UAGA 1UZMA 4IM7A 3HDYA 4ND3A 3WIEA 3WTBA 4NFSA 4DIOA 1AXEA 4K26A 3OEYA 2P5UA 3PIIA 2HK7A 3O4RA 1SO8A 4BKQA 4P4GA 4AJIA 3T4EA 5TJHA 3JQFA 3L9WA 4RPKA 3KUXA 1I33A 2NUAA 1GPDG 2OHXA 3IP3A 4EW6A 1FDSA 2X4GA 3OM9A 4PG8A 1G6KA 3JQGA 1AHIA 4ND1A 2B5VA 2XXJA 3RC1A 3LT2A 1U3VA 5IG2A 1DIBA 4CLOA 1A7KA 5DOVA 5HS4A 1W4ZA 3V8BA 2B83A 1NM5A 2W98A 4CV0A 3GDFA 5CG2A 4OKNA 1PL8A 2VYNA 3MTGA 1K6JA 1G1AA 4FOSA 4J0EA 1P9LA 3KETA 3O8QB 1UXJA 4AJOA 2GZ1A 2JFFA 2X9NA 4B8ZA 4WNCA 1SEPA 2Q50A 2B0JA 1E6WA 4J1SA 4N5LA 3H5NA 3JQBC 4DXHA 2EGGA 4ALJA 3FNGA 4NBWA 1OFGA 4TRJA 3SJUA 3DZIA 5G4LA 3JD3A 4MPDA 1H5QA 5T64A 3RQSA 1K0UA 3GZ4A 1Z7BA 3WMWA 1Q7GA 5IXSA 3NJ8A 2H6EA 1DPGA 1U28A 3QE3A 3Q1LA 4FN4A 3VVBA 2JD1A 4BOYA 2DBZA 5IAAA 4E6PA 3D5TA 1LLUA 2V6GA 4J16A 1XU9A 2LDBA 1KYQA 3HE3A 2P4HX 2UDPA 4BMSA 5KIAA 3D4PA 2WMDA 3KO8A 2ZIZA 1T2AA 5KJFA 3R1IA 3JQCA 2D59A 4A0SA 3R6DA 3GN1A 4WEQA 1I24A 4CV3A 4YJFA 4IXWA 1D3AA 1B14A 1T26A 1YBAA 4CV2A 1SB8A 2DQ4A 3ZV5A 1O95A 1TT5A 4Q3CA 4I5EA 1TT5B 2JL1A 3EY4A 3VOSA 4J91A 4HY3A 4BUCA 1FDWA 1ENYA 3IUPA 1UAGA 1PQUA 4B3HA 1JVBA 2G82A 5GY7A 4D7AA 3OJ0A 2EW2A 4XR9A 3CMCO 4RF3A 4A26A 3GVHA 2ZCVA 4YTEA 3GF4A 2X0IA 4ZICA 5G4KB 3RSHA 1LLQA 3FWZA 3M6IA 1I2ZA 4CUKA 3OHSX 1IY8A 1GV1A 3GZNB 4I9NA 3H2SA 3PEFA 3EZYA 2PGJA 4YBZA 2OXIA 2PD4A 4ESOA 5HWSA 1I3MA 1E3SA 3C8MA 4YJGB 3O9ZA 3WQRA 3WICA 5CG1A 3FPLA 5MGBA 1VJ1A 5CHEA 3IJPA 4Q3DA 1DC3A 1ZSYA 1HF3A 1WVGA 4CMBA 1SEVA 4M49A 5CPFA 2W2LD 3HFGA 2ZTMA 1I2BA 1UAYA 1ZZEA 1D8AA 4QUKA 1HYEA 4BO5A 2Y0DA 4MO2A 4BKPA 2RAFA 3BTOA 1XR3A 4J43A 4CL3A 4J0FA 1K5HA 1DLJA 5TC4A 2XAAA 4J3FA 4XIYA 1A4UA 1HSOA 2D5CA 2FWMX 5A3JA 3HFSA 3NGXA 2B36A 4WEOA 1PTJA 4BO9A 4IGFA 1B8PA 4U0JA 3PJGA 4KZPA 1DAOA 1MC4A 3TOZA 1B3RA 2ET6A 3GEMA 3PLRA 2JCXA 2GRAA 2VHXA 1E7QA 1NTOA 3QWAA 4XQCA 4AJ2A 2FSSA 1ADBA 3VZSA 2DUWA 4A27A 4U5QA 4BO8A 3EHEA 2XF8A 5GZ3A 1Y8QB 1I10A 2VUUA 5KVQA 2WTBA 5JDIA 4MP6A 1HTBA 2HMUA 3MEQA 5CDUA 1LSUA 3ZHZA 4JBHA 2VUSA 5A05A 1P1JA 3Q6IA 2JKVA 1YVEI 3PYLA 3T7CA 3ZWCA 3W8DA 2DBVO 3SVTA 1U9JA 4IMRA 2W8ZA 1XU7A 3TJRA 3LK7A 2D2IA 1HEUA 1JTVA 4DQXA 3WWZA 2HCTA 2HJSA 2YY7A 5TS3A 5A4DA 5AXAA 3SEFA 3IJRA 5G2OA 1N2SA 1P44A 3FR8A 4NU5A 2C7VA 1DEHA 3RC2A 3AOGA 3FBTA 4LMPA 1UUFA 2OBNA 3GGPA 3AJRA 3D64A 5IDQA 3PQFA 1FMCA 1V8BA 1EBFA 4WLFA 1I36A 3AM4A 1CQIA 5B4UA 4B79A 1NBOA 4KWIA 1T2CA 1Z6ZA 5DBIA 2Q2QA 2UVDA 3O03A 4NK5A 1IE3A 2W90A 5CDGA 2VTDA 4GKVA 2IEDA 4WCFC 1GQYA 3G0OA 4R1TA 4S3MA 1F8FA 5DBGA 1E1NA 3UGKA 1E7RA 4MVJH 4WGGA 5B37A 4II2A 4RLSA 5G0WA 1U2GA 1FDTA 3ROMA 3GFBA 5G0TA 1YL5A 3WJAA 4CM8A 2FPPA 4FW8A 1NWCA 2YFQA 1FDVA 1CERA 1RPNA 1IPEA 2RCYA 3K30A 5TSDA 1X7HA 3OQ1A 2QYTA 4MIYA 1Y8QA 1ISMA 3WBBA 3KBOA 3L6EA 4OXKA 3ZWNA 1GTMA 4JXKA 1T2FA 3WQSB 1E7YA 4DC0A 4L4XA 1QYVA 2Z5LA 4NIMA 4U8GA 1H2HA 4HX5A 2CF6A 5JAZA 4O63O 4PZEA 2NQ8A 1HZZA 1IULA 4BGIA 1VJTA 3U4IA 4WASA 4URFA 2Y0CA 1T25A 2DKNA 3UCEA 3DMTA 1PJCA 3INRA 4Y67A 4J7UA 1DFHA 1YQXA 4FFOA 4E2YA 1ENZA 1PZGA 2PH3A 3ZU5A 3AWDA 2X8LA 1BDMA 1JDJA 3SLGA 2FHSA 1EVIA 3PQDA 3W8FA 5ADHA 2HQ1A 2P2SA 4ID9A 1R66A 3VZQA 1B16A 5TIIA 2WE7A 1QYCA 5HM8A 5CEFA 3EYWA 4ND4A 4I5FA 1P74A 4KUHA 4M55A 1JKFA 3Q9NA 5DN9A 1UXGA 2X5JO 4F3YA 1GU7A 7MDHA 1GAEO 1N1GA 1R0SA 1D1SA 1NWHA 1M6WA 5IDWA 1GR0A 5KNLA 2JFGA 3QP9A 4MINA 2OOSA 3EGOA 1MLDA 5A03A 1GPJA 4P4NA 3U5TA 3KB6A 2AHRA 2FR0A 2IZZA 4HFMA 4A10A 1YJQA 4JIGA 3WYCA 1FDUA 5JDCA 3GVIA 3AI1A 