3T61A

Crystal structure of a gluconokinase from sinorhizobium meliloti 1021
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
176
structure length
176
Chain Sequence
RRFPGSIVVMGVSGSGKSSVGEAIAEACGYPFIEGDALHPPENIRKMSEGIPLTDDDRWPWLAAIGERLASREPVVVSCSALKRSYRDKLRESAPGGLAFVFLHGSESVLAERMHHRTGHFMPSSLLQTQLETLEDPRGEVRTVAVDVAQPLAEIVREALAGLARLAENLYFQSHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Gluconokinase
publication title Crystal Structure of a gluconokinase from Sinorhizobium meliloti 1021
rcsb
source organism Sinorhizobium meliloti
total genus 59
structure length 176
sequence length 176
chains with identical sequence B
ec nomenclature ec 2.7.1.12: Gluconokinase.
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3t61A00
1E2KA 1D9ZA 4JVNA 1CU1A 4UXHA 2JLQA 4EQ6B 4FMDB 1DG3A 4O2RA 4F91B 4Q03A 4ZDKA 1U8AA 3ICQB 1F2UA 1ZP6A 2IHBA 3IPYA 1VYUA 4TZ6A 1HE8B 2J87A 3SN6A 1N0VC 2KWIA 4I81A 4DCSA 1IBRA 1XMIA 1E94E 2WZQA 4JLMA 1S9DA 2AHOA 1TF7A 3AKDA 2G0TA 5L3VA 3KXLA 2ZVPX 4B73A 1E2GA 3GQBA 1GZSA 4FCTA 4Q4AA 4UNNA 4XVUA 2A78A 2ZRIA 4I4LA 1KDPA 5CJ2A 4U02A 3SYKA 3QXXA 1CR2A 5BQ5A 5JFGA 4PC3A 5L3RA 1ZRHA 4HATA 4QBFA 2R44A 3ZZUA 1N6HA 3UK6A 2IYXA 5FL3A 4YXWD 3GLHA 3A1SA 4QM7A 1E79A 3Q7PA 1W2HA 3W34A 4D81A 1XEXA 1Z6TA 1D2NA 5FPHA 3V4RA 3NH9A 2YOGA 2W0SA 3ASZA 3OZXA 4V03A 5JRJA 2RH5A 1RJ9B 2QMHA 3UWKA 1Q44A 3GLFE 4LK2A 3CNOA 1D9XA 3ZS9A 2XOKA 2WPDD 1Q12A 1IOZA 4PAMA 1KAGA 4B6FA 4KODA 4HZUA 1G3QA 1KJWA 2F3RA 1KZ7B 3PG5A 2IYUA 3AVYA 3OFND 5E7IA 3RC8A 3U7FB 1TUEA 2WHXA 3QG1A 3RHFA 4C0SA 3BC1A 3S1AA 1OW3B 2ZRHA 4EUNA 2IYLD 1WRBA 2C96A 2OUKA 2WWFA 3B1XA 3EWSA 3EZ9A 2PBRA 1W48A 1E96A 3UG6A 1AS3A 1Q57A 1W0KD 2FN4A 5G40A 3AV0B 3BAFA 1GRNA 3MLEA 1UKEA 1W49A 1YZQA 4X8HA 3T1VA 4QNMA 2J7KA 3MJRA 4WW0A 4XJXA 2D4HA 4JLJA 1KSFX 1VCMA 1Z0AA 1P2TA 1L8QA 3KB1A 1P2VA 2F1JA 1FQJA 2R65A 5CB6A 2ZM5A 4PZYA 5CK4A 3VR6A 1NMYA 4L16A 5C4MA 2D3WA 4LYAA 1K6MA 2KJQA 4P0TA 3TSWA 2IXFA 1IXSB 1MV5A 1E2DA 2ATVA 4P33A 2GZHA 1E2MA 1NLYA 4OHVA 2CCGA 4WBSA 4EPYA 3GLFA 5IRCD 5K8IA 1SVWA 3B5JA 1NIPA 2MSEB 1EWQA 2ZR7A 4H9GA 1GRRA 1VHLA 2PZGA 5DISB 1OFTA 2IW3A 1U9IC 2QAGA 4P32A 4DIEA 5KNBA 4MUBA 4BEJA 2CNWA 2H8KA 2PZFA 1S96A 5FUXA 5KSPA 3W8NA 4GDFA 1FZQA 5KUTA 4P4SB 1Z08A 2GJAA 1G7TA 2FFHA 1UDXA 2MSCB 2VBCA 1EXMA 4Q9JA 2FV8A 4YC7A 5C4GB 1TU4A 3T1OA 2WMNB 3FKSD 4HSEA 2ZREA 2BEKA 3CR7A 1W0JD 3U4QB 3CRVA 1G21E 2I1VB 5FL7D 2OESA 2GZAA 1Z2AA 2BBOA 5DI9A 1IQPA 2PCJA 4CVNA 1OIVA 1UKZA 1TF5A 1XZPA 2V6IA 1GAJA 4OKSA 2QQEA 1ELOA 2ZROA 3C5CA 4BASA 1QZXA 4G5GA 3P26A 2WJYA 1OIXA 2BKEA 1G16A 2SHKA 4W9MC 1GNRA 1UF9A 2J0QA 2R9VA 1FTSA 4KI0A 1Q3HA 2KI5A 1TF2A 1DE0A 2XB2A 1G3IA 4QHSA 3TJZA 1S3GA 1QDEA 3EX7C 4C0BA 2JCSA 4PPQA 4IFBA 3DMNA 3M1IA 1JEDA 2O8CA 2GF0A 1JQLB 1MO6A 1A7JA 2FEMA 3CW2A 4PQRA 1F2UB 3NDPA 2GK7A 4ZO4A 4RD0A 4TL8A 4KFSA 1X8LA 1F3OA 1T5IA 5FOXA 5TMPA 4IRUB 2NG1A 3BOSA 3P4XA 3P32A 2D2FA 3EZFA 2FA9A 1QVAA 3WRXC 1Q1QA 1MR3F 3WMEA 4BUJA 5KTYA 4D0NA 4PZZA 2GHIA 2HJVA 1X6VA 2J5XA 1GITA 5JBQA 3ICEA 3I92A 5EP2A 2CL0X 5JSZA 3PEVA 3QXHA 5C2JB 3B6EA 2BVNA 3N70A 4QGAA 4Z1MA 5LD2C 2NOAA 2QI9C 5JWHA 4G5QA 2HYIC 4LY6A 3FHCB 1M6NA 4OK5A 4ZCLA 4PC2A 4LJ7A 4JKIA 2VP4A 1GM5A 1R0WA 4D4JA 5KHOC 3C4JA 2WSMA 2YWGA 4TLBA 3GLHB 4G5RA 1Z3IX 4L9SA 4KSCA 3O8CA 4QJ5A 2IC5A 2FX3A 2OBLA 4Y0AA 1M7GA 1U99A 2W58A 4DZZA 1UBGA 2ZSAA 3AKCA 2IS1A 1Z6XA 3SFVA 4B3BA 5H68A 3GEIA 1ONBA 4PXAA 3PQCA 1EX7A 1OH8A 3OAAA 4HZUB 2JJ8A 1YRBA 1I4TD 1Z0JA 1W1WA 4B35A 4BFWA 3WHLA 3SC3A 4N1AA 4NDZA 4KBFA 1EFUA 2ZRKA 2QEQA 1BIFA 3RWOA 3TRFA 4QG7A 4D4MA 2GETA 1L2TA 1M7BA 5C46F 4YMUA 4Q7LA 1NVXQ 1Z0KA 4GZLA 3BK7A 1P62B 4RSGA 3AF0A 1LVGA 2OCAA 1OYWA 4HLDA 4B75A 3UWOA 5KPDA 3O47A 3TH5A 3N2EA 2V7QA 1OKKD 1IN5A 1G6OA 1IXZA 1YJ5A 3HU2A 5D3MA 4DDVA 4AI6A 3VKWA 2OBMA 3OEED 2O5VA 2CDNA 2GBLC 2C9YA 4LYFA 1VTKA 3QIAA 1TQDA 4BEBA 3DEFA 4OJQA 3MCAA 2BIFA 3CRW1 1KI1A 2HLDD 1Z5ZA 1XFAA 4JL5A 3PUXA 2NO6A 4H1VA 1E2JA 3UMRA 3QKSA 3QEJA 1AQUA 4LSGA 4I1UA 3DO6A 4WZBE 1G64A 5L8VA 3B9PA 5TXGA 4FWTA 4Q4JA 2DYKA 4ARZB 2IF0A 3FVQA 1XCMA 3BIFA 3TVDA 2XZLA 3ADCA 5FI0B 3G5UA 3CH4B 5G41A 4IW3B 2HT1A 4ZKEA 1II8A 1N2CE 3W8RA 4EPWA 4AYXA 1ZUHA 3KUCA 1Y63A 3MWJA 4Y0VA 3CZQA 1ZNYA 2V54A 1X1RA 4A1FA 1LNZA 3F5FA 1EX6A 2ZVQX 2P67A 1P6XA 2XTMA 3LY5A 3QF4B 3QKUA 4NYMR 4Q66C 3ZIAA 3A4LA 3FWYA 3X1XA 3DL0A 4ITRC 3Q5DA 4ASUA 5EE5B 4TLDA 1SHZA 4DWJA 1B23P 4MGIR 4RCYA 2ODWA 1VCNA 1E9BA 4U7DA 4TSFA 3PEWA 1X1SA 4TWZA 4URYR 1YE8A 4HUQB 3B85A 1K5GA 2PEZA 2Z4RA 4RFSA 3L0SA 4XSHA 3WYGA 2ZJOA 2QRZA 4A2QA 2ZAOA 3VKGA 4HB4A 4UXJA 2FF7A 2RGBA 3VHLB 4D4LA 5DH9A 1OT3A 2RGEA 3VTKA 2IYRA 1XPOA 1E98A 4ZPXA 1ZM3A 2XTZA 2O0KA 2A30A 4TQUS 4Q1FA 1Z6GA 3D6TB 4PSAA 4YDHB 1O3YA 4EJSB 1P7CA 1CLUA 4ON9A 5JZVA 1S4QA 4XD7A 1IJEA 4OQNA 1KY3A 2H57A 1GUAA 2ZS9A 5E7MA 2IS4A 5IK2D 3TBKA 2G3YA 3REFA 4QRHA 1LW7A 5AJZA 4M53A 1VYVA 3I8SA 4LOAA 5DN6D 3ASYA 1E1RD 3VMFA 3WBKA 5J4KA 5F9HA 2K5UA 4F4CA 4NE2A 1XTQA 1Q20A 3DKPA 4DCNA 1S2MA 2HXSA 4OQFA 5BN4A 5GJVC 2OFOA 1OE0A 4BZQA 2O8FA 1GKIA 2WBLC 3G0HA 3ND8A 2ONKA 1BMFA 2ZSDA 5M04A 1WQ1R 5HCNA 