2BMJA

Gtpase like domain of centaurin gamma 1 (human)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
176
structure length
174
Chain Sequence
MRSIPELRLGVLGDARSGKSSLIHRFLTGSYQVLEKTESEQYKKEMLVDGQTHLVLIREEAGAPDAKFSGWADAVIFVFSLEDENSFQAVSRLHGQLSSLRGRGGLALALVGTQDRISASSPRVVGDARARALCADMKRCSYYETCATYGLNVDRVFQEVAQKVVTLRKQQQLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CENTAURIN GAMMA 1
publication title The Centaurin Gamma-1 Gtpase-Like Domain Functions as an Ntpase.
pubmed doi rcsb
source organism Homo sapiens
total genus 62
structure length 174
sequence length 176
ec nomenclature
pdb deposition date 2005-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2bmjA00
5FL7D 3H2YA 2GK6A 4DIDA 3KUCA 1ZD9A 3P27A 4Q7MB 4HAUA 2IS6A 4B2LA 3WP0A 2G77B 3CNOA 3KKMA 4BEBA 1UF9A 1FUKA 2FSFA 1W44A 1E2DA 1Z6AA 1U8AA 2GVDC 1F3OA 1JXMA 3NH9A 3Q5DA 3Q5EA 3QKRB 4QNRA 3RRNA 1HY3A 4RD4A 5JS8A 4OI0A 1CJVC 2WSSA 5KDOA 1KKMA 2BEJA 1FUUA 2XNDD 4NYJR 5IRCD 1PZNA 4JT4A 4S2EA 3IIMA 3K0EA 4QGHA 4URWR 4LPKA 3PEUA 4KU4A 2ZRPA 2IL1A 4KYUA 2C78A 4EPTA 1XCPA 1YZGA 2G3YA 2JCSA 4HLUA 2V8OA 1QF9A 1ESMA 2VHQA 2KSQA 2ZYTX 1DAIA 2J0UB 4BLSA 4OJQA 3EA0A 2ZJ8A 2J0VA 2RGBA 3K53A 2GK7A 1T8UA 3AVTA 2A5GA 4ACBA 4D81A 2DYKA 2H18A 1E2GA 4Q7LA 1QDEA 3SE0A 4TN1A 5HZKA 3HJNA 3K0FB 2ZI9A 2AX4A 2GF9A 3A1UA 4LK2A 5EP4A 821PA 1E2HA 2ODBA 2ZE7A 4HATA 1W4CA 5DISB 3OEHA 3W6PA 4JYBA 4B3XA 3AF1A 3QPVA 1N5KA 4CEJB 3BFKA 3MG9A 1OXXK 1DAHA 5DIFA 4V0MA 2GNOA 1Z0FA 5HE8A 2J5XA 2JJ2D 2RGAA 2W0SA 2FDCA 2A5DA 4X8HA 1KK0A 1WB9A 4QFMA 3L43A 2P3SA 1Z08A 5CJPA 1SVLA 4HB3A 3GLGA 1UBCA 3TBKA 3UMFA 1G7RA 3DMNA 1AIPA 1AQUA 2Q9AA 2KB0A 1II8A 1NSFA 4XWAA 3P32A 2RGNC 1KYIA 1GRQA 2R6GA 1X3SA 3C16C 1ZC3A 1ZINA 2G6BA 3B1WA 2ZE8A 1S8FA 2BHRA 1DAGA 2WVJA 4LJ9A 2CHVA 5EXTA 5BQ5A 4N0DA 4US1R 5E4FA 1AJEA 3TVTA 4ZPXA 2K5UA 1C4OA 2RKOA 2G0NA 3BH7A 1W36B 2YINC 2FSHA 4PAMA 5DN6A 1NBMD 1AM4D 1XMSA 3SNHA 2ZRBA 4MGYR 4TL7A 1P73A 3MUFA 4ZI3A 3GLFB 4M1YA 4G0NA 2ZI5A 2WKPA 5HCNA 5P21A 3TK1A 5L8VA 1VG8A 4LHVA 2J7KA 4IEEA 1GG2A 2O0JA 3AV0B 4JL5A 4ASUD 4JVLA 3CR8A 5DNYB 2CLSA 4PHTA 3EW9A 4D80A 1ZRHA 1RE0A 4IVRA 2OHFA 1KK3A 3GFOA 3GLIE 3THYB 3DPUA 2BMEA 4RD0A 3FPAA 2ZRJA 1QHHA 1AS2A 2BM1A 4IOLA 1TF7A 1JXOA 2ZSAA 3B1XA 3E2IA 4O0MA 5G53C 5FR2A 2IYVA 4OI4A 2WWYA 4URXR 2R9VA 3THXA 1PUJA 2VTKA 3T1QA 3B8HA 3RRZA 1FNMA 1ZCAA 3LXXA 3W5JA 3CB4A 4E07A 1VCOA 3WMEA 1XRJA 1Q22A 2BOVA 5FPKA 5FBRB 1ZP6A 3IQXA 1CJTC 4H9GA 2QQ0A 3B9PA 4Q4AA 5K8IA 3I1FA 3T12A 5KNDA 2ANCA 3DKVA 1MABA 2ZUDA 2MSEB 1KSJA 3IBGA 1V5WA 2P65A 3QEOA 3RS2A 2NGRA 2PZEA 4F93B 2W6IA 1Q44A 3HYTA 2IS2A 3J81k 1W2GA 3ADCA 3FMFA 2E87A 4B74A 2WBLC 3EWSA 1MR3F 1S0UA 4C0JA 2YKGA 2REXB 5FL7A 2EWWA 4G01B 4KFSA 1R0WA 1DO0A 1YR7A 1R0XA 3C7KA 2EQBA 3PVSA 2XNSA 3PUVA 1E98A 4PQRA 5KSYA 1XTIA 1P3JA 3K09C 4ZIRA 5FUWA 3PUXA 2WJIA 3Q72A 4PPFA 4PSVA 3TLXA 5JWRA 2DFTA 3VR1A 4A15A 2BM0A 4BECA 1II8B 4J0QA 2QT1A 5HE9A 3W8NA 4YMVA 3HR7A 5KOYA 4KXFB 1H8HD 1XTJA 2XNDA 1OIWA 3WXMA 1CIPA 3RNLA 5J4VA 1N6OA 2QPAA 4GSYA 1IXSB 4JVNA 3DVLA 3U6BA 1SQ5A 2IYQA 1UPTA 4LDJA 4AIIA 4EPWA 3ONWA 4U02A 3QVUA 2VHJA 3IQWA 4QJ3A 2EFEB 4IDOA 1SKQA 2Q6TA 2UZ3A 4HDQB 4Q4JB 3FDIA 5EE3A 5EE5B 3ZZ0A 2XZOA 1M7GA 4NYJQ 2B92A 5KNBA 4PANA 1Z06A 3P26A 1ESNA 2FJUA 4WZBE 2ZYWX 4HSEA 1LB1B 1IXRC 1OLOA 1W4RA 3F0TA 2QP3A 1CF4A 1BS1A 1JEDA 1G3MA 4PHHA 5EZ6B 1E0SA 1KSFX 1Y63A 2DY1A 1CJMA 2ATVA 3I3SR 3P4XA 4LJ8A 4YLGA 3TQFA 1NSTA 2WWGA 4TYYA 4E22A 3IHLA 1F6BA 1E2IA 3CIOA 2FSIA 3T15A 1TU4A 4EFMA 1QHHB 2DB3A 4ILEA 4M22A 2CCKA 2EYQA 1IJFA 2WIAA 4QHSA 2ZSEA 3ZVLA 5HR5A 3NHAA 3GLFE 2JJ2A 5KDLA 1IJEA 4M53A 4RKFA 3ADDA 2FE4A 1XB2A 4D4MA 2IX3A 4NYIQ 4DZZA 2JASA 1FP7A 1Z6XA 2QI9C 3C41J 1MH1A 1ZM7A 1WF3A 2ZRCA 4GZMA 4IXNA 2JATA 4NU0A 5CJ2A 1KI8A 2GZHA 2BVNA 3GLHB 3MJRA 5EUQB 3TSWA 2VYFA 3SC3A 4O2RA 3SS8A 2AWOA 2D06A 4OHXA 3EA5A 2IYSA 1EX6A 3HU2A 3IDQA 2P6NA 3OIYA 3SDZA 3B6EA 1NBMA 4TMKA 2P2LA 3IILA 4AK9A 1G41A 1NNEA 1QG2A 3LWNA 2RB4A 1Z2CA 4GNKA 2FFBA 4QGAA 2IEZA 1NVWQ 1ZD1A 2ZITA 3A37A 4JLMA 3IPYA 4KAXA 4ASUA 4DLTA 2JAQA 4Z8XA 5AJYA 3OFNA 1SZPA 3QE0A 3REGA 3U44B 3KKNA 3M1IA 4W9MC 2HF9A 3R9IA 5HKKA 3BWDD 2QE7D 1JR3E 4DEXA 5L3VA 2RHMA 4JLAA 2DBYA 1Z8FA 2OLJA 1HH4A 4Q5IA 5D3MA 5JBQA 3EPHA 1ELOA 5CLQA 3MFYA 3KKOA 521PA 2BC9A 1E9AA 3SOPA 1Z0AA 1M34E 4C7OA 1XBTA 1VPLA 2ZJYA 2VRWA 4TYNA 3ZQ6A 2C9OA 4BZQA 2FX3A 2HF8A 2BWJA 3LX5A 4TTRA 2F43A 1R5NA 1XEXA 4OQFA 4N0EA 2ZSBA 3VNVA 1T6NA 3SBDA 1E2MA 2ASEA 2NIPA 2WWFA 3VKHA 2X2FA 5F3WB 3K9LA 1UBGA 2IXFA 1A1VA 1OXTA 1TNDA 4AKGA 1RRFA 4Q1EA 4FCTA 2GCPA 3IKJA 2Q3HA 2CHGA 1G5RA 2Z6VA 1F60A 4LSGA 2ZRFA 2HYDA 1ZBDA 2AFHE 5BXQC 1N6RA 2F1IA 2P6RA 1NVUQ 2Q9BA 3KZ1E 1S2MA 2I4IA 1TMKA 4HB4A 4OI2A 4BEJA 4EPRA 2QSZA 4RJLA 1JNYA 3FWYA 1Z07A 3PUWA 4C0HA 1G7SA 4LCBA 5FUYA 5AWFC 1P2SA 4M9ZA 1US8B 2A5FA 621PA 4DVGA 3OEED 4GL2A 2YC4C 2F55A 4UJ5A 2HJVA 1MO5A 1H8HA 3ASYA 4DB4A 2ZRNA 4A0HA 4EJSB 4US2R 2ZI7A 4FWIB 2LCFA 1E9BA 1D9ZA 1OSNA 1NIPA 1CXZA 2ZYUX 1KIMA 4JYCA 2OILA 3PXGA 4O25A 2GJAA 5CB6A 3C8UA 3LBHA 1S1CA 5M04A 3LXRA 4NL4H 1OT3A 1R5BA 3RS0A 