3T61A

Crystal structure of a gluconokinase from sinorhizobium meliloti 1021
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
176
structure length
176
Chain Sequence
b'RRFPGSIVVMGVSGSGKSSVGEAIAEACGYPFIEGDALHPPENIRKMSEGIPLTDDDRWPWLAAIGERLASREPVVVSCSALKRSYRDKLRESAPGGLAFVFLHGSESVLAERMHHRTGHFMPSSLLQTQLETLEDPRGEVRTVAVDVAQPLAEIVREALAGLARLAENLYFQSHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gluconokinase
publication title Crystal Structure of a gluconokinase from Sinorhizobium meliloti 1021
rcsb
source organism Sinorhizobium meliloti
molecule tags Transferase
total genus 59
structure length 176
sequence length 176
chains with identical sequence B
ec nomenclature ec 2.7.1.12: Gluconokinase.
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3t61A00
1M1YE 2XNSA 3T61A 1E79D 3GPLA 1P2UA 4URWR 2XGJA 4XVUA 4YQFA 4GSYA 4MKIA 1KJYA 4IXMA 4TYYA 4ZKDA 3JZMA 1G7CA 1KDOA 3TLXA 4N0EA 1W4RA 4GL2A 4KFSA 2XZPA 4QJ4A 4JMPA 3VR5A 4D4KA 3JVUA 3TKLA 3PEYA 5EE1A 2F1HA 5KO2A 3TH5A 4NKRA 4YMWA 1P60A 1NY5A 3LD9A 4M1KA 3W6PA 3EA5A 2O8FB 1GL7A 3P1JA 2ZS7A 3QI2A 1CEEA 5J40A 2W2VA 2BEJA 1N6HA 5KHOC 1E94E 1GAJA 1GP2A 3LBHA 5IF9A 2CHVA 3CR8A 1NN1A 2BBSA 4HB3A 2WTUA 4QM6A 2BHRA 2QAGC 1XD2A 2C78A 3Q5DA 2XITA 4BLQA 2JJ1A 1Z3IX 2FPKA 3GLIE 4GPTA 2ZRBA 1Z08A 5J47A 4Q7JB 1OH6A 1G3IA 2AFHE 1QG4A 4B3FX 5KSPA 2XSZA 4WXPA 4QNRA 1OT3A 1GDDA 1ZP6A 3M6AA 4B34A 1JECA 2F3TA 2IX3A 2A5YB 1LF5A 1XPRA 5K8UA 2YVUA 1UM8A 3I3SR 4ABYA 2VO1A 3C16C 2GAAA 3CB4A 5JRJA 3IQXA 2AWNA 4LI0A 3W6NA 1AJEA 1E9AA 2V4ZA 3RS7A 3VU9A 3QSYA 2GZHA 3BRWD 3M4YA 3GEIA 1WQ1R 4HZIA 3ZLJA 1T9HA 1P6XA 4OQXA 3FB4A 3BFVA 3LBNA 5EP1A 4KFRA 5K8IA 1IM2A 1J90A 2BIFA 2ZE8A 4DLRA 3G0HA 5FOVA 1G21E 4LC1A 4JVLA 3ZVLA 4JLKA 3MJHA 4LPKA 2AXNA 1KHTA 4LJ7A 2WJVA 5EUQB 2GBLA 4OJQA 3VMFA 4OHYA 4NYMQ 3U7EB 2BM1A 3E5HA 5FPHA 3J81k 4BFVA 1E3MA 1NNEA 2Q0HA 3A37A 3VFDA 1IXRC 2ZRDA 1T3HA 2JLRA 4G0NA 3P4YA 2H17A 4EKDA 4DT1A 1R10A 2PCLA 1CULC 4PC3A 2ZE5A 1T3LA 1XEXB 1P62B 3GCGA 1YZTA 4DLXA 2QE7A 4RY2A 4PZYA 4BLRA 3K0EA 3Q8XB 1HT1E 5BN4A 4KU4A 2WWIA 1EFRA 2WOOA 2VA8A 1XMSA 1K6MA 3VHLB 3SU8A 3NH6A 2OFOA 3A4NA 2ZAMA 3X1ZA 2CBZA 3U6BA 1YVDA 3THOA 2ZSDA 3PQCA 2IK8A 5JS8A 1AM4D 3LDAA 2OCPA 1UF9A 5HKKD 1EFTA 5CM8B 4IVPA 1N6IA 4C2TA 1EG7A 3G5UA 1AGRA 4JT2A 1ETUA 2DFLA 3NH9A 3RRYA 4RFSA 4V02A 1E4YA 1JJ7A 1PLLA 4MQBA 3LWNA 3KKOA 4KO8A 3ASYA 1CU1A 3KUDA 2WSMA 2I3BA 5IT5A 2ZUCA 3TGPA 4KI0A 1JAIA 5C1BA 1X1RA 3N70A 3FMPB 4Q1BA 4ZCMA 1S3SA 3B7GA 3R8CA 1E0AA 3NHBA 1MKYA 2CL0X 2ANCA 3N5CA 3GJ4A 4LBZA 5TMPA 4IOJA 1E4VA 3QENA 2LCFA 1OPXA 3F3YA 4ZV4A 2WOJA 1CRQA 1E79A 2IBMA 3K9LA 3AKDA 3HWSA 4I1SA 3WXMA 3AF2A 4PQRA 4R7ZA 1DG3A 4CT4B 3CO5A 5UKDA 2ZR9A 1RW4A 3NWJA 4DWJA 4U00A 1UBGA 3L0IB 1U9IA 2F43B 5JCZA 1FX0B 1UKYA 3LH5A 2GZDA 4M9QA 4KLNA 3X1WA 3HYRA 4NU0A 1N5IA 1E32A 1ONBA 3GLIB 4JL6A 4JZKA 4AC9A 1J99A 1XMIA 1FQJA 2XJ4A 1JNYA 5EP2A 4LRWA 3TBKA 5JZVA 3AUXA 1E9BA 1MV5A 3WBJA 2V6JA 3LRPA 1N25A 3NBYC 4QRHA 3ZIAD 3UKDA 4CW7A 1EX6A 3IBYA 4UKDA 2ZUDA 2Z43A 2RGGA 1G8YA 1TL7C 2ZI3A 3GJ3A 4B48A 3ASZA 2G0TA 4A6PA 1Q44A 3AF1A 2ZVPX 4Q4HB 4TL6A 2PEZA 3T15A 2VHCA 1KI1A 1KY2A 4U02A 1S8FA 4RZUA 1ZUIA 1E2NA 1GILA 3QJYA 2J3EA 3ADDA 2R9VA 4FCWA 5DI3A 1RE0A 2PMKA 2FZ4A 2QZ4A 3KQLA 5JFGA 3B8HA 2BCJQ 4BRUA 1LF0A 4DLWA 2VBCA 3EPHA 1RFLA 3TIFA 5CLQA 1VKJA 1Q20A 2G9NA 4A4DA 221PA 2FEMA 3BH6A 4JVNA 3WRXC 2VH5R 4B76A 3I4LA 3NDBB 3KX2A 4LHWA 2EFCB 2ZRIA 4V0KA 1V43A 3QOFA 1KI7A 2PBRA 3SDZA 1DTSA 2E1RA 4XOIA 4D25A 2MSCB 4EQ6B 3GMTA 1KZ7B 5G53C 4Q19A 1E9FA 1U99A 3EA0A 4B74A 1YZQA 1PUJA 1N5JA 2OXRA 2XTNA 4YLGA 3K09C 4A0HA 2FV8A 2GDJA 2IXFA 4IDNA 1W44A 1AZTA 4UXHA 4TTPA 4PSKA 3LBIA 2GF9A 2QMHA 2V8OA 3U3JA 4E03A 3N2EA 4TL9A 5E3HA 2BDTA 2RGBA 3EG5A 3HU3A 2D4HA 2OCYC 4U7DA 1KKLA 2YWGA 4ZDIA 4DLVA 4E22A 3BD9A 3DZDA 1AQUA 1WA5A 3GEHA 1XTKA 4XIGS 1Z63A 1XCGB 3L8YA 3NC1C 1Z83A 3TW4A 4IEIA 4TLBA 1NN0A 1ZCAA 1KNQA 4O2LA 4OI2A 1FQKA 1N6OA 2PZFA 3ADBA 5E95A 1EFHA 3K0AA 4KODA 1E99A 1C4OA 4DSTA 4X8LA 3O8DA 4NL4H 1R0ZA 4NCNA 3BH7A 1KSFX 1SVMA 1IY2A 5KNBA 4DLZA 1G4AE 2O0KA 1SXJB 2CJWA 2FOLA 1RKBA 2ZAOA 4BFTA 1D9XA 4QBHA 1KSHA 1AQYA 4B2LA 1FPMA 1DG1G 5B64A 5M04A 2DB3A 1GFIA 1UAAA 1F2UB 3VHXA 4DLUA 2J59A 4XD7A 2AKAB 2YV5A 4KYIB 2QENA 2NG1A 2WZQA 4W7SA 5CIQA 1JALA 1MABB 4G3XA 1QDEA 3VX4A 5HZKA 2QAGA 1W2GA 5FBWB 4DB2A 4N3NA 1N6PA 4ZPXA 2J0UB 2GEVA 4B75A 2HDNB 2ZRLA 2KB0A 5L8VA 3A4LA 4RD6A 4BLPA 3RWMB 2ATXA 3ND8A 3BE4A 3QG1A 3LLMA 1YE8A 1W36D 4ASUA 4GRAA 2B7BA 2IXEA 5DH9A 1K5DA 1QZXA 1NG1A 2Q9BA 2ZRPA 1FFHA 2WSSD 1SULA 2EYQA 2QL6A 4FMCB 1ODFA 5FR1A 3BERA 3CBQA 4D2IA 4NCHA 1T5LA 2GEUA 1X6VA 3QXXA 2NQ2C 3T5GA 4A1FA 4A15A 1Z0AA 1D2EA 1S2MA 4O3MA 3CZPA 2BJWA 1A7JA 4DDTA 5KSZA 2JJ2D 2ZM5A 3ZIAA 2QMUA 2BC9A 3SYNA 2I4IA 4NCJA 1XZPA 2OT3B 1NVVR 3CRVA 3GJ6A 4B3XA 1Q57A 2C5LA 1VDZA 5JJKA 4PR0A 5JMTA 2AKYA 4BFWA 3FHCB 3GJ5A 3Q5EA 4Q66C 3UK6A 4F91B 5SZJA 1OB2A 5FBVB 1KDTA 3Q9LA 1VYVA 2Z4RA 4A0GA 4WIAA 3DMNA 1WXQA 5EZ5A 4DIDA 4LY6A 4MGZR 4HLUA 2ZXUA 2IHYA 4MKGA 1T4GA 1QHSA 1U98A 3R7WA 1P2TA 4HAVA 3SBEA 3SOPA 1VG0B 2NIPA 3KB2A 5TDHA 