2BMJA

Gtpase like domain of centaurin gamma 1 (human)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
176
structure length
174
Chain Sequence
MRSIPELRLGVLGDARSGKSSLIHRFLTGSYQVLEKTESEQYKKEMLVDGQTHLVLIREEAGAPDAKFSGWADAVIFVFSLEDENSFQAVSRLHGQLSSLRGRGGLALALVGTQDRISASSPRVVGDARARALCADMKRCSYYETCATYGLNVDRVFQEVAQKVVTLRKQQQLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Centaurin Gamma-1 Gtpase-Like Domain Functions as an Ntpase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords CENTAURIN GAMMA 1
total genus 62
structure length 174
sequence length 176
ec nomenclature
pdb deposition date 2005-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2bmjA00
5B2ZA 1UKZA 1W36C 4UJ5A 3S1AA 1XZQA 2ORWA 4A0HA 1OB5A 3AVUA 1UEIA 3PUWA 5HZHA 2ZRIA 1KK1A 2CNWA 4B3BA 1CR1A 3AKYA 1CS4C 4X8OA 5DGXA 3VU9B 4WZ6A 4B3DA 3K70D 3EIEA 3SU8A 2P65A 1YKSA 2O8EA 2A5YB 3KB2A 4J0QA 2FZLA 1HURA 2ZYWX 1CR0A 1E32A 3I1FA 1U90A 3H4MA 1JJVA 1TF2A 1G17A 2FSGA 3CNLA 3KX2A 3GJ6A 2ZRAA 5F2EA 1Z0AA 5G53C 3RAPR 3IQWA 2GVZC 1G5TA 5M04A 3MRSA 1MH1A 1XXHA 5BWMA 3K70C 4NYIQ 1ELOA 1VHTA 4PZLA 3RRNA 4QBFA 2D74A 2MSDB 4AIIA 1ZIPA 2V7QD 1FMLA 3OFNA 4HAUA 2F3TA 3F3YA 4KHZA 1AM4D 4HAXA 4BLSA 4C4PA 3HU3A 5TY0A 4YXWD 3KXLA 1KK2A 1NIJA 3U6BA 4IEEA 1OH7A 4CEIA 4KITB 1JQJC 1BYIA 5KSPA 1TL7C 2GTPA 1GL9B 3AQ4A 2PH1A 4EJSA 4B75A 3BD9A 1ZM7A 4IOJA 5P21A 4US2R 2V9PA 2VHJA 4JYCA 4E09A 1ZNXA 2DWPA 4MA4A 3SYNA 4BWYA 1W4BA 1Z6GA 3NVAA 1YZNA 4JMPA 2HYIC 1ZIOA 5FOSA 4B35A 1W0KD 5J47A 1CF4A 2QGNA 3IPXA 4P33A 4XWAA 3IUYA 1ZCBA 1YZQA 2I4IA 1KI7A 2KE5A 1XNJA 3B7GA 1NVWQ 4XTRA 2ATVA 3KKNA 4YMWA 1DAEA 5DHFA 4AKEA 2B21A 3BXZA 3CONA 4EJSC 2WJGA 1SVOA 3T35A 2X8AA 4JL8A 3AF0A 1XB2A 5HPYB 3EZ6A 3T1OA 5HR5A 3KQUA 5CLQA 3Q85A 1JEDA 1Z6AA 2LKDA 4A0GA 2XTNA 5G40A 1XCPA 3M6AA 4Q7MB 4PPNA 2OFWA 4WXRA 1GILA 3X2SA 1NJFA 1ZCAA 2R6FA 4JL5A 4MGYR 3VQTA 3B6EA 4JYBA 3NIBA 2J7PA 3HU2A 1P3JA 2WWFA 2HCJB 4G5OA 3IO3A 4H9GA 1CJMA 1A4RA 2YZ2A 3LW8A 2ZYUX 1U81A 1RRPA 1N6PA 3EA5A 3CR8A 4URZR 3K8YA 2VP9A 2AXNA 4KAXA 4Q1DA 4RSGA 1SGWA 1OXUA 1QHXA 3B9PA 3KXKA 2G3YA 1KYIA 2XEXA 1F6BA 1NY5A 4JIMA 3HYTA 2W83A 3HPQA 2ORVA 1RJ9B 2H16A 2ZRPA 3KUCA 1ZD1A 1D6JA 3PEYA 4OQNA 3A1TA 4U02A 3AEZA 5SZJA 5C46F 3SBEA 3K9NA 4TMWA 2IW3A 3AP2A 1E2MA 1ONBA 1BYUA 5FUVA 1T4GA 1XCGB 2AKYA 3WMGA 4EKDA 5BN4A 4PQFA 1P75A 4OHZA 4AG5A 4Y0VA 1U0JA 1DARA 2BBOA 2FZ4A 3RANA 1IN7A 4BLQA 3I5XA 3SN6A 4A92A 2RGEA 4QFMA 1RJ9A 2QU8A 4YQFA 1OV4A 1W36B 1AS0A 1QZXA 2G88A 3CF6R 5KTYA 4PC2A 1QHGA 2VA8A 4QHYA 2B92A 2NO7A 5KNBA 1LF5A 4CYMA 3A4MA 3GLHB 4A82A 1Q12A 2DPXA 4KJZA 1G3IA 1NSTA 2ZYVX 1SVWA 4JZKA 1Z07A 1SZPA 4OI4A 4JVLA 4KVGA 2P67A 5SZHB 1G1MA 5LD2B 3AH8A 4LGMA 3WP0A 4DCSA 3QF4B 1RFLA 1P7CA 2OO7A 4L8GA 3EPLA 2VO1A 2AWOA 2ZRMA 5CYOA 2QT0A 3BERA 4HAZA 1Q22A 3CRMA 3FE2A 4V0MA 5CITA 3K09A 2GRJA 2WBLC 4B48A 2CCGA 3O8RA 3IBGA 5EZ5A 5KSZA 2XXAB 1X8KA 4C0LA 1CR4A 4UXHA 1SULA 1W2HA 3NBXX 3OE7D 5F98A 1E2LA 2FFBA 3UXMA 2A30A 2J46A 2D06A 2CCKA 3BC1A 3BB3A 2GHIA 2DFKB 1KMQA 2P2LA 5E7JA 5GVRA 2A5GA 2ZU0C 2ZSEA 1X1RA 2VTKA 2OFOA 2WAXA 2YINC 1ZM4A 3KB1A 3KJGA 3FWYA 4QNRA 2QRZA 2EVWX 4YLGA 3SJCA 3SZRA 3BFVA 4ESVA 1NN0A 1IY1A 1XBTA 2WWGA 4N1AA 1KDOA 5D3QA 3VKWA 1JXMA 3EWSA 3EZFA 4TLEA 3W9YA 3V9PA 2IYLD 3GLFE 1NG1A 3IHWA 2CE2X 5JCPA 1VG1A 4HEJA 1R0WA 3Q72A 1N3BA 4DLSA 1R6BX 4RJLA 1W2GA 4M0LA 1AK2A 4EJSB 4QHTA 1AGPA 4TL9A 2DCUA 4WZAE 3Q3JB 2DYKA 1V43A 3B78A 4AG6A 2EYQA 4LHYA 1G3MA 1R0ZA 4PSAA 3SHFA 3EPHA 4OQMA 4YMTA 1WBBA 3TGPA 4F92B 3CNOA 1JQLB 2GAAA 4DLVA 4XWOA 3QI2A 1G19A 4Q21A 4LBZA 4TLAA 1RRFA 3CW2A 4JLMA 1KO1A 1ZUHA 4O0MA 4TMZA 1P4SA 2W6ID 1S1CA 3PXGA 4UXJA 2BMDA 2RHMA 5JZVA 3CPEA 1OPXA 2QMUA 3FMFA 2YVUA 2GK7A 4LBVA 3DMDA 2ERXA 4Q47A 3KZ1E 1T3LA 2IS4A 4FN5A 4PC6A 4UNSA 4EIWA 2BMJA 1VMAA 2CNWD 1SXJB 1N0VC 2VRWA 4BFSA 4C0BA 2O8FA 4R71A 4PQRA 1R0YA 1Y63A 3OEED 4U7DA 5L3QB 3CX6A 2DHRA 3LBNA 2C98A 4LJ7A 2UVQA 3REFA 3C14C 3NTUA 5AJXA 1TUEA 1XXHB 4ACBA 3AF2A 3ECCA 3L2OB 4ZDWA 4BEBA 3QE0A 3TW8B 1XPUA 2ZQ5A 2RGGA 5JS7A 2GVDC 3BOSA 1MABA 3N2IA 3OEHA 2R8RA 3CO5A 4PPFA 2DWQA 2G6BA 4UNQA 2WJYA 1QHNA 3GMTA 4A0FA 5FUXA 4DJTA 2ZE6A 2J5XA 3A6PC 2AD5A 5FL3A 4B74A 5JBQA 3KDSE 3I62A 4PAMA 1YZKA 4M1MA 1XMJA 3T5DA 1ZUNB 2C2HA 2EFEB 2IWRA 4U5XA 1R0XA 1S3GA 4ASUD 3DO6A 4A4DA 2ZI9A 3ZZ0A 5KO2A 2HDNB 3VR5A 2P0EA 5LD2C 3Q5DA 4BZPA 2O5VA 2ZRLA 1OLOA 2C9OA 5JI2E 2YWHA 5IRCD 1JR3A 4QOSA 1T3SA 3H86A 5FBLB 4IKEA 1BMFD 1TU4A 1LB1B 3EPJA 1XTQA 4ACAA 4AKIA 1VCMA 3GLHA 2IUTA 1N5JA 2R6AA 5H68A 4LYHA 4C9BA 4XSGA 2GCPA 1CJKC 4HUTA 1Z29A 5KU1A 3ICQB 4QRHA 3I5YA 3K0AB 2G0NA 4ITRC 3TJZA 2VSXA 2XZLA 1G6HA 3CF2A 1DO2A 1M7BA 4NCHA 4D4KA 5KPDA 4KCGA 4UJ3A 5C18A 3FHCB 3TIFA 1AN0A 4B3GA 1ZNZA 1UKYA 3ZYCA 1GSIA 3C5CA 4UNPA 2BDTA 2BC9A 4IXMA 4LX0A 2GCOB 3W6OA 4L16A 1NI3A 4M1TA 1KDPA 4BGDA 4PO8A 4Q4HB 2XZOA 2ZE5A 1OXSC 3DKVA 2PMKA 1ZC4A 2J87A 1VYTA 3LNCA 4CT5A 3AB3A 1X6VA 1BO6A 3AKEA 1Y3AA 2DBYA 2YNMA 2C77A 3I3SR 3TUIC 5J4YA 1BS1A 1T6NA 2QY9A 2JASA 1P9RA 2WMNB 2FEOA 2YV5A 3I72A 1EFRD 3NC1C 3ASZA 4TTQA 4XD7A 5C4GB 5BQ5A 3VMFA 1W48A 3I73A 3K0SA 