1S0UA 1QHYA 1H8EA 4A92A 1XU4A 4M9XA 2VSFA 1X8JA 3K0EA 4LJ8A 1XJCA 2IL1A 1H8HD 1ZNZA 4OI0A 1KK2A 1HUQA 3IIKA 2GJ9A 1QHXA 2W6ID 1BS1A 3BFVA 3NDBB 2KB0A 4NYIR 2GAOA 3FMIA 1KK0A 3L82B 3AVPA 4PQFA 3NBZC 4MKIA 3AQ4A 2YWFA 2YWEA 4DLTA 2QTVB 2GCPA 3LXXA 3UANA 4HEJA 4R9UC 1EFTA 5CIQA 1D2MA 4A2PA 4EIWA 4GZMA 2IYSA 5FFMA 3LBHA 5E3HA 2ZS8A 1TTTA 4D0GA 3AF2A 2HCBA 2YC4C 1KO5A 4NCKA 3EZ6A 1YRAA 2FG5A 1NN3A 3M0EA 5EE9A 3RRNA 2FGKA 4QJ4A 2OXRA 1ZD9A 1RZ3A 1UKYA 5CITA 4PHTA 3THYA 4XWOA 2O8BA 2N46A 2VHJA 3QJYA 3AF4A 2PT7A 5LPNA 3T12A 1MH1A 2FNAA 4NCJA 3KJGA 2ASEA 1S9HA 4OI2A 3MFYA 1TX4B 1OXTA 2BBTA 2IYVA 5FTKA 4MGYR 1FMLA 1KDRA 3VNUA 5GJCA 3WNBA 3W3AA 2ZYUX 1YZKA 4TTQA 2OILA 2HF9A 2QGZA 4R2HA 1DADA 2VHTA 3GEHA 4TMKA 4CZ2A 1U98A 2CCKA 4HAYA 1ZBDA 3SHWA 2JDIA 2EFEB 1GG2A 1DAGA 1XPUA 1DS6A 1H65A 2A5DA 2EFGA 2QROA 3B82A 4LJ4A 1CRPA 3SBEA 2YYZA 1E99A 1OH6A 2GEVA 2BHRA 4Q4JB 4B2LA 5E4FA 3TR5A 4LHZA 4YMSA 5JEDA 5AK0A 4CEIA 2D7CA 2FPMA 5DYIA 2B7CA 2CEAA 4HAWA 5AUPB 4GOXA 1ZAKA 5KSZA 4EQ6A 3MSXA 1U94A 1II8B 4JS0A 3IBGA 2REOA 5TB5A 2PLRA 4KXFB 1VG9B 1JR3E 3ZJYA 2XTNA 4LPKA 1EESA 3OIWA 1F2TB 3OE7A 4W5JA 1G8PA 2GILA 4WXPA 1QG4A 4DCTA 4RJLA 2J0UA 2ZJAA 4HUTA 1GIAA 1RFLA 3LVRE 3SJCA 4TTPA 1KMHB 3CPHA 2XAUA 1U8ZA 4G5SA 4LJ9A 1ZU4A 1QRAA 2WWHA 4M1OA 2VP2A 4R7ZA 3QPVA 4AG6A 2AKYA 5J4HA 1KI4A 3PITA 2WJIA 4G3XA 4RFVA 3U7HB 3GFTA 3QF7A 2J9RA 3QXJA 2X2FA 3OEHD 2ZAMA 3IO3A 1QHHB 2I4IA 2CK3D 3PIRA 2D2EA 2PLFA 2QPAA 1XF9A 3KL4A 4B2IA 5H8WA 1VG0B 1QHSA 2IF2A 5K8LA 1ZC3A 4JVMA 4OYHA 4PR0A 2N1BA 1E0JA 3CX7A 4I1OA 4ZV4A 2R6GA 3CF6R 2NO9A 2GTPA 4RCZA 2C9CA 2DBYA 2H17A 3FHOA 5AR1A 2UKDA 2HUPA 4HB0A 4DLRA 1RJ9A 4RZXA 1E2HA 1VMAA 2OXCA 1T3LA 3I5YA 5JI3E 1ZINA 3GJ6A 4BFYA 3KQLA 1VDZA 1TL7C 2IS2A 1AS0A 2YZ2A 5L3QA 2GJSA 1JR3A 3CX6A 1WF3A 4NCHA 2B21A 2Z0MA 4BFSA 1SVLA 3NKVA 2ZU6A 4NH0A 3PR1A 1BOFA 1HY3A 2AK3A 2C9OA 2QM7A 4C4PA 1D2EA 1AQYA 1OH5A 5KSYA 2ZI5A 4C0QC 2O8FB 4PHFA 4UJ5A 4TYYA 4LJ5A 2CHQA 2V4ZA 2ODEA 3SHFA 2NZJA 3AVXA 2A5GA 1EFCA 1FUUA 3VAAA 2O8EB 3GLIB 4KAXA 4UNSA 3RYTC 3QXSA 2WOOA 4LYHA 1FUKA 3ZZ0A 3ZQ6A 1VYTA 4AC9A 2H92A 4DXAA 1GWNA 2VEDA 2A3RA 3TQCA 2NTYC 3O8DA 3C14C 3MRSA 1DAEA 2WWXA 4B3DA 1XDBA 2VP6A 1N6RA 3A37A 2BEJA 1QHNA 3HDTA 3EA0A 4QL3A 4TT3A 4TN1A 5CLLA 3TAHA 3TGPA 1ZVQA 3AH8A 2GCNA 3LWNA 4DDWA 3O8RA 3RRZA 2VSOA 2JIZD 1WBBA 3T5DA 3R8FA 1D6JA 4DEXA 2ZI9A 2CE7A 2EW1A 4G0NA 4E09A 2ZRGA 1G8GA 5EQTA 2VO1A 2VPPA 2ATXA 2G0NA 2HYDA 1JI0A 4GT1A 4OHYA 4JJKA 5SZIA 4EPVA 4AYTA 3ONWA 2VLIA 1C4OA 4JL6A 5SZKB 1E69A 4BQSA 2ZJBA 4HI0E 3U2QA 5HKKA 2O52A 2QMEA 3BB3A 3BBPA 4NP6A 1KO4A 3LQQA 4P4SA 2O8BB 4L15A 3PXGA 4V0ME 5DE3A 4B76A 2J41A 2JLUA 1XEWX 4BFXA 3U4QA 1HV8A 3FDIA 5IDVA 3RC3A 4IEEA 2E9SA 1E0SA 1KI6B 2OHFA 5FBQB 1GDDA 4FIDA 4OHXA 2VYFA 1JQJC 5JI2E 1AGPA 1F60A 1SKYE 1HT2E 3U61B 3QPWA 5BXQC 3B1ZA 5TVKA 1KI3A 3GFOA 3PUYA 1G6HA 4DSOA 4M4SA 2IYTA 2AD1A 1T9HA 1W2GA 3IPXA 2JASA 1G3UA 1T3SA 5FOSA 5HTKA 4CEIB 1LY1A 3N5CA 1JALA 3DKVA 2BC9A 4DBLC 4B32A 2ZE8A 3IILA 2ECKA 4IHQA 4B43A 1COWD 3UMFA 3HR7A 1CXZA 4ZCMA 3AVUA 1N0WA 2OCBA 4S35A 1XZQA 2OM2A 2J0UB 3WMGA 2VL7A 1A2BA 1NF3A 3SS8A 5BW8A 2EWVA 1NBME 5EP4A 2NPFA 5C18A 1XNJA 1GKYA 3K9HA 3AKEA 3KKNA 5EP3A 3GJ7A 4WZ6A 1G4UR 3IBYA 2IYZA 2QAJA 4G01B 1RPZA 4MDFA 1N25A 3ZVNA 4PZLA 2YOFA 1LS6A 3THXB 4BFUA 4Q5IA 5EUQB 2EQBA 3K9GA 1E32A 2W2TA 1E1QD 3T1QA 4BRWA 3EPHA 1NLFA 2BCJQ 3A4MA 1UJ2A 4KVAA 1G3MA 4N3NA 4QGHA 2O0HA 2QN6A 3LRPA 1A4RA 3FYHA 5EZ6B 1GL9B 1Z0FA 4KJZA 3P1JA 3UPUA 3LV8A 4LDJA 5FOWA 3VKHA 3OESA 2ZR9A 4KLNA 3NG1A 4WIAA 2XGJA 1SULA 1N6IA 4FCVA 5DI3B 1I4LD 3BXZA 2WJVA 1R4AA 2FMXA 5HE9A 1UBCA 3PV0A 3K9NA 2RHDA 3LA6A 4EPXA 5L3QB 1Z2CA 1DARA 1Q1ZA 4ZDIA 5FOUA 2Z43A 2IXGA 2EWWA 4IJMA 1UBFA 3C8UA 1E2LA 1JECA 2BMJA 2X1VA 3V9PA 1HTWA 4URVR 5FOTA 4DUGA 1NBMA 4TL9A 5LD2B 5EE0A 2V1UA 3CKLA 2P5TB 3C7KA 4MYHA 4UNPA 1KDTA 2DFKB 2FU5C 1N5KA 4MYCA 1GVNB 2HDNB 2YINC 3I32A 3AF3A 1IONA 4AG5A 2ONJA 1KMQA 2OSBA 1NSTA 3IDQA 4GP6A 4URUR 1ZNWA 4EAQA 3KKPA 4ERNA 4OBEA 2QT0A 4MYUA 3TW8B 4RD6A 3OHMA 4US1R 4YLGA 1SXJC 1XB2A 2OBNA 1JEEA 2V9PA 4V0OA 3B60A 4QXAA 2JJ1A 4GP7A 4CGZA 1FQKA 1IAQA 3K9LA 2V8OA 4G5OA 2QGNA 4J0QA 1YR7A 3U6BA 1RRCA 4OHWA 5JWRA 2PMDA 3QKRB 4LJYA 2I3BA 2L0XA 3RSOA 4BLSA 1ZD1A 4IDOA 4ARZA 4GL2A 5FPTA 1YHNA 5EZ5A 2OO7A 4BLOA 3ZLJA 1YZLA 4B3CA 1W44A 3IQWA 1ZIPA 2EFDB 3KFXA 4DLZA 1OXVA 2GCOA 4FINA 4I99A 2IUUA 3SR0A 3WY9A 3AUXA 5FUWA 4M0LA 1NP6A 2GRJA 3D7MA 2V6JA 4Q1CA 5FBLB 2QP9X 2JGNA 5J4VA 1YZTA 4PFSA 1KK3A 4PANA 4QGFA 3IIMA 4D25A 3QF4A 1Q21A 1EFHA 3JZMA 4IFEA 5GVRA 1FP7A 4W7SA 2FEOA 2ZE6A 4UKDA 1TQ4A 1AZSC 1W46A 2ZRBA 4HDCA 3Q8XB 3K0FB 3MWLA 4YDSA 1FPMA 5D3QA 1X8KA 2V55B 4FWIB 1NY5A 4A8JA 3U44B 2Q3MA 4HUQA 4JBXA 5KNCA 4UQOA 1E9DA 1U81A 2A5FA 5B2ZA 4YXWA 5JJLA 2R6CA 4F38A 4B33A 1KNQA 4WVFA 2Z6VA 4BFTA 2CL7X 4Q47A 2ZJZA 3NEJA 2PJRA 1JBKA 1NL3A 2JEOA 5DHAA 1Z83A 5F98A 1HH4A 1N6LA 1S1MA 3NWJA 5JJIA 3EZ7A 4EJSA 2WPDA 4HLUC 1K8RA 1A82A 2CL6X 2F9MA 1JJ7A 4QBGB 5GADl 1AA9A 4WA7A 1QHGA 1ANKA 3RS2A 3OFNA 4JBWA 1WMSA 4DLVA 2QY9A 2RGDA 2QZ4A 1A5TA 3K0AB 4CT4B 2FJUA 1OLOA 5EXTA 