2BMJA

Gtpase like domain of centaurin gamma 1 (human)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
176
structure length
174
Chain Sequence
MRSIPELRLGVLGDARSGKSSLIHRFLTGSYQVLEKTESEQYKKEMLVDGQTHLVLIREEAGAPDAKFSGWADAVIFVFSLEDENSFQAVSRLHGQLSSLRGRGGLALALVGTQDRISASSPRVVGDARARALCADMKRCSYYETCATYGLNVDRVFQEVAQKVVTLRKQQQLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CENTAURIN GAMMA 1
publication title The Centaurin Gamma-1 Gtpase-Like Domain Functions as an Ntpase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 62
structure length 174
sequence length 176
ec nomenclature
pdb deposition date 2005-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2bmjA00
3K09A 4Q5IA 1JXOA 3TUIC 5G40A 1AGRA 2QP3A 3KDSE 4KAXA 1SVMA 2O8BA 1N3BA 1DVRA 1XXHE 3PG5A 1MR3F 3KJEA 1ESNA 3GLGE 2BIFA 4ERNA 5CITA 3VKGA 5CIQA 1G6HA 4TWZA 1EFRD 1Z22A 5SZKB 2L0XA 4DB4A 3HU2A 1KMQA 1YR9A 1ZM9A 2F7SA 3U4QB 4LV5B 1AKYA 5FBLB 4FMDF 4OBEA 4JVNA 5IT5A 1HY3A 4Q1FA 2IC5A 2IYQA 2J59A 3H84A 2FOLA 4S2EA 4D0LB 2FSHA 1DG3A 2J0VA 2A78A 1JXMA 4JBWA 4LI0A 4DEYA 6Q21A 1KK2A 2NIPA 5EE5B 1N6KA 1PUIA 1I2MA 1MT0A 1G3IA 1NJFA 4JL5A 2FN4A 4WXPA 2G6BA 4AKGA 3M0EA 4A0FA 3AVOA 2QP4A 5LDDC 1WBBA 3LD9A 1U0JA 2WJHA 2H16A 1D2MA 4LGMA 1Q22A 3GLIE 4M4SA 1SXJE 1O3YA 3CWZA 4B35A 1UDXA 2PBRA 4ACBA 1AM4D 1ZIPA 4RFSB 1XCPA 1KO7A 4JLKA 5FH9A 1Y3AA 4HAXA 4MDEA 1RE0A 2R8RA 2ZI4A 1II9A 1YZKA 4GZMA 3H86A 3UATA 1YQTA 2JCSA 1J2JA 2MSEB 2VIIA 2VSOA 4PPQA 4TT3A 2F43A 1F2TB 2W58A 3TUZC 2D62A 3FTQA 1DO2A 2J0UB 2OILA 2QL6A 3LFUA 3HP1A 1AS0A 4IDOA 1WCV1 4OQLA 1C1YA 3ADKA 3E5HA 2Q6TA 5LB2A 1MV5A 4MRPA 4MYHA 2I1VB 1G3RA 3DEFA 3B2EA 3QBTA 1N2CE 2XOKD 3B1XA 4R71A 4L9WA 1KNXA 1OFUX 1GSIA 4U5XA 1LTQA 3ZD6A 1ZC4A 3OEEA 3TLXA 3E70C 3R7WB 4OKSA 2J87A 3CWQA 5FOUA 1IJEA 2B6HA 2OV2A 4C0JA 2J3EA 4PC2A 3RS5A 4DT1B 5C46F 1OE0A 4FMDB 1CR0A 1ZM3A 2FZ4A 4M0LA 4HB0A 4R2HA 2IF0A 3SOPA 2C5LA 4QHTA 1GWNA 1DOAA 4M1MA 3CF6R 3UG6A 2IYVA 1XEWY 3EW9A 4DVGA 2RGCA 4LK2A 2GK7A 3RSOA 1T6NA 3GMTA 1R8SA 5FI1B 4Q9JA 2XNSA 3NDBB 3NBXX 4LBVA 4ZDWA 2DWOA 2F1IA 5EE0A 2WWGA 4A6XA 3K0EA 1KSFX 1S8FA 1NN5A 3QE0A 1EG7A 2CNWD 3GJ4A 4HLUA 1CTQA 3SFZA 4FWTA 3ZLJA 4TYYA 1M7HA 5K8IA 3VNVA 1EFUA 1JQJC 3IIJA 2BHRA 4F93B 1AS2A 4MKHA 1OFTA 5E3HA 3CLVA 5BN4A 3TH5A 5HZKA 3OIWA 1U98A 2CVFA 5HZHA 1DAIA 3L0OA 2J7PD 1FP7A 1XEXA 1E2KA 2BMJA 3VR6A 5H8WA 4PHGA 1CR2A 1M8PA 4C0SA 3AVVA 5BN5A 1OH8A 4QJ3A 4J0QA 3T06B 4NL4H 5JJKA 2QENA 5DI9A 2ZUDA 3X2SA 1HV8A 2ORVA 1HE8B 2CBZA 1CF4A 3B8HA 3IILA 4TMXA 4KFUA 4X8OA 5D3MB 3SFVA 3TQCA 4RD4A 3BH7A 4A2QA 3Q5EA 2ZROA 5HE9A 1NF3A 1IXSB 2OAQ1 1OXVA 4IXNA 3ZVRA 2FGKA 2P5TB 4PANA 5FI0B 2QM8A 3I72A 2IXEA 4TTQA 3K70D 4XJXA 2JIZD 2XNDA 1A4RA 3CF2A 4A92A 1XMSA 4WBSA 1KI6B 1XTSA 4A0HA 3M4YA 1FZQA 1E4VA 2EFGA 4EUNA 4PTLA 4HSEA 2QAGA 2H8KA 4N0EA 2ZI7A 3FE2A 1DAGA 5DI3B 2JDID 2GESA 1J99A 4Q03A 4ZIRB 3R8FA 2WWWA 2ASEA 2GETA 4JLVA 3TK1A 1DAEA 4V02A 3CNLA 3UWOA 5L3SB 3A6PC 3E2IA 3QXXA 2MMGA 4FW9A 4DSNA 3ND9A 5EE9A 2IA5A 2UZ3A 5SZHB 4QM7A 2ZE8A 5K8UA 2Y8EA 1G8HA 4XSGA 4XVRA 4C9BA 3TNFA 1OB2A 4LPSA 4V0KA 2A9KA 1VCNA 3RS4A 1SHZA 2XEXA 4TLBA 2JJ1D 4A15A 2ZR9A 1TU4A 1QG2A 1CJMA 4NCNA 3NBYC 4A8JB 4HUQB 3CRRA 4JLMA 1X1SA 2FF7A 1NP6A 1W49A 2X2EA 2QTVB 5B57C 2CLCX 2YC4C 2ZSEA 4UJ5A 1N6HA 3I5XA 1VIYA 4HLDA 3B6EA 4C0BA 3HYRA 3ADBA 5FPYA 1W0JD 2PX3A 1HH4A 3BB4A 2VF7A 3CPEA 3CUEF 1AA9A 1AJEA 2F1RA 3CPJB 1OV4A 3RYTC 5JJLA 4Q9LA 2C2HA 1NVVR 2AX4A 2QRZA 4GT1A 4BFZA 1CXZA 1F2UB 3ZH9B 1TF7A 2YZ2A 1L4UA 3K9HA 4L16A 2VSFA 4DHEA 1U94A 1E2LA 1T3LA 2CJWA 4BPBA 5AUQA 4BEBA 3QEOA 1XFAA 3QG5A 2ZE7A 5BQ5A 3GLHE 3EZ7A 3AF3A 1Q3TA 1UKYA 1ZIOA 2BKUA 1XPOA 2ZJZA 2ZAMA 5KDDA 4BLQA 4DIEA 4YMTA 4U02A 4BFSA 5J47A 1FTNA 5LD2C 2QA5A 2IEZA 1GRQA 3BWDD 4KSBA 2R6DA 1F3OA 2V55B 3OAAD 3BD9A 3SZRA 4A9AA 1GNQA 1HURA 4G5GA 3SC3A 4V0MA 1GILA 2EQBA 3QJYA 3VMFA 2WIAA 3OE7D 3KQLA 2MSCB 2J46A 1Z83A 4BRWA 4URWR 5FR1A 1FNMA 1T8TA 4NYJQ 3IO3A 4P0TA 4X8HA 4M1YA 1BO6A 3LVRE 2PCJA 1C9KA 5JHHB 2WMOB 4OL0A 1S1CA 2D3WA 1N5KA 4YONB 1Z06A 1FUUA 3DM9B 3KUCA 2OEPA 2YVUA 4KYUA 3QBVA 1SXJC 3IPYA 4GMDA 4B3GA 4MDFA 5EUQB 2ZE6A 1CULC 2W6JD 3CZQA 5BN3A 4D6PA 5FPKA 3W6NA 1E2NA 2B7BA 2QMEA 3QKSB 4I4LA 2H7VA 2QTHA 4DCTA 3BFVA 2IHYA 2PZGA 3FKSD 1XD8A 1LB1B 3SHWA 3L82B 1FTSA 4YMVA 3I3SR 2YOHA 1D9XA 4QC2A 2ANBA 4LV6A 2GZAA 5J5CA 2G3YA 1E9CA 4I1UA 3AEZA 3EPKA 4Q4HA 5C4GB 1ZVQA 5FUVA 3HYTA 1Z6GA 4NCJA 1H65A 1KJZA 3KKQA 2OFOA 3ZGXA 2QN6A 3IQWA 2GZHA 4I1SA 4B2IA 4DEXA 3FWYA 4PAQA 3MD0A 2ODNA 2XTZA 4HUTA 4EQ6B 5F98A 2VP0A 3LH5A 3TGPA 4HATA 5JSZB 1B23P 3B5JA 3KX2A 3AKDA 1KAGA 1H8EA 2JJ2A 2ZRAA 3FDIA 5GJVC 5JWRA 1YR8A 1OXSC 4KODA 1QBKC 2X8AA 5L3RA 2QQ0A 3K0SA 1G5TA 3LBHA 121PA 1JEDA 2DFNA 2WWHA 3MRSA 4OJKA 1NKTA 2EU8A 4WZAE 2QAGB 1D6JA 4DIDA 4F4JA 1G5PA 4Q7MB 1SVSA 3B1WA 3N2IA 5C1BA 1XTJA 2XB4A 2ZI6A 3BGWA 4DLUA 3J81k 3ZYCA 2ZREA 4W5JA 3WBKA 3GPLA 3MJHA 2QQEA 1MABA 2R9VA 3P20A 5EXTA 4OQMA 2IW3A 3KKPA 4MRRA 4Q66C 4B3DA 4ZDIA 1LVGA 1RJ9A 1G4AE 2YV5A 1A2BA 4Q18A 4I99A 2QUZA 4ZCMA 3MWJA 2IXGA 4KV9A 2IYXA 2QMOA 3EA0A 1MO4A 2RHMA 1R0XA 1U9IA 