2QM7A 4FXPA 1OSNA 5A5GA 1N0WA 3IPYA 3A58B 1T8UA 4C2UA 4DEYA 3IO5A 3GLGE 2D2FA 3EAQA 4KFSA 4B47A 2PL3A 2FG5A 2NPIA 2ZRDA 1J7KA 3THOA 2OXRA 2A5JA 4RFSA 1Z6XA 4TN1A 4URVR 5JLJA 3IDQA 4CGZA 4FIDA 2OLJA 4FMDF 2HYDA 4LC1A 1KI1A 4HYYA 1Z6YA 5FPYA 4Q4JB 2G1JA 2PZGA 2QT1A 4QXAA 1QG4A 2QM8A 2UZ3A 2O8CB 1KHTA 1XJQA 4TT3A 2OHFA 1KOFA 1E9CA 1QDEA 1YE8A 1HE8B 4PC7A 2ZRCA 4YMUA 2FSHA 3OF5A 3RS4A 3CUEF 3VX4A 5DO9A 1SXJC 1E2QA 3ZDQA 4AY2A 3AF1A 3UIEA 3CKLA 3PUZA 4Q1AA 4Q9HA 3EW9A 2ZXUA 1VG0B 2QUZA 4FMCB 2JJ1D 2QNRA 1U99A 2VYFA 4Q02A 4YDSA 2D2EA 4C0QC 4JLAA 3HWSA 4GMXA 4LPKA 4PZZA 3QG5A 4ZV4A 4LC0A 1U8AA 2ZU6A 5FR2A 1W4CA 2VP2A 2HJVA 4ESHA 3EA0A 4DSOA 5K8UA 2G0TA 1C4OA 4XVQA 2ZI6A 2Q21A 1WMSA 4C2TA 3LBHA 3Q5EA 3QIAA 2NO9A 2MMGA 1XD2A 1GKUB 3MAAC 1NF3A 4NTZA 1E9RA 1OKKA 5AJZA 1IJEA 3UWKA 1Z5ZA 1MABB 1X3SA 2VBCA 4ZPXA 3LWNA 4B2PA 3LV8A 3ZD7A 2MSEB 3B2EA 1J70A 2IS6A 721PA 3FGNA 1XMIA 5KSOA 2HLDD 1T3HA 2NZ8A 1VYUA 4ZI3A 4CIDA 4MH0R 2J45A 5C4MA 2IYSA 3QPUA 1E69A 2RAPA 2ONJA 3N70A 1N25A 4P31A 1TADA 2E87A 2GF9A 2JLSA 2BMEA 1LNZA 1TQDA 1VCNA 2C04A 2XTZA 3EC1A 3FMIA 4CT4B 2ZANA 1OHHD 1IOZA 2R9VA 2ZVQX 4RD6A 4V03A 4UNNA 1C9KA 4XVRA 4WOPA 4I1UA 5H1YA 3A8TA 2GEUA 5DE3A 5AUQA 3T1VA 4C0JA 1N0UA 1YHNA 4PAOA 1BKDR 1KKMA 1NRJB 1JXOA 2ODBA 2QSYA 3B13B 1ZD9A 2Q3MA 2VSOA 4LBWA 1RIFA 4EUNA 1W7AA 3U5ZB 2CLCX 1NN5A 2ZI4A 2OZEA 4P3YA 5HCIA 3LVQE 3TBKA 3CRW1 2WJVA 1NL3A 2JJ2A 3TVDA 1RW4A 1EX7A 2CVHA 2OG2A 1TX4B 4KBFA 2WPDD 4TLDA 4JVNA 2VF8A 5LB2A 1SXJD 3QKUA 1IXSB 4XVUA 1TNDA 2UZIR 3VFDA 5EJEA 1Z2CA 1K6MA 2A7QA 1Z08A 3JZAA 1GUAA 3SC3A 4EPYA 4DLUA 1G7SA 3HR7A 3TSWA 5DISB 4DCTA 1CJTC 4JL6A 2FOLA 1UADA 2NGRA 3VKGA 4D4LA 1XTSA 4GRAA 4ZKEA 1II9A 5EUQB 2VLIA 1HT2E 1NN3A 3LQQA 3EZ9A 1IY0A 1KY2A 2V55B 4GPTA 2GWHA 3RS5A 3GPLA 1XEFA 2JIZD 4TYNA 3ADDA 4Q9KA 2IK8A 5BW8A 1OXVA 1XZPA 1VKJA 3LDAA 3QKSA 3UMRA 3W34A 1XRJA 2FMXA 3NKVA 3AKDA 3LAWA 3GJ0A 1ZBDA 4MKHA 2DWOA 2PBRA 3RDPA 3W5IA 2ZI3A 1IAQA 2BEJA 3IBYA 2Z5FA 2YC4C 4NYJQ 5BN3A 2ZAOA 1GVNB 4HB2A 2GXAA 5JSZB 3KKQA 4XTCS 4PR0A 5TXGA 1IM2A 3L0OA 2ZI7A 4B44A 2WWXA 5AUOB 5CM9C 1TF5A 1R4AA 4DLZA 1AKEA 2VPPA 2EWVA 1T5IA 3EARA 2NTYC 3PFIA 2KI5A 4A8JA 2ZS9A 3K0AA 5JSZA 2DFTA 3FMPB 1G3RA 3BH6A 1OIXA 3NG1A 2BM1A 2WZQA 4N0DA 1IN4A 4GOXA 3KQLA 3A4LA 2Z6VA 2GXSA 2ZE8A 4KO8A 1VECA 4WVFA 4M1WA 1QG2A 2CMKA 3C8UA 1NMZA 2O8BA 3N2EA 4QHSA 5KNCA 2R62A 2J7PD 1G21E 4L9WA 4QBIA 4D25A 1SHZA 4LV8B 1ZM9A 4PHGA 4BRUA 1LTQA 3CZPA 3IIJA 5LBIA 2P6RA 1KO7A 4OK3A 4DWJA 5DN6D 4PXAA 4HB0A 1JNYA 1UKVY 1G8PA 3GD7A 1A5TA 1EFTA 5AJWA 4LI0A 4TMTA 1DVRA 3MFYA 2YWFA 3P26A 3PG5A 4PFSA 2GJ8A 4URWR 1G4AE 4IOMA 2QG6A 1E3MA 2BEKA 4I4LA 3THWB 1KAOA 1KAGA 1L2TA 2F43A 2GF0A 3P27A 4JKYA 1RRCA 4NCJA 4TSFD 3UANA 2Z4SA 4ABYA 1QHYA 2O0HA 1W36D 2FU5C 2QBYB 4QM7A 2ZR0A 2A5FA 3AVOA 4CEIB 5FOTA 5K8TA 4HLDA 2ZRHA 3O8BA 2IUUA 1C1YA 2QEQA 2ZREA 3T1QA 2ZITA 4KFRA 3MWJA 5JJIA 4C30A 2VF7A 3FTQA 3THWA 3TUJC 2JLZA 3L0PA 2TMKA 1ZVQA 3PVSA 4POAA 2AKAB 2GXQA 2J9RA 4TYYA 4WIAA 1AQUA 2PX0A 4A2WA 3NEJA 3WHLA 3EXAA 4MRVA 5KUTA 3QBVA 1FNNA 2VP5A 3W6PA 3H1TA 2O8FB 4QL3A 2BBWA 4B3FX 4F38A 2JLXA 2QENA 1N6NA 5CYPA 1GFIA 2HCBA 1N6HA 2BHRA 2IS2A 3ETLA 3SHWA 1I2MA 4R9UC 1IN5A 1EX6A 5J4VA 2F1RA 3Q7QA 1YJ5A 2JLRA 3PQCA 4DXAA 3P4YA 2QAGA 3DPUA 1KDRA 4DSUA 2V54A 4O3MA 3KKMA 2ZR7A 4NBSA 3SQXA 4YC7A 3EZ2A 1U8YA 821PA 3SEAA 1MV5A 1GL7A 1JEEA 1G8FA 2NIPA 4BFXA 3R7WB 4M1OA 1OIVA 3PUYA 4GOKA 4O25A 4BQSA 3I32A 3KFVA 3PUVA 1AS2A 2ZSFA 3SJAA 5F9FA 3C5HA 2JCSA 1S2MA 1T0JB 2QORA 2PZEA 3LXRA 4YDHB 1GOTA 3TSZA 2IC5A 2FF7A 5AR1A 3CM0A 1CRQA 3V00A 5FBRB 1ETUA 3IHLA 1N2CE 2W0MA 1G8YA 1W0KA 2OM2A 1W49A 4LYJA 3U60B 2H92A 4CEJB 3SNHA 4CZ2A 2IYZA 3B1ZA 4NKRA 4BASA 4WZBE 3KQKA 1NLFA 1M7GA 1MO4A 4P4UA 4DB4A 4OKSA 4F4JA 1A2KC 1D9XA 2WOOA 3R9XA 3BRWD 3MMPA 1DEKA 2PJZA 3K09C 1PVOA 2IYVA 5CJPA 1ZNWA 4ZIRA 1Z63A 1KJZA 2FNAA 1E9EA 1ZMXA 3WMFA 3AVTA 4NDZA 2XB2A 4OK5A 1FPMA 2X1VA 3NBZC 1AS3A 1KI2A 4FWTA 1CIPA 2O0KA 3CPJB 4DDVA 2RH5A 1SQ5A 1W4AA 1G8HA 1FTNA 1RPZA 1Z28A 2ZVPX 2WSSA 4YMSA 5J5CA 2Q0HA 2OESA 2E1RA 2QE7D 5AWFC 1E2JA 4W5WA 2KWIA 4FMDB 5A4JA 2CHQA 2XGJA 2HEIA 2K5UA 2XSZA 1E2IA 2B7CA 3QOFA 3U61B 3AVPA 1DBSA 1MT0A 3BORA 1RKBA 1JALA 4B34A 3WBJA 3I61A 2XJ4A 3TQCA 2L0XA 4X8MA 3AVYA 3T5GA 4X8HA 4PQYA 2JDIA 3WXMA 3G0HA 2VHTA 5JRZA 2QAGC 1FFHA 3AUXA 3OAAA 3OEEA 2G9NA 5AJYA 2GK6A 4DSNA 2XXAA 3KKOA 4YONB 1X1SA 4QJ4A 1G3QA 3DKPA 4R2HA 5EP2A 4ZCMA 1OH5A 4DC9A 1JJ7A 1NY6A 2H18A 4PO1A 3UATA 2IA5A 1KO8A 2KBEA 4KV9A 3CB4A 5JJLA 2J41A 3AVXA 1HH4A 3UKDA 5GJVC 4EQ6B 4Q7LA 1HV8A 1NBME 2GXUA 3NH6A 5CM8B 4FINA 4JLPA 2V3CC 1UAAA 4CVNA 5SZKB 3PEVA 1E9SA 5EXSA 1GM5A 3KQHA 1A1VA 1CJUC 2FJUA 2XJ9A 2OLKA 4GL2A 4HLUA 4X8LA 2G77B 3K0CA 3F0TA 4NYMR 2CHGA 1AZSC 4G01B 1LW7A 1FOEB 5FPHA 1OE0A 4D80A 2ZM5A 4B3CA 1N5IA 1KDTA 1LF0A 1UKEA 3IGFA 3QPVA 3THYA 3WY9A 3LD9A 2RGAA 1P2UA 3AKCA 4W7SA 3PITA 2AD1A 2BKUA 1HEIA 4BLTA 1R8SA 2QZ4A 2ZSDA 1DAKA 4F91B 2VEDA 3LFUA 5IT5A 3OIVA 1UBEA 3B85A 3BH7A 5FUWA 2EFCB 4BZXA 5D3MB 2ZJOA 4XOIA 1K5DA 3VR1A 2ODWA 1NG9A 4NONA 4OI1A 1G64A 1J8YF 2JGNA 1P73A 3HPRA 