3T61A

Crystal structure of a gluconokinase from sinorhizobium meliloti 1021
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
176
structure length
176
Chain Sequence
RRFPGSIVVMGVSGSGKSSVGEAIAEACGYPFIEGDALHPPENIRKMSEGIPLTDDDRWPWLAAIGERLASREPVVVSCSALKRSYRDKLRESAPGGLAFVFLHGSESVLAERMHHRTGHFMPSSLLQTQLETLEDPRGEVRTVAVDVAQPLAEIVREALAGLARLAENLYFQSHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gluconokinase
publication title Crystal Structure of a gluconokinase from Sinorhizobium meliloti 1021
rcsb
source organism Sinorhizobium meliloti
molecule tags Transferase
total genus 59
structure length 176
sequence length 176
chains with identical sequence B
ec nomenclature ec 2.7.1.12: Gluconokinase.
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3t61A00
3MD0A 2XEXA 3RSLA 1NMYA 3HU2A 2HCJB 4NCHA 5TVKA 4XVUA 4A8JA 5HR5A 3TIFA 621PA 2PCJA 2Z6VA 3EG5A 4RVCA 4A9AA 4WAUA 2DCUA 5HPYB 4RD0A 5AJYA 5EZ6B 3SJBA 3AF4A 4C0BA 4CDGA 3MWYW 4F93B 3VR6A 4ZKEA 1SGWA 1ZC3A 4QBGB 1ZM4A 2G1JA 4Q47A 1OT3A 2ZPTX 4Z51A 2C9YA 1GOTA 2WSSA 2WWIA 2GTPA 3KXKA 5KDLA 1JQJC 2QQ0A 2JEOA 3FKSD 2QPOA 1G19A 3GJ0A 4B32A 1W2GA 2V6JA 3LXXA 1R7RA 2F3RA 4RD6A 4Z8YA 1CR0A 1IBRA 1OH7A 5JJIA 2WSMA 3BS4A 3EXAA 2V8OA 4WVFA 2WKQA 2OEPA 1IJEA 3AB3A 3CBQA 4MRNA 5JWOA 2G88A 1KKMA 4TTRA 1N6KA 5K8TA 1U98A 4JZKA 2YV5A 5CIQA 1SQ5A 2Q3HA 2FH5B 3B1XA 3RS0A 1HA3A 4W9MC 1BO6A 3QEJA 1CJUC 2XTMA 1NLZA 3WRXC 2V54A 1QHHB 2OZEA 3N2EA 1OSNA 1KI6B 1HQYE 2V3CC 3OEED 4Q4JB 2KE5A 1GRRA 1CJMA 1W0JA 3SJZA 3BXZA 4Z8XA 3REFA 2F1IA 1G16A 2OAQ1 3FFBA 1YU9A 3CRW1 4LJ4A 1U2RA 1P4SA 1IHUA 1TEXA 2ZVPX 1NIJA 2N1BA 4HZIA 2QMEA 1VPLA 4ABYA 4NYJR 2PLRA 4PO1A 4B33A 4ILEA 4NYMQ 5C2JB 3EASA 4E5UA 1M1YE 3OE7D 5EXXA 4D4JA 3QVVA 3CNOA 1OH6A 2CNWD 2QAGB 3KQNA 1E4VA 4DDTA 3LRPA 3MJRA 3CRRA 5FBQB 4QGFA 4DJTA 3TVTA 2XITA 2WJYA 1IN6A 5F9FA 4DLUA 3VX4A 2ZS8A 1RPZA 3QPWA 2IT1A 2VP9A 5TDHA 3O8RA 2PMKA 4AI6A 4Z54A 3VR2A 3GLHA 1UAAA 1GUAA 3TAUA 4AG6A 2GBLC 1AA9A 1RYFA 2FNAA 3T35A 5FOXA 3IIMA 1ZINA 1WRBA 3QXXA 2OAP1 2OHFA 2ZSFA 3Q7PA 3QIAA 4YXWA 5BN4A 4G1UC 2XOKA 2BOVA 3CWZA 4PZYA 1G7RA 2YWHA 3E1SA 2OE2A 3K9NA 3QKRB 4MYHA 1HE8B 2GXSA 2IS1A 1R5NA 5C4GB 2G1KA 2ZETA 1U99A 1II8B 1DARA 3GMTA 2BM1A 2C03A 2G83A 1S0UA 1W1WA 3BFKA 4C0HA 1T3HA 1TQ6A 5GJVC 3BERA 1SVIA 1WBBA 3EW9A 2HXSA 2LKDA 2XNDD 2UZ3A 1M2OB 4XSGA 5FOVA 3T61A 4DC9A 2ZREA 2XGJA 3TAHA 4UNRA 3JVUA 4HDOB 1S1MA 3MWKA 4RFSA 4BWYA 4EUNA 4NH0A 1E2GA 4E07A 4PQRA 1NN3A 4ZCIA 2JJ8A 3H0KA 2KBEA 3QNUA 4Q01A 4HLCA 4LYHA 3A6PC 1F2TA 1EK0A 3IDQA 4JLPA 5LDDC 2ZRHA 2XX3A 3T5DA 2P67A 2VH5R 1VG9B 1CP2A 1E1RA 5EP1A 1EWQA 3IHLA 3ADBA 1EFRA 1UDWA 1QHHA 4QM7A 4M8NE 2WIAA 4FINA 1UBFA 2ZYVX 1X1RA 2XB4A 3D31A 1I2MA 3UXMA 1IXRC 2RH5A 1KAGA 1R8QA 2E87A 4EPTA 4AKGA 4PR0A 4I81A 1FZQA 3EPKA 1U94A 5JS7A 4ASUD 2MSCB 4LV8B 2A7QA 1KNQA 2ZI9A 4KAXA 2WSSD 4A15A 2BWJA 3IEVA 1A1VA 2C95A 4Q1DA 2ZRBA 5FL3A 3GLIE 2REOA 3KDSE 2GJAA 1QBKC 3QBVA 3UANA 1P2TA 3U3RA 2VP2A 3SNHA 1BOFA 3TW4A 1L4YA 4F38A 2OBLA 3VAAA 1Z6YA 2HEIA 5E3HA 4JLVA 4QXAA 3UMFA 1Q12A 5FBWB 4LUCA 4HB4A 3NC1C 2ORIA 1IN5A 1GNQA 2IL1A 1GKYA 4D81A 6Q21A 1YE8A 2QT0A 2DHRA 1ZCAA 5J40A 3RS2A 1M7BA 3R8FA 2ZXUA 4UJ3A 4DCNA 1HT2E 3B2EA 2QTHA 3EWAA 2CXXA 4EFNA 3T34A 2D2FA 3KUDA 4POAA 3GLFE 4RJLA 3GLGE 5B58C 4BFVA 5ELXA 2VP5A 5FPKA 1E9FA 1HT1E 4JIMA 1KI8A 3VHXA 1W0JD 4QBIA 1E2JA 2ZJ5A 4Q7LA 5FOTA 4IFBA 4PQYA 4A82A 2UKDA 2ZJ2A 3BAFA 2QP3A 2FJUA 4V0LA 1F3OA 3I3SR 3EZ7A 1YZUA 1RE0A 3GJ6A 3C5HA 4E09A 3BK7A 1UFQA 3QKRA 4YQFA 1W44A 4DLVA 2ZSBA 3RRYA 2W58A 4AYWA 2JA1A 4ESHA 4K46A 2ONJA 3X1ZA 1S8FA 4A6XA 5FBVB 3IPXA 3LV8A 4DLSA 1OB5A 1AGRA 4G5GA 1XX6A 1NI3A 3DOFA 3SHFA 4ZDIA 5EE5B 4LYJA 1BIFA 1LNZA 1AQUA 2ORVA 1G7SA 2GBLA 2KI5A 3QE0A 5HE9A 4B2LA 2QENA 3GLIB 3ZLJA 4TLAA 4LYAA 2AFHE 4CYMA 2QP9X 3QKTA 5D3MB 1VTKA 5CB6A 3IUYA 5J5CA 2IXGA 4CW7A 4TLBA 1E9SA 2QG6A 5EE1A 4YLGA 2O8EB 1FUKA 4PAOA 5EE3A 4M1YA 4BLSA 5DO9A 5SZKB 2RCNA 3IPYA 1H8EA 4YXWD 3NBZC 1ZU4A 2WPDA 3GLFB 2XOKD 4HZUB 4QFMA 3U7GA 3GLGB 3VMFA 1N0VC 2W0SA 5CK5A 4Q18A 3H1TA 3B85A 3VQTA 1NVVQ 1UBGA 1KI7A 5A0FA 3J81k 1AIPA 1SZPA 4FMCB 2ZS9A 4B3DA 4LJ5A 3C41J 1FMLA 2C9CA 4DSTA 1E2PA 2ZRNA 4XVRA 5JCZA 3CPHA 3TVDA 1CR2A 2H5EA 1Q20A 5C4MA 4QBFA 3WP1B 3D8BA 3B9QA 3PIRA 4BLOA 5HKKA 4XD7D 3U60B 3W6OA 4ZO4A 4US0R 2WAXA 4BZXA 4DLYA 4U00A 3A1VA 3GJ4A 3UMSA 1EFUA 2AD5A 1BYUA 1MO4A 3Q9LA 3ADCA 4KYIB 4R2IA 5CM8B 4JYBA 2D4HA 3BE4A 1C9KA 1VYTA 4PSAA 2BBWA 3P32A 1Q1QA 2O0KA 4FMDB 2J0UA 4URXR 1N6RA 1JEEA 2GXUA 3B9PA 4LHYA 1TU4A 1YZQA 5HTKA 1TF5A 1E1RD 1Q1BA 3OFND 1UPTA 2EFDB 2ORWA 2BVNA 1LY1A 2DY1A 2GAAA 3EIEA 4LJ8A 1SVWA 2QMHA 5G3ZA 4WW0A 5FI1B 4C2TA 4RCYA 4TZ6A 2QE7A 2OV2A 2A5FA 3PEVA 1NVWQ 2VPPA 4S35A 5BYJA 4B3CA 5EJEA 2AWOA 3ZD7A 4FMCF 2WWFA 2YZ2A 1U8ZA 4GZMA 5FI0B 2RGBA 1BMFA 2OCBA 3GJ3A 2Z4RA 1QVAA 4AG5A 1ZIOA 2JIZA 4Q1FA 2B8WA 1JALA 1UF9A 2IF2A 3C16C 2A5YB 3R9XA 2D74A 1P75A 2CJWB 3AUYA 5UKDA 1DE0A 1LS1A 3M6AA 4OYHA 4A0HA 3KQUA 3QQ5A 1KKLA 3O8DA 4TMXA 2DWPA 3K0SA 5IT5A 1F2UA 4I1OA 3T1TA 3BORA 3AKDA 2BEKA 3ZS8A 2NZJA 3K09C 4H1VA 4LK2A 4L8GA 2NO1A 5CLQA 