1WXQA 2DFLA 2HDNB 4WVFA 4ABYA 4AK9A 2GCOB 4P33A 1F6BA 1T5LA 1US8B 4IJMA 5JEDA 4DUGA 1QG4A 4XWAA 1T5IA 3NH6A 3T1OA 3VHXA 1RRCA 2R44A 3BFKA 4Q4AA 2QRNA 1J7KA 2W2XA 3KQKA 1N6RA 3DKVA 1Z0FA 5SZJA 3TW8B 3WMEA 5CDFA 4EAQA 2AXNA 1G6OA 4KU4A 3UWKA 3CRW1 1X8LA 2GAOA 3B9QA 1X8JA 3QF4A 4EKDA 3H4MA 1KDOA 4RKFA 5EE3A 2GK6A 5CLQA 1JQLB 4FCWA 1Z07A 2ZETA 3REGA 1GKIA 4M1OA 4JT2A 3PITA 4WZBE 2R6GA 3VU9A 4LX0A 1FP6A 3AVPA 2D06A 1OT3A 3B9PA 1KSHA 2DCUA 3AVXA 1T91A 1FNNA 1Z47A 2MMCA 1RVDA 3A4MA 3TAHA 3AP3A 3A1SA 2HCJB 4IVRA 4OHVA 3DZDA 2QMUA 4M1SA 1NMZA 4ZPXA 5JJIA 3PCRB 4N1AA 2GWHA 1T8UA 3PXGA 4IDHA 2X1VA 5AK0A 4M1KA 5J4YA 4HB4A 2D7DA 1DELA 1P2VA 2WAXA 4Z8XA 3VR2A 5H1YA 4URVR 2KWIA 2CE2X 2O8EB 1KDRA 3EIEA 5FTMA 2QY9A 5BYKA 3OIYA 2NO0A 1XX6A 1QHYA 3T34A 2ZR7A 3PR1A 1F60A 1CEEA 3CRVA 4C7OB 3EWSA 3LV8A 1XNJA 3RC8A 3ZS9A 4V0OA 3I8XA 2V3CC 1YZQA 3CO5A 4HB2A 2GAAA 2G0TA 3RC3A 2JLRA 5FL7D 1GUAA 1IM2A 3I8SA 1NRJB 1TPZA 3CPHA 2JLUA 4UXHA 1WDTA 2VHTA 1JALA 1DBSA 3D8BA 4GI7A 4AURA 5AJZA 4Y0VA 2WJVA 1Z29A 2VBCA 2CXXA 4WZ6A 1BMFD 3SHFA 3V4RA 1XJQA 1P2TA 3U3JA 4UKDA 5F2EA 3SE0A 1D2NA 4EJSC 3MLEA 3D31A 2CK3D 1JB1A 2WSSD 3CRMA 4BFUA 1IY2A 1MO6A 3U3RA 2ZIAA 4KFTA 3NXSA 3JZAA 3LO5A 3MJRA 1CR4A 2NPIA 2GVDC 2QTFA 2WWIA 3PV0A 3GLFE 1Q44A 3BORA 4MUAA 1P2SA 4XWOA 5FUXA 3EIQA 3AH8A 5HKKA 4LPKA 4DXAA 4JL6A 4Q4JB 3U7FB 1NG1A 3QF7A 3MAAC 3PUWA 1IY1A 2GVZC 3K9GA 1E1QD 3BIFA 4AY2A 4TYWA 1E1RD 1Z0KA 1IN7A 3K0CC 5LB4A 1E2QA 1Q3HA 2H1LA 2IK8A 3N2EA 4BLTA 2V1UA 4RKEA 1ZW6A 2AFHE 1KIMA 2C8VA 1NJGA 4RFVA 1L2TA 3QXCA 1V43A 4Q1DA 1W36D 2O8CA 2VL7A 3FVQA 4UNRA 1G7CA 2XZLA 1WP9A 4NP6A 4XVQA 2QPAA 1OHHA 2HLDD 2XB2A 2WJGA 5GVRA 4A82A 3TW4A 1P7CA 1E2HA 2WJYA 4DLTA 2PLFA 1EFTA 4UJ3A 3K70C 4IVPA 2Z0MA 3CF0A 2BOVA 3O8CA 4C0HA 2P6UA 2WTUA 2YJTD 3K0FA 5AJWA 3RABA 5JMTA 3C5HA 1AQUA 4NE2A 2ZJ5A 5FOVA 2AXPA 2QEQA 3IHLA 1IOZA 3KFXA 3RRYA 4D4JA 4DC9A 2CHGA 2C96A 1K5GA 3AF0A 4KYIB 2C95A 3QNUA 4JL8A 3WXMA 1NIJA 4DDVA 1IAQA 1YZGA 2XZPA 4PHTA 1E9DA 2HYDA 4RZXA 1GRNA 4OHZA 4U00A 1BKDR 4CEHA 3U60B 4HAZA 2RCNA 4AI6A 1HEIA 4AWXA 3W34A 4QBFA 3CIOA 2CHQA 5J4VA 3RHFA 3ASYA 3WYAA 2XITA 1VPLA 4KXFB 3SNHA 2EFEB 4JVSB 4HLQB 1HT1E 5JEEA 4Q1CA 2A5JA 1N25A 2GZDA 3PVSA 4WA7A 2JA1A 3MFYA 3ZVMA 3ADDA 1JNYA 1NVXQ 2ZRLA 2WWYA 2JLQA 2ZS9A 1WQ1R 3VFDA 4MA4A 3OFND 3LNCA 4PQYA 2V8OA 1KTVA 4F91B 5DN6A 4W9MC 3NKVA 4XH9B 1BH2A 1EX7A 1N5LA 1R0WA 4FCVA 8OHMA 3UMRA 5F3WB 5C4MA 1SZPA 1UEIA 4F38A 4PPFA 3A36A 2ECKA 3X1YA 2W6IA 1ZNXA 3GCGA 4CIDA 4C0KA 5IK2D 5KSZA 1E9SA 3VR5A 5EE1A 1Z8FA 4B48A 4PX9A 4XWKA 4AG5A 1RC8A 2ZITA 1ZNZA 2FFQA 1QF9A 4LHYA 3VAAA 1KAOA 1TADA 3WBJA 4TT3D 3L43A 4RZUA 3ECCA 1LS6A 3C5CA 3PIRA 2CL6X 1ZAKA 3WP1B 1KI1A 3B1YA 2YHSA 4LJ6A 3SU8A 3GQBA 4BE7B 5SZIA 3LW7A 3NHBA 4QG7A 5AUOB 1Z0DA 3O8RA 5C18A 3N5CA 5DHAA 4ZV4A 3FMFA 4ZKDA 1X1RA 3GEIA 1W5SA 2WWXA 4DLVA 4BFVA 3D6TB 3U3MA 2Z6VA 4MGKR 4Q7KA 5E7MA 1W4BA 5KO2A 3EPHA 3CH4B 2PEYA 1P5ZB 5FPTA 3TE6A 3SR0A 1CRQA 2ZRHA 1KMHB 2AKYA 1ZD1A 3UG7A 3T15A 1UAAA 2FV8A 1J8YF 4TQAA 4BZXA 4EFLA 1XXHA 4OHWA 4NCIA 3WNCA 4BZQA 4LBWA 3GLGA 1AKEA 2ZRMA 3I32A 2V6IA 3PUYA 3UPUA 2NG1A 2QPOA 5DO9A 4PHFA 4PO1A 3EZ6A 2H5EA 4Z1MA 1Q57A 3B13B 3RAPR 1GZSA 1Z0JA 3R9WA 4JS0A 3EPLA 2QZ4A 1WRBA 4ZDJA 2LKCA 2V9PA 1NLYA 3PEUA 1E2IA 2QPTA 4M2LA 5P21A 4Q7JB 4KSCA 2Z83A 4DCUA 4XD7D 1ZNYA 4CRWB 2ONJA 4P32A 3NTUA 3NEJA 1IN8A 3TBKA 4HLCA 2RKOA 4Q02A 2ZR0A 3GLIA 1UM8A 3DVLA 1SXJA 5JZVA 4UQOA 3A1UA 2ZE5A 1G8PA 1HQCA 3MSXA 5KU1A 2WOOA 2GEUA 4KBGA 3CONA 4LJYA 4RVCA 4OJQA 4M9QA 4M9XA 4FMBB 4B71A 1T4GA 1LY1A 2IWRA 3NC1C 2IYTA 2AHOA 3MUFA 2ODEA 2AR7A 2DHRA 1W5TA 4RJLA 1A1VA 4C2TA 2IUSA 2I1QA 3LLUA 2GCPA 2BM1A 4G5SA 3IEUA 2XTNA 2QORA 1E96A 4DLRA 1ZUHA 1R0YA 2DFKB 2HXYA 5GJWC 1OH6A 1NVWQ 2VP6A 2PT5A 3KL4A 3QVVA 2GTPA 3AGQA 2JLWA 2ZS7A 4BEJA 3KQHA 2EVWX 2P6NA 4X8MA 2ZUCA 4PQRA 1II0A 4GP7A 1MO5A 2VHQA 1OKKD 1CKEA 2QBYA 2KBFA 1PLLA 4D4LA 5AUNB 2ZRDA 4HDOB 4LSGA 4Z8YA 4N0DA 4O2RA 4E09A 1A7JA 5FBQB 2VHUA 2ZRPA 2GXAA 4CEHB 2W0MA 2ZS8A 1ZJ6A 2OLJA 4JLOA 4TQUS 1VG1A 2XJ9A 3PENA 4LJ5A 4Q9HA 3DDCA 2K5UA 1NMXA 3QXHA 4KBFA 3SJAA 1SQ5A 3THYB 1ESMA 1N6NA 1GTVA 3SN6A 4CEJA 2WKPA 2Q9BA 3HDTA 3QIAA 1E3MA 2DYKA 4M9SA 5EJEA 2BVNA 3GEEA 2ZQ5A 3RANA 4D0GA 4EFMA 3ZDQA 1WB9A 2PEZA 4OQFA 2PL3A 1FX0A 1NL3A 2CLSA 2WICA 3WRXC 5FOWA 4QGHA 3RS3A 3EC2A 1E0JA 5BYJA 5TDHA 3A4LA 3BH6A 3RNLA 1M74A 2GXQA 2TMKA 2GBLC 4TL8A 3KKMA 3AP1A 4YMSA 1XTRA 3RLFA 4US2R 4Q9IA 4BRUA 4HYYA 4AKIA 5EP2A 4NBSA 5IF9A 1G8GA 1N0UA 3QKRA 4ON9A 1COWD 4NMMA 5G3YA 3P4XA 2IS2A 5CJ2A 2RGBA 1L4YA 3MWKA 1VG9B 1LNZA 2FPKA 4MYUA 4PO8A 4RSGA 2YWEA 1WE2A 3ONWA 2QROA 1G4UR 421PA 1EFRA 1IY0A 3W8NA 4LZZA 2GNOA 3FYHA 4CDGA 3JVVA 5EP1A 2VP9A 5ANRB 3M6AA 1LFDB 2FGJA 2EFDB 4R9UC 4LHWA 4NHOA 3Q3JB 4B2PA 3THXA 1W4RA 2Q21A 2ZSDA 1QHSA 2ZI9A 4CEIB 5KPJA 3H2YA 521PA 3F8TA 5JRJA 1FPMA 1II8B 4BGDA 4MYCA 1N5IA 2P65A 3CX6A 3Q9LA 3V9PA 1UBCA 5E7JA 2D4HA 2QP9X 2F55A 3C16C 2V4ZA 4WAUA 2IL1A 3Q7QA 4AKEA 4NYIR 2IF2A 2OO7A 1E99A 2G1KA 2ZYWX 1I4LD 3JVUA 3KTAA 4PHHA 4TL9A 1D5CA 4D4MA 5KUTA 2C98A 3ZZTA 3MG9A 1D2EA 2F3TA 2O8BB 