4NYMR 1IN7A 1Y63A 2C2HA 1NJGA 2FPMA 2Q21A 3DOFA 4OK6A 3QBTA 3TVDA 2D7DA 2JLVA 4EFNA 1WP9A 4LOAA 1WMSA 4RKFA 1TQDA 2FPLA 4JYCA 3GFOA 5BW8A 2JLWA 2WM9B 1R4AA 2O8CB 3ZS8A 2W58A 1P9NA 3I62A 4M53A 1KSJA 3LFUA 2FSIA 3FVQA 2JA1A 2RH5A 3THWA 1E2JA 1TEXA 4QBFA 4RD0A 4V03A 5EJEA 2ZI6A 1XMVA 2OHFA 3EWAA 3I1FA 2YC4C 4IW3B 4B32A 1RYHA 2DCUA 5LB4A 3MFYA 4NYIQ 5HCIA 2RCNA 5CJPA 1QRAA 3ZD7A 3SJCA 3AVXA 4Q9KA 5JWOA 2ZI7A 4O2RA 2ZR7A 4B47A 2Z5FA 3REFA 3DPUA 4URXR 4LHXA 4FN5A 1IN4A 5DI9A 3AVQA 4XWOA 4KXFB 4R2IA 1US8A 4OBEA 5DE3A 1DO2A 4GBMA 4P33A 3IHLA 4DCTA 2AFIE 1G19A 1D8TA 2IYLD 3DM9B 5DIFA 2QN6A 2KBFA 3MCAA 3GLGE 1NLFA 1OFHA 1G9XA 2ZRCA 4TQ9A 1S3GA 2IYRA 1NLZA 5KDLA 3FMOB 4D26A 3ZS9A 4LV6A 3GLGA 4B71A 1TNDA 1NSFA 4RSGA 2EFDB 1EFUA 5G3ZA 2R6CA 1IQPA 1GRNA 4MGYR 2ZRKA 3R20A 5L3VA 3EARA 4WAUA 4TZ0A 1GKUB 1Z5ZA 3S1AA 1G5TA 1E9EA 3K0FA 1L8QA 4C7OA 3JZAA 3ZGXA 1M34E 1KAOA 1OIXA 1PUIA 3C5CA 5KNDA 1W4BA 1S1CA 2PT7A 1SVSA 5FOUA 1GUAA 1GL9B 1G5PA 2ERYA 1LS6A 4DIEA 1WDTA 1IN8A 1FP7A 4HAZA 4OQFA 4PZLA 2BKUA 2FGKA 2NTYC 3RABA 4CVNA 1KKMA 4I1UA 1R8QA 1ZD8A 2G77B 2VQSA 4FW9A 5HZHA 1G7SA 1Q3TA 3KJIA 5TARA 1XD8A 4LYFA 1CR1A 3WYGA 2F3RA 1SKYE 3CF6R 1N6LA 2WSSA 4XVQA 2WJHA 1QF9A 3VR3A 4M22A 1KAGA 2ONKA 2QRNA 3DHWC 5FTMA 3O8BA 4JJKA 5EE0A 3GLFB 2HT1A 4BZPA 2QTFA 3D3QA 4FMCF 4ESHA 3DM5A 3SEAA 4TMXA 4D80A 2JJ2A 6Q21A 4YDHB 3X1DA 2MSEB 1P9WA 1XTSA 3QXSA 1O3YA 5FFMA 3I73A 3RS5A 3V4RA 3GFPA 1YR6A 3BFXA 3SI7A 2CCJA 3TR5A 1XTRA 1N6KA 1J2JA 1CKEA 1YZLA 4IVQA 1GRQA 4LK2A 4C0LA 1R0YA 1E9RA 4IHQA 1AKEA 4ZCIA 2ZITA 3K09A 4XTCS 5AJVB 3CX7A 2QAJA 3WBKA 1WBDA 2BEKA 2ZJOA 1HT2E 2QP4A 4KV9A 4P4SB 2H5EA 1ELOA 4TYWA 2HXYA 2V55B 4WBSA 5KPDA 3QEOA 1OV4A 5F98A 3H4MA 1W47A 2AK3A 3THXA 1IOZA 3X2SA 5JHGB 5FUWA 1RIFA 1YU9A 1SXJC 3KQHA 2VHJA 3LO5A 4BRWA 4X8HA 2FN4A 4WOPA 3EIHA 4FMDB 2B8TA 4PTLA 4G5GA 3I61A 2QORA 1G4UR 4RD4A 3SJZA 1ZU4A 1W1WA 4KCGA 2JLXA 5GJBA 4Q21A 3CH5A 3FPAA 4QHTA 4KFUA 1R5NA 4W5JA 1KO1A 3TW8B 1NVWQ 2ZRGA 1M6NA 2HYIC 4PO1A 1Z2AA 3KJHA 1IY0A 4TN1A 2RGNC 2PLRA 3BC1A 3K8YA 4I81A 5JBQA 2N42A 1GL6A 3VR4A 2CE7A 1ZM9A 4P32A 4BFYA 4F92B 4Q4AA 3QEJA 3QY0A 4CEHA 1BMFA 1U8YA 1IY1A 2OILA 5J4HA 2FE4A 5ANRB 2YOFA 2GJSA 3DL0A 2ERXA 1N0UA 3B2EA 3TE6A 1CRPA 3AVOA 4DB4A 1KNXA 3LNCA 1EFRD 4OJKA 5GJWC 5FPTA 1ZM4A 3LV8A 3KB1A 2OM2A 3SYKA 2CK3D 1TUEA 1Z6AA 1FOEB 3ZJYA 1NG9A 2QPAA 1MO5A 2P2LA 5FH9A 1PVOA 2PLFA 2O0JA 3UATA 2O8EA 2AXPA 2F1RA 2EU8A 3PFIA 4ACBA 2IWRA 2VLIA 1OB5A 1NIPA 4LWZA 1XPUA 2A2ZA 2HCBA 1JR6A 4ILEA 2WHXA 1W36B 1AIPA 2EW1A 4LHZA 2PL3A 4M9XA 3Q3JB 3KKQA 2G3YA 2OZEA 3LAWA 3RS3A 4DEXA 4ZDJA 5KNCA 1KYIA 3CNNA 3OIWA 4LZZA 4PQYA 5D3MA 5EE9A 3PUWA 1CJVC 4DDUA 5JEEA 1G20E 3KKNA 1C9KA 5L3QB 3R9WA 1OKKD 1N0WA 4WXRA 2GA8A 1OE0A 4Q1CA 1KI2A 1L4UA 1OLOA 1P2SA 3TNFA 3ND9A 1MRNA 3LW7A 4QBIA 1A82A 3AF4A 2IS4A 4D4JA 2GK7A 4OYHA 2F55A 1DVRA 1K8RA 4DLTA 1KI8A 4PPNA 1KK0A 1YRAA 2QT1A 4MUAA 4BE7B 4IFBA 2HCJB 4M8NE 1Y3AA 2P6RA 2O8DB 2IEYA 4P0TA 3KKMA 1CJMA 4UNRA 1P3JA 4CEIB 3VNVA 4TTRA 1YJ5A 2C8VA 5H70A 1KI3A 1G3QA 1TAGA 3ECCA 4GOXA 3F8TA 2WAXA 1SQ5A 1LW7A 4CEJA 4WZAE 2GK6A 2OUKA 1ZNWA 1IJEA 3GFTA 2FF7A 2HYDA 1KI6B 1ZYUA 4PAQA 2WWFA 4BZXA 3PXGA 1SZPA 2ZRAA 4HDQB 2AD1A 3FFBA 4TSFA 4Q18A 1KO4A 2VP9A 2BJVA 2C77A 3WMFA 2QQ0A 1QHGA 1FUUA 1VHLA 3MRSA 3B9QA 3H0KA 3A58B 4ACAA 3MG9A 4U5XA 3AVTA 4KBGA 2IW3A 4JLDA 4JLPA 4AKGA 3W8RA 3BB3A 1HY3A 4UNPA 3ZQJA 2P6NA 4Z54A 2GKSA 4M4SA 1RRCA 2IYWA 2BMFA 4JYBA 2FDCA 2VHUA 4URYR 4GMXA 4UJ5A 1CJUC 1QBKC 2GXQA 4GMDA 3BOSA 5HTKA 1OF1A 1R7RA 3B6EA 4Q4JA 1DARA 2FFHA 4BFUA 5KSYA 4GP6A 3RNLA 1F2TB 5JSZA 2ZJ5A 3CM0A 4BASA 1E2LA 4B44A 4Q7LA 5FUVA 3NIBA 2CHQA 2CHGA 3F0TA 3CX6A 4HB2A 2IYZA 1XX6A 4D0LB 2P5SA 2V1XA 2XOKD 3NHAA 4HATA 4LJ8A 4D0NA 2AD5A 3VKGA 4FMDF 2JIZD 1RRFA 5CYOA 1KMHA 3L82B 1L4YA 1YKSA 2X2FA 4R71A 5L3SB 3RS4A 4A92A 1X86B 4AYXA 3QKSB 3TAUA 3CONA 1ZNYA 3I5XA 4BLSA 1P75A 4ZO4A 1E2PA 2MMCA 1DAHA 1EX7A 1U90A 2XX3A 4HZUA 5IDVA 3K0CC 2ZJ2A 4QKQA 4YC7A 1NSTA 3Q85A 3AVPA 2ZYWX 2PJZA 4LSGA 4PHTA 2OBNA 1FNMA 1FMJA 4X8MA 5E7JA 2EYUA 3U3OA 3CPJB 1BH2A 2BM0A 3UWKA 5HR5A 4TLEA 3U44B 1Z28A 3AVWA 2TMKA 4MDFA 5EE3A 3WNBA 5JS7A 2P6UA 2Z83A 2CK3A 4HUQB 1XJQA 4M1WA 1N6RA 3C4JA 3U2QA 1L2TA 3KKPA 3BB4A 4LGMA 4RD1A 3RS0A 1PZNA 1U2RA 1G1MA 4JIMA 4Q1AA 1GNQA 2B92A 2D2EA 1G3UA 1H65A 2GVZC 3UMRA 1GWNA 4LUCA 2A7QA 3C41J 3TR0A 4CDGA 2HUPA 2KI5A 4OL0A 3K70C 1GTVA 3LVRE 4QGAA 5JWRA 3TSZA 2RHDA 2VTKA 4Z51A 3QVUA 1M74A 3B5JA 4Q5IA 4BUJA 2IS6A 1RRPA 4NPHA 2VIIA 3NBXX 4RZ3A 2QBYA 2FA9A 1W5TA 2ATVA 2ZEJA 4XD7D 5KDOA 2YC2C 3HU2A 2VP6A 1OKKA 2AN9A 3GJXC 1LFDB 1NN5A 3DVLA 3NXSA 3FTQA 4C9BA 4EUNA 1ZUNB 2C03A 4YDSA 2J1LA 1NMXA 1Q21A 3K9NA 4JKIA 4PSVA 5GVRA 3QG5A 2OV2A 4MYHA 3VR6A 2IYVA 5F2EA 1KOFA 3CKLA 3ZQ6A 2J41A 3T1QA 1G6OA 1XD2B 3M1IA 3PCRB 3E1SA 3HU1A 1CF4A 5FL3A 1NKTA 2V9PA 2YOHA 4ASUD 3A6PC 2BMEA 3LXRA 3EZ6A 3MJRA 4YMUA 5AJWA 4P4UA 3NDPA 1GIAA 4PX9A 2ZJ8A 5B57C 2O8BA 1LVGA 2NZ8A 3ICQB 2GRJA 3AVYA 1PJRA 1U8AA 1IN6A 2NPFA 1DAIA 4OHWA 1IXZA 2RGAA 3AVUA 1VIYA 3HPRA 4D6PA 3W6OA 4JBYA 3EX7C 2ANBA 3VU9B 4YMSA 4Y0AA 3U3MA 4LJ4A 1MO6A 