4U6QA 2IE0A 4BVAA 2AEMA 2UV8A 4M54A 4KQXA 2O2YA 5FYDA 3FTPA 3GUCA 5F5NA 2DPHA 3H9GA 3ADOA 3HG7A 4IS2A 2Y1EA 1I8TA 4WE3A 3UHAA 1U8XX 1YBVA 4YCAA 2I5PO 1LC3A 2O4CA 3KSDO 4GX0A 1WPQA 1P31A 1Q1NA 3T7EA 5T57A 3STHA 4NBTA 2GCGA 4LVCA 1CETA 2WDZA 3DDNA 3NRCA 2AQ8A 4IMPA 4H16A 2I66A 4R5HA 4YRBA 2IYOA 2ZJ0A 3VPXA 3R3JA 1Z45A 1LX6A 3H9JA 5JLAA 5G0VA 4Y8VA 4NHEA 4G81A 1YQGA 4WOJA 4YRAA 2X86A 3ZN2A 1G0OA 2PR2A 4XYLA 3VH1A 1Z73A 3DBVO 1LUAA 3PLNA 1E0DA 3PI7A 1M76A 2UAGA 2BF7A 1VSVA 2QQ5A 3SLKA 2IZ1A 1UXIA 1B7GO 4NPCA 4QO8A 4XJSA 1SNYA 4L75A 3CXRA 3I9OA 3IP1A 3P7MA 3GH3A 2NVBA 3DTYA 1WP4A 3GUYA 2EERA 5ILOA 3GHYA 2BFAA 2W4QA 3M1LA 1CQJA 4H3VA 2CD9A 4CMEA 5IN4A 1XHLA 2VWQA 3RASA 5HBRA 4GVXA 4M1QA 5FI5A 4EEZA 2Y1GA 3V2UA 4IXTA 3DAGA 1KC3A 2FY8A 1DHTA 3CZRA 3ZH2A 4PLYA 3C1AA 2CSUA 2O3JA 4JP2A 3TN7A 3I9NA 4D0SA 1BVRA 5JBIA 4NMHA 4OOFA 3ZW8A 1W8DA 1GCUA 1YH3A 1PZEA 3IL2A 3JD1A 2O7SA 3D0OA 4BV8A 3EW7A 4YJHA 4RPGA 4A7PA 3ZU3A 1PX0A 1EK6A 1PGOA 1X13A 2VQ3A 4I1IA 4IS3A 3VTFA 3DZKA 3GK3A 4YXFA 2QIOA 4I5GA 4RLHA 4NK4A 4WCDA 3PGJA 1G0NA 4M8SA 3HDHA 2Q2VA 4LRTB 3LQFA 4WECA 4DUPA 3KRTA 1ZW1A 2C5EA 1LRLA 1X15A 1NFQA 3ETEA 1O8CA 3L6DA 2OP1A 4GX1A 4LW8A 4OKIA 4Y6SA 3WX0A 4C7KA 5JYDA 4IDEA 4MVJF 2C29D 3M1AA 1UXKA 3H65A 1S7CA 1ZJZA 2C0CA 4JK3A 4R3WA 5ITVA 1LBEA 4OH1A 3DHEA 2YHIB 4WJZA 4MP3A 2PKQO 5K6AC 1EK5A 2G1UA 3PFFA 1NPYA 2YDYA 3DBRA 3DZGA 1H6DA 4PRLA 3MJ4A 3ZWMA 3P5SA 4G2NA 4ZQGA 4CM1A 1NR1A 3WLEA 4FBGA 1EDZA 1H2BA 5DDIP 4MKZA 4C7JA 1WMBA 2Q46A 2J5QA 3QVWA 1XA0A 1E7MA 2H63A 3ZI0A 1PWZA 2AE2A 1V3TA 2PGLA 4NBRA 3S1LA 1PQWA 2NLOA 5FF9A 2GSDA 4XWYA 4CM7A 4ZGWA 3GQVA 4BO6A 3KXDA 3D5QA 1WLYA 3M2TA 4PLTA 5C7OO 5ICSA 1R4MA 4NI5A 4BO3A 5KTKA 5L7TA 1KVQA 1NPTO 1Y6JA 3CMMA 3KOUA 3W1VA 1YE3A 4NBVA 1V35A 4I8XA 2X9VA 1ZNQO 2HAEA 4FR5A 5IDXA 3PVZA 2EEZA 3R3SA 4P22A 1LDYA 4YAGA 1HE5A 2VYND 3F3SA 3I9JA 1YB1A 1B3BA 2JD0A 3GT0A 1NQOA 4IQ0A 4U6SA 1KY5A 2E37A 3JYPA 2VWGA 1I32A 2C20A 4UEJA 1RM4A 2WSBA 3QWFA 3LF1A 1H94A 1EUCA 3HADA 4NFHA 5BR7A 5JO9A 4XIJA 1DSSG 4W82A 2J5RA 3UFXA 1DHRA 3GG2A 1S6YA 2NU6A 3H3FA 2ZYGA 3K8ZA 4ZU3A 5AQ1A 3JTMA 1U3UA 3NTOA 5TJ9A 4XYMA 5JW6A 1OC4A 1KERA 4RGBA 2ZB3A 1T2EA 3WNQA 2YHIA 1NFRA 1ML3A 3RUHA 2Y93A 4BGUA 2P5YA 2BI7A 3C1TA 3DZJA 5BSFA 3OECA 5U4QA 3S2IA 2AQKA 1X14A 2HMWA 3L4BA 4INAA 1HDCA 6ADHA 4Z9FA 1HE3A 4DWVA 2PWZA 3CINA 1D7OA 2IXBA 3QVSA 2NTJA 2PA3A 1ONPA 3G3EA 4CODB 1NX6A 3GDOA 5DULA 4R68A 2BFMA 3INTA 3K2BA 4BO1A 3K73O 3WMXA 3RUIA 1ZXBA 4QEDA 2PD6A 1EE9A 3TFOA 4N54A 4E0BA 1UJMA 4IPTA 4UVGA 4BNKA 1XSEA 5TQVA 2JCVA 3VAZA 4MVJM 4IDAA 4B4UA 5A3VA 5U1PA 2AE1A 3WNVA 2VT3A 3VPFA 4DBVO 1EVJA 1KEUA 3OEWA 3F4LA 3W4IA 1C0PA 2YV2A 4JJIA 5BNFA 3S55A 3WGOA 1H0KA 3EAGA 1QRRA 3VZPA 1MB4A 4BV9A 2WYWA 2R6JA 1EZ4A 3ZNQA 1RYEA 1E3IA 4YYZA 3HWRA 4NH4A 4ALNA 2HK8A 2X58A 1QORA 2NWQA 4CR6A 1TEHA 1ISGA 3DB2A 1ZO8A 3DBHA 4UEOA 5DBFA 3PK0A 4TRNA 5DCWA 4Y6PA 1DIRA 4RPHA 4GQAA 1VSUA 1O89A 2POQX 4NJMA 3F1KA 4BMNA 3WGZA 2CZCA 3V1TC 3QIVA 3PWSA 3FNEA 5LDGA 3ZWWA 4GVLA 3GZNA 1LLDA 1XELA 3N74A 4MVJA 3JYLA 2HLPA 3AU8A 2GNAA 1E1KA 1PQPA 3CSDA 1X7DA 4IDFA 4JQCA 4AFNA 4CPDA 4TZTA 1NVMB 5THQA 5ENVA 1E3EA 3P2YA 4R01A 3DHNA 2G17A 3AI2A 4B7UA 1UDBA 3CEAA 4FQ8A 2GN6A 4NDNE 4YRDA 3SBOA 3PHLA 1R12A 1YDWA 1E92A 3NDRA 3L0DA 2Y1OA 1B2LA 5C7IO 2JAHA 4MVJE 3W8EA 1A71A 3ETDA 4JJGA 1QP8A 4CLDA 3QVTA 2A35A 1XYGA 4RV9A 1GUFA 3MJEA 2VOEA 4YJFB 2G76A 