2BMJA

Gtpase like domain of centaurin gamma 1 (human)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
176
structure length
174
Chain Sequence
MRSIPELRLGVLGDARSGKSSLIHRFLTGSYQVLEKTESEQYKKEMLVDGQTHLVLIREEAGAPDAKFSGWADAVIFVFSLEDENSFQAVSRLHGQLSSLRGRGGLALALVGTQDRISASSPRVVGDARARALCADMKRCSYYETCATYGLNVDRVFQEVAQKVVTLRKQQQLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Centaurin Gamma-1 Gtpase-Like Domain Functions as an Ntpase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords CENTAURIN GAMMA 1
total genus 62
structure length 174
sequence length 176
ec nomenclature
pdb deposition date 2005-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2bmjA00
1ANKA 2WMOB 1BYUA 5B57C 2XTNA 4B2IA 3PEWA 5LD2C 2JJ2A 5EXXA 2C9YA 1T6NA 4Z1MA 1R2QA 2Q3HA 2A3RA 1CU1A 4PC1A 2WWYA 2GK6A 1E99A 3QPVA 4FW9A 4DDUA 4WW0A 4OQMA 3CPEA 3KZ1E 4DB2A 2DWQA 5FPHA 2WBLC 4PZZA 1X8JA 4M1KA 4A2PA 4M9SA 3TIFA 2NQ2C 2PMKA 2C9OA 2ZQ5A 1B23P 1ZC3A 2CHQA 2W6ID 3MCAA 5DYIA 2C04A 4JT4A 2REOA 1XD2A 4ZKDA 1W36B 4CEIA 3C5CA 1TPZA 2QZ4A 4V0KA 4Z51A 1B0UA 4D81A 4Q47A 1HUQA 4B35A 1IAQA 2ZRFA 4TT3A 4EPTA 1U8ZA 4URWR 3LWNA 3D8BA 5FFMA 4JLKA 4S2EA 4TQAA 2HUPA 2RGAA 5FPSA 3CONA 2QUZA 4OQXA 3Q5EA 4OJQA 1U98A 2O8FA 4DSOA 1IXRC 2ZR7A 1FX0B 3BIFA 4ZDWA 4JBYA 4V03A 4IDNA 1GKIA 4DWJA 2JLSA 1H65A 3EZ7A 2O8DB 2AN9A 2H17A 1DARA 2FPMA 2W58A 4M1WA 3P20A 1UF9A 4PX9A 3OE7A 2O8FB 1Z5ZA 3THXB 4PPFA 2PX0A 3U5ZB 5GJCA 3OF5A 4F38A 4ESHA 1E9CA 1LW7A 4E07A 4OQLA 4NH0A 4G5OA 2ODWA 1I2MA 1W2HA 3BFXA 2GJKA 3LA6A 1XMJA 4LJ5A 3CR7A 2Q9BA 4RJLA 1JPJA 1SVWA 5KSZA 4I1SA 3MJRA 1YRAA 1VTKA 4QJ3A 2IS1A 4BGDA 1PVOA 3TRFA 2WSMA 1ZM9A 3QVVA 1XTSA 5HR5A 2HF9A 4GFDA 4NCKA 5JWHA 4G1UC 1UDXA 2EYUA 4B71A 4U5XA 2GF9A 2QMHA 1EG7A 3NBZC 3THYB 1D2NA 1RRGA 4MUBA 2QGNA 4B47A 5HKKD 1KSJA 2HCJB 4V0LA 4Q1AA 1KY3A 4BRUA 5FI1B 1ZCAA 3GD7A 5FTMA 3CWQA 3SBDA 