4QG7A 3AF4A 1R2QA 3FMOB 3T12A 2OILA 4DRZA 1QBKC 4RD3A 3OIUA 3C4JA 4Q4AA 1WP9A 3UK6A 3REGA 4MYTA 1GKIA 4Q19A 2AFHE 3GEHA 4HB4A 3B8HA 5CJ2A 4K81B 3GP8A 3GLFB 3HJNA 4OI0A 3GEIA 2YJTD 2WKPA 4EPRA 3G5UA 4ZDIA 2AK2A 4RCZA 2RGDA 4KYUA 4P4SA 2GJ9A 3R20A 4NYJR 1KKLA 4BLOA 4IXNA 3RSLA 2W2TA 4ZKDA 5J4HA 2YHSA 4RD2A 3TE6A 3TW4A 4EDHA 5B30A 2ODNA 2F43B 3DDCA 4QKQA 4Q4AB 1VG8A 3RWOA 3T15A 1ZU5A 1S9HA 3OIWA 3P32A 1UJ2A 3QBTA 4WA7A 2P5SA 4BECA 5A0FA 1WRBA 3PJRA 2OCAA 1EFRA 1ZYUA 1H8EA 4LV6A 4OI2A 4E5UA 2EFHB 2OCBA 2RMKA 4BRWA 3CX8A 2J0VA 2GJAA 3PUXA 4HI0E 3R9IA 3QF7A 5EE3A 1NLZA 3VR6A 1FW6A 2REBA 1F2TB 3TR5A 4B32A 1E0AA 4CEJA 4DEXA 3NEYA 2DFLA 3PR1A 3MJHA 1LY1A 3ZH9B 3G82C 4G1UC 2REOA 4NZYA 2IYYA 4NCNA 1GG2A 5E7MA 5L3VA 2YOGA 2IYQA 1E98A 1CR2A 4EPWA 8OHMA 3HP1A 1T8TA 4LJ8A 4I1VA 3CR7A 4PC1A 4AD8A 5KDOA 5FPTA 1TTTA 4GBMA 2QN6A 4BE7B 2FDCA 4D0LB 1ZD8A 3SE0A 3EASA 1Q1QA 1P60A 2JJ8A 2X19A 4NYMQ 2XNDA 4M8NE 5IDVA 5LPNA 2OE2A 4FW9A 1WB9A 1R8QA 2QGZA 4OHVA 3QPWA 4U00A 2QAGB 1KSJA 2W6JD 1DE0A 1OFIA 1Q3TA 3IQXA 4HAWA 2J7KA 4S35A 2VP4A 5DI3B 4D2IA 3GJXC 1E0SA 3BH0A 4UQOA 1Z0FA 2CK3D 1R5BA 3JVUA 4M53A 1FQKA 1E9FA 4M9QA 1VDZA 5HE9A 4A15A 1JECA 4MDFA 1SKYB 2XTMA 4HZUA 2WSSD 4OL0A 2BVNA 4QM6A 3SDZA 4LZZA 1M1YE 4PHTA 2WM9B 4URUR 1MKYA 3FKSA 3EIHA 1OIWA 5DI3A 3QKSB 4NHOA 2R6DA 3RHFA 3WMEA 3QVUA 5JEEA 2PLRA 1E4VA 1H8HD 2CCJA 3KJEA 4C7OB 3DL0A 1CULC 3QY0A 421PA 2NO0A 1W44A 2OCPA 4FMCF 3GCGA 5FBVB 2JIZA 1XTKA 3R8CA 4IOLA 2Z83A 2OAQ1 4EQ6A 3QXXA 3AUYA 4GT1A 3WBKA 4QJ5A 3Q9LA 5FUYA 4L15A 2ZS7A 4P0TA 4A9AA 3U7FB 4Q00A 4DLTA 2JLYA 2IL1A 1XWIA 4MYHA 4IFEA 3FHOA 4KYIB 1M7HA 5BYJA 4NCKA 4NMMA 1RZ3A 1FUKA 4KI0A 3ZIAD 3BS4A 2WAYA 2J0QA 1UDXA 4Q4JA 4MGKR 2RGNA 4BLRA 1NBMD 2V7QA 3E2IA 1UEJA 1PUIA 3MLEA 4TWZA 4CEHA 4MKIA 1DG3A 4MYCA 1U2RA 1G6OA 2FPMA 2QTHA 2HXSA 1NVVQ 1GP2A 2ATXA 2LWIA 1LV7A 1MRNA 4JJKA 4DLRA 4EPVA 4A6XA 1E9AA 5LDDC 4V02A 3TH5A 2WPDA 5FPSA 1DOAA 1O3YA 1XMSA 3ASYA 4NP6A 3SJZA 1KTVA 1S96A 5L3QA 3GLIA 1CEEA 2IXGA 3EIQA 1AJEA 1VCIA 4TYWA 4F93B 2H1LA 1R10A 1B0UA 2ZRKA 3FYHA 3L8YA 5TV2A 1GRQA 4KLZA 2QTVB 3GFPA 2HT1A 1MO6A 4IW3B 3SJBA 4AYWA 5IK2A 2G83A 1M34E 1P5ZB 3LW7A 1EWRA 2GBLC 2Z43A 5BN5A 3FOZA 3B82A 4Q9JA 4RZ3A 1KY3A 2Q6TA 1JI0A 5DYIA 1MRSA 3D6TB 3ZGXA 3BWDD 2SHKA 3WNCA 3R8FA 3TNFA 3E70C 3O8CA 1KSHA 1OHHA 4Z8XA 3RRMA 3SI7A 4LHWA 1ODFA 2C03A 4HAYA 1N5LA 2QP4A 2RKOA 5FL7A 4DHEA 3M1IA 4LWZA 1SVMA 1SVIA 3K53A 4PAQA 4JKIA 1NMXA 3IIKA 3NC0C 4F4IA 3LH5A 3AM1A 3RYTC 2HUPA 4RKFA 1VIYA 2FA9A 2YYZA 1OW3B 3H84A 4KXFB 5JWOA 2BOVA 5GADl 4H1VA 4E03A 1Z22A 2WWIA 2ANCA 4ERNA 5EE1A 3OE7A 2P6UA 5CB8A 3ZVNA 3GJ3A 4MGIR 2AN9A 4HSEA 3ZQJA 4ZI2A 1S4QA 5B64A 4TMXA 4WBSA 5UKDA 1M6NA 4AK9A 1NP6A 3T06B 1SXJA 1T91A 4KFUA 4WAUA 3OEHD 3B1XA 5KSYA 1E1QD 3B60A 4V0OA 4LJAA 4PC3A 3LVRE 2Z0MA 4WW0A 3SR0A 1F3OA 1W47A 1P2VA 1EK0A 1OYYA 1Z0KA 2BCJQ 3AV0B 3T61A 4LRWA 1AKYA 1EFCA 2H8KA 1YRAA 2A2ZA 1E1RD 1XJ0A 4MRNA 3AVQA 2NG1A 4DUGD 2FGKA 1KI3A 2XSZD 3D7MA 4UKDA 2OEPA 1J2JA 5L3RA 5E3HA 4GMDA 1KK3A 2IBMA 1D9ZA 1GNPA 1Z83A 4M21A 4ARZB 1AGRA 2GJKA 3WNBA 2ZYTX 2BM0A 2G1KA 2ZJ2A 4XJXA 3ND9A 5GJBA 5G41A 4QGFA 4FCWA 1S8FA 2AK3A 2ZJAA 3C41J 4Q1EA 3TSOA 5HE8A 4B73A 4N3NA 4M9SA 4HZIA 4I99A 2GEVA 5FH9A 1PV4A 4MRSA 1YR7A 2NOAA 2JLQA 3UMSA 5DIFA 1GL6A 4ARZA 1GDDA 4TSFA 3TRFA 1H8HA 3QF4A 3CRQA 1G18A 1W5TA 1R5OA 5C2JB 5EXTA 2FEMA 2CL6X 2REXB 4PTLA 2QMEA 4M1KA 1LFDB 4OK6A 4Q4LA 4RD1A 2OV2A 1GWNA 4LHZA 4HUQB 4I1SA 3KFXA 3QSYA 3I8XA 3I8SA 4MRRA 5DSZA 4LYAA 4EFMA 4MYUA 1G9XA 1KSFX 4ON9A 3IEVA 4O2RA 1ZP6A 1X86B 3SS8A 1E0JA 3ZS8A 2JLVA 1SKQA 2AHOA 4LJ5A 2LCFA 2ZR9A 4MGZR 2OAP1 4AURA 1N5KA 2WJIA 4TQ9A 2N1BA 1NVUQ 1IN8A 2IYTA 4D4JA 4EAQA 3A1VA 2WKQA 3UMFA 2IX3A 4HDCA 4I81A 3SFVA 1P9WA 2Q3HA 3BGWA 4A8JB 3SYLA 4D81A 1XEWX 1NIPA 4QC2A 4JVSB 3CWZA 5HKKD 2IF0A 2H17A 2FPKA 2H5EA 1XXHE 2DB3A 2QP3A 3BK7A 4TMVA 4MITA 3BB1A 3HU1A 2VH5R 5CIQA 1EXMA 2FWRA 1BMFA 2O8BB 4E22A 2IEZA 3CF0A 2IXFA 4DLXA 1J8MF 2PLFA 2PT7A 2WWWA 4Z1MD 4TQAA 3NWJA 1AZTA 1U9IC 3MCAA 3ZD6A 2X77A 1P6XA 5E95A 2FFHA 5KYKA 2JA1A 2VHQA 4OQXA 1NN1A 3VX3A 1N6LA 1BOFA 3UPUA 2GILA 2EYUA 5TB5A 4C3ZA 1N6RA 2OBMA 4BFVA 3B1VA 3KJHA 1GITA 1AIPA 1HY3A 2BMFA 4DUGA 4OYHA 4HATA 5FPKA 1U98A 1X8LA 5H70A 4I1OA 2V6JA 1JAHA 3ZJYA 4MQBA 2W58A 4EFLA 4LDJA 5IF9A 4PANA 3QXCA 4DLYA 2H57A 5B58C 5FTKA 3NDPA 1KK0A 3K9LA 2B8WA 5EE5B 4OHYA 2HXYA 1KZGB 5FOWA 2I1QA 4TYQA 4GSYA 5FOXA 3FPAA 3LY5A 5KNDA 4XD7D 4QGAA 3VU9A 2Q9BA 1F48A 4Q1CA 4F4CA 3EX7C 5IHPA 1DG1G 1VTKA 4RZ2A 4KU4A 3FB4A 2NO1A 4AC9A 1P9NA 3DOFA 3B1WA 1BIFA 1OKKD 3UG7A 1E6CA 4KSCA 2V8OA 2WMOB 2JATA 1II8A 3OESA 3RLFA 2VIIA 3AGPA 5B57C 2IYXA 2XNDD 3NHAA 1E4YA 1Q20A 4QNMA 1W0JD 1FUUA 1SXJE 2ZUDA 1O87A 2W6IA 1D2EA 1KI8A 3J81k 2IXEA 4A6PA 1Z2AA 1YQTA 2ZRNA 4Q7JB 4V0KA 4GNKA 3GLGA 3D31A 1CTQA 4BEJA 2ZROA 1II8B 3W6NA 2A9KA 1E2KA 1L7VC 3M4YA 4TZ0A 4JS0A 5EZ6B 3R7WA 1F2TA 2HF8A 1ZRHA 1D8TA 2BIFA 2AL7A 1N6OA 4V0NA 1HT1E 4A2QA 4GP7A 1IXRC 5HCNA 1IBRA 4IDHA 3W90A 3QUSA 4ZDJA 1UF9A 3DVLA 1E2PA 2WSMA 2ZETA 1NKSA 4XWKA 1SHKA 3GQBA 2C9CA 2CL0X 1XPOA 1KI6A 1S0UA 2F7SA 