3ZWAA 1XWFA 1I3LA 1Y5MA 1EQ2A 1EE2A 2OGUA 4QX6A 1C1DA 1P1RA 1Q2XA 2B4TO 4L8VA 2A92A 2AQIA 3QSGA 4MP8A 4UUOA 3ZWPA 4YAIA 3BHJA 3GRPA 3B1FA 3BHIA 4Q3NA 5KCZA 3PRJA 5EINA 4J9VA 3GFGA 1NVTA 1ZIDA 1Y5RA 2VWHA 3ZCXA 1H6BA 1YGYA 5C3MA 5JO0A 4H7PA 2VUTA 3GEGA 3WLFA 4IJKA 1JWBB 3G17A 4RO0A 4OHUA 4I9UA 5F5LA 4IZHA 2EV9A 1T1SA 4UVHA 3WSVA 4M86A 2XXBA 3JQ7A 4OJNA 3M2PA 1J4AA 4IZIA 4PIVA 2DPGA 2GN9A 1PWXA 3ENNA 2P4QA 1O9BA 2DM6A 3NEPX 1HYGA 5KKCA 5L53A 1AHHA 1ID1A 2ZTLA 2YDXA 4RORA 3DFUA 3MWEB 4FC7A 3U4DA 5C7LO 2YJZA 3BTVA 3I52A 4BNWA 4XB1A 1UZLA 2HMTA 1VKNA 2CMDA 4CQMD 3WGGA 5A02A 2J3HA 1IOLA 4IQGA 3SX2A 4OXNA 1E77A 3D3WA 5I9LA 2AEJA 3L6OO 4XGKA 1P33A 1W73A 4O0LA 1IZ9A 3UN1A 5BSEA 3NT5A 4CM3A 4HXYA 1GZ3A 4BB5A 4YEDA 4L4RA 4E30A 4GGOA 4Z0PA 1Q7BA 2X23A 1HXHA 4HFNA 2D4AA 1ULUA 4AJNA 5BSGA 1SZJG 3PDJA 1XIVA 4WKGA 3ZWYA 1NFFA 4XRRA 2PZMA 3I5MA 4GSLA 1KBZA 2Y0EA 2VWPA 4LRSB 3RUCA 5CP8A 2VHWA 5L7YA 3AM3A 3DZBA 3PJDA 2NM0A 4AJPA 2I6TA 4J7CA 4E4YA 1BMDA 5HTOA 3DL2A 3KYBA 4H15A 3I83A 4EYEA 4W6ZA 1OI7A 4AJJA 4YPOA 4BNNA 1LDGA 3U62A 5LC1A 2AXQA 2NTNA 5GZ6A 4BNFA 1P1IA 4KUEA 5F3RA 2DTDA 1DB3A 3JQAA 4F45A 2A94A 1R4MB 4IGEA 1T24A 3JQ7B 3UKOA
chains in the Genus database with same CATH superfamily
3EXEB 2LDXA 1DO8A 1PT5A 2ZUFA 1RRPA 2PZJA 4UHFA 1G8KA 5HBGA 2QQEA 2P30A 3JQ9A 2AD1A 3TG8A 3UWMA 1AGRA 1ODSA 2Y3IA 3WQBA 4ALMA 1ZGHA 2YH2A 1XQVA 3BMQA 4E46A 2W6MA 4C0QC 3GU3A 4J0JA 3VR5A 1XTVA 1SB9A 1CV2A 4HWSA 1OHHA 2B8EA 1SPXA 4KXYA 4WI1A 1Y8ZA 1GA4A 2HLDD 4PSVA 5FL3A 2QJRA 1PS9A 3BWYA 1MFZA 1J9ZA 4DANA 3LGXA 3G5UA 2A4KA 5MF6A 1QGOA 2AOUA 3K6JA 1ODIA 1PVVA 3EGEA 3ND8A 4UUMA 1WB4A 2P3LA 4Q01A 3ROZA 1YI8A 2PN1A 3T15A 1AGPA 3P19A 5JD6A 3I0ZA 5FBKA 2GETA 1NA5A 4Y9SA 1II0A 3UXYA 1QG0A 1RPAA 2V4MA 4B3MB 1H2RS 2ILTA 3K5PA 1Z0DA 4ESHA 3D9QX 3LUAA 2XMGA 4C0BA 2QMZA 3NAZA 3RRFA 2GCOB 4MCJA 2NZ8A 4RWZA 1CWUA 4B73A 2CVQA 2RGWA 3FPAA 4MVWA 4BWGA 3FCEA 4EI2A 1X7ZB 2JH8A 4Y2GA 2HLNA 5JSQA 2XTZA 3PTLA 4JJ8A 1JXAA 2ONKA 5HX7A 1WXFA 3SC2B 4MZDA 2ESRA 4FOPA 4WDQA 4LOKA 1NXVA 4FIZA 5EE9A 5HOEA 4ERNA 3HLTA 3T7TA 2CFSA 4KN8A 4Q9NA 3BCUA 1USGA 2QLLA 4E5NA 1OW3B 3C85A 2WV9A 3TZCA 1NYTA 2O07A 3AR7A 2BKXA 3OD5A 4BRUA 4LMAA 4D4LA 4YAUA 3RTDA 1DCFA 1ZGZA 1PJBA 2FVXA 2CWWA 2Q8NA 4LHEA 1UP6A 2QL5A 4OBWA 4UU7A 2HZBA 4ZI7A 2R4UA 4WXEA 3ZWXA 4J9UE 2X1HA 1H5NA 4R0VA 3L4JA 2J0SA 2V6FA 4MWTA 4QG7A 2GBGA 4OQFA 2C7GA 3GNTA 3N58A 2QW8A 3TNJA 4EG7A 1E3TA 2FP3A 3ZWDA 4DPMA 3UMMA 2A0UA 2G09A 4PBSA 2OY0A 2Z3VA 2VF5X 2BEWA 1HMYA 4NZ9A 4EG1A 5DX8A 2MIIA 4C2AA 4ZU6X 4Z4EA 1V11B 4JSRA 1LQUA 4KTVE 4RIGA 3S40A 3UXEA 3FTNA 3KUCA 3WGHA 1MX1A 3JD2A 4OK6A 5KQGA 3D8BA 1IBCA 2TMDA 1OTHA 4PXYA 1QPZA 1W49A 1OAKA 1I1HA 3L7YA 2AOVA 1NE7A 2QJWA 2WIAA 1ACLA 2UUOA 2WT9A 5FFFA 4ZGGA 4Z53A 2Z8XA 3JR7A 2I7XA 1KDOA 3E4CA 3OQIA 1UJ4A 1FL9A 4IXDA 4DLNA 1SBZA 2P3SA 3DNFA 2FPGA 2VHQA 1GN9A 4RA9A 4BCBA 3D7SA 1EUZA 1R16A 3EDMA 3NWEA 3SKVA 4YUXA 1K7FB 2FU5C 4CEJB 4M8IA 2C82A 4D8VA 4LFAB 4IIDA 1VPTA 2OQRA 1EX7A 1Z7WA 1PFUA 4X44A 3L1VA 3I8OA 5KOJB 1P3DA 3UWOA 2OCBA 1KQOA 2EG9A 1ZJ5A 4MR7B 4JGBA 4KITB 2V7TA 4FS3A 3SJZA 4EZIA 1ZXLA 4NE9A 3W90A 4R1MA 2EQ5A 2O8DA 1JR3E 4OYLA 4CYMA 4DBLC 2IEBA 5JY6A 1KI9A 4R5MA 1ZDMA 2L82A 4TS1A 4HH3C 5BN3A 5JYCA 4QWWA 4F9FA 5J4VA 3SICE 2Y71A 1K1EA 1Q1EA 4CF7A 1VDZA 2VK1A 4A82A 4EVIA 3C6YA 2XRMA 2G5GX 2VCEA 3EA5A 4BUJA 4O5OA 2FW8A 3G0IA 3L41A 2FPOA 4XWGA 4GWKA 