5HZKA 2ERXA 4AKHA 2GZHA 3AVOA 1IY2A 4M1SA 3GLIA 5DISB 3R8CA 4EIWA 4BFYA 3KX2A 1RRGA 4FMDF 3DO6A 4Q00A 2ZJOA 4KI0A 2PMDA 1YRAA 2IYTA 2R6FA 4G0NA 2A3RA 3I5YA 2W6JA 3B13B 4BE7B 3AKCA 3B8HA 2VHJA 3PUXA 2O8EA 2Q9AA 4ITRC 5E7IA 4GRAA 4JLKA 4MYTA 4AD8A 2J3EA 3CONA 1ZP6A 4RY2A 3KXLA 4FW9A 2AN9A 3PFIA 3KFXA 1XCGB 5G53C 1UEJA 3GLFA 2WBLC 3THXB 3FFAA 3EA0A 3MJHA 2ZSDA 3SYLA 3AQ4A 1TUIA 2ZJZA 4D25A 4B34A 3GP8A 2BBOA 3DOEA 3TRFA 3QF7A 1P9WA 4LPSA 4TT3A 2JLQA 5H8WA 2IS6A 1Z6GA 4CRWB 4EQ6A 4CEHB 2O8DB 1ZW6A 5GVSA 1XFAA 4KFTA 4CZ2A 4KLNA 1ODFA 2HJVA 2J0VA 1KK2A 5AJZA 4M9ZA 2GF0A 3Q72A 1US8A 1KOFA 2NOAA 4PO9A 1ZBDA 4YMTA 3Q8XB 2BKUA 1NVUQ 5JI3E 1YVDA 2B92A 4HYYA 2HJGA 5BN3A 5EZ5A 1G5RA 2A5GA 1AS3A 1DELA 1YR6A 3CUEF 1TX4B 3QG1A 3QG5A 1EX6A 2ZYTX 1Z2CA 1XF9A 2A5DA 4KFSA 4C0QC 2XZPA 3K53A 2WPDD 4HAXA 1W5TA 1OIWA 4PC6A 3OZXA 2P65A 4PX9A 4R9UC 5JLJA 1FP7A 2RGDA 4HLDA 3KJEA 2Q3FA 3U61B 1GKUB 3PCRB 3EAQA 4F4CA 3AVPA 3RRMA 2VSFA 4CEIB 3HU1A 2WHXA 4LPKA 2FF7A 1K6MA 3KJIA 2EW1A 2QGZA 3PUYA 4LY6A 4HB3A 2BC9A 4OBEA 2NGRA 3LWNA 2ZE7A 3ZQJA 1LS6A 5HKKD 2NZ8A 5FUWA 3MLEA 4HATA 4TLEA 2GCPA 4A0GA 2CLCX 4EDHA 2QRZA 5GADl 3L82B 4PZZA 3LNCA 1ZM2A 3I8XA 2AXNA 3MWJA 1KO5A 1D5CA 1JPNA 1QHSA 3NXSA 3AF2A 4UXHA 3AVUA 2ZRGA 4H9GA 3ICQB 3S1AA 4NPHA 4DLTA 4R2HA 2G6BA 4B2IA 2BMJA 1NN1A 1N6HA 2G0TA 2F7SA 1K8RA 1G1MA 4BEBA 4OI0A 1IXSB 3GFPA 2XSZD 2QE7D 4MYUA 3PENA 2QBYB 2BDTA 4X8OA 3K09A 1WBDA 2AXPA 4Q7JB 1NJFA 4MKHA 1COWA 2JIZD 1G8FA 4A2QA 3LVQE 221PA 4PC2A 4AYTA 5KSOA 3THXA 3TBKA 5FFMA 5SZIA 2HYIC 1QF9A 4DCTA 1K5DA 5JZVA 3NBYC 1JECA 4LSGA 4TQ9A 3FKSA 3QOFA 3BGWA 1EXMA 4RD3A 2Q6TA 2OLJA 3LQQA 2WWWA 4JL8A 4Q7MB 3GJ7A 2C77A 2NQ2C 1AK2A 2PX0A 2VTKA 1G5TA 3E5HA 5J4HA 3A1SA 3L0IB 1G20E 1M7HA 2V6IA 4Q02A 3GJXC 3Q5EA 2HYDA 5E7MA 2W6JD 1DO0A 1AN0A 5IK2A 3I72A 5D3QA 5EQTA 1XXHA 2IXFA 1YRBA 2QUZA 2KWIA 3A4NA 4TQUS 1KY3A 2GRJA 4MA4A 1UDXA 1KSFX 2YVUA 1MOZA 2JLVA 1OKKA 2OXRA 4PXAA 4TSFA 1E2DA 2J59A 4M9QA 1ZNZA 3DM5A 5C1BA 1G4AE 3ADKA 3WBKA 3SFVA 4XIGS 4WXRA 2GNOA 1E9CA 4GOJA 5L3QB 4TT3D 2SHKA 2OO7A 2FE4A 5JEEA 1VHLA 4PZLA 4QNRA 4LBVA 4KYUA 2QU8A 1BKDR 1CJKC 4IRUB 1ZU5A 2ZJBA 1E2MA 4JSTA 1KK3A 3SFZA 1G3MA 2IYRA 2IWHA 3CPEA 4KSBA 4LC1A 1XD2B 3RAPR 3DEFA 1FMJA 1E2HA 4LJ9A 2ODEA 4YMWA 2IA5A 3VR5A 1R5OA 4DLRA 1E9RA 3QI2A 4Q03A 3FKQA 2MMCA 1R6BX 2Z0MA 3CF0A 3Q5DA 3DVLA 2O5VA 4JKIA 4P0TA 2IUTA 3KL4A 1QRAA 2P0EA 1NSFA 4MKFA 2D2EA 5DH9A 1Z2AA 2CE7A 4URWR 3W5JA 4NONA 4NCJA 2VP6A 1H8HD 2R62A 2H1LA 4IDHA 8OHMA 2CLDX 1CS4C 3K1JA 3FOZA 4URVR 3WP0A 2J1LA 2E9SA 4JVLA 4AC9A 2PZGA 4OQMA 1Z63A 1X86B 3QXSA 4O0MA 1NN0A 2VP4A 2QBYA 1D2MA 3KUCA 2OFXA 4HSEA 4P31A 5E95A 3SJAA 4BFSA 1G3IA 3THWB 1X3SA 4N3NA 2EVWX 3CX8A 1OB2A 3ZYCA 1G64A 1W36C 3CNLA 2BIFA 2ZAOA 4NCIA 1G18A 2ZE5A 4XWKA 5JRJA 3AVWA 1OYYA 3SBEA 5LB4A 3U44B 5CYPA 4GMDA 2WTUA 4QRHA 3BIFA 3FE2A 4UQOA 5CIWA 4DZZA 4PSVA 4DT1B 4DEXA 1KSGA 4TYQA 2IX3A 2P5TB 4GMXA 2F6RA 3MWLA 1KSHA 2ZUDA 5L8VA 4B3XA 2CLSA 4NTZA 1YHNA 1K5GA 2DFKB 3ZZUA 1FP6A 3QXCA 1W36B 3HYRA 2CL7X 5J4VA 2NO7A 4FXPA 1GILA 2D3WA 4QKQA 3EPHA 2X1VA 2LCFA 4Q19A 3EX7C 121PA 2NPFA 3U4QB 1WF3A 2CCJA 2QPTA 4QGAA 5TY0A 3RLFA 4CEJA 1COWD 1S4QA 3U3OA 4ASUA 4OK5A 1TEVA 4A36A 2ODNA 1MABB 4I99A 1IM2A 1VMAA 4QHTA 1YKSA 5KDOA 4XTCS 3WRYC 4KCGA 3VX3A 4WZAE 5B57C 4TLDA 3LX8A 4FWTA 2VP0A 1G8PA 3TQCA 4M9SA 3TSZA 3I5XA 3T1VA 2JLRA 4N1AA 2A5JA 2JLZA 2VL7A 1KGDA 4I1VA 3CH5A 4LJAA 2K5UA 3W6NA 5CDFE 4RZXA 3RS3A 3FMIA 5KDDA 1TL7C 3QXJA 1ZMXA 1D9ZA 2JASA 3AVVA 2YOGA 4HAZA 4BFZA 4G01B 4URUR 2FU5C 4F4JA 1FX0B 3LD9A 1XTIA 1OXUA 3H86A 2I1QA 2V55B 4KODA 1JEDA 3RANA 4QGHA 1JB1A 1N0UA 1L2TA 4PTLA 2OFOA 5ANRB 1FUUA 3EPJA 5IK2D 2QAGC 4B3GA 1MO5A 1NP6A 4OHZA 1LVGA 3TR5A 3I62A 3GQBA 3UG7A 2ECKA 3CO5A 2BCJQ 2QTVB 3FHCB 3WYGA 1C4OA 4D4MA 2WAYA 1OKKD 4TSFD 1TQDA 4AWXA 4IHQA 3MGCA 3VR3A 1XEFA 3T12A 1YZLA 1AGPA 1FQJA 3T06B 1W49A 4QJ4A 2ZUBA 1P9RA 4P4TA 1HYQA 2DYKA 4GBMA 5JEDA 2ANBA 1KI2A 3JZMA 4A92A 1FTSA 2OT3B 4V02A 3N5CA 2C04A 4HDQB 3MRSA 1Z28A 2WKPA 3RNLA 3RS7A 1KZ7B 4MITA 3ZVNA 2G0NA 4ZCMA 3A1TA 3NIBA 3IEUA 5FPSA 4KHZA 3NEYA 1N6LA 1XJ0A 3HYTA 1JAHA 2V9PA 3C4JA 4MKGA 2WWYA 1WQ1R 3CX7A 2C5LA 4GPTA 2Z83A 3LBNA 3N70A 3GEHA 4EJSC 1ZD1A 1XD9A 2ZANA 4ZI2A 4BUJA 1OE0A 4J0QA 3ZVLA 1VG1A 5BXQC 4Q7KA 2XJ9A 4F92B 1SHKA 1Z47A 2FEMA 2Q9BA 4EPYA 4M21A 4PAMA 1MH1A 3LAWA 3BRWD 1QG4A 3CW2A 4XH9B 2ZQ5A 3U4QA 2YKGA 3RABA 2CVHA 3THOA 4B76A 2O0HA 1GG2A 3RC3A 4QGGA 4ESVA 5JHHB 4OHVA 4YMVA 3GJ8A 2CHGA 1AS0A 1AZTA 4LBWA 1P73A 2IYWA 4EJSB 4TMVA 5FUYA 3RS5A 1XPOA 4XD7A 2GCNA 2G77B 3IO5A 1W0KD 2AR7A 2GXAA 2XZOA 1MV5A 1DPFA 1TADA 1E6CA 1O87A 4WZ6A 2MSDB 4B6FA 2OCYC 1OXVA 3LH5A 2QPAA 2ZRKA 1XRJA 1G8GA 1MR3F 1UBEA 3CIOA 2F43B 4DLXA 3OFNA 2RGXA 4LWZA 2AL7A 1RIFA 4LJYA 1IY0A 2AFIE 1SVSA 1KI6A 2CVFA 5IRCD 1FNMA 1JR3E 3K70B 5P21A 4Q4JA 4C0JA 3CR7A 4LI0A 4IOJA 2ZI7A 3R7WB 4OQFA 3PJRA 3MMPA 2WJVA 3SQXA 3K8YA 2IW3A 3CRQA 3L43A 4M1KA 5KPJA 4II7A 1HTWA 1S3SA 4GP6A 3IKJA 2QRNA 4BASA 4QHYA 2Z4SA 1IQPA 3FMOB 4JVSB 3JZAA 1RFLA 3TMKA 2ZYWX 1E2LA 5AJWA 4UXIA 4NYMR 4PANA 1KY2A 3W8RA 2EFCB 5KUTA 4DB2A 2P6UA 