1YZUA 2Q9AA 1AN0A 1HE1C 2HUPA 1K5DA 4A0RA 4EPWA 1J90A 1Z3IX 2P6RA 2IUUA 2NGRA 3P4YA 2C77A 1V5WA 1NNEA 3EXAA 1MH1A 4ZO4A 2G88A 1DADA 3SYNA 2QG6A 1JPJA 1DAFA 2HEIA 2V7QD 4US1R 3B1VA 2XOKA 4TSFA 1XTQA 1CIPA 1U90A 1UFQA 4WOPA 2DR3A 1OH7A 1NMYA 2YKGA 4LV8B 1GP2A 1P62B 1ZD9A 3A1WA 4N3NA 4CT4B 1F5NA 4JSYA 2VF8A 3K9LA 2HJGA 3QPWA 4AIIA 3AF2A 5L3QA 4OI0A 2EYUA 1CJVC 2J41A 4Q48A 2PMKA 1G7TA 4B3FX 4M9ZA 1OIWA 3F5FA 3ZQ6A 3KJGA 1EESA 2DWQA 5G3ZA 5FBWB 5KNCA 1HTWA 2BBSA 3GLHA 3IKJA 2BMFA 3B78A 3THWA 4O3MA 1L7VC 5DE3A 2BCJQ 1NVVQ 2PH1A 4PC6A 1DO0A 3GJ8A 4EIWA 3CNOA 4Z54A 2XSZA 1P9WA 1E9AA 2RGXA 1H8ED 4JKYA 4TYQA 4DDWA 3VR4A 5D3QA 2A5FA 3KKNA 1G17A 2F43B 2WMNB 3QUSA 2ZJYA 4C0QC 3DM5A 2RAPA 1MKYA 2VHCA 3VR1A 3VTKA 3AF1A 4ASUA 2IYLD 4RD1A 5K8TA 2EW1A 5DSZA 2O8DA 4A1FA 1IJFA 1Z6XA 2ODBA 2CL7X 4GFDA 1KO5A 1OFHA 2XXAA 2J7PA 4O2LA 2ZVQX 4CF7A 1XD2A 4HZIA 4NTZA 2WIBA 1XBTA 2E87A 3K0CA 4JVMA 4RD2A 1JJ7A 2BCGY 3CX7A 1CRPA 1W4CA 2ZXUA 2JLVA 3QG1A 4UXJA 1U81A 3BS4A 3ZVNA 5JCZA 4B2LA 3NVAA 2KI5A 4IHQA 4EPRA 2YOFA 1NBMD 4FI3C 2OCYC 2RHDA 5JS7A 4BASA 1VG0B 2FG5A 2B92A 4C0LA 1CBUA 2Q9CA 2GXSA 4B3XA 2SHKA 1HQYE 4TQ9A 3T35A 2G0NA 3ZZ0A 1E0SA 2W83A 1ZUIA 5FPHA 1W2HA 2ORIA 3W5JA 2W0SA 1QHNA 1N6IA 1UKVY 2JIZA 1ZNWA 1WBDA 4OQXA 4UXIA 2ATXA 1PJRA 4C3ZA 3WNBA 2WOJA 2OLKA 2IEYA 4IXMA 3AQ4A 4OHXA 3ZS8A 1RKBA 1G1MA 2OBNA 4DUGD 2J7KA 3K0AA 4BWYA 5GJBA 2JDIA 3NH9A 2VRWA 1IHUA 4A8JC 2EWWA 1I2DA 2BEKA 3AUXA 1TTTA 3QKRB 2B8WA 1IN6A 4DLSA 4PSAA 4QJ5A 3SEAA 3K9NA 2RGAA 5JI2E 1GKYA 5H68A 2A30A 4MKGA 2O8FA 4OI1A 1XEXB 5FTLA 2R6AA 2Z5FA 3SYLA 5B2ZA 1ZUNB 2GRJA 3IUYA 4JJKA 2GKSA 2YWFA 1JR3D 5JI3E 4MRSA 1T3SA 1QHGA 1S1MA 2BBTA 2HXSA 4HI0E 1ETUA 2F9LA 3KB2A 2WPDA 3M1IA 3AB3A 1Q1QA 4DBLC 4CVNA 5DISB 3GJ0A 4MKIA 221PA 4KI0A 4MKFA 5HR5A 4URXR 3KKOA 1IBRA 2JASA 1OSNA 3Q85A 2I4IA 1S3SA 1Z08A 3PEYA 1W0JA 3TR5A 2AFIE 4I1OA 4B76A 4TLCA 2NZ8A 4LWZA 1E2DA 3IIMA 3F0TA 3S1AA 3A37A 2OESA 2Q3MA 2IT1A 2J45A 3C14C 2IYUA 4IRUB 2CCJA 3RWMB 1PV4A 2R6FA 3L0IB 1YE8A 3FHOA 3IBGA 2FWRA 4MRVA 1E94E 4F4IA 1Q1ZA 3EG5A 4LJ8A 2OCBA 4JIMA 5DGXA 1Q12A 4LHZA 5AJXA 2F3RA 4TMKA 1ZCAA 2IYYA 1KNQA 2VP4A 1VG8A 4JT4A 2I3BA 3I4LA 3ZJYA 4JLPA 3W8RA 1ZD8A 4KVGA 5FTJA 4KFRA 1G16A 4MYTA 1R10A 2HCBA 3AKEA 3LBNA 1P73A 2KBEA 4P4SA 4DCSA 4GOXA 1VCOA 1QDEA 3OE7A 4FXPA 2NOAA 4HZUA 4ARZA 1WF3A 1KHTA 3AGPA 1DARA 1AZTA 3FFAA 4RD0A 3SBEA 3EWAA 1GITA 1R2QA 2VA8A 3P1JA 4BZPA 2IYSA 2QU8A 5CM9C 3B60A 4TN1A 5EZ5A 5KHOC 5HKKD 3A4NA 3QVUA 1AGPA 4DB2A 1P72A 4DSTA 2V6JA 4RCYA 4CT5A 1NBME 1XEFA 3T1QA 1U8ZA 1E9RA 1J8MF 1P6XA 3THOA 4B75A 4TMVA 4B6FA 1XPUA 5EXXA 2CJWB 5GJCA 2ZJOA 2W6JA 2ZI5A 4LJAA 2VTKA 3R20A 5TXGA 2VLIA 2ZJ2A 4D82A 4H1VA 1D8TA 2ERYA 2WWFA 3FKSA 3OF5A 3QXSA 4DDTA 3G5UA 2OCPA 5K8LA 4TLAA 1E79A 3O8DA 5IRCD 4TZ6A 5AR1A 2XXAB 1E2GA 4BFXA 1OHHD 1CS4C 1E9FA 1M7GA 2FPLA 3EASA 3NWJA 4Q19A 4QGGA 3ZD7A 2H57A 3AVWA 5CDFE 1E32A 1Z0IA 2KSQA 4B3BA 5GVSA 2V1XA 3CR7A 1KSJA 2PX0A 4TYPA 5JWOA 2ZI3A 1GIAA 4KLNA 2ZUBA 3IDQA 5A4JA 3NBZC 1TU3A 4AYXA 3K1JA 1NN1A 2QAGC 5C2JB 1JR3E 1E2MA 1ONBA 4I1VA 2WBLC 1T0JB 3EZ9A 4DRZA 2IYRA 3CRQA 3TVDA 3C41J 3V00A 1N6OA 5CLLA 1VHLA 2RGDA 2VPPA 4PO9A 1AQYA 3T12A 1KDTA 1YRAA 1KDPA 4MITA 3TRFA 3I61A 1TAGA 4KITB 4O25A 3C15C 2MSDB 4DSUA 2PLRA 1E9EA 2VYFA 5B30A 2PJZA 1KI8A 4MH0R 1DAKA 2BMEA 2FH5B 4QBHA 1S9DA 2JLSA 4IFEA 2AN9A 4GNKA 1CLUA 4NZYA 1GNRA 2C9OA 3GJ5A 1M1YE 2WVJA 2YC2C 2AK3A 3AVYA 3GLFA 3CH5A 2ZRCA 4PPNA 3U7HB 3TSWA 1OF1A 3RRMA 4BLRA 2PCLA 5J4LA 3U44A 2GJKA 3C7KA 1KSGA 4Q4HB 4GZLA 3ZQJA 3U3OA 3EZ2A 2R65A 2QE7A 5KSPA 3NIBA 1Y63A 5H70A 4XOIA 2FMXA 1OH5A 1H8HD 3UIEA 3RS2A 3H0KA 5AWFC 2ZU0C 3TR0A 1KO4A 2GJ8A 2G1JA 1UF9A 5CYOA 2QT0A 1RYFA 2VEDA 2NO9A 2JGNA 2ZAOA 2GBLA 3HU1A 3QPUA 3HR7A 4KFSA 4Q4LA 1VIAA 5EXPA 1KYIA 1LF0A 3U4QA 4NYMR 1TX4B 5JWHA 1FQJA 5J40A 4BLSA 4YQFA 1W36B 3QSYA 1EGAA 1W46A 1T3HA 2A5GA 2AWNA 1ZBDA 2O5VA 5KYKA 2H18A 3WHKA 2BJVA 2O0KA 1N5JA 4B44A 2YYZA 1JAHA 1FMLA 2JJ8A 3I73A 3IPXA 1DS6A 4KCGA 2FPMA 4HAYA 4QXAA 1UDWA 1MABB 1UADA 2AL7A 2EWVA 3P26A 1KY2A 1FQKA 1MRSA 2J9RA 2XJ4A 4Y0AA 1RJ9B 3LVQE 4M53A 4RFSA 5B58C 3ZIAD 2ZRBA 5FOTA 1E69A 2KJQA 2NO6A 4US0R 5JBQA 2BV3A 1TNDA 1E2JA 2B7CA 4P4SB 4FD2A 5CB6A 1Q1EA 3RSLA 3A1TA 3ND8A 3UMSA 3W90A 4DCNA 1D9ZA 5KNDA 1U8AA 2CDNA 4HB3A 3FMIA 2HJVA 3AKCA 1RIFA 4TYNA 4TMTA 3FOZA 4QRHA 3W3AA 1F2TA 1VYUA 2IS4A 4F92B 2P5SA 2GJAA 2QM7A 1GAJA 2J0UA 3BFXA 3RVBA 1QHXA 1G291 1G5RA 2BDTA 4HEJA 1RRPA 1VKJA 5HTKA 1IONA 1P3JA 2HT6A 1NKSA 4Q4AB 4L4UA 1XMJA 4QBIA 1HUQA 4H9GA 5FUYA 1R6BX 4XTCS 4AKHA 1E9BA 2HF8A 1PLJA 2AWOA 4LBZA 1Z0AA 3BXZA 3QF4B 1SHKA 1VYVA 2RH5A 3DL0A 3R7WA 5BW8A 3W5IA 5FL7A 3VU9B 1X3SA 3U3KA 1SULA 4W5WA 4MGYR 4TLDA 4FIDA 1DG1G 3CM0A 4IOJA 1P60A 3AM1A 5EZ6B 1BMFA 3SQXA 4DLXA 2D2EA 4YMUA 2BC9A 2ZYVX 4WXRA 2OBLA 3I62A 1GDDA 4RCZA 5JECA 3ADCA 5F9HA 2N42A 5FPSA 5FR2A 4RZ3A 1HA3A 1Z6AA 4P4TA 1Z63A 2V54A 4II7A 3HPRA 4IKEA 2WJIA 4LHXA 4QKQA 3ICEA 3SJBA 2Z4RA 1BYIA 4KLZA 1QZXA 3BERA 3IGFA 1TQ2A 1XCMA 1ZRHA 2QSZA 1E1QA 1TL7C 1W0KA 1RW4A 2FFBA 3DO6A 1XJCA 4BFTA 1E1RA 5TVKA 3OEED 4G0NA 4YDSA 