3RS5A 2OCYC 2BWJA 2BKUA 3AUYA 4YMWA 2IHYA 1HYQA 2GESA 4FMCB 4LBYA 2ZRCA 5GJBA 4GMXA 5FOVA 4JSYA 2BMFA 2B92A 1VHTA 4OI1A 2ERXA 2AR7A 4L5BA 4Q9IA 2R6DA 1W0KA 2H16A 4NZYA 621PA 2WJJA 2ERYA 4AKEA 4R2IA 2VRWA 1T5LA 3GP8A 1P5ZB 4GBMA 1N3BA 3B2EA 3BORA 1GKUB 4OK6A 5TY0A 2AKAB 1ZM7A 1IM2A 1II9A 2QNRA 3QKTA 2MMGA 2FSFA 4CEJA 3LLUA 1QG2A 3GMTA 2ZU0C 4FN5A 1SKYB 1G5TA 2Q21A 3NVAA 1OPXA 4Q21A 1JXOA 3CIOA 3U3JA 4BPBA 2ZJ5A 4UJ3A 3K70C 2W6JD 3GJ5A 4IDQA 3CRQA 1PZNA 5JRZA 2IEYA 1EGAA 4FD2A 4JLPA 3TQFA 121PA 4MGZR 3KB2A 4DCUA 3AM1A 5SZHB 4GPTA 2RHMA 3H1TA 2OT3B 2VSXA 3THOA 3PFIA 3IIJA 1Z6AA 3WP1B 1Z22A 4TYQA 2ZRPA 2C8VA 4PHGA 3AP3A 4NL4H 1G8FA 4CEHB 1OFHA 1P73A 1XTKA 3I4LA 3AB3A 3FKSA 4ZDWA 2EU8A 2FOLA 2DWPA 4D0LB 1XD2B 4B44A 5J40A 4KITB 1W0JA 2A2ZA 1HQCA 5CB8A 1CJTC 2GXSA 1S3SA 5FL7A 3WYFA 2IYYA 2AL7A 2G88A 3PEYA 1KGDA 4MDEA 1E4VA 1CULC 1FX0A 3QUSA 4NBSA 3BD9A 1J2JA 5JECA 2CJWA 3K09C 1PVOA 2ZI6A 1G8HA 1M8PA 1T8UA 3A58B 4GSYA 1BH2A 1E2PA 1MKYA 2IWRA 4A0FA 2QE7D 1OV4A 3KJEA 2WV9A 2J46A 1JB1A 2RGNC 4C30A 1AKYA 3H84A 1DEKA 2DWOA 1NVWQ 2WKRA 4LI0A 3FMOB 1XTJA 3F8TA 3OIVA 1E9AA 4RY2A 1XMVA 1XD8A 2DHRA 2DFTA 1LS1A 3G82C 2UVQA 4TYWA 1VIYA 3ZD7A 5JCZA 1N6OA 2GCOB 3RNLA 2ZRAA 3HU1A 4HAUA 1G19A 1AZTA 1Q1EA 1SZPA 3SQWA 1XXHE 4XSGA 1F2TA 2C99A 1CTQA 5EXXA 4Z8XA 1J8YF 4V0LA 4B3XA 3ZZTA 1W4BA 3HJNA 3K0CA 3NC0C 3CWZA 1KMHA 3ZDQA 4PO8A 1DO2A 2GA8A 3NTUA 4PC1A 5KPJA 3I62A 5AUQA 3T61A 3MJHA 3SJZA 1XEWY 4E22A 3HPQA 4XOIA 1P75A 1N6KA 1SXJD 3DM5A 1SVMA 4C0JA 4A8JB 2WOJA 3UATA 3GLIE 3BH7A 4F4IA 1G1MA 4A82A 1QHHA 3GJ3A 2FH5B 1D5CA 1RRPA 4A0HA 3QOFA 1R8SA 2FWRA 3NBFA 1XEFA 4K46A 4KFUA 3QSYA 1RRGA 1OFUX 3KXKA 4IOKA 3ZH9B 1TQ2A 1NSFA 3CX8A 4PPGA 2X8AA 4B47A 4Z54A 1M34E 3B1VA 4GOJA 1U8YA 1P9RA 2QG6A 4M1YA 1KSHA 4RZ3A 2ANCA 1ETUA 4FMBB 5F2EA 1NN1A 2W83A 2HJGA 4RZUA 2ZRLA 4MRSA 5ANRB 2YHSA 3ZVRA 3I61A 2X77A 1GTVA 3U3OA 3LLMA 1Q0UA 4LZZA 5CYPA 2ZSBA 1XXHA 1IN4A 4LJAA 2XX3A 2ZE7A 3UG7A 1KHTA 4Q9HA 4IOMA 3WXMA 4DLSA 3SBDA 2ZJYA 2N42A 2WAYA 3FKQA 4XWKA 2VH5R 3SYNA 2OAQ1 4AIIA 1OKKA 3W3ZB 1KO7A 1SXJE 3I5XA 1C9KA 4Q00A 4XH9B 5JHGB 2W0MA 4URWR 1QHIA 3OEEA 2VHCA 2IEZA 1SVKA 3FGNA 2V1XA 4G1UC 4CEJB 3KTAB 2CHVA 1EFRD 4M1SA 3GLIA 3KQHA 2O8EA 2HLDA 4QNRA 4M1MA 3C16C 4UXIA 2VQSA 3L0IB 1RE0A 3AGQA 3P27A 1Z06A 4M1TA 4PPNA 2JLVA 4FMDF 2F1IA 2BOVA 4M1KA 2R62A 5JS7A 5FPYA 1XBTA 1XRJA 1KOFA 2G83A 2AFIE 4DB2A 2B8WA 1OXXK 1BO6A 2ZQ5A 4L9WA 5G3ZA 1E6CA 3A1TA 4LYJA 1DPFA 3ZQJA 1ZCAA 2PX0A 2CHGA 4GMDA 4V02A 3CNLA 4R71A 4A15A 4AKHA 1CF4A 1CIPA 1NKTA 3LW8A 3VNVA 1KSJA 5J4LA 1VPLA 1DAIA 2CXXA 1ZM2A 5CLQA 1KSGA 2XNDD 2ZIAA 2JLSA 1J99A 2Q3HA 5HR5A 3A1WA 4POAA 4PPFA 4OL0A 2GXQA 1XCPA 3T15A 3KUDA 4DT1B 2O0JA 4IVQA 3TSZA 2HEIA 1T91A 1V5WA 2GDJA 1IY0A 3TMKA 3KQKA 1KK1A 4XVRA 1KZGB 2D7DA 2RGCA 1M2OB 1FX0B 1XJ0A 4QOSA 5HCIA 1N6PA 4BWYA 3EIQA 1KI6A 2CJWB 3NEYA 4KCGA 2X2EA 3T5GA 4CW7A 2FPKA 5A0FA 2F55A 3R9WA 4DLUA 3WNCA 3K70D 3QXCA 4RKEA 1JPJA 4US0R 3QEOA 2G9NA 1FTNA 2HT6A 2H5EA 3CONA 3U5ZB 2WKQA 2QT1A 4MH0R 3Q7QA 2QAGC 1UAAA 3W5JA 2Y8EA 2DR3A 3W6PA 3CF2A 1U9IA 3H0KA 2BDTA 5IK2A 4WXRA 3V00A 5DN6A 1VCOA 3EASA 2ZETA 2J59A 1E1RA 3PVSA 3CBQA 4TYPA 4B2PA 4CIDA 1IY1A 5AWFC 4TLAA 4D6PA 1OHHD 5AUNB 3AKYA 4PO9A 1KIMA 1I2MA 4NYJQ 2AX4A 2F1RA 3DMDA 1DAHA 2LWIA 3GFPA 5J47A 3R9XA 1GNQA 8OHMA 1G18A 5JLJA 4C0HA 2ZI4A 1XMJA 4JJZA 4O3MA 1E2EA 4TMTA 3A4NA 3HYRA 4Q1EA 5ELXA 1CKEA 1PUJA 2A5YB 1CJKC 5KDOA 3RWMB 1ESMA 1E2NA 1H8HA 4FXPA 1WCV1 4RVCA 5IF9A 3LX8A 2DY1A 2B7BA 2J45A 2ZS7A 1P2UA 2W6IA 1G20E 3TAUA 3THXA 4MGKR 2ZSFA 3CZPA 2P3SA 1M74A 1C1YA 2ZE5A 4MKGA 1ZUIA 1FP6A 2BM1A 2OV2A 4RD2A 721PA 1VG8A 3QBVA 1HQYE 4LX0A 3M6AA 3SEAA 4JVLA 2FZ4A 2QMOA 2JJ2D 3SU8A 5CIWA 3MG9A 4B71A 3DZDA 2JLWA 5FBVB 1TQ6A 3U60B 4PO1A 5DI3A 4V0NA 4ZI3A 2O8DB 1JAHA 1Q1BA 1RYFA 1Z8FA 3C41J 1U0LA 3PUVA 4JLVA 2XZPA 4EKDA 3EPJA 3FOZA 4M21A 2D62A 3KKMA 3REGA 3R9IA 1XXHB 4JZKA 1W36C 3TVTA 2PT5A 221PA 3L8YA 4ZKDA 2R6AA 3MWYW 4Q7KA 2J0VA 1DO0A 2ZRDA 1CEEA 4URZR 3ZVLA 3DOEA 3IGFA 4AD8A 4IKEA 2E87A 5AJVB 3W6NA 1CJVC 2VTKA 1J8MF 3CPEA 4Q1AA 4F7WA 1R0ZA 3WHKA 3OIUA 1G5PA 2AD5A 3QVUA 3CLVA 4AKGA 4HAXA 2ZR0A 1KYIA 5JS8A 2VP5A 2YVUA 2J7PD 2ZPTX 2ZTSA 3AVQA 4CYMA 4HB2A 2FSIA 2HCJB 2W2VA 1KNXA 2UZ3A 1W7AA 3CF0A 1KY2A 2EFHB 1JNYA 4V0KA 1E3MA 1CR0A 5J4YA 3U3KA 4DLWA 2IYWA 4BGDA 4GI7A 1XD9A 1OFIA 1MO5A 2QU8A 4Q9LA 3T34A 4RKFA 3K0SA 2G6BA 2ZRMA 4ESHA 3LD9A 2RMKA 4DLXA 1G17A 3QKRA 4ABYA 5BN5A 1UKVY 2C2HA 1TEVA 2XITA 3DVLA 4MRPA 4N0DA 3BRWD 4MYTA 3SDZA 3OIYA 1OXUA 4KSBA 3LDAA 4OI4A 3B1WA 1UDWA 3EPLA 2YOHA 4B3GA 2OEPA 4KU4A 1BYUA 4D80A 2WWYA 1ZYUA 2FSHA 1XMSA 2QRNA 2QSYA 3AGPA 1RIFA 3W9YA 4O25A 5CJPA 3EIEA 1T8TA 3O8BA 4TQ9A 3J81k 2MSDB 3QE0A 1KI8A 2W2XA 1YZGA 1KKLA 4KVGA 1SXJB 3BB4A 5FH9A 2GBLA 1E79D 1FNNA 4OJKA 4NTZA 3KQNA 3OEHA 1UEIA 4B3FX 4JT4A 4JKYA 1VCIA 3VQTA 2HXYA 5FI1B 5LB4A 5TV2A 3R8CA 2DB3A 3K0FA 4S2EA 4BZXA 1G4AE 1OXSC 5AJYA 2CK3A 1PUIA 2C77A 3EZ2A 3LFUA 3NBYC 4PTLA 5JHHB 2J1LA 2XOKD 3U44A 1ZU5A 3JVUA 4B74A 1P60A 1FL9A 2LKCA 4EPRA 1MO3A 1RYHA 1FNMA 4JLNA 2C03A 1GL6A 4K81B 1R8QA 3X1ZA 4F4JA 