2ZI5A 5DLQC 2BV3A 1OF1A 2C8VA 3N5CA 2FFQA 5EXXA 5KDLA 5KDDA 4Z1MA 4IDOA 2QTFA 1E2EA 1EFUA 1R5NA 1RRGA 1T0HB 2CL7X 2YOHA 3W8NA 4EFNA 3U4QB 3SQWA 4JLNA 1WF3A 4BLPA 1K5GA 1DAGA 1TUIA 3M0EA 1R7RA 2IYUA 2ZPTX 2Q3FA 3LX5A 4LV5B 1RYFA 2QSZA 4CDGA 2WIBA 1FQJA 2RGBA 4EPTA 4W9MC 4OBEA 1Q3HA 1Q21A 4LY6A 3VTKA 4A8JC 4EPXA 1FP7A 1IN6A 1ZM2A 3TK1A 1QF9A 5DYGA 1F60A 2ZJBA 2EFGA 2QA5A 2X2EA 4N0EA 4BUJA 3U6KA 1SVSA 3LLMA 3OAAD 3TMKA 4JBWA 2V1UA 2W6JA 1XU4A 1AQYA 3WRXC 2VP0A 5HTKA 1E1QA 1OH8A 2Z4RA 4E07A 1I4TD 1Q0UA 1FX0A 3QKTA 3ZVLA 5CK4A 4ZCIA 3QVVA 1KO4A 1HTWA 1L4UA 3NXSA 3ZLJA 2HJGA 3PEUA 1U8ZA 2WJHA 3A4NA 1GZSA 2EW1A 1G8GA 5FOVA 1WA5A 3WYAA 3OIYA 4GOJA 2QQ0A 3U3RA 4CW7A 3JVVA 5JWRA 4QBHA 4LJ6A 1E96A 3RVBA 1ESMA 5AUPB 2W2XA 2VQSA 2C78A 2GCOA 2ZIAA 4YXWA 4G5GA 4D4MA 2WWYA 3GJ8A 2ZJ5A 1VIAA 2BKEA 4FMBB 4IDPA 1U0LA 4UNRA 5FI0B 1EGAA 1EESA 4LJYA 4BFYA 3KL4A 1V5WA 3GLHE 5CDFA 4Y0AA 1FNMA 1XF9A 3AGQA 4M1SA 5GJWC 4QGGA 4GZLA 2A3RA 1XPRA 3EZ7A 3V4RA 4G0NA 5JI3E 3ICEA 2H7VA 4B6EA 1Z0DA 4Q48A 1ZUIA 4JSTA 1FP6A 1TPZA 3RABA 1G20E 2OSBA 4PHFA 3WYFA 4LCBA 4W5HA 1QHIA 4CF7A 1GIAA 4LUCA 3W3ZB 3O8DA 4US0R 1E79A 2J3EA 3MWKA 3T1TA 3U3KA 4RFSB 2PMDA 3GFOA 2ZSBA 4TTRA 2IYWA 2XZPA 2N42A 3UWOA 1NBMA 1UBCA 3BBPA 2PCLA 2D62A 2A78A 4TLBA 3X1XA 2VP6A 1E2GA 1QHHA 4GFDA 4RKEA 1EWQA 2GJSA 3NHBA 3VHXA 4DVGA 3VKHA 3A1SA 1DAHA 3QNUA 4Q01A 1HQYE 5EE9A 2D7CA 4DZZA 4LJ9A 4LHVA 1SVKA 4OJQA 4OQFA 4B33A 1T9HA 2ZJYA 2CHVA 5EP1A 4PO9A 1JR3D 5CK5A 2I1VB 3CWQA 3DOEA 1II0A 5TARA 4URYR 1M74A 3LBIA 4ZDKA 3Q7PA 1KJYA 1HYQA 1QHHB 3TKLA 4NU0A 4ZO4A 4LPSA 1WXQA 3A1WA 5F3WB 2CEAA 2F3RA 3QEOA 3NBFA 1N6KA 4DKXA 4KVAA 3B1YA 4IFBA 4QBGB 1KMHB 4DCUA 5JFGA 3KQNA 2HT6A 1CBUA 4DLWA 5SZIA 5E7IA 2GNOA 3GLGB 4HLCA 1WE2A 1YZLA 1ANKA 3DMNA 2MMCA 3QXHA 3SYKA 1OFHA 1TQ4A 2ZUBA 3DHWC 3U7EB 2FSFA 2W00A 1IXZA 3TAUA 4B6FA 1EG7A 3C16C 3L0IB 621PA 1UBFA 4K46A 3ZQ6A 4C0AC 1Q1ZA 2YWGA 3CRVA 5CB6A 1G7TA 5G3ZA 4LK2A 1WQ1R 2AXPA 1DPFA 3VAAA 2C9YA 3F5FA 2NMVA 4D82A 4RZUA 3E1SA 4ZIRB 3K0CC 2KSQA 3TQFA 2PX3A 4FI3C 2EWWA 3THXB 5JHGB 2X2FA 1GTVA 3FDIA 4D0NA 1MO3A 1ZU4A 1LVGA 1P72A 1Z6TA 5TMPA 1I4DD 3MWLA 3U4QA 2GZHA 3RRYA 2CK3A 4NL4H 3RNLA 1OT3A 4XSHA 2BJWA 1GKYA 3DEFA 3KJIA 1E94E 1PLKA 3K9GA 2CBZA 1Z3IX 2F1JA 1CKEA 3QG1A 1XCMA 4OHWA 2PCJA 4MKGA 2AWNA 3THXA 3U2QA 2ZSAA 5EQTA 4HDQB 4M22A 1PLLA 3MWYW 4B43A 2QAJA 4B2IA 2HF9A 2F9MA 2PZFA 1D2NA 1GAJA 3RWMB 4JSYA 4D6PA 2OXCA 2R2AA 2P6NA 1CLUA 4HLQB 1L8QA 1PZNA 5ANRB 1FX0B 2V4ZA 2ECKA 1RVDA 3TR0A 2XNSA 5K8LA 5FTNA 2C96A 3H0KA 1YVDA 1J90A 4Z8YA 3DZ8A 1TQ2A 4V0LA 5F9HA 3U44B 1H8ED 2FE4A 1E2HA 3L43A 4IDQA 1OYWA 5DHAA 1WBDA 1JPNA 2OT3B 5FOUA 3RS2A 2RGNC 521PA 1Z0JA 4M4SA 3VR4A 5CLLA 1DO0A 4Z54A 1VHLA 1CJVC 1WDTA 2WIAA 3VHLB 4HAVA 1ZJ6A 4NCIA 4K8OA 1RYHA 4HUQA 5JCZA 1TQ6A 4PSVA 4Q1FA 1P61B 1M8PA 1WCV1 3DZDA 2F9LA 4IVRA 2ODEA 3GJ7A 3LRPA 2NPFA 1G5PA 2N46A 2R44A 1NJGA 2YOFA 3CPHA 4WXPA 3R9WA 3QQ5A 3VNVA 2RGXA 1KSGA 3NBYC 3TAHA 3AVWA 1XX6A 5DNYB 1X8JA 4JT4A 2P3SA 1KO5A 2NZJA 4FCTA 2CE7A 4KODA 3BB4A 4Q03A 4DDWA 3VNUA 2AFIE 3W8RA 1Q1BA 1NVVR 1KJWA 2W2VA 1CXZA 5JEDA 4JLDA 2GESA 4XIGS 5L8VA 1OFTA 3WRYC 1JR3E 4IJMA 1OB2A 2VSFA 5BXQC 2F1HA 2Q9CA 4JLBA 3C15C 1CP2A 3LQRA 1XEXB 4MRPA 3LA6A 2B6HA 5JWHA 1XMVA 4OQLA 2CDNA 3X1YA 4DDUA 1LS1A 4MKFA 3F8TA 4L9SA 2BCGY 4GP6A 4JLVA 4GDFA 1JR6A 3RC8A 5CDFE 1UPTA 1E79D 2J0SA 1YRBA 1DAIA 4A1FA 4BFZA 1NKTA 2O8EB 4F7WA 1PLJA 1YR6A 1E1RA 4G5QA 2J0UA 4Q4HA 1NSFA 1UDWA 1HQCA 1XEXA 1A82A 3P4XA 2FPLA 1HA3A 2DFNA 3GLIB 5EP3A 3PCRB 1W4RA 2OCYC 2RGCA 1DTSA 1M2OB 4C0HA 1J99A 221PA 2FH5B 2WHXA 4MUBA 4XH9B 4JLKA 3EG5A 1YZGA 4PPQA 1IONA 3ZVMA 1XD2B 1KMHA 1PJRA 2XB4A 2QP9X 4OJKA 4S2EA 1VCOA 2DR3A 1S3SA 3K1JA 2OFXA 3WNDA 1W5SA 1DAMA 5EE0A 5LB4A 2PJRA 4DB2A 1E99A 3HDTA 1JB1A 1G7CA 1TF7A 4FCVA 4B76A 2F55A 4HDOB 2YWEA 4JJZA 1OXXK 2J1LA 1L4YA 2CVFA 2ZE7A 1XTJA 1F2UB 2O52A 2O8CA 2ZJ8A 1E9DA 2JLUA 5FBWB 1UFQA 3CLVA 4ASUA 4A36A 3L0SA 5EP4A 4KLNA 5FTJA 2VL7A 4LHXA 2QBYA 3AF3A 2QRNA 1YZTA 2VHCA 1NMYA 2IWHA 2CXXA 3SFZA 2D4HA 1QVRA 4V0ME 4TL6A 1JAIA 4NE2A 3KUDA 1G291 5BYKA 4LYFA 1LS6A 3GEEA 4JLJA 5JRJA 1P2TA 1W46A 1DAFA 2ZUCA 2ERYA 3JZMA 2WTUA 1SKYE 4LSGA 1JPJA 1E2NA 2KBFA 3QXJA 2F1IA 3KTAA 4TLCA 2GETA 1NVXQ 1S1MA 5K8IA 4PX9A 1IHUA 3QKRB 1K8RA 1N6IA 1US8A 2ZEJA 3CH5A 2GA8A 3A1UA 4PSKA 4O2LA 4RD4A 5KPJA 2DY1A 2JJ2D 4BPBA 1KGDA 2GZAA 3U3JA 4US1R 3VR2A 4P4SB 4HZUB 5J4KA 2JJ1A 1Z06A 1Z0IA 4BFTA 2CLSA 2ZRBA 3KTAB 2ONKA 2O8DA 4JVMA 2HV8A 2WWHA 3P1JA 1Q57A 1BH2A 2J59A 2ZRFA 3PEWA 5GJCA 4TTPA 2ASEA 1US8B 2NO6A 2JLWA 1ZAKA 1NNEA 2P5TB 3EWAA 4DCNA 3IILA 4NPHA 4NYIR 4P32A 4L5BA 1ZINA 2IEYA 3PV0A 3L8ZA 2F6RA 1EFHA 4PPGA 4LJ4A 5GVSA 1KI6B 1QRAA 2EFDB 1G16A 1CU1A 3A36A 3GJ4A 5JECA 3I92A 2WVJA 3QJYA 4KBGA 4TZ6A 2WICA 3ZVRA 1FZQA 3SOPA 1OH6A 3MSXA 4JT2A 4IOKA 4B3XA 4YMVA 4G5RA 4PHHA 3U7HB 2A5DA 1H65A 2FV8A 3RS7A 3D3QA 1U94A 2FSIA 2JDID 5CIWA 2V1XA 5DN6A 1OJLA 5L3SA 1DELA 2QPAA 2CLDX 3DM9B 3S1AB 4GI7A 4M1YA 5KOYA 3A37A 5FTMA 2W0SA 5AUNB 2RHDA 4Q7KA 4Q66C 2EU8A 3IKJA 3H2YA 4TYPA 3IEUA 2GDJA 3K0EA 4A2PA 1E0KA 2C99A 2RB4A 