4R6XA 3WQQA 1POXA 3PJFA 2P2ZA 3E05A 5IFKA 3GDGA 4QSMA 3PDWA 4L07A 2X9GA 1QYXA 1P81A 1F1JA 4C4OA 2JHCA 4WADA 2GAIA 3HU1A 1MQSA 2GKGA 2SCUA 13PKA 3AETA 1A97A 4LVOA 1QX4A 2O8BA 1QAOA 1ECPA 3INGA 3T5TA 1V11A 1SD1A 2VAPA 4CM5A 1ZJ6A 2OD7A 2PX8A 3KB2A 4MH0R 1BX1A 4DLAA 4KX5A 5CUQA 1PCXA 3ORRA 2XUQA 4EHFA 1QAQA 3NEAA 3FTFA 1CEYA 1YHYA 5DM0A 4PLVA 3QUTA 3RTCA 4C0LA 5LQJA 4TSFD 3FD8A 4JI0B 1HLDA 1DDOA 1FYXA 4L1KA 2I6QA 3GJ7A 1NUHA 3MGBA 3F78A 2QRJA 3DJYA 4B3DA 1TDJA 2I6FA 3AW8A 4FDVA 1GNVA 5JJ5A 3KQNA 5GJWC 5LOVF 2BAGA 1JQJC 1Q2UA 2ZJ4A 4IF6A 1PQYA 4FFVA 2F00A 3OG9A 4ND2A 2FN8A 3AV0B 3VO8A 1UPAA 4KFCA 4LVNA 2C4UA 3AYXB 3GJ5A 4HCJA 4OX9Y 4UREA 2JJ1D 4JITA 2QSYA 1UPXA 2XR1A 1D6MA 1QOZA 3N70A 2Y0BA 4KTTE 1AGNA 1IYZA 5DZSA 3RYTC 4E6EA 4CEHB 2NV0A 3V32A 5DSZA 2YNMA 5IK2A 4DMKA 4NMXB 4F4DA 3JQAD 4XX0A 3Q2IA 4MHSA 4NWIA 1ZN7A 4BFCA 4N76A 4MIEA 5EZYB 1A8UA 3BMQB 6REQB 4LOIA 4C76A 4P4UA 4DA4A 4CJXA 1U9IC 1THMA 1YNOA 4DBZA 1GQ2A 4R31A 4TX1A 3E23A 3HBNA 5JH7A 1Z07A 3QFSA 3TAUA 3KOMA 1SXJE 3LQ2A 2FN7A 1XZAA 2H5LA 2WB4A 2K7ZA 1MBZA 2ZUCA 3F67A 3IS3A 3OY7A 2QR3A 3VYVA 1N8NA 4PLWA 3H2BA 3T7JA 1SKBA 1ZH2A 1U04A 3I5UA 2W42A 2O5CA 4U00A 3MT0A 3WOHA 2CNDA 4GBGA 3P2KA 1CR4A 4P3OA 4ASUA 5DMHA 4I5IA 1YDEA 1ZWKA 4BQEA 1AGXA 2EFYA 3STYA 2BBTA 4IDGA 4DHEA 1PE0A 2ASVA 1AT1A 3EW9A 3P9IA 1KI8A 4I1VA 3NEYA 5FADA 2CE2X 3R09A 2UZ3A 1FFWA 2VJLA 4QJ5A 2HHJA 5FR1A 2A5DA 3BL6A 1XMVA 3KYDA 1EDDA 3OHMA 1RE1A 2O3TA 2P7HA 1Y1PA 4JR2A 4YJ3F 3IKTA 4N5IX 4XOUA 1SAYA 1Z62A 2BRUC 2GARA 5TPWB 2OVFA 4O4IA 4DGQA 3IESA 4UEWA 5BWCA 2PMWB 2FG6C 4F1JA 3S2EA 2R751 1VPDA 4MYDA 4BEBA 2FEXA 4N7BA 2J59A 1OC2A 2F9LA 2IL1A 3OUUA 5C5EA 4J94A 1WKVA 3KHTA 3LPMA 4UHEA 1Z12A 3SFTA 2EJTA 1E9AA 5EIEA 2DYKA 4UBMA 1L6IA 3KZMA 4LC9A 5AIBA 3NAGA 3EWIA 1UC4B 2C2YA 5C3UA 2V59A 4E13A 2DLCX 1PR9A 2GPWA 2VZEA 1OWLA 1TF2A 3ET5A 1FNMA 5BQOA 2DHRA 3QPVA 2CLHB 1MFPA 1Y5LA 3NEJA 4NF2A 4OHPA 2NO0A 3ZE6A 4OI2A 3TQRA 3HTXA 4MJLA 1X42A 2ZT6A 3EIWA 3D2LA 4GRAA 4K0RA 2QNIA 3AJ9A 4GPZA 4YP9A 2BFDB 5LD2C 1P3Y1 3K70C 2PLNA 1RWXA 5CW2A 1N5DA 4FOTA 2LPMA 4UNNA 4AICA 1KA9H 3VGPA 3VU3A 4G1CA 3KLOA 4W8OA 2C5BA 4F8YA 3X1JA 3WLOA 3DV2A 1Z74A 1QVRA 1GV0A 1LA2A 1T0UA 1U5CA 4YUAA 1GZ4A 3G49A 4ZXFA 1VL8A 1KMMA 4X1KA 5CFOA 3JVEA 3H97A 1UOQA 4F46A 4CM4A 4AMUA 4BTVA 4EHKA 2QMUA 2XDWA 2DR3A 1C0KA 4P0QB 3E9NA 3K1YA 2KHZA 1VKHA 3RD5A 1NW6A 1T1JA 4G0YA 3V2HA 2Q1WA 1SXGA 2PNJA 3QMMA 4I1SA 2D5BA 2W2QA 4BO7A 8ABPA 1WZNA 2FJ0A 3N2KB 1T1GA 1REQA 1PYOA 2R6AA 1KYZA 2J7KA 1J23A 2DQZA 1A7UA 1L7AA 2HCBA 2X2EA 4GP7A 2GB4A 3CJTA 3DW3X 1SQFA 4FS8A 4J4HA 1E3MA 3CUVA 5TGZA 3CN7A 1NHGA 5CPBA 3THYB 5EEGA 3SE0A 4NYJQ 3FCXA 1RACA 3AFHA 4MVJG 3AJAA 3QV2A 4PC7A 4WBNA 3JASA 3BVPA 1VMIA 4CKYA 4RE6A 4QLBA 1CKEA 1E3JA 2BOVA 2JD2A 2GLXA 4YROA 3PHGA 5AI8A 1ZU4A 1N6HA 4YHHB 1IBSA 1P7CA 2F9MA 2NZWA 5HIJA 2HDNB 3OE4A 5K09A 4R1SA 3WHPA 2C92A 5JEDA 1MD9A 1EG2A 2CBGA 2FMUA 2IW3A 2PJUA 4MQFA 3RROA 2Y1DA 5JAUA 4D8WA 4X97A 4K2HA 4KN9S 2BZGA 1UPBA 2RBKA 4YRPA 3DBHB 1UBJS 2WWRA 1JDVA 2C4KA 2C5FA 3DBLB 4L6CA 4OJQA 1ISSA 4NTZA 5IAGA 5A4IS 3G5AA 1E0AA 2BM1A 3NAQA 1SJ9A 4IO0A 1P9NA 4U02A 4U7TB 2NVUA 2ZOSA 3N5KA 1JU3A 1TO1E 2V6BA 2JHPA 4D56A 1FUYB 2QZ9A 2VKTA 3HJRA 3B3QA 1QLJA 2IDMA 2WEKA 2I2WA 1YQEA 3B1JA 1E2JA 2V8BA 1TA9A 4LZJA 3SLRA 1DAPA 3VAYA 4A6XA 3BK2A 2M98A 1SOWA 1VKOA 2ONJA 3GJZA 3HNRA 2X0FA 3B78A 5BSMA 1KFJB 5EJFA 1YBMA 3FVVA 