4M1OA 2QAGA 3IBGA 1Q44A 1GITA 2J7PD 5DGXA 1HH4A 4JJKA 5AR1A 1KDTA 2ZRLA 4BFTA 2AK2A 1SVKA 5GJCA 4JSYA 5TMPA 3FDIA 2OBNA 1S3GA 5JFGA 2A2ZA 3THYB 2LKCA 3MFYA 2DWOA 3I8SA 3K0CC 1U0HC 1NMZA 3UWOA 1NNEA 5FPYA 3PXGA 2C99A 1OW3B 3RYTC 2FEOA 1H65A 4JLDA 1HEIA 1G7CA 1TQ2A 1ZYUA 5BWMA 4AKIA 3OHMA 1DG1G 4OI4A 1P5ZB 2IUUA 2FZLA 4LJ6A 2XZLA 5EP3A 3SDZA 4IDPA 1T3LA 4GT1A 4MDEA 4V0ME 4EFLA 1SXJE 4EPXA 2QP4A 3EZ2A 5A5GA 3SOPA 4FCWA 2VSOA 4R7ZA 1XU4A 4Z1MA 3C5CA 4JJZA 3IBYA 3RS4A 3PUWA 4JS0A 3H84A 2FGKA 5E4FA 2C96A 5G40A 1II8A 3O47A 5JRZA 1E98A 1J90A 2JDIA 1IN8A 1M6NA 2C9OA 3R20A 4HAYA 4ON9A 3TUIC 1FNNA 1Q0UA 4C4PA 5TV2A 3CB4A 4W5JA 1FW6A 3W90A 5JWRA 2JJ1D 2GZDA 2Z43A 5K8LA 3HPRA 3E70C 4EJSA 3KTAB 3M1IA 5AUPB 1U9IC 4HUQB 4NL4H 3SJCA 421PA 3ECCA 4CT4B 4A1FA 5A4JA 4KBGA 4NMMA 1TMKA 1R2QA 2ERYA 1CKEA 5DIFA 1R5BA 5DNYB 4LHZA 3QJYA 3TKLA 4BLQA 5FPHA 3KXIA 2B21A 3HR7A 3ZVRA 1QG2A 1KI1A 4PC1A 1L4UA 1IONA 1Z0JA 3VKGA 5GVRA 3TW8B 3PQCA 2ZR0A 3VFDA 4B3BA 4DDVA 3PEUA 4MH0R 4KO8A 4LHXA 2NO6A 4F91B 1XBTA 1W36D 1WCV1 2AKAB 2D7DA 3SU8A 3ND9A 4TTPA 1YR7A 3SYNA 4PHTA 4YONB 2F1HA 4TYYA 2ZYUX 2ZRMA 3P27A 1GM5A 4G3XA 4NU0A 3LA6A 4G5SA 4CVNA 4ZPXA 3DZDA 2FX3A 1T0HB 3CZQA 3QBTA 4Q5IA 2GK6A 3VHLB 1R10A 1SXJB 1DTSA 1CJTC 3IHWA 4PHHA 3W9YA 1QHNA 2KB0A 1XMIA 1XTKA 5DN6D 2OBMA 3CH4B 2HLDA 2WIBA 5AK0A 4M1MA 2FSIA 2PLFA 1P7CA 4P4SB 3P26A 2GWHA 2UZIR 3FWYA 4P4UA 1ZAKA 3GD7A 5K8UA 3VNUA 1OYWA 2RAPA 2IS2A 4V0OA 1YZNA 4I4LA 2HDNB 4LDJA 3T1QA 4DIDA 4ARZB 5KYKA 2EFEB 1NVXQ 1NKTA 1G41A 3EARA 4RSGA 1JNYA 2F1JA 3THYA 3B7GA 3Q7QA 3U5ZB 4BRWA 5KNDA 1YR8A 3B1WA 2VHCA 4Q9HA 4ZDWA 1DEKA 1TNDA 5LD2B 2F9LA 5L3SB 3EPLA 1P62B 1Z83A 2XSZA 5FOWA 1ZNWA 3CX6A 4TTQA 2PEZA 4BLTA 1KK1A 4ZIRB 4NHOA 2FGJA 2WWGA 1A2KC 4JLJA 5HCNA 4X8HA 2PBRA 2WJGA 2XXAB 2B8TA 3BJIC 5IF9A 2FSGA 2J5XA 1E69A 4DSOA 1JXMA 1NBME 3BD9A 3K0CA 4U02A 5KO2A 1JI0A 3AF0A 4M4SA 2QN6A 1CRPA 2IEYA 3W5IA 2NO0A 1N3BA 3KFVA 2IXEA 4RCZA 3SEAA 4BQSA 1U8AA 5SZJA 1DS6A 4MUBA 4L15A 3KTAA 1IJFA 2WICA 5AUQA 2GDJA 4XWAA 4G5RA 5D3MA 3M4YA 1NMXA 1KIMA 2PJZA 1KNXA 1Q57A 3A1WA 3HJNA 2PX3A 3PV0A 3EIHA 2QL6A 1SHZA 4KFUA 3B82A 4IFEA 3QSYA 2IK8A 1ESNA 4LBZA 4HUTA 3AVTA 4M0LA 1ETUA 3C14C 3KQLA 1KI9A 3SQWA 5DI3B 3WBJA 2OSBA 3CRMA 3MAAC 4TMKA 4C7OB 1OV4A 3DZ8A 4HZUA 2YJTD 4QNMA 3GLGA 2N42A 1NVVR 1U9IA 4L4UA 4Z1MD 5F98A 1E9EA 4WBSA 3TQFA 3PEWA 3AM1A 1ZUNB 5FR1A 4RZUA 2B6HA 4OHYA 4TN1A 3B60A 3I73A 2JDID 1G21E 3H4MA 4E03A 1BYIA 2FFHA 1SXJA 1XDBA 2Q21A 4IW3B 4B75A 3A58B 4TMTA 3BFXA 3TK1A 2G3YA 1U0JA 3BWDD 1DAGA 3SI7A 3ADDA 2RGNC 1KAOA 5CB8A 2YC2C 1OIXA 4CT5A 2DFNA 5KSPA 3W6PA 2C98A 2YC4C 2VLIA 1W47A 1B0UA 3T5GA 1NG9A 4IXMA 1T91A 1R4AA 4LHWA 1R8SA 4ARZA 1V43A 2GJ9A 3CKLA 2IWRA 2H8KA 2FPLA 3REGA 4QHSA 3CNNA 3ZZTA 5K8IA 1KDRA 2A30A 1KI3A 4IEEA 1H8HA 3W3AA 4JBWA 3U7EB 3KKMA 5G3YA 4WA7A 5FTKA 5L3SA 1XJQA 2DPXA 2KJQA 2PL3A 3K70D 1E0JA 2EWWA 4ZI3A 1VCMA 2GEUA 1IY1A 2XJ4A 1VKJA 5DYGA 1ANKA 1XTQA 2QEQA 4ZV4A 2D06A 4ZIRA 1QVRA 3AH8A 3FPAA 2WKRA 1JBKA 2CHVA 2ZRAA 3K0AB 5F2EA 2ZR9A 1XD8A 5AUNB 4U7DA 4O3MA 2VHTA 4KLZA 3AGPA 2DB3A 1T9HA 1XEXB 2CJWA 2H57A 3GCGA 4IVQA 1XJCA 2OM2A 1CIPA 4Q4HB 4KBFA 2HLDD 4Q9JA 3ASZA 5CITA 5CLLA 1R0XA 1I4TD 1U0LA 5EP2A 1M7GA 1KI4A 3DL0A 2CHQA 1SVLA 1WA5A 2ZI5A 3OIVA 1NJGA 2CMKA 1NG1A 2ZUCA 2F1RA 3A37A 3FYHA 1GL9B 1MRNA 2F9MA 3MCAA 4D0LB 1P6XA 1N5IA 1N6PA 1OF1A 2YWFA 1ONBA 4Q1AA 3RWOA 4DCVA 1W2HA 2QROA 1A82A 4PAQA 5CJ2A 4TL8A 2G9NA 3WYFA 2OESA 1O3YA 1RKBA 1C1YA 1KO7A 4O2RA 2GA8A 4KJZA 1KMHB 4Q9KA 1T6NA 3U3MA 2FMXA 3KKQA 2IS4A 1ZD8A 2PJRA 4WXPA 1E2IA 2CE2X 1GTVA 2IYYA 4JBXA 2ATXA 5DYIA 4YMUA 2V4ZA 1LF0A 4DDUA 1RJ9B 3EA5A 1P61B 4RD2A 1L8QA 2WZQA 1JR3D 3AP2A 1OPXA 1Q3TA 4M9XA 4UNSA 4P32A 4B3FX 3ICEA 3JVVA 3BBPA 1D6JA 2BM0A 4DLWA 4QJ5A 1SKQA 3PEYA 1AKEA 3WMGA 4C3ZA 5BYKA 3HPQA 2P3SA 1VIYA 4NZYA 4OHWA 4CEHA 5BQ5A 2O8DA 2BKEA 1KSJA 1GIAA 2H92A 2IEZA 4FCTA 1UKEA 1QHYA 1W46A 1ZJ6A 1J7KA 1NBMA 2P2LA 5JSZB 1T0JB 2ZI6A 1TPZA 4IKEA 1FPMA 1AKYA 3GFOA 2WJJA 4TMZA 2X19A 4C0KA 3FTQA 4C0SA 4PPQA 1KZGB 5KSYA 1NRJB 4F4IA 4MGZR 4YC7A 5FR2A 1E96A 4ZKDA 4Q1CA 3ZD6A 3OIWA 5FBRB 4QG7A 1ZVQA 1E2QA 3AKEA 3VTKA 3KJGA 3M0EA 1IN4A 2DR3A 1LTQA 2GK7A 3BH6A 5KTYA 1A7JA 2YYZA 1S96A 3VU9B 4B47A 1GVNB 1DO2A 4RD4A 4A8JB 2ZITA 2RGNA 3C8UA 4N0DA 3AVXA 4A0RA 5HZHA 1GZSA 3D3QA 3WHKA 2IF0A 2A78A 1E4YA 1G3UA 1WXQA 2CCGA 2ONKA 3HDTA 4A0FA 1Z5ZA 4CEIA 1XP8A 1Y63A 1LFDB 4GFDA 4Q4LA 5H1YA 1PLJA 3GFTA 2H16A 1SXJD 1XEXA 2HCBA 2O8FB 2BMFA 2WM9B 1Z0AA 1ESMA 4Q9IA 4HLUC 1OH5A 4Q48A 3TLXA 2W00A 1RZ3A 5B30A 1BH2A 4DKXA 5J4YA 3DKPA 5BN5A 2YINC 1DAEA 4LRWA 3NG1A 1Q22A 1PUIA 1VDZA 2C8VA 3AV0B 2HV8A 4B35A 3V00A 1T8UA 3SC3A 3TSOA 3ASYA 3GLHE 5F3WB 1YZTA 2Q9CA 2REXB 1ZNYA 1TAGA 3G82C 1RC8A 2L0XA 3BC1A 3WY9A 5TB5A 2EU8A 1OXXK 1KMHA 1EFHA 2GVZC 4DBLC 3TR0A 5JS8A 3VR1A 2IYXA 3WNBA 2GILA 1YR9A 3NDPA 4LZZA 2PT7A 3SS8A 4DSUA 1M34E 4IDQA 3NBXX 1G291 3LDAA 1NF3A 2VYFA 5KOYA 4M22A 3P4YA 3FMPB 5FUVA 5TXGA 2O8CB 1LF5A 1E9AA 4BZQA 4RZ3A 3ZH9B 4TYPA 4IVRA 4KSCA 4TL6A 1G6HA 4D0GA 4D80A 3WNDA 1L7VC 3DMDA 2VHUA 2V1UA 1KDPA 1KTVA 4L9WA 1W0KA 4NYJQ 