3TUJC 4EPYA 5DYIA 3VR2A 3PVSA 4Q7KA 4Z1MD 4KAXA 4A8JC 4JLNA 4XJXA 1XD9A 3SC3A 4DVGA 4TLDA 2ZYVX 4EJSC 5J4KA 1TQ2A 2RGNA 2EFHB 2PH1A 4B2PA 3QVVA 1UBCA 1G8PA 4NCIA 2IHBA 2FFBA 2ZSAA 2HV8A 2E9SA 1QHHA 1X8JA 4TZ6A 3MWJA 1F48A 3A1TA 1P72A 4DT1B 4IFEA 2YWHA 2ZJZA 3IPXA 2G88A 2YYZA 2OLKA 2ZYTX 2ODEA 2EWWA 2NO9A 4MRSA 3D7MA 1SVOA 1DELA 2GJ8A 2NGRA 3EC1A 4PC6A 3SZRA 4ARZA 2XOKA 1E9SA 3LQRA 2JIZA 2YNMA 4MA4A 4Q4LA 1IXSB 3U7FB 4YMVA 2KSQA 2R44A 2Z6VA 2IS2A 5CYPA 3GQBA 3MWKA 3C14C 2RGCA 1RVDA 1WBBA 4AG6A 3K70D 2WWGA 4G1UC 4AURA 3QKRA 1MH1A 3LY5A 2G1JA 4OHZA 4B3DA 3SQWA 2Q3HA 2QG6A 4LV5B 2Q9CA 4LYAA 4ERNA 3T1VA 1VPLA 3TK1A 4ZDKA 3W3AA 3BH0A 1F5NA 4CF7A 5F9HA 2Q3FA 1E2HA 2C96A 5AUPB 4NE2A 3PEWA 4RFSB 2QPOA 4C0BA 2WKQA 3QXJA 4KSBA 1KI4A 4IOLA 4C0KA 2QTHA 3GLHE 1R6BX 1X3SA 1XU4A 2IC5A 3PG5A 4FCVA 1OFIA 2B8WA 4RZXA 1ZC3A 1JB1A 2ZETA 4AG5A 2VSFA 4BEJA 5GADl 3GLHA 3RRZA 3FKSD 4M1SA 2WAYA 1BIFA 3K9GA 2VP0A 2ECKA 4MDEA 4LV8B 1UJ2A 1ZNZA 2AL7A 2ZR0A 1CR0A 1VYTA 1NY6A 2V3CC 1HURA 1OW3B 2YWEA 5AWFC 3RWOA 3U3KA 5CITA 4RJLA 1KK3A 2JCSA 1DAEA 3MWYW 4URUR 1WRBA 1ANKA 1GG2A 1QHXA 1FMLA 1KJZA 1Z0JA 2J46A 2J7PA 3TQFA 1U8ZA 2J0QA 2QGNA 3UIEA 4FIDA 2NPIA 4BWYA 2J0VA 1W46A 3NEYA 3DDCA 3KFXA 3VX3A 1WCV1 1VG9B 2NO0A 4B6EA 2GCOA 1J8MF 2OAP1 2P67A 3QUSA 3RHFA 1TTTA 1JXOA 4RD3A 4PC7A 4TLCA 4A0FA 4TL7A 4LC0A 3T1TA 3MUFA 1NVXQ 2ODWA 3CH4B 3ZVNA 2VF8A 4K81B 1KO7A 4C30A 4B6FA 1JEEA 4DJTA 1JAHA 1OFTA 1JPJA 1A5TA 2QPTA 1VTKA 3T12A 1YQTA 2OLJA 4JLOA 4W9MC 5HPYB 3B85A 2A3RA 1VCNA 4LYHA 5EXTA 4E07A 1JPNA 3AVVA 4QHYA 1XDBA 4TMKA 3BGWA 3LLUA 5FTNA 3SFVA 4HYYA 3THYA 2BMDA 4KITB 2LKCA 3NBFA 2D74A 2DPXA 2C9OA 4KJZA 5DI3B 2ZYUX 4US0R 2REOA 2XTMA 1II8A 4PPFA 4B3GA 1KO8A 3QBVA 4L15A 1U0LA 3BXZA 4C0SA 2CXXA 3IILA 4GOJA 5BWMA 1RPZA 4Z1MA 3HYTA 1J70A 4LHVA 2WVJA 1J8YF 2CVFA 4HDCA 5EE5B 1M7BA 4DKXA 3DMDA 3DKVA 5KUTA 2PJRA 1NN3A 1QVRA 2G83A 2R2AA 1OXTA 4RCYA 1VHTA 2I1VB 2J0SA 2ZRMA 5FPSA 1E2GA 2PEYA 4D0GA 1N5KA 5BXQC 3K0CA 3EWSA 1T3SA 2J5XA 4HAUA 4PZZA 1FUKA 4HSEA 3DOEA 5AJXA 4Z8XA 4IJMA 1R5BA 1BYUA 2N1BA 2CNWD 2QQEA 1TQ6A 2BBOA 1P4SA 5K8TA 3KJGA 3R9IA 1G3MA 1YZGA 2XB2A 3RANA 1XP8A 3PR1A 2ZJYA 3GJ0A 2A30A 2PCJA 3D6TB 4ITRC 2XEXA 4QGFA 3IIJA 3KTAA 3CWZA 5JLJA 1ZM7A 1ZJ6A 2MSDB 2BV3A 2HLDD 3B1WA 2ZRJA 1OXVA 5C4GB 4L8GA 2NMVA 3W34A 1YR8A 4MRVA 1MO3A 1PLJA 3T1OA 2KE5A 1W7AA 4JL5A 1XCMA 3K0AB 4HLDA 4JKYA 5FBLB 4OI1A 2EQBA 3RLFA 3FMIA 1XEWX 5CLLA 3U6KA 1AGPA 2ODBA 4M2LA 2ZRFA 1HEIA 1S9HA 2WKPA 1UBFA 3L0PA 1BMFD 4KHZA 2CJWB 5P21A 4HAWA 3VNUA 2XB4A 5G41A 1HYQA 2DWPA 3BIFA 4OHVA 2C9CA 4ESVA 4M9ZA 2XXAA 1IAQA 1RZ3A 1UDXA 4NCKA 2BOVA 3QE0A 2GJ9A 3LQQA 4Q1EA 3OF5A 4FMBB 1VECA 4A9AA 3FKSA 5AK0A 3ONWA 2QAGB 2BCGY 5E7MA 4FD2A 1N6NA 3CNOA 4AWXA 2JDIA 4ZI3A 2F7SA 3B78A 5DN6D 3PIRA 4S2EA 2VP4A 5E4FA 1JXMA 3P20A 1DBSA 1XCPA 1N5LA 2DFTA 2FNAA 4UNNA 5AUNB 4QC2A 1E2KA 3EZ2A 3QIAA 1S0UA 4M9SA 1G7TA 2H1LA 3BWDD 1A2KC 3CZQA 2VEDA 4YONB 3U3RA 3K0SA 2JATA 4OK5A 4E09A 3FDIA 3GP8A 1D6JA 4IRUB 2G0NA 2IS1A 1XTQA 3NBZC 4LCBA 3P27A 4DUGA 4DLSA 1TX4B 1ZW6A 3OIYA 4BPBA 1GKIA 4A8JA 2HF8A 3AGQA 2FEOA 2RHMA 4XVRA 4XH9B 4EJSA 2O0HA 5BYJA 4PO8A 4L4UA 3X1YA 3NVAA 4OKSA 5D3QA 5IHPA 4KYUA 4F7WA 2HXSA 2FFAA 3AP1A 3K1JA 4B35A 1TF5A 3LX8A 5DO9A 1VG1A 1RJ9A 4Q48A 4BFSA 1CIPA 5JECA 1U0JA 4QXAA 2DFNA 3OZXA 2FFQA 2RGEA 1CBUA 3IQWA 4C4PA 1W5SA 3MWLA 2BBTA 2G6BA 3ZZTA 4ZIRA 3LVQE 1UPTA 4NBSA 1M7GA 2CCKA 2W2XA 4DSUA 3EZ9A 3R7WB 4G5QA 5JI3E 2WWXA 2ZU0C 2P65A 3I92A 4JVSB 1X8LA 2JAQA 1ZCBA 1H8ED 2QM8A 4LYJA 1T8TA 4TSFD 2GVDC 1BYIA 2NOAA 2CVHA 2X8AA 3FOZA 1TMKA 3T34A 4GT1A 4TMWA 5LD2B 3SQXA 3K53A 3NC0C 5DHAA 1DAGA 1KK2A 1II9A 1KY3A 2QI9C 1LY1A 5DNYB 1Q3HA 2OG2A 4URZR 3DO6A 1E1RD 3F5FA 2LKDA 3HJNA 3THWB 1LNZA 3BFKA 1I2MA 3ADCA 3BAFA 5LPNA 3ICEA 3VAAA 4EPVA 4PPGA 3QF4A 3M0EA 1DOAA 1TF7A 2WIAA 3IO5A 2CNWA 4RD2A 2CDNA 3WYAA 3RVBA 1R8SA 1NP6A 2PZGA 2FX3A 2QSZA 1ESNA 2QA5A 5TVKA 1US8B 2P0EA 4PHFA 4BFZA 5KYKA 1E0JA 5FI0B 3CRMA 3WYFA 1NRJB 5EXPA 4YXWD 2ZSEA 4Y0VA 3RRMA 2H92A 1E2QA 1KDPA 3D8BA 1Z0FA 2NZJA 3UG7A 2HLDA 2O8FA 1E2MA 1R0XA 2QU8A 2OXCA 2X1VA 4JLBA 4S35A 4D4LA 4ZDWA 2VHQA 4EIWA 3GLGB 1DO0A 1NLYA 2GWHA 4OHXA 4C0JA 2UZIR 1AN0A 5CK4A 3FMFA 2ONJA 4DCUA 3AKEA 4K46A 1JQLB 1XTJA 4HI0E 1A4RA 5EZ6B 1M2OB 2E87A 5GVSA 3UPUA 3RDPA 4XWKA 2W6ID 3S1AB 3QQ5A 2EVWX 1VCIA 2C04A 3HR7A 2SHKA 4LX0A 3SBDA 3K0FB 3OEED 4C7OB 2ZU6A 2W2TA 3B1VA 2CLCX 3KUCA 4F4CA 3ZDQA 3WRYC 2I1QA 4NZYA 1I4DD 3TQCA 4NH0A 3IUYA 3CRRA 3WY9A 1I4TD 2EWVA 2D2FA 1OXUA 5DN6A 2F9MA 5HE9A 2H8KA 2A5DA 3SR0A 4DBLC 2C9YA 2ZIAA 3CWQA 5JRZA 1EESA 4B3CA 4ZCLA 3C15C 2O52A 1DS6A 1GZSA 1N2CE 2V6IA 3PEVA 4OQMA 5FI1B 1TF2A 2WPDD 3KXLA 5DSZA 1IJFA 1H8HA 2F1JA 2FMXA 4XTRA 4EPWA 5EQTA 1MO4A 2QGZA 1PV4A 1UFQA 5FPKA 5EXSA 3RAPR 1SKYB 5L3RA 1XEXA 1Z6YA 1CP2A 3U4QA 1GNPA 2HEIA 2IF0A 3H84A 4TYQA 1S96A 1YRBA 5C2JB 4MRPA 3SJBA 4NDZA 1QHIA 2CCGA 3IKJA 3PITA 4URVR 2A5FA 121PA 4MUBA 1SVKA 2PZEA 4RVCA 5CDFA 3EZFA 5DHFA 2JLQA 5LBIA 1P9RA 3UG6A 2QTVB 1XBTA 4QGHA 3EXAA 1IHUA 2ORWA 1KMQA 3L43A 2IYYA 3A8TA 1C1YA 5LDDC 3O8CA 2VP5A 2HF9A 2ZREA 4CZ2A 