4BFZA 1SHKA 4IP0A 3LBAA 4MKIA 1NQAO 1R8SA 3L0BA 5BSHA 2WT8A 1CRLA 3MINB 5A1JA 5AVWA 3GFTA 3K96A 2FKAA 2EBWA 3I28A 3SZOA 3O2QB 4K7JA 4GGPA 2AJ8A 1G21E 2ZG6A 2N1BA 1W6RA 5DI3A 1JEAA 1Q0PA 2C84A 2CFIA 4L74A 1VCNA 4P08A 2XNKA 1HDEA 4NFYA 4QNNA 3F7NA 5AW5A 2IXGA 4RESA 5KYKA 2IA5A 1AUQA 3EVTA 3R0IA 1CEQA 2XJ4A 1DXYA 1JR6A 3TSZA 4MB2A 1B4DA 1Z7EA 1XMJA 4LSGA 5LLTA 3GP8A 3H1PA 3B7WA 2YW9A 2G7ZA 2ZYSA 4K9RA 4YP1A 2WMOB 2HBQA 4N3NA 4JN6B 4LDRA 1WF6A 3B38A 1XDZA 1E4YA 3DDUA 4M9SA 4ZRMA 3BWVA 4MQFB 2I2BA 3TOVA 1CB0A 4HWPA 3UW3A 4NEQA 1K2VN 2CW5A 1ABEA 3K4QA 4ZVVA 4EEXA 1QGYA 3FDXA 3FWNA 1KTVA 3REOA 4EO4A 4EITA 4J0QA 3A4MA 3RHFA 4DMLA 4MO9A 5B12A 1ADFA 1HUQA 1OT3A 2PSHA 2WPNA 4BZZA 4RQUA 4LMRA 1NNEA 2NXWA 3D2CA 1TVMA 3DBRB 3NVDA 4UW9A 2QD3A 3JAMA 4PCVA 3IMFA 2XBMA 1J8MF 2MHCA 1AKRA 1NONA 2NVUB 3IGFA 4A5OA 4DPLA 3ZV3A 5AVRA 4RDHA 3UXMA 5KS2A 2VZLA 3HSKA 1X1EA 1AUPA 1FA9A 1JSZA 3BULA 4M89A 4ZV7A 4DLLA 2JLWA 2OSVA 1OI3A 1ESZA 2F3SA 3OZUA 4MR8A 1M2VB 1PR0A 2H8GA 4QFCA 3Q5DA 1A5SB 2CE7A 3O7WA 4CLHA 1CZUA 1LQ2A 4E5PA 3D6HA 4EUFA 3E03A 1IXZA 1FS6A 1XB2A 4JP3A 3RRYA 4D9KA 3TUZC 4E32A 5K0LA 3WQHA 3H3JA 2R3SA 3GFRA 4HDMA 3MLEA 4P2GA 5F4ZA 2CBXA 4CQMA 1D4ZA 1HH4A 3DFZA 5BR1A 2FEKA 1D9XA 1BSVA 2FX5A 5AUOB 5KVSA 3SXPA 2IXAA 1JX6A 2XT9A 3DDCA 1TQ6A 1KFEB 1RKUA 1CR0A 3KJGA 3DM5A 4UCQA 3KPYA 5KOHB 4UNSA 4IQFA 2F62A 1OD6A 3K2EA 1EDOA 1U0BB 3N2IA 3NUGA 1U11A 2J9FB 4KH0A 4ID3A 1GVHA 1O5IA 4RCYA 3K7EA 2ACWA 3GGOA 3TMKA 2ZRNA 4KV7A 1KYWA 5GADl 3WYNA 1NASA 3DC2A 3F0TA 4G1FA 2G1AA 1V1RA 1PD1A 2WJPA 4FQ7A 3SR0A 4U39A 3IUMA 2FPRA 1FZTA 5FP0A 1OVGA 4C5CA 4AX4A 3AJ8A 4D43A 2XTNA 1OBOA 4DR5B 3NVKI 3NYIA 1L4EA 2Y67A 2GH1A 3FHLA 3OMXA 2J0VA 4YDRA 4CM4B 4FSHA 1N2EA 4C08A 3BMOB 1ES9A 5CH3A 4KQKA 5LNK1 4RYDA 4TMFA 1IM2A 1WDKA 1CIVA 2C2ZA 2TECE 5ES3A 5KSOA 2DQSA 4PO8A 1KMHB 3OQOA 1GSIA 1FXUA 2DTXA 2NTVA 3BXFA 1B8UA 2A0WA 3DAYA 5DIZA 4FWTA 4GH5A 1E4EA 3IPLA 4M83A 2O8DB 3M4ZA 3TCNA 2RONA 2OA0A 3HQ4O 2JFNA 4J0KA 1WZ2A 1QU3A 4YAKA 1J0BA 4S1VA 4GW3A 3D8SA 4JB8A 3R44A 2LRHA 5CYPA 4JBXA 4TS4A 5TPWA 1ULBA 1IBKB 3G82C 3K9LA 3N07A 1OGYA 4NJEA 3K9HA 4GMGA 4Y0VA 1NXPA 3L8CA 4MWDA 2WU1A 4YX9A 2QTAA 1MN6A 2ENUA 2Q0HA 2WD7B 1RHRA 4RJTA 1R3UA 1CRQA 1RYHA 4UHKA 4W9NA 3Q9UA 1WMSA 1Q77A 4RF5A 5D01A 2CN1A 1D2MA 2WA2A 3TGLA 2QM0A 2YNMC 1EFPA 2ZSKA 2P90A 1GZ6A 2YWDA 1VRWA 2AYZA 4KJXA 3QVLA 5KOHA 3G2KA 4RULA 4G85A 1K75A 1UJNA 5AW0A 1CLEA 1QZTA 2RHDA 2R2GA 4AG6A 5KAPA 1WV1A 2Q8PA 1O97C 3LD9A 4I50B 4UNPA 3V2GA 3REFA 3TL3A 4CQJA 4LHVA 4ZYUA 3F3YA 3SC2A 3ENZA 4Y6LA 2GF2A 1RVV1 3ZNNA 4EFDA 3EH2A 3KVNA 5C32A 1LXCA 3IIJA 1N32B 1V4NA 3TQSA 1FXSA 1WLSA 4KXFB 3ZE9A 1WHTA 2ZAOA 1OF1A 4HH4A 5LU9A 2P77A 1OIVA 2ZE7A 4LK2A 3VHRA 3NNNA 2IUUA 5AW4A 1N34B 2ROQA 4EKEA 1K5DA 4WLNA 1VBMA 2I6UA 4XI9A 1S3GA 1SIOA 2XVYA 1KPGA 5JHHB 1GWNA 1U7DA 2F1RA 2HJVA 2XYHA 1II8A 1KO5A 3LQYA 1EFVB 4KUGA 3RU9A 5LIRA 1XNQB 1XCLA 1XCGB 2EJUA 3N7UA 3OTIA 4HAIA 4QFMA 3WYAA 4B6RA 4CW7A 4ER5A 5KTSA 2B2NA 3WGKA 1MNAA 3PUZA 3UMVA 5KMGB 1RI1A 2QXTA 3CRW1 1PS8A 3MLAA 4GOLD 2VL7A 3G23A 5E6UB 4MDEA 4CF6A 2LD4A 3EG9A 2Y4OA 3OOYA 5J2TB 3H5OA 2FR8C 2VJDA 3VR5H 1N3BA 3A6FA 4ANFA 5BORA 4IEFB 1YZYA 2HTFA 5JWOA 3GD5A 3T35A 1TVEA 3QUQA 2DUUA 4LYHA 4FB5A 1MO4A 4Y0NA 5HIMA 3B2QA 4KDEA 2XKKA 1MXFA 2R6GA 3LSTA 1E60A 2PZFA 5F73A 3UBTA 2VXOA 2CL0X 3OD1A 4GZ6A 4PG7A 3FMGA 1JDUA 3FZEA 5IANA 1FX1A 2PGAA 1PWEA 3K20A 4ZYVA 