2IT1A 4TMZA 1AGRA 1GSIA 3ZS8A 1NIJA 1IHUA 4C2TA 3X1DA 1MT0A 4LJ6A 1DAMA 3EXAA 3TUJC 2ANBA 3L2OB 3CUEF 5K8UA 2GJKA 4HAZA 4JLDA 4F92B 1DELA 2WWIA 4TZ0A 1TU3A 4PC6A 3K0AA 2VP9A 1U0JA 2DPXA 3RS4A 1FOEB 1OF1A 3IQXA 3TLXA 3AVTA 5CK5A 2AXPA 4RD1A 3LXRA 1Z29A 1MOZA 2VF7A 2ZRNA 1U0HC 2ZRFA 3IKJA 4YONB 3X1YA 2YNMA 3GEEA 2EYUA 4AURA 1SGWA 6Q21A 4V0MA 3RS7A 5FBRB 1E2IA 3SFZA 2J7PA 2C95A 3EARA 4A36A 1ZM4A 1A1VA 5EE1A 3WMFA 3VU9A 1IN8A 3A1UA 1V43A 1F6BA 1ZMXA 3FFBA 1TMKA 1VKJA 1NLZA 2R8RA 1IY2A 5LB2A 2GK6A 2ORIA 3ZYCA 2AK2A 2GVZC 2WJGA 2Q9AA 2VIIA 3SOPA 1AM4D 2CNWD 1Z63A 5CM9C 2JIZA 5UKDA 2CLSA 4A4DA 4YQFA 1P4SA 5L3SA 1EK0A 1NKSA 3I8XA 4GRAA 4ESVA 3CRMA 2J3EA 3VX3A 3THWA 3HPRA 3LBIA 1KI7A 3QI2A 1OH7A 2D06A 1W5SA 3VHXA 1GNPA 1W4CA 1SVSA 3SQXA 3EC2A 5CM8B 3QBTA 2D74A 4EFNA 4KFRA 3GCGA 1BYIA 5J5CA 1DG1G 4Q01A 4DDUA 2P0EA 4CDGA 2JLXA 4II7A 3KX2A 2E1RA 1ZNXA 2GZDA 3MUFA 4JLAA 4M9SA 3R7WA 2REXB 4BZPA 2Z4SA 4Q4HA 1UPTA 4DLYA 4CEHA 1UFQA 4X8OA 2ZJ2A 4MRRA 3IUYA 1CRQA 1Q22A 2LKDA 1MABB 3AVWA 3QNUA 1DTSA 3QQ5A 4LRWA 1LF5A 1XD2A 3BERA 4C7OA 4DVGA 4L4UA 4MKFA 1NG1A 3U7GA 4Q18A 3NIBA 2OFXA 2TMKA 4CF7A 3HWSA 1MRSA 2X19A 5C1BA 4RD4A 3K70B 1IN7A 1R5OA 2OAP1 3Q3JB 2FPLA 1NNEA 2ZYWX 4MRNA 3PCRB 5DYGA 4LV8B 2AFHE 1GRQA 5FR1A 1P9WA 2CVFA 2JA1A 3NBXX 3A6PC 1JJVA 2CLCX 2I1QA 5FTMA 1KO8A 1R0YA 3NHBA 4DDTA 2J0SA 1T3HA 3A8TA 3AP2A 4HLQB 2ODBA 4HDQB 4BLRA 5F3WB 3EG5A 4FI3C 1JPNA 3PENA 5A5GA 2ZJ8A 1CBUA 1COWA 2IYQA 2ODNA 3ZGXA 4MITA 1DVRA 1Z47A 4QBIA 4C0KA 3ADDA 1W36D 1KJZA 4ZIRA 3WNDA 4Z1MD 2XZOA 3GD7A 1N5IA 5JJKA 2NQ2C 4K8OA 4Z51A 4QC2A 5DO9A 1YZUA 3SJBA 3CR8A 4IVRA 2IWHA 1NVVQ 3VR3A 2ZSEA 3N2IA 1YZNA 2IXEA 1OSNA 4JBYA 1QF9A 2GAAA 1G8YA 4LC1A 3WRYC 2BJVA 5G53C 3LO5A 4AWXA 3HYTA 2NO0A 4C0LA 2PMKA 4X8LA 1E0KA 4BFVA 2GXUA 2Z83A 4GFDA 1E1QA 4KYUA 3CM0A 1I2DA 4Q02A 3B8HA 4ILEA 2F43A 2XJ9A 5GVSA 3OAAD 4JT2A 1LV7A 3EAQA 1T0HB 1GFIA 3L43A 4IXNA 3RDPA 2QPTA 2AN9A 2NO1A 1YVDA 3LVQE 4ZDJA 2QQ0A 3BH6A 4PHHA 2R6FA 5LDDC 2NZ8A 2REBA 3LNCA 3DPUA 4LHXA 2LCFA 4DB4A 2P65A 3DHWC 3W90A 2A5JA 1P3JA 2V7QD 4Q7MB 4X8MA 3P4YA 4JMPA 5DNYB 1N5JA 2QP4A 2WJHA 4IDNA 3K8YA 4QJ3A 4Q4LA 1NY6A 4WZAE 4XWAA 1B0UA 2VF8A 3ETLA 4B6EA 1WB9A 3IHLA 3AVOA 1PLKA 2QORA 4Q1BA 2MMCA 3GJ0A 3LBNA 2C5LA 5DSZA 3SJAA 4ACBA 3BE4A 1P9NA 2QM8A 3TR0A 3AP1A 1NN5A 3VU9B 3QPUA 2W00A 3EWAA 4QFMA 1XWIA 3D31A 3KTAA 3NHAA 2DWQA 4LHYA 2C78A 5EXSA 2RGXA 1G7RA 2BMEA 5BYKA 3FB4A 1HA3A 1E9SA 4NPHA 3DM9B 4O0MA 4HLCA 4FCWA 5L3SB 2R2AA 1ZIOA 1UADA 4D2IA 4BRUA 1UBEA 3ZIAD 3THWB 4MKHA 1Z28A 2RCNA 4YMVA 3RVBA 2HV8A 4Q4AB 2ZUBA 3BB1A 4ASUD 1E4YA 4D26A 2PL3A 4AK9A 3HR8A 3QVVA 3U7EB 4EFLA 4M9ZA 1HE1C 2CE2X 2PX3A 2EFCB 3BWDD 4TSFD 2JLRA 4QGGA 2B6HA 4PX9A 2ZUCA 4LBWA 3NH6A 3R7WB 3TE6A 2CMKA 3FTQA 1NVUQ 4XVQA 1NI3A 5E95A 4CRWB 1XTSA 4Q4HB 2ZITA 3OF5A 2KSQA 3SNHA 4CT5A 1RRFA 3Q85A 5EP1A 3F0TA 1SKQA 3E5HA 2JLYA 4QBHA 1XEXB 1LFDB 1M1YE 1TPZA 2GKSA 4U5XA 5BWMA 3EIHA 4C7OB 3TUIC 2NO7A 2XNSA 3T06B 4KYIB 3A1VA 3FMPB 1KJYA 1ZD8A 3UMSA 4DT1A 2FGJA 4WOPA 2G1KA 2BMDA 4TMVA 4DSUA 4XD7D 2DFNA 4BLPA 1W47A 1G9XA 5AJWA 2YC2C 2AWOA 4LV5B 1L4YA 2G1JA 1YU9A 5B30A 4NYJR 2YKGA 3S1AB 2ZANA 4JYCA 4DHEA 3NXSA 3RS0A 1KAOA 4MQBA 1GL7A 4TLCA 1E9RA 1LF0A 3LW7A 1ESNA 1U90A 2WSSD 1AK2A 1VG1A 2PZEA 2BBWA 5IHPA 3TIFA 1WBDA 3HP1A 1OJLA 4JLOA 1D8TA 4MA4A 1BMFD 3PJRA 4PSVA 1US8A 1AKEA 3AEZA 4ZIRB 1H8ED 4GOKA 4Q19A 2ZXUA 2NGRA 2G77B 2JAQA 1IN6A 4I1SA 2RGGA 4LHVA 2VA8A 1E9CA 2XEXA 1JXMA 5KSOA 4HB3A 1G5RA 1JAIA 5LBIA 1XTRA 1K5DA 1UEJA 4PQYA 2WWGA 2Z5FA 5B57C 3CO5A 1W5TA 3EA5A 1SVIA 1IJFA 3RABA 4XTCS 2AWNA 4C9BA 1TAGA 2PJZA 5FTJA 3GLFB 2YV5A 4DCVA 3B7GA 3D8BA 3VR5A 2XB4A 5TDHA 3TNFA 4LV6A 4DC9A 4C2UA 3A36A 1W4RA 3BS4A 1EWRA 2QAGB 2RGAA 2F43B 3PEUA 3TSOA 3U6KA 2WIAA 1GP2A 5IT5A 3QG5A 4OQLA 2FDCA 2W6JA 4IOLA 4Q48A 4AKIA 1T0JB 5DIFA 4B34A 4EFMA 2ZUDA 3GJ4A 1WDTA 5DLQC 2OLJA 1KDOA 3RLFA 3LX5A 4JYBA 1ZW6A 4O2LA 5AJXA 3AVVA 5FBWB 4BE7B 1AJEA 4RD3A 1PV4A 4P4TA 2XXAA 4W5WA 2GEUA 2P2LA 3W5IA 1S8FA 4YMTA 1IXRC 2DCUA 1G7SA 2O8DA 3BJIC 3KXIA 4M1WA 4US2R 3BH0A 3RRMA 1BKDR 2WAXA 2IA5A 4BLQA 3QENA 4KLZA 5KU1A 4FW9A 2BV3A 4PSKA 5B58C 4TQAA 1Z6YA 3LAWA 1T4GA 4MUAA 4JSTA 1NMZA 2JDID 3TKLA 4DSNA 2IBMA 2H1LA 2FFBA 2P6NA 5FPSA 3SYLA 3MAAC 1X86B 1F5NA 3LQRA 2FFQA 3WYAA 4LHWA 2O8CB 2BJWA 1CS4C 1KTVA 1MRNA 1O87A 2HF8A 4TL7A 2QE7A 4IDPA 3C5HA 1RVDA 3PUZA 2FE4A 2P6UA 3TUZC 4AY2A 4M22A 4KHZA 3X2SA 3GLGE 1P72A 1G7CA 1E0AA 2WSSA 2EVWX 1N0UA 1KI2A 3GJ8A 3OE7D 4QHYA 5FTLA 3CRRA 2V3CC 3KQUA 4L8GA 2Q3FA 4NU0A 4F93B 2YJTD 5JSZB 2CVHA 5FUYA 5JWOA 2IX3A 1W36B 1JR6A 1PLLA 2RB4A 5H70A 1Q3TA 2NMVA 3KJHA 3B9QA 2C98A 4LBZA 3I3SR 3K1JA 2ZI3A 4PAQA 2DFLA 2P6RA 1T6NA 1SQ5A 2WVJA 5F9FA 5CDFE 1YR6A 2ZI7A 2GEDA 5EXPA 1Z0DA 3KDSE 3Q5EA 1XTIA 2QP3A 1R6BX 3D3QA 5GJWC 4DKXA 1E9FA 2CLDX 4P31A 4B48A 4E07A 4WAUA 2QBYA 1GOTA 3VR4A 3BGWA 4NMMA 2H7VA 4LGMA 4HAVA 2GXAA 5KYKA 1KKMA 1NMXA 1N6NA 5KDDA 4IXMA 1SXJA 3U3RA 3X1WA 4GNKA 5KDLA 2Q9BA 3KJIA 1FW6A 2ZRJA 3VFDA 4UNRA 1R5BA 2WM9B 4P4UA 4TMXA 2FFAA 1LTQA 4NHOA 4Q9KA 5B64A 1XX6A 5BYJA 2PH1A 3ADBA 2CBZA 3ZVMA 4LBVA 