3W90A 4BFXA 1V5WA 5KPJA 5EP4A 4TWZA 3L0SA 4EFLA 3WMGA 4QM7A 4IKEA 1RC8A 3LW8A 1H8EA 1OXSC 2CLSA 1XF9A 4MGKR 3W3ZB 4RKEA 1SXJD 1FP6A 1MOZA 2GHIA 4Z8YA 2DHRA 1F6BA 3AKCA 2V7QA 2W83A 2W00A 1KTVA 3R8FA 1Z29A 4RZ2A 3THXB 4ZI2A 3IDQA 3T35A 5B2ZA 4A0RA 1D2NA 1P73A 1Q1BA 2F9LA 2XNDD 1U0HC 1ZD1A 3QNUA 3G82C 1E1RA 4AYWA 2IYSA 2QY9A 4GDFA 2X2EA 4Q9JA 1P2VA 4GNKA 5JI2E 4C0HA 1OH8A 1Z47A 5DYGA 4R98A 2CE2X 5FBRB 4IDQA 4Q02A 4QBGB 5LB2A 3EIQA 5B30A 3W8NA 4AKHA 1W49A 2QT0A 4R2HA 4F4JA 3NKVA 4NYIR 2EFEB 2OESA 2W0MA 4PO9A 4J0QA 4V0OA 3NEJA 4UNQA 2GXUA 3A1UA 1YZUA 2F43A 2ZSFA 4DXAA 2AWOA 1FX0A 1XJCA 4YXWA 2ZRNA 4Q4AB 4KLZA 4CEHB 3GLIA 2NO6A 3I8XA 1AS0A 4NTZA 4KVAA 1UEIA 1OJLA 1CR4A 2QEQA 3OHMA 1M8PA 1AS2A 1WF3A 1NVVQ 3SN6A 2UZ3A 2YHSA 2IUTA 4AKEA 3AKYA 1XXHE 2V54A 1Z0KA 4W5HA 2IL1A 3LX5A 3DKPA 4HDOB 3FKQA 3W5JA 3AF0A 1E69A 4HEJA 2ZVQX 4Q4HA 4QHSA 2VPPA 2Q9AA 1MR3F 2FWRA 1XXHA 1QG2A 4Q9LA 1KSGA 2O8EB 1VCMA 3WMEA 2IT1A 1NIJA 2ZUBA 1Z2CA 2Z0MA 2KBEA 2W6IA 4AK9A 5IK2D 5TB5A 3OEEA 5JCPA 2W0SA 1IBRA 2F1IA 2OBLA 1NVUQ 4JBWA 2R8RA 1JR3D 2ZQ5A 5TXGA 3EAQA 2WWYA 1JJVA 4MYUA 2CMKA 2FH5B 2G1KA 2GESA 2ZI4A 3AV0B 3BBPA 4TL8A 4MRRA 4V0LA 5C46F 5FOSA 4HLUC 1E2FA 2H57A 5D3MB 3IEUA 4JL8A 4AYTA 1DAFA 1WE2A 1W0KD 2QMEA 3C8UA 2ZS9A 3FWYA 4NYJQ 3U4QB 3X1XA 1XEFA 3OAAD 1OH7A 2D06A 1YHNA 5H68A 1W4CA 2ZROA 3OESA 1HQCA 3OFND 1BOFA 1COWD 1UADA 2GZAA 2B7CA 1NKSA 1T0HB 2FJUA 4EQ6A 2WPDA 1RRGA 1W48A 5LD2C 2H18A 2YJTD 1ZM3A 1T91A 2C99A 3EASA 5JWHA 5SZHB 1Q12A 2JASA 2ZTSA 3I32A 3WNDA 1IONA 2J7PD 4AKIA 4F93B 2D62A 4QOSA 2VL7A 4G01B 5FL7D 2D3WA 3SNHA 3B1YA 2X19A 1G5RA 3NTUA 4JT4A 4OK3A 4WA7A 4Q9HA 4O25A 4DC9A 1D2MA 4QGGA 3EPKA 3DZ8A 1QHNA 1AS3A 4TMZA 4CEJB 1I4LD 4JSTA 2A9KA 1W2HA 4M1YA 5EUMA 2F6RA 2OFXA 4ON9A 1GITA 2JJ8A 1CTQA 3K9HA 3B9PA 4TTQA 2HJVA 4LJYA 4G5RA 4FCTA 1A2BA 4HB4A 4DCVA 3I8SA 3QXCA 2YKGA 5FTKA 1NMYA 3W9YA 5K8LA 4PC2A 1G6HA 2ZRHA 5G3YA 3DEFA 1A1VA 1G8GA 2W6JD 1HH4A 5EP3A 2X77A 3I5YA 1P7CA 1SXJE 1KI9A 2AK2A 5TV2A 3AGPA 1Q1EA 3UWOA 1CJKC 1Z6XA 3HR8A 4LJ9A 1YZNA 1YZKA 2QP3A 2J9RA 2WJGA 4M0LA 4Q00A 2CL7X 5FUXA 1SXJA 3SJAA 4DZZA 1VYUA 4WVFA 2WIBA 4IDHA 3I72A 2C95A 4LJ5A 5DGXA 1CS4C 3V00A 3E70C 1BS1A 4IEEA 3WHKA 3ETLA 4KVGA 4Q4JB 4DDWA 3A1SA 3PJRA 1F2UA 2XNDA 4UXIA 3RS2A 5KTYA 5AJZA 5FBQB 5JSZB 1DEKA 5F9FA 4FI3C 4AI6A 1GRRA 1MABA 3B60A 4W5WA 4MYTA 2YWFA 4UJ3A 5H8WA 1MRSA 2AHOA 2J0UA 4TLAA 3W5IA 4XSHA 1ZINA 4BZQA 2IEZA 1ZIPA 2OO7A 4A2WA 1HQYE 2WBLC 1O87A 5EXXA 3AB3A 3FYHA 5KDDA 1KMHB 1E1QD 3VQTA 2OEPA 1OIWA 4V0ME 1TQ4A 1E0KA 2CLDX 4PFSA 1HV8A 1SVIA 1VCOA 3R9XA 4B73A 4C2UA 1LV7A 3QKTA 1U94A 2IUUA 2RAPA 4JLJA 1SKQA 4HZUB 4V0MA 1XXHB 2RKOA 4M1TA 1GVNB 1OIVA 4L16A 4DCSA 2IYQA 3MMPA 3FHOA 1TUIA 3TSOA 1W36C 1XFAA 4CT5A 3RC8A 3H1TA 2FU5C 2IXGA 2JLSA 1Q1QA 4LBVA 2DWOA 1UKZA 1E0SA 2ORIA 2NO7A 1CJTC 1FTNA 2ZI5A 3RRNA 2GTPA 3CIOA 4IDPA 4M21A 3GJ7A 4WW0A 4L9WA 2R6GA 2IYTA 4EPTA 2AX4A 2RMKA 2BKEA 3BORA 1OYWA 2DR3A 4US1R 2DFKB 2XAUA 4RCZA 1N3BA 2VSXA 3QKUA 3UXMA 5A4JA 3EPJA 1JR3E 5KU1A 4FXPA 3IPYA 5IK2A 4DSOA 2DBYA 4QJ5A 3UMSA 4C3ZA 3V4FA 2ZE7A 3KQUA 2WJYA 4HLQB 3V9PA 1JR3A 2VP2A 3SS8A 2GCNA 3Q7QA 1S9DA 3C5HA 4IVRA 4I1VA 1GNRA 5AUOB 5JJIA 1G64A 4JVMA 2QBYB 1AZSC 3UMFA 2QP9X 1W0KA 1G8FA 1T8UA 2VRWA 2XTZA 2L0XA 3OAAA 1SGWA 2O8CA 1TU4A 4BQSA 4Q1DA 4CGZA 1VIAA 2WJIA 2UKDA 3OFNA 1COWA 4Q7MB 5AJYA 3T06B 2JDID 1TEVA 3UANA 1G16A 5A5GA 4OQLA 2CEAA 3SHFA 1CLUA 1OSNA 4L9SA 2R62A 4ZKEA 1DAKA 1SVWA 1X1SA 2NO1A 3WP1B 4EPRA 4Q47A 5KSOA 1OH5A 5SZKB 1ZNXA 3WP0A 1Z6TA 1OFUX 3WNCA 3EPLA 5HCNA 1CXZA 5SZIA 1QVAA 4HUTA 3TSWA 5FL7A 1UKEA 4X8OA 2R6FA 3T5DA 4BEBA 4BLOA 4NMMA 5HKKA 2O8BB 8OHMA 4N1AA 3OIVA 3VKHA 3LA6A 3P32A 1E9DA 2ZE6A 4B2IA 5AUQA 4DUGD 4OI0A 2FGJA 3RSLA 5CM9C 1EFCA 1KIMA 2PMDA 2GXSA 3U61B 2ORVA 1T5IA 2D7CA 2GAOA 1XEWY 2GILA 4XSGA 5DLQC 2C98A 2WMOB 4DRZA 1JEDA 4F38A 5J4YA 3CPEA 1UDWA 5CB6A 2W6JA 3GD7A 4DEYA 1W0JD 1VG8A 3KXKA 4D4MA 1UBEA 1ZM2A 2OAQ1 3CUEF 2XJ9A 4IXNA 2YZ2A 1ZC4A 2IYUA 3C7KA 4Q03A 3B1ZA 2GEDA 2IUSA 1HE8B 3TUIC 1J7KA 4GZMA 4BGDA 3A1WA 521PA 1EGAA 1QHHB 3H86A 2H16A 1E2DA 3QF7A 4AY2A 4LHYA 2CL6X 4Q9IA 3HDTA 1JQJC 1EXMA 2MMGA 3RC3A 3FHTA 5J4VA 1XJ0A 2OCAA 1GKYA 1R0WA 3A36A 3MSXA 2A78A 2GF0A 3OEHD 2OBMA 4P3YA 3PEUA 2JLUA 4ARZB 1P5ZB 3CLVA 3L2OB 1HUQA 1E98A 5HE8A 4I1OA 1E1QA 4QFMA 2EFGA 1AK2A 4WZ6A 4WZBE 2ZANA 2FSGA 3B82A 3EZ7A 3KDSE 4AD8A 2RB4A 3EIEA 4UXJA 3ZD6A 3CW2A 3B1XA 1KJWA 1Z0IA 4QL3A 3U60B 1GM5A 2ZI9A 2LWIA 3ZYCA 3GLFE 2WWWA 3IEVA 4JLVA 3QKRB 1JBKA 4MKFA 4A6XA 2O5VA 2IWHA 2V1UA 4GFDA 5CB8A 1D5CA 2PT5A 4PHHA 1WB9A 4TYPA 4LPSA 3GLFA 1DPFA 4KFTA 5J4LA 2P5TB 1OHHD 3AEZA 1G3RA 3MAAC 3KZ1E 2P3SA 4TT3D 1T6NA 4DLYA 3AUYA 4MITA 1P61B 1SVLA 2BVNA 5C18A 1KO5A 5G40A 2FZLA 1KDRA 5FOWA 5FTLA 3KXIA 1BO6A 1U81A 3GJ8A 5J5CA 1LTQA 3GLHB 5FR2A 3EW9A 1X8KA 3MGCA 4B43A 5JHHB 3CRW1 4LBYA 2OE2A 2HT6A 2BBWA 3P26A 2HJGA 4NYJR 3NG1A 2IF2A 4MKHA 4PSAA 2WWHA 2R6AA 2WJJA 2VSOA 2DY1A 2QNRA 4P31A 2GJKA 3SFZA 4P4SA 3RYTC 4LJ6A 1N0VC 3KQNA 1NJFA 3PV0A 4G5SA 3TRFA 5CK5A 1B23P 1HTWA 5H1YA 3IIMA 4A2PA 3H2YA 2QROA 4JS0A 4GZLA 3RSOA 1KZGB 3LXXA 