2AK2A 4L5BA 3MAAC 4GBMA 4C0SA 2VIIA 1E9CA 4DCVA 3W6NA 3AH8A 4OBEA 5L3QA 4EDHA 3PFIA 4TSFD 5AUOB 3GLHE 1WDTA 4G5RA 3IPXA 1YZUA 3NHBA 5FOTA 4YMSA 3RSLA 4A8JB 3U3OA 2QU8A 2WZQA 4B3FX 4ZCLA 2C9CA 4E5UA 3U4QA 2Q3FA 4Q02A 1Z2AA 3ZLJA 2QN6A 4FXPA 4QG7A 3W6OA 3THWB 3A6PC 4QBIA 2BCGY 3TSZA 5D3MB 3H1TA 4V0LA 5FR1A 4LV5B 4NMMA 1PUIA 1NY5A 3AM1A 5GJVC 5AUNB 4C7OB 5CDFA 1QHIA 2ZE5A 4NCIA 5FOVA 2ZU0C 3KTAB 4OHYA 2PZFA 3RAPR 4KFUA 4H1VA 4CEIB 2QZ4A 2B8TA 1GNPA 2F43B 1XEXB 1KMHA 5A4JA 1CR4A 1ZAKA 2QMUA 1KJYA 4C2UA 1G3UA 4IXMA 2GETA 1H8ED 1QHSA 5EXPA 5KSZA 1KK1A 3BIFA 4WAUA 3X1WA 3VQTA 1I2DA 1OFIA 1MRSA 1GP2A 2CL7X 2R8RA 4AURA 3PUYA 1NVVR 3NXSA 2ZIAA 3VHXA 1XZPA 1DARA 1EFUA 2D3WA 3W5IA 1KTVA 1AN0A 1KGDA 2ZR9A 4PHFA 3ZDQA 2C95A 2G1KA 1KZ7B 1Z0IA 3SQXA 1NJGA 2HEIA 3TJZA 2J3EA 1KO5A 1X8JA 2F6RA 2QGZA 2DFNA 3WNCA 3Q7QA 2XZPA 2ORVA 3FE2A 3LV8A 3M4YA 4TMZA 1R8SA 1T9HA 4KJZA 2WJHA 4P4SA 5KSPA 4WVFA 3X2SA 1HQCA 421PA 1CJKC 3MCAA 2IK8A 3W9YA 4BZPA 2ATXA 1KDOA 2ZRDA 1SHZA 3P4YA 5HCIA 1E96A 5JJLA 1TQDA 1OFHA 2QE7A 4GZLA 2OBLA 3PQCA 4MYCA 2QAGA 2OESA 2O0KA 1QG4A 4QXAA 3I73A 5G41A 4HUTA 2WAYA 721PA 5HPYB 2JLZA 4NCNA 1G3IA 3PITA 4IDHA 2NPIA 1DAFA 1GIAA 1B23P 4ZDJA 5K8TA 5G40A 3EZ9A 3HPQA 2JLWA 1HYQA 1E9FA 1E6CA 1N6LA 2C99A 4DSOA 4Q9LA 1SVMA 3O8BA 4UNSA 2I1VB 4IOMA 2YV5A 5CM9C 2ZI6A 2DWOA 4DT1B 5GJWC 2QMHA 1E9RA 1VTKA 2OCYC 2W2XA 3AF0A 4LYAA 5TARA 3PR1A 5TDHA 1NKSA 4Z8YA 4F4CA 1EGAA 3CNNA 3KQUA 1PLLA 1XP8A 2V6JA 1JQJC 1HA3A 1G64A 4OYHA 4Z1MA 3U3JA 4PO1A 5KO2A 4D82A 3TUIC 3EAQA 4K8OA 5CIQA 1S4QA 3SJZA 5JEEA 3PENA 1QHYA 4ZDIA 3T35A 1P60A 5CIWA 4DHEA 2C8VA 3OEEA 4CDGA 1GRNA 1D2EA 1R5OA 1XJ0A 2HLDD 4OK6A 4EPYA 3AVQA 4P4TA 3GP8A 2QENA 1LFDB 4LYJA 4PQYA 1F5NA 5EZ5A 1GWNA 2B8WA 4DDWA 2QRNA 3Q8XB 4LJAA 1VDZA 3T1VA 1NMXA 4B3DA 4V02A 4B71A 1OPXA 2QY9A 1GTVA 4JKYA 1W4BA 1YZTA 4RD3A 1UKYA 3VMFA 4BFYA 2FSGA 1U98A 3BC1A 2O8BB 3HDTA 1WCV1 3RDPA 2OFWA 4L9WA 4UNNA 3TE6A 1EXMA 3U3KA 5FTLA 1OF1A 2VSXA 5KPJA 2G88A 1LVGA 3CW2A 4P4SB 3V00A 2O8FA 5L3SA 3NBXX 3ZS8A 1NI3A 4B48A 3SFVA 2RGEA 1JAIA 1E0KA 4EPVA 3TRFA 3TVDA 2ZR0A 2VF7A 3K9NA 4KFRA 2GVZC 2IYLD 2B21A 2KJQA 2D62A 2FEOA 2QL6A 4B3BA 2RGDA 4G5OA 2JJ8A 5JRZA 5E3HA 4IW3B 3R9XA 3QI2A 2ZETA 3SR0A 3R7WB 1N0VC 3WMGA 1IONA 3FOZA 1OFTA 2WHXA 5JWOA 2QPTA 2OAP1 4LV8B 1E94E 5JFGA 3F5FA 2N42A 2J41A 2A7QA 2H92A 4I4LA 1T3HA 3MWJA 3TAUA 4LBWA 4GP7A 2FH5B 5CK5A 3RS4A 3KXKA 3NIBA 3RC8A 1XPRA 2DPXA 1Z0DA 2GCNA 4LJ4A 2ZM5A 4D2IA 1U2RA 3I8SA 2ZXUA 1P2VA 3OAAD 4OHWA 1JPNA 2VHCA 4ARZB 5KHOC 2FEMA 4CIDA 121PA 1YRAA 1KDTA 3DOFA 1PV4A 1I4LD 1OE0A 4L15A 4HB0A 1DELA 3RS3A 1GOTA 4TZ0A 1W5SA 1ZIPA 2Z0MA 1M74A 4NYMR 4PAQA 1IY0A 1EFCA 1N6NA 4Z54A 4BGDA 1W47A 1BYIA 2QORA 3CUEF 4KITB 2H16A 2GAOA 2X19A 2AWNA 1L2TA 4DSUA 2GWHA 1ZM4A 2WJJA 1UKEA 4RZXA 2F1JA 2YOFA 1ZC4A 2GJ8A 4U5XA 1E4VA 2IS4A 2NMVA 1U9IC 2AK3A 1U8YA 4LY6A 4DDUA 5KYKA 3K9HA 2FU5C 3K0CC 4CEHB 3X1ZA 3GJ4A 4Q21A 1KI6A 5DI3B 5A0FA 2JLXA 1S9DA 4DJTA 5ELXA 4MUAA 4PX9A 1PLKA 2GJSA 4F4JA 3AVXA 2QM7A 3WMFA 2D2FA 1XTKA 4L9SA 1FX0A 2F1HA 3CWQA 2Z5FA 3UXMA 1P2TA 1GSIA 1KOFA 2WOOA 3SQWA 3RABA 1Q12A 3PEWA 2BBOA 1M1YE 2A9KA 4RVCA 1HUQA 2O8FB 4GDFA 3QF4A 3AF2A 5L3SB 2OFOA 2VSOA 2KBEA 3QJYA 3U7GA 2A3RA 1XMVA 4LBZA 4I1OA 2ZVPX 5FTKA 2OV2A 4GRAA 4FCVA 2O8EA 2GDJA 1S3SA 1ZU5A 2BMFA 5JJIA 1IOZA 1E2NA 2QP9X 2WSMA 1IHUA 3OE7A 4HZUB 2Z4SA 4C0AC 2CVFA 3B85A 5AJWA 5E7IA 3B5JA 1RPZA 2CLCX 4B33A 3UG6A 2JA1A 1WP9A 2ZREA 2EU8A 4E03A 3W3AA 3RWOA 2ZRKA 4WXRA 2EFHB 1CRQA 2HLDA 4FW9A 1X6VA 2R65A 4XVRA 1QVAA 1SVIA 4JS0A 1SXJE 5DH9A 1P62B 4DKXA 1E0AA 3FKSD 3CZPA 3OIVA 2MSCB 3TH5A 5LPNA 3HU1A 3UK6A 3U3MA 3KXLA 1KAOA 1P6XA 1G1MA 4HAYA 5AJZA 3VX4A 1L4UA 4BRUA 5JWHA 2FA9A 2CE7A 1P5ZB 1XZQA 1T3SA 2B6HA 2Q3MA 1U90A 5FPHA 1FTNA 1TUEA 3O8RA 5KSOA 4Q01A 2AD1A 2H1LA 4OKSA 4XSHA 2IUSA 4EAQA 3AGQA 2V54A 4TQ9A 2D4HA 2NO9A 3QKSA 3NBYC 2C98A 1XTQA 4WW0A 1ZNWA 1DAKA 1TQ6A 2QTVB 2D7CA 4TMWA 4FCWA 3VHLB 4F4IA 3CRVA 3TR5A 4DRZA 4Q19A 4UNQA 1I4DD 2O0HA 5GVRA 2PJRA 4D0GA 1N6PA 3TSOA 3I61A 3ADKA 2D7DA 4TQUS 4Q7KA 1EFHA 2R2AA 2RGNA 4QRHA 4B3CA 2ZSFA 4BQSA 3RANA 1G17A 4RZ3A 3U3RA 2PZGA 4C0KA 2J7PD 3BORA 1E2QA 5B57C 3AVUA 2CLDX 2J9RA 2FV8A 5J4LA 1U0JA 4AD8A 3LY5A 4BFZA 2BIFA 4Q1DA 2Z4RA 3OFND 2XOKD 1D5CA 1U0LA 1XD2A 3A36A 1X8LA 4NE2A 1E32A 1Q1EA 5HKKD 2R6CA 2WAXA 1NN3A 5JSZA 3QF4B 3W3ZB 4E09A 1AZTA 2IC5A 3LBIA 4PSKA 4IFEA 1A82A 3OAAA 3B78A 1NN5A 1OIVA 3I8XA 1OYWA 3L0IB 4TQAA 3SYNA 3I5YA 2C03A 2CXXA 2IWHA 3I32A 3MSXA 2OG2A 4BLRA 1VECA 2ZS9A 3D3QA 2CDNA 5EXSA 5LB2A 2ZROA 4LJ7A 2CHQA 1J8YF 3RS5A 3U7HB 2VEDA 4DSTA 2FFAA 3BRWD 3I92A 1HT2E 5IK2D 1KNQA 3KJIA 4NKRA 1Q21A 4I81A 5EP1A 3MGCA 3V9PA 1UDXA 3ZH9B 3OESA 4XIGS 4C4PA 1KO1A 1Q1QA 3AEZA 3FHOA 2AKAB 3D31A 5CM8B 3FGNA 4F91B 3PEYA 3O8DA 1IN4A 2A30A 1VIAA 1E79D 1FP6A 1E2FA 2QAJA 1KKLA 3FHTA 1HE8B 1E2KA 3AF3A 1N5LA 3AKCA 2KWIA 3EX7C 3BE4A 4PR0A 5TB5A 3IIKA 3SFZA 4BPBA 1IN7A 4QM6A 3GLGB 4F38A 4D4KA 2CCGA 2V9PA 3KQLA 2ZJAA 3WNBA 1EFTA 3NH6A 1DEKA 3QBVA 1DG1G 3LLUA 5FTMA 3CNLA 2GEDA 1GVNB 3SJBA 2F1RA 3RS7A 3NG1A 1V43A 2A2ZA 4A92A 2XTMA 