4JVSB 4D82A 3GLGA 1JR3D 2QMUA 3W6OA 4QM6A 4Z8YA 1FMJA 1II0A 1Y3AA 1P2SA 2FSGA 2QPOA 3B78A 5CYOA 4IOJA 1X3SA 4M2LA 1R10A 3DZ8A 4A0RA 4BFZA 1HEIA 5D3MB 3RS3A 1LB1B 1L7VC 4DRZA 4A6XA 3WBJA 1E2FA 1US8B 2OE2A 1WXQA 1DOAA 2RKOA 3PUWA 2XJ4A 521PA 5SZJA 2C04A 4HDOB 1E2QA 5CDFA 5FUVA 3KFVA 1G41A 1XCGB 5K8TA 3KKQA 1F48A 2PCLA 4NCIA 4TMWA 2QL6A 1OB2A 2KBEA 2OFWA 1SHKA 3CPJB 4IDHA 1J90A 1XP8A 3QKSB 2P5SA 3Q72A 3B1YA 4IVPA 4A8JC 4HZIA 2QA5A 3LH5A 4E5UA 3ECCA 4TT3D 2IUSA 4LWZA 4OQXA 4IEIA 3Q9LA 5EE3A 4EDHA 4URXR 4HYYA 1WA5A 2F1HA 3V4FA 1EFRA 3VR2A 1AS2A 2GJ8A 2F6RA 1CJMA 1Z07A 4EPTA 1GILA 2JATA 1P61B 5HZHA 4EJSC 4E03A 1S1CA 4LCBA 5EUMA 5A4JA 1CP2A 4LC0A 4U00A 2GNOA 5TARA 3T1TA 3M4YA 2QTHA 3C15C 3EPKA 4HLUA 5JCPA 2XSZD 2ZYTX 1G3RA 3MWKA 3K53A 3FE2A 5DHFA 1TUIA 1J7KA 4TLEA 5DGXA 1EG7A 3EW9A 1A2KC 3E1SA 4NKRA 5HKKD 5HZKA 2PEYA 2WKPA 3FPAA 1RC8A 3ZD6A 4RZ2A 3R20A 4H1UA 2YWHA 2XXAB 4I1VA 1CR4A 1NG9A 2A7QA 1W4AA 1R2QA 3RRYA 4M9QA 4RFSB 5BN3A 1DBSA 3GJXC 3UIEA 2XNDA 1XPRA 3I72A 1I4DD 1KO1A 2IS6A 2ORVA 2BCGY 2IUTA 4C3ZA 1FFHA 421PA 4NONA 3MMPA 2KE5A 4JLKA 4NYMQ 2BBSA 4A0GA 4OQMA 1ZCBA 2KBFA 1MABA 3H86A 3RANA 2Q6TA 3BFKA 3CB4A 4DIDA 4QKQA 2AXNA 4KFTA 3L8ZA 2FZLA 3ADKA 3UXMA 4LUCA 3WP0A 3KKOA 1VECA 2ZYVX 3IHWA 3DDCA 5KOYA 5HE8A 2WTUA 2GF9A 1PLJA 4NCNA 2WWWA 3E70C 1NN0A 2B8TA 1CJUC 4TL6A 3I1FA 2OG2A 5FR2A 1R7RA 4ZCIA 1NVVR 1N5LA 3I73A 3L0PA 3TK1A 4DJTA 2BM0A 4XIGS 4JLBA 2NPIA 3RAPR 3FMFA 3HU3A 2WMOB 4W5HA 3ND9A 5KNDA 4JIMA 1VIAA 3NC1C 821PA 4FMCF 4C0AC 4D4KA 4ACAA 3SI7A 1OHHA 1KI9A 2F7SA 2QUZA 5JEEA 3U3MA 1TADA 3CNNA 2F9LA 2RAPA 1L4UA 1R5NA 4KBGA 3VX4A 4ZI2A 4OK3A 1OYYA 3FFAA 4TTRA 1HT1E 3CWQA 1AN0A 3MD0A 2IK8A 1SVOA 2QTFA 4M8NE 2A9KA 3E2IA 1NJFA 2OCPA 1RKBA 5EJEA 2QBYB 5G3YA 3JVVA 3VR1A 2VHQA 4A6PA 3GPLA 2WICA 5KO2A 4OHZA 3QY0A 3BFXA 1R0XA 3AF1A 1OB5A 5P21A 4DEYA 3RSLA 3DOFA 1NRJB 1UM8A 3K09A 4TYNA 1ZC4A 4PC7A 2WIBA 3L0OA 1XJQA 4Q7JB 1TNDA 4DSTA 3UKDA 1J70A 2RGNA 1WE2A 1G291 2ZEJA 4KO8A 2Q9CA 2XSZA 5FTNA 4NYIQ 3EC1A 3JZAA 3TW4A 3GLGB 2GVDC 2F3TA 2OZEA 3FHTA 1U2RA 5H1YA 2GWHA 3THYB 3IEUA 1OIWA 5FPKA 3F3YA 2VP0A 3T35A 2JJ2A 1NJGA 3H2YA 2ORWA 4BECA 1QBKC 1PJRA 2EYQA 4DUGD 1NBMD 1ZM9A 4JL8A 1E9EA 1QVRA 2NIPA 4BLTA 4N0EA 5E7JA 1YQTA 4LPSA 1YR9A 2QSZA 4PAOA 2OLKA 4XTRA 3H4MA 1ODFA 4KV9A 4UNQA 3K0CC 3P20A 1RW4A 3MGCA 4QHTA 1YR8A 3KZ1E 4MRVA 1AIPA 4A9AA 4AYWA 4Q1DA 3IEVA 1DAFA 1TEXA 1WP9A 2Q0HA 1CR1A 1HURA 1ZJ6A 3B13B 3IO5A 5JMTA 4P3YA 3SE0A 5HPYB 1MO4A 3SZRA 4A2WA 3CH5A 2UZIR 2JJ1D 3GLHE 1M7HA 2H18A 2QENA 2CCJA 1DAKA 1ZUNB 2VHUA 2JLZA 4R98A 1YKSA 1Z0IA 5AUOB
chains in the Genus database with same CATH superfamily
3QX3A 3IDAA 3KTDA 2L42A 2EAUA 4UXHA 2JLQA 1N1EA 2BTQB 2PUJA 4FMDB 4F91B 3NVDA 3QFHA 1ISHA 2UU9B 3ZY3A 4DRYA 2B36A 4PSUA 4ER5A 1U8AA 1F2UA 4U7HA 4M49A 4CM8B 3ED1A 4PX5A 1MQ8B 1J49A 4TZ6A 3HVHA 1HE8B 1FFAA 2PRSA 3MTDA 3SN6A 3R3HA 3TTUA 4KN9S 4J07A 1E94E 4S0XA 1I6LA 1TGYA 5A6VA 5BW5A 2PAAA 5KHLB 3LYLA 3E61A 1PVVA 4WXEA 1O96A 2OGWA 4QTTB 5DMHA 2WQ7A 4EB8A 4YUYA 1ONOA 1JR2A 2A6PA 1MNQA 4YHHB 1E2GA 2D00A 4TMFA 2X5NA 1B93A 1GZSA 3ZBTA 3BDVA 5B37A 3E8MA 4W5RA 4LSZA 1LC0A 3LOPA 2JAPA 1UFKA 1Y8QA 3ORHA 4AU1A 4RTJA 1HG0A 3K1ZA 3TFWA 3OUTA 2Q6IA 1CR2A 3ZU4A 5G0TA 2RG1A 4PC3A 5L3RA 4KACA 4YWJA 5KYXB 4GI5A 4QBFA 4KUEA 4F4DA 1QANA 3X1KA 4DR3B 1FFCA 3R3UA 4ZO7A 4HXEB 2PXXA 5A3QA 1U6JA 2EL7A 1APBA 4RH0A 4KLCA 2CVQA 4M1EA 1SU7A 2OVFA 2QX8A 3FG9A 3OI7A 3TPFA 4QM7A 1RHRA 3Q7PA 4I08A 4NC9A 1LTHR 5E6UA 3RUAA 4D81A 1WSBA 3KT0A 3EH2A 3OZDA 4Y6LA 5FPHA 3CZRA 4F6CA 5EJAA 4V03A 1CY1A 2GN2A 1RJ9B 4I6JA 4J49A 5CPFA 5I01A 5JZSA 2YUIA 3ZS9A 5AHKA 4AP5A 4QA9A 1Q12A 1Z5VA 4DLLA 4FS3A 1MJ5A 4HZUA 1KJWA 4EGJA 1IJBA 1QG0A 3C1TA 3SM9A 3HJUA 3OFND 5E7IA 2Q5EA 4MIOA 4BAZA 3RHFA 4RTMA 3E18A 3BC1A 3LT5A 1JLSA 2JJQA 4L4XA 3S1AA 4DABA 4F5DA 1QP8A 3DE5X 3HRIA 4OB8A 5K0BA 3EEOA 1C3XA 5ENZA 5TF4A 3JWJA 3B1XA 2XWBF 5GGXA 3LZCA 2PBRA 1E96A 1XVIA 2WUWE 2X5XA 4O0LA 4UC0A 3LCCA 3FRIA 1IXYA 1W0KD 5G40A 1Z8DA 1JFFB 3ZW7A 2V98A 1CUVA 4A26A 1G8AA 2PIDA 2LXNA 4D3YA 3FF1A 6CHYA 3SSMA 4ZYYA 3T5PA 5BR1A 4BQNA 4MPDA 3G5LA 2PWZA 1VCMA 1FRNA 3NAMA 1UDBA 1L8QA 9LDTA 3Q1KA 2F1JA 4CM1A 1FQJA 3KCQA 1CWUA 3W5VA 4ZEOA 5CB6A 9ATCA 2ZM5A 4I1IA 1ST3A 5CK4A 5I8PA 1AGXA 1Z8NA 4O4IB 1QO0D 4HD8A 4R84A 4L16A 5C4MA 3BHIA 2IW1A 2FPSA 4R1NA 1L5GB 4B0OA 4EUKA 4P0TA 1BH6A 2I0FA 5FV7A 3A28A 5IN5A 3SAJA 1MIHA 4X61A 2ATVA 3PC8C 5LXTF 1E2MA 1P33A 1N2HA 2CCGA 3K4HA 3UMGA 2XKJE 3I6BA 5CT9A 2LCIA 5DEOA 5ALZA 4CKWA 5H59A 3B5JA 1NIPA 5WRFA 1K9SA 1BA3A 2ZR7A 5HJ5A 1CJSA 4BKRA 1Y6QA 3N3AC 3OMWA 2PZGA 3CH6A 4WK6A 2PSEA 4MV5A 2OB1A 4AJIA 5KNBA 3WYCA 4YAGA 4BL5A 5GAJA 1NQXA 4YJ3F 1LNSA 3L93A 2PKQP 3AJEA 1Z08A 1DLIA 1G7TA 4QUJA 3SBOA 2QB5A 4EVSA 3PXBA 2ZK7A 1R9GA 4WY5A 3CN7A 1AUQA 5BSEA 1E3SA 1V39A 1DBWA 4DCJA 4WKBA 1BS2A 3CR7A 3DAYA 4EYKA 1M0TA 1CUSA 1JIXA 1U8TA 2QTGA 3IQHX 4X85A 3PX7A 3CRVA 4YCDA 3CSSA 3TYXA 1D04A 2GZAA 1IK6A 1SCUA 3K94A 3M33A 2BBOA 3ND7A 2AC4A 4CG0A 4DR2B 3P9KA 3KE9A 3TAXA 4CVNA 2Z3ZA 1TF5A 1XZPA 2QRGA 1GAJA 3SIRA 3COJA 2ZROA 3P5SA 1Z74A 3P26A 3PQ6A 