4PXAA 2ZJBA 1EK0A 3AF3A 2REXB 2FG5A 1EWRA 3AH8A 2GCOB 3CPHA 5BYKA 5AR1A 4JBXA 2WV9A 3AP2A 2J87A 2RGXA 3KL4A 3SYLA 5A0FA 2XZOA 1Z06A 2Y8EA 1II0A 3TVTA 3IGFA 3TMKA 1LS1A 4E5UA 1NBMD 3U7GA 4AIIA 5JEDA 3BK7A 3OE7D 1ZU5A 2JEOA 1E96A 4UNSA 3HP1A 3QXHA 1H8HD 1AA9A 4NP6A 4PC1A 2WICA 4BECA 821PA 1SHKA 1Z07A 4IOKA 4BLTA 4GI7A 2GBLC 4TMTA 5B58C 2ASEA 2UVQA 5DISB 4Q1FA 2OCBA 3THYB 1ZUHA 1XTIA 3L0OA 3A4MA 1XNJA 3PUYA 4Q01A 4CRWB 1Z8FA 3ZZ0A 4H1UA 1HA3A 2OSBA 2ZJAA 3AQ4A 1XRJA 4CIDA 2B6HA 1R2QA 1II8B 2Z4SA 1Q0UA 3CX8A 4EAQA 4EDHA 1L7VC 1W0JA 1XWIA 3KJEA 1TADA 4QNMA 1G8HA 4RFVA 2VHTA 4B33A 2WKRA 4TQAA 4JLMA 4M1MA 4A36A 1E6CA 1PLKA 1ZIOA 2FSHA 4I4LA 1EWQA 4I99A 2K5UA 1YR7A 3TJZA 3BJIC 3PENA 5FTJA 3U7HB 3HPQA 4POAA 1QHYA 1ESMA 3IBGA 3TAHA 4HLCA 2JLYA 4C0AC 4PQFA 2ZPTX 4H1VA 4MYCA 4PPQA 2DWQA 4NHOA 4DSNA 3FE2A 5F3WB 2V7QD 2REBA 1G41A 1MT0A 2A5GA 2QM7A 4N0DA 5CIWA 4UQOA 3OEHA 3U5ZB 3BB1A 3SE0A 1M7HA 1F60A 2J45A 3EC2A 4GP7A 4HAYA 3SHWA 2AR7A 3IO3A 5L3QA 3Q7PA 4PAMA 1SHZA 4G5OA 4CYMA 3QPUA 5CJ2A 3KTAB 3N2IA 1G291 1VMAA 1E2IA 2A5JA 2GJAA 2GNOA 4US2R 4OI4A 2QMOA 3K70B 4FWIB 3MD0A 5GJCA 1D9ZA 1T0JB 2DYKA 4YMTA 3E2IA 2QSYA 1Q22A 4H9GA 2B21A 4PANA 2O8DA 421PA 1XPOA 2JJ1D 1GSIA 4CEIA 1G18A 1Z0DA 1CR2A 1OXXK 1R5OA 1OHHA 1W4AA 2XSZD 1Z6GA 1ZRHA 2R6DA 3VR1A 3FGNA 3O8RA 2YOGA 5GJVC 4TYNA 3ZVMA 1DE0A 4TT3A 1XZQA 4OQNA 1KI6A 1U9IC 2BMJA 2JLZA 1XMJA 2YINC 2XXAB 5KOYA 1GOTA 3AM1A 3REGA 4JJZA 3VTKA 2VF7A 2Q6TA 1K5GA 3ZH9B 1Q1ZA 1I2DA 4PAOA 2ZS8A 1KK1A 4TMVA 1ZMXA 3MLEA 5FOXA 5C4MA 2RGDA 4MH0R 1G7RA 2Q3MA 4JLAA 4KSCA 2GCPA 5ELXA 4KBFA 1BKDR 1FZQA 1HE1C 5JJLA 1ZD9A 2KJQA 4M1OA 5TY0A 3IIKA 4FWTA 4P4TA 5E7IA 4LDJA 1NI3A 3Q72A 1UKVY 3FFAA 1ZVQA 1FL9A 4O0MA 1FW6A 5BN5A 4NONA 3ADKA 1F2TA 2H7VA 3P4XA 3KFVA 3B13B 1NBME 2JGNA 4HAXA 2PX3A 2XZLA 2FSFA 4FINA 1KGDA 4K8OA 1B0UA 3CRQA 2J7KA 4R9UC 4A8JB 3BS4A 1E2EA 2QE7D 721PA 4QG7A 5FPYA 4MGIR 4EJSB 3L8ZA 1NMZA 1UEJA 1NBMA 1IN5A 3IHWA 1JI0A 3KQKA 2OFWA 4L5BA 1TU3A 4A2QA 3OE7A 5BQ5A 2QUZA 1NL3A 3GEEA 3AP3A 3CF0A 1AKYA 1TPZA 1OYYA 5L3SA 3ZZUA 4JSYA 3ZVRA 2BWJA 3QKSA 4DHEA 3TUZC 2VYFA 4A82A 1RJ9B 2PX0A 2IA5A 1YR9A 2WMNB 4XWAA 4D81A 5FOTA 1FTSA 3VKWA 5BN3A 3CF2A 4ZIRB 4GOKA 2IYXA 4II7A 3QPWA 4TQUS 3WHLA 5CDFE 2QRZA 3CR7A 1ZBDA 3JVVA 4MRNA 4DDVA 2GETA 3CNLA 4LJAA 1DAMA 1F3OA 4EPXA 1ZAKA 1NF3A 5FUYA 3A1VA 4QJ3A 3PUZA 3U44A 3D31A 4F4IA 4EFMA 4C0QC 4PHGA 4HUQA 4HB0A 4D82A 4B3BA 3QPVA 621PA 2R65A 2GXAA 2ZSBA 1RYFA 2ODNA 2KWIA 3O47A 1XB2A 4LBWA 1LB1B 1FNNA 5IRCD 1S4QA 3OIUA 3PUXA 4IDOA 1S1MA 3PUVA 4IOMA 1Z22A 4DCNA 1DADA 1E9CA 4V0NA 3QF4B 2N46A 1G17A
chains in the Genus database with same CATH superfamily
4YUZA 3T61A 2VHEA 1KGSA 3I2KA 4JQOA 3TYXA 1U0OC 4EG0A 1T1EA 5CFQA 4K88A 2PDAA 3Q0EA 5NLLA 5BQPA 1I5OA 3EEYA 4MKIA 3L8CA 4Q3CA 5L45A 4N9QA 5AXBA 1S6YA 1LDBA 4HSGA 1GPLA 1W4RA 3FZQA 4MWZA 3TRKA 4E1BA 4D4KA 1SHLA 2I2DA 3PEYA 3DXXA 5IXYA 1AH2A 1Y7PA 5MFPA 3LK6A 3OQ1A 3TH5A 1ZUNA 5BOSB 4QVIA 3D3WB 3BXGA 3WYNA 4LOLA 3DFUA 1QHFA 3NGMA 2WV7A 3Q98A 3QI2A 2EFYA 2O5EA 3D8UA 2BEJA 3GGSA 4DLNA 5KHOC 4AULA 4GDMA 5IF9A 1RKXA 4WZAA 4E5KA 3RIXA 3FCAA 4JEUA 2WTUA 5KB3A 3ZYZA 1XD2A 2C78A 2WU0A 2XITA 3KTDA 3Q5DA 4RA6A 5E7QA 5HCUA 1Q7TA 4KQ1A 3VKUA 4DPMA 4ZQIA 5I7UA 4GPTA 4JB2A 2ONYA 3SJ7A 5J47A 5HOQA 5KJ1A 4N3GA 4B3FX 4QNRA 2ZBRA 2DBZA 4FEEA 4BUCA 1GDDA 3ZK9A 5I9TA 1FFCA 1QPZA 4QSHA 3E35A 2F3TA 2FXIA 2PZMA 4YRSA 2CNOA 3KEOA 4RTLA 2IX3A 5K8UA 2YVUA 1PYGA 2EEPA 1Y7LA 2QUBA 3CB4A 4L07A 3D5TA 2XKAA 3QLUC 4LI0A 1E9AA 4WPGA 4HXEB 2O1EA 1RQGA 4HZIA 2JD2A 5E8RA 1W9MA 3X2EA 4OQXA 3ZQKA 3TRDA 3BFVA 1BWQA 3LBNA 5EP1A 5TJ9A 2D5LA 1DUIA 2BIFA 2ZE8A 1KXJA 4GX2A 3RIYA 2I9KA 1YRHA 2PWPA 3UQZA 3PEEA 3ZZNA 5FOVA 4JVLA 3ZVLA 2CHEA 4JLKA 5EJ4A 4CKYA 3MCZA 2CMFA 1PZMA 1MUUA 2ZQZA 1C7QA 2DPYA 4OJQA 3VMFA 2FPXA 2BUAA 5FPHA 4GS5A 1XZAA 4YACA 1M66A 4N5MA 3V42A 1SXGA 3AI7A 4CQLB 1SXQA 2Q9UA 2HWXA 2LR0A 3VFDA 1NXSA 3E03A 5E8JA 3OTQA 4BLUA 1DRJA 3O9VA 3G2MA 5JPIA 2IY8A 2H17A 1HL3A 3I6YA 2Y1DA 1N2CB 3CMCO 4DT1A 5HFJA 1R10A 3GRPA 1VJ5A 4CMAA 3Q2IA 2ZE5A 1R0CA 4J1NA 5LQDA 1KQGA 5JW6A 4YRBA 5HDQA 3JWEA 2ZJFA 4BLRA 3DNPA 2WVGA 5CLHA 4ARIA 4EYEA 1UZMA 2Z9BA 5C0OE 5KSWB 2PM8A 2DFDA 1R0RE 3NP9A 4J0GA 4WFJA 1CY1A 4NFYA 1RKVA 1GU7A 3MHTA 2JFUA 1V1RA 1K6MA 4RVNA 2C9ZA 3VHLB 4DQLA 2OFOA 2ORYA 4OSPA 5JO9A 4UATA 2JF0A 1NRIA 3F3SA 3HN2A 3WRVA 1E62A 4RETA 1WZ2A 1CPYA 5JAIA 2IVZA 4GE3A 2YXEA 3PQCA 4ZTUB 4D0SA 5HG0A 1G5IA 1R8XA 1UF9A 4NBRA 5JH7A 5K8VA 2Y0DA 4EA6A 2P35A 4MUEA 5CM8B 3NHZA 1EG7A 1G42A 3G5UA 3CO0S 4HY3A 1DOZA 5TT1A 3JASB 4AZ0B 1PLLA 3LWNA 1U80A 3KKOA 2D00A 4QPPA 3SF8B 3N3BC 4NLLA 3AWDA 2XE6A 1CU1A 3LF1A 3P52A 5B3JC 2O3UA 3QA3E 4EG8A 2FPPA 2H1HA 5IT5A 1JAIA 1GNSA 2ATIA 2JB9A 1QRSA 1Z39A 3FMPB 3HCNA 1ULUA 2A9JA 3OEYA 4QU8A 5E4TA 3WQBA 2X13A 3R8CA 4AJ2A 1E0AA 2DR2A 1WPQA 1ZLXA 3F8SA 4REQA 1U3GA 3ZIUA 2LGJA 4LHSA 5EPOA 4CF5A 4GX1A 5KVSA 1TD9A 5IJWA 1XN1A 1ZHOA 3NFRA 1GNLA 3ZJVA 3TG8A 2YASA 1GD1O 3ANXA 3Q8WA 1Q7EA 1OPXA 1SURA 3G23A 4ZV4A 2BD0A 1CRQA 2W9XA 1RM5A 2I7TA 1HLPA 3AKDA 1A95A 4WFIA 1SK9A 1IHDA 3AF2A 3Q3IA 4R7ZA 1SHTX 