3ZDQA 2GXQA 3C7KA 4GDFA 5EXPA 4O25A 4O2LA 2IUSA 1Z3IX 1NSTA 1N25A 1Z29A 1Z8FA 4FMBB 4JLNA 4ZCLA 3ZIAA 3NH9A 5JSZA 3WYAA 2CBZA 2X77A 2VA8A 1QHXA 2NPIA 4IDNA 4CIDA 1EGAA 4IVPA 1T4GA 2BJVA 5CJPA 1TQ4A 1HQCA 1F48A 1HURA 1XB2A 3K9LA 3UIEA 4TZ0A 3GLHB 1QZXA 1WDTA 3IQXA 4TWZA 3UPUA 3LVRE 5GJBA 3PUZA 1CLUA 4PPFA 4OQXA 1SKYE 3F0TA 5CK4A 2ODBA 2JLSA 4IOLA 3VU9A 4NDZA 1Z6TA 2D62A 5L3QA 2UVQA 1KJWA 5JI2E 2J45A 3VNVA 3UKDA 2OLKA 2FG5A 3LLMA 1BS1A 1N5KA 4G5QA 4Y0AA 3KKNA 1J8YF 2J7PA 2O8FA 3CF6R 3L0PA 2O52A 3FGNA 5JJLA 3OF5A 1OHHD 1WB9A 1YQTA 1M74A 2FSFA 5KNBA 4BLPA 1WE2A 1I2DA 1NBMD 4OJQA 5E7JA 1II0A 3NBFA 1XD2A 3DDCA 2ZI4A 3L8ZA 3ETLA 1TTTA 5FL7A 2YHSA 4HAUA 4TMWA 3X1YA 4R71A 4DB4A 3WXMA 1X8KA 2QZ4A 2GHIA 4RFSB 3SZRA 3EIQA 4DUGA 1TUEA 5J47A 3MSXA 2LWIA 3NTUA 4D2IA 3VKHA 2J46A 4JLBA 2NMVA 1XMSA 2ZI3A 1G8YA 2YWGA 3TNFA 1XMJA 2JJ2A 4GOKA 4DDWA 1F2TB 2J41A 1E94E 1S9HA 2IHYA 4HLUA 1DAMA 4JL5A 3BB4A 3CZPA 4GOXA 4OHXA 2RKOA 4KU4A 1XCMA 2NTYC 4XJXA 4RKFA 4B48A 4QC2A 1E99A 2W6ID 4B74A 2JATA 3THWA 1KO1A 4P33A 1XCPA 4AK9A 1GWNA 1SKYB 2O8CA 4OL0A 1XTRA 2YNMA 4FIDA 4A2WA 4NCNA 2JJ1A 2W2TA 2WWXA 1MO3A 1MT0A 4PHFA 4LC0A 4MRRA 3OESA 3UMRA 1CEEA 4BLRA 3TJZA 3HR8A 2QORA 3U44A 1G7TA 2J0QA 2ATVA 5KPDA 1XPUA 3KB2A 3EZ9A 4D26A 2FPKA 1ZNXA 3I1FA 4DT1A 1CXZA 2ZR7A 1Z22A 1CULC 1EFTA 3ND8A 2PZEA 4HI0E 1D8TA 2R65A 3B5JA 1VHTA 4KVAA 4XSHA 5DI9A 5JJKA 1RRFA 1OFHA 1E2NA 3PVSA 4DLZA 1UEIA 1YJ5A 5TARA 4BRUA 3AUXA 3LW7A 2BJWA 3I4LA 1KYIA 1SVOA 4HB2A 3WMEA 5L3VA 4S2EA 3U7HB 3NHBA 1NY5A 3I61A 4CGZA 3LBHA 3LX5A 4HLQB 1OXSC 1Z07A 1G5PA 4URYR 4Q21A 3OEHD 3VR4A 3ZVMA 4MKIA 4ACBA 1Z0FA 1S9DA 1JPJA 2QMUA 4MUAA 1XZPA 1MABA 3P1JA 3T1OA 2X2EA 2XTNA 2X8AA 4RKEA 3KB1A 3K70C 521PA 3BH0A 5DN6A 2R44A 4MRVA 1YZKA 5AWFC 4NP6A 5IDVA 4IOKA 1TU3A 1P9NA 1Z6XA 2E1RA 4OK6A 2HUPA 2ZSAA 5JWHA 4JLAA 4TYWA 1HY3A 2PZFA 5DHAA 4MRSA 1UJ2A 4ACAA 2QSZA 1CJVC 3D6TB 5C18A 1ELOA 4B44A 3L8YA 2ZRDA 5FUXA 3U2QA 1U8YA 4V0NA 4D0NA 1FX0A 3ZIAD 2F55A 3FMFA 1CRQA 3LO5A 1G8HA 1OJLA 3EC2A 5EXSA 4X8LA 2EQBA 2EFHB 1G3QA 3NKVA 5EE9A 4EPVA 3UG6A 4FI3C 2ASEA 2CL6X 3B1YA 4BZPA 1DBSA 1F60A 3F3YA 3TSWA 4MDFA 3H2YA 2Z5FA 3NEJA 4LV6A 4GP7A 1I4DD 3RRZA 2GEVA 1KO4A 821PA 2BEJA 2HT1A 3QF4B 1XZQA 1E1QA 2JLXA 1G9XA 2HXYA 2H18A 1AJEA 1RW4A 3ZGXA 4H1UA 3WHLA 3TE6A 2VF7A 3NHAA 2FV8A 4LX0A 4DXAA 3AF1A 3NVAA 4UXJA 4UNNA 1AQYA 2XB2A 4JLMA 4LV5B 3BFVA 3B1ZA 4NYIQ 1JJ7A 1KDOA 2FOLA 2JAQA 5FTLA 4PQFA 3RRNA 5JHGB 1GSIA 1G17A 3SYKA 4B6EA 2VO1A 3N2IA 4L16A 2EWVA 5EP4A 2DFLA 4M1TA 3W8NA 3UATA 2QI9C 1SULA 2R6GA 5FL7D 1Z08A 1W5SA 1XTSA 1J2JA 1ZD9A 3CLVA 4BFXA 4TYNA 5CDFA 2NIPA 4DUGD 2R6DA 2JLUA 5GJWC 1XPRA 4L9SA 2QAJA 3CF2A 4Q4AB 2NO9A 3DKVA 3AF3A 1MO6A 4NE2A 1FTNA 1UM8A 2JJ2D 2ZRJA 1VECA 1KHTA 4HDCA 5FTMA 2ZM5A 4LGMA 3A8TA 5FTJA 1EX7A 2P6NA 2ZROA 4BECA 5KHOC 2V7QA 2J0UB 3CR8A 2QSYA 1DOAA 4I1UA 2FN4A 1UKVY 2RMKA 5SZHB 3FVQA 1UKZA 3BB1A 5B2ZA 4GI7A 2YWEA 4TLCA 2QTFA 1G3RA 1E3MA 2I3BA 4BFUA 5JCPA 4GZLA 2QMOA 3X1DA 4M53A 1Z06A 1Z0DA 2WJIA 2B7CA 4QBHA 4RD1A 2IYZA 3SN6A 3DHWC 1QDEA 2Q3MA 3QXHA 2XNSA 5F9HA 1X1SA 3Q85A 2PH1A 3G0HA 1VIAA 4C2UA 1HV8A 1KMQA 2TMKA 3QPVA 4NKRA 5JBQA 1NN5A 4IXNA 3ZQ6A 1CBUA 2EYUA 2WOJA 2FPMA 2QGNA 4FWIB 1F2UB 2QM8A 3L0SA 4JVNA 1SXJC 4D4KA 2DBYA 4A2PA 5EUQB 2RHMA 3QUSA 4WIAA 2F43A 1RYHA 4GNKA 4IJMA 3RHFA 3SBDA 3LFUA 5EXTA 4A6PA 4D4LA 5C46F 2GF9A 1Q1ZA 4LBYA 2ZEJA 4NBSA 1OH8A 5DSZA 3NH6A 3R7WA 1VCNA 4GL2A 2BV3A 5J4LA 3V4RA 3V4FA 2D7CA 2QA5A 2ZJYA 4JMPA 1IOZA 3B1VA 3QF4A 3UK6A 1XWIA 1LW7A 3QY0A 1VG8A 1PZNA 5LD2C 1F6BA 1GDDA 2RHDA 3IGFA 4B73A 2HF8A 2RGCA 3AGQA 4HAVA 2PCLA 4M2LA 3D7MA 3HP1A 1EG7A 3CRVA 1RRCA 1II9A 2VEDA 1MKYA 4NYIR 5H70A 5KSZA 4R98A 1Z6AA 1Z0KA 2WMOB 1OFUX 1E2EA 1VYVA 2VIIA 2GAOA 2REBA 4KVGA 4EQ6B 2FDCA 4IEIA 3DMNA 2AKYA 1N0WA 1E0AA 4OKSA 4JKYA 2GESA 4BEJA 1X8JA 2OUKA 2RB4A 3TUJC 1QHIA 2GZAA 3AKYA 3NWJA 1W4RA 2IYVA 1NKSA 1US8B 2VRWA 2OFWA 4KITB 1TF2A 3P4XA 2ZAMA 5HE8A 4GSYA 2QM7A 5LB2A 4I1SA 1ZUIA 4PPNA 3LLUA 4Q4AA 5FBLB 3RDPA 1G4UR 5CYOA 1W4CA 2CDNA 5FH9A 3LY5A 4Y0VA 1E32A 1E1QD 3PITA 3AP3A 4DCUA 1N5JA 1OFIA 1JR3A 3QEOA 1JJVA 4YDHB 1LB1B 4C9BA 2JCSA 1VG0B 1EFRD 2J9RA 1S2MA 4EPRA 4IDOA 1IN7A 2ZRCA 3LBIA 5JMTA 3O8BA 5CM9C 3NC0C 4OQNA 1PUJA 5G41A 2OXCA 2GETA 2RGGA 4P3YA 3U3JA 3T15A 4HUQA 4YDSA 2HT6A 4BGDA 1XEWY 1ZCBA 3O8CA 3AVQA 2JLYA 1X8LA 1ZM9A 1ZM3A 3QVUA 2ZRFA 2KBFA 3DPUA 3OIYA 4JBYA 1KJZA 4UNPA 1HE1C 1A2BA 1JR6A 2ZJAA 1B23P 2JGNA 2BBTA 4DVGA 2WV9A 4JT2A 1AS2A 2CK3A 4DCSA 2ZS7A 4C30A 2YOHA 3R9WA 4TQAA 1XXHE 1EWRA 1S1CA 1ZUHA 2PT5A 3EWSA 2BBSA 4CF7A 5AUOB 4G5OA 3RSOA 2EFGA 2V7QD 3X1WA 1GRQA 3S1AB 3TUZC 4QL3A 3GEIA 4XOIA 3HU3A 1XMVA 2BMDA 4K8OA 5FTNA 5FOSA 4Q66C 3A4MA 2P6RA 1DAHA 1UBCA 2AWNA 3TGPA 1CF4A 2Y8EA 3AEZA 4BFWA 4MGKR 3KKOA 4V0MA 3QKSB 3F8TA 1GRNA 2JLWA 1LV7A 4FD2A 1VCOA 1E79A 2DFTA 2R6AA 2W0MA 1D9XA 4F7WA 2X2FA 1E9BA 1OLOA 1N6IA 2ZU0C 3E2IA 4UKDA 4P4SA 4PHGA 1GKIA 4TL9A 1T5IA 1Q21A 2IYUA 3GJ5A 3W34A 3IIKA 3BH7A 4HB0A 2IYQA 3MG9A 4JLOA 2C78A 3P20A 3OIUA 3RWMB 3KKPA 4V0KA 2BMEA 4PSKA 1V5WA 2QQEA 2ZSEA 3U7FB 1XNJA 3LXRA 4PPGA 1IXZA 