3P9RA 2H4ZA 1XMQB 1G16A 2QAIA 2SHKA 4C6TB 2BGIA 3T41A 4DNOA 2R9VA 4TKMA 2HC9A 1ZMOA 4OP3A 1WVIA 2PGAA 3TCXB 4A0SA 5GTDA 4QHSA 1F8YA 1S3GA 3U0BA 4XUGB 2PYIA 5TGDA 1E3TA 2Q5LA 3EX7C 3DQPA 2IOFK 5LA6F 3WLHA 1WB6A 1JVSA 3TRHA 3AR7A 4FOTA 3MOGA 2D0IA 1VKHA 3GLSA 3RS9A 2O8CA 2PZMA 3P9QA 4IG4A 4PNEA 2FEMA 4PQRA 1FP1D 3ILVA 3N0VA 4PYLA 4ZO4A 4TL8A 2G9VA 2JFPA 1IB0A 2YY7A 4O8ZA 2ONYA 4EWLA 4MB0A 5AW9A 3LZ6A 2ZSKA 4R9SA 2V5VA 3OQ1A 3P32A 3PS9A 2FA9A 1BJRE 1Z4MA 2VWPA 2XCQA 1KAMA 1MR3F 4DBZA 5KTYA 1A3CA 3FPBA 5AKJA 4ZI5A 5AW0A 3TLGB 1ZOPA 2GHIA 4FUQA 3IR6A 2NWQA 1ENOA 1X6VA 2HK8A 2QJOA 4XLTA 3ZZMA 3EGOA 3I92A 5EP2A 1G21A 1O08A 3HJFA 3OX1A 2X23A 7MDHA 3D7NA 1GZ4A 3U1VA 3B6EA 5C2JB 4Z1MA 4HH0A 5F52A 2OO5C 1LK7A 1ONNA 2C4HA 2NOAA 3GBPA 4FK8A 4TUYB 2IUFA 3IPRA 2G82A 2J9GA 1M6NA 3OCWA 4IIGA 4N7BA 4JKIA 1KC3A 3OQ6A 3WV5A 1R0WA 1ZICA 2I22A 3C4JA 2XCLA 4L07A 3GLHB 1NUUA 4PLHA 2ZB4A 3ND5A 2FRDA 2FX3A 3MGKA 2OBLA 2HFKA 5TT1A 1U99A 1N4AA 4DZZA 1UBGA 2IPOA 2ZSAA 3C6BA 4OG2A 3ZGNA 1SCIA 2F64A 2OUIA 4AZWA 2IS1A 4XQ0A 3B36A 1Z6XA 2VQFB 4B3TB 3R40A 1Z5PA 2IQIA 5H68A 4LY0A 1NXXA 4PXAA 1RNLA 2JB9A 1EX7A 3CEJA 3PQCA 3KKEA 2ZB3A 3OAAA 4U6QA 4WL0A 1YRBA 4H15A 2W70A 1P7YA 3S3TA 1I4TD 1Z0JA 2COEA 3AEQB 5AOVA 4GL4A 5KCMA 4JDPA 1QK5A 4B35A 5CG1A 1OGJA 3MBOA 4FFWA 3SC3A 5PNTA 3GRRA 1FRVA 1EFUA 2IITA 3A1EA 3OZ7A 2QEQA 4WCVA 5A4DA 3B5IA 3TMAA 3A06A 4QEKA 1H3NA 4D4MA 4QRIA 3EXHA 1M7BA 4UOQA 4YMUA 4CV2A 5KWJA 3BK7A 3SXUA 4ZOLA 3AF0A 3OWOA 1EEXB 2X0EA 4YUZA 1LVGA 3I34X 3FMGA 3TH5A 2C2WA 3K1YA 4YJ2B 1Y9EA 5D3MA 5DTMA 4DDVA 2VEOA 2VYNA 4AI6A 4ZAYA 3VKWA 4B4DA 4E5YA 4G4SP 4YRRA 3GFVA 3IUQA 1AC5A 3OEED 3QEBZ 4LYFA 4MV1A 1ZVJA 4IIDA 4WQMA 1KVUA 1C3OA 1UP7A 1DHRA 3Q98A 5C1DA 1H4TA 1GGJA 2D0PB 1EM6A 2NNLD 2QRMA 4FVTA 4HXFB 1Z5ZA 4CFYA 2F4VB 1LD3A 2NO6A 3DGEC 5DT9A 1AQUA 4LSGA 3RTAA 3UAYA 1N9ZA 1SRRA 4PYIA 4WZBE 2DHDA 1A9YA 5TXGA 4KQWA 2XT9A 3HCAA 2V96A 3OLCX 4PZPA 2IF0A 4Q7EA 3WMWA 5KS2A 5K4HA 3KYCB 2NYVA 2I03A 3KR9A 5FI0B 2EW2A 2CLEB 3EGDB 4COOA 3C3DA 3DD1A 1AG9A 3BXGA 1NONA 1RCUA 4KO3S 4RIGA 4EGSA 5I7UA 1XCOA 2YJ6A 3JQCA 1JIKA 1ZUHA 3KUCA 1Y63A 4LISA 4FT4A 4WBNF 1MZVA 3CZQA 2GZMA 4IGFA 1NBWB 2VDWB 3V8RA 5LZ2A 2PUHA 1LNZA 1EX6A 2ZOSA 5FB3A 3QKUA 1N92A 3VRHA 3FWYA 1FC0A 3DL0A 3Q5DA 3IESA 4AW9A 3D4LA 3A4IA 5JFOA 4CTJA 4DWJA 4KQHA 4RCYA 1EXNA 1JLRA 1O57A 1UFOA 2ODWA 3QHPA 1WETA 2R8ZA 2VHYA 2VTVA 5JPDA 4TV8B 1L5HA 1H0RA 4Q3KA 3SJ7A 4U7DA 1X1SA 4DIUA 1KFKB 3AYXB 4W5QA 3D5EA 4URYR 3AY3A 4L3OA 3LYHA 4AMVA 3FSJX 4NCAA 1C2YA 1TB4A 3WOHA 3L0SA 1UP4A 2OVBA 2ZJOA 4RF5A 2ZAOA 3ET5A 5DSTA 5L40A 1CC1S 2FF7A 2RGBA 3NGXA 6AT1A 5FA8A 1XPOA 2IYRA 3LS2A 4LC9A 3AI2A 3U4AA 1ZM3A 4DW8A 4ZANA 5DYNA 2RHWA 2WU4A 2A30A 4GGPA 4BTEA 1DFHA 3D6TB 3BMCB 1EDBA 1NPYA 2LP4Y 2V7GA 4PSAA 4WGFA 3VJMA 1VRWA 2FEKA 4Y1RA 3WICA 3WIDA 2Q1SA 2JAWA 1ND6A 3REQB 4TSRA 5E6SB 2IS4A 2H57A 3HBAA 1GUAA 3QW2A 1UIMA 2EBUA 1MB4A 3QNWA 5IBQA 4EFDA 4I46A 4GM0A 4M53A 1N2CA 2J0EA 2Y2UA 4LOAA 4TT8A 3EA4A 4KO1S 2MDTA 3WBKA 4RY0A 1CZKA 1E3JA 4KWHA 3WMRA 2X4IA 1FUIA 3DV2A 4R0VA 5GP1A 4DCNA 2EX4A 1PVDA 3ADOA 5CFLA 5GJVC 3RIHA 4MTCA 1RWBA 2OFOA 1OE0A 4O1HA 4BQEA 4C1NA 4A03A 4B3RB 2DPHA 4YREA 4I4CA 2ZSDA 4PO3X 1YSCA 1WQ1R 1QRSA 1S0UA 2ZSHA 1PKXA 3NNSA 4MJXA 4UBJA 4A92A 4GE3A 1H0KA 1XZNA 4GR4A 1GUYA 1X8JA 4HV4A 2XRYA 1XJCA 2DC1A 4NAHA 4LJRA 4QTYA 3WSVA 2ZYIA 2P27A 4P0QB 3RVPA 1YKFA 1D2CA 3MMXA 3OC6A 3FMIA 3WGKA 4FB4A 2VT6A 5LXTB 1XTBA 1A8QA 2Z95A 2O20A 2IUEA 4J8PA 4Q15A 1KRHA 5FLYA 4ZVRA 1WZUA 4ZCSA 4ER3A 1MIOB 2YWFA 3AEXA 3OJOA 4UMFA 2FZGA 2DGDA 4R05A 1LDBA 2R1ZA 2XMGA 3MF4A 5E2BA 3SHTA 4HS9A 2QE6A 5EMNA 3V32A 2EG9A 3RKUA 1MZPA 1AUPA 2CXRA 1R9MA 1QE5A 4LN1A 2IHKA 3MS2A 4G8DA 2AC7A 3HY3A 1RTTA 2X3UA 4GQIA 4YJ3B 4XJSA 4ZEVA 1KP9A 4GZMA 4HNHA 1MQAA 4JP3A 3LTEA 4FKBA 4HVCA 3A70A 5E3HA 2YYAA 2ZS8A 4M7OA 4AJKA 1V95A 2Y67A 2Z1DA 4MYRA 7GPBA 3COZA 5JD6A 2PMWB 3W04A 1F6DA 4DA0A 1YCGA 2OXRA 3JARA 1RZ3A 2H6EA 3PUJA 3TIGA 2EZUA 4QELA 2FWBA 3PDJA 4J0CA 1ZJ4A 1U9JA 2QOEA 2VJMA 3AF4A 1QHFA 3H05A 3PDIB 3PHGA 4K6MA 4UHBA 2VWHA 4ZVPA 4BTVA 3KJGA 3PVZA 4EHFA 2ASEA 1NJ6A 1S9HA 1YTLA 2H85A 2PR7A 4OI2A 3VI3B 4KPEC 3R5FA 3OTQA 3MCUA 1T43A 5JH7A 3QTTA 4L5JA 4ZJZA 3IP5A 5FTKA 4L0DA 3HN7A 1UZAA 3HVJA 3WNBA 3W3AA 2IOYA 2C83A 4TTQA 3P2IA 1SUAA 1KBQA 4BN5A 2PJDA 1C8VB 3C3WA 2QGZA 3HZHA 4DIBA 2FPRA 1DADA 1F8GA 3PXAA 2F67A 4Q3CA 4R2HA 1U98A 1XCBA 4HAYA 4MUFA 3SHWA 2GN8A 4BB9A 1DAGA 3MRXA 1DS6A 1W87A 2C31A 1XG5A 3UT6A 1PR9A 1I6WA 2QROA 3K3PA 4MAMA 3SBEA 4CBVA 3UK2A 5AVWA 1R3DA 3T4UA 3NLLA 4Q4JB 2X9LA 4CEIA 5BMOA 3NETA 1HFEL 2FPMA 4FFDA 5CVDA 2B7CA 2Y93A 4LF9B 2WDZA 4GOXA 1NRXA 4UUMA 2JL1A 4K0KB 1NASA 3TQRA 3CCBA 3T5TA 4X9XA 1XXLA 3N2LA 1RDFA 5KSZA 3X44A 2BTQA 1II8B 2X86A 2XUKA 3CZ9A 3SC4A 5A1JA 4CKEB 2Z6UA 1YDFA 1JR3E 4CM8A 4L8LA 3ZJYA 3AFOA 4AIRA 1N8NA 2GILA 4AUNA 2GGSA 4X6XA 4DCTA 2V7EA 1ZI8A 3SPXA 2QTTA 1CIVA 1SVNA 3BFJA 2E4AA 3F7NA 1UT8A 3TOZA 3OKPA 1MXFA 5F1OA 4XPZA 1U8ZA 1V35A 4BEWA 1C7IA 1ZU4A 3CJRA 4LJ9A 4OJYA 4WLVA 4K86A 3L1HA 3M4NA 4AG6A 4IHJB 4DADA 5J4HA 3OQMA 2WJIA 4G3XA 4GYJA 4MPTA 