5EHZA 1VI5A 2IUFA 1QF9A 3OIUA 1H3FA 3N0XA 3QGMA 1LB1B 2W8BA 3KEGA 4RTMA 5TF4A 1ORRA 5GM2A 1QG2A 2FLKA 3UANA 5LLSA 4EL0A 1KK3A 3RRNA 2QK4A 3OZTA 2R1VA 1KU0A 1YJCA 4RANA 1YOBA 1P1FA 3U7JA 2F3TA 1ZM2A 1QHSA 5ESXA 2FOIA 3DAFA 3PEEA 2RB5A 3NO4A 3RYHB 3L7IA 4OFXA 1QHIA 2P5SA 3JYOA 4X00A 4CR7A 5TQ0B 1FDOA 1Z56C 3LHIA 4L7QA 4CMIA 5C80A 1A2QA 4GX5A 3L4SO 3TSCA 1LBTA 1M6YA 4PFJA 1DZIA 3USCS 4J0GA 4ZQBA 2ZQYA 2D5LA 3BS4A 3NBKA 2NO4A 1P80A 4B47A 2P40A 3MNFA 1R0BA 5HF6A 4DREA 1XQWA 5HF8A 1USUA 3KQLA 3SU8A 2DAPA 2QP9X 4WESB 5CFZA 5IH3A 5FPKA 4QREA 2CDBA 3AKDA 1VPEA 5JY1A 1H4VB 3BE5A 1OB2A 1KJJA 5J58A 4JI2B 1AH2A 5DNYB 1BWPA 2WVHA 4B6EA 4Q12A 4HSGA 4DOMA 3GFPA 1YDFA 1QIJA 1R6TA 4IEEA 4IKEA 2BCEA 2WM8A 4WWHA 1NVWQ 5LXTF 1CUHA 5DP2A 4YMTA 1YL6A 1QH0A 2UYQA 2VDPB 3M70A 1NW8A 1C1DB 3FYTA 3MLBA 4IHKA 4J0CA 4TUYA 2C2MA 3PUIA 4BPBA 1U1IA 5H68A 1FXWF 3DTNA 3SQDA 4CGYA 4F5YA 2OSBA 4LNUA 1KYYA 1AY0A 1XNJA 3I45A 3IHKA 4MA5A 4X6YA 1CR2A 3T61A 2R84A 1GGHA 1RYDA 3F6PA 1JXOA 4CI0B 1IMJA 2OFPA 3CZ5A 4NYMR 1L4HA 2E5LB 1MR3F 5BSTA 1BIFA 4ACAA 4N6GA 2JBAA 1HORA 2WZCA 4TS3A 3WXMA 4EFKA 3ZXXA 5U9CA 1G9XA 5K2OA 2GCOA 2YUTA 3L01A 3RBVA 3TNFA 3U2QA 1DKUA 3LYLA 2KBEA 5J9FA 3TTUA 4EY7A 1NBEA 5KPDA 1MV8A 3K9GA 4PGFA 1A9PA 3QPBA 2FP4B 3R3WA 3S29A 5T5QA 2FUG1 1DX6A 4TRRA 3T3EA 4TQGA 4L73A 4OLJA 1DWQA 1XHFA 2DPXA 4MVYA 4YI5A 2WIKA 1Q95A 5DSXA 3RM3A 3DGFC 1BE1A 2PWPA 3ZW7A 2O6HA 5HR5A 3WK7A 4EB0A 5JC8A 5KYXA 1E4VA 4JBLA 4UAGA 5HPYB 1A27A 1ZW6A 4DJAA 3QKSB 2A58A 4GAEA 4EY8A 2E6UX 2IBMA 4RZXA 3L0OA 3LAWA 3WI7A 4PE5B 2Z4SA 4TSFA 5F23A 5KNBH 1TO2E 3BMNA 5C8DA 3WLPA 3OH8A 5E6SA 4AG3A 3FN4A 3K4PA 4HMOA 4CCSA 4PFSA 3KYCB 1ULZA 1Y7IA 2RC6A 5ENDA 3PDCA 2IEYA 4LWQA 5FI1B 2Q9BA 3WZLA 2IEIA 1RWKA 4YRMA 4DV1B 4DARA 1CVIA 1OYWA 3I3OA 4G09A 4JNCA 4FPXA 3VR2D 4ZJPA 2WD7A 1NMYA 3T99A 5E95A 3RR2A 4US1R 1FTNA 1P2BA 2CJPA 3V1LA 3ZNPA 2YJGA 3JYNA 2PH1A 1W85A 1SKQA 3NOQA 4LZZA 3JQ9C 4JHLA 5DE3A 4LZOA 4RUKA 3FJ1A 1L4UA 4FJ1A 3TZBA 5FUXA 3V5NA 4DDMA 3OCCA 3QMWA 2XMCA 2C3MA 4K1XA 3FSEA 4R81A 5HCUA 5IUKC 1XZEA 4GYKA 2X5KO 4JBWA 3TDMA 3TLGB 3NTQA 1KARA 3AUYA 1ZD8A 3OQBA 3I72A 5GIOE 1TQDA 3RTBA 1VHLA 1IMOA 1GFWA 4EF4A 4JUBA 3R8CA 1IRXA 2CL7X 4LXXA 4D42A 3AY7A 3SS9X 1EWQA 4HD8A 3NFYA 1XX6A 2YQ5A 4RMHA 5BUQA 2V7GA 2WSLA 4YP5A 4YACA 3COJA 3NAMA 1GTVA 1MAUA 1RWNA 2I8LA 2QLBA 1DC8A 2ONCA 2IPMA 2QTTA 2RGCA 2BD0A 4B3IA 4TVKA 2QVYX 3ZX4A 4C78A 1H4TA 3G2NA 3HB5X 1SUEA 4I1YA 3U3KA 1VJ0A 3QFCA 4LZLA 3RC9A 4YT8A 3ZV6A 5C81A 3M6UA 5FWXA 1W36C 1TADA 1VCOA 1FNBA 2H57A 4PONA 4NYIQ 5EQDA 5FUYA 3V46A 4F3CA 4FZVA 1H6CA 3WO1A 2H7CA 1HA3A 3MHPA 4DQVA 2FHPA 3CT6A 1XOIA 5JD5A 2BBWA 5JWHA 5E4JA 4MWBA 3SNKA 1C80A 1V47A 5LZ4A 1P8AA 5IMBA 1G3RA 4X45A 1SU6A 3KTOA 2B25A 1X1QA 3LZCA 3N7TA 1CUWA 3L6BA 4MUJA 4MRVA 4AS2A 1ZUWA 1SXJD 1JS1X 1GYRA 1RZ3A 1L7QA 3BSSA 4P81A 5BW6B 1I4TD 1K9SA 3LT4A 3HS3A 2W6CX 5JCXA 5BRAA 2BHLA 2H8KA 3RB8A 1UBFA 1M5RA 1P17A 5FULA 2VXBA 4XDYA 4IHJB 4W5WA 2ZYTX 5K03A 1YDHA 1KK0A 5E1MA 2C4NA 1BDHA 3KBBA 3QKIA 4K6HA 3RS5A 1T8UA 1QR6A 2PZGA 4KLRA 5BQ3A 1EFAA 4ZRNA 4J6FA 1EFHA 1KQNA 2J45A 3P94A 1DX9A 3A37A 3Q2KA 5FPPA 2O5RA 2WDPA 1WD5A 4INOA 3LP8A 4U8HA 4BNGA 3DE6X 3HBMA 5EQFA 3Q7TA 3UBMA 5ULLA 1C4KA 2NZUG 3WRVA 5ITSA 3FOZA 2MMGA 1XAIA 4ZOLA 1J1UA 1E2QA 4GD3Q 4JUDX 1GPH1 5CT8A 4B71A 1K88A 2WNIA 3HEMA 4UEKA 4TTAA 3X1MA 5EQJB 3V80A 3HR4A 4EVQA 2ODBA 2D1YA 3RWOA 4N3AA 