2FFQA 4HAWA 4MGYR 3WNCA 1NL3A 3IIJA 4PC3A 2FSHA 5EUMA 4Q9LA 1DVRA 3ONWA 1QHGA 3F5FA 4D6PA 4N0EA 1P60A 1ZM7A 2AD1A 3CM0A 1VCIA 2O0JA 2WVJA 2FFBA 3SE0A 1ZIPA 5HCIA 4K81B 1XXHB 1ZRHA 2ZJ8A 3OAAA 4DIEA 1CR1A 2W2VA 2ZE6A 2CEAA 2VSXA 2XXAA 4XTRA 4JYCA 5B64A 4C0LA 3FB4A 2GJSA 1NLFA 1GAJA 1H8ED 4X8MA 2GJ8A 1Q1EA 1DAFA 1Z0IA 4DEYA 4MYCA 2J0SA 2I1VB 3QKUA 4EFMA 3B78A 2ANCA 4FCVA 1A4RA 3K0FB 1FFHA 2I4IA 2WWHA 3DM9B 5LBIA 4URZR 4RFVA 1J99A 4LHVA 3SHWA 1WP9A 1KK0A 1P72A 2AK3A 4OI2A 4IOMA 2FFAA 3ZJYA 4US2R 4U5XA 2HF9A 5FOUA 4EPWA 1OXTA 3ZS9A 4DSNA 4AY2A 3KZ1E 2VF8A 1P3JA 2IYLD 1N6OA 3MUFA 2QNRA 5J4KA 1E0SA 1CU1A 1OIVA 5KU1A 3B6EA 5FPTA 2GCOB 1N6NA 4W5HA 5DHFA 1Q3HA 1P2SA 3G5UA 4LOAA 3UWKA 4DWJA 5DE3A 1F5NA 3IO3A 4Q1EA 2IHBA 4KFRA 5DI3A 1AZSC 1RRPA 1XTJA 2J7KA 3FHTA 4C7OA 2O8BB 2ZU6A 1X6VA 3EZ6A 1N2CE 4B2PA 2C2HA 4XVQA 3Q3JB 2NG1A 3HWSA 1SVMA 1XEWX 4HEJA 2FZ4A 4M1WA 4US1R 5KNCA 4W7SA 4YMSA 1D2EA 2N46A 4EKDA 1NY6A 3X1XA 2GEDA 3L2OB 2FWRA 3LQRA 4Q1BA 1R0WA 4ZDKA 5EE0A 3PUVA 2XAUA 3A4LA 2OCAA 2A9KA 3QKSA 1BMFD 4NCKA 3U3KA 1GP2A 1PV4A 3K0EA 5IHPA 1OHHA 3KJHA 4A8JC 2FA9A 3C15C 2P5SA 1U90A 4WZBE 3GEEA 3BOSA 2IBMA 5M04A 4MQBA 2KSQA 3IILA 5H68A 1R0YA 1WMSA 1T5LA 3I32A 1W4BA 3EC1A 4QM6A 2CCKA 1E2KA 1OFTA 2RGEA 2WMNB 1E9DA 2GJKA 1E2FA 3BB3A 3U6KA 4D82A 2IC5A 4OJKA 1CR4A 2CK3D 4L5BA 3CWQA 1N5LA 3IQWA 1PLLA 1J8MF 1NLYA 4DHEA 3TH5A 5L3RA 5DLQC 2OILA 4B71A 2F3TA 4JL6A 1PVOA 5LPNA 1DG3A 2AHOA 1PJRA 4QJ3A 3RC8A 2OCPA 1FQKA 1M8PA 2H7VA 2DWQA 3KQKA 1TF7A 1FOEB 2W6IA 2XTZA 4JVMA 3GPLA 2CL0X 3L0OA 1RVDA 3OEEA 3K0AA 1A5TA 3R9IA 4MRPA 4B43A 5BW8A 1EFCA 1PLKA 2WJHA 2QT1A 4PFSA 4E22A 4LJ7A 4CEJB 4W5WA 3WMFA 4Q4HA 2ZRIA 1E79D 1T8TA 1Y3AA 2GVDC 3K0FA 1UKYA 3AP1A 1P2VA 1MRSA 1P2UA 3A1UA 2VBCA 1U81A 4KV9A 4LYFA 3PR1A 3FHOA 5AJXA 3OE7A 4TL7A 4BPBA 2R6CA 1FL9A 2CNWA 4A4DA 4ZDJA 1GFIA 3EZFA 1W4AA 2BCGY 5AJVB 3QENA 3V9PA 3PG5A 3NDBB 3RVBA 1T3SA 3W3ZB 4PC7A 2GCOA 1GNPA 2RGAA 2GKSA 4V03A 3ZZ0A 1JAIA 4UJ5A 1DAKA 2VHQA 4RZ2A 2J87A 2W2XA 2BHRA 4WOPA 3OEHA 1DAIA 1VYUA 3OAAD 2O8BA 1YZGA 1R0ZA 2V1XA 2ZVQX 3SR0A 1JXOA 1RJ9A 1UADA 4FN5A 2IYSA 1NIPA 4LCBA 4C0AC 3AVYA 2R9VA 4AIIA 2AX4A 2WOOA 2R2AA 2H17A 1E0KA 4MGIR 2ZE8A 1HUQA 1W7AA 1GL7A 3K9GA 4AYXA 4PO8A 4EAQA 5JECA 1JQLB 1GL6A 1D2NA 4DRZA 2PEYA 3QPUA 4UNQA 1DADA 4OI1A 3X2SA 4JT4A 3VKWA 2OG2A 1EESA 3U6BA 1KO8A 4AURA 4ERNA 1KJYA 721PA 3LW8A 1J70A 4OK3A 2ODWA 1W48A 4KXFB 2XNDA 2ZTSA 2ZIAA 2B7BA 3I92A 1CTQA 2W83A 1AM4D 1I4LD 1ZC4A 3CPJB 2EYQA 2QY9A 4XWOA 1GNRA 2Q0HA 2MSEB 1IAQA 3KQHA 4AKEA 1G6OA 2MMGA 4OQLA 4QOSA 3A36A 3K9HA 2VQSA 2ZRPA 2YOFA 2R8RA
chains in the Genus database with same CATH superfamily
2XEXA 4X0EA 3L6CA 3QYJA 3OFSA 3VI3B 3CZMA 4BWGA 3K3PA 2PCJA 2XZTA 4L28A 4MAMA 5SICE 4MR7B 4RPCA 4GXQA 3GRKA 4JC5A 4WAUA 2VDRB 4QEDA 1RQPA 3CT6A 3CS3A 3ADPA 2P4EA 3IVCA 1LI7A 4V0SA 5EFZA 4RD0A 5FNVB 3ZGYA 4YXFA 5HPYB 1M73E 3KQVA 5EZ6B 4LISA 4C0BA 1K8XB 5E1BA 3MWYW 1M0TA 4FGWA 5F5XA 3ZLUA 4ZKEA 4F9FA 2C57A 1SGWA 5MFZA 1UBSB 1UXOA 1BEEA 1Q15A 1ZM4A 1B1AA 2J5KA 4YRJA 4Q47A 2ZPTX 4NEHB 1NRWA 1Z25A 3GDHA 2C9YA 4O4IB 4OYLA 4Z51A 4YUAA 4MMYB 3O92A 3HL4A 4BGEA 2REQA 2BF4A 3N0RA 5BPFA 1QONA 5FLKA 5A4AA 4GMKA 3I53A 1VPWA 3CO0S 5BSVA 1A5AB 3BXPA 3QFCA 5FA8A 3L7OA 4Z8YA 5FQOA 1IBRA 2ZB8A 1X8XA 2X8LA 4R0NA 4ZXPA 4NBLA 5L7TA 3DDSA 3ZZMA 1OH7A 2CFIA 3RV4A 1VLJA 1XDZA 5LQJA 4R3WA 4NOMA 2OEPA 3Q12A 4MRNA 3BWBA 4WFKA 5HG0A 1G5QA 3IX7A 1E6LA 1UANA 2B61A 1U98A 4JZKA 1K9SA 4P4GA 2Q3HA 4QA9A 2JHFA 2NADA 3B1XA 3QU5A 4RDXA 1HA3A 3UUEA 4UD2A 1IC6A 2J4CA 5AW1A 2HWXA 4NJEA 4DREA 1XP5A 1GSHA 3KK0A 1NLZA 3AEYA 2IYPA 5IM4A 4EHBA 3N2EA 1ZUWA 4K6KA 2V3CC 3AEXA 1BA2A 1JGTA 3TL6A 5FNVF 2JGIA 3GJRA 3BXZA 2IXAA 1M9NA 1LDGA 3LTEA 4RKYA 7REQB 5DF1A 2OAQ1 3NOQA 2ADFA 1B8NA 4N12A 1OYVA 1K8YB 3PUJA 4O4IF 2QN9A 3Q11A 4OGGA 4ZHSA 2FHSA 2N1BA 1RRVA 1VPLA 3W9BA 4G37A 2EJTA 1JLRA 2VEOA 4L02A 2L42A 1UKCA 3ISJA 4NYMQ 3VKVA 1XDWA 3OE7D 3NHJA 4D4JA 3T9BA 3QVVA 5EJAA 1OH6A 1SIUA 2CNWD 4WY8A 2YV4A 5EIHA 1E4VA 1BVHA 1TZKA 2GZSA 2V7BA 3MJRA 3AI1A 3IE0A 3CRRA 4DJTA 3A32A 3AM5A 3RREA 1BWQA 1Y1QA 2H8GA 2WJYA 2XGSA 4JUFA 3FA2A 4G67A 4C6SA 1W85A 5F9FA 1Y5MA 3T9FA 3GEGA 1FMTA 2JF0A 1OAAA 3QHAA 5CD9A 4JJ7A 5JD6A 2IT1A 1JIUA 2PMKA 3FCYA 4S1PA 3OP1A 4Z54A 3VR2A 5JS1A 4AI6A 1Y6ZA 4BXOB 2ABWA 4NG5A 4NH4A 1BOOA 5LJIA 4F3CA 1PUXA 4RM2A 1GUAA 1DUIA 2PWPA 1AA9A 2FNAA 2CDAA 1ZINA 2VNHA 1Z3CA 1WRBA 1ECPA 2GYVA 1UOQA 2Q2WA 3SHQA 5FBHA 1BGVA 1PR1A 2OAP1 4E3ZA 2DUWA 2RONA 3CWZA 4ZQFA 4PZYA 1Z74A 1RKXA 1X94A 4R1NA 3NXKA 1VLMA 2NYVA 2A0YA 3QKRB 1JTFA 2BHTA 1HE8B 1FQOA 2D6FA 1EVZA 3V1MA 4DS3A 4LX8A 1XA4A 4KO1S 3WGYA 4AMUA 4AROA 1TO2E 2FPIB 2JAOA 3TXAA 4MW6A 4D57A 1W1WA 2V58A 1CETA 4YMLA 2CWDA 3BERA 5GJVC 5KWSA 1WBBA 1CUCA 5HSGA 1U3VA 3OZGA 5FOVA 3T61A 4FB4A 3S1LA 5L95A 3E9YA 3MW8A 4FEAA 4MRMB 4HDOB 3TQQA 4BE4A 2XUAA 4K03A 1E3EA 4TN5A 3QFFA 4W82A 5GINE 3H05A 4ED9A 3LT4A 5F64A 3ZGZA 2JJ8A 3H0KA 2I0FA 3QNUA 4I08A 3K0BA 3AHIA 4FBMA 3PWTA 1E62A 5EERA 3A6PC 4LYHA 4GF5A 3RHTA 1F2TA 1EK0A 3IDQA 2X6QA 1Z82A 2VHVA 2XX3A 4K6OA 4EI2A 3P71T 2VH5R 4PAWA 1O0CA 