3WB9A 1IVYA 3U7HB 5KWEA 1P1CA 3IO3A 2X9VA 3WGZA 5LYJF 1QHHB 1C14A 1Y3IA 3PQ8A 4L8WB 5TPWB 5KTSA 5KYXA 4PBRA 3SJUA 4ARCA 5HXAA 4UTZA 1Z18A 1M2JA 3CKMA 2G7MC 3A7EA 3HYLA 4J29A 1FFEA 4RANA 5CVTA 4TKUB 5I9NA 4E11A 1PNTA 4A3SA 3CVWA 3IH5A 4NZNA 1J2YA 3TNDA 5LVAA 2ROQA 3VO1A 2MYPA 2RHJA 1BRMA 2IZ0A 1YMVA 4JVMA 4OYHA 4WLUA 4WZBB 2DQZA 3M9LA 4XWYA 3K2EA 4E0BA 2R6GA 4YP7A 1O5TA 2WEKA 5EWJB 5TGTA 1NXQA 3ZJUA 4HMPA 1ISGA 1Y4SA 1E8NA 1HTTA 2FLVA 1RJ9A 4HVLA 4YP0A 2C5GA 5HSGA 1SUDA 4UCXA 2OXCA 5KYNA 4KW7A 2Q3EA 1FDVA 1ZINA 3AEYA 4WCFA 3GWGA 4R3UC 1TL7C 4EHIA 4MDHA 2IYPA 1AS0A 4HNQA 2EP7A 3Q87B 1LDGA 3CX6A 3FVTA 1GCUA 1QV6A 2CFIA 2Z0MA 4WK4B 4ENPA 1Z25A 2KS6A 5C8XA 2VPQA 1E6KA 3IQGX 1GN9A 2O07A 3L7DA 3SCZA 5HOQA 3PR1A 4K9OA 4QTXA 1HY3A 1TMOA 3STUA 1QH1B 1AQYA 4MVJH 1G5FA 1U8XX 3EGIA 5CPBA 3LT1A 4M0EA 4UJ5A 5D6OA 4ZGGA 2PE5A 1FYXA 3LVBA 2E21A 2XDQB 1XDWA 2ODEA 4B80A 4NBRA 2H7CA 4PNZA 3N6VA 3DAPA 3KWLA 4ZZ3A 1ND5A 2A5GA 2Q7XA 3FCAA 4LYEA 4FYMA 5AT1A 5HFAA 3RYTC 4W1PA 1GKKA 1KYWA 2WOOA 3CHYA 1IG0A 3NCHA 3WLFA 3ZZ0A 3PQ3A 4JR0A 1IWBB 2H92A 2X42A 4U2FA 1GWNA 1GUZA 1XYGA 2VEDA 4J2TA 2A3RA 1MAAA 1MVLA 4EM6A 3KR1A 4NQRA 1Y1KE 4BNTA 4B3DA 3H04A 3B9BA 4N6OA 5DX0A 1N6RA 1ZJ5A 3JQ8B 1QHNA 4LYYA 4TMYA 4TT3A 4OJNA 4TN1A 5CLLA 1SWWA 2WJZB 5KB3A 4O4IA 2IXTA 3U9TA 4DJFC 1ZVQA 1U3DA 2GCNA 4B9EA 1T9AA 3RRZA 5BMVB 4Q39A 1JX6A 3C74A 3G2MA 4FNAA 1WBBA 1NR1A 3OKCA 4N47A 4FU0A 4RADA 4WBNB 1F3LA 4INZA 1G8GA 3B2NA 5T7BA 2VPPA 3SF8A 1EJ2A 2EGHA 3PZRA 1H2WA 1O9BA 3L8FA 5FJIA 3D4OA 2P5UA 3RJZA 5IKEA 4EPVA 2FK8A 1ENYA 2W2KB 3ONWA 1C4OA 3OQHA 1EVIA 2HMSA 4XDZA 4TVKA 3O0DA 1T5SA 3DCNA 4HI0E 1I36A 4B82A 2YZNA 5HKKA 2O52A 4LRSB 2AXQA 2QMEA 4BE4A 5K51A 4ZI7F 2Q5JA 3GB9A 5HNKA 1TJPB 2RGUA 1VA5A 2C2ZA 4UUPA 3I6MA 1XAIA 5I7HA 4PR3A 3S2FA 3Q3GE 1Q0RA 2G76A 4OH1A 3C2QA 1HV8A 5ALIA 4M6WB 4OHMA 5AVYA 2PRJA 3RC1A 1E2BA 1ICIA 4EO4A 1Q7BA 2OHFA 1GDDA 3NRBA 3DFKA 4OHXA 4U39A 2LUOA 4CFSA 4Y9RA 1JQJC 5JI2E 1HOXA 4GX1A 1ZGBA 4BP8A 1EVQA 1OCEA 2BFCA 4Q3LA 3D54D 3I2IA 5L3ZA 4KPYA 4J3FA 4K2AA 1KI3A 1M2EA 3PUYA 4DSOA 2QLBA 4M4SA 4C6TA 3FYCA 1H5QA 1W2GA 3H2ZA 2A1TR 3JD4A 2GDZA 3KSRA 5E0KB 2GQ0A 1XP5A 1K7YA 1IQ0A 3ACCA 3EQ8A 1VP9A 1X9HA 3OQJA 5E6RB 2HHJA 4LOJA 2DECA 4IHAA 4B32A 4DBLC 1EVKA 2Q4DA 3EWIA 2G1PA 4CKYA 3PK0A 3CVOA 3M70A 4XDYA 1COWD 4P6VF 1G9TA 2OORC 1E1CB 1Y34E 1YE5A 2ZWPA 4UPEA 1RXEA 3RFUA 3N6RA 2YFHA 1EFLA 3CNQS 4HNTA 1QJ4A 1G4HA 1OTHA 3CKKA 3RWMB 3VO8A 3R9XB 4MVYA 4I9NA 4ZEWA 1A9TA 1WS6A 4DV1B 2BFDB 2VL7A 4MQLA 4X41A 3NHYA 5BW8A 2EWVA 2NPFA 4EITA 2D54A 1ESCA 1GKYA 2J5QA 1W34A 3L4BC 1ECFA 3R5TA 4O5AA 4Y7CA 5AM4A 4WZ6A 5EP3A 3VR3D 3IBYA 1Y1LA 4DKJA 5FWNA 3IOYA 4OLAA 2DPGA 4AL4A 5JQGB 2Z58A 5IVHA 4MDFA 4GPZA 3JSXA 4PZLA 3HZZA 4C08A 1TM5E 4IZHA 1ZGAA 4INJA 4F21A 3K2QA 2XI4A 3IOBA 4Q5IA 4Z9AA 1N9KA 3D4BA 5C8YA 4Q16A 5F21A 1E32A 1T2UA 4TUYA 1E1QD 3ZYZA 4BRWA 3EDOA 4C4OA 4DV2B 3EPHA 2POQX 1UJ2A 1EBBA 1SZJG 2ZDQA 2ZB8A 4IYRA 4PYKA 3EXEB 1XDGA 2CSUA 5G02A 4E1VA 1V71A 1A4RA 1BFDA 1VMIA 1R0RE 3DH0A 1I1NA 1Z0FA 2BCEA 4QT0A 5I6DA 5FOWA 3UPUA 2DQSA 3RTEA 2BYTA 1SBYA 1TJNA 4KLNA 1UL1X 3MCTA 1SULA 1N6IA 3FPCA 4FCVA 2IV2X 3RG2A 2YV4A 4ISBA 4FOLA 2E2WA 1I4OA 1V48A 2TYSB 4NH4A 4RA6B 4OB6A 4FFOA 5AQEA 3RE1A 4OH7A 1SBQA 4NMXB 3HVKA 4GMGA 4BO1A 5HE9A 4LFCB 3K9NA 2RHDA 4FNMA 2BEUA 4PFJA 3T9FA 1ACMA 2FUEA 2QUAA 1TYEB 2AUNA 3JAWB 4FILA 4ZDIA 1UFRA 1QYWA 4FZJA 5IDXA 2HCFA 3GUYA 2AIRA 3QA9A 2Z43A 3Q4GA 2EWWA 3WHPA 1XDDA 3C8UA 1E2LA 1BG6A 1NA5A 2X1VA 2HF2A 1L5NA 5D86A 2XDWA 1NBMA 1XZMA 2O0MA 2PKXA 3BMOB 3HVIA 4GM4A 4HTFB 4TL9A 2ZDGA 5I8ZA 1H9CA 2VKTA 2P5TB 3C7KA 3O4HA 4BMDA 5CT6A 1MVOA 4NNPA 4AO8A 2NUTB 4ENVA 1WIWA 1E59A 1W1UA 2FW1A 3BIOA 3SOZA 4Z9FA 3U39A 4AG5A 4FGZA 1NMSA 4EFKA 3IDQA 4HTAA 4N12A 1ZNWA 2P1DA 4EAQA 3RKRA 2EKPA 3KKPA 1ZL0A 3T1HB 4RD6A 3OHMA 1DXQA 4YLGA 2QX9A 5H5JA 2OBNA 7AT1A 4JUFA 3OURA 4MVJE 5JAQA 2FEAA 3B60A 3GXOA 3PFGA 4DLBA 4O4JB 4CGZA 1J9GA 3NUZA 1G2IA 1IAQA 1M5TA 4RHTA 1L6RA 2FZ5A 4JC4A 3VKFA 4JUCA 4ZC1A 1F38A 1AQIA 2I6TA 4GUDA 4LZWA 4YH1A 1CFZA 1W8IA 4RMIA 2CXOA 1VJ5A 1MCZA 1E5LA 1P18A 5BN5B 4LJYA 3WGNA 3TGPA 2V7UA 3EAFA 1YJQA 4D9HA 1WDWB 5FPTA 3HA5A 1SD5A 1MT3A 3F6EX 3VPHA 4Z7NB 2UXBB 5AVQA 1YR1A 4JJ6A 3EGDA 2C4WA 1ZIYA 4GXQA 4DMHA 4PINA 3IQWA 2QX6A 2EFDB 4YBZA 1M66A 2GCOA 4HKTA 2BTOA 2IUUA 3SKXA 3TMYA 5MDHA 4JYAB 3NTRA 3DDWA 5FUWA 1F0PA 4M0LA 2C5SA 5TT0A 3RFTA 5J4VA 2GAFA 2QP9X 5GZ1A 3H16A 3JCZA 2R7KA 2VDWA 1A2OA 4M1QA 4MR7B 3OH8A 5GVRA 3HCPA 1USVA 1LQ2A 1MX3A 4UM7A 1YB7A 4W7SA 5LYJB 3KIPA 1VSQA 1SUCA 4LRYA 4P4NA 1W46A 2ZRBA 4UBKA 2PUGA 4IFIA 1E7SA 5AMXA 1DJLA 2O7NA 2CFTA 2C9MA 2QTNA 3K0FB 3Q8XB 4BMCA 4TV8A 5HBRA 5I47A 1IL0A 5K8CA 4O2BF 5EKXA 4MHSA 5CDGA 2V55B 4FWIB 3GOHA 1NY5A 4HQFA 4CMIB 4H16A 3U44B 1JA9A 4JB0A 3KTOA 4E5KA 4YYZA 5ECWA 5B2ZA 5JZOA 1UQTA 1AK1A 3ZHQA 3OM0A 4F38A 5EC8A 5HRUA 1KNQA 3STWA 1DBIA 1FTYA 1Z33A 1N2ZA 2BHLA 2HTFA 4GZ5A 4M7PA 3VH4A 4Q47A 1FTWA 2PJRA 5DHAA 5H81A 4BLUA 1Z83A 5KQGA 3QXGA 3NWJA 3BMCA 4U7TB 4O5OA 1BXRB 3KB6A 3KSAC 3QV1A 4IF4A 1JJ7A 5GADl 3DYVA 3RODA 1CV2A 1ANKA 3I12A 3OU2A 1Z38A 