4FXPA 5FOXA 4L8GA 1J2JA 4TYYA 2WJIA 2VLIA 3O8RA 5TV2A 4KJZA 1NG1A 3HU2A 4Q01A 1XEXB 2IXGA 1EWRA 4TQ9A 2X2EA 2E87A 3M4YA 5BYKA 2GCPA 2VP4A 3A37A 4EUNA 2OBLA 3LNCA 4LOAA 1Z63A 4JLMA 3GJ4A 3AVUA 1R5NA 4WOPA 1XJCA 2WKPA 5AJVB 4GMXA 4IRUB 2WWWA 3NEYA 3LVRE 2CBZA 2JDID 4JKIA 4PAOA 4I1UA 4TT3D 1QHHA 2ANBA 1XEWY 2TMKA 3B6EA 4PC6A 5CYPA 3EZ2A 1FP6A 1LS6A 3FFAA 4IJMA 1OV4A 2FU5C 4JJZA 4O0MA 3CNLA 2GJSA 3D3QA 5CM8B 4AYTA 3RC8A 1NVVQ 2NO7A 1T0HB 2RGCA 4Z1MD 2HF8A 4G01B 5FBVB 4DT1A 4EAQA 2O8EA 2FWRA 4BZXA 1TTTA 3K70C 2MMGA 4ARZB 4L15A 4GDFA 1E2QA 4EQ6B 2DFLA 2HDNB 3SNHA 4RZUA 3HU3A 5HZHA 1OIXA 3DVLA 2RCNA 3C16C 1CP2A 3V4FA 5LD2B 3TAUA 3THYA 1YZQA 1CULC 3MD0A 2IUSA 2WOOA 2MSEB 3V9PA 3CRW1 3RS7A 4Y0VA 1R4AA 3PG5A 4PSKA 4DCSA 1E0JA 2IW3A 2WWXA 5HCIA 2GBLC 2O8BA 1UBFA 4IDOA 2O0KA 1X3SA 1MABB 1NSTA 1M6NA 4C4PA 5JLJA 4MRNA 5FTJA 3FHOA 3HPQA 5CK5A 2IYTA 1C4OA 1E9AA 4B48A 3E1SA 2F1RA 4TQUS 1R5OA 2B92A 5EZ5A 1KI6B 1NNEA 4YMUA 3OEHD 4DKXA 3HR7A 2PLRA 2EYQA 4NYIR 2XXAB 5TXGA 3F0TA 4HLQB 2FH5B 3SQXA 1CBUA 1M7GA 1G7TA 1KOFA 1OKKA 1GITA 1OHHD 1Z2AA 1TX4B 2G83A 3BH6A 3EIQA 3K0CA 4NDZA 4LV8B 1SXJA 1YKSA 3IDQA 1EXMA 4KYIB 4Q66C 4U7DA 4LPKA 2ZS7A 4C30A 2CCJA 1KAGA 1SXJB 3CPHA 3A36A 2RHMA 3AVOA 4ERNA 1S9DA 3LD9A 1XJQA 4A2WA 2P3SA 3QKSA 4P0TA 4XSGA 1KJWA 3L8YA 4EDHA 4QBFA 4FCTA 3IIJA 3QG5A 3LLMA 5GVRA 1ZIPA 4PO1A 2WWIA 4LJAA 2PX3A 4URVR 1PLJA 1ZP6A 1NSFA 2YC4C 5JEDA 2ZUBA 2QT0A 1XD2B 2CE7A 2ZETA 1PLKA 4C0KA 4RD2A 1V43A 4P4TA 2HXYA 2IYVA 1G7RA 2HEIA 1GUAA 4KFRA 4B3XA 4MKFA 4A0FA 3AVVA 1E1QA 4B32A 4TLAA 3T12A 1E79D 4PC7A 1I2DA 1P2VA 3W8RA 5EP3A 2PZGA 3EW9A 3KUDA 1MO4A 2HT6A 3VAAA 5IK2D 4DCVA 4F4JA 1HT2E 5H68A 4HZUB 4MQBA 5JCZA 3EPJA 4AURA 4ZDKA 1Z28A 3SS8A 1KDRA 1KDTA 4IOLA 1IN6A 3VHLB 2I4IA 1VCNA 3QNUA 1ZU4A 4EQ6A 4KV9A 3O8CA 3A4NA 4EPXA 1RIFA 4LYAA 2GF0A 2F1IA 3LXXA 3B1YA 3ZVLA 1R10A 4C0BA 5KNCA 2EFCB 