4KVAA 3ZS9A 1E9DA 3CF0A 1DS6A 4M1MA 2YJTD 5F9FA 1IN8A 1JEEA 4JLDA 4AWXA 1RRPA 5TY0A 2C9YA 3K09A 3AQ4A 1WBBA 3DZ8A 1TL7C 2RGCA 5FPSA 1KAGA 4K81B 5EP3A 3LH5A 4FMCF 5FL3A 1N0UA 2C96A 4CVNA 4Q1AA 2NTYC 1G6HA 1MO6A 1RRGA 3A58B 3R9WA 2WMOB 5CITA 3BGWA 4URUR 1W0KD 2HUPA 1R0ZA 2R6FA 3A4LA 5TV2A 3QPWA 5TVKA 4MDEA 4MYTA 3KJHA 4QL3A 5JCZA 5G3YA 5EP2A 3DZDA 5J47A 1Q20A 1XD2B 1OJLA 1UEIA 1IQPA 3FKSA 1TTTA 4TLBA 4MRRA 3A1VA 1IN6A 1Z63A 1SVSA 2O8CA 2ODWA 5C18A 3ND9A 1OFUX 1G19A 5DYGA 5KNCA 2DCUA 4DCTA 4W7SA 1VYUA 4CYMA 1EESA 2WKQA 4QHYA 2P5SA 2CJWA 2FFQA 4JLJA 1CTQA 2ZJZA 2OEPA 1NF3A 2VL7A 4TLAA 3THXB 3E70C 4MKIA 4YXWA 5A5GA 1KO4A 3BERA 5JHGB 3U61B 1L7VC 2QGNA 4HYYA 1NP6A 3NC0C 5UKDA 3BFXA 3B60A 3RC3A 1Q0UA 4NCHA 4Q4AB 3M0EA 1AKEA 1N6HA 2OCPA 3V4RA 1MABB 1N5IA 3K8YA 3BAFA 4FMDF 4EJSC 1XXHA 4NZYA 2OSBA 1KO8A 3X1DA 3RVBA 3K70D 4DIEA 4LZZA 1T3LA 2DHRA 3EZ6A 1HE1C 4TTPA 4S35A 1D2NA 4IDNA 2IYRA 2YOGA 2I1QA 3SHWA 4KI0A 2PH1A 4CGZA 2OZEA 3RYTC 2HCJB 4I1SA 3Q7PA 1NJFA 2YVUA 5GADl 1E9SA 2ZRHA 2FF7A 4A1FA 2A5YB 2YWGA 3KKQA 1GM5A 4ZIRB 2BKEA 1ZNXA 2J7PA 4A8JC 4D0LB 3A1WA 1KK2A 1YRBA 2V7QD 2Z43A 1EWRA 1NMYA 3PUZA 4A9AA 4TL8A 4CT4B 3X1XA 2XOKA 1QHNA 1VYTA 4V0ME 1FFHA 1IM2A 3THOA 3DL0A 4EIWA 3FKQA 1CR1A 3CPJB 4RZ2A 5TMPA 4DLSA 2XJ4A 2BV3A 4JZKA 4M9QA 2VSFA 5F9HA 4TZ6A 4HZIA 4EFNA 2RMKA 2QT0A 3GLGE 4M1SA 4LWZA 4KBGA 1J8MF 3B1ZA 1D8TA 4M0LA 1E0JA 4MA4A 4B76A 3AP3A 3PCRB 1E2PA 1BMFD 5B30A 4FN5A 1JAHA 5IK2A 3U6KA 1M6NA 1DADA 1G4UR 1KI9A 3EZ2A 5FUVA 3BB1A 2CL6X 2CK3D 4JLKA 4D6PA 1DPFA 4M9SA 3VKWA 2RHDA 3TW8B 3TNFA 2LKDA 2Q9CA 2SHKA 4FIDA 2XGJA 1DAEA 2GEUA 3EZFA 5FBLB 1E79A 3NTUA 4Q9JA 1F2UA 3IHWA 5FOSA 2BBTA 2JDID 1P9WA 4RD1A 3RSOA 4Z1MD 1NIJA 4IJMA 3AKDA 2DR3A 1CBUA 2CJWB 2VP4A 3L8ZA 2WICA 5DE3A 1AQYA 1G8HA 3GJ7A 4KODA 2AXNA 4RD6A 4HEJA 2WWHA 3OF5A 4NHOA 3RWMB 5K8LA 3T61A 4FD2A 3KB2A 4QJ5A 3CM0A 4QOSA 4G5GA 1RRCA 4HLCA 3SI7A 2QM8A 2F3TA 3LQRA 4MRNA 2GZAA 1Z6TA 1OH7A 4M1WA 1IBRA 1XEWX 2W83A 3AVPA 4R71A 4P4UA 4RCYA 1K6MA 2YC2C 1G3RA 2GA8A 1XFAA 4D4LA 2IYYA 3F8TA 4NBSA 4ZV4A 3N5CA 4PTLA 1OW3B 1LY1A 4KLZA 5K8UA 1R2QA 1W4AA 2OM2A 3UKDA 1ZUIA 2DFKB 3DMDA 1WRBA 3CO5A 4IVQA 1GL7A 4YMTA 3UWOA 1Z29A 4KYIB 5B58C 2YWFA 2FFHA 4P31A 1BKDR 1W0KA 2JIZA 3EIEA 3K1JA 1YVDA 1RC8A 1GDDA 3VR5A 1Z6YA 2YOHA 5HTKA 1HQYE 1P72A 4F92B 3H0KA 3B1VA 1JR6A 4MYHA 1E1QA 2IYWA 3LW7A 2GXAA 1LW7A 1NN1A 5EE1A 2ZRIA 2WWXA 3LA6A 3AGPA 1RYFA 5AJXA 4NTZA 3CRQA 2ONJA 1TEVA 2BMDA 3BK7A 3N2EA 4IDPA 4II7A 4Q4LA 2FZLA 2CNWD 2GXQA 3DM9B 4W5WA 2B7BA 1Q3HA 1W0JA 2JJ1A 1ZM2A 4UXIA 2FOLA 1CS4C 1A2KC 4JKIA 4ITRC 4MGZR 3KUDA 4PQFA 4R98A 3GD7A 1QRAA 4PO9A 3CR7A 3MLEA 2BMJA 3L82B 1A5TA 5BN5A 1GRRA 4V0KA 5FUXA 2J1LA 3SEAA 2X2EA 2X8AA 3VTKA 3WBKA 2GBLC 1PJRA 3QXJA 1RFLA 5SZIA 1T0JB 1KY3A 4F7WA 2UVQA 4LBVA 1XNJA 4MDFA 4Z51A 1YE8A 2BKUA 2PX3A 3D6TB 4QHTA 3NWJA 4M1TA 3BH0A 5J5CA 1AS0A 2V7QA 4RFSA 2IYTA 4LYFA 1FQKA 2UZIR 2GZDA 5EE0A 2VP6A 4I1VA 2HYIC 2IWRA 4KO8A 2WTUA 3KDSE 3R8FA 4JL6A 4DLWA 4C0QC 1OH8A 5JRJA 1UJ2A 3UIEA 1BO6A 1SXJC 2ZSDA 3F3YA 4X8OA 4AKHA 3L2OB 1XEFA 5LBIA 3FMIA 4MKFA 1RYHA 4PO8A 2XB4A 2JLYA 1YZQA 1YR6A 2N1BA 4DLYA 2ZANA 3LFUA 3KQHA 3SN6A 2VLIA 4LBYA 3Q85A 2ZYVX 1T8TA 4A0FA 5AUPB 1M7HA 4OQLA 1ZCBA 2OCAA 3EG5A 3HYRA 2F9MA 4URZR 5F98A 2WPDD 1U0HC 3AP2A 4LX0A 4U7DA 2IXGA 4TL6A 1BMFA 1GL6A 1NN0A 4Q4HA 5LD2C 5ANRB 4TYPA 3A4MA 4XD7D 1H65A 5L3QB 1II9A 1RKBA 4ZKDA 2EWVA 4MGKR 1KJZA 3UATA 4EFLA 4HAVA 3EARA 2CK3A 3GJ5A 1XMIA 3AKYA 1FW6A 4QGFA 2VPPA 3U4QB 3B7GA 3LD9A 2E1RA 3BH6A 4JVMA 4RY2A 4ZI2A 1NBME 3GJXC 1TU3A 2IW3A 4LC1A 4PC1A 4LV6A 2IT1A 2JGNA 4JIMA 2JDIA 2EVWX 4D26A 4B47A 4Q66C 3OE7D 1TPZA 3CF6R 3NKVA 4IOKA 4Q48A 2QP4A 3CPHA 4M1KA 3KQKA 4MUBA 3WRYC 1KMHB 2W6JD 1AK2A 3BOSA 3B13B 1NY6A 3MWKA 4NH0A 3U60B 4LJYA 1KJWA 2A5JA 1VG0B 4B2PA 2F9LA 1JECA 3DOEA 2G0TA 2R62A 3LBNA 1G3QA 2PMDA 4LJ5A 3TIFA 3O8CA 4OK5A 3LRPA 1OH6A 3SZRA 3K70B 1JALA 3OIWA 4DCUA 3L0PA 4LPSA 2AHOA 4P32A 1RJ9A 4B34A 4OL0A 5JI3E 4OK3A 5JLJA 5FI1B 4BWYA 2J46A 4LHYA 3ADBA 2GAAA 4B73A 3IO3A 2WV9A 4ZDKA 4EQ6A 4PZLA 3IIJA 4HDCA 1Z28A 2ANBA 1LTQA 5FBQB 3UMRA 1K5GA 1JR3D 1P9RA 3A8TA 2FPLA 4M9XA 1R0YA 1QVRA 5EXXA 4W5HA 2VQSA 1YU9A 2VP5A 1NRJB 2PJZA 2C5LA 4XOIA 3ZVRA 4BASA 4EUNA 1TUIA 1QHGA 2ODEA 2QAGB 2YWHA 4WIAA 5KUTA 2O52A 3NDBB 1KDRA 4JBXA 3QKRA 3N70A 5DO9A 3ZIAD 3A1SA 5GJCA 1HT1E 5B64A 1KI4A 4YDSA 2ZS8A 4BLPA 2NO7A 2R6DA 3PJRA 2H5EA 1AZSC 2CNWA 4Q03A 3VKGA 3HWSA 5C4GB 3PIRA 2EW1A 2IS1A 3VU9A 1I2MA 1M8PA 5IF9A 5LB4A 2IHYA 4H1UA 1E3MA 1GKUB 4WZ6A 1VCNA 1D6JA 4P3YA 4GMXA 1N3BA 5JEDA 2LWIA 2V1XA 1LS1A 1GUAA 1DBSA 4QBGB 2J0UA 1DG3A 3TUZC 4JSYA 3C5HA 1FL9A 3V4FA 3T5GA 1VYVA 1E4YA 1CU1A 1UAAA 2ZRGA 5J4YA 4ZCIA 4RFVA 2W2VA 3OZXA 4CZ2A 3FFAA 2YZ2A 1CEEA 2REBA 1E1RA 1TADA 1P7CA 4GOXA 4TMXA 5FH9A 3K0FA 3QXSA 3RHFA 1W46A 2EFDB 1ETUA 4IRUB 1G8GA 3BFVA 3EC1A 2EFGA 1P4SA 2IUUA 4CEJA 4R7ZA 2NO0A 2V1UA 3EPLA 1NVVQ 4IFBA 4RCZA 1G7TA 2IUTA 1N5JA 4MITA 3ZGXA 2RH5A 2BBSA 5H70A 4L4UA 3QG1A 1XEWY 1Q57A 4KFTA 1Z83A 3SJAA 2IYUA 4I1UA 1SVOA 4A0GA 4DEYA 1R8QA 1W36C 5C1BA 2AL7A 2H7VA 5IT5A 3DHWC 5CDFE 