1VLHA 1W0CA 5EXEA 2ZR9A 3BD7A 1ND6A 4DWJA 4U00A 5CIYA 1UBGA 4XQCA 4Z49A 2BMAA 1U9IA 1M5RA 1JNXX 2O3SA 3UW3A 1UKYA 4X44A 4AZVA 4LXHA 5KOIA 1P4JA 3ON5A 3VI4B 3W6UA 5GIOE 4UZFA 4UU1A 3I0ZA 3GU3A 3HA3A 2PRZA 1A9RA 1MFPA 4G5HA 3GLIB 4GI1A 2Z9CA 2CKDA 4A8HA 1V1JA 5KJEA 1FQJA 1C9NA 1GA6A 4LRWA 3W3AH 2I29A 1Z8DA 4FPXA 3AUXA 1E9BA 1SBIA 3GLTA 1WB6A 3IYLW 1N25A 3NBYC 3TS1A 1SELA 3DOOA 4RELA 3U7QA 1ZSYA 3UKDA 3AERB 1H05A 1EX6A 2NNWB 3MYRA 4H60A 1L4HA 4UKDA 1CUXA 3SLRA 2ZUDA 3QVGB 1XMPA 3FM9A 3OF2A 4YEDA 4ZOLB 1ZKDA 1O96A 2UZ0A 3GJ3A 1OLSA 3C3KA 3KP1A 3ASZA 4JASB 2PUEA 3WO0A 3LYLA 1EGHA 2NYRA 1M54A 2QVLA 3FOCA 4KI7A 3OZAA 2VHCA 3T15A 5KX5B 4MJ7A 3VJLA 3NVKI 1SU6A 4U02A 3BE6A 5I47A 3OZRA 1P77A 2D7JA 2OPBA 4LSMA 4QASA 3WRYA 4BMXA 4CV2A 1LVUA 2Z8YM 3OURA 3QJYA 4WBXC 5MGNA 2J07A 3QOYA 2R9VA 3ADDA 4CEHB 3K7EA 2FEWB 2C88A 2YV1A 5DI3A 3HN6A 3MJTA 4QIHA 3K0HA 2JGEA 5G1NA 3W5DA 2ZUFA 5JFGA 2WI8A 4C4YA 3B8HA 2RIPA 4IKOA 2VBCA 4Y3UA 4HQOA 2O07A 3FR7A 4Z86A 2Q8QA 2Z2YA 2Y67A 1TI7A 3DZJA 2JKVA 1RLJA 3IELA 2CGEA 4Y67A 1WKCA 1RXCA 2CJPA 1CUJA 4RGYA 221PA 2FEMA 3BH6A 4BJ3A 4B76A 5BSWA 4ZD6A 2M6SA 3VYTB 4CM6A 3BMXA 4G0XA 3KX2A 3AETB 4Z7JA 1VL2A 4YR9A 2EFCB 4UPDA 3REOA 4YDQA 1CNFA 1N7GA 2I87A 1OI3A 1UJ6A 1WNTA 4D25A 3M7IA 1A9PA 4NU6A 5G53C 1ZK1A 3OJWA 4PU0A 1NBEA 2X14A 1E9FA 1H2YA 3JRXA 1U8TA 4Q19A 3RRFA 4B1FA 5I9NA 5JAZA 1FFAA 4RVUA 2W2OA 3WGLA 2JPDA 1IHXA 3SEQA 2IXFA 3E9CA 4IDNA 3W0LB 4ID9A 5BVGB 1BVYF 4PSKA 3ZCRA 2QMHA 4YGYA 1QMPA 4HWSA 5C8YB 1SOMA 1A72A 3TQRA 2R85A 2I4RA 2GARA 2RGBA 2QD4A 1T8WA 3HU3A 5DT2A 3LBAA 4OP1A 1WY7A 2Q1XA 1V45E 3BXOA 3QHAA 4ZDIA 3X1JA 2YH2A 5A4DA 3DZDA 3HGMA 2IIVA 5GZ1A 1Z63A 3ZK8A 4XIGS 1EK5A 1XCGB 1IULA 2X41A 3D7SA 3DCNA 3T5MA 3TW4A 4PSDA 4KQGA 1TIPA 3H5VA 3ZU3A 3MXTA 4O2LA 1DXYA 5AW9A 1FQKA 4D42A 2BR5A 2NVBA 2Q2OA 1W29A 5IDWA 1QR6A 3KVOA 1DINA 1UK9A 4HVCA 3DAOA 3SF0A 1E99A 1C4OA 4DSTA 1O95C 3WQHA 4X8LA 3O8DA 3T7TA 4BP9A 2HWWA 1XWFA 3PDJA 4RXTA 3K4HA 1SVMA 2VCYA 1PT7A 4TSRA 3OTOB 3JALB 2I2AA 3TEMA 2CJWA 4RIHA 4A73A 3PUHA 5E3IA 4DTCA 1MENA 4NC9A 1I4EB 2Y1CA 4YCDA 3OT5A 2B9VA 4PWYA 2DB3A 4FFOA 2H9AA 2CLOB 5IBQA 2ON6A 2J3MA 3WK9A 3EDRA 2QL5A 3TCXB 2YV5A 3H11B 3P2JA 4GYWA 4UARA 2GA9A 2VBGA 2WZQA 4GX5A 2AJDA 1JALA 1YQUA 5HZKA 4DKJA 3O2NA 1JSLA 2GTIA 1QKKA 1RXIA 5FBWB 5C1DA 2QUAA 4H7DA 1DO8A 3GVXA 1S8OA 2YDYA 4WSOA 2KB0A 4B6PA 5FOQA 1VKNA 3GCDA 4RD6A 5GONF 3GX1A 4ZHQA 3LVFO 3GA7A 1OZHA 5DB4A 5BV8A 1KEVA 1EWKA 1RC1A 4JWTA 3QG1A 1BJRE 2P4HX 4EY6A 1ST3A 1GTZA 2JNWA 1CD5A 3K5IA 5FYQA 3AOEC 3MLBA 3R9XB 3QEKA 3QLJA 1L7XA 3L6RA 1QZXA 5JYCA 1NG1A 3QP9A 2ALJA 2WSSD 2ZRPA 3ESAA 1ULZA 3O4VA 2UUCB 5IULC 3Q10A 2FAXA 4MX8A 5FR1A 2TYSB 3MPUA 3GRKA 1X6VA 3GEMA 1RZVA 3QXXA 2NQ2C 2ZIZA 4DCCA 5MN4A 2GN2A 1YD7A 3CZPA 2VF4X 3IV7A 4WGGA 4RL6A 5LUAA 1G55A 2ZM5A 4BYMA 2G6TA 5DMHA 2I2BA 4X6YA 1TM4E 4IZHA 4E5MA 1RLUA 1Z17A 2B25A 1NT2A 4MWCA 3X0DA 2PUWA 5LLSA 4PCVA 4JI3B 3ZLVA 1Q57A 4BMOB 1YJXA 1L7AA 2Z5GA 4M86A 3D1LA 2AKYA 3KCNA 4CT0A 1CT9A 4GM4A 4HX5A 3P45A 1K9VF 5SZJA 2VQFB 3Q9LA 1GAXA 1DDGA 3U7IA 4AY5A 4D8XA 1RI2A 1LW6E 2XQFA 3FHJA 4A0GA 2OBBA 1JHYA 3DMNA 3U4QB 1UT5A 4LY6A 4MGZR 5AM5A 2PYIA 2ZB8A 5EI5A 1UOQA 5KI6A 1V9LA 4MKGA 2I2XB 2HJRA 4KC0A 4E1VA 1XZHA 4HDRA 2SICE 1H3FA 2AI1A 3CCBA 2REQB 2GYUA 1HNNA 4NYMR 1SQFA 2FPMA 2WF6A 3ONFA 3FNIA 3M5WA 4OK6A 4XM0A 1KEZA 4EFNA 2QRVA 3O3NB 3T7EA 1T5BA 3KYBA 3IR7A 4RKFA 1TQDA 1EJBA 4JYCA 4QDTA 1YDWA 3DE4X 2PWZA 3CLKA 3JV7A 3L5KA 4HDSB 4IS3A 3UBMA 3LUPA 4E7PA 1RJDA 2X23A 1P9NA 3I62A 1JVBA 1YE5A 3O94A 4D99A 1KSJA 3A06A 2JA1A 1J6UA 1GT6A 2QYOA 4NEQA 5GIPE 1M76A 3IURA 3THWA 1C9JA 5LOVF 4RD0A 4V03A 5K8JB 5AKJA 2FR0A 4MARA 4IW3B 1E6EA 1Z4IA 2I54A 2JH9A 3G49A 5HCIA 1UT6A 1L5HB 2RCNA 1QRAA 3DDHA 3IB3A 3SJCA 4UE6A 3GRUA 1FNBA 5IT0A 2ZR7A 5G4KB 1C1DA 2O2EA 4GW3A 3BMCB 3S2SA 4URXR 1Q1NA 2H4YA 1B8OA 1GTG1 3K8ZA 3VH4A 6LDHA 4KXFB 1F4VA 1US8A 2GYWA 4OBEA 4EELA 3EDYA 1FW8A 5CFNA 4KNVA 1EJ0A 1AHPA 2PBFA 1R4MA 4G9GA 1L5YA 2PR2A 1GQ2A 4IIBA 5CFZA 5ALMA 2AFIE 2JCBA 1G19A 1HKUA 5I6DA 1PJSA 1PJ8A 4RKQA 3UM9A 9MHTA 1NUTA 3R6GA 1V48A 1YCDA 2R4TA 4E5NA 1OI7A 1NLFA 3WOHA 2H1CA 2GNAA 2ZRCA 2QI9F 3P2YA 3L1UA 4HQ0A 2AFIA 4JMLA 4TQ9A 3GDGA 4LDZA 1I1NA 4R5HA 1WUKS 3CLSD 3U16A 4OHMA 2JGMA 1E8DA 3ZS9A 2H4XA 4CKWA 1V8DA 3N0WA 3N8DA 2ATCA 4Q3BA 4W1SA 1GO2A 1QDLB 1SRQA 2HM7A 3H87A 3I9V6 3UAVA 2DBRA 3UUWA 4FB4A 1EFUA 3D64A 1IQPA 1GRNA 3ELWA 2ZRKA 5EWMB 3V97A 5L3VA 1XZDA 1IWPB 2JAXA 3ZIDA 4KXYA 2O19A 1JG2A 2GO7A 2A0UA 3VKFA 3V7FA 3PQ5A 1L1QA 3KT0A 3U17A 3K0FA 1L8QA 3V8NA 3QYFA 1GN8A 1H2HA 3HABA 3K05A 4GO1A 1TZCA 1KAOA 2II6A 1MAWA 3PUKA 4L50A 3C5CA 2JLCA 1S1CA 4UD6A 1K8ZB 1NW8A 1EI9A 1LS6A 4X90A 3KR2A 4IGIA 1JA0A 1G2QA 3PGMA 1YGPA 3SLGA 4PZLA 4D9MA 1LLFA 4WEQA 1KC3A 2FGKA 2NTYC 2XCUA 2XDAA 3RABA 3ZWPA 2IU4A 3ROPA 4HN9A 1R8QA 3IERA 2AW5A 4FW9A 4Q4CA 1K98A 3EMDA 4UU7A 3KJIA 2YMLA 1VB5A 1XD8A 5JXGA 1YZVA 3YASA 4YRKA 1N1DA 2F3RA 3CF6R 1GYRA 4WZBB 5CR9A 4YP0A 4HGOA 5EQFA 3RE1A 4G0ZA 2WJHA 3UB4A 3H13A 4TRNA 4I6JA 1QP7A 3BPSA 4XX0B 2FOXA 4HDMB 2QRNA 3BMQB 5ALWA 3WWZA 1KMMA 2WJZB 3DHWC 