4HAYA 5FR1A 4YMSA 1ZUIA 2VEDA 3L0IB 2QTVB 5DNYB 2XNDA 4R71A 2CLSA 4MRSA 2B8WA 3SJZA 1E0AA 3LV8A 3D7MA 4BLRA 4E22A 4M8NE 3HDTA 3E5HA 1G4UR 2Q9CA 1Z6XA 1JALA 1EFCA 2AR7A 2SHKA 2ZAOA 3QQ5A 3U44A 2QPTA 5KSPA 1T5LA 3QY0A 2OAQ1 1LB1B 1G8YA 5KSYA 1VG1A 3TW8B 4CZ2A 1IOZA 1P4SA 2J7KA 3U6BA 3GLGE 2OCPA 1OHHA 2MSDB 3MMPA 3LRPA 4DJTA 1E9DA 2QBYA 3KXLA 4K81B 5J4KA 1MR3F 1TF2A 4ON9A 3BB3A 5TY0A 1T8UA 2GJ8A 1P73A 4YQFA 3QPWA 5BWMA 2GNOA 5D3MB 3K70D 3RS2A 2WWFA 4AWXA 2V1UA 2B7BA 3K0FA 1W46A 4AIIA 2PJRA 3MRSA 5FOSA 3TGPA 3F3YA 3LAWA 2AWOA 5AJWA 4Q18A 3MWYW 4Q4JA 3IQXA 4P33A 4OBEA 3CO5A 3AUXA 3DMNA 3TSWA 1ZMXA 5AR1A 5EJEA 2RMKA 1SZPA 4Q1BA 1L7VC 3RRYA 1VYVA 4YMVA 3EA0A 5E7JA 2ZE6A 4ZO4A 3I61A 1JAIA 1DADA 2IC5A 2H1LA 4TSFA 2J41A 1NRJB 3QSYA 1TMKA 3OEED 4V0OA 3X1YA 3CRVA 4FMCF 2GHIA 2QAGA 2YC2C 2H7VA 2IS2A 3VTKA 2WHXA 4CRWB 5LDDC 1R0YA 2OCAA 1ZCBA 3T35A 3U3JA 3O8BA 3KJIA 4X8LA 5TB5A 2C95A 2IHBA 3I73A 3RHFA 3BRWD 4D80A 3FGNA 3DDCA 2PH1A 1GVNB 1T8TA 1KMHA 4AYXA 3K0SA 1ZM4A 1VG8A 4HUQB 5B2ZA 3DOEA 2HXSA 2OE2A 4LUCA 4Q1CA 5C2JB 2ZREA 2IUUA 5KTYA 5CIQA 2J1LA 2WPDD 5EP4A 5JWOA 1R8SA 4G5SA 4W5JA 3OE7D 4JMPA 3A1UA 1ESMA 4ZDIA 1N0VC 3RS3A 3JVUA 3KKPA 4X8OA 2AXNA 2J59A 3T1OA 2NZ8A 5FUWA 5DE3A 2BOVA 1QBKC 2W6JD 5HZKA 2XAUA 1PJRA 1RJ9A 5L8VA 1W49A 2OM2A 1OXVA 2VHQA 1TL7C 2G0NA 5JSZB 2YJTD 3NHAA 1JXMA 4R7ZA 4M2LA 2GAOA 3U3RA 2DY1A 4M9ZA 4FN5A 4M53A 4Q48A 1E1RA 2PZFA 1OH8A 5JS8A 4IFBA 4C2UA 2O8EB 2A5GA 2WIAA 3AH8A 1FUUA 2ZE8A 5JI3E 1G3MA 1EESA 4B44A 4R9UC 3PQCA 2GEUA 4BPBA 4BFTA 1NY6A 3TNFA 3GCGA 2CLDX 1TQDA 3VKHA 1NKTA 1QVAA 4RCZA 5FI0B 4IVQA 1BMFA 2HJVA 4KHZA 5KDLA 2EFDB 3VU9B 4DDTA 1QHHB 1CTQA 1VECA 1ZBDA 1J8MF 3CRQA 4Q9HA 4HLUC 4YLGA 4CEHA 5DH9A 3U7EB 2DPXA 2WWGA 2C2HA 4FMCB 1AJEA 4II7A 4O3MA 1ZM7A 1BKDR 4JVMA 2ZITA 4QNMA 4KVGA 3FKSD 2C8VA 4JKYA 2L0XA 2A78A 4Q7KA 3W5IA 5J40A 2OBNA 4JVNA 1G17A 3KKMA 