1J7KA 3NBZC 2ORIA 1UKVY 2FWRA 4K46A 1CR2A 2WPDA 3BS4A 3BJIC 1BIFA 4Q18A 1SGWA 1U9IA 4V03A 4X8LA 4G1UC 3ICQB 3FVQA 1JJ7A 1PLJA 4ESHA 5J4HA 4XD7A 3HPRA 3K0CA 2GJKA 4YONB 4DLUA 3PG5A 3VX3A 1FMLA 3LW8A 2XAUA 2ONKA 3WYGA 2GEVA 4PSAA 1ZVQA 1WXQA 2W00A 2XSZD 2EYUA 1MO3A 3GLFA 1LS6A 2BJVA 1D2MA 4HLUC 3ZVMA 3I62A 4XTCS 1CLUA 5SZKB 3QVVA 1XPUA 3VFDA 1GITA 2ZR7A 3X1YA 1KSGA 2PLRA 4QBFA 3ZJYA 3ZVNA 2QQEA 4EKDA 3THYA 2IF2A 1IY2A 3VU9B 1O3YA 1CP2A 1VCMA 1XF9A 2W6JA 4O2LA 1AGPA 1YR8A 2PT7A 2LKCA 4Y0VA 3WY9A 4MKHA 2QMEA 2V3CC 4DB2A 4TYWA 3AF4A 3KJEA 4PHGA 3QIAA 4DLVA 2AXPA 4JLVA 2BJWA 5EE9A 2AR7A 5HZHA 2IYXA 1XPOA 1OV4A 5JCPA 4DC9A 1YZKA 1L4YA 1NVXQ 2QMOA 2NOAA 1Z22A 4BLOA 1QZXA 4QBHA 2KE5A 4A36A 4JLNA 2HXSA 1MT0A 2OBNA 4N3NA 4YXWD 4LHXA 1IY1A 4FMBB 4IHQA 4HB2A 4KBFA 1X1SA 2Q0HA 4NYIR 4TL9A 1II0A 1ZJ6A 1YKSA 1G20E 4IDQA 3BB4A 2VP9A 4QKQA 3PEVA 1FQJA 4YC7A 1GFIA 1NG1A 3HR8A 4HDOB 4RD2A 1G291 1JR3A 1XD8A 5FPYA 3SHFA 2JLUA 4JJZA 3UANA 1KDPA 3DM5A 3KFXA 3TUJC 1XCMA 1OH5A 3KFVA 3GJ0A 5H1YA 1KI7A 4CRWB 1N0WA 1PVOA 2RCNA 1KI6B 4R2HA 1I4TD 2RGGA 5DHFA 1N6IA 3TMKA 2XTNA 3ZIAA 2ERXA 2FG5A 1CR0A 4JVSB 4LHZA 2HJGA 5FTJA 1JJVA 3WRXC 4URYR 3G0HA 2DFLA 2HV8A 2MMCA 1FX0B 2ZTSA 3O47A 1DOAA 2AFIE 3T1OA 4OQNA 1GKIA 3GJ8A 2FPKA 5CYPA 2O5VA 3U2QA 1G6OA 5AR1A 2PLFA 4ZCMA 2BDTA 1GL9B 4L16A 5JS7A 3ZZUA 4AG6A 1OYYA 2NQ2C 4OQMA 3AVWA 4DDVA 3GFTA 3FMPB 3LO5A 1E2EA 2HXYA 2REOA 2C2HA 4Q4JA 4XH9B 1TX4B 4X8MA 2OLKA 2CEAA 4TYQA 4NPHA 4IOJA 4KV9A 4B6FA 5JJKA 5DYIA 1XWIA 3KXIA 2O8EB 1AGRA 2H17A 2PCJA 3CWZA 4DLZA 4B3GA 1EFRD 4MYUA 3QSYA 1YZNA 3I72A 1EK0A 1DE0A 1TQ2A 1TQ4A 3A4NA 3KKPA 1E9EA 5BWMA 3FB4A 3OHMA 1S9HA 2OO7A 1ZUNB 3GEHA 4US0R 3RLFA 5CYOA 4JSTA 2ZUBA 2MSDB 1E2LA 3NEYA 4B43A 5FBVB 1O87A 3B2EA 4NYMQ 4B35A 1G5PA 2ORWA 3ZZTA 1K8RA 1XJQA 1QBKC 2R6AA 1XDBA 2XITA 3AVOA 3B9QA 2FGKA 4KSBA 5B2ZA 1JQLB 2PX0A 1TF5A 5KU1A 1OHHD 1FZQA 2VHUA 4M8NE 2XTZA 4TMVA 1MOZA 1EWQA 2IBMA 4LGMA 3GLHA 1G18A 4AKEA 1G16A 4A2PA 5EQTA 4A6PA 1LNZA 2PBRA 2QRZA 4XVQA 4DXAA 2ZI4A 3RRYA 4WXPA 3QKSB 4LC0A 4NONA 2OAQ1 2ZVQX 2ODNA 1X8KA 3CRMA 1ZU4A 4Y0AA 2XSZA 2X1VA 4GMDA 1OB5A 2ZS7A 1J99A 4JT2A 3I4LA 2RAPA 3KB1A 4MRPA 2VF8A 4CF7A 1MO4A 2XEXA 1KZGB 3D8BA 5E95A 4P33A 4MGIR 4GPTA 3U44A 2ZUCA 4YDHB 4D0NA 3DEFA 4QGGA 3KX2A 3LVQE 4WZAE 1U8ZA 2NO6A 2OXRA 1XTSA 2JIZD 4RKEA 5C46F 2QPOA 3QBTA 3LDAA 3IO5A 3W34A 2J59A 1GILA 2E9SA 3E1SA 4Q1BA 3K9GA 1SVWA 3GPLA 3MMPA 1E1QD 4OQXA 4FINA 1R4AA 2BBWA 3NVAA 4DCNA 5JSZB 3VNUA 4BFWA 2PL3A 1BOFA 2D2EA 3VR6A 2CBZA 1OIXA 1P9NA 4A4DA 3LLMA 3CONA 4UJ3A 3EZ7A 4KVGA 1NG9A 3MRSA 3K0AA 1KHTA 3SBEA 1W0JD 2JJ1D 4M1OA 3GJ6A 1G8YA 4LUCA 1F2TA 3NBFA 2OCBA 4V0OA 3T06B 4JJKA 2H57A 1P61B 3JZAA 1NLFA 4GI7A 3OIUA 3EWAA 5GJBA 1KI3A 5L3RA 3QXCA 2VP0A 2G9NA 4AG5A 3T1TA 3ZYCA 2Y8EA 1JB1A 2DWPA 4YMUA 3ZD6A 1FOEB 2GILA 3L0OA 2P6UA 4PC3A 1A4RA 1RIFA 3QY0A 3UMSA 3QNUA 1WQ1R 1US8A 2NG1A 3FHCB 4C0LA 1WE2A 3KQNA 1YR9A 3U5ZB 1ZYUA 2IHBA 1FNNA 2W2TA 3QENA 4GP6A 1XD9A 2J45A 4UNRA 5FFMA 4PC7A 3QXHA 1HTWA 4PZYA 4EJSA 2GJ9A 4PPNA 3WYFA 4DUGD 1OXVA 1S1MA 3DO6A 4XVUA 4DLXA 4BE7B 4BFUA 3GMTA 3VR3A 2WMNB 2QUZA 3CKLA 5FTNA 4FWTA 2HCBA 2PMKA 4A6XA 3GQBA 1UKZA 1W2HA 4PPQA 2ZJBA 4DCSA 2V55B 1LF5A 3D7MA 1W7AA 2XXAA 2JLVA 1COWD 4MH0R 4HI0E 1ZD8A 3TGPA 2WKRA 2IA5A 5AUQA 5JZVA 4A82A 1SULA 1G8PA 3G82C 4BFTA 4Q1FA 4A8JA 1OXSC 4BFXA 3VAAA 3WNDA 3UPUA 1E2JA 3LNCA 4NDZA 1EFRA 3SYKA 3H84A 1YQTA 3ECCA 1SVKA 4KSCA 5KDDA 3ZD7A 2KBFA 4TLCA 1ZIOA 2O8DA 3UG7A 3EXAA 2WWIA 3QXXA 2R44A 3M6AA 5EJEA 1N25A 3THWA 1K5DA 1CRPA 1T5LA 1SXJD 3CZQA 1XTRA 3AUXA 2HDNB 3NC1C 4JLOA 2VO1A 2IXEA 1ZNZA 3DDCA 3LX8A 2BEKA 2RGXA 2ZPTX 4TTQA 5GVSA 5DLQC 4LHWA 1HEIA 4Q9HA 3TKLA 4TT3D 3TQCA 4Q7JB 3JVVA 4RZUA 3KTAA 1GZSA 4PPGA 2WJGA 4CEIA 2WJYA 2O8CB 1G5TA 4HUQA 1VIYA 2IF0A 4MRVA 2ZI3A 2QROA 4ZKEA 5C2JB 1KSHA 2G1JA 1OHHA 1DVRA 2GRJA 1T91A 3K0AB 3MWYW 4ERNA 1P2UA 2WWWA 4OJKA 1E69A 1F2TB 2ZAMA 3RRMA 1ONBA 2JLRA 4OHZA 1ZM9A 4Q1CA 4UNPA 4IVPA 2GTPA 1VKJA 1UEJA 2L0XA 1Z0KA 1R10A 1JBKA 4R9UC 4JBWA 2ZRMA 5JI2E 1G21E 1KY2A 1XXHB 3BD9A 5D3QA 1G4AE 3EASA 2FZ4A 3PV0A 1T4GA 4UQOA 4I99A 1TAGA 2H8KA 4LOAA 4TLDA 4GOJA 3U7EB 2V4ZA 4AI6A 2UKDA 4OHVA 5FOXA 3UWKA 4AYTA 1N2CE 4Q9IA 3SU8A 3AUYA 5BYJA 5FI0B 4Q00A 2PEZA 4B2IA 3EPJA 3WHKA 2C04A 4BZXA 2VA8A 1J90A 5SZHB 4C9BA 1SHKA 1SKYB 2CE2X 5TXGA 4UXJA 2C77A 1KO7A 2CL0X 1W1WA 3AKEA 1QHXA 2PEYA 1Q1ZA 2V6IA 2FMXA 3HP1A 5CK4A 4C0BA 5DI9A 4DBLC 5JECA 1UFQA 3P20A 1DTSA 1S3GA 2GKSA 3L0SA 4P0TA 5SZJA 3AVYA 1A7JA 1WMSA 3BBPA 2XXAB 4URVR 2QTFA 4GFDA 4AY2A 3TR0A 1WA5A 2IYZA 3REFA 1UDWA 4BFVA 1FMJA 3G5UA 1ODFA 4L8GA 2CCJA 4MQBA 4ACAA 5H8WA 1M2OB 2QNRA 2O8DB 3C15C 4DLRA 3H4MA 1OKKD 3T34A 3GJ3A 4DT1A 2Z83A 4Q9KA 4WA7A 1AA9A 2EFCB 2YWEA 4RSGA 2QBYA 3FFBA 2F7SA 4XJXA 1P75A 4JMPA 1X86B 2WOJA 1Z3IX 3T5DA 3K70C 3EPKA 5DGXA 5FOWA 3TAHA 2HT6A 3GCGA 2NO1A 1E1RD 2F3RA 5C4MA 5J4KA 1IAQA 1F2UB 4FI3C 1YJ5A 4G5SA 4HUQB 5EUMA 2OXCA 1FPMA 4PC2A 1X1RA 2GESA 1AKYA 2ZEJA 2W58A 3MD0A 2ZJOA 1E99A 2YYZA 3CX8A 4QNMA 1UBEA 3WBJA 1C9KA 4DUGA 2CVHA 3IUYA 3VR2A 4MRSA 1RW4A 4POAA 3FTQA 1J70A 