3OFNA 4IRMA 1WMSA 4PFKA 4BE9A 2H5LA 4PBTA 1A5TA 2FK7A 3EQ6A 5CB4F 1OLOA 3EQ7A 1KVSA 1NW7A 3HC7A 3W77A 4XIFA 2PWPA 4YMWA 4MUXA 2IHYA 4JT9A 2GESA 1UMBA 2ZRCA 4FE4A 1OY1A 1YBAA 5FOVA 1JI3A 3DEKA 4B2YA 2BMFA 2D5CA 3W3AH 2D6FA 5AVUA 4L5BA 4B3HA 1XHEA 4HGPA 1S3IA 4J76A 4Q9IA 3GEBA 4M99A 1HT3A 1W0KA 2KMLA 3L0YA 4M76B 4NZYA 5EMLA 3WMXA 2OB2A 2WJJA 2A86A 3OOJA 2VK4A 2GMWA 4R2IA 2A9RA 4U2BA 3K31A 1N3BA 2H9AA 2HAEA 4OK6A 2A9JA 5JADA 2AKAB 4D9IA 2BEWB 1IM2A 1U3WA 2XQGA 3PHIA 3S8MA 1C1XB 2VSYA 1ENZA 2FSFA 3OT1B 4AJLA 1E9VA 1GPYA 3VH3A 3SXPA 1AKNA 2PH3A 2Y1LA 2I4LA 4ZVNA 1QO0A 1R0BA 2PMFA 3K5IA 3DZHA 3V1NA 9LDBA 2GLUA 1JXOA 3CIOA 4IMJB 4Q21A 4OHBA 4I6EA 1Z39A 5LXTA 3BXFA 3ZDBA 1PSZA 4IINA 1N7GA 1J7JA 4LDZA 4B4WA 5JCJA 1UXJA 1I2AA 1OYVA 1MIOA 2PX6A 1HDGO 2Q1YA 3A25A 2NAFA 3IQEA 4G9EA 4KK3A 2IEYA 1EGAA 3EVGA 4LMRA 1UC5B 4TRMA 121PA 4UHCA 3AM1A 2J5KA 5KAMA 3MGBA 4PLCA 5SZHB 1NURA 2OT3B 2VSXA 1LC3A 3IIJA 4ZYZA 1T0BA 1NFRA 2BUAA 4YJ3A 2CZCA 5JU6A 4KQXA 2Q3JA 1Z7WA 2VPYA 4ARUA 4ZO6A 1JXQA 3U37A 1L7BA 1P0CA 3CN9A 4CEHB 1CFJA 1OFHA 2FCAA 2ZWAA 3G2PA 3OPVA 5EIWA 2J3LA 3Q3CA 3T9DA 1P73A 5F5NA 3VMMA 4YRNA 1F4LA 4F0JA 1I0LA 1JV2B 3ID6C 5LIPA 3LUKA 4HCJA 1E1MA 1FDTA 4D0LB 2BL4A 3KP1A 4PZCA 1J22A 3BUSA 5J40A 3VHQA 5IJWA 1CJTC 3AOEA 1N2SA 3QTLA 4Q12A 5AHRA 3PRJA 3NIWA 4BNGA 3H8JA 3PDIA 4DEVA 4R6WA 1S3SA 1QUFA 2BN4A 4O63O 2IYYA 4UFPA 5A3JA 1M10A 1ZBQA 2AL7A 4ID9A 4AXXA 5A9SB 1Q1NA 3LY9A 1I32A 4F86A 1XPJA 5GOTA 4MDEA 1E4VA 1CULC 1M2OA 1FX0A 4HWGA 4M0DA 5EEGA 2OCKA 4P1ZA 4NZMA 1M75A 4OA8A 3PRHA 2P78A 4BMOB 5JECA 2CJWA 4KIGA 3K09C 1EMDA 3GHYA 1GPDG 1MKYA 2G4CA 2AE1A 4JP2A 3OPNA 4CLEA 1SBCA 5IVKA 4Q24A 4C30A 1J6UA 2TSYB 2PXCA 2FPOA 4LI0A 4S1WA 3CYFA 3PLRA 4QPDA 1K7FB 1XTJA 2JBWA 3MRTA 4DGQA 2FN9A 3OIVA 1E9AA 5CVJA 4IJ6A 3S1SA 4S3MA 2Y1XA 1WCXA 4E88A 2O6HA 3RSCA 1U3GA 2A33A 1K4KA 3KSUA 1XSEA 1USGA 4RLFA 4FR0A 4G5FA 1OLXB 1QB8A 3WSWA 4OHPA 2QJFA 1G60A 3DBLA 2JEZA 3GJRA 3ETNA 1Q7RA 4MGEA 5EHZA 1C1DB 2IEDA 5EMHA 1LH0A 1UBJS 3MLBA 4P9NA 4MPRA 3MWDB 2BFMA 3ZCUA 5BSUA 1EEHA 3NANA 1GQQA 4QLAA 4RWZA 3CNHA 4C07A 4XEHA 2J5BA 4B4UA 3WJAA 2F90A 3SQWA 1H6BA 1KPGA 4YAWA 2C99A 2G5PA 3IP3A 1J8YF 2QD1A 3PHBE 4M1ZA 1LKZA 3IEIA 5EWLA 4C01A 3Q8LA 1J4AA 1RQGA 2YZ7A 3CWZA 2IH5A 3AXSA 4PS0A 3FTEA 1KJJA 2CT8A 2GA8A 3NTUA 4PC1A 1EX9A 4MGHA 3C6KA 2A4KA 5AUQA 3SJZA 4DHWA 1DQRA 1DEXA 2QM0A 1P75A 4IHJA 2AI2A 2Q4RA 4BP1A 3L92A 4C0JA 1KH2A 2JLBA 4ZVSA 3BH7A 3BKXA 4G8JA 1G1MA 3I9FA 5EJ4A 1QHHA 4IKOA 4PYNA 3E03A 5TPWA 4TWRA 1K97A 1QGOA 2BGRA 2F3UA 3E8XA 1XEAA 2YFKA 1R8SA 4R01A 4DPLA 3RREA 2P7IA 4CE6A 4TKUA 1QIIA 3DZCA 4IOKA 5AICA 1TQ2A 4GSLA 3LPLA 2XBMA 4FI3F 1DC5A 4PPGA 4WZBA 2F1OA 2X8AA 1K7XB 2H2IA 2CZQA 1B00A 1Z4NA 3DKKA 3PSAA 3ROTA 3OETA 1I3CA 1N2JA 1U8YA 1H2EA 4GOJA 3DKIA 3PP8A 4M1YA 3MJDA 5DCYA 4EB0A 5LZ9A 3WISA 2ANCA 1W6UA 3PXXA 1JA0A 4FMBB 2HJGA 2ZBVA 1POXA 4H4DA 4CCSA 1KIAA 3AUAA 1NW3A 1ZPDA 3QELB 4E6EA 4KO2S 4OXNA 4BMYA 1GTVA 3A9RA 3CLUD 1J1UA 4XXHA 4KIJA 1Q0UA 1SC1A 4LZZA 4DJDC 1TJ3A 5BWNA 4QU0A 2QJRA 1GZHB 2DR2A 1TZBA 1KHTA 3LHIA 3MJCA 4IOMA 1F0YA 1QH1A 4XWKA 3JAKA 7ABPA 1PQYA 2PKEA 3TOSA 2GZ2A 4EZBA 1E0DA 5HGJA 3PPYA 1GTG1 1DKPA 4URWR 1QHIA 2PRKA 2GT1A 3A04A 3OEEA 3R5XA 4DREA 3FGNA 4DL9A 4YRSA 1NBAA 3DT9A 1O03A 2JANA 1WNTA 1PG5A 5K3FA 3KTAB 4XQCA 1EFRD 4W5OA 4CEJB 3KQHA 5TPZD 1NHWA 3BF8A 2I7DA 4K6FA 5ESRA 3WLMA 4P83A 2AOUB 3MZ0A 3IPLA 4RV4A 3AGQA 4CETA 4M1TA 4MA0A 5BW6B 1N5RA 3K8ZA 3H19A 3TR6A 1LLCA 5FPYA 3JQ8A 5K9ZA 2DP4E 2G83A 2VNKA 1SCBA 2AFIE 1C4KA 1NP3A 4L9WA 1OXXK 3ROKA 5G3ZA 3A1TA 4F5EA 1JDNA 4LYJA 4C05A 4KV7A 1DPFA 1IDN1 2PA0A 3K30A 3F5MA 5T57A 3ZQJA 2CWDA 2ZR8A 3F4LA 4RHUA 1KEKA 4WBNA 3NHKA 1RLOA 4N6NA 4UEOA 4AY3A 1L9XA 3HB7A 4A15A 2FMKA 2UZ0A 2ZWOA 3LU1A 3NV9A 4MULA 3ZXUB 5JATA 1MD9A 5ALLA 3LW8A 1QVWA 5F7XA 2AEFA 1VPLA 2I8LA 2FZVA 2CXXA 2XXJA 2W2KA 5C7IO 2VPTA 4D5GA 2CB9A 2QYSA 4OREX 4JDUA 2IP2A 3VPDA 6GPBA 1J99A 4B17A 1TTHA 2RB5A 2QZSA 2YZGA 3PNMA 3V8BA 1Y6RA 4JJAA 1XCPA 5K05A 2Q45A 1VPVA 3KUDA 4DT1B 1A9ZA 4IVQA 1JUDA 2EERA 3P0EA 2HEIA 3SS9X 1Q0PA 1V5WA 4UZFA 4MICA 3TMKA 2PX8A 3VV3A 3MINB 5A4IS 1JBEA 1KZGB 1T15A 3I2KA 1RBYA 4QOSA 5HCIA 2YR0A 1N6PA 4C03A 3RD5A 4EVRA 1VA4A 2PT9A 2HRCA 2OKGA 3LECA 4KCGA 1PBTA 1ZY2A 3M1YA 3PQEA 3ROQA 4EMTA 2F55A 1JEOA 4DLUA 1JG3A 4IZIA 3K70D 1GEGA 2FX5A 3QXCA 4ZVMA 1FTNA 2H5EA 1UPUA 4MI9A 4ZVOA 3E3NA 1ZD3A 2YY6A 3DDNA 3Q7QA 5TNXA 4F3RA 4LG1A 4OP1A 1WL8A 3TS1A 5FPQA 3U1TA 3ZBUA 2R6R1 2DR3A 2ECOA 4MWGA 1GA6A 1WMDA 3CW9A 3H0KA 4FDMA 4G1FA 5B4TA 2OOSA 4GKVA 1PW5A 5KNDD 4LZAA 3LDFA 3PVSA 1QQAA 3GUZA 1C80A 4LY9A 3CBQA 4TYPA 4ZREA 4EUSA 5LWHA 1X1CA 5AWFC 3BDAA 3HYSA 3S2IA 3SHVA 3G0OA 2FRXA 4R2WA 2O7VA 2GPWA 3AKYA 1YACA 4H2DA 1E5DA 1CX9B 1YZYA 3EGCA 5LQKA 3DDOA 3H7AA 2E6KA 1LLUA 2WFLB 2XMDA 4HGOA 4DNPA 5IEJA 1M1YB 3EW7A 6LDHA 3R9XA 1YIOA 3ABZA 1K92A 2ODAA 3R0QA 4E4RA 4N9QA 5CBPB 3ORSA 5JLJA 3R7WA 2R8BA 2ZI4A 4MS1B 3BN3A 4C0HA 4OQZA 4O3MA 3A4NA 2OY0A 4JK3A 4Q1EA 1IBSA 2FKNA 3PE6A 2A5YB 3RK0A 5JAOA 5KDOA 3WFIA 4FXPA 4RVCA 3C7CB 4ZYVA 2ZS7A 2B7BA 2J45A 3G2QA 3NAGA 2BSXA 4H59A