2XDWA 5SYMA 3IHLA 2FFRA 3ADBA 1EFRA 1SQSA 4QM7A 1QHHA 1WCWA 4HEQA 4GEGA 2X7XA 1EVQA 2R8BA 2CV0A 2Q8PA 1SMKA 2XB4A 4RY0A 3RAEC 1DKQA 1PJSA 2AOXA 2FRDC 4OB7A 1IXRC 1NV8A 1OR8A 1KAGA 2RH5A 3UWSA 1RHJA 3QKIA 1BGWA 3VR6D 3NDJA 4ND2A 4PR0A 3KR2A 1U94A 1GPWB 4FYPA 1NW5A 1YUBA 3H8JA 4JBIA 4OKIA 3SKYA 4B3TB 1ZPDA 2MSCB 1KNQA 4KAXA 1BE0A 4Y18A 5ALZA 3RVPA 4A15A 1NXQA 2BWJA 2ZT5A 4MHOA 1N3YA 4NECA 1TZ2A 2FLKA 2CXTA 2ZRBA 2ZYIA 3KDSE 2CXRA 2GJAA 3I39X 1QBKC 2E7ZA 4FFBA 4PNHA 3WQRA 3V8EA 4U6NA 3SNHA 1JEAA 1FLDA 5ICSA 1Z5GA 3GRRA 3VAAA 1A72A 2HEIA 5E3HA 5CVCA 1CUFA 4IHJA 3I34X 4PYRA 5FBWB 1PT5A 3T4PA 3BIWA 2QV7A 2J6IA 3T0FA 1NXXA 3CUUA 5AOBA 2D5BA 3L92A 1GNQA 3AOGA 3PE3A 4MQ5A 1Z4OA 3UWDA 4CGYA 5CCEA 4F1WA 3IAHA 1X2EA 5BR8B 2XZDA 1VKOA 3KYDB 2H29A 2HOQA 3OPNA 2P41A 2Y1XA 4CM8B 2WUVA 5FJJA 3TZCA 1TA4A 2P6PA 3WK8A 4CLOB 3UXHA 1XRMA 2YIJA 5EG5A 4A03A 1EUQA 1JE0A 5DNVA 1HT1E 3T0GA 2A9QA 1KI8A 4IBOA 3T4UA 5FORA 3ZGNA 4GEKA 4IFBA 4P80A 3TVYA 2PUHA 4F56A 1N7JA 5LU8A 4A82A 3RM3A 1V95A 2B7LA 3KV1A 4V0LA 5CGQB 3R7FA 1RE0A 1ZMRA 3BE5A 4CEHA 1X80B 2XE8A 3C3MA 2YJ4A 2ZPAA 4PIVA 2DUMA 4BVEA 4HWPA 3FCSB 5DHRA 2XVYA 4AYWA 4BNDA 4XB6B 1ZN2A 4DPMA 4K46A 1WXXA 2ZT6A 2ONJA 3W5AA 4AJHA 4DAEA 2GBIA 1ZGBA 3DOFA 3LGSA 3IQEA 3ISVA 2RHJA 2ST1A 1AQUA 1KVRA 1ZWLA 5AW5A 2ORVA 4F9EA 3C2QA 4YRMA 2E4VA 2SCUB 5HE9A 4EVQA 1M2OA 1LNQA 4F6LA 1K98A 3ZTWA 4LYAA 4CYMA 5D3MB 4MS4B 2Y4OA 1FDTA 3IT0A 1YQGA 1FYFA 3R77A 4GR5A 3IP3A 1YJCA 2Q5IA 4Y7DA 5EESA 4CT0A 4D99A 1J5XA 2JW5A 2OBFA 4YLGA 3V55A 2VAVA 3KSZO 5EE3A 5KOHA 4IDFA 1UPCA 3SEFA 4BLSA 5DO9A 4OLFA 3IAEA 4MV9A 3HJCA 1SHUX 3VJRA 2FZ5A 1T6ZA 4YXWD 1QZTA 2RAVA 1W581 2OCKA 1Z2DA 4HZUB 2QLBA 1ACMA 2C4VA 2J9FB 4HWSA 4Q18A 4S1TA 3MQ4A 4TXLA 1KYVA 1XN1A 4P08A 2R79A 3L0CA 3FPLA 2Z5GA 1NVVQ 3OJCA 3S2YA 3OZCA 4BB0A 1C3XA 1YVRA 3LUFA 4QSMA 5A0FA 3J81k 4P0PB 3VR6H 3MLBA 3FYDA 1FJGB 1XQWA 3EK2A 3STUA 1OC2A 1RJEA 3UWPA 4YUWA 3RHZA 5J43A 2UYCA 1GYPA 2JIRA 4BYMA 3QUCA 2A57A 2OV8A 2HQRA 2NVWA 3NP7A 3L7JA 4H6VA 4QECA 3V2UA 5K8JB 1CR2A 4L8YA 4XFJA 3GB9A 1HE5A 1DX6A 1E1CA 4V0QA 3C6XA 3D8BA 4LRYA 2I78A 2B78A 2ZOSA 2C0CA 5DEIA 1CWUA 4PYQA 2AC7A 3NHZA 4JCOA 2AFRA 3P8ZA 3D0RA 4PRKA 3J80A 1XRSB 1EFUA 1BYUA 1Y7IA 2AD5A 1MO4A 5IWCA 3PX7A 4KYIB 5TQ2B 2D4HA 2FRDA 1J0EA 3HGMA 3L79A 3MPUA 1XZAA 1ENYA 2F00A 1CUXA 1E5XA 4PW0A 4Q3BA 4B85A 3IURA 2LZ0A 2VUHB 3Q1LA 3VO1A 4AMVA 5A4KA 1IPFA 5IXYA 2PVCA 2GXUA 2P7HA 2H0QA 2EL9A 4URXR 2DBRA 2B69A 2WPNA 3AIKA 2RH8A 2ORWA 3ZUGA 5K8CA 2DY1A 3ER6A 4TXNA 4CF4A 1QCYA 2GAAA 3EIEA 4LJ8A 5A3RA 2QMHA 4EO4A 3ZI4A 1D0IA 1XK7A 3KQMA 4L7VA 3BEOA 1H2YA 3CA8A 1NVWQ 3ZD7A 5EJEA 2AWOA 3NW9A 1W8DA 4WXYB 2PXAA 1ZZGA 1ZIOA 2PPVA 3LT5A 4OUDB 4Q1FA 2B8WA 4W4TA 3C16C 2ZUUA 3GO4A 3MJTA 5ITZB 3RRFA 4BNIA 5JNTA 1B74A 1Y33E 3FBWA 4OYHA 4XQGA 5EWLB 3JW8A 3QQ5A 1SUPA 3IP8A 4FFOA 4C5CA 1GR1A 4RYLA 1NFFA 1IXKA 2NO4A 4NNOA 5TQVA 2Q1TA 2BLNA 3ZS8A 4N3CA 1KJIA 4H1VA 5BYAA 4LK2A 1E92A 4H7EA 2JGFA 1YS2X 2OXFA 2QTGA 3BWYA 3M89A 1WCIB 2ERXA 3W5HA 4FT4A 3MIZA 1FVFA 4KQ2A 5JASA 3KNZA 2QX9A 3O74A 4TZKA 5DISB 1BC5A 5DMXA 1A8QA 4BNVA 4UTPA 4YT5A 3CY6A 3KX2A 3DO6A 3OX4A 1Q7RA 4KI0A 1MQSA 2FZVA 4XCVA 1NW6A 2AQ8A 3LLSA 3B48A 2R6FA 4DV3B 3QRWA 1WMDA 3ZCSA 4ND1A 4P7JA 3B8HA 2VHJA 2A94A 8ABPA 4WWHA 2JFXA 3NM4A 5E7IA 4AP5A 4MYTA 2RHOA 4RY2A 3KXLA 2OZPA 3MTJA 2A0UA 2C58A 3HHPA 4BEWA 2AN9A 3L4KA 4K2HA 1M6VA 3F78A 3PFIA 2EATA 2H65A 3KFXA 1UEJA 1GGEA 2WBLC 5TRTA 2Y1LA 3GLFA 3THXB 1UP4A 3R8XA 1EAYA 4QFBA 1V0JA 1JHAA 2VSQA 1C0IA 2ZSDA 3SYLA 4CLRB 2BI4A 2ZJZA 2MR6A 3QJGA 3QF7A 3DTVD 3JQRA 2IS6A 2HHCA 5KWIA 4EQ6A 5ITSA 1IHYA 4CEHB 5IAOA 5GVSA 1XFAA 3KKZA 1LBQA 5DX1A 5ALRA 3EVFA 4R3UC 5KYVA 2HJVA 3JQ8A 3SC2B 4BQOA 3FDFA 2EP7A 4OQPA 1NKVA 3WLSA 1JHZA 4P9NA 3RGGA 3CSDA 3ZU3A 1EP9A 3GRYA 1XEAA 3DOJA 3Q72A 4K9KA 4QDKA 1DWOA 3R7BA 3T1YB 2BKUA 3ECSA 5DWVA 4BCCA 2DQKA 4ENWA 1WXHA 1O6CA 1TLTA 2BFFB 5FAXA 1PWYE 3FRHA 1VPTA 3DMPA 1N2JA 3K5HA 1HDEA 4DGQA 3F6RA 3O9MA 1E61A 1Z2CA 2ZJ0A 9MHTA 3FROA 3DBOB 4MUEA 4BNLA 4C0QC 3JAKA 4HAXA 4MS1B 1OIWA 2QLMA 3TLBA 3UWMA 2GERA 3WV4A 3EGOA 3ZC3A 2VFAA 2G25A 3OZXA 4R9UC 5DHPA 1NR5A 1FP7A 1EX1A 2GPNA 4IWNA 1C8BA 4XQ9A 4OQYA 3KHUA 3CLUC 1QCCA 2EFJA 3EAQA 4F4CA 5C7OO 2VSFA 4RVOA 2WHXA 1K7CA 2JI7A 3DDNA 3JV7A 2PGIA 4N9WA 3EHDA 3COVA 5DYNA 5EEGA 1K6MA 4DG8A 3R3ZA 5IX8A 1NNUA 2P2SA 3B3GA 4I3GA 3LWNA 3M33A 3V4VB 3SDSA 2ZE7A 1EJ2A 2VQ3A 2NZ8A 1ILWA 1TRKA 1WPRA 2OWDA 2YIMA 3PQ5A 5AI0A 5BN5B 4EDHA 2CLCX 5TJ9A 1C2YA 3B8EA 3H6GA 3T9CA 4TS9A 3ZEIA 5KOJA 1VI5A 4M0FA 4YJGA 2CJXA 1VRVA 3L1IA 3NANA 4RKWA 2AOVA 3ZE6A 4CCSA 2Z8ZA 3NJRA 5EHZA 3WYCA 1VLQA 2C5GA 1GNVA 3NXSA 1C1XA 2FWIA 3OTHA 4UXHA 3HI4A 3DKKA 2C31A 4A26A 3CXUA 1ADFA 2BFBB 4B2IA 1PTJC 3G1TA 1XZNA 2P68A 1HBJA 2I4OA 5HF5A 4INOA 3SR4A 2CJFA 4Q15A 5FYQA 1V5FA 1S2LA 3HGTA 5JCJD 2XSZD 5KWVA 4BX2A 1PFVA 4N9QA 1TECE 4LN1A 5ERYA 4GBJA 4DW8A 2QR3A 1U7HA 4O0LA 3N8DA 4RSMA 3MMSA 5HJ5A 3MBIA 5THKA 5AM3A 1L5MA 3LVQE 2EZ9A 1Z38A 4HGPA 4PC2A 4PN7A 5KSOA 1L7QA 1A77A 3KPYA 1QF9A 4DCTA 1K5DA 3CHYA 2H4WA 4R9RA 3T5CA 5JZVA 4LSGA 3S28A 3PGJA 3TLEA 4TQ9A 