3D8BA 1UM8A 5HKKA 3L82B 4DT1B 1G4UR 1HE1C 5IK2D 3FVQA 4RD0A 4Q1BA 3BAFA 1U9IA 2KB0A 2BBTA 4TL7A 2IUSA 3B9QA 3EPKA 1I4LD 2PEYA 2D7DA 4AI6A 2GZDA 1XEWY 2Y8EA 3CRRA 2C95A 3IIMA 1ZNYA 5G3YA 4B71A 1IQPA 4C0KA 2OUKA 3B5JA 4IVQA 1GRRA 2R6CA 1YR9A 1Z8FA 3ADKA 4DT1A 1KI4A 3E5HA 3HYRA 5DH9A 5FL7D 1F5NA 3C7KA 3T34A 3RS0A 3K9HA 3W3AA 3X1DA 3AVVA 3HR8A 2IHBA 2QE7A 4IVPA 2IF2A 3RC3A 4AWXA 4Q9IA 4Q9LA 2YC2C 4JBYA 4M9XA 1P62B 4IHQA 3U44A 3EC2A 1GRNA 3RRZA 1XD9A 1IJFA 4AYTA 4IEIA 121PA 5FR1A 4PZYA 5JHHB 3THYB 1KI9A 1XP8A 2PEZA 3U7GA 3LO5A 3V4FA 4RVCA 1MOZA 3U3OA 1G3UA 4W5JA 2WOJA 4A0RA 5FBQB 3ZZTA 2ZRGA 1E2FA 2JEOA 2R6GA 2V6IA 3TVTA 1VPLA 4JBXA 1ZC3A 1YU9A 5JMTA 3BE4A 2D3WA 4OHXA 5D3MA 4DIEA 5AJVB 3PIRA 3ADCA 1YZUA 4CEHB 4TL8A 1VYVA 3FKSD 3AP3A 3TUZC 3DM5A 1HUQA 1Q1EA 1E9BA 1OFUX 1YR8A 3ONWA 3RS3A 3ND8A 3OHMA 4HLUC 3FKQA 1COWD 3ZZUA 2QI9C 6Q21A 1A2BA 5TDHA 3W5JA 4Q18A 4R98A 4RCYA 3BFKA 4RZXA 3QENA 1DADA 2XITA 3SBDA 1IY2A 1W0JA 1RC8A 4NH0A 1XTIA 1SVLA 3X1ZA 3U3MA 1QVAA 2IHYA 4IRUB 3I4LA 3MD0A 3MGCA 4DSTA 1I2DA 1W1WA 3WYGA 2KJQA 2J0UB 2E9SA 3RSOA 3FFBA 4RY2A 3FHTA 3PENA 4II7A 3TLXA 1KNQA 3P20A 2GEDA 1D2MA 2GKSA 2YKGA 2XOKD 2NQ2C 2ORIA 4CRWB 1D5CA 2R65A 3CH4B 2FFAA 4JLOA 4QGHA 3ZS9A 2B7BA 2FN4A 4KSBA 5EXPA 1Q44A 4G3XA 5FI1B 3K70B 1GNRA 2GAOA 1ESNA 3MJRA 2XAUA 3QXSA 1MO5A 2O8DB 4BFUA 1TEVA 2GCNA 2IYRA 2WJJA 2ZAMA 1NLYA 3LX8A 4MUAA 2BWJA 3ZIAA 4QJ3A 5J4LA 5TVKA 1COWA 1XFAA 5EUMA 4BZQA 5HZKA 2ZS8A 4RFVA 4R2IA 3GLFA 1B23P 1TEXA 4AKGA 3KKPA 4UXIA 4M9ZA 1TU3A 1FMJA 3OZXA 4TT3D 4DIDA 4HB3A 5DI9A 5H8WA 5KHOC 1E2DA 3AP1A 3CNNA 2C5LA 1F2UA 2O0JA 3MG9A 3NH9A 4URXR 1VG9B 1DS6A 1ZM3A 1ZW6A 4DDTA 2GBLA 2IT1A 1TAGA 2QQEA 3O47A 2LKCA 3LXXA 3VR3A 4M2LA 1KNXA 5AK0A 3K0FB 4DBLC 2XOKA 1KIMA 2WKRA 1QHSA 3X1WA 1UBGA 3KXIA 5L3SB 3OFND 1XDBA 2AX4A 5ELXA 4P4TA 1XJCA 2QPOA 2VHUA 1Z47A 4C0SA 4FD2A 1G5RA 3MUFA 1JBKA 4D26A 3GFTA 1A7JA 2AR7A 5JJKA 3UG6A 1CRPA 3BIFA 4Z51A 1XD8A 3QKRA 2EQBA 2I3BA 2XX3A 3K0FA 3QEJA 4TMKA 3Q8XB 1G7RA 1RE0A 4AKHA 4ZCLA 4C7OA 2Q9AA 4LBYA 2UKDA 3WHKA 2OBLA 1PUJA 2QPTA 1MR3F 5E4FA 5JS8A 1GNQA 2FGJA 3GLIE 4D0GA 4FWIB 1S9DA 3BFXA 2MSCB 2PT5A 4G5SA 5C1BA 2IS1A 2HLDA 2BBSA 4IDNA 1FL9A 3CBQA 4DCVA 3CX7A 4R7ZA 2QL6A 2FX3A 2ZTSA 1OXTA 4B2LA 3CIOA 2BJVA 2OBNA 4AYXA 4L4UA 2CJWB 4TQUS 4LOAA 3ADBA 2B8TA 1AA9A 2JAQA 3NDBB 1T5LA 2WV9A 3CZQA 4H1UA 5FFMA 3BJIC 5J40A 4BFWA 3WP1B 3FFAA 1G41A 5FTLA 2ANBA 4KFTA 4MDEA 1FTSA 4ILEA 2ZRJA 3LLUA 4Q5IA 1XTRA 2RCNA 2QROA 1P2SA 3GJ5A 1U0HC 1TMKA 2QMOA 2CJWA 4GZMA 2ZJZA 2QMHA 1KZ7B
chains in the Genus database with same CATH superfamily
3GUYA 1QH1A 1X0VA 1KC1A 2AIRA 2FN8A 1SUPA 1Y5IA 2PS9A 1RJDA 4R40A 4TKMA 5EMMA 3S1AA 4A0HA 5KOJB 5HZHA 3GGGA 3N74A 5ALSA 4ZEMA 2ZRIA 4J0KA 1IEXA 2C5GA 3NYWA 1PWZA 4L72A 4WHMA 5EJGA 3ZJ5A 4QELA 2H1FA 1QBGA 2AS0A 2Z4TA 3HXLA 3GRYA 5DB4A 3VU9B 3WGLA 4WZ6A 4CMEA 6GPBA 3EIEA 3LGXA 1Y48E 4IIUA 4CV2A 1BX3A 2B6NA 4J0QA 3V97A 5FWXB 1HURA 1PFUA 3F7NA 4OQ4A 2DT8A 2JI8A 3I1FA 1U90A 2CMFA 3A05A 2UU9B 5HBRA 4AZ0B 3DMRA 1XNRB 1GY8A 2XOXA 3D7RA 1KZ4A 2NVWA 3D7KA 1RHRA 3F67A 3PQ4A 4FR2A 5DSXA 1IDN1 4X1OA 1L5RA 2XA9A 3KOXA 3PZBA 1G5TA 4UBNA 1NXVA 3ZV3A 1MH1A 4BRZA 1V11B 1WB5A 5TIIA 4CFZA 2UUCB 4PZLA 3RRNA 1OBOA 2X3UA 1DX6A 1A9XB 3AM3A 2O0LA 2D74A 2MSDB 1ZIPA 1I80A 5AHXA 4HAUA 3EAGA 3D0OA 5AHKA 5EQJB 2CDCA 3TE7A 4HAXA 5BW5A 3BT7A 3HU3A 5ALNA 1KK2A 1SD1A 5EKXA 2C42A 1JHDA 1T6BY 2XNKA 4IEEA 4D9MA 5HA5A 5JPIA 2XY4A 4EVSA 4CEIA 5KSPA 4R41A 1R0SA 1P1FA 3AQ4A 4JP3A 4Y2QA 1W5BA 3L4BC 3F7MA 4W5TA 2OHGA 3R6DA 4US2R 2OGUA 3C0KA 4JYCA 4ENSA 4Q3BA 4KREA 3MYRA 1YA8A 3IMFA 1X7GA 3L41A 3ZBPA 3B6KA 2Q2OA 3I39X 2EJUA 2D8AA 1GG8A 1AUQA 4JMPA 2OCXA 1ZIOA 5FOSA 4B35A 1W0KD 3Q88A 4U2EA 3FVVA 4EI9A 3RADC 3BWXA 3IPXA 4P33A 1EEHA 1XO1A 3IUYA 3ZEAA 2AI2A 1XHEA 1C7FA 3D7SA 3UWMA 2ZJ3A 2KE5A 2RSLA 2O54A 3CGGA 5JWRA 1NVWQ 2HSJA 4QXPA 5IUKC 4AKEA 3KSBC 4C14A 4EJSC 1QU2A 3NFYA 3M2PA 5KB3A 3RIYA 1DXYA 4RGQA 3T3HA 1XB2A 5HM6A 5JCOA 2DG2A 3EZ6A 3U3XA 4BNWA 5HPYB 3ETGA 1KYYA 5LYJF 1M8FA 4Z6KA 3KQUA 4DV4B 5CLQA 1BHQ1 2PLAA 5AXCA 1O89A 5CH8A 2Q5EA 1EHIA 4F5EA 1SPXA 2GCIA 2Q6LA 2B7LA 4JJGA 1Q16A 4MRMB 5KYGA 5G40A 1QF7A 3H8JA 3M6AA 4OXXA 4TTJA 1HDGO 3IAS1 3IH5A 1N2EA 3UXHA 4COKA 4YQZA 4D7AA 2H5LA 1R8XA 1T2AA 4L07A 1NJFA 1C1DB 2MSLA 3CLSD 4RETA 1JB9A 3HU2A 2CNBA 4PZ0A 2I7CA 4QE3A 1BQ4A 1ZK0A 3I05A 2YJ4A 4G5OA 2HCRA 3QKWA 4H6VA 5DHPA 3RTCA 4JR2A 3ZV4A 1KS2A 3GZNA 2GPWA 4R0MA 4OGGA 2XDYA 4FT4A 1ZI9A 2ZYUX 1X80A 2ZDGA 1N6PA 3OJLA 3D6MA 4J76A 3EA5A 5CUQA 4BLOA 2B20A 3HY6A 4URZR 3K8YA 3KQYA 4KAXA 3X0DA 1IUNA 4RSGA 1Z12A 4KRXA 1L5FA 3ZIDA 3DQPA 1ZWLA 4MVJM 4ZQGA 1KRHA 3U7QB 3BICA 1A71A 4UMFA 4CXMA 1PX0A 2WUWE 3DNFA 2QZZA 3H5RA 4JIMA 5CCXA 4H6XA 1RJ9B 3FD8A 4LOHA 1SIOA 2C88A 5KX5B 5TLSA 4KXWA 2SICE 4OY3A 1D6JA 3PEYA 1A8PA 2PVSA 1V5IA 3A1TA 3OZ7A 1HEUA 3ROFA 2A86A 3IPLA 3KM0A 5SY9A 3SBEA 2FRVA 2FQYA 1MOPA 4R8KA 1IQUA 1ONBA 1BYUA 1T4GA 1XCGB 5BNZA 5IH7A 1JR2A 1Y9JA 2I4MA 2G9RA 4NG5A 4Y6SA 3LKZA 4IHJA 4BLQA 1NURA 1IU9A 2XWJI 1SCUB 4BE4A 4GS5A 3MRTA 4YROA 4EUFA 4YQFA 2XBMA 1HYHA 2P2YA 