1IL0A 2FTKE 3HUFA 3VV3A 1TEVA 3RT9A 1ZOLA 1OB5A 3N0VA 4GLOA 1S3SA 5H70A 3PBKA 1R9NA 2F4NA 2WPDD 2ZI3A 3ELBA 3EBOA 2WYHA 1Y8AA 3FAZA 1MX3A 3FGPA 2EL9A 4ML3A 2YIVX 7REQB 2YV1A 1JDBB 3DVAA 4KI7A 5IP5A 5P21A 4BV3A 3GT3A 4LDQA 1Z15A 1XDBA 2X8JB 4AKEA 2VTBB 1G9SA 3K16A 4TLCA 3GQBA 3EOZA 3SZRA 3SSOA 4BKUA 3EX7C 4UMEA 5HMLA 1IFXA 2ZB2A 4TWAA 2Z6VA 5ITZA 1E0SA 3VSDA 4I3HA 1IHOA 1K7CA 1EFRA 4KFRA 2WZBA 3QLUA 5EHNA 3JVDA 4CUJA 3PG5A 1QH1B 2QLJA 2DBYA 4X41A 3VYWA 2JZCA 3H0KA 5DRTA 1GCOA 1NF3A 1FU4A 2YQ4A 1WOMA 3RSGA 1DXQA 2IYEA 2YWGA 5J23A 2I80A 3M81A 2XX3A 1WXDA 1L7VC 3ZDFA 2YC4C 4Y98A 3CR7A 3OF2A 1OPXA 1QP0A 1Z0AA 3AR9A 1UH5A 4KGVA 2AS0A 1P1KA 3H84A 3V8MA 3PQ2A 4MYHA 2G88A 3H2KA 4LBWA 1VRVA 2GGSA 4ES6A 3MCVA 3V7FA 4ZQFA 1YR6A 1CUAA 4UBOA 5C5IA 1M1NB 4BNUA 5B7NA 4B8WA 3ACCA 4BGVA 3CEJA 3AERA 4KO3S 4ECAA 3QOFA 2IV3A 4RXMA 5I4KA 3NGLA 3WL6A 6PFKA 2XCUA 1HE2A 5ARCA 1QG6A 1XF1A 4F71A 3TLJA 4EA8A 3AUTA 4WLOA 4AJ4A 4OHKA 3W2GA 1K06A 1K8YB 1SN7A 1W44A 2VP4A 3OMLA 4KSBA 4R9UC 2N3ZA 3RVMA 4QTYA 4YCSA 1HFWA 1GLVA 2BGIA 3EVNA 1SOVA 1JHRA 3OU2A 1X7XB 1YU9A 4R16A 5D3QA 3VJRA 2A3RA 1QHXA 2FW6A 4JB3A 4ARZB 4EQ6A 1PJAA 2PHZA 1GRRA 2KWIA 4LGVA 3TMYA 4DC9A 4PS0A 1CDOA 2Q5HA 4PYRA 4OI1A 2GZ2A 3NANA 3EY9A 3QVUA 1TC2A 1D2NA 1GGFA 1Q3TA 4N8DA 4G01B 2ERXA 3P96A 1TGVA 2O23A 2P79A 2BTQA 3AF6A 4FSXA 2P68A 1KAGA 2NNWB 3U6KA 4N12A 2PZLA 1AS2A 3TMAA 1KETA 2AIRA 5CM9C 1J2YA 3ZLTA 2EWWA 4Q3BA 2IGTA 3TXAA 4XX0B 1R4AA 3PP8A 4H7DA 1WOYA 3HB1A 3EMKA 5TT0A 3TOSA 4X85A 1QIMA 5CLHA 5ERGB 2I4NA 3TKYA 1OFHA 2NX2A 2Q0SA 3MMPA 3FLAA 1FSZA 4RVOA 3IQEA 5JD4A 3VDXA 1M2FA 5BRNA 3AFMA 4QVGA 2FF7A 4TLEA 4TXHA 5ELXA 2FJUA 2GN4A 4IVQA 5CB6A 1EVZA 4G65A 3HDQA 4RFVA 1C4WA 3TLMA 1OWOA 2Z98A 1JALA 4URUR 2X5OA 2WINI 3DYVA 3H9CA 2AKYA 3SIWA 1WEHA 1XQ6A 3UQYS 2Q3MA 3RFXA 2FMHA 3OIYA 4XCQA 2PNFA 1J22A 2Q1XA 4UJ5A 2D2XA 4RLFA 2FAXA 3LGSA 3W6PA 3HXLA 4EARA 3I76A 1BJRE 3ANMA 3IA2A 3D31A 4EA9A 3GRFA 4MWSA 4HEJA 2PWBA 2W0MA 2BFOA 2E5WA 3H13A 4MV5A 4YAFA 5AKGA 2WHXA 5ER9A 2HA3A 3AF0A 3KUKA 4KIUA 5A3RA 4D4IA 1MT3A 2OE2A 4Q4LA 4F2PA 1T43A 2Q0QA 1SIUA 3NONA 3VMMA 2D8MA 3WGQA 1JR2A 5TX7A 4BEWA 2O2CA 3W5HA 2NO5A 3PQEA 4G86A 3VPHA 4MROA 1KZHA 3DEAA 1TUGA 4Z4QA 3WAGA 1HO3A 1GTRA 5D7BA 1BDBA 3P8ZA 3T3DA 2O7NA 3QU2A 4I9FA 4U5XA 2FYTA 5H81A 5F7XA 2E4UA 4FDMA 4BKRA 5J4LA 1MABA 3PI6A 1VLJA 1EPUA 2D3TA 3DL0A 1GYPA 1W8IA 1EQAA 5CFPA 3OY2A 5BN3B 3IERA 1JILA 2ZSDA 1SXJA 4OL9A 3TYXA 1JIUA 2IZOA 2JGJA 5IYZB 2Z6AA 1L1FA 3ASVA 4U3JA 2G40A 1G5FA 3PIRA 1L7MA 4LUCA 4YDHB 4N48A 3EC7A 1M2KA 2O3QA 1SUBA 1KAMA 1DBPA 2DQYA 4QECA 3HYNA 4ITUA 1DC7A 1ODJA 1OXBB 3VNRA 2FVYA 3W6OA 4KLCA 2ZZNA 1P6XA 1HT0A 5ILGA 1Z6GA 4FE4A 4YQZA 4RPLA 2GESA 5KU7A 3CY6A 3QF4A 1RWWA 4HS4A 4V02A 4CLRB 1GXSA 2DT8A 2O8NA 4HTFB 3DVRX 4KLNA 4M76B 5FBVB 3SEAA 4PCUA 3K31A 4TXLA 3U1VA 1SKYB 4J8PA 2C5AA 1GFZA 4RA6B 1ADCA 3I6YA 3HMKA 2X77A 4B9AA 1OZHA 3IAUA 2Y1KA 4MKXA 3CX6A 1TRKA 5AVOA 4BMVA 3DQPA 1Y4DE 3CW8X 1A7JA 4IQ8A 3VZDA 3HCBA 3UK6A 1SG9A 5CGQB 1VMDA 3I53A 3HB7A 4DZRA 2GRJA 5TVKA 1CSEE 3HMQA 3K9QO 4MYTA 3ENWA 2WJWA 1E66A 4UZEA 3RF6A 1LD3A 4E2ZA 5HQ3B 2CKMA 3URKA 3QM1A 1JIXA 3R77A 4HJXA 2V74B 4ZJUA 2I4TA 1M8FA 2JPDA 4HQ0A 4RVSA 2NU8A 5CCEA 4AM8A 3NHZA 3QY9A 4CQLB 2RK4A 3S2UA 3QVOA 4J03A 5KQSA 3THXB 1JSRA 1A9YA 4MS3A 1P73A 4QC2A 5CT9A 1RRKA 2PPLA 3NHJA 5JCOA 4LHXA 1KR5A 2AR0A 4ENPA 2F3RA 3D3JA 2WWGA 3SHOA 1ZK4A 