1J70A 4LY6A 2J1LA 1M6NA 1IXRC 4M22A 1VMAA 3SJCA 4DKXA 1TF2A 4E22A 2NZJA 2X19A 5AJVB 3U61B 2ZSFA 3QKTA 1XPRA 1N6LA 2OHFA 2REBA 2VO1A 3LQQA 4GPTA 5D3MA 3UXMA 1RZ3A 2NMVA 4Q1BA 3R9IA 1U0HC 2E9SA 4ZCLA 1T0HB 2ZEJA 3X1XA 5FFMA 1TQ4A 3FHTA 3OEHA 2OE2A 4W7SA 4CGZA 4M1TA 4U7DA 1KI6A 5JRZA 2OBMA 4NU0A 3Q5DA 4X8LA 4Q7LA 5KDOA 3WYGA 2LKDA 3FGNA 2FU5C 1XDBA 3A58B 4NPHA 5DI3A 2BBWA 2FFHA 3RS0A 4ZIRA 1G21E 1OXUA 2ZVPX 3F3YA 3RRNA 5L3SA 4YXWA 1OIVA 1RFLA 3BBPA 5CB8A 1KK1A 1YJ5A 4CW7A 2XZOA 2ZANA 3IQXA 3TAUA 2OT3B 1BS1A 2WKRA 2PMDA 5TMPA 5GADl 4G3XA 4OYHA 1AS3A 5DYGA 1OLOA 3LBIA 1OXTA 2FSIA 4A8JA 1TF5A 1DAMA 4R7ZA 2R62A 3LWNA 2BEJA 2NTYC 2VH5R 3NHAA 3DMDA 2FEOA 3QQ5A 3CBQA 3BB3A 2O8CB 1Q0UA 1ZC3A 4DLYA 5FOSA 1QRAA 3TJZA 3FMPB 1ZP6A 4NCKA 1W44A 3AUYA 3OFNA 4R2IA 4HUQA 1O87A 1FMJA 4ZI3A 4NKRA 4Q00A 1VDZA 3NDPA 3K53A 3WYFA 5E7IA 3PEWA 2XNDD 2D7CA 1UKEA 1NLFA 2JAQA 3DOFA 3U2QA 3K0FB 2H17A 1KJWA 2ZYTX 1NIPA 2A5DA 3GJXC 4TL7A 1F2UA 1KI3A 1T9HA 4JSTA 2ANCA 5IK2A 4AYTA 4DLWA 4WIAA 1FL9A 2FE4A 1W1WA 4LBYA 2BJWA 4LHVA 4BLOA 1HYQA 4JLJA 1R5BA 2N1BA 4PC1A 4Q47A 4V03A 3VNUA 1S2MA 2AK2A 2OFXA 3HU3A 5JCPA 1GRRA 4KVAA 4C30A 5G53C 3P32A 2FNAA 4PFSA 3EZFA 1OB5A 3BE4A 1N6PA 3KXKA 5CM8B 1GM5A 4PR0A 3WP0A 2DPXA 3PFIA 4JLAA 1XZQA 5CIWA 4IEIA 3QI2A 5EXSA 3FKQA 2ZYUX 3BJIC 5DYIA 3TVTA 1KI2A 1TUIA 4LYAA 4DWJA 1PZNA 4ZKEA 4TSFD 4G5OA 2GJ9A 2C78A 2FSGA 1XU4A 2KB0A 1UBGA 1XJ0A 5FTKA 3CW2A 3AP2A 3QKUA 1XF9A 1CR1A 1R0ZA 4DZZA 1GG2A 1VHTA 3EPJA 4DJTA 4L8GA 2OZEA 3GFTA 3LAWA 4F4CA 1E4YA 2VP5A 3TKLA 1ZYUA 3KXLA 4TLEA 2BMDA 4YC7A 2JLYA 1CP2A 2PZFA 4JYCA 2P0EA 3DMNA 5EP4A 1JPNA 3SDZA 4CYMA 3LXXA 3U6BA 3SI7A 3W9YA 2BBOA 3CR8A 5E4FA 2O0HA 4TTPA 3WRYC 3BH0A 2XSZD 4NH0A 1R7RA 3SBDA 2J5XA 4OQNA 2DB3A 1KKLA 2GJSA 4B3CA 3EX7C 2ZRIA 2OM2A 2FX3A 4XD7A 1G20E 3QKSA 1DAHA 1UPTA 4IOKA 2JLZA 1KZGB 4ASUD 3GJ3A 2LWIA 4I81A 1XP8A 1ZCBA 1XZPA 4AG6A 1JEEA 3O8BA 4G5QA 1G18A 3PUXA 1FFHA 4B74A 3EA5A 3AKYA 2BM0A 1OYWA 3U6KA 3FHCB 3KQUA 3TSOA 3DPUA 3UK6A 2BKEA 2REXB 1A82A 2RGGA 4UNPA 4E07A 4QM6A 3DOEA 2UVQA 1JR6A 4G1UC 4GOKA 1UBEA 3NG1A 4OHYA 4JZKA 2YOGA 1RRFA 3W6OA 2RMKA 2AKAB 4PC7A 2IWHA 3OIUA 5LD2B 1U99A 2P67A 3B7GA 1XXHB 2O0JA 2WKQA 4B32A 4EQ6A 5F9FA 3GLGB 5JSZA 4IDNA 1E2EA 2BWJA 1TQDA 2UZIR 1U0LA 2FA9A 1GL9B 1X8KA 2D2FA 4IOLA 4NYIQ 4V0LA 2QGNA 1QHHA 4S35A 2YWGA 5B64A 2CEAA 3ICQB 2P2LA 5HCNA 1KI7A 1CJKC 1OPXA 2QNRA 1RPZA 3ASZA 4A2PA 3REFA 3VKWA 4JJZA 1AIPA 1OKKA 3L8ZA 4D26A 4OK5A 1YRBA 4V0NA 5L8VA 4RD3A 5CK5A 4ZCIA 2RGNC 1YKSA 4QHYA 5BXQC 1QHIA 1SVKA 2A5YB 3LX8A 4DDUA 3GLIB 5FOXA 3W3ZB 1SXJB 4QNRA 4LYFA 5DIFA 1NY5A 2IUTA 3B82A 4PZZA 5CJPA 3TSZA 3VQTA 2ONKA 3DZ8A 1HT2E 2REOA 2F6RA 4GBMA 3W6PA 4IDQA 1S4QA 4UNQA 1ZM4A 4HDCA 3AVTA 4POAA 4BLPA 2WPDD 4G01B 5JHGB 5UKDA 4MQBA 4EJSA 1BYUA 3NBFA 4ACAA 1TEVA 3ZVLA 2VHJA 4LJ4A 4YLGA 3KJIA 4OK6A 1XMVA 2JJ2D 2A3RA 2GCOA 1P75A 1US8A 4ITRC 3VX4A 2CNWA 2EFHB 2YWHA 2CLDX 2C9YA 2RGEA 3IHWA 1COWA 1Z6YA 1OYYA 1UBFA 1ZM7A 3LA6A 1KOFA 4FCTA 4YMWA 5DLQC 3TQFA 4GOJA 4D4KA 3MWLA 2ZRNA 3E1SA 2C04A 2FDCA 2QBYB 4LUCA 4URZR 1E6CA 4RY2A 1K6MA 3RRZA 3WNDA 4FN5A 1MOZA 2WHXA 3DKPA 1JECA 1G3UA 2G77B 3BAFA 3I5YA 1GNPA 1XWIA 4CEJB 3DHWC 1M34E 2FJUA 5G41A 1E0AA 3EAQA 3LQRA 4BQSA 4MGZR 3K09C 1E98A 4TTRA 5EQTA 5TY0A 3OZXA 4EDHA 1ZU4A 1JI0A 2F9MA 3MMPA 1FX0B 2ORWA 4NYJR 2CL0X 4GL2A 1W2GA 4IOMA 4GMXA 2O8EA 3QEJA 1G7SA 5IHPA 1XMIA 1CU1A 4A6PA 1P4SA 4QFMA 4QBGB 4V0ME 1MO3A 3UANA 2AD1A 2OAP1 2ZTSA 5LPNA 2HT1A 3GEHA 4C7OA 1Q21A 3PUVA 2DBYA 2XTMA 2ZSBA 1YR6A 3D7MA 4M1WA 4JBYA 2JLXA 3X1WA 3BRWD 2IYWA 4A36A 2GEDA 2PZEA 1ZM2A 4AYWA 1DPFA 3L0PA 4P4UA 4TMWA 2QMHA 3A8TA 3Q7PA 3QPVA 1AK2A 2JJ1A 5KNBA 2V7QA 3AF4A 3L0SA 4BFWA 4TMZA 1VTKA 4NDZA 2DWPA 4QJ4A 1VYTA 1B0UA 1Z2AA 4GRAA 3L8YA 2NO7A 3KJHA 5FL3A 1C4OA 1WMSA 4B47A 3THXB 3EIHA 4DSOA 1GL6A 2GF9A 3VR3A 1E79D 4AD8A 3O47A 4BFYA 4F7WA 2QAJA 1SVIA 1E2FA 4IFBA 4ZDKA 1A5TA 4GDFA 2OCAA 3UMFA 3BK7A 4ESHA 3G0HA 4DCVA 3R8CA 2PJRA 1XD9A 3V4FA 1WA5A 4C0AC 5FTNA 3IIKA 3A1VA 4OK3A 4URYR 1S0UA 2O52A 2ZRFA 1G9XA 4HAUA 4Q4JA 3KTAB 1P2UA 4FMCF 3MWYW 2Q0HA 1JJVA 4A4DA 4FWIB 5JFGA 5LBIA 2P3SA 1A2KC 4DLZA 5JLJA 4LC0A 3AVUA 1QHHB 4D81A 3RDPA 1EFHA 1KJYA 4XTRA 1G64A 3EARA 3GFPA 3OIVA 4PC3A 1ZMXA 2E1RA 1GL7A 2D74A 1FOEB 1KZ7B 2NPFA 1XRJA 1XCGB 4B6EA 4TZ0A 4GSYA 3OAAA 1DTSA 1S96A 3HWSA 1OFIA 4BECA 1IN5A 2NQ2C 4AC9A 1M2OB 3LRPA 3T1VA 4B33A 1SKQA 3KUDA 4URUR 3GJ7A 4PZLA 3GD7A 2R6CA 2QT1A 4QGFA 3MGCA 5L3VA 2WM9B 2FFAA 1NBMA 2B21A 1SGWA 1Q1BA 3Q8XB 5ELXA 5EUMA 4D0NA 2YNMA 2FEMA 5L3QB 4HLUC 4EPTA 5CK4A 1LS1A 3L2OB 1JAIA 2ZM5A 2QE7D 1KO1A 4E5UA 721PA 5BWMA 1SVWA 4E03A 4PXAA 1Z6TA 1FW6A 1ELOA 4EJSB 3GP8A 1SKYE 3GLHB 4KO8A 5A5GA 1YZTA 3I92A 4QHSA 3THWB 2A7QA 4IEEA 4LYJA 2LCFA 4K81B 2B8TA 2FSFA 4EPVA 1OJLA 2F1JA 3LW8A 1QVAA 1AZSC 1JBKA 2IYZA 2PT7A 4QGAA 2EYQA 5TARA 2IS1A 4FMCB 1UJ2A 3BB1A 1ZU5A 3LY5A 1Q20A 4Q01A 4QNMA 1NY6A 4XIGS 5DNYB 2O8DB 2W2VA 2IS6A 4LRWA 4A0GA 4PAMA 4JBXA 3IEVA 5KDLA 1XD2B 4PZYA 2VQSA 5AUPB 1XTKA 2J0SA 1YVDA 4LC1A 1NN3A 3C8UA 3U7GA 4LDJA 3FPAA 1JR3A 2F1HA 3RWOA 4ILEA 3SJZA 2C03A 