2R11A 4EA6A 4RD3A 3RBXA 1PDWA 1BVRA 4MIOA 2G70A 1E7SA 1CIVA 2YVLA 3OPMA 3N5KA 2BSQA 4XZ3A 3C8HA 5ES3A 2ORYA 2XWQA 3CRNA 5CH5A 4C7JA 2K7FA 5F78A 1FMFA 4YCCA 1L7AA 4KWIA 1RXYA 4EYKA 3TR6A 1ADYA 1E1KA 2VTKA 1G5TA 3ICVA 4YAKA 5IDXA 1KXJA 5EJIA 3PGXA 4HHEA 3N1UA 4OHUA 3BTUA 2ZLBA 1L4FA 3ZGLA 3WGNA 4Q37A 3GJXC 3Q5EA 2MWMA 1ZJYA 3LUBA 4RF3A 1MOPA 3KQQA 1B93A 5IK2A 3SZOA 2UVDA 5B37A 1QMPA 5D3QA 5EQTA 4A8PA 4H08A 2IXFA 1YRBA 2KWIA 2XIJA 1N1MA 4WSOA 3QIVA 1QIEA 4QUKA 3URMA 3DCNA 1L1QA 4JBLA 1K4KA 5T57A 3ZDAA 2YVUA 2NTNA 5A4IS 4L0MA 2JLVA 4TSFA 2OXRA 4OGFA 3UA3A 5LUAA 4ZI5A 3T9EA 2J59A 3ZV4A 3R23A 1CUBA 2QZ9A 3DM5A 4GWLA 2H5IA 1G4AE 3ADKA 4OL9A 3SFVA 5KVCA 1Z15A 2MINA 8ATCA 3QW4B 4ZOQI 2GNOA 2OK8A 3CLTC 3KSBC 4GOJA 3TCNA 3WGOA 3RYCA 4QXPA 4LBVA 2BZGA 5FHRA 3EQ8A 1BKDR 2CZCA 3DOIA 2B6NA 4IV0A 1ZU5A 3AEQB 3BE6A 3X43A 1F9EA 1J9EA 2C7PA 2ZJBA 3Q1KA 3VZSA 1SK8A 1SN7A 2XNHA 2IWHA 3SFZA 4BJHB 1PU2A 2NVOA 4KSBA 2VUIB 4EYOA 3RAPR 3DEFA 3PDHA 1JXQA 1LRKA 3KEQA 1FMJA 6GPBA 5HYVA 1WXEA 2FUEA 1I5EA 3F1KA 4JP8A 4YMWA 3VHRA 1JA9A 1CYDA 2GEBA 2QYHA 4Q03A 3ZV3A 3Q5DA 1WY7A 3QLJA 1QZUA 4CI0B 2JKYA 3HCOA 2HDOA 4BO9A 4TKZA 2P0EA 3CXRA 3O3MB 4ID9A 3W5JA 1QFYA 4UTZA 1H8HD 2R62A 4YP6A 4TM8A 2P2ZA 2CLDX 1CS4C 1H2WA 3K1JA 4ZAVA 3PT5A 3HXLA 2PXHA 3PZBA 3WP0A 4F12A 4U63A 4JHLA 3VDMA 3QUAA 1C9MA 5B2EA 1UP7A 4BUCA 1NN0A 2FG7C 4G0ZA 2QBYA 1KH1A 3H18A 4HSEA 5HKOA 2QDXA 3C45A 3WWZA 5E3JA 4BFSA 1PR6A 3DL2A 4OSPA 5EHGA 5KQSA 1YRWA 1X3SA 3CX8A 4JLSA 3BCSA 3DYIA 3U44A 1OB2A 3ZYCA 1O6FA 4OIFA 4J0KA 3QZUA 4ZT6A 4O29A 4XGNA 4UUQA 2YN2A 5JRJA 2Y1GA 1BJKA 3QEAZ 1PTJA 5IKEA 2IP1A 1FVOA 3U44B 3GFSA 5CYPA 1MGOA 3TI7A 4GOND 4BNNA 4U2KA 4ALJA 2F64A 4RPIA 1QGUA 1TT5A 5C1PA 4DT1B 2NQTA 2DULA 3OIFA 1SUEA 3ZCVA 4BRZA 5F9MA 4EHKA 3COJA 4DA8A 1KOGA 3G2KA 2ADMA 3DD1A 3MWLA 1HLPA 5BSMA 1YHNA 2WZBA 4FQ8A 3P7MA 3WA7A 2DFKB 2R8OA 1W36B 1JG4A 4RHCA 2GM5A 5L53A 3N74A 2I6UA 5J4VA 3DKIA 2AEEA 1GILA 2NPOA 4OAPA 3WBBA 3EPHA 1QVVA 2LCFA 4CL8A 5ARBA 1C9NA 2MSLA 1WF3A 3MT0A 4NBKA 5CIYA 1N9KA 1D3AA 1T8WA 4IJVA 4EDFA 4D02A 4ASUA 2OZKA 5TPWA 5E9JA 1TEVA 2RJNA 2ZAIA 3P2IA 1I2AA 5EGSA 4J6EA 1VMAA 1U2DC 3PPYA 1EVYA 4KCGA 3KO8A 2EX4A 4C22A 4RE6A 3WO1A 2COEA 1AVTA 3G0OA 3LX8A 4HDNA 3GV0A 5AJHA 3I5XA 4M9SA 1JW9B 4G09A 2A5JA 1DQZA 2O0MA 2GPSA 2VL7A 4FJ2A 1SZJG 2VDOB 4I1VA 4ZO8A 2K5UA 4GHWA 3RFCA 5CDFE 4JVOA 3WGZA 1YV9A 3FMIA 3GEBA 4AM8A 2EKLA 1GJRA 1KJQA 5I9SA 5DGIA 3VMFA 3HZOA 4BX8A 3AVVA 5I7OA 4F2HA 4BFZA 3DE2X 4F4JA 2FU5C 4PY2A 4PM4A 2BFMA 3QY9A 1XTIA 5HX7A 1KVTA 3H86A 4HDKB 5IAKA 1HDRA 1CJBA 2HRRA 4KODA 3TX6A 1PFYA 2PS1A 4UQLA 5AVRA 2FQYA 1FUUA 1QH9A 4PSCA 1EWVA 4KIWA 1LD3A 1MGPA 2JFGA 4OHZA 3KLOA 4YIHA 1VI2A 2G9QA 2AEMA 2Q2QA 1VL2A 4E4TA 2NU6A 4BMSA 4RVGA 4CR8A 1KERA 5CFZA 2BCJQ 3HXKA 2QTVB 1NBWB 2GD0A 1WUTA 2G8NA 2QN3A 3AG6A 4D6XA 5BVHA 1ZR2A 3H3FA 5REQB 2JLAA 3VZQA 2I66A 3T4EA 1XEFA 4WCDA 3ZZNA 4OHKA 4BTVA 2QRHA 1R15A 3VI4B 3R9KA 1YONA 4GYKA 1KJJA 3MIIA 1N2XA 1NUPA 3N9IA 3QE4A 3T06B 4DDMA 1P9RA 3PWKA 4C88A 4L5CA 3DMTA 3GY0A 1IRXA 5FWYB 1U02A 4QYWA 2QRVA 3GIDA 3L8EA 4HNUA 5CDUA 2Y3IA 5JEDA 3M6XA 2SNIE 3PKJA 3Q0EA 3OUTA 4EEKA 3RVNA 2V3VA 5CEFA 1C0EA 4QAJA 4ZAGA 3DLIA 4HVLA 1GEGA 4X84A 3T8YA 4HDQB 3ZPXA 5K0BA 1MJ5A 3CMMA 2WKPA 3KG2A 2CVZA 3LHIA 3OTGA 3RS7A 3HCRA 2A5LA 3KL2A 3V4OA 4ZCMA 3NIBA 3PXBA 3UOGA 4CUJA 2AUNA 4MDHA 4F3KA 4KHZA 3NEYA 2O7RA 3BWXA 1N6LA 1X7HA 3HYTA 3OVMA 3NKLA 2Y66A 2I3GA 4FT2A 4MKGA 2WWYA 1EG2A 1IPEA 2C5LA 4NU8X 3N70A 3GEHA 1X0XA 2ZANA 1OE0A 4L07A 4ZTBA 3JYQA 3AL3A 1VG1A 2VNAA 4W9RA 5IVDA 3U81A 3WADA 4AZWA 4MR7A 4RNDB 1Y8ZA 4RJTA 4H7DA 4UDOA 1ID1A 3P0EA 1CT9A 1PL0A 2JARA 2XJ9A 5DTMA 2FEMA 5FNVA 5LCXA 3L6UA 3H4IA 4MWGA 4ZQCB 4XH9B 3AF5A 3U4QA 2DGDA 3FCUB 4QNNA 5TV2A 3PHLA 3S99A 3WRWA 3RC3A 1W1UA 4FZVA 5BSFA 2YX1A 3DLTA 3PS9A 4ESVA 1WUIS 2B5OA 4O4IA 7AT1A 3HMQA 3G02A 1AS0A 2CYAA 3A06A 4LBWA 4QOHA 3TMAA 4Q3DA 2IYWA 3TM5A 5FUYA 1GHTA 3HB7A 3OD5A 2GPYA 3N58A 2BGUA 3HCAA 4WKCA 4CN9A 2BUCA 1ABEA 2G77B 3OJLA 3BM5A 3DONA 4JI0B 3PA6A 5T3UA 3Q3HA 4BAUA 3NFRA 5DCWA 3PA8A 1I4EB 2AR7A 4P3XA 2HMSA 4OPMA 1MV5A 1TADA 2GD6A 3N76A 4C78A 4H4EA 3AQIA 3BULA 3V8MA 2OCYC 4BB5A 3OH8A 4ETIA 1MR3F 3Q3VA 5ESXA 2F43B 2V6GA 4CT4B 4QPPA 2RGXA 3KPJA 3JWGA 3AXSA 1EBBA 4LJYA 4RA6B 3ZIUA 2JD1A 2XF2A 3ZDYB 2CVFA 1U2DA 1UC4B 3K70B 4CMEC 2R8PA 3O4JA 4RK6A 3WFJA 5JPDA 1J22A 3ZHZA 5BSKA 3QWFA 3VPDA 3WIEA 3BQ9A 1E9VA 5FQNA 3FKJA 4XUCA 2OPHA 4F86A 3PJRA 1KEUA 7REQA 4ZARA 1IJKA 5ECWA 3K8YA 4DY6A 3SQXA 3L43A 2ZT8A 3JSXA 1NBOA 1PL7A 3HO6A 3EXEB 2FOXA 3ITKA 4I9NA 5GWXA 5DLYA 4BASA 5I7WA 3PXAA 4ONEA 1H2BA 3A3YA 1GG5A 2P62A 3FMOB 1YT5A 3VPAA 4K5QA 5BWCA 3FJ1A 4NYMR 4KPYA 4CLXA 3DZHA 3QWAA 4M1OA 4WLNA 5H02A 1NT4A 2PZBA 2Z1NA 3OPYI 3C97A 1Q44A 2YY6A 3ANLA 4KACA 4K9NA 3EMBA 1HH4A 3K1AB 4ZYZA 5K01A 1DRUA 1JKXA 1E7YA 1QKIA 2FPPB 1W34A 4KI7A 4V2UA 3RJZA 5GJCA 3WZLA 3NBAA 5A5VA 5LLTA 3ZLTA 5TMPA 2B2CA 2VHXA 3A6JA 5JFGA 2A2ZA 3THYB 1I7NA 1NVEA 3QVWA 4UM8B 3ZN2A 4RENA 2V7XA 1Y8RA 1J09A 1NNEA 2BMAA 5FPYA 1A50B 4DR2B 4IQFA 4I5GA 4BXOA 2PRIA 1G1AA 1GTJ1 4MB2A 4EJFA 2RIRA 3HO8A 