4W99A 3GR6A 3M89A 2YW2A 2O5CA 1I80A 2XUIA 3F5DA 2BMVA 2W6MA 4N7JA 1N9GB 1Z45A 4ESHA 2W7TA 2QTLA 3SYTA 1VLLA 4NJOA 3W9BA 5D01A 1T1RA 1MVLA 3QXSA 1MC4A 4BGEA 1X9GA 1O3YA 1Z18A 4B3TB 3I73A 2VZLA 3RS5A 3V4RA 3QTBA 3GFPA 4ND2A 5GY7A 3BFXA 3EZYA 4BBZA 4YCMA 1Q2UA 2RJOA 3H1AA 1ZWKA 4KXUA 1J2JA 2MJLA 2C00A 1UZLA 2JAOA 4BQFA 1YZLA 2HRRA 5KMGB 4LK2A 2XUHA 4O3FA 1E9RA 4C0LA 5KOHA 3P2KA 4ZCIA 2EIHA 2P9EA 1E7RA 3CX7A 3FLMA 4CTOA 2VHXA 5EIHA 2VNHA 1HGXA 1F4LA 4R1PA 1JSCA 2PJDA 5EIXA 3N75A 1EA7A 3D6AA 1YUNA 3OIDA 2H5EA 3DHEA 4IIDA 3H9BA 4G0MA 4ZT3A 5HW0A 1Z7WA 1FFGA 2V55B 3WL4A 1J0DA 4RV9A 4J7XA 4WBSA 2JVIA 1OV4A 2C5SA 1W47A 3B38A 1JJFA 4GGMX 4QUHA 4UCXA 1U3DA 2PX4A 5FUWA 2CMGA 2X22A 4G8JA 1W88A 2V9ZA 3GYGA 1YH3A 4FQ5A 2J3JA 1SXJC 3LUGA 3KJNA 4LRSB 4M0PA 4UBNA 4DYVA 3LO5A 3WB1A 4IYRA 1MJFA 5B7QA 1RR6A 4PTLA 2PKQO 3I61A 4DQ0A 4BMPB 1G4UR 2P9QA 4KCGA 5KYNA 2JLXA 5E0KB 1TJ3A 2XMDA 3QYJA 4QHTA 3TLGB 2VF5X 3KU1A 1BA3A 4ML3A 4H6VA 1NVWQ 4IEFB 1M83A 4GVLA 3MT0A 1M6NA 1ZGAA 4PLVA 2BDUA 2VJBA 4QYSA 4W9NA 2HYIC 2OV3A 4O59O 3JD2A 3PHLA 1C3OB 2W6NA 4AS2A 3K8YA 1Y80A 3KXDA 4MR8B 5LYJA 4J7UA 4U63A 2XRMA 3LY9A 3TDNA 5L6LB 1Y3BE 2FK8A 2WU3A 5LQSA 1UQRA 4BFYA 4CDNA 1RM0A 3QEJA 2B9EA 4YJ2A 4WCDA 1XA3A 1NQXA 2PUTA 2GJSA 3JWGA 1O4VA 3DL0A 4OSEA 4QGSA 2HBRA 3ZDBA 1B00A 1N0UA 2NU7A 3ML1A 1XOIA 4J43A 5FWNA 4K3VA 1KNXA 1GY8A 1PJZA 2PZKA 4HMQA 4LZJA 5ALGA 2PO7A 4F6LA 2ENWA 3ETGA 5IX8A 1XR3A 3EYWA 1ZM4A 3LV8A 4LGCA 3HKCA 4EMSA 1WTAA 5BVHA 3DZCA 1WCWA 3NM5A 1FOEB 3ZJYA 4BTVA 1PVOA 5FH9A 1M34B 2Q5IA 2RHGB 4L73A 2PLFA 1I7NA 4PCLA 3UATA 2AXPA 4CMBA 4ILKA 3EUWA 5FULA 4E7OA 5C81A 3Q3CA 1P7ZA 4FHFA 1GFWA 2IQ5A 3ESXA 2IWRA 4E4TA 3DQZA 5HDBB 4YH1A 2PL1A 2IUFA 5FQOA 5IW8A 2HCBA 3WWYA 1GHTA 3EVZA 4ILEA 3DTYA 1PJ4A 3A28A 4QNNA 5JFOA 4G1EB 4ECAA 1W36B 2LUOA 1VKOA 4C3UA 3Q3JB 4ZAYA 1VL5A 1WSDA 3V3KA 1U02A 3DQPA 2OK8A 3TRIA 3RS3A 2Z5VA 2H5LA 2XWSA 2SKEA 2W2LA 4DIMA 4PQYA 4WOCA 3PUWA 3RSZA 4DDUA 3FRIA 1G20E 3KKNA 3ESCA 2F67A 4UMVA 3LOQA 2GEKA 4IIGA 1Z75A 2NAFA 3R9WA 4RESA 3MK31 2I80A 2YMMA 5I5EA 5KYYA 1OE0A 1J0EA 1ZG3A 3FD8A 4CPDA 2BFCB 3D54D 3K8OE 3TNFA 2ZWVA 3JQ8B 3L7MA 2HADA 1MRNA 1E4OA 4WBNA 3AF4A 3DPSA 2B7LA 4MSUA 4O29A 3WYBA 4D4JA 4DIKA 1U8XX 2WHPB 3VDNB 1DVRA 3T4UA 1LZLA 1K8RA 3PRYA 4WDRA 1ID1A 2ZB7A 3R44A 4PPNA 4XOUA 4KOEC 4DLTA 1YRAA 5BUZA 4BE7B 2Z3ZA 3OUZA 4PLCA 4IFBA 2GBFA 1Y3AA 4AJ9A 4D9GA 3DKIA 1KYYA 2P6RA 2O8DB 5EIAA 3HWWA 1P3JA 3VNVA 2POQX 3F98A 1T8RA 2UVDA 3H5RA 2C8VA 1DBVO 1QE5A 2XQGA 4GOXA 1G3QA 2FOIA 2HA7A 2Q0QA 4TV9A 4UTRA 3FOWA 3DCIA 3F8TA 3HVKA 3LLCA 1DLJA 1DIOB 1WULS 2OUKA 1ORTA 1IJEA 3GFTA 4CEJA 3L5OA 2JFBA 4BZXA 4PAQA 5LZ5A 5JCJD 1ECGA 2IHVA 3PDUA 1SZPA 1IIRA 1ATZA 2WU1A 3CUWA 4HDQB 3AKZA 4TSFA 1KO4A 1TCBA 2C77A 2AOWA 3WMFA 3R77A 3DJFA 3SXUA 3ZGLA 5BMVA 1QHGA 5EEHA 1VRWA 3MRSA 3K94A 4UMFA 3B9QA 3A58B 4OXXA 2P4UA 1IL0A 1LNQA 4AX4A 4P2BA 1Z5GA 2W98A 4EHLA 1DFHA 2IW3A 3DH0A 3GDOA 3BULA 1Y1PA 4AKGA 4ZREA 5AP9A 1Y1TA 1HY3A 1SIBE 3FBTA 1ZI6A 1YHZA 1KBZA 3BJEA 4MUFA 1FRFS 1KQNA 3H2GA 1U1GA 1VJDA 2BMFA 5FAXA 3CNBA 3W9SA 5HM6A 2FDCA 4O4JA 2B35A 4QBTA 5IUKC 1CQJB 2P68A 2JIPA 1WCIB 4IH4A 4TKUA 1NR7A 4AO8A 3BOSA 4BJ5A 3BREA 5BN5B 2FKNA 4Y2VA 1BQ4A 4AXXA 3ZGZA 1SCUB 3PFKA 3CM0A 3KALA 2XCRB 4BASA 3SG0A 1WUTA 2CHQA 4F5YA 1CUEA 1CV2A 1UKAA 2G7MC 2IY7A 4H7KA 3CX6A 3MJVA 4MQEB 5COAA 4YRGA 4W5RA 3P97A 3FF1A 4D0LB 2V1XA 1NR5A 3NHAA 4D0NA 5BR1A 2FUG6 2AD5A 2NXWA 2WP8J 3AHFA 3CEHA 4FMDF 2QVYX 4HDNA 4HPJB 3IDAA 3PJFA 3TGWA 2OXIA 3VOBA 1T24A 4R71A 2YJGA 3AEQB 5KWIA 2VNAA 1X86B 4UVIA 2P8JA 1L8OA 5SICE 4K86A 2BMWA 4CLOB 3L18A 3GXBA 2V7BA 1T9KA 4MWTA 3AOGA 1E2UA 2HMTA 3OX4A 3ZCXA 1C8KA 1U90A 4O2AB 1PF7E 2QIPA 1GEEA 1KEWA 1MHTA 3K0CC 2H3HA 3SZMA 4JEHA 4EECA 1K7YA 4GG1A 1E59A 1ZITA 3EDMA 4Z4IA 5CDHA 3W3AD 8AT1A 1HDZA 4TV8B 4E08A 1AKRA 5AVOA 4X8MA 1FMJA 4LXGA 5BV0A 3RARA 3SM3A 3GQVA 2W6OA 4QPJC 3WVNA 4D9IA 2PKYX 3CPJB 1X15A 4L6AA 3RK4A 1KOJA 2X1LA 2D3TA 1CQIB 3K2IA 3KD3A 1U1DA 1Z28A 3R41A 3F6SA 4MRMB 4QTZA 2DOKA 4XIFA 3AVWA 3T7RA 3AXSA 4KEAA 5EE3A 4WLFA 4R83A 4BRSA 5JS7A 2CK3A 2GFIA 3ILSA 3MJEA 1N6RA 1IYZA 4GYJA 4M1WA 2LCQA 3R7SA 2AOUA 3KKPA 2VPYA 3KSBC 3WLJA 3W1EA 1LC3A 1PZNA 1U2RA 5ICMA 2DG2A 1QB8A 2P9GA 4RK1A 2VTEA 1ZMTA 5EAIA 3LCUA 1RHKA 4LUCA 5JZ9A 3EF3A 3C41J 2WMDA 3GEBA 3L6CA 3TR0A 3UT5B 1X8XA 3PWTA 3RI3A 3LVRE 1E7YA 3MBIA 1HC7A 1MQ8B 1UJMA 3PKZA 4CR7A 4P3KA 1V8FA 5JWRA 5K01A 2RHDA 1ZWLA 3G0DA 4FNMA 2VTKA 3B8EA 3E1GA 5EZYF 2VAPA 1B7GO 2HBZA 2IKSA 4CDRA 5CDYA 4ZVSA 1Y48E 4Q7EA 1M74A 3B5JA 3SQNA 3IAS1 4XJTA 1MJHA 4BUJA 5ALHA 1KC1A 1RRPA 1MXHA 1PSDA 2E4VA 2QBYA 6REQB 4WNIA 1NYQA 1W5TA 2ZEJA 6ADHA 4O4IA 1GCIA 4S05A 4GWLA 2CFRA 1E4EB 3WNQA 5ICFA 1JFVA 1XLUA 4OLHA 4BMZA 2C42A 4QXQA 5D7BA 2C03A 3FUVA 5HUHA 3CN7A 1ZGGA 2J1LA 1NMXA 1Q21A 3AZOA 4OD0A 1GQFA 4D57A 5A5FA 3OI7A 3INGA 3QG5A 1UMKA 2OCGA 2TMDA 3HRHA 3ZU5A 3F5MA 2J9GA 4J8PA 1JQAA 5F2EA 1KOFA 3HVIA 4CQMB 4DR5B 1A9XB 3M1IA 4XGKA 3PCRB 4G0UA 1QPGA 5F12A 1N0HA 5JXWA 2C83A 1NKTA 3QFTA 4Y1RA 5HJ7A 5M2QA 4Q12A 1UXJA 3EZ6A 3MJRA 3PPWA 4N6OA 3ORHA 2QV0A 3BIXA 4YMUA 4TLMB 