3IILA 3PUYA 1F3LA 3Q11A 4DPKA 4ER0A 1NIPA 1DC5A 5YASA 4FFBA 4URHA 2GCEA 4ZOCA 4HI0E 4UFNA 3BOSA 3E2IA 3A1SA 2NPIA 3B12A 2AUNA 1Z4KA 2PK3A 4B3TB 2WYVA 3EYAA 2JHAA 3WFIA 3H1TA 5HF9A 4WUVA 3EDYA 3MMXA 1DJQA 1NN1A 1N8KA 2Z30A 4AZWA 2NU9A 5REQB 3EEFA 2Y05A 3FBGA 3O3NB 5JD3A 1J0AA 2RAUA 5LA6F 2C2WA 1WB9A 1H8ED 4CM9D 1T9AA 4D4MA 3QEOA 2Y76A 1C0IA 1PU2A 2WJ6A 4YO8A 5EUBA 4X60A 1XGKA 3RV4A 2NPOA 4MAAA 4WT7A 5CFMA 3NYWA 4JJ6A 1ZH8A 3VR1A 1NC3A 5AI5A 1P4GA 3WYEA 3ZY3A 5IT0A 4D9HA 5BMVF 3TEJA 4DMGA 4NAHA 1C8LA 4ZIRB 3ANNA 2EJWA 2EP7A 4YVFA 4B5LA 3G0DA 5BYBA 5BVGA 3BSWA 5BVGB 5JCJD 1OMOA 1NKVA 3JASB 3BH7A 2C95A 2R00A 4ZGBA 5KWJA 3F3MA 2HFJA 3OEHD 3BQ9A 3FMVA 1P5HA 3GFQA 1ZICA 4IQ4A 4D4JA 4C1NA 2EHDA 1X7XA 3LDHA 4BE4A 4TV8A 3HB9A 1J24A 5HKAA 5BT9A 3PICA 2J08A 3UAZA 2ZAIA 2ATIA 3VYRB 5I7FA 3H5RA 2BDEA 3RT7A 2G1PA 4GMDA 1X94A 4JP1A 1QPBA 2CHFA 2O20A 2WLTA 2JFPA 2A78A 3WC4A 1G1MA 3ECCA 1XV5A 2FPXA 4GL4A 2WJZB 1PSDA 5IKPA 2XUZA 3OF3A 4DCJA 1QMPA 3GMIA 5BV0A 2GVNA 2Q62A 4P34A 3KR2A 3P9SA 3MHTA 2AG0A 2VDLB 3EZXA 2IYTA 2ZIGA 3LT1A 3QWBA 3DSRA 4JODA 3U39A 3ZY2A 2BTOA 3R4VA 1FVOA 2C04A 4K0KB 2RGNC 3ZWKA 5KVVA 4JYBA 1DC6A 4CMGA 3FW1A 1IUNA 1YFZA 3ICWA 3VUEA 3RAGA 2V55B 4GLFA 3GC6A 2VR1A 3DV0B 3H2HA 4HN4B 4KK3A 1XUOA 1RRMA 4E08A 2GVZC 4PHFA 3VBCA 4ARCA 2BLNA 1T5LA 1CX9B 1F14A 2J6CA 2ZR7A 3AUAA 3IIKA 4DV7B 2W4IA 3G6KA 1KI4A 1I9CA 3E22B 3RS4A 2VC2B 3FYDA 4FW9A 4IWNA 1XMOB 3JQBA 3C3DA 4UXJA 3WK6A 3C5VA 1VYUA 3NTVA 2PA0A 2ETVA 2HIMA 3OLCX 5HG0A 4QELA 3F6EX 1O03A 2BUBA 1FYDA 3KU4A 1N25A 1NVXQ 1HLPA 1PYGA 2DC1A 4UUPA 1KZYC 2IHBA 1U7TA 2PBZA 3HDJA 2I2AA 3B5IA 3OIWA 1T9ZA 4RY0A 1AKYA 1WAMA 5BUCA 4JLSA 3VYTB 3LUFA 3GAZA 3HV2A 3O83A 4K81B 4M1TA 5C0OE 4QUGA 4DV4B 5ALSA 3QEMB 2ZCJA 1K89A 3I61A 2I9KA 1NG1A 1VB3A 1N7GA 3R9IA 4FCTA 4YJ2F 3ZG6A 4EP1A 5GWXA 1R6XA 4IFBA 3GX1A 4KIJA 3H0CA 4GI1A 1NVEA 3CU5A 4G0MA 1EFKA 2PY6A 1JBQA 2IYNA 4C03A 3PUXA 1MJHA 1EI9A 2I99A 2IQIA 1FFXA 2O9JA 3ZU4A 1SBYA 4YMGA 1HE4A 2JI6A 5IBRA 3O73A 1VE9A 1P3JA 4C9BA 4G07A 4C4YA 2W6QA 5BR8B 2HT6A 2V6MA 1RYNA 1Z0KA 3AF1A 3I2KA 3PHCA 5DNVA 3CH7A 4F85A 3DOOA 1FW8A 3G1UA 1Y4SA 5GV7A 2VEOA 1BXRA 3DOHA 5HUQA 2VYVA 3ACBA 2PRIA 3GR6A 3KQHA 4HDNA 1PJ3A 3B1KA 4N0QA 1DLIA 1WU8A 1M1YE 1NNSA 3E2PA 4MJ7A 2VBIA 1ZITA 4PG4A 1KJNA 4Q1FA 4UUNA 5FOSA 2Q7OE 4JQOA 4EO7A 3SYKA 3T7SA 4W9RA 2FPKA 1LI4A 4CKEB 3LW8A 3F6CA 3Q6MA 4AZ3B 4BX3A 3G2OA 2AI2A 1YZHA 2AEEA 5L7WA 1GRVA 3FWYA 1FSGA 5DCYA 4A8TA 1M75A 3T9AA 2FZCA 3MCUA 4P9NA 4MR8B 4QDXA 2YMLA 4UJ3A 4ZXPA 3AF5A 4DUGA 4YT4A 4ZYZA 4KXXA 4W5HA 4DY4A 3S2ZA 1YUBA 3TPCA 5DASA 3VSEA 2AN1A 3B36A 3LC7O 2ZIUB 5H0IA 1D4OA 2NUTB 3ROGA 2JJ2D 2HNAA 4CFSA 1N6KA 4MVJD 4CEIA 4Q24A 3EXG2 2I91A 1P2DA 4L15A 3WTBA 1S1MA 3C8HA 1CQWA 1AXEA 5GINE 1DELA 3GLIE 3DOIA 2FN9A 5DN6D 1M7BA 2Q5QA 3PIIA 5JEEA 3PGKA 2GYVA 3KC2A 4IL5A 4GKKB 4ZJZA 2ZI9A 4M1OA 1Q6YA 3KSRA 5TJHA 3GA7A 2MJLA 2ANBA 4HB4A 3L9WA 4RPKA 4X1KB 4ZEMA 1I33A 2KM1A 2NGRA 4QXAA 2X4GA 3BG5A 4PG8A 1G6KA 4KIWA 5T4HA 1AHIA 4KNWA 7ABPA 3LT2A 5BR4A 2QL9A 3RJTA 1KJYA 3G5LA 1CUDA 1Y5IA 3EODA 4G5YA 4U7PB 1SBCA 5DU2A 4WK2B 4XFJA 1RBMA 2W2TA 3SZGA 4DNXA 1ZJWA 2W98A 2L0XA 5B58C 4JYZA 2ZUBA 4FMDF 4OKNA 1SA0B 2QS9A 4ENSA 2ZM6B 2Z4RA 3OPQA 4QNMA 2RGUA 3AF2A 1YZNA 1GGMA 2OTCA 4FOSA 4TMYA 3O82A 3IBYA 3P9PA 2JFFA 2X9NA 3D6AA 4BAZA 1UT5A 2OBBA 3MAJA 1W0KA 2GN0A 3SXJA 3AG5A 3KR0A 4WNCA 3UK1A 4B8ZA 4LHYA 2QSZA<