1B8OA 4IO1A 3RBAA 2FSVC 2QY6A 2G88A 4GSKA 3FTFA 2XUQA 1G5QA 4PXSA 2P62A 2NO4A 4UQPA 5E4YA 3RYHA 2NO7A 5KNBA 4CYMA 1L8LA 1YOVB 5CNJA 2PNJA 4FJ1A 3CXRA 3GLHB 4A82A 4AAYA 4EY5A 2YHIA 4H2DA 3W6ZA 1G3IA 1Z4PX 4YJFA 2RH8A 1NSTA 2QTAA 1XQYA 1DHTA 3K15A 3ON5A 4LVUA 1SZPA 3KXPA 4OI4A 4YIKA 4LGMA 2GO7A 1ND5A 4ZYYA 4FSHA 1XRRA 1RFLA 1NBAA 3PQ5A 5IFLA 4YREA 1P7CA 2OO7A 4L8GA 2MYNA 1ZG3A 3E6AA 5FTWA 4I14A 4XE5A 1AUOA 2ODPA 3DV2A 2AWOA 4ZGWA 2A67A 3BERA 1Q22A 4X41A 1GGKA 5KOIA 1Y8CA 3QE4A 3IBGA 5G02A 5KSZA 2NTVA 1K92A 1PHPA 3IERA 5BSMA 3VH1A 3JYOA 4KGXA 1ATZA 2XXAB 1PZFA 3O3NB 4ZQCB 1ZRNA 1OZ0A 1W2HA 3DDOA 3IVGA 1O77A 3B6JA 2YXBA 4FEEA 3T94A 2BGWA 2YY5A 2WF5A 3KO8A 2XCTB 2GEKA 4X7BA 3E1KA 3H18A 2FQWA 1A9ZA 3VV3A 2IDJA 5LMNB 2IPLA 3VTAA 1KMQA 2ZGVA 1SCDA 4MS1A 1KE1A 3VDMA 5IP5A 3EBOA 2G09A 4QNRA 1ZM4A 3SJCA 4E14A 1HZZC 4XDHA 5HRCA 4ESVA 1NN0A 1X14A 4N1AA 3F5MA 1QWOA 2H9YA 2IEBA 3EWSA 3EZFA 4BVLA 1U0OC 3RTAA 1L5GB 3VZCA 2WTNA 1GXSB 1WCIA 3PXUA 1QU3A 4HEJA 2PQ0A 3JD1A 3Q72A 1N3BA 5KWJA 4RJLA 1W2GA 1WULS 4LTMA 4TL9A 1AGPA 4A3SA 2DCUA 3L4BA 4RE5A 4WZAE 1QMGA 2DYKA 3Q3JB 2ISCA 2VN8A 2EYQA 4H3KB 3A7DA 1R0ZA 4CM8B 4UTNA 1IXKA 1G2QA 1V9SA 2QR2A 2VFAA 4R8MA 3ABQB 3FPJA 1JQLB 6ABPA 2F48A 1BMDA 1GA6A 4OOFA 4ZZ1A 1K6EA 1RIIA 2HUNA 3BBLA 3QI2A 3RROA 4QOIA 1YRWA 4TLAA 3LDUA 4LF4B 3ENWA 4FGLA 3PNSA 3L0ZA 5GAJA 3V42A 2AEEA 1ZUHA 3GN2A 4TMZA 2W6ID 2BFEA 2L42A 4DVJA 3PXGA 4LJSA 4UXJA 4IDCA 3C87A 3EHDA 3AIMA 1FQOA 1VP3A 2H54A 3JVEA 2CJYA 3QW4B 3DZHA 1T3LA 2Z3VA 5DM4A 3IQHX 5KIAA 5BNIA 3OQOA 4UNSA 5F2EA 3B89A 3W2EA 4CM6A 2BMJA 4GKBA 4XLLA 4EIWA 4EX6A 1JA9A 1VMAA 4C0BA 5K0JA 1L5YA 3S2UA 3RF7A 1ZXXA 2DFDA 3HU5A 4EAAA 3OEED 4U7DA 2A1UB 5L3QB 5J2TA 3SKXA 2ETVA 1LJUA 2DHRA 2R85A 2C98A 3BTVA 3HR4A 4IH4A 2XYGA 4IQ8A 3C14C 3TDNA 4EATA 4F11A 4OG2A 3RSCA 3ECCA 4HTFB 1KEUA 1SKUA 5F4BA 3NS7A 3ZY2A 4JKOA 3ST7A 5HJ7A 5DFAA 1A8IA 1ZVVA 4FLEA 5JS7A 4OQYA 2GVDC 1IRXA 2WUEA 1GKLA 2ILTA 3EXFB 4FJ0A 2I6QA 4JZYA 3RD5A 1TQ8A 3VAZA 2AC4A 2DWQA 1OR8A 2HU2A 3P0JA 6CHYA 4L0QA 4X9XA 2ZWOA 5B4VA 1J39A 3BWEA 4HRAA 2HRRA 1PZMA 2Z2ZA 2W6MA 4I5GA 1KFBB 1Y89A 2ODTX 2AE2A 4B74A 5AW3A 3NHFA 1K7YA 4MYSA 3RAEC 1A50B 1SR8A 2RC6A 3FPHA 1O6BA 1WTAA 5JCJA 2R6JA 1SO8A 1XMJA 4RK7A 4MARA 1H0SA 3T5DA 3MRXA 1U0SY 1HDRA 1ZUNB 1IIRA 1RXIA 2C2HA 3FUXA 4K9DA 2IWRA 4BGUA 1R0XA 3LHDA 4NV3A 5BW4A 4M87A 3HWWA 4ZANA 1N2JA 2BONA 1XDUA 2C7GA 2P0EA 3NBQA 4NK5A 3I9NA 5G1PA 4EY6A 4CMGA 4BZPA 2O5VA 1UBJS 3P45A 3V4PB 1JWAB 2YWHA 3C3EA 3E3LA 3I2JA 3UA4A 3ZE8A 1T3SA 3ZCUA 1XLVA 1TU4A 3PP8A 3ZY5A 4I8IA 1MC5A 1NC1A 3GLHA 1N77A 1L7XA 1WUTA 4QYSA 1L1QA 1UBNA 4NWIA 5HW0A 5B7GA 2WD9A 2R6AA 3I6MA 4LYHA 1HDZA 4M0CA 1VI5A 3AL3A 2P27A 3I04A 4RADA 1DLIA 4Y30A 4QRHA 1NLMA 5T6BA 5A3QA 3I5YA 5CU7A 5J43A 3KYJB 2HO5A 2Y99A 1Y1KE 1E77A 2WKWA 3GT3A 3PC7A 4QU0A 5JAOA 4D74A 1U2DA 1G6HA 4CN9A 1T2DA 3A6EA 3TLGA 3H1PA 1M0EA 2IE0A 4NCHA 1O6ZA 1UC9A 2ZIZA 4D4KA 5KPDA 3L6CA 1WUYA 4UJ3A 2XGSA 4P3KA 1W8IA 3W06A 3OFSA 1GQRA 3QJ5A 3ZYCA 4Y2UA 3RVPA 2BC9A 4ZVLA 2HRBA 4D9EA 2GCOB 1ONSA 1BWRA 3QFTA 5H02A 4F3CA 3U4HA 3MSCA 3W6OA 4L16A 2LUOA 1KDPA 1LLUA 2RH9B 4PO8A 3PGJA 1TZ2A 4X44A 4Q4HB 3H17A 3PDIA 1TLLA 4GSLA 2Z6AA 2I66A 5HG0A 1IB6A 1VYTA 1TT5B 3LNCA 4YP6A 3AB3A 3T4PA 3AKEA 1JR4A 1Y98A 3TQHA 3D3NA 3JD2A 3NB0A 3RG8A 2P9ZA 2GAFA 4GZ6A 2XOEA 4K86A 2WMNB 4KDEA 4TTQA 2FEOA 2PRKA 4XD7A 1EFRD 3U7JA 4FE7A 4C07A 1N5OX 4MVJA 3OIDA 3VMFA 2O3SA 3BMCA 2QM7A 4FXPA 2FW6A 1N0WA 2QZJA 4ZRDA 2GAJA 1WMBA 1EYZA 3A58B 2UZAA 3TZLA 5FA5A 4AB1A 1R16A 1B73A 3C7AA 4OXYA 1W34A 4NPAA 2NPIA 2ZRDA 2QD5A 2P8JA 4R2XA 4INJA 1Z6XA 4YBRA 3T7KA 4C20A 1O5TA 3UK2A 4FIDA 4XASA 3V7FA 4BV2A 5JLJA 5J2UF 2ZFUA 4LC1A 2GS9A 1LRJA 2CBXA 1A8UA 4QXAA 1CRWG 3MW8A 2QM8A 3GGDA 3K4PA 1JDPA 2R87A 4LXXA 1Z13A 4LYDA 2W8BB 3HNOA 4MULA 3TR6A 4NSNA 1ODTC 3MEQA 1E9CA 1YE8A 3GCWA 1HE8B 1QIJA 2C8JA 2XMZA 1E5TA 4MPDA 1QVZA 2J6HA 4XM1A 4ETWA 5HOEA 5I7HA 3OF5A 5AXDA 1RLJA 3CUEF 1AUPA 2DHEA 2P35A 4R7GA 3VX4A 4AY2A 2DUWA 3AF1A 3QPAA 1VMEA 1O95A 3KD3A 3E9YA 3EMBA 5JSYA 5EZQA 3EGWA 2ALJA 3LTEA 4CMJA 3EW9A 4MQMA 5LU8A 2C82A 1JSCA 2H4HA 1SXQA 3E3MA 2VVTA 3KKEA 2HF7A 2ZXUA 1VG0B 2C5HA 2MTBA 3ECSA 4RQTA 1U99A 2XUZA 3IYLW 2VYFA 2GBPA 4FEGA 1V8OA 4NDAA 3IUBA 2Q1XA 4FVTA 4KX5A 2GD6A 1F0YA 2V5AA 3HCDA 2PJDA 4JJ8A 4C0QC 3TEFA 4GMXA 4PZZA 4WERA 1Q3KA 3HUEA 4ZV4A 4KLAA 3GEMA 4AG3A 1U8AA 5LQNA 1U3UA 4JUIA 4YRJA 5J2TB 2QVBA 2HJVA 2J6CA 3EA0A 4X93A 1EZZA 2VQ3A 3HB5X 1C4OA 1VZ2A 4JQZA 4DIUA 4DSOA 5JXIA 5K8UA 4I4CA 1WMSA 3B38A 3LBHA 1M3SA 3UAWA 3Q5EA 3QIAA 2AFVA 3BXFA 2XMGA 1VKOA 1OLSA 2MMGA 3M8KA 1DC7A 1NF3A 4NTZA 2BEVB 3LYLA 3LWNA 5JYBA 1HLPA 4YJ3B 3B2EA 1TIPA 3GLKA 5E1DA 4CMCA 3BJRA 4MVJH 3UHJA 5ITZB 2W11A 1ZGCA 4ZI7F 2FUEA 1PJ3A 1ZUWA 3P9NA 5JAUA 2XVMA 1N0HA 4KVFA 3QU5A 4MH0R 4ZQEA 3VVCA 2VPXA 3CKKA 5C4MA 2IYSA 3QPUA 1ISGA 3HSSA 2ONJA 1AZWA 1OLSB 1N25A 2CLEB 1E5QA 2OG1A 4IX1A 1DRVA 2WKSA 2OMEA 2PKEA 1VM6A 3HJHA 4I8XA 3SM9A 4EHNA 3CQ9A 2JLSA 3TZBA 1LNZA 1VCNA 2Q7XA 3PR2B 2ATIA 4KK4A 2FZCA 3KTOA 3PNBA 4CT4B 1OHHD 2C4MA 1PT7A 3K96A 3S2FA 4UNNA 1C9KA 2CMHA 