3D6TB 3NDBB 1P3JA 5CLLA 1E0KA 2OCBA 4FWIB 1SVSA 1AIPA 2WM9B 3PUVA 3SFVA 2CL6X 5GADl 4A8JB 3VR1A 1G7SA 1UDWA 3IUYA 1G6OA 2FPLA 3KB1A 4HI0E 1G291 2WSSA 1LV7A 1LF5A 4Q7LA 3KQKA 5CB8A 3GFTA 3IKJA 1CJUC 4CF7A 4FWTA 3UKDA 3W3ZB 4ZV4A 1PZNA 1J7KA 4B74A 4MKHA 2FPKA 3WNCA 2VSXA 2WKQA 2QM7A 3IO5A 3OEHA 4AK9A 4XWOA 1OW3B 4LBVA 2FSIA 4C0HA 1WB9A 2ZJ2A 3QXJA 1R0XA 2IEYA 1XZPA 2QN6A 3ZZTA 3GMTA 4LYFA 4MITA 1DAGA 1ESNA 3L0SA 4OI2A 2D4HA 3GJ6A 3REGA 3RYTC 3AF1A 4HLUA 1WE2A 2QNRA 3QKTA 2IWHA 4DEYA 2VF8A 4R98A 4I1VA 3B1VA 4IW3B 1E1RD 5DN6A 4D2IA 2V8OA 1ZC4A 2JJ8A 3H86A 1U8YA 1A7JA 1W4CA 4XOIA 1FZQA 3RC3A 1LF0A 3H4MA 3VR2A 1QHIA 2WWHA 3LQRA 5K8UA 1U99A 4AY2A 3H1TA 3U7FB 4N1AA 2CK3D 2D3WA 5DISB 2JJ1A 4B2PA 2VBCA 4UXHA 1E9FA 1IN7A 2GESA 2NOAA 3NVAA 4DBLC 2W83A 2KWIA 2GJAA 5TDHA 1JPNA 3NKVA 1MO5A 2BCJQ 2NO6A 1F2TA 2D74A 2IL1A 3HU1A 3RWOA 5IHPA 1NI3A 4QGFA 2IYQA 4MDEA 1OLOA 3KKOA 2ZRBA 1BH2A 1GKYA 1X1SA 1ZAKA 4WXPA 1CIPA 2UVQA 2BMDA 4PZLA 5D3QA 4QBHA 5HE8A 4M22A 3K0AA 5F98A 3I8XA 2REBA 2XX3A 4BQSA 2FX3A 1JR3E 3AP3A 4HDOB 4KLNA 4JLVA 2ODBA 4M9XA 3BJIC 2JGNA 2FG5A 1U9IA 2ZRCA 3CRMA 2KSQA 5KHOC 1VKJA 1E98A 5LB4A 4B3FX 4LHWA 4ABYA 5KPDA 3TAHA 621PA 2ZE7A 3P1JA 3R8CA 2QM8A 4NE2A 3PJRA 4IFEA 2I1QA 4B6EA 4KSCA 2BV3A 1WBBA 2C98A 1VCIA 2H5EA 5DI3B 2CCKA 2Z4SA 1M1YE 3RSOA 2F7SA 3Q85A 2Z4RA 1CR1A 4ZKEA 3X1ZA 4FCVA 3BGWA 5JECA 2XNDD 3DKPA 1GL9B 3PUYA 2W2XA 2OILA 3MWLA 5DSZA 1HE1C 1G8HA 1VCOA 2ONJA 2DCUA 3QEOA 4TL7A 1NJFA 3D31A 3U3MA 3QOFA 2JLUA 3VR6A 3K1JA 3AV0B 1XXHA 5CK4A 1R7RA 4A9AA 4PXAA 3ZZ0A 3HYTA 4GL2A 2ZUDA 1QHYA 1J8YF 4LSGA 2D7CA 4ZCMA 4MYUA 1Z0FA 2W2TA 1TEXA 3R7WB 3WYAA 1KO8A 3IIMA 2QAGC 3CLVA 5JJIA 4HLCA 4YONB 4F4IA 4E09A 2CNWA 1U9IC 4PANA 4Q9KA 4HSEA 3GLIB 5SZHB 2R9VA 1CR2A 3OIVA 1MO3A 2BMEA 1PUJA 3KX2A 4KU4A 4D0LB 5FOVA 4LYHA 4RCYA 2GCNA 2BBWA 4QRHA 4IEEA 1NIJA 1NY5A 1N5LA 1KO1A 3AVYA 2