3NDPA 3L05A 4TRJA 3EPPA 9GPBA 3KSUA 1LVGA 1YF3A 1PJRA 2OZPA 1IN6A 1E63A 1DAPA 4MTLA 4MWEA 1DAIA 4K7JA 5EKTA 2NPFA 4C20A 1X7ZB 2B5VA 4NK4A 3AVUA 5B1IA 2OO5A 3DKRA 3O7WA 5JSHA 4D6PA 2HQRA 1PWZA 2C2WA 4JBYA 4ND4A 5DP1A 3EIXA 2YY7A 1QH1A 2WTBA 4X93A 4KPYA 1ABFA 3VU9B 3OO1A 3G85A 1CDOA 1V35A 3LHKA 3TQTA 5LUBA 4E31A 1XO1A 3U3MA 1MO6A 4M88A 4ZEXA 2NM0A 3TUJC 1RU3A 4YWHA 3WSTA 1J2YA 5IANA 4QYIA 4DVGA 4AP6A 3GA0A 4KTTE 5DX0A 2QR2A 2ZYVX 3S44A 4IWNA 1WW8A 3OCWA 4MCJA 1F7VA 5KVCA 1EMDA 1U1IA 4PXSA 2NUPB 3RV3A 4Y2SA 4UW9A 1X13A 2PH1A 2VZEA 3KQTA 5DGTA 1ARZA 5FHRA 3R76A 2ONCA 3KV3O 2FFBA 1OVGA 3C3AA 2ZSAA 1V0JA 3HHPA 4EKIA 1QHHA 2W2PA 3EDOA 4TZ6A 4ANFA 4WINA 3USZA 5BR8B 2H29A 5A7GA 4AJKA 4AN0A 1X9HA 3SKXA 1Z7EA 3HGTA 4LDPA 4X1YA 4YRNA 4ZC1A 2YYZA 4RBNA 4ODIA 5D3ZA 3OU6A 4UM5A 1FNSA 1RLTA 1CRWG 4BBPA 1M2WA 4MRSA 4L8FA 3DMTA 4QQNA 3UKOA 1SVOA 1BVHA 3Q11A 5T67A 5D8DA 2IZOA 2IYFA 3EXG2 1Y4UA 4CUJA 4FFMA 4B45A 4EHKA 3LTEA 1E8MA 2GOYA 3GUYA 3LQRA 2VUTA 2YNMA 3GFGA 5D51S 4ETWA 2PSHA 5LR6A 4N03A 5AM1A 3T8YA 2ARKA 5K3AA 1QGUA 3DTVA 3F6EX 4YMVA 2RGYA 1DIHA 1HQDA 1Y33E 3F6YA 2WK1A 3LYHA 3M4JA 3MWKA 4O1IA 4X41A 1B0ZA 4XGIA 1SK8A 2RGCA 3B70A 3HBFA 4OJYA 1NTOA 5HUJA 2Q0XA 2P9ZA 3R23A 4RMHA 4KNYA 4G1UC 4JUCA 5FWYB 4J0FA 5DOZA 3K5WA 3LY5A 1ZD3A 2Q3HA 3IODA 3RVQA 2FG7C 3T1VA 1Y98A 5K0EA 4KREA 5HF9A 5LZ8A 3DDNA 2R7AA 5IC6A 1BFKA 1G1AA 4B3SB 2HNAA 2DHQA 3OZIA 3H7IA 3SHOA 4C2BA 2QPOA 2H1IA 3DUFB 4PVCA 4ZMSA 2WKQA 5FUQA 1CYEA 2HRCA 3MWDB 1EXWA 5KAMA 3RIHA 1Y6FA 4CF3A 1DIGA 1EGQA 2F4VB 3PG5A 1L4NA 2B4RO 5IZCC 3B5IA 2BFDB 2L42A 4EK9A 1ZC3A 1JB1A 3WTBA 4RF4A 4AG5A 1BXRA 2CFIA 2EKBA 4J0HA 2R1TB 2VSFA 2B36A 4BEJA 3R0QA 3RRZA 3FKSD 2V45A 4DREA 2PWBA 4N76A 2VP0A 1RYMA 2ECKA 1QK5A 3R3SA 1ZNZA 2AL7A 3IAEA 3T1YB 1VYTA 5EUCA 4JC4A 2R5WA 2V3CC 1OW3B 2YWEA 3HC7A 3V55A 3ZE6A 4B2YA 4CM4B 1WBJB 5FFFA 3NHRA 2JCSA 1P4AA 1N8TA 3KWLA 4QQRA 4Q7QA 4URUR 1QHXA 3DWEX 2RAVA 2WY2D 3W04A 3K15A 4QFBA 2XDYA 2J0VA 1TVEA 1G5HA 2OHGA 1DCFA 1P4RA 1K3UB 4DMHA 4P80A 5EVCA 4XB6B 2AOTB 1WCV1 1VG9B 3ZEIA 3ZTTA 1JFSA 1DHRA 2OAP1 4QUGA 3LG2A 1XVUA 2WP0A 3PQ3A 4CIXA 3K6KA 4RD3A 1YVRA 5JR3A 1LDMA 2GB4A 3C97A 4TL7A 1N75A 2B8NA 4K81B 4HYQA 1OA1A 5G0WA 1FDWA 3HXMA 3NAGA 1X39A 2KMLA 4C30A 1JEEA 2HCTA 3MT8A 4DJTA 4X60A 5KTTA 1OFTA 3ONVA 4BNZA 3G2NA 1YGYA 1FBNA 1I1HA 3TRJA 5FORA 1TRHA 2Z8XA 4MV7A 4QTUB 1RWOA 4S1PA 4W9MC 2ZSHA 1GDTA 3O5AA 5A4MS 5EXTA 3WZLA 4YASA 3OU2A 1BHQ1 1JPNA 1Q95A 1XDBA 2ILTA 1ISRA 2BP7B 3DMPA 3HEAA 4ISBA 4QHYA 3ZD9A 4AZSA 3KOUA 3EY9A 3O1IC 4OGWA 2P90A 4UVGA 4DM4A 2LKCA 2P9HA 2DPXA 3WB9A 4RULA 1BMQA 2ZYUX 4HMPA 4B4WA 4ZCPA 1B0AA 4BB6A 5LQCA 1L9XA 5KKNB 1TT5A 5AKKA 2PANA 4ES6A 3P4UA 4EY4A 1KP2A 4PPFA 3O7MA 1T1IA 1WD5A 3WA7A 1Q1AA 1F06A 2R8OA 3IILA 4K5QA 5BWMA 3HYTA 3K1AB 1A9SA 3ZW8A 4X94A 5AJHA 4HDCA 5EE5B 3FYUA 1M7BA 1VE6A 4GM1A 5L51A 3IPRA 3STUA 3WYCA 5AW7A 3C3CA 2FQWA 1NN3A 5KUTA 1YB1A 2G83A 2R2AA 1BHJA 2PU7A 1VHTA 2PX5A 3BFPA 4FGSA 3WGZA 3L4JA 3WA6A 3KPJA 4X7PA 1WZIA 1RP1A 2HV9A 4BC0A 3UHOA 2PEYA 2XYGA 3G8YA 3LWZA 2HMAA 1M8KA 3Q9NA 4RH1A 4D0GA 1I0LA 4QICA 3ST7A 3EWSA 3H8WA 3RAFC 3N8KA 1W9HA 3R75A 5IBCA 3RW9A 2EP7A 2O2DA 4HSEA 5AJXA 1RYDA 1P1JA 4HDKA 4Y9TA 1YE3A 1Q92A 5LP6C 2GHRA 4HWPA 4LSZA 1C3LA 1VLZA 2NSLA 1TQ6A 1CUFA 1YI8A 3KQMA 3PC8C 5DNVA 1P4SA 3LT0A 4I55A 4FSHA 3V33A 3KJGA 4RDIA 3PHHA 1UWCA 5B3KA 2VG8A 2ZZNA 3SWWA 3LCCA 4K6KA 2XB2A 1BHSA 3LP5A 1UBNA 2ZJYA 3N0RA 4MUKA 3UUFA 2WZDA 1JZTA 2JI9A 3PC3A 1I7PA 1CX9B 2V4UA 3I2FA 1DMSA 3C8HA 4QGFA 3VZDA 5BORA 3DC7A 4TQGA 4ZOAA 5EQDA 5JLJA 4CV1A 3TLCA 2F62A 3D8RA 3B1WA 3ROZA 3PFFA 2QJTA 3O75A 2WZBA 4L8GA 2PYDA 3DFKA 1M1NA 3DXFA 4Z3OA 2Z2IA 3NUQA 4JI1B 2QTGA 4S0XA 1XAGA 3W6ZA 3MB8A 4RV5A 1ESDA 4DR4B 2HA3A 4QYWA 4D4IA 5BR4A 1U3VA 4HLDA 3FNGA 3GB9A 5FBLB 2PJUA 3HSKA 3I2IA 3PSHA 4N0MA 4EABA 2CZCA 3UFXA 1QIJA 3O8LA 2R4QA 4X64B 3I4CA 1ZSVA 5FI3A 2ODBA 3KUKA 1J23A 1HNWB 4YO7A 1KMIY 2ZRFA 3EH1A 3IEPA 5ALLA 4RLFA 1IK6A 3VDMA 3OZUA 1C4XA 4LWOA 5G41A 4HVLA 2Z08A 1LDGA 2WUGA 3EQ2A 2C9CA 3T4PA 3WGHA 2XXAA 1PR5A 1T8SA 3TI7A 1IRXA 5E6SA 2IZ5A 3C74A 4HLNA 2FHPA 5T6BA 2GJ9A 1M5UA 1KRWA 4LYDA 4BO8A 3RV4A 3LUFA 2AEMA 1MOQA 1E3JA 1LJLA 3ONWA 1GL3A 3VNQA 5IT4A 4LNHA 3CNOA 5A05A 3WJAA 1I8TA 3DF7A 4BU1A 4KX5A 2OR3A 2PV0A 4ZV7A 4UU8A 2IZ1A 3T5AA 3PIRA 2X40A 3DP7A 3ZBQA 3EF1A 1PS0A 4QXRA 1DBSA 4RTMA 4UNNA 2A9PA 4Q6WA 1OWPA 2D4AA 1E2KA 4RTSA 4MHTA 3A9VA 1EFLA 2HRBA 2NP7A 4R5MA 1HM5A 2QE6A 3ZNQA 1U28C 4TUYB 3RBZA 2H1LA 3BWDD 1ORDA 3VV2A 3K0SA 4WD3A 2JATA 4RHXA 1YUMA 4A23A 4OK5A 4E09A 3FDIA 2AV6A 5CNKA 1JLLB 2G04A 1X7YB 3PWSA 1GPJA 5IKEA 1UBMS 1X70A 4IRUB 5GWXA 3GP8A 1GU0A 1QLHA 2IS1A 2B2XA 3NBZC 4BQQA 4BEWA 2XBUA 4DLSA 3OIYA 4F2HA 3QPBA 3RUEA 2NUAB 3EY4A 1KPIA 3E53A 1FSPA 2OQIA 2C3UA 1GKIA 1OR8A 1V11B 2HF8A 4ERXA 1Q91A 2FEOA 3H5WA 1IZZA 4R8MA 4YCSA 4XH9B 2O0HA 4N12A 4DLBA 4LIPD 1XNQB 2VPQA 1MN6A 3PQFA 4KYUA 4H4EA 4F5ZA 1TVKB 5CJJA 2HXSA 4GECA 2FFAA 3AP1A 4WJLA 3K1JA 1Q7CA 4U7TB 4AU1A 2FPOA 5J5AA 3KBOA 4MGHA 4DMUB 1RJ9A 3C7CB 1PFKA 4KKXB 3SR3A 4EX6A 1CIPA 4E88A 5CUQA 5JECA 3U7RA 1MC1A 3HDJA 1K4MA