3OSUA 4L4ZA 4LECA 1ABBA 1UQUA 1W1UA 4V3CA 1I1NA 1YA4A 4Y1FA 3UGQA 4JI0B 1PFQA 5DE3A 1UPXA 4C0JA 3SR4A 4DDWA 1BKDR 1G1AA 1HORA 1RC0A 2RI0A 1KKMA 5A5EA 3KSAC 3V8QA 4DMRA 4Y6GB 4JOSA 3B13B 3RV4A 3IE2A 4QDZA 1SOUA 3GT0A 1F38A 5LJLA 1RIFA 1Q0LA 5ALPA 4EUNA 4KR0A 3MCZA 1GTZA 2CLCX 4JJEA 5DXAA 3W5HA 1VMDA 2A14A 5HCIA 1FJHA 2PMCA 3UUWA 1H4SA 2WM8A 4KHPB 2NV6A 2AQIA 4WXYB 2JJ2A 3OOYA 5DASA 1JG7A 2JZNA 3P9QA 4KBFA 2C1ZA 2OGWA 4F8JA 3TPFA 1D0IA 1NF8A 4JVNA 4TLDA 4F2HA 1T5TA 2IOYA 2QF7A 4W1RA 1MO2A 4II2A 2VF8A 4DGSA 5LB2A 1JTEA 3WZLA 1IXSB 4YALA 3WNQA 4BV9A 3H65A 5CR9A 3HL4A 2RONA 4KZKA 2J67A 1QP7A 3AR7A 1K6MA 3SD7A 5EAIA 1UJBA 2IXAA 4NI5A 1OBFO 4Y67A 1Q1AA 4IV5A 1ISJA 1GUAA 3SC3A 1GZ3A 3GRCA 1JKFA 1G7SA 3HR7A 1KQNA 3TSWA 2I2CA 4TZKA 3R7FA 5AI6A 5U1PA 5DYNA 1GA1A 3NHWA 4JFRA 3SIXA 1NUTA 3KC2A 1XTSA 3ZDYB 1II9A 1G5HA 1ACMA 5EESA 4I3HA 3TXAA 1SVNA 2VWHA 3W04A 5FKJA 4CR8A 2IODA 1IY0A 1J9EA 1KY2A 2GWHA 5FUQA 1XEFA 3DMYA 4GECA 5KYYA 4ZV7A 3KFLA 1PU2A 4YUVA 1D6NA 4DEVA 4KQGA 2PMBA 3UQYS 1ILEA 3KVVA 2VZ9A 1K9VF 2P0AA 3N7UA 3TQRA 5JIBA 2CB0A 4DBZA 1XRJA 1AQ6A 3NKVA 1D09A 3LAWA 5TF4A 5AQ1A 1QJ4A 2DWOA 5COAA 4KN5A 4DNPA 4TXNA 4LN1A 2BEJA 3IBYA 1YBAA 2FHSA 1U7HA 5JLAA 2ZAOA 1B1AA 1GVNB 3A1FA 4HB2A 1HWYA 2GXAA 2QI9F 3NJRA 5AVVA 4QO7A 1REQA 1UM9A 3I0ZA 3LWDA 3A1EA 4PR0A 1JFLA 1NI4A 5KCZA 4B44A 4BVJA 1YJCA 2IKSA 5CM9C 5AUOB 1H23A 1JAYA 2RBEA 2UYQA 5C5DA 1YZ3A 2VQFB 2EWVA 3TW6A 1YQ9A 2OSVA 1GNTA 2GEBA 2XZTA 4HFNA 2KHZA 5TVGA 4HVTA 1MQ8B 4YCSA 5BSKA 3VR2D 3KOMA 2O4CA 2HA4A 2PGIA 3M9XA 1Y6QA 3PFIA 4AFNA 5BN3B 4AO6A 2HA3A 1ZL0A 3CBGA 4NZNA 3IIIA 2DFTA 3FMPB 4J0CA 4B6JA 1SG6A 3ETEA 2AQ8A 4F60A 4P98A 1PYOA 1V7PC 4JGIA 5AK5A 1MB9A 5CNIA 3RVJA 2X9QA 1G8JA 3GDHA 4K6OA 3KQLA 1FFYA 4GQAA 3TRIA 4RA6B 1MGOA 2Y9PB 1VECA 2CFTA 4Q12A 2XGGA 3H0EA 3M6LA 1NRIA 2OZLA 4QHSA 3BMOB 5H4HA 1G21E 2HM7A 1IZ9A 4FDAA 4BRUA 4WK2B 2CGEA 4H7FA 5JD6A 5A4IS 2P6RA 1JYEA 3LG2A 1P7ZA 5B2FA 1RMYA 2PU7A 3SSOA 1HE4A 2C20A 2HK9A 3NTXA 1A5TA 2CXNA 3KTDA 1EFTA 5AJWA 2JJYA 1DVRA 3V4LA 1Y9AA 4OTZA 1A76A 5JATA 2YWFA 1YZYA 2X8WA 3P26A 3OQ1A 3P5BA 4XKJA 1W73A 3KPUA 3NC4A 2IY7A 3HO1A 2QR5A 1E3MA 2ZW9A 1OWMA 4I4LA 1UMDB 2D59A 3R5KA 1KAGA 2GF0A 4M0KA 4NCJA 3K4HA 3F78A 2G80A 2Y1FA 1IWPB 2O0MA 2ZCVA 4KO3S 4YJ3A 3LT4A 1WQ3A 2O0HA 2L17A 4MQFB 1X7DA 2QBYB 1JEOA 3AVOA 4PO3X 5JVDB 3GGOA 2N3ZA 2PH3A 3U37A 3O8BA 1E4EA 1YDGA 3FPEA 1F20A 3MLAA 3OD1A 1U0GA 3JASB 1C1YA 1HFJA 1JJIA 1P74A 2DF8A 3M3DA 1N2HA 1P8AA 3LF1A 3V32A 2QEQA 2VT3A 2ZREA 5P8WA 3T1QA 2JFHA 3MWJA 3R6GA 5TF0A 5G2OA 3RIEA 1S89A 4P53A 5AW2A 2RHHA 3THWA 1RVV1 2JLZA 3KR2A 3L07A 4YP9A 3PVSA 4G0OA 5HF5A 1ZH0A 4YXFA 2AKAB 3BXEA 1ICEA 3QX9A 5E1BA 4EA6A 4ENRA 1AQUA 3T95A 2YVKA 4OCZA 1U7XA 5DYYA 3RU2A 3WHLA 2H3EA 3T3NA 1ZHHA 1OVMA 2AFIB 1VYHA 3GBSA 4U7HA 1L5HA 2BBWA 4F38A 2P9JA 1U3CA 3WL4A 4WOBA 5H59A 2O2HA 4KL8S 1GFIA 2HCBA 2VRCA 5CD9A 3M6IA 1FYWA 3Q11A 4GICA 3V7UA 4FBLA 3TWOA 1EX1A 1BX1A 1I2MA 1NMEA 4QVIA 3E18A 3UMYA 3P2IA 1MCZA 2WF9A 3VHXB 2OC9A 3Q7QA 4E6PA 1TZMA 4PYKA 1BVRA 5ESXA 5F1PA 4Z4IA 1BXGB 2I8LA 3CF4A 5EN4A 4E5YA 1D1QA 4DSUA 1CETA 2V54A 4O3MA 4XX1A 1M34A 3HQ4O 3O1JC 4FZ3A 4WWHA 1JG3A 1UBHS 1KY5A 2ZYSA 4Y7DA 5HUJA 2FRDA 3EFOB 5BXYA 1GTG1 1SD5A 1U8YA 4JD5A 4IIXA 3WWZA 3WYBA 2P5UA 1GL7A 1JEEA 2NIPA 2OHJA 2Z58A 4M1OA 2F8SA 1RPJA 2L82A 1PG0A 3IP8A 4O25A 4BQSA 4QOGA 1GPLA 2DPHA 3CMMA 3LY8A 3M5CA 4GW3A 4G4GA 3S2EA 4DILA 4RK4A 2Q2WA 1ZOIA 3PUVA 3P9RA 3GIDA 3MVEA 4ML3A 4Y2SA 1JI3A 2HA0A 3SJAA 4ZYTA 1UIMA 1UDRA 2QORA 3LXRA 2PRIA 4X6UA 1JHZA 1CRQA 3ROKA 5EMHA 5FBRB 1ETUA 2W0MA 3CCBA 3UOAB 1W49A 1KVTA 2H92A 1WO8A 3SNHA 2TMDA 4CZ2A 1Q19A 3KWJA 3U81A 1NSYA 3E8XA 3HA3A 3A1NA 3NV7A 2XUDA 1QYIA 2R8YA 1M7GA 3OKFA 4OX9Y 3BWVA 4H0NA 4BFCA 4TKUA 1JZQA 1BDHA 1APBA 1A2KC 1QB8A 3HKCA 2WOOA 1C9JA 2AI3A 3AUKA 3D2CA 3PFGA 4KN9S 4JMLA 3R9XA 2I6GA 3FFWA 1C9DB 1IUPA 1M0TA 3LT2A 5CJPA 2BGJA 3M6VA 1Y1TA 1T6YA 1I33A 3NQ41 1HQDA 3AU9A 3OQIA 4URHA 1V71A 2ZSKA 3PGLA 4OK5A 1FPMA 2C4KA 3D6NB 3NBZC 4HPJB 4L3WA 4NMLA 2VAXA 1YCDA 5EIHA 3UAYA 4EY3A 4FWTA 1UM9B 4F3TA 3RH0A 1L5NA 1UJ6A 2IHVA 1S2OA 1CYEA 2IVFA 2VXBA 5C53B 3EIFA 1SQ5A 1WEKA 3FETA 3FNRA 1G8HA 3HCPA 4XJVA 3UVEA 1RPZA 1ENZA 3LS2A 1SRQA 1JDNA 3OJCA 3OZGA 4EMSA 4MB6A 2H48A 1RWVA 2WSSA 2ZVPX 1ZS9A 2OESA 3EA4A 2QE7D 3KSZO 2A9FA 4CIBA 1EFDN 1XJ5A 4G5HA 3N58A 2CHQA 3G68A 3OU2A 1CZOA 3F98A 4J1TA 2B7CA 4QDXA 3SJUA 4AZ0A 3HVHA 5BV8A 1EKXA 5K4GA 4ARCA 1C3OA 2XJ4A 5IEJA 2UXCB 3JQFA 3T5GA 2FXVA 3PPXA 4PQYA 3F7TA 5BUSA 3LPDA 2QAGC 5JRZA 1ZO8A 1J8DA 1QR2A 5I7OA 1ACLA 1ZK4A 1YGPA 3AUXA 3OAAA 2P0YA 5AJYA 2AFHA 4HNAA 4BLPA 3VPAA 2FHPA 3L7KA 5AVYA 1B2RA 4L5YA 3KKOA 4QPNA 2BLLA 3RVNA 5KNDH 4RPGA 1D2AA 5EP2A 2I4NA 2VPZA 1MA0A 2GN1A 3KD2A 4ZCMA 3PGVA 4DC9A 1BGWA 3RYFB 2H18A 5LDGA 3UMBA 5I4BA 3ANSA 2IA5A 4S1TA 5B3KA 2HHAA 1KO8A 4GWKA 4KMMA 4ZHSA 2XA2A 4H6WA 2HGZA 5KQPA 3PFKA 1KRWA 3CB4A 1XRQA 3HXPA 2V4MA 4B7XA 4WNCA 1E3WB 5GJVC 2ZB4A 2B61A 4NFYA 5CM8B 1TLFA 2X6TA 4QT4A 3TCXB 2ODQA 4M7PA 4G0WA 2EG9A 4MW9A 1IY8A 1M2FA 1NC3A 2NSLA 5IZ4A 1GM5A 5FOQA 1A1VA 3BGSA 2NXWA 3DLPX 