1M7BA 4QL3A 4JLNA 2ZJAA 1KO8A 1G8FA 1EXMA 2GILA 2GF0A 2CCKA 5EP3A 1UKZA 3OHMA 4GP6A 3WMGA 1DEKA 2ZJBA 2CMKA 1NSTA 1F48A 3K70B 3HPQA 1TMKA 1NI3A 1R5NA 2G83A 2A2ZA 1S9HA 3IO5A 4PSKA 4HDQB 3LX5A 2OFWA 2XAUA 3UKDA 1ZINA 1G7RA 3K0AB 4BUJA 1U2RA 3CX8A 1GVNB 4G5RA 3QY0A 4Q9KA 5KSOA 3PEVA 1KKMA 4B43A 4L15A 3K8YA 2WZQA 2ERXA 4Q21A 5HPYB 2O8FB 3D3QA 3PJRA 1QVRA 1VCIA 2RB4A 2ZJ8A 4QOSA 2VSXA 3X1ZA 1KMHA 2OXCA 3OESA 4KJZA 4M21A 4OI4A 3KQNA 1KI9A 1EX6A 1Z28A 2IX3A 2GA8A 5JS8A 5DN6D 4Z51A 2CHVA 2CCGA 2XGJA 1EWQA 5AJYA 2QGZA 3B85A 5FBVB 1U8YA 1R5OA 2YINC 2W6ID 3H1TA 3ETLA 1NLZA 1ODFA 2ZU6A 1SVOA 5KTYA 4UNSA 2XX3A 4HAWA 2R2AA 1CJUC 4Q1AA 4HAVA 3WHLA 1IXZA 3P27A 3TUJC 1TQ6A 2G9NA 3PUZA 1G3MA 1GOTA 1KGDA 1N0WA 2IBMA 1OW3B 1X6VA 1P9NA 1X86B 4B34A 5KOYA 3S1AB 2X77A 5TB5A 2WV9A 1ANKA 4XVUA 4MRNA 1LW7A 1I4TD 2NO1A 2WJJA 2ZRGA 4NYMQ 2GEVA 1W0KD 4IW3B 3SS8A 1S3GA 1VCMA 1XEWX 2H92A 3FFBA 4ZI2A 3CNNA 4ESVA 4JKIA 4RD6A 1XTIA 2ZRJA 1UEJA 1LV7A 4JMPA 4L5BA 4LCBA 4CZ2A 4D2IA 4D80A 3HR8A 4R98A 4YDHB 4A2WA 1TEXA 5FBRB 5J4KA 3KB1A 821PA 3WMFA 1NN0A 1SKYB 5DHFA 3LLMA 1DE0A 3CZPA 1BIFA 2OSBA 3SYKA 1E2PA 3AV0B 1CJTC 1OXXK 5IDVA 1YR7A 1YZLA 2WAYA 3TIFA 1KK3A 1NSFA 3LDAA 3OEHD 2ZPTX 1P61B 1RYHA 4HZUB 1LF5A 4ARZB 2J0QA 2Z4SA 1Z5ZA 3HJNA 3NC0C 1GFIA 4Z1MD 3KXIA 4W5HA 3MCAA 1PVOA 3KZ1E 2Z43A 4EPXA 4M8NE 2CVHA 2AD5A 1I4DD 4IDPA 4K46A 4PQFA 2OUKA 1NVUQ 1SVLA 2HF9A 4IVQA 3LXRA 1BOFA 3GJ6A 2W00A 2OXRA 4RZ2A 4PSVA 4YXWD 1W47A 2ZRKA 4KHZA 5HE8A 1W7AA 3ZZUA 1SXJD 3PQCA 4Q1EA 5M04A 2ATVA 4DT1A 4L9SA 2X2FA 2IHBA 3THYA 1YU9A 1OIXA 1G3QA 4K8OA 4B73A 4MUBA 4EFNA 3I1FA 2C99A 2RGNA 3GFOA 3BOSA 3JZMA 2JATA 3EC1A 2CK3A 1G8YA 1RRGA 2GXUA 3T5DA 2WSSA 5FUWA 1KY3A 1IN4A 2OG2A 3RS7A 3N70A 4JLDA 4LJ9A 4TL6A 1EWRA 3BC1A 1N0VC 1GKUB 4P31A 3WY9A 4D25A 3KFVA 3AVQA 4MGIR 1E0KA 3NEYA 4FINA 1MRNA 4PAOA 5CYPA 2GHIA 4UNNA 1KK0A 4C2UA 1W4AA 1R4AA 1PUJA 1VECA 1H8HA 2VP2A 1W36C 4LOAA 3T5GA 5KSYA 2ODWA 2Q3FA 2JEOA 1KI4A 1P9RA 2DFTA 2KE5A 3FMOB 2HYIC 4JVLA 3B1ZA 2CE7A 5KPDA 3R9XA 4EPYA 3IBYA 4PPGA 3QXJA 5HCIA 1NG9A 5TV2A 4OI2A 3T1TA 3CB4A 2WSMA 1Z2CA 5A0FA 1EFCA 3Q72A 2HV8A 3FB4A 1FUKA 4NONA 3C4JA 4LYHA 2ZSAA 2FZLA 3VX3A 5E95A 1YHNA 3TMKA 1K8RA 1PLKA 2DY1A 2QI9C 1G19A 3SQWA 2Q3HA 3G82C 4H1UA 1YZNA 2EFCB 2HLDA 3U7EB 3CKLA 3VKHA 2UKDA 3T61A 4CEIA 3X1DA 1EK0A 1W48A 2GCNA 4JLBA 4C4PA 4WW0A 5DH9A 3GLFB 3QENA 4XSHA 1II8A 3U5ZB 1G41A 4NCHA 1IQPA 1R8QA 4O0MA 621PA 1U9IC 2IXFA 5J4HA 2C9CA 4JYBA 3U44B 4LJ7A 2QSYA 1L8QA 2N46A 1TUEA 2W2TA 2GDJA 1XB2A 3QOFA 4P3YA 3ZIAA 3VHLB
chains in the Genus database with same CATH superfamily
2PLWA 3LUFA 3K09A 4D9MA 2XR1A 3MGGA 4RZIA 1PJ3A 4YUAA 3O4VA 3U4AA 3TUIC 4GUAA 1MJGA 4CDNA 1Q2UA 2XADA 2G5CA 4UDOA 1SPBS 2O8BA 4HP8A 3SZGA 3SX0A 1XPJA 8ABPA 1DVRA 3RRXA 1W5FA 2OSVA 4ENPA 1NBIA 3PG5A 1IBLB 1ESNA 3I2GA 2WT8A 4LNUB 3EG9B 4RK7A 2HBZA 2PGNA 4EUKA 2ZWVA 3CT6A 5CIQA 2VRNA 2B69A 3MUEA 4MZDA 4YP1A 5ICGA 5EKSA 2D1RA 3E58A 3WGTA 1KMQA 1ZM9A 3U4QB 4MYDA 4XX0B 3AIKA 3Q3HA 4Z86A 5FBLB 4KO1S 1NQ5A 4G4SO 3T5PA 4OBEA 1XRRA 3CVYA 5A5EA 4DR7B 2PWPA 4M7RA 2GAJA 2C58A 2IC5A 3ZDYB 2FOLA 3OQNA 3P97A 5HMLA 1NZFA 6Q21A 5K3OA 3SQDA 5K20A 4GZ6A 2JKVA 1V4NA 4FFNA 2VAWA 3DNPA 2YW2A 3A6FA 4HNAB 5CLIA 3PTZA 2FN4A 1OFGA 4GOMD 5CPFA 3M0EA 4PE5B 4DZTA 4DR6B 1F8XA 2QP4A 4DA8A 3LD9A 2ZXFA 5T41A 5C9ZA 4TVKA 2WYUA 4M4SA 1SXJE 3E3OA 4Y2UA 4ZALA 4B35A 2PKYX 2HIAA 2I03A 5K6TA 5BWNA 3M3DA 3CZ4A 3D8TA 5K01A 1XCPA 2RC6A 4JLKA 4P3PA 2X1MA 3B7WA 2ZB7A 2ONYA 4N01A 4BJ1A 5LP6C 2IKSA 2ZI4A 5DM1A 3MOSA 4UUAA 1KORA 1NUPA 3UATA 4GZ5A 3CX4A 2IY9A 1KXJA 4WCDA 4FBMA 2AX3A 3UAXA 1XTUA 3JD0A 2NADA 2VIIA 4P82A 4I66A 4LF8B 1Y1QA 2RCYA 3FRHA 2CHUA 1CDEA 1N8KA 2DQYA 3GYGA 4UAGA 1XVAA 4EYQA 1F2TB 5KYNA 4S0ZA 3TUZC 1A96A 2A4KA 5IN5A 3A06A 2EJWA 1RM3A 1NFRA 2DLCX 1AS0A 1D8AA 4IX9A 1NXXA 5H3HA 2VTBA 5LB2A 3AR6A 4MRPA 1RXSA 3DEFA 4R71A 1OJ7A 1HZZC 1FFGA 3HFRA 1MDFA 2VDJA 1RQ2A 3BIOA 6ABPA 2I54A 4HO1X 3SYMA 3ZD6A 3LP6A 5DTJA 4IIJB 3R7WB 4OKSA 1P33A 2J87A 3FNEA 2B6HA 2OV2A 3H2GA 3PWSA 4LZPA 3COWA 3RS5A 2CJFA 2A9PA 2C0PA 3E9CA 4JJAA 1R0CA 1CR0A 1SBYA 2FZ4A 3G2QA 5K3FB 1YB4A 2H07A 3Q87B 1G2PA 4M1MA 4FI3F 2LCQA 2F67A 3UG6A 3EW9A 1GN8A 4DVGA 1QC5A 3HEMA 5KVAA 1OBCA 4LK2A 3SHVA 4ZVLA 4XYMA 1T6NA 5KNCD 3GMTA 4R8SA 5A03A 2XNSA 4GNRA 2VQDA 3ZY3A 3T54A 1B6SA 1NRWA 4QAQA 2CF6A 2DWOA 5JYBA 4A6XA 2PY6A 3K0EA 1KSFX 4WCFA 4UBNA 4ZXPA 2QF7A 3GJ4A 3M4JA 4TYYA 1E60A 2JI9A 5GMOA 2DJ5A 1XNGA 2I4LA 3WYEA 4EB6B 1FYEA 2XGSA 4CXMA 1K7SN 2ZIFA 1XR3A 2ORED 3ZGVA 1OFTA 1YDHA 1FJXA 2FWJA 3AUUA 3CLVA 1PW5A 3G7SA 3IULA 3BTSA 4RIFA 2G9RA 3PR2B 4MKRA 1D7OA 3B6IA 3QJGA 5DXJA 4A8PA 4E33A 1QF6A 3VR6A 1FP7A 4AMVA 2BMJA 1GU1A 5KHAA 6AT1A 1CR2A 2XMCA 1NF8A 4YJ3A 1C0PA 3L6RA 4ZT6A 4Y8VA 5LOVF 1VP3A 1HKHA 3UMGA 1ISMA 1IHOA 2XCLA 1KU6A 3X2SA 2CLHB 1UODA 1HV8A 1YRLA 2V7PA 4UCFA 2ORVA 2YBEA 3N8IA 5ES3A 3T3EA 2CBZA 2EEZA 4KO2S 4A8TA 5J2TA 1G8AA 4X8OA 4JB8A 5ALUA 5HK9A 4RD4A 3BH7A 4A2QA 5KJ6A 2C7QA 2MJLA 3EODA 1L9XA 4MCJA 4RSMA 5FPPA 3T3IA 4LSMA 1XMOB 4ZOLA 1SQ0A 2P6MA 3AFIA 3S4YA 3ZVRA 4EATA 2EW2A 2W98A 