1NKTA 4PC6A 1XJCA 2B7CA 5E7MA 3QF7A 4PXAA 1XMJA 2GBLA 4PZZA 1D9XA 1VG9B 1W5TA 5JHHB 2NZJA 2QAGC 3Q9LA 4R2IA 3EC2A 4ZO4A 5G3ZA 1COWA 2O8BA 4XSGA 1ZM3A 1W48A 1YZLA 4AYXA 3BB3A 3AP1A 1OB2A 3B1YA 4LI0A 2QG6A 5DSZA 1CKEA 4JLBA 4QM7A 1Y3AA 3QKUA 4M21A 1UADA 4B6EA 4HAZA 1IXZA 1M7BA 2PT5A 1KMQA 1EG7A 2ZQ5A 2ZU6A 2FNAA 2CMKA 1F48A 3H86A 4A2WA 1HV8A 4KCGA 1SXJA 2VH5R 1UM8A 4U00A 2XZLA 2GCOA 1W36D 2ZE6A 1XXHE 5FBWB 1T5IA 1ZW6A 4DSNA 3C5CA 3R7WA 1CJUC 2OE2A 1RVDA 3NEJA 4KLNA 3R8CA 5LDDC 2J87A 4YMWA 3W90A 1MKYA 1CULC 4TT3A 1VCIA 1HURA 2QTHA 1L8QA 1NLYA 5BYKA 1VHTA 2HT1A 5KTYA 1VMAA 3K0SA 2VP2A 4Q47A 5BN4A 6Q21A 1JI0A 3BXZA 2WSSD 3MWLA 3Q3JB 4G3XA 4UKDA 4OI1A 1UBFA 3FMOB 1T0HB 1XCGB 2D74A 2QSYA 4GT1A 3LAWA 4TWZA 1LV7A 3S1AA 2ZJ2A 4CW7A 4D25A 2QA5A 1RZ3A 1SKYE 2ZAOA 3NDPA 1MV5A 1ANKA 1Q3TA 3FYHA 1U94A 3WP1B 2FGJA 4ARZA 2NZ8A 1Z0JA 3JVUA 2DWQA 4HAXA 5E7JA 2WM9B 1S96A 221PA 3P1JA 2QBYB 4M2LA 3N2IA 3GFPA 3QG5A 4LJ6A 5FOUA 2YHSA 3EIHA 3GEEA 2AN9A 5F2EA 3QPUA 4XWOA 5J40A 2ERYA 3ETLA 5AJVB 4HLQB 1TEXA 3CRW1 3C4JA 4FMCB 3CH4B 3R20A 1G8FA 2Q21A 4WOPA 2WIBA 2WJVA 4TLEA 1VHLA 1ZNYA 3OEHD 4ABYA 4BLQA 1FTSA 4ESVA 4G5QA 1GKYA 2I3BA 2JLQA 2QEQA 1MRNA 4PAOA 4CEHA 1BYUA 3WHLA 4B44A 4AYWA 3GLIA 4C30A 2GXUA 4IEIA 4ON9A 5DI3A 4MKGA 3CX6A 4TMTA 4RFSB 1EX7A 3JZMA 1Z6GA 3AVVA 2N46A 4DWJA 4DDTA 3LQQA 5DHAA 2OBMA 4N1AA 5IHPA 2J0QA 1GAJA 8OHMA 2AD5A 4C2TA 4XWKA 4A2QA 3CH5A 4B32A 2P5TB 2X77A 2IEYA 4NCJA 4CT5A 2ECKA 3IGFA 2A78A 4O3MA 1XX6A 4BLTA 3CLVA 4TSFA 2FN4A 4WBSA 2XX3A 1W49A 1DAMA 1VG1A 4D4JA 3I5XA 3U7FB 1IN5A 2GXSA 4QC2A 3ASZA 4XTRA 5H68A 2KI5A 3EIQA 1ZMXA 1G7CA 3IBYA 3L8YA 2P0EA 4Q4HB 1OKKA 3CF2A 4FMDB 3AB3A 4AC9A 1TF2A 3ND8A 1LF0A 1SXJB 4BRWA 4UXHA 4JLPA 2GCOB 1A2BA 5DN6D 2TMKA 2GHIA 3QUSA 4GOKA 1C1YA 1U81A 3ICEA 2W0MA 1NLZA 3GEIA 4HZUA 4LRWA 3CBQA 4BFSA 1J2JA 3TW4A 2XJ9A 3QQ5A 2YNMA 3A1TA 3ZQJA 3LVRE 4YQFA 3CRRA 4M4SA 5IDVA 4PFSA 4NP6A 4B75A 4IKEA 4HLDA 1Q1BA 2VBCA 2ZRLA 1B0UA 2VHTA 5LD2B 4V0NA 3QOFA 1G9XA 4W5JA 1H8EA 3QEJA 2AKYA 3E5HA 3SJCA 1YHNA 4HAWA 5BN3A 3S1AB 4JBYA 3C14C 1KI2A 4NCKA 1OXUA 3MJHA 4BUJA 2PCLA 3CPEA 4EPXA 2ZJ5A 3SYLA 2J0SA 2ZRAA 5BW8A 3QKTA 4C3ZA 2MMGA 1KI1A 2FPMA 3CX7A 4LYHA 1JPJA 1DO2A 1R7RA 1BH2A 1AS3A 2XB2A 2GF0A 3IEVA 3W8RA 1Z5ZA 3B82A 1U99A 4JL8A 5JMTA 1WBDA 2G83A 2JEOA 1R6BX 1NMZA 1NL3A 1RJ9B 5FPTA 3WYAA 3DKPA 5KPDA 4AKIA 5AK0A 2P67A 1N6KA 1Z47A 5CLLA 2OUKA 1ZUHA 2OFXA 4EQ6B 2BCJQ 5CB8A 1XU4A 4KHZA 2NPFA 3VR4A 2W6ID 3IEUA 2JLSA 1KNXA 2OT3B 3KL4A 4QJ4A 3GLIB 1GNRA 4A0RA 3KJGA 4ZDWA 3HU3A 1GNQA
chains in the Genus database with same CATH superfamily
2VUHB 3RE1A 1Z7EA 3QFTA 1RLJA 3DVQX 3T7SA 1B0AA 4DIDA 1ZD9A 3AEUA 1K8YB 2J3DA 5KYNA 4NABA 1TVMA 1ZJ4A 4ETNA 4B2LA 1C50A 2VS1A 2WU3A 2AOWA 3L77A 2HYIC 2V5VA 2CLMB 4BEBA 2RHJA 2X14A 1YUBA 2GVDC 3BWCA 1JXMA 5TSDA 4QPJC 3T6KA 1DCMA 3RYCB 3AOEA 1EBBA 1VGRA 2WSSA 1XUOA 1W5EA 2BEVA 3JRXA 3L1HA 5KDOA 1V95A 1YDEA 3IFSA 4NYJR 3BMOA 2V9CA 3IIMA 1U4OA 1CUJA 1BEEA 2ZBGA 1JT2A 3A1EA 5GIPE 1EQAA 4KU4A 5A2GA 3H42B 2Q3JA 4EPTA 4YRNA 1XCPA 4MEBA 4V2UA 1YZGA 3KSBC 3M70A 1L1FA 2Q1YA 4E0BA 4WBNA 1K66A 4G1CA 4AZSA 4F46A 4JY7A 5T8KC 1ZAYA 4XYBA 1MN6A 2BLLA 2XUKA 1Y1QA 2ZJ8A 3EA0A 5A9RA 2VQFB 1P0QA 1UAGA 1UMKA 2O7QA 3U31A 2WVHA 5J1TB 1T8UA 4XA8A 5LYYA 4CN8A 4RVNA 1EWTA 1ZKDA 4BGUA 1XN1A 1K7XB 1T34A 1Z4QA 2DLNA 2H18A 4I50B 2IH2A 1QDEA 5K0TA 2OWDA 4BNNA 4RC9A 1SBZA 1A50B 1NNI1 4DR7B 4XDGA 2DWUA 2IOFA 2PLNA 3X1MA 1WKCA 4B3XA 4CM5A 4HNHA 2ATCA 3DYBA 1P7ZA 5BRAA 4CEJB 3ADPA 1C80A 3V7UA 4F5YA 1C1DB 3PXBA 3QLVA 3FCAA 1IHYA 1SOUA 1Z0FA 3FWNA 5HE8A 2J5XA 2QTTA 2JJ2D 2VZ9A 1UPCA 3GBPA 3PFBA 4G67A 4M6WA 4DIFA 2IHZA 1EBUA 3PUJA 3O9ZA 1GLGA 2C57A 3GUVA 4QFMA 1Y8CA 1Z08A 5AW9A 5KYWA 3GGCA 1HWYA 2ZYGA 1AQUA 4XQCA 2CC2A 4YJ3F 1WXXA 1II8A 1NSFA 3C2QA 2KMLA 1K7YA 3IT3A 3LYHA 3DCIA 5LU8A 3GUYA 2R6GA 2YXDA 3C16C 4IV8A 5KTTA 2OHIA 1SR8A 1PZGA 2ZE8A 2BFDB 2WYVA 3B1WA 3PUKA 1S8FA 2BHRA 1DAGA 3L4EA 3QTLA 4WA8A 3C97A 2LUOA 2WIFA 2AFVA 3VDNB 2W43A 5IAGA 3FOFC 1UBJS 2XDYA 4DA6A 3E22B 3C8DA 3O4HA 4MR9A 4MV7A 3TVTA 4ICIA 1UBRS 1NVKA 3VR3D 3AFNA 1BVYF 4OU5A 4MO9A 5FLEX 2R68A 2G9UA 3TB4A 2FSHA 1XMSA 2W98A 4NMHA 4H4CA 2ZRBA 4K87A 5ALLA 4P2BA 4X64B 5KWEA 1CUXA 3QTBA 1Z5NA 1ZGBA 4M1YA 4G0NA 2XUPA 3WRXA 3UUFA 4AKTA 3U16A 3K1YA 3L9XA 3D5TA 1YV9A 2B3TA 2Y67A 4IEEA 3P0HA 4ZTZB 1OFUA 4KMOA 5KJFA 2GFIA 4AECA 3RVPA 4PHTA 4HTAA 1PS0A 3BK1A 3PC8C 1BS9A 1ZRHA 1RE0A 1FVOA 3E82A 4GOMD 3GFOA 2BFPA 2GPTA 4IVRA 1XMQB 4M49A 4RD0A 4KXVA 1RQGA 1U1IA 3SZOA 2VBGA 3GV0A 2R1TB 2G25A 4EUSA 4EJ6A 3OQMA 4J9UE 4ZQCB 4IOLA 1J0DA 3GEGA 3KXDA 1NUQA 1X1AA 5G53C 4YUZA 5AVWA 4N5MA 3ZU4A 3I12A 5LQAA 3R5SA 3S2EA 5ALIA 5AW5A 4URXR 2VTKA 3LS2A 3T1QA 3AETA 3B8HA 1ZCAA 3JQ8B 3T95A 4BX9A 3FUUA 4QYMA 3AZPA 2PGIA 3AWIA 4XX0A 3WMEA 1XRJA 3ZE6A 3IKTA 2IZOA 4MW1A 2QMQA 1RQ7A 2IKSA 5DM1A 3ET4A 4G1MB 4EW1A 1AUPA 1QPGA 1WXWA 1OBHA 1RABA 2PH5A 2QD3A 2VZEA 3IPCA 3NDJA 3NHLA 1VA5A 3O73A 3QBEA 1K1EA 3N8NA 4PONA 3WYBA 2WD7A 5CB4F 2UYHA 5CT4A 1M67A 3QHQA 2CXTA 3N6VA 1RC1A 2MSEB 4MB6A 4UFOA 3WSTA 1UH5A 2ZQYA 1JVNA 3GVHA 