2HBQA 3QE3A 1OFGA 2O8NA 3AUKA 2C1EA 3AHGA 3T5BA 4C05A 4AKIA 3L1HA 1RAEA 3CUYA 2IUUA 1LSOA 1ZOOA 2CNKA 3UQZA 5JSHA 1OOEA 5HZGA 1XVAA 3IERA 2AOWA 4KIGA 3SDZA 1JJBA 1URPA 1Z17A 3VSAA 3BT7A 4V0ME 1Y3DE 4EFLA 4EPXA 3VR3D 1U2QA 1A2OA 5MGBA 1V4VA 2ZBVA 4FCWA 1XU4A 3L49A 2V7EA 1JJFA 3IBYA 4JJZA 3GWZA 1S2IA 2G1UA 3HKDB 2DKFA 3ZW9A 4W99A 1JDTA 2WHPB 2YXNA 4RVSA 3S2FA 5AVUA 5AXDA 5LIRA 3WQHA 5C35A 1E98A 1J90A 1L7EA 2FPIA 2C9OA 1JFRA 3LPCA 3R20A 5AW9A 3TUIC 3U7JA 3SXPA 1FW6A 1PNVA 3W90A 2I6FA 4L3WA 4H3VA 2H4YA 1SOAA 1AKUA 1A69A 3E70C 3M1IA 421PA 4PYLA 1ZIYA 2FY8A 2FR0A 1SK9A 4MRMA 4NMMA 5ES4B 1VJTA 4FJ0A 5BW5A 1CKEA 4YDQA 2ZT7A 2WU3A 3DVAB 3FNRA 4DTCA 2E5WA 4IFIA 2B21A 4IUDS 2W6ZA 4YWJA 4F7DA 5CBKA 2K7ZA 1UBRS 3UMGA 3ZBQA 4PC1A 2Y9PB 1DJOA 1IONA 1ND5A 1ZIDA 4BGIA 1UBUS 2GZ2A 1PGQA 2F2TA 4YJ3B 5AHWA 2ZR0A 3RCBA 3VFDA 2W48A 3WIDA 4DM3A 1PV1A 4B3BA 2RK3A 4POOA 4KO8A 1D6NA 4LHXA 3SM9A 1IVYA 1GRVA 1WCV1 2OBXA 1DLIA 1IZYA 1FB5A 1VSBA 4GMGA 2YIVX 4EW3A 4PLGA 1NMQA 3ND9A 5ABPA 2CXQA 2WM3A 4CETA 5SY4A 1QNLA 2ZYUX 5EJ6A 3P5SA 2ZRMA 1R12A 3D4LA 3GBVA 3QELB 1S8AA 3KJXA 5C8YA 1GDTA 4RK4A 4G3XA 3EZGA 4CVNA 1Z37A 4B4WA 4AULA 4ZPXA 4XWWA 2BHNA 1LCIA 3WB1A 3MLAA 3BF7A 1IEVA 1WXWA 3CZQA 2FR8C 3V4LA 4Q5IA 2QVXX 2WWTA 4AWAA 4YX9A 4FSHA 3C4QA 2D54A 1CJTC 5BUCA 1N8TA 2KB0A 2Q46A 4EGAA 1DIHA 1XMIA 4HQRA 3MJEA 1XTKA 1U0NA 5EHIA 2VKTA 1C1DB 1KYZA 2ATEA 3LUJA 1E7MA 2PLFA 4IKOA 4IO1A 3AIOA 1W29A 1Q50A 4OY3A 3P26A 2NZYA 3FWYA 3OOJA 4ITUA 4CMEA 3T3PB 3GD7A 5H83A 3VNUA 1OYWA 1AKWA 4I4LA 4D98A 4DIDA 4ARZB 3G2LA 2EFEB 3AUFA 3LQ1A 1NKTA 1IHOA 3EARA 4YJ3F 1A95A 4O8CA 3IEMA 1JNYA 2XUJA 4WT7A 1HK7A 3B7GA 4H17A 3KYDA 4CKWB 2H4ZA 4Q9HA 4CM8A 1YU6A 3HR4A 1FYVA 1JQ3A 1WR8A 1QLWA 2XGMA 4LFAB 4RGVA 4BMNA 1P62B 2X15A 3Q8WA 4EMTA 1ZNWA 4UM9B 1YASA 1R0RE 2WEKA 4YRPA 1S2DA 4J16C 3VC3A 4BLTA 4D3DA 2WUGA 2C4HA 4E7OA 1WNTA 2IYNA 4OMUA 4R16A 4NHOA 5K45A 2WUDA 3DB1A 2WWGA 4K6GA 1A2KC 3QOXA 2HLPA 3BJIC 2XXAB 1X80A 3IH5A 5K3BA 5A3JA 3A9CA 4UTVA 1CW2B 2J5XA 4HRYA 1RHQA 2FEXA 3CE6A 4DSOA 5LU9A 1SFRA 3P97A 1JPVA 4LXUA 4U02A 5BMVB 5DMHA 3KHSA 1DFIA 2GEJA 3AR7A 5KO2A 2O6HA 2F8SA 1JI0A 4JEUA 3OQBA 4LQLA 4KB5A 2IEYA 3PXEA 1BGXT 3CT4A 3HWRA 3P52A 1N3BA 4FQ5A 4RADA 3W5IA 2Z98A 2BPOA 1Z2NX 3HDYA 1Y4AE 3KTAA 4EITA 1IJFA 1GPAA 4U2EA 3ZHUA 3TLMA 1RQXA 4D96A 3R5TA 4KO3S 5CXQA 2R4UA 3I42A 5D3MA 1XTZA 3IUJA 4C6TB 1NMXA 3BWCA 4MS4A 4E12A 1J49A 3VNAA 2ZYDA 4MPRA 2GRUA 1SUDA 1TJ5A 4R5HA 5DXAA 3VC7A 4BNFA 1R0LA 5FWXA 3A05A 2PX3A 3IQDB 3EIHA 3IVGA 1HRKA 2RI1A 1Z0UA 3EGIA 3B82A 3Q7IA 2GS9A 5JAZA 1L5WA 4UAJA 4H35A 3PGMA 2IXBA 4IFEA 5J9FA 2WVGA 3EUAA 4HUTA 3AVTA 1KYYA 1TCCA 5EJ8A 1INLA 2JFYA 3VAYA 3IPCA 4CIWA 1RYDA 2Z8YA 5DI3B 3SQWA 5HRCA 3WBJA 2P6MA 5BSUA 3L0YA 5BSTA 1UKBA 4WEOA 1OV4A 4EJ2A 4K8RB 1LDMA 2JFWA 4HZUA 1Z39A 2J9FA 3RUIA 4DG5A 1NVVR 1M83A 3C3BA 1VJ5A 1U0SY 2JFHA 2O4UX 3GDWA 4L4UA 4QLBA 3PEWA 4YAGA 1P1JA 1J7JA 1ECFA 1MTOA 3TBFA 1KA9H 1ECLA 5B7QA 4Y1EA 4E3WA 3OSUA 1RZRD 4OHYA 3B60A 2TMYA 4E5PA 2PUDA 3D4BA 3RG2A 4KC0A 5M7EA 4IW3B 1SIWA 2GRAA 4QVIA 4JX9A 4Y2JA 2AG8A 3ETNA 3A58B 4TMTA 4HSGA 5B4TA 1U0JA 1GPLA 1IUNA 1G6Q1 3ENVA 3OZBA 3FUCA 5F7ZA 5KVVA 3SI7A 1A76A 4CG0A 1KAOA 5LL6P 2DFNA 2HMVA 4BMCA 1H05A 2YC4C 3UT0A 4D9EA 3M34A 2E3JA 2VLIA 3FVVA 3PNOA 2CUKA 1B0UA 3HBFA 3T99A 1ICIA 1U7DA 2ZIFA 4LHWA 4D74A 4BO2A 1Q6ZA 1TYCA 2ZIWB 4AJKA 5ICMA 3M4ZA 3ZWWA 1JQ5A 1VOTA 3CKLA 3UHJA 1T34A 3U5TA 1I2CA 4EAAA 4TXHA 3L4BC 2FR8A 1JIQA 3AHJA 3ZZTA 1KDRA 3SLRA 2WD7A 4IEEA 3W3AA 5LA6B 3V32A 4JD5A 1MG5A 3HI6A 1FXWA 5FTKA 5L3SA 1LH0A 1XJQA 2PL3A 1VIMA 3HJGA 4OP2A 2XJ4A 1IY1A 5TT0A 3UUGA 5DYGA 4UCXA 4UOEA 4GXNA 1OZ0A 1XTQA 2QEQA 1TD1A 3FCOA 1RMQA 3ANXA 3FPAA 1LVHA 2P9HA 5AKEA 4OUDA 3A31A 1XD8A 3JD4A 3Q9UA 2HMWA 4O3MA 3RU3A 5ITZA 1F4VA 2H57A 3LK6A 5CPBA 3E7DA 5EWLA 4H1TA 4HDMA 1E3WA 3CLRC 2XF8A 4IYJA 3GUCA 4KBFA 4DCPA 3FCAA 4NK5A 2PKCA 2VT2A 1L8OA 2PSFA 2E6UX 4YPFA 4PONA 2DC1A 3BXXA 4F4HA 5ILOA 2BGMA 5IMSA 1I4TD 1U0LA 1ZLYA 4ME6A 1M1UA 1M7GA 4LDNA 3OOHA 1KI4A 4NK4A 4B6GA 1XZMA 1X3LA 4IEFB 3DL0A 4NQZA 3PTZA 1WA5A 4HV4A 2R7MA 2Q2NA 1NG1A 2ZUCA 4L4XA 4HTFB 2J3KA 1MRNA 1T1IA 3E9NA 4D0LB 5KS2A 1NDUA 1P6XA 1HFWA 1N5IA 1OF1A 2G17A 5CX4A 4KR9A 3QYPA 1W73A 4TL8A 3PDIB 4PXYA 2VZLA 1E2BA 1FFDA 3L9WA 5K9ZA 5FEUA 3G7UA 1O3YA 1RKBA 5E9QA 4ZU1X 4Q9KA 1T6NA 3OZFA 3U3MA 5HQTA 3PRKE 1E2IA 2ZCUA 4RGBA 4FCCA 1IZ8A 4EEZA 2LTAA 5DYIA 4DXHA 2ATXA 1QIDA 1GNTA 2CL5A 4PLVA 3NONA 4ZGWA 1EHYA 1JBEA 2GPBA 3EA5A 4ZN6A 1JPUA 1XAGA 4H18A 3F4KA 3KJNA 4IX9A 1KMIY 2K2QB 1Q3TA 2JAUA 2J07A 2VZ9A 4I0WB 3ICEA 3BBPA 4C7MA 4TV8B 3RIEA 3E9RA 1MAUA 1BH6A 3C8ZA 3HPQA 2P3SA 1C0LA 2QG9A 3ODGA 4NZYA 5BQ5A 3RFTA 3KSRA 4MUXA 4ETMA 4MPTA 4FC7A 1P1FA 2HPHA 4WKBA 4KYVA 4EF6A 1W46A 3BHNA 5AJUA 5DN9A 4XLZA 2AJDA 1QG6A 3F47A 1IIBA 1K2WA 2QUIA 4DLBA 1KRHA 4G1VA 5H82A 3RUPA 3H2JA 4AN0A 1SO8A 4WXMA 3VOBA 3BJRA 3RW9A 4IKEA 1WU8A 2BGTA 2WJWA 2QYSA 4QT0A 1GU0A 3IQZA 1HTTA 4G4SO 4A10A 1EE2A 1KZGB 1VHJA 2BFFA 1NRJB 1ZK4A 2UZ0A 2NM0A 4JGGA 5J58A 2YJ6A 3EBPA 2AZMA 4TRNA 4ZKDA 1IWPB 2PE5A 4QG7A 3U56A 4IDAA 3AKEA 3F67A 3M0EA