1COZA 1WVGA 2WINI 4RQAA 4LWQA 4P7KA 1ZBQA 2DSTA 2XH8A 1DOZA 4NYMR 1AZSC 1THMA 1O95C 1FOEB 3BN3A 3QFCA 4L74A 5TGZA 4AL4A 1DL5A 3GAAA 2ZM5A 3RJTA 4B3CA 3FWPA 1UKEA 3EFEA 4RLHA 4CBVA 3SIWA 3RHSA 3WY9A 5LQUA 4ZVKA 4I4TF 1OU0A 2E5WA 2Q27A 3AKCA 5HDQA 3A6ZA 4B3MB 4BLTA 1HEIA 1MW9X 8ABPA 2C9DA 3O2SB 4F91B 2VEDA 7MHTA 5DX0A 5KKAA 3T38A 4TV9B 5FUWA 4B4DA 2WVAA 4BZXA 3AFHA 5DULA 2CYAA 1PUXA 2Z1DA 2G4VA 4XOIA 1NG9A 3ESRA 3MPOA 4M7OA 5LQCA 4UAGA 3BWBA 2XCRB 1J8YF 4DBVO 2JGNA 3DEAA 4OHFA 4CG2A 5DPMA 2YFQA 2ZYAA 4BRSA 3DAYA 3AHJA 2HMUA 1YTUA 3BF7A 4YAKA 1KZ6A 2OZLB 4K0RA 5JY1A 1CUEA 1W0CA 1NTOA 4BQEA 3C4JA 4Q4AA 1WP9A 4UZEA 2NU9B 3UK6A 3TF5A 4CIYA 1AF4A 3BFJA 3ENQA 3GAMA 4KE6A 4Q19A 3GEHA 5JARA 1EGQA 5CJ2A 1YR1A 3GP8A 4A23A 4A16A 3GEIA 4H08A 3SMQA 1CNEA 1Y3HA 2YVQA 4KRGA 1VKNA 3U7QA 5ES4B 3AT1A 4KYUA 4LMRA 1Y42X 3AJAA 4P4SA 3L5KA 5GM2A 1KKLA 5IVIA 3IV9A 1H93A 1P6QA 1ZJ4A 4ZKDA 1HSOA 1KJ9A 4JN6B 2YHSA 3RUPA 1EXNA 5J4HA 1MXHA 2G5PA 5B30A 5CA1F 4RZSA 2ODNA 3WGYA 1XU7A 3DDCA 4QKQA 3RWOA 5CP8A 4BY9E 4JBNA 1UJ2A 2RI1A 4IXDA 3RJ5A 1B00A 4MUJA 1I3CA 3GFVA 2O3RA 3OOWA 3P2EA 4R7TA 5A0FA 1ZYUA 2GD2A 2OCBA 1ISPA 2RMKA 3FSRA 4WMLA 4OJTA 2J0VA 2GJAA 3PUXA 1GAEO 2QM0A 3AINA 4L3VA 5DNEA 1H22A 3O93A 3WG9A 3ZV6A 4YY3B 5D00A 3L9WA 1MQSA 1Y8ZA 4BNDA 3DF7A 3TM4A 1QC5A 3T1YB 1VLVA 2WJ3A 2JAHA 3N3AC 2VJDA 3PVCA 1DX4A 2XWQA 3G0IA 1IBMB 3DP7A 3OU6A 4M7RA 2Q4RA 1HLDA 4NZYA 4A0SA 1TO2E 1EE2A 1GG2A 3PUKA 3MTAA 3N0VA 4BWVA 1OTHA 1YZFA 3KPWA 2YOGA 1I2AA 3COWA 4NNOA 1KIFA 2H59A 2OBXA 3TZEA 1EE1A 4PC1A 3E8MA 2B82A 1VHWA 3FWHA 2WE8A 1TTTA 3VUFA 2VUTA 2FDCA 3SE0A 3MTBA 3S2SA 1XMOB 5JXJA 2DLDA 3OCXA 1HKHA 3P0RA 2P9HA 2ZBEA 2JK0A 3IUSA 3BMQB 5LPNA 2OE2A 2WWVD 1R8QA 1JG1A 2P9YA 1RLTA 3R0VA 1DE0A 3URMA 1X80B 5DI3B 4D5GA 5K3EA 2PD3A 3PCTA 5DSTA 1PFYA 1E0SA 2W6NA 2DWCA 2JI7A 5F9MA 2CK3D 1ZAYA 1DQSA 3QV1A 4TV8F 2XF8A 2OVBA 3KAKA 4E2WA 5I7SA 1YJBA 2ZDHA 3AEUA 4TKLA 4M9QA 4A15A 4MDFA 4BAUA 1K3UB 3WQHA 4J91A 3DZCA 1VHQA 1SKYB 2XTMA 3U4IA 4HZUA 4UMVA 5TR9A 4LQDA 1UXIA 2E48A 4POOA 3SDZA 3LL4A 4R05A 1HYEA 1LNSA 1M1YE 2PX8A 1WLSA 2WM9B 2JGDA 1JDTA 3CCCA 1P1HA 3FDZA 3FKSA 4I1IA 3WKEA 3EIHA 4ZJYA 2QB5A 3TG2A 2CCJA 1H8HD 1N1MA 3KVRA 3RYCB 1Q7RA 2BI8A 3DVSX 2FWMX 4J75A 1U7WA 1JEQA 3HXKA 5FEMA 5GONB 1UJCA 4ZREA 5JYDA 3KALA 1BKSB 1LBIA 2IYEA 3FWZA 5GGXA 5FBVB 2IY8A 4UBOA 2JIZA 2ZCJA 3TFWA 1IB0A 1NUSA 2JI9A 2AUMA 3LCVB 3OPYB 5KWSA 1IVSA 2FPXA 2H4WA 2BKAA 5A1JA 2I3AA 2Y1CA 2C2ZA 2B94A 4M9CA 2OAQ1 4Q82A 4C88A 2VJLA 2QLLA 1L7AA 3NHJA 1SFRA 4IXTA 4DQDA 3KEOA 3GPDG 4ZYLA 1SOMA 2ZS7A 4P0TA 4AMBA 4Q00A 4DNQA 1GQ2A 4DLTA 3UKJA 4K05A 4K87A 3C1OA 1GNVA 1U8XX 3KOYA 4DJJA 3O03A 4KYIB 1YZVA 2WAMA 3WOVA 5JBNA 1RYNA 4GEKA 4KI0A 2JKZA 3GHYA 4P2GA 4ARBA 9MHTA 2VDNB 3TIGA 3BG5A 1UWVA 4Q4JA 1AMUA 1NBMD 4X5OA 1PUIA 4YJ3F 4MKIA 2DR2A 3ZYZA 1G6OA 2FPMA 5A6SB 4WFJA 1NVVQ 2GWRA 2PZ8A 5DGDA 3MJTA 3NHLA 1AVTA 4DC1A 1VE1A 4H60A 1E9AA 1UZUA 3FA2A 4A6XA 1Y5LA 2B1IA 2FG7C 4V02A 2YYSA 2WPDA 5FPSA 2C2MA 3B2QA 3GLIA 2JBAB 1UDCA 1R8JA 2IXGA 1W9MA 2YBEA 1VJ1A 3EIQA 3RW9A 4AS1A 4TYWA 3QYJA 5DTMA 3QHQA 3ISTA 2XNCA 3O4GA 5JJ5A 1AO3A 1GRQA 2DQ4A 2F8MA 4FFDA 1KMCA 2FMKA 4QTUB 5ENDA 3TXYA 1A8QA 2KLHA 3OT1B 5BNFA 3ZZ1A 2A33A 1P5ZB 1YD7A 2O2XA 2CYCA 3Q2KA 2AYYA 2DUMA 2X13A 3E4CA 4OKNA 5SYMA 4RORA 4IP0A 4B6RA 4Q9JA 1J5EB 2Q6TA 3I2GA 1JI0A 3PHGA 4P08A 3TD6A 5EKTA 4D97A 3SF8A 1ACJA 4JUBA 3R8FA 2SHKA 3R7NA 4K6MA 3WNCA 4QULA 3TNFA 3BGOS 2BFBB 3E70C 3NYQA 5FNVA 1KSHA 5IAGA 4CKEB 4QLBA 2FDRA 1IN1A 1A96A 3I2KA 4NARA 2FUNB 4MZDA 4OAOA 3SI7A 1ODFA 2C03A 4HAYA 1CVIA 1JKXA 3B9BA 4JOBA 3WJ1A 4FHCA 3R7AA 5CURA 4CIXA 2RKOA 5FL7A 3ZY6A 5BMOA 4LWZA 4JKIA 3PD7A 1M1UA 4F4IA 1E3TA 3B20A 3FR7A 4M36A 1QMPA 2OTCA 3RYTC 1ZH6A 2ZIUB 3G0CA 1T2NA 3PC2A 4FFVA 1VIYA 3V1NA 5A5FA 5AW7A 3H84A 4IQGA 4CKEA 4KXFB 5IYZB 5JWOA 1U8CB 5ALLA 4H1VA 4ZT4A 2O2DA 5FT9A 3GOQA 4FCCA 5AOVA 3S3TA 3UFXB 3CE6A 3OE7A 4N0MA 3ZVNA 4FSXA 3HS3A 3LFTA 2CFIA 5IBRA 4BDTA 4JJFA 2DJIA 4WJKB 3JQDA 3W2IA 3FF4A 2FPSA 4CLDA 2R3SA 3T06B 3AZQA 3SJ7A 1ISHA 2JF0A 2W98A 3C3XA 1B8PA 1GD1O 1QG6A 3OEHD 3KXDA 4AMVA 1E1QD 1DU4A 2Z1MA 3IA7A 3GC6A 4PC3A 2H63A 2EAUA 5D1NA 4P92A 3EODA 3LVRE 2Z0MA 3DEIA 2ET6A 2EZUA 1OYYA 1Z0KA 1L5OA 1U1CA 1M0SA 4LRWA 2Y92A 5TMDA 5JR3A 1EFCA 4WOCA 2O7RA 3I23A 5DK4A 3TM5A 1T4MA 4XWWA 1TA9A 2A2ZA 3FCOA 1E1RD 3FNIA 1XJ0A 4GOOD 1SBYA 3L7CA 2X5NA 3JRWA 3AVQA 5FAXA 4PAWA 3GPIA 2J4FA 1LCIA 5H80A 1Z45A 1C0LA 3LQ2A 4WUTA 1O2DA 3C97A 5L51A 5KYXB 1O08A 2BMVA 3O8RA 1GNPA 4N03A 1UMKA 1Y5RA 4FK8A 4M21A 4EI2A 1I1OA 3Q2OA 2H8GA 1H6DA 2J3DA 3BHIA 2I1LA 1ZXLA 2VJAA 2BM0A 2G1KA 2ZYTX 4KUEA 4BN0A 4RTQA 3PKIA 3G9XA 4UEWA 3ND9A 3L7AA 4TWIA 2GFHA 4WLNA 3D3EA 4FCWA 1S8FA 4ZVMA 4IY1A 5JU6A 2IP1A 2AK3A 3C41J 3HFRA 3TSOA 2CXHA 5HE8A 5REQA 4Z2AA 4ITUA 2NO5A 3I5MA 3PHHA 4K2AA 3GU3A 1Z5PA 4BJ3A 1GU1A 3QVGA 4M8IA 3ZV5A 4BMYA 1TGYA 2BDEA 2NOAA 1FDIA 2JLQA 5DIFA 2XQIA 1IG3A 5DHTA 1PT6A 3HDGA 4C4XA 1UPAA 4TV8B 1XF1A 2E4AA 3FNGA 4X6LA 3QF4A 4OJMX 4CTKA 5KOHB 1HDIA 1ZHFA 2I87A 2REXB 4WBNA 2LD4A 5EJAA 1JHPA 1RS0A 4MUYA 4OK6A 4RD1A 4CFSA