3IBGA 1XKXA 5LYJA 2FB9A 4F93B 1WSWA 1P1HA 2PZEA 4FMPA 4J75A 3SXJA 3HYTA 3T1YB 3NGMA 2EG5A 1P19A 2E87A 2CD7A 1XNHA 4O4JA 3EWSA 1S0UA 1V8DA 1O7JA 2G4VA 1JPUA 2D1FA 2EWWA 4I3FA 2HD4A 3WAKA 4Z4QA 1SIOA 2AH5A 1MF7A 2EGGA 5KNDA 3AR7A 4KOEC 4QVIA 1GCGA 3PUVA 5KWSA 1M34B 4FEAA 2HIGA 5H4HA 3UOWA 2H4FA 1I01A 3T3DA 1WB4A 4ZIRA 1VJ5A 4BMOB 5L40A 4CIVA 2VBFA 4HDRA 4CHGA 1J0AA 2ZCVA 5HFAA 4YMVA 1PDWA 1PYDA 3DEHA 4Y30A 5HE9A 1C30A 1E3WA 1FDOA 4A26A 1XTJA 2XNDA 1KS2A 2WHPA 4PCUA 1X1BA 1C7IA 1HOTA 2H00A 4MJ7A 1N33B 2R66A 4XFJA 4DWVA 1NPDA 4DKJA 4WECA 4BV3A 3OA2A 2YVKA 4KQCA 2VUTA 1V71A 1G1AA 1UPTA 3LPAA 4AIIA 3ONWA 5FFNA 2O8NA 3PNPA 5BURA 1RWMA 4U02A 3QVUA 2YQ4A 1N7JA 4MMXB 4DMKA 2IH4A 2CEKA 4X93A 3ONEA 3O9MA 5FV4A 3SFTA 3ZZ0A 2CZCA 1TQHA 1C4XA 4YACA 5EE5B 2Z3ZA 1M7GA 3DEYX 3QVKA 1KEKA 3UYLA 1MAAA 3F8SA 4PANA 5KNBA 4OBBA 1XZIA 4C7BA 2QDKA 5HHTA 1ZIDA 3CVYA 1ENPA 1JMKC 3RO7A 2MYNA 5IBRA 1PJ8A 1AHNA 2C07A 3BKWA 5IF3A 2E21A 5G1PA 1B2RA 4KQ1A 3P4XA 1CJMA 2LW7A 3D4OA 3IAXA 1VSVA 3MINA 3NU1A 4L8VA 4W5TA 1M0TA 4E22A 4FTWA 1F6BA 2GI4A 2PZBA 5DLDA 3T15A 1QHHB 1UK7A 3NOXA 3KD3A 4Q12A 1GUYA 4MW9A 4NAVA 3GLFE 2O2DA 1ZEMA 2XUGA 4HOYA 1OX6A 4NV0A 5JAHA 3ADDA 3GDGA 1WIWA 2FE4A 1XB2A 2VA9A 4YVFA 4NOJA 2IRWA 2UYYA 3MT8A 3P2IA 3RTGA 1Z6XA 2J6IA 2CVOA 2JK1A 2QI9C 3UF0A 3U4AA 1QGED 1WUJS 3C41J 1O0CA 1SHLA 1OASA 1KH1A 1WF3A 4HY3A 3E9ZA 4IIJF 3S5UA 1U2GA 1BDJA 3OQBA 1BGXT 4GZMA 1J1UA 1QIJA 4I9GA 4TV9F 3ISTA 4II2A 5CJ2A 3TSWA 5JZSA 4LCEA 5I9TA 3ZE2B 1YA8A 3MTDA 4LN1A 4O2RA 3ILSA 3EMDA 2AWOA 2C2BA 3D6MA 3TD9A 2D06A 2H1RA 1NJ6A 4K05A 3TZKA 4AZ0A 4OHXA 2C2WA 3VH4A 3EA5A 3JQBA 2IYSA 1X9GA 5ALRA 2WC1A 8ABPA 3OIYA 3B6EA 3HLYA 1Q5PA 4UUNA 4LFCB 3QX3A 1E5VA 1QQTA 2WFAA 2D1YA 1QG2A 5EPEA 3LWNA 2RB4A 4JYMA 1V3VA 4JI6B 4E1VA 4EW6A 5CVJA 3F49S 1V35A 5DU2A 3CF4A 5B36A 4ZQBA 2FQ1A 5K0LA 4DSAA 2ZITA 4RK4A 5K3OA 3BEDA 2JAOA 1YBVA 5AKZA 4ASUA 4HGRA 2Y1WA 3D4LA 2JAQA 1G66A 1DIGA 1KAHA 1MD9A 2BHNA 2KPOA 3ROXA 1SZPA 4MI9A 3AFIA 3QE0A 4DZTA 1S3IA 3ABQB 3R5KA 1HQDA 3PHBE 4MQUA 3PPXA 1JR3E 5L3VA 4JLAA 1ZN8A 2OLJA 2P7IA 2UZ1B 5JBQA 1KEPA 3MFYA 1R74A 3KKOA 5KNCH 1SQ6A 2AI3A 4L6IA 2GLUA 4KDEA 4GPD1 1XBTA 5CU7A 3KAPA 1XDWA 3W4IA 4IHJF 2V6GA 2FX3A 4ZT7A 2BWJA 1FDWA 2C7GA 2F43A 5TEVA 4N0EA 2OQ2A 1T6NA 3DT9A 3TLBA 3O3CA 5DCYA 3QELB 4GUAA 2W6OA 3ZGZA 2NIPA 3NM5A 3Q7IA 5K0CA 1I80A 3K9LA 4OAQA 4EA8A 3IHTA 1YGYA 2XDQA 1S3FA 2ASVA 3KZVA 1PR0A 2O0MA 3PYXA 4J43A 3U7IA 3FJOA 3E15A 5EJ5A 2SKCA 3OPNA 2XPCA 4FCTA 1IZ7A 5HMMA 3MUOA 3PFHA 3E0XA 3I2HA 4KYTA 1P4RA 1TUGA 2R6HA 4ES6A 2CFRA 4HH4A 1DTEA 1ZBDA 2X6TA 1C7EA 2XNCA 4PHCA 4J0DA 4D9IA 2P6RA 4QDOA 1S2MA 2E7ZA 1TMKA 1ZUD1 1YRQA 3LQYA 4ZCTA 2CV2A 3I53A 1UQRA 1VRWA 5EJGA 2Q8QA 4QNNA 2GNAA 3PUWA 4CF4A 2B36A 5DNVA 2YYSA 2JKYA 1IIRA 5FUYA 2O59A 4WFQA 5AWFC 4GRIA 1EGMB 3EDOA 3HVUA 1SFRA 2PRIA 3RADC 4E5MA 2H7XA 2A57A 2VT2A 2Y0CA 1T9BA 2YFQA 4LCJA 4U7WA 1WQ3A 5D87A 4UQLA 4BXOA 3WQBA 1WB6A 4B6OA 2NUPB 4J90A 1LLFA 2XBUA 4QDUA 2ZIXB 5AM5A 4A0HA 3L4BC 4EJSB 5IG2A 3QBJA 5AHXA 2BAGA 2ZI7A 4UZEA 4WKPA 1D9ZA 1OSNA 4L9RA 4B3TB 1U7DA 3UJNA 3MJDA 5J2UB 1C8LA 1WXDA 4HH0A 5KKNB 2X0KA 3UC5A 1KWKA 3OPMA 4RO0A 3C8UA 4IYJA 5CB6A 3GQVA 5FLYA 2EGUA 5CT6A 1RLTA 4L2IB 3LXMA 4O59O 1VJCA 2NM0A 2AK2A 1PGPA 3MAAC 4C0SA 4D0RA 1U5BB 4V24A 1ONSA 1CY7A 1D4ZA 5K3DA 1T13A 3H83A 3M81A 3PFIA 3BWBA 3MRVA 2UUOA 3IPXA 4RZQA 1C8BA 3NHBA 5FOTA 2IV7A 4FDLA 4HAIA 2A1TR 2QU8A 3TKYA 3SHQA 4BVHA 2FLKA 3U0VA 3LQ1A 4OP3A 2UXCB 2X8LA 1CV2A 2VHWA 2Y0EA 4OTZA 4MV5A 3HKDB 3OT1B 1CQJA 1RBMA 3D81A 4FYWA 5JNRA 3PLAE 1EFVA 4QBIA 3ZBTA 4V0LA 3H3JA 3KZKA 3BL6A 4LV5B 3TLZA 1H6AA 1NY5A 3AM1A 4ZU6X 1CD5A 1M8JA 2I7DA 2VWGA 3OUTA 5AUNB 1FLDA 2CNNA 4CMHA 5CDFA 4C7OB 3V1TC 3KTAB 3L7JA 4H1VA 2B8TA 1PJSA 2NLOA 2H3HA 2JGAA 4JUBA 4C3OB 1KMHA 3BX1A 2IY7A 1CR4A 4EB0A 1YJAA 1Z2PX 3HA5A 4DM4A 2C3MA 4C2UA 1YRYE 1PVVA 1QHSA 3DB1A 3IE2A 1KK1A 3NCTA 4MR8A 1Y4DE 4WAUA 1MRSA 1V0JA 2EJUA 1GP2A 3RVLA 2R8RA 2DQSA 4M1EA 1PR1A 3M4JA 3PUYA 4JNCA 5A6SA 1LDMA 3NXSA 4EVSA 5I7FA 3KDAA 3FG9A 4HXYA 2D3WA 5E6RB 3V4ZA 5CFPA 1AN0A 4MWOA 5IVIA 2QZJA 1KGDA 2ZR9A 2CKMA 1E64A 2XEDA 4PHFA 2G1KA 1BW9B 1KZ7B 1UQTA 1Z0IA 3DFFA 4HN4B 3TB6A 3SQXA 4WQMA 1NJGA 2HEIA 3OQIA 1ZI8A 3HBLA 3P2KA 1EHYA 3TJZA 4UM8B 4XUDA 5LQMA 3O3MB 1L4LA 1CPYA 3HJHA 4PAGA 2XHEA 2OENG 2XXJA 2XZPA 4KAJA 3ZE9A 2BGGA 4K0KB 6ABPA 1K3TA 1O6GA 3GEDA 2WK1A 1PDOA 4KJZA 2JBAB 1R4NB 3OPVA 4P4SA 1HQCA 1V16A 2N47A 1TVEA 3IH5A 4JA2A 4IF6A 1TLLA 2GF2A 2YIMA 3MCAA 3ODGA 2HEGA 4CM6A 2ATXA 1JB9A 1KDOA 4TWIA 2VOEA 1XWWA 2CDCA 5EOVA 3RHSA 3PQCA 2QAGA 2OESA 2O0KA 3RS9A 1QG4A 2FFRA 1QCDA 3QMVA 1UJCA 1HDGO 2HK7A 2VF2A 3OC0A 3ZEIA 5HPYB 2JLZA 3RRXA 2NU8B 3VNRA 3QV2A 1JG6A 1G3IA 3F4LA 1GLNA 3PITA 4RKWA 4Y6QA 5CBPB 5IBCA 1DAFA 1GIAA 2RONA 5HKOA 3U37A 4WGFA 4YGXB 4HVLA 1B23P 4A27A 5K8TA 1BDIA 2J3IA 2NU6B 3Q0TA 1G2OA 3EZ9A 3HPQA 4EHFA 4N8SA 2WD9A 1YBAA 3NKFA 3M1LA 2JLWA 1PV2A 2W9XA 1G20A 1G5HA 4IQ8A 2JI9A 1N6LA 2C99A 4Q9LA 1SVMA 5JJ5A 5KREA 4RTRA 2I5PO 3Q98A 2GEJA 2ZTUA 1N7IA 3NNDA 4GSKA 2F8MA 1KH2A 2PZMA 5CM9C 3R3YA 1U8CB 3MMXA 3PXEA 