3DWGA 2P5TB 1WCWA 3CTPA 5FI0B 5IG2A 1QLWA 5KCZA 4U7JA 1YCDA 1E7RA 2A9QA 2AN3A 3ZWKA 1RJGA 1A4RA 2XNDA 2DY0A 2NUTB 1J0CA 2DHEA 3H5TA 4JY7A 4JXJA 3PYXA 2PZKA 4GGMX 4MUGA 3RCBA 1LBQA 2W6OA 3CUYA 1P80A 2X3FA 3DWFA 3L4BA 5IC5A 5EJGA 4M36A 3F71A 1HLDA 2V97A 4M0DA 4P8RA 1DCFA 5DI3B 3DAGA 4R8RA 3WB2A 1JZSA 3DD5A 3R8FA 3E15A 3TK1A 2GETA 2I8CA 4FHDA 2QTLA 3RUIA 1DI0A 4WESB 3NYIA 3Q6IA 3CNLA 4RKYA 4IL5A 4J1TC 5CP8A 4ARSA 3QXXA 1JAYA 2MMGA 3ND9A 5EE9A 2UZ3A 5E6SA 4YAIA 4QM7A 2JJMA 1CQPA 4CLEA 1UUFA 1N33B 4BN4A 4HQOA 1WM1A 4J0CA 4LPSA 3QUQA 1BXKA 1DBQA 1ZOOA 2R1VA 4PW0A 5HIAA 4FZVA 5JTTA 1C29B 3L7IA 4EB0A 3CZCA 3V1LA 5KNBD 1YJQA 1CJMA 3PNPA 4EY3A 3NBYC 3FDZB 2BDUA 4L75A 4JLMA 1QFYA 2AG6A 3BMOA 5DX0A 4BWFB 5JR3A 2ADFA 2JFQA 3FCOA 4KUHA 3A7EA 5BWCA 2JIRA 1MAHA 4HQFA 4HWPA 2BZSA 4RXUA 4WERA 2XQKA 3W5HA 3ZU3A 1SBHA 1VIYA 4RLHA 5B1DA 4F3CA 3B2NA 4HLDA 4YT5A 2Z2XA 5AMXA 4JITA 4MUYA 5TT1A 1RABA 5AH0A 4FGJA 1W0JD 3W0LB 1V8BA 4G9BA 2O5EA 3ZCRA 4JUIA 4OQDA 3CPJB 1YZ3A 4UHDA 5JJLA 4DNXA 4Q9LA 3OE1A 5CFRA 5KX5B 2CKDA 3WV4A 4RIHA 1NVVR 4HDMB 1T2VA 1F2UB 3W1VA 3MT8A 2GFHA 2CMDA 2VBFA 1L4UA 3QOWA 2V7BA 4ZN6A 5KTNA 1K66A 2SKEA 1CQWA 3WLRA 1FVOA 1U94A 3FM9A 2CJWA 1S8OA 3WJAA 1WO8A 4ALIA 1ZN9A 4I7EA 4D6XA 1XFAA 1OPRA 3G0BA 4G26A 5D5HA 1QCYA 2ZE7A 3GLHE 3A4TA 3EZ7A 4RS4A 1UOEA 2I34A 3AF3A 2YIMA 4COOA 1UKYA 1ZIOA 3EDOA 3E3LA 1XPOA 3FYSA 1N3LA 4ROTA 2ZAMA 3F7MA 1D04A 4ZRMA 5C51B 5MHTA 1PX2A 1WAMA 1W6UA 3D2BA 4U02A 4W4TA 5FT9A 1GPNA 5LD2C 1IJBA 2QA5A 2IEZA 5ALYA 4BQRA 4HD8A 3L04A 1F3OA 5KS2A 3G9UA 3BD9A 2I7TA 1FQOA 1BH6A 1HURA 2EEPA 5LJIA 2JI6A 5EGNA 1N7GA 1Z4MA 3EYAA 1U3DA 1SC4A 3VMFA 2WIAA 3OE7D 4WH0A 1NXOA 2F59A 3NU1A 3CT4A 4WV3A 1Z83A 4PEVA 1A5AB 4HGZA 2QQFA 4AU1A 3K9FC 1UT8A 3KG2A 1X0VA 3NUGA 3P9XA 5FR1A 5IDWA 2O2DA 1MAAA 4X66B 3LT4A 4NYJQ 4EY7A 2GARA 3MTAA 1U5CA 2PXXA 3LVRE 1GZ3A 3MMSA 1XIVA 5EHQA 1CY8A 1QCCA 3ICOA 3WTBA 3NHKA 1FNDA 1NVFA 1EFPB 2CGEA 3OPMA 3SQMA 3ZDAA 4NJEB 4RKWA 3VKFA 3IV9A 3B1FA 2VTDA 4BO3A 4Z3DA 3QBVA 4RM2A 3ZQUA 1NDQA 3U31A 4JUCA 2OAEA 3IR7A 3C3DA 2X0FA 3O90A 4OLAA 1EDDA 2EP8A 1OYOA 4BUCA 2RHGB 4U63A 2W6JD 3CZQA 5AW1A 1G0OA 2A57A 2GBFA 5LBUA 3W6NA 2ZB2A 2QMEA 5U1PA 2FW9A 2NZUG 3QUTA 3T9AA 4KLAA 3SVLA 5J3JA 5CT9A 1JR2A 4RYDA 1U0TA 2EJBA 2PZGA 2E4XA 1DRJA 2QLTA 2XT0A 1M8JA 4V0QA 3VI3B 2YZNA 4U3JA 4I50A 5DLDA 2HHCA 5JDCC 3RFCA 3CSUA 4YMVA 4GAEA 1CRZA 4OMFG 2O7VA 2L2QA 1D9XA 3CLSC 1SZDA 3R6TA 4QC2A 5LIRA 5LL6P 2VQFB 2WM2A 3BWMA 5BYAA 2WYVA 5D84A 3EPKA 2WU3A 1BNCA 1TK3A 4B84A 1KR5A 2Q6OA 3I9OA 4JJFA 1ZVQA 2UZ1B 4U8GA 3C1UA 2YFQA 4XD2A 1H65A 1KJZA 1ZH6A 2QN6A 2R79A 2GZHA 4I19A 4B2IA 3PFNA 2PBFA 1X7XB 2X9GA 4GIBA 4U7GA 5ALZA 2QTRA 3ZWCA 3ZEAA 1PNTA 4HUTA 3HWWA 3MSCA 3PA6A 3LRTA 5JAZA 1E5TA 4H7FA 3HZHA 2NUAA 1ODSA 3B5JA 3PRKE 2PUDA 3AL2A 5H83A 2CMHA 1JVBA 5GJVC 1H0RA 1UZLA 2GSDA 4KODA 4OHMA 2FSUA 2C54A 3W3AH 3M6XA 1Z5PA 2X8AA 5I8ZA 2JIMA 3ACDA 2FEWB 2QQ0A 3O21A 1EX9A 2CT8A 3H1GA 2DP4E 2H08A 1NT2A 1LBTA 1SHTX 2PTHA 2PZBA 4J6FA 4Q34A 121PA 1JEDA 3K0KA 3X1MA 3K0SA 4OJKA 3LIIA 4MIOA 2Y1GA 2EU8A 4F4JA 1EP2B 3M3PA 4KRXA 4FP9A 4Q9AA 1JWAB 5SY6A 1YRQA 4MMYB 3C6BA 4JLWA 3WLEA 1SVSA 3LO8A 3ANTA 5C1BA 2XB4A 3BRQA 1C50A 2ZREA 4RTPA 4W5JA 1JHYA 2PUWA 3A31A 3O94A 2CXRA 3K92A 3GPLA 3SBOA 4D4GA 4GI5A 3MJHA 2QQEA 1MABA 2PDAA 1YVPA 2J30A 1UMBB 2PLAA 1JHZA 2IW3A 2O59A 1KIAA 1O97C 4B3DA 4ZDIA 3MIIA 2J08A 3LC1O 3D3WA 2CNBA 1C9JA 3LWDA 3CZMA 2UUPA 3N8HA 3PFKA 4Q18A 2C00A 3T95A 4ZT4A 5L7TA 1CY0A 4RORA 4C21A 5CAEA 1UCFA 1ZSYA 4KV9A 2IYXA 2QMOA 2E5LB 2JHGA 4WLFA 5FBHA 5ICFA 3ZNQA 1RS0A 2DFLA 4IM7A 4P98A 4ABYA 1WETA 1RHUA 1IXYA 4IJ5A 3R5TA 3ND7A 1GZHB 1DDGA 1F6BA 3P9RA 4IS2A 3QNWA 1IUKA 2A5LA 3AHIA 2FN3A 2QRNA 4WLNA 1O94C 4OAOA 2W2XA 4AF8A 1B0AA 3CV3A 4IYRA 1F17A 1BCRA 3DZJA 3D9QX 3R09A 4IDDA 3TSAA 1DCKA 1X8JA 2QXYA 4EKDA 3RUAA 2VT3A 4F2WA 3AO0B 1UBOS 4QULA 1EEXB 4RKFA 2JI7A 4EL0A 1UBLS 2XPCA 1M73E 1VFPA 2P2YA 4X1IA 3FDFA 1G2IA 4TGLA 3OQIB 3NPAA 3W5VA 4JOCA 5C8VA 4M1OA 2R6GA 2QLJA 3LQFA 4LX0A 5ITZA 3AVPA 2HRBA 1FE8A 1ZZEA 4X90A 3L0DA 1LPMA 3QA3E 2RIRA 5KTKA 1FNNA 5AXAA 2MMCA 4F97A 5LQUA 3AP3A 3PUKA 4H27A 4EHFA 3P9QA 4BNIA 4BMSA 2BEUA 2VJYA 4D9CA 4NNOA 1QIFA 1E4EA 3S2EA 2IPXA 3ZE7A 3ZBTA 2NVBA 5JJIA 2W6MA 2ZVDA 4WXYB 1NPYA 4N1AA 1Z35A 4GKVA 2GWHA 3H87A 5I48A 1T8UA 4YT2A 1QFSA 3PXGA 5DGHA 5JJBA 3UUGA 4M1KA 1QFMA 3A4IA 3T1YB 2LDXA 1DELA 5JNLA 4WOKA 2WAXA 1V8PA 2Z2IA 3HCBA 3VR2A 2YFKA 1NW3A 4C7XA 2KWIA 4P38A 4CKBB 1KDRA 2CWWA 3GZTB 3ZCSA 3PT5A 3GMDA 4NS4A 5TLSA 5K99A 3D3KA 4JCCA 1P6UA 3LSYA 3O3CA 4C87A 5BYKA 5FTWA 1USKA 1GQQA 1DJLA 3T34A 1BMTA 2Q8NA 1TC1A 4M0FA 5LP6A 3PR1A 3B6MA 3NTXA 1KC1A 5BPFA 4AZ3A 2YBDA 2ZDGA 5HRCA 4H7PA 3CRVA 4F8YA 1SQGA 3EWSA 3AZQA 3TTWA 1W6RA 3I8XA 3AR4A 2J31A 1YZQA 3CO5A 4HB2A 2XI4A 3EZNA 1C8VB 3ZEIA 5FL7D 1GADO 3ANSA 4C4YA 1JJBA 3DCIA 1DXYA 3I8SA 3PJDA 4FFVA 4QLBA 1XL0A 2IZ0A 1KOLA 4CMGA 2H7CA 2IUEA 3CPHA 4Q6BA 3D8BA 1VA4A 2HWXA 3GI1A 3IEIA 4AURA 1QIJA 4F3TA 4AZSA 1WDLA 4Y0VA 2WJ4A 2XDQB 1HZZA 4N7BA 4WZ6A 5IARA 3SHFA 3PGKA 1ZA1A 1P2TA 2YVQA 2GN8A 1PJ2A 3AY3A 3CWCA 1CE8A 1X8XA 2FEKA 4FQ5A 4ARCA 2PR2A 4EVRA 2EIXA 3FI9A 3TCNA 2RG7A 2WSSD 3CRMA 1Z5GA 4BFUA 3WS7A 4O3MA 2ZIAA 1YIAA 1FJGB 1FUIA 3K5PA 1ZGGA 3LO5A 2Q41A 3TJRA 3DT6A 1BRTA 5KAMA 2VPTA 1SVUA 2QTFA 4UARA 4WLUA 1P5FA 1JDSA 1ZLXA 4TS3A 1PR2A 4FXOA 1ECJA 3JCZA 4RGYA 2ZTUA 2AMVA 3RRBA 3ZOZA 4CF5A 4BCDA 1IFXA 5LA6A 1OLSA 4DXAA 1PJ8A 1U7UA 3WFZA 4HXGA 4JL6A 1VGQA 3F6YA 3QF7A 3MAAC 4L8WB 1HTTA 5HF6A 4BNKA 1DRUA 5EJIA 4Y2VA 3K20A 3UK1A 2HQSA 1ZWLA 2XIQA 3I30X 4AY2A 5JO9A 3DLPX 3JAWA 3W5UA 4EF4A 2XODA 5LB4A 4BDSA 4RK6A 4BV3A 1Q3HA 2O20A 4HQ6A 1Z13A 2IIVA 4E2YA 4BLTA 4PINA 2QVGA 3PRJA 3RHZA 2AFHE 2PGLA 4Z7NB 3FXAA 2MSLA 1OROA 2HA0A 3GT4A 3OJOA 4Q4DA 3ZWPA 2L17A 3CW9A 2XWJI 4ZHQF 1LRKA 1L2TA 2M9MA 3L05A 1L1RA 3FF4A 3TTXA 4AY5A 4UNRA 3TXAA 1G7CA 2XZLA 1K9VF 1RC1A 2B3DA 2IOQA 4NP6A 1OHHA 4IICA 3WYNA 2VYQA 4G1EB 3LQ1A 5GVRA 4A82A 4B4DA 4DV2B 1SK8A 4ECEA 2WJYA 3DUFA 3KQMA 2PLFA 1EFTA 3K70C 5GZ3A 3HCOA 2DECA 2Z0MA 3CF0A 1LI5A 3BF7A 3LC7O 3GLRA 4GYJA 4YAJA 4C0HA 4KIUA 3TIXB 3ZHSA 5AJWA 2ZSUA 2VATA 2JGIA 1C81A 2ZJ5A 3R3SA 3FW1A 1VIMA 4NICA 4BN0A 1ZS9A 2FPRA 5KTOA 1C7JA 3AF0A 2FDXA 1X9GA 1JG7A 3IIIA 2AN4A 1F7VA 2VZ9A 3T9DA 4EOGA 4XWWA 1F8GA 3F5MA 3GFBA 4NBVA 4ZU6X 5J59A 2XGGA 4OHZA 3WDLA 4R5HA 3ZX4A 2WDZA 3RQSA 2LE0A 3U37A 2HA5A 3EEYA 3VZPA 2RCNA 3REQA 5KKCA 3REOA 2GHQA 3PQ2A 4M49A 3RUCA 3KHTA 1J8DA 1G6KA 3IMEA 4G41A 1JV2B 5ESWA 5K3BA 1C2YA 3MA0A 3WYAA 3G85A 2ZLBA 5FUMA 4AUNA 2G7ZA 2XA2A 4K9MA 3O2NA 2EFEB 4JVSB 1Z5OA 2CNLA 4B85A 1S02A 1HT1E 1C9MA 1ZUWA 2DUNA 2H54A 3H2IA 3COPA 3OC0A 3OP4A 4Q1CA 2GZDA 4J1TA 3DTVA 3SSAA 3SM9A 1EFVB 3IUQA 1JN0A 3DYVA 3A7DA 4RF2A 3LLCA 2ZS9A 3OT1A 5D3KA 4OX9B 4J7AA 1EJ6A 2ZZKA 4A92A 1YZYA 1LJUA 2AKEA 4DWWA 3AFMA 1TCVA 3VZBA 4W9MC 5DN6A 1VLZA 3NKVA 4IWNA 1BH2A 4XH9B 1SB9A 8OHMA 1PI3A 1HRDA 3H3FA 1GTG1 1Q0HA 3PQ5A 1ADBA 2OZLA 1SZPA 4JBHA 2BHSA 4QDTA 5JZSA 1WNTA 5A2QA 2ECKA 3K05A 3T7DA 5IK2D 1KDZA 2P30A 2B2NA 5G2OA 3RE1A 5KSZA 3TKAA 3VR5A 1Y4ZA 5EE1A 1Z8FA 4XWKA 5I4CA 1LC0A 3NM5A 1FXWA 1HTBA 1RWXA 1DWUA 4WINA 3VAAA 3EFOB 2OYRA 2IVZA 2PGDA 3IR5A 1RTKA 4F5DA 4TT3D 3NT5A 4RZUA 3DONA 1LS6A 3O8OB 4KPUB 5DRYA 2VSNA 3LHFA 5A9SB 5M29A 1M1YB 2RG1A 2BEVA 2YHSA 1I2BA 2GRAA 5TEVA 4C06A 5SZIA 1AT1A 3ENWA 2ISCA 1Z3CA 3NHBA 4ZO9A 3G0GA 5C18A 2HNBA 2XNHA 4F4HA 1QIGA 5LFAA 3SFTA 4ZKDA 3JQAB 1G59A 2C9BA 3D6TB 5KO2A 3EPHA 1EQ2A 2HU8A 1BGXT 1PD0A 3CH4B 3KELA 4KIGA 3SR0A 1CRQA 1R1DA 5A5VA 2AKYA 1MJFA 2AMLA 1ZD1A 7REQB 2H63A 4WX2B 3USZA 2Q4RA 2IBTA 1JJIA 4RA9B 4PLTA 1UAAA 1DKMA 3FYTA 1XXHA 2J9FA 1EIZA 2AHRA 4Y2SA 5CDHA 1Y8ZA 4KJXA 1S2NA 1UKCA 1H3NA 3T9CA 1ENZA 3I32A 3JTEA 5AKHA 3PUYA 2QRMA 5DO9A 5JS6A 2VT7A 3FOEC 5LMNB 1ZN8A 2O4CA 1Y1LA 4I5FA 3EZ6A 4M46A 5I9TA 5A4IS 4Z1MA 3U9LA 1RKXA 1D1SA 3KBOA 3A10A 1YC5A 2C0QA 2A1UA 4JS0A 5BP7A 1FFCA 3EXG1 4BAZA 3GVHA 1UOQA 3NORA 1E2IA 2QPTA 2XMBA 4M2LA 5AW6A 3TZ6A 4L4ZA 1BHJA 4I9GA 2Z83A 1ZNYA 2RHWA 4L50A 3M1YA 4P32A 4R8LA 2ONJA 3T3MB 5HX7A 2LPMA 1F4LA 1I7DA 1IN8A 1LBEA 2YIJA 4HLCA 2QUHA 2QB5A 4IFTA 4GX1A 2Z1NA 5BVGA 1ISIA 2I3DA 3QE3A 4HYQA 4KC0A 4AJEA 5TT0A 2ZE5A 3ZDRA 3OU7A 1N2HA 3THRA 2WOOA 2CXSA 1F8UA 3IRUA 1L7EA 3HM2A 4M9QA 4OJQA 1OBVA 2WNHA 4R4JA 5DEOA 4EH1A 2QJOA 2YJGA 1CUJA 2OB2A 3K94A 2MYNA 1H1LB 4XJTA 1UIRA 2AHOA 2IYTA 2QM3A 3EXFA 3QW4B 4QQNA 2AR7A 2BTQB 3LQ2A 4RJLA 3S29A 1XZBA 3DPIA 4BC0A 3NR2A 5HIKA 4PLWA 4C2TA 2IUSA 2I1QA 4OYRA 5JDCA 2QYHA 4B44A 3RYCB 4MLPA 1JBEA 3OPYB 3ZGLA 3R77A 1E96A 1MVNA 1CX9B 4GPZA 1HDRA 3L4JA 1I6KA 1NVWQ 1RJWA 2W2NA 3BK2A 3W05A 1T1RA 3ETCA 4NCAA 2WA2A 3K8ZA 1QAQA 3B3FA 2GZMA 4HRAA 1KF0A 1IWBB 2ZS7A 1TUBB 2MU1A 2R8PA 2EVWX 3DBHB 3ZXXA 4GP7A 4GGOA 4RNDB 5D1HA 3T7CA 2PN1A 1SO8A 2KBFA 1PLLA 2GN0A 3LWBA 4D4LA 1E5LA 2CD9A 1L3CA 2GERA 1HOXA 1SQSA 1XCJA 3ICPA 4INOA 4MUKA 1N3YA 2ONZA 2NSLA 4JOSA 4O2RA 4ZYWA 2ZJ3A 4R1SA 2PVPA 3ASUA 5ADWA 2W0MA 2ZS8A 2VI5A 1A8UA 1VG1A 3BHMA 3D7RA 3PENA 3IJRA 3GH1A 3R41A 4IHJB 4LJ5A 4U2KA 4Q9HA 4JP8A 1EE1A 4GM0A 4KBFA 4KN8A 1SQ5A 2OP0A 3MOIA 4CEJA 4NOLA 2P9EA 1AF7A 2Q9BA 4LK3A 5WRFA 2DYKA 2BVNA 2ZQ5A 2PYDA 5SV2A 1M5RA 1KEZA 2ZFUA 3ZLTA 3AM4A 4CKCA 1QK5A 2L18A 3ODGA 1FX0A 1WHTB 2WICA 2AYXA 3DNFA 1IY9A 1S7GA 4QGHA 4ZVSA 1BFDA 2X22A 1I1QB 3CYFA 3KEOA 3KDPA 2X7XA 3IQZA 4ZQIA 3IUEA 4X94A 1ZJZA 4BMOB 1I7PA 1Z4OA 3RU2A 3ZTWA 2TMKA 3PSHA 4W8HA 1V11B 3HB9A 3O7MA 1JHPA 3KKMA 3AP1A 2X9QA 4JNCA 1XTRA 1VL1A 3RREA 3CUWA 1R6UA 5CH5A 1PV2A 2YASA 4Q9IA 3R0XA 2OCIA 4AKIA 5IF9A 4D1YA 1NJ1A 2FQ1A 2CYBA 1RQXA 5G3YA 4KE8A 2H1OA 1OI4A 1DTEA 1UBTS 1O1YA 1LNZA 3O9MA 3HO6A 3ONWA 4QO8A 4EUSA 3R9XB 2FMHA 1G4UR 2Y6VA 3QA9A 2B2CA 2R48A 4IQ0A 4JI1B 4LNAA 3GB9A 4LZZA 3RT7A 3W8NA 4KLCA 3X44A 3U1BA 1TGYA 4HUJA 1O94A 5EP1A 1HI9A 5ISMA 1LFDB 4HH4A 2FGJA 3FFXA 1GFWA 3OLYA 1T5OA 1JP7A 4LHWA 4R9UC 1SOMA 4CN8A 1OWMA 3Q3IA 3THXA 1W4RA 2AR9A 1A27A 4PSUA 2AR0A 5ECYA 3KUKA 3NWEA 2ETXA 4K6FA 4KQXA 1FPMA 3RK4A 1QQ6A 3V1NA 4GEGA 3O3MB 5DNVA 2WMDA 2PKQP 4PRLA 4MYCA 1OX5A 4HX9A 1N5IA 1ODIA 2P65A 5BUCA 1OILA 3FPJA 5E7JA 1I36A 1MNAA 3LECA 4FOTA 4KITB 2QP9X 2RJ3A 3GT3A 4YN3A 2V4ZA 4YACA 1EM6A 3Q7QA 4GPIB 4WSOA 5ITWA 1I9CA 2G1KA 4PHHA 1I4LD 4TUYA 3T3GA 1D5CA 3UAZA 2ODPA 3KV1A 3MG9A 3ILVA 4AF6A 1L7AA 4IIEA 1ECLA 2IHJA 2Q9AA 1Z9BA 2FRXA 1HE1C 1PFKA 1UWKA 4PX2A 4EJ6A 3CF4A 2G71A 2HU7A 3LKVA 4EA7A 4EPWA 3AZOA 1Z3IX 1Y4AE 2Y0EA 4GG1A 2IV2X 2P6RA 2C77A 1V5WA 4GX0A 1NNEA 3UGKA 4U1RA 4RU1A 5KYGA 1DADA 3SYNA 5F51A 1Y34E 1YH3A 1KQNA 4YRCA 4IIYA 2GN6A 1YFLA 4QWWA 4RESA 1Q92A 1CIPA 1U90A 2AJ8A 5HQ3A 3WGMA 1M2OA 2PKEA 3AUKA 1FRZA 2GF2A 1IUOA 1K1EA 4J1QA 4L6IA 1EUZA 4G24A 3BSWA 3EUEA 3ZNNA 4OV6B 2OYSA 4GS5A 1P62B 1ZD9A 2D1QA 4KQEA 4JSYA 5LZ9A 1WW2A 1T4CA 2VF8A 4XM2A 1KTIA 3QPWA 3IT3A 3ZXIA 2LVBA 5K3SA 1XZEA 2PQ6A 1ZDMA 1ZI8A 1EBUA 1YAJA 2J41A 3PP8A 4XA8A 1G7TA 1SC1A 2QTGA 4RKRA 1OIWA 1WPQA 2P2NA 5F76A 1V1RA 3KJGA 2B98A 3NAZA 3G0IA 4KQGA 1RAIA 2B1QA 1HTWA 2BBSA 4IXDA 4K9RA 4R1TA 3L7JA 3S1LA 3T0GA 1J09A 1UJMA 1GPWB 1FFWA 5FWYB 2NSYA 3VNQA 1ADCA 1R9MA 1AQIA 3O4GA 4NFSA 4Z2YA 4RACA 4Z54A 1JBQA 2XSZA 2Z2YA 3HR4A 1ORVA 4TYQA 4JP1A 3WO0A 1CC1S 4DDWA 3PLAE 3B38A 2EGUA 4M8IA 1CYEA 2WMNB 5IBQA 2C4HA 4JXXA 1NXVA 2RAPA 1DBWA 2OQIA 3VTKA 3H8VA 3VR1A 1I4OA 4AJHA 4RD1A 3DFUA 4EGFA 2EW1A 2Q3EA 1YCGA 4J0HA 4LF9B 4KBYA 2QTCA 5FHQA 4F2DA 3NZEA 5CM2Z 3DULA 1KO5A 3WGYA 4IIDA 3S70A 3NYRA 4KQKA 2G1UA 2GCGA 4K1XA 4N3BA 3F8SA 2WIBA 2E87A 2M1ZA 4NTZA 5DZSA 4BS9A 1O0SA 4DRXA 2G9VA 2BCGY 2V6BA 2NX2A 1CRPA 2JLVA 3VA7A 1RSZA 2I66A 5DP1A 1K3TA 2BGWA 1WUTA 4PVDA 5JCZA 4B2LA 3BCRA 1XK6A 1A77A 2KI5A 4WD3A 2YOFA 1NBMD 3TD9A 2OCYC 3H2ZA 4L08A 3TPCA 3DMPA 4TM8A 2QMYA 1T9GR 2YNMD 3E9RA 2FQWA 4O29A 3CB2A 1LLUA 1MH9A 2NTEA 3QPAA 5FA5A 2YVKA 3EGWA 1HQYE 4X62B 4YROA 1XZLA 1C30A 5EJFA 5FYQA 3T35A 4A91A 5AVQA 2W83A 1A95A 2J4FA 4BV2A 16PKA 3E84A 2PO5A 4M99A 1W2HA 3FHLA 3PC6A 1DX9A 1NMEA 1XDWA 4J49A 4P53A 4CQJA 4D8VA 1BE6A 1Y5RA 2JIZA 3I9MA 1M2HA 1WBDA 2ATXA 1RXYA 3WNBA 4G0OA 1ENOA 5CEFA 1NT4A 4OHXA 3GBSA 2PMEA 2QUJA 1RCFA 3QPBA 2GBCA 4HJRA 3IPAA 4BWYA 2I4MA 2P40A 3ZN2A 1Z68A 2DCMA 3QKRB 2B8WA 1IN6A 4HGQA 4O2BB 3UMJA 3AB8A 3OKAA 4W6ZA 3WKDA 5H68A 4NRDA 4YS6A 5IC4A 3OLXA 3Q10A 2WF8A 5FTLA 1OI3A 3FUXA 5ALLA 8ATCA 2H31A 2H7YA 1IVSA 2GRJA 3EDCA 1JKFA 4UUQA 5BN5B 4O6VA 4FKBA 4MVJD 4MRSA 3IAM6 4H7JA 2V96A 4LQ4A 4CF4A 1QHGA 1RYYA 1LDEA 4RDIA 3QPCA 4BEWA 3PKIA 3VTAA 3M1IA 1MJHA 2EHJA 2QR2A 4CVNA 2DUJA 1Y1RA 2GBPA 3NB0A 1M0WA 4KI0A 4MKFA 4R54A 1CUAA 1YV9A 4B0OA 1RAFA 1IBRA 2JASA 2X41A 4DOMA 1U9YA 4OGWA 4QASA 3TZKA 1CY4A 3G6KA 4GHWA 1PJZA 5ALQA 4BTEA 1D1PA 1XDDA 5H9VA 3MGAA 1JHXA 4I1OA 2RONA 3JALB 5HIIA 5JVDA 5EVJA 3HA2A 2WIGA 3GK3A 4TLCA 2VXOA 1OGIA 3H9GA 4ZZ3A 3GUYA 3FTPA 3CMMA 4OATA 3AK4A 5HDBB 3DBRA 3S1AA 4ZHSA 3A37A 4BNDA 4UBIA 4DREA 5HZMA 1O4WA 3WLSA 3CIFA 3TKYA 1GPLA 1UDRA 3VGJA 3ISJA 4PZDA 3JQAD 3JQBC 1YXMA 3TM5A 1QGUA 3WB9A 3WGIA 1L5FA 4BY9E 4JYMA 5IXSA 1K4YA 4K9LA 5TR9A 4QYIB 2XCSB 3WL5A 3HXQA 2CXUA 1M6HA 2VP4A 4JASB 2H65A 4YJHB 4F1JA 5KYWA 3SE7A 5A0TA 5ER9A 1EHYA 2BMVA 4AO8A 1BQ4A 2I3BA 4B6OA 4JLPA 3W8RA 4FYKA 4D45A 5FTJA 2YQZA 2Z2KA 1M0SA 1LGYA 3AEQB 4I14A 4KFRA 4X20A 1P45A 4GECA 4R0VA 1S3FA 4PBTA 1KOJA 2Z58A 1E6LA 1GV1A 4JYPA 4L28A 2DZDA 1J5PA 4DCSA 4DXDA 4EEZA 4JC5A 5LZ4A 3F90A 3YASA 3L1IA 1GPH1 2EZ4A 3MAGA 1WF3A 1KHTA 2XHEA 4O4IB 1AZTA 1Z4JA 2HQ1A 1VI6A 2PGXA 3DDHA 3EWAA 3FFAA 3SBEA 4BVBA 2HJ9A 1Y6RA 1YWGO 2C9DA 2VA8A 4IX1A 4KSYA 3ZY2A 1EFAA 5CM9C 2R7KA 1YA8A 4TN1A 4RVUA 1TRHA 1VP9A 5KHOC 4E2XA 1JVSA 4L6AA 1B0ZA 4FQ7A 5HKKD 1WUJS 5J2UA 4DB2A 1E6UA 2O1SA 1PQWA 5FQOA 2PWBA 3OUTA 1SEPA 5AXBA 2ZJ0A 2C4MA 3Q98A 2VHWA 1GAWA 2G9UA 2R2GA 3OTGA 2ZJOA 4RTMA 1EDBA 3WV5A 3ZDFA 3ETDA 3ZGOA 2B9VA 1CUFA 1M1ZA 3JATB 1Z16A 4LJAA 4QD3A 5BSUA 1G5HA 2VTKA 4FLMA 1XQVA 2ZJ2A 1KQPA 1H2RS 1PSZA 1PSDA 1WZCA 5DBEX 5DK4A 1KPGA 1ZKDA 2H2AA 5ARDA 2JK1A 5BWBA 5GONF 4H3HB 1IEXA 1YDWA 1JLSA 1GFZA 1KAHA 2DOKA 1T3ZA 1V6AA 3NFYA 3O0TA 2OCPA 4D4HA 4X3CA 4ERXA 5K8LA 5IRCD 1AH2A 1E3LA 2OB1A 5DX1A 2XXAB 3DZBA 1R3UA 1U3GA 2OO5C 2AYZA 1OASA 1CS4C 4KDRA 4M0UA 4YH1A 3NWJA 4O2AF 3OOEA 4Q3CA 4X93A 3RU3A 3AY6A 3SC2B 3AVWA 3CRNA 3NT2A 3PF9A 1PO7A 4JEIA 5GVSA 2WI8A 4Z3OA 1FYFA 2FFJA 4GEKA 1KSJA 2GZ2A 4D9JA 4EKYA 2PUFA 2OD9A 4ZT3A 2CBGA 4IG9A 3JV7A 4I9UA 4KLNA 2MOKA 3IDQA 1M66A 2LP4Y 3QRWA 5IMBA 4XB2A 3WLLA 5C2JB 1WUHS 4YY3B 3GRRA 1MDBA 1ONBA 2CF5A 4I1VA 4X7BA 2Q1YA 4IIXA 4KQ9A 4TYMA 4DRZA 3CRQA 4IJWA 3LT1A 2IIPA 9MHTA 1HE4A 4KQHA 1N6OA 2KHZA 3GV0A 4HNRA 5IFLA 1ONNA 1IBSA 2OA0A 1L3BA 1ZUD1 1WY5A 3T7RA 4LZLA 3T7TA 2PX5A 1KDTA 4KDFA 1T4DA 1LDBA 2XF2A 1KDPA 1Z38A 3TRFA 4IMRA 4LFCB 3PPYA 5HK8A 3WMXA 2VYFA 2XY4A 4DSUA 5BN3B 2PJZA 1NR1A 2X0DA 2QLMA 3ANYB 1KZ1A 1TVKA 2FH5B 4MYRA 3E4CA 2NUPA 4OHUA 4E11A 2NVWA 4OXIA 2JAXA 5H80A 1XA0A 2HGZA 2AN9A 2QI9F 3N0WA 2O19A 4F11A 4XJVA 3GLFA 4M8KA 1RRMA 3BVPA 4P34A 4D56A 5J4VA 2HDWA 1OU4A 4UDXX 5EMMA 4ENTA 4NZNA 3JYQA 1FU8A 5SYAA 1GYRA 3N1UA 3C7KA 3GLUA 4NZOA 1RWBA 1UMCB 2VC2B 3S8YA 2V6MA 4FOPA 1U3FA 4YMGA 4FWBA 2FP3A 3HNPA 3H9JA 1TTPB 1W59A 3N9IA 3PS9A 5H70A 3VC2A 3NS7A 5T7BA 2H52A 3ZG6A 2AUNA 3H1AA 4OHOA 5DNDA 4L74A 1CEXA 1NXWA 2W4QA 3H0KA 2JAWA 4JJ7A 2F8TA 3ZHVA 5AWFC 1OWPA 3V4ZA 3OQVA 2ZU0C 5FWXB 2VPXA 5GP1A 1DWOA 3TR0A 2G1JA 2QLFA 3K5HA