1U7WA 1D6MA 1MDFA 3HEBA 2G9RA 2X58A 3NVDA 3WV4A 2W2XA 1BX0A 1VI2A 2NXNA 3R3XA 4LYAA 2RK6A 1BQEA 3G1WA 3DZCA 3JARB 2WWRA 3PZRA 5F77A 3T99A 2Q2OA 4B5LA 4EELA 4F4CA 5JZ9A 1EGAA 1RWPA 1U7TA 3CNNA 3OIDA 3SVLA 5KO2A 2YH2A 4OYHA 3WC4A 1S7CA 5JYBA 1DIOB 1GUDA 4K8OA 1ZW1A 4P84A 3VZQA 1H2EA 2R97A 3AOGA 1K7FB 5KKAA 1QHYA 4R84A 1MQ8B 3T35A 3GROA 3LRTA 4CL3A 3KRTA 3OEEA 1D2EA 3D6UA 3SOZA 2A35A 4EPYA 4MHOA 1YBHA 2WMDA 4PFJA 2FZCA 4U6SA 4EYEA 3A6GA 2JAWA 5B2EA 5EZ5A 3V46A 4KEAA 4C5BA 3G5LA 2B8WA 1XRLA 2PLAA 3JAKB 2AT1A 3ORSA 4DDWA 1XTZA 3JRNA 5DSTA 3Q8XB 4YJFA 5IXSA 4HJRA 1VDZA 2JZOA 2QKYA 4WV3A 5BQOA 1PFWA 4JUAA 4B3DA 4ER0A 4EF5A 4LVUA 4B71A 2VFAA 1RWBA 4RDXA 3L1VA 2QY9A 3PGJA 3Q7SA 1YZTA 4XIJA 4HYEA 4J0EA 3SKVA 2R4TA 2ZZKA 5IMBA 2RKBA 1H2FA 2DOKA 2QK4A 3VMFA 4X1YA 4TTJA 4YRMA 3B1FA 2O8BB 3EVEA 2J4CA 1JIUA 4MGHA 2O5RA 1XDSA 2GMWA 4UNNA 4XYGA 3RC7A 2QQGA 3T7TA 3TE6A 1OF1A 4EI9A 5H0IA 3O2JA 2WYOA 4MXDA 2VSXA 3CW2A 1J2RA 2CXRA 2O0LA 3QVMA 3A4IA 3A28A 1GARA 2PTGA 3NBXX 4YRKA 4B48A 3SFVA 5DMXA 2PYDA 2H4WA 2VWPA 4KQWA 5EJ2A 2ZZMA 1I0ZA 3BHJA 2XQKA 1QTQA 3HL0A 2VF7A 3L5KA 4KFRA 1MAUA 4NZMA 2H5IA 3PC2A 5K0JA 1D0VA 2BMAA 1NW5A 3UENA 1C2TA 4S1TA 4F5DA 1H2WA 3TD6A 5E3HA 4IW3B 5JRZA 3QI2A 3R9XA 4JWTA 1N0VC 3IXQA 3W8EA 5FF9A 2G82A 1OFTA 3RYFB 3CF4G 1DJQA 2IHUA 2OAP1 2OV6A 2ATIA 4NHEA 1ZK2A 2DTXA 1ZXXA 4IIJB 5JAZA 2N42A 2J41A 3C70A 4CV3A 2M6KA 2BHSA 4F45A 3RGGA 4CLRA 5KQRA 1T6BY 1MA3A 2G4CA 3BMNA 4KXUA 3GYBA 4RJTA 5LKAA 4GP7A 2Y0DA 3F6RA 4AY6A 1WCIA 3KOYA 5CK5A 1R8YA 1U8UA 5IJZA 1KP3A 1OGJA 2ZM6B 1JPNA 1RXUA 2GCIA 4IGFA 3KQYA 5KHOC 1P31A 2O7SA 1J56A 1U65A 3GDHA 2JF0A 1V8FA 3BF7A 3LOQA 3TPFA 5K0EA 5DM60 1PNVA 3RS3A 2Z0MA 5C81A 4H4EA 1M74A 4S0XA 4NYMR 3FDXA 4PAQA 1IY0A 1N6NA 4BGDA 1BYIA 2E18A 3LBFA 4PRLA 5TGDA 1LLQA 1PRYA 2ZYHA 3CINA 1YI8A 1EQ2A 3ET5A 3O0DA 4ALKA 1G5QA 1SCKA 4YBZA 4EABA 1NP7A 4CM1A 1YF3A 3R4VA 4OP2A 4BOYA 1ZM4A 1UKEA 2R84A 3TXYA 2H7CA 4WZAA 1RS0A 2F1JA 1YIAA 3NFRA 2GJ8A 3TOVA 1E4VA 3A3NA 4DEVA 2R8BA 3OPXA 2HWKA 5FADA 3K9HA 5BMVF 4GKVA 2FU5C 4XCXA 2ZUVA 1E3QA 4CEHB 3VJKA 3X1ZA 4AF8A 4BMXA 4K9DA 4QQRA 2WPNA 1ESZA 4HVCA 5BSHA 5BUCA 1PU2A 3ABIA 3VDXA 2ZWOA 3FFXA 1DKRA 4NG5A 3T5TA 4C76A 3AVXA 2W2OA 3PXAA 3FF1A 4BJ1A 1T8SA 2XKBA 3OY2A 3S2FA 1RJDA 4JZYA 3T4PA 2PA3A 1T1RA 2DHEA 2WOOA 1IBMB 1A4XA 3P2EA 4EB6B 2YWDA 1UDRA 3PEWA 2CW5A 4XUEA 2BBOA 1M1YE 4DMUB 3I04M 1SUPA 4RVCA 3E1GA 1FC0A 4Y2XA 1X7GA 4FYKA 2OFOA 2P9FA 2CZGA 2KBEA 2A3RA 1Z75A 3RNOA 4LBZA 2IZZA 1IEXA 2GM9A 3IP5A 1IUOA 4B80A 2GAIA 3E7XA 4C06A 3CJTA 4BKOA 5K4GA 1QS0A 4N48A 5ENVA 2Q62A 1AB6A 2GD1O 2GK3A 3PQ8A 1YONA 4L02A 5JJIA 2ZBFA 3DV2A 4C4YA 1N7HA 1WD7A 2VQ3A 1IHUA 4Z9AA 1IOWA 3OKPA 1I51A 1JI3A 1OBVA 2Q1TA 4DPKA 2AC7A 3B85A 5DASA 4Z99A 1FBNA 1E6WA 1RPZA 5KU7A 1ENZA 1NXVA 5K01A 3W3AA 4YRRA 3RWOA 2B94A 1JE0A 4WXRA 1JKXA 3HC7A 2HK8A 3PQ2A 4FW9A 5A4FS 1OILA 1X6VA 2R65A 4UTOA 5LA6A 1QVAA 1KOGA 5KX5A 4KPEC 2JGKA 4JS0A 4WADA 1SXJE 2HLHA 3QH4A 5DGCA 5DH9A 3HNOA 4ZAYA 1L4EA 1VBFA 3CZPA 1O97D 3OIVA 4N3BA 5LPNA 3HU1A 2NNLD 4GKBA 4ME6A 3WLOA 1XZMA 1YJXA 2YDYA 4G5HA 4HDKA 4AZ3B 5KNCD 5LZ9A 5F1PA 3ZOZA 1P6XA 3FAZA 2CDAA 1H0RA 3MELA 4I1PA 1L4UA 5JWHA 2O8EB 3MJSA 2J3QA 2YCBA 4PINA 4GXNA 1P5ZB 4FM9A 4G1VA 1XZQA 1DC6A 3K8OE 2B6HA 5I48A 3QVXA 2VSNA 5AW7A 5JNUA 1U90A 1UMDB 2NYUA 5HCUA 1TUEA 1NRWA 2R00C 1C7RA 3E03A 4RGVA 4YCBA 4ETMA 2X7HA 4OKSA 3OHPA 2V4UA 4KG7A 4XSHA 3F6CA 1ZGGA 1C9YA 4FZ5A 4LOJA 3M3PA 3PXXA 4Y0NA 3HL4A 3W8FA 3BWMA 4B7CA 1J20A 3GT0A 4TQ9A 4N5NA 1EEXB 4ZOCA 4KVFA 1PT7A 3F6SA 2C98A 4WW0A 1DAKA 1TQ6A 4FCWA 4PYMA 4YRAA 2JFBA 3FCYA 4Y1FA 2A1UB 1ESCA 1I4DD 3QFCA 3ZZNA 2PJRA 3QKWA 3ZDRA 2QN8A 4I14A 4J49A 3UWSA 3FZEA 4PW0A 4W9NA 2EFYA 1UK6A 2E6KA 2IYOA 2PSDA 3L0ZA 3ZLBA 2RGNA 2WE8A 1RI2A 2GUWA 2G17A 3MIIA 5LM3A 3E9DA 1K75A 1XKQA 1XCOA 2PFSA 2XYRA 4HRVA 4RZ3A 3RANA 3TJMA 2JGRA 5KTNA 3Q88A 2J7PD 2XADA 1U9ZA 1W88B 2J9RA 2FV8A 2ZSKA 4JI5B 1YOVA 1XDUA 3TBHA 1QF6A 1Z34A 1ZICA 4X1OA 3WL7A 4AD8A 4Q1DA 3OFND 4YR9A 5JSUA 2VJOA 3CZRA 2UYGA 1NQUA 1U3CA 3BGIA 2FPPB 4FBGA 5HUJA 2R1VB 4PM4A 3V4LA 4EKNB 3W3ZB 3RT7A 4PICA 4GC5A 4E09A 4EYOA 3OAAA 4AP6A 3PR3A 1G21A 1GY8A 1OYWA 3A9TA 4NI5A 1OQAA 2C03A 2GARA 1YDGA 5DWDA 2IWHA 2Z1MA 2CDBA 2FEXA 1YJBA 3DQQA 4OB6A 3STTA 4KIGA 1RRMA 4M0FA 1MENA 3AZQA 1PCXA 3PYMA 1FK8A 4HEA6 3GRPA 5DT9A 3RS5A 4DFDA 4G8JA 3FI0A 2VEDA 5EXDA 4BQIA 3BRWD 5AMXA 2POQX 4DSTA 3NUZA 1HT2E 2AN1A 4B8YA 4E33A 5M34A 3GW8A 1E6LA 4CTNA 3EZXA 3GY0A 4TGLA 8AT1A 2RBKA 3ZH9B 4YA6A 1J00A 3OESA 4XIGS 3ZHUA 1DKUA 3FHOA 3IVCA 2OZVA 4HNAB 4GD3Q 5D3ZA 3FGNA 3PEYA 5GY7A 3HB9A 4JUFA 1E63A 1JIQA 1OOEA 1VIAA 3UJ7A 1E79D 5D5QA 2J48A 5D5HA 4HDMB 1FP6A 1BCSB 1V1JA 1KKLA 3HNRA 1HK7A 2F9FA 2JKVA 5IH7A 1JH8A 3VZRA 1CUWA 3AF3A 1JKJB 4RPLA 1ADCA 1N1DA 1GNLA 4I9NA 1NFRA 5TB5A 2RBGA 2R6JA 3RJMA 3R3JA 4BVGA 4EF4A 4BPBA 4QM6A 3TOXA 1AXGA 2BFCA 2W4MA 2V9PA 2ZJAA 1EM8B 3ZNPA 4AUKA 1EFTA 3WNVA 2IPLA 4FB5A 1DT5A 3GVPA 4L57A 5AFSA 4M8LA 3ER8A 5CX1B 2G07A 3GC6A 1DXHA 4TXNA 1E66A 5A7HA 2EP5A 1I1HA 1HFJA 1QKIA 3H3FA 4UHHA 3RS7A 1PZMA 4QWWA 4Z0NA 4IWYA 4MLCA 3DOJA 4IPTA 3IP9A 4KVAA 2JGDB 1DS6A 3EYAA 4RIGA 1SBHA 4TQGA 4X9XA 5F5XA 4ZYLA 2YJTD 5JD5A 5EC8A 4DF3A 1QO0A 4M7WA 5E6SB 2ZDGA 3F7TA 5LSAA 4GYYA 3FXAA 1HPLA 2J5QA 4AWXA 1BX1A 5CCBA 3MGKA 2ISQA 4O4HB 1EFLA 1I14A 2C9YA 2F3SA 3ZQ4A 3K30A 4AUEA 2F48A 1P1FA 3EVNA 1ZO8A 2RGCA 3LPCA 1KAGA 1E1YA 4GR5A 5EP3A 1H2XA 4ZOQI 4FMCF 5FL3A 3ZHXA 4Y3UA 3TPZA 3DC2A 2LGJA 5DXJA 1GPMA 1QFXA 3A4YA 2Y9MB 1G6HA 4JBGA 2VHYA 2AEJA 2IITA 1P2FA 1W0KD 2HUPA 3VUFA 2E2WA 3NPMA 3PPIA 5CXQA 3H0EA 3QPWA 5TVKA 2ZIZA 4MDEA 2WHEA 1OLSB 3KJHA 1UZNA 2HO4A 3IQEA 1IY9A 1U1GA 4FGLA 4GKAA 1GRCA 3DVAB 3SIXA 5G3YA 3TXAA 1M6VB 4D02A 1DKOA 4G63A 2PRZA 2XCQA 3F6YA 4BGEA 4MRRA 1Z63A 1IN6A 3A32A 1SVSA 4PBTA 2ODWA 4ZEWA 1JIKA 3ND9A 4YRTA 5C18A 1G19A 1N8SA 5IMSA 1C0PA 1HEUA 1ORDA 2UV8A 1W93A 1RQPA 2EJWA 3PNYA 2C94A 5IJAA 2WKQA 3UCEA 5EINA 4FOOA 1EP3B 2ZJZA 2ENWA 4I9HA 2VL7A 2UUAB 1KJJA 2FVXA 3K1AB 4PS0A 4FR0A 2HPVA 4DM3A 3ZPXA 1WULS 2INGX 1WKBA 1GU7A 5CIYA 1L7QA 4HYYA 1NP6A 2FSPA 3SYRA 3JQEA 4H7HA 2FW8A 3B48A 2AE1A 3HFJA 4HK4A 5ENZA 5IUNC 1AKTA 3NNNA 3R09A 2TRSB 3M0EA 3T1NA 2ONYA 3FSGA 3CW9A 3DA8A 1HLPA 5DBGA 5CJJA 1MABB 3W9SA 3HBFA 4X6LA 3I6YA 1CUVA 1KO8A 2OSBA 3KV1A 3RVBA 4DIEA 3RFUA 2JHFA 1H6BA 4DRXB 1JQKA 4C7KA 5GM1A 1USVA 4ZAXA 2DPHA 3P19A 4C4OA 1RXWA 1MTOA 4GNRA 4TTPA 2O1EA 2OKCA 2ZLBA 4IDNA 2HN9A 5F3DA 3RIEA 3ZY4A 5H9WA 3UK0A 3B53X 3VNVA 1QSGA 4UOQA 3JATB 1PTKA 3AG6A 4J0FA 4DR4B 5C7IO 3Q7PA 3FCXA 3ITEA 4CQMD 4TM8A 3RWBA 1U2ZA 3OJFA 2J3KA 4A1FA 1NHGA 5L7WA 1RVV1 2V7WA 3MFQA 4ER3A 4AQYB 2CXUA 2PSHA 1ZNXA 4DILA 4A8JC 4D0LB 3HXQA 2ZJ6A 2I80A 4MQLA 2RD2A 2IIQA 3PUZA 4B2YA 4TL8A 1JDPA 4ZT2A 2AS0A 3NOQA 4HGOA 3LDUA 5AM4A 3X1XA 5GZ3A 2C84A 1FFHA 4B47A 1Z6QA 3THOA 3KCQA 1VJRA 3TS1A 1T2NA 3AONB 4NE9A 2UAGA 3NV9A 1CE8A 4JZKA 2QTMA 3KPVA 5DCUA 5ALPA 1O6BA 4TZ6A 2X3YA 3DE4X 4G4GA 3INYA 4MWDA 4QEDA 5IC4A 1NWCA 1LBQA 3ZU3A 3MERA 6REQB 1EB9A 4MWGA 4KBGA 1GQYA 3B1ZA 5HRAA 1RAEA 4WUVA 2G9ZA 1E0JA 1O5OA 1QHFA 5A9SA 1O94C 1TYAE 4B76A 2DF8A 4QT4A 1WF6A 3SQOA 4MA0A 4HCJA 4MINA 5B30A 4DDMA 2HPAA 3IUBA 3SHVA 5BMOA 3TFOA 4G2NA 4JGBA 1DADA 1G4UR 1KI9A 2B98A 3K7EA 3H05A 4YRZA 2WT4A 1TUBB 2CK3D 3ACDA 4MQMA 5E1DA 4YP6A 3UWPA 4D9FA 1XO1A 3N6XA 3HACA 4D7AA 4E4YA 1DQSA 2IUYA 3TNFA 4WK6A 5ILOA 4FIDA 4EJ0A 5MN4A 1RZVA 1SQSA 5B6IA 2GEUA 4MVJI 3UJHA 2B4TO 3T4EA 1PD1A 1PX2A 3AT1A 4CMEC 5EWLB 1UPBA 1XE3A 3HHEA 1RHRA 1HMPA 2G28A 3PNMA 4H7DA 2ODQA 4Z1MD 3K5IA 4WLNA 4DQLA 4EHAA 2R751 2I71A 2WICA 2QD4A 1AQYA 4JI7B 4FEGA 4MPRA 3WIEA 4EGCB 5BT8A 3ZNOA 2AXNA 5HQJA 3HJFA 4PGMA 3OI7A 1TQ8A 4NHOA 4RORA 3WNZA 4HMQA 4CMBA 3DQPA 5K8LA 3UMCA 3T61A 1CZRA 4Y6GB 3KB2A 3PNSA 5FQOA 5B58T 2WF6A 1QVWA 1NPTO 4HT3B 2GEBA 2O8FA 4QYIA 3JQ7A 3LQRA 4A7PA 4E46A 1JBEA 2NT4A 4YEDA 3RH0A 4BO0A 3AQIA 3A6DA 3AVPA 4X0EA 3L40A 4YQYA 3EEOA 4R71A 1RYZA 1XU9A 1AV6A 2Q0QA 3LU1A 3LQKA 2HMSA 4GPEA 3UHAA 2YC2C 3JR7A 3LP8A 1Q7GA 3FDJA 5L7YA 2PQ0A 2BM9A 3MCTA 1B3RA 4KAFA 4NBSA 3OE4A 3N3BC 4W1SA 1GTSA 3O7WA 4Q7EA 1VXRA 2ZAYA 5K8UA 2P62A 2D6FA 3QE9Y 3QWBA 1R2QA 1HT0A 1W4AA 1LU9A 2OM2A 1ZUIA 3CO5A 3RJ5A 4WE3A 5DXFA 5BSWA 3W5AA 1CYEA 2DRIA 2YBEA 5AW2A 1YO6A 2QR2A 1HMYA 3H6HA 4FX5A 4XJTA 3U9SA 4P31A 1BKDR 3CFYA 3EIEA 2ZT7A 4WEQA 1RC8A 4FPXA 2VZ8A 4DSZA 2YHAA 3VR5A 1QKKA 3E2MA 2R4UA 2LCIA 3D4PA 4P83A 3H0KA 2Q4EA 3B1VA 4EB8A 4I4CA 1ILEA 3WL8A 1GUZA 2MWMA 2P91A 1KPGA 4EKYA 2D4AA 4QGSA 4IINA 2OYCA 4MUJA 1XP5A 5A4KA 1I94B 5IJ9B 2JLCA 3L01A 2NUAB 4W5NA 3ZR4B 4EVQA 2UUBB 3PRJA 5JDCC 5GGXA 3H1EA 2GM4A 1NBOA 5AJXA 1WW2A 1JLLA 1TEVA 2AMYA 4IHKA 4IDPA 4Q4LA 1MUUA 2FZLA 2HRDA 2CNWD 2GXQA 4W5WA 4B46A 4DABA 4UUQA 1SCBA 1IUPA 4B7XA 4RULA 4L8LA 3JVEA 1GEGA 2GPYA 2HQRA 1H85A 1VE3A 1XXLA 3TZCA 2FZWA 1M1NB 4FOTA 1PEDA 4S1OA 4WASA 4B43A 3DJYA 4PO9A 1PFKA 3CR7A 3FRHA 2CGEA 4XWGA 2Y1CA 3WFIA 1W96A 2C1XA 3HXPA 2PWZA 2RJ3A 1RYBA 2NVWA 2ZULA 2GEKA 3O0TA 3U62A 3O8OA 3ND5A 3PNLA 3L7YA 3ICCA 1RI3A 1Z73A 2V5AA 4RADA 4ZVLA 1NR5A 5ALXA 4JQSA 1PJRA 2V97A 5H83A 3KUXA 5CVVA 1DDGA 4EDFA 1JDNA 4OHFA 3SXUB 5BSUA 3IEXA 1NNLA 4RVUA 3NTQA 3FVTA 3D6TB 5EJFA 4QHTA 3R8XA 4OG2A 4CKCB 1ODSA 1YB4A 4G85A 4LAFA 2R8XA 4DCMA 2P2YA 4X24A 1AS0A 1BJKA 2V7QA 5A5VA 4UASA 3G2NA 2I76A 3PFWO 4LNAA 2Q5CA 2IWRA 5TJHA 1HRDA 5FA8A 1RTKA 1NNUA 1JJFA 3KDSE 3QVOA 5ESXA 3L8DA 1N5MA 3S6JA 3TI7A 1H2ZA 5DTIA 4GLLA 4DLWA 5JYEA 1YQUA 1SXJC 4RESA 4JHLA 2VXCA 3BHMA 3FW1A 2E4XA 4KKXB 1M6HA 1SUDA 1QWOA 2G5GX 5FBHA 5EL0A 2HB6A 5BOSB 1JIVA 2FRVA 1TLTA 2E0IA 3MS7A 2MSKA 2VNHA 4LXGA 2ZYVX 1BJRE 1T8TA 4AMZA 5AUPB 4EENA 2IOYA 3M49A 1D2CA 2F9MA 3M6FA 1A95A 4LX0A 3ZH2A 4R1QA 3AR6A 4UMEA 4W6ZA 3WKAA 4TL6A 1PTJA 5JYCA 3LUFA 1JLSA 3KS9A 4WN3A 2OGUA 3CSUA 3O4GA 4Q4HA 4YCJA 5LD2C 3A4MA 2YJ5A 2P69A 6AT1A 4OX9Y 4JQZA 1RKBA 5A02A 5LVAA 4EG7A 1I36A 4H0FA 5BWBA 2QXTA 3K9FC 3R7FA 4ODIA 4B8WA 2BLNA 2I4MA 5IWCA 3ZJVA 3AKYA 4Z0HO 3BILA 3A25A 1N8KA 3U4QB 1WVIA 2E1RA 3A11A 3BH6A 3GWZA 4PLVA 4RY2A 5DHPA 3CE9A 4ZI2A 4BHTA 1VPWA 1NBME 3GJXC 4LC1A 4PC1A 4LV6A 2DTEA 2B83A 2JGNA 4FE4A 5TRTA 2JDIA 5FULA 1Q0TA 1MXHA 2WM8A 4G9EA 3UC9A 4Q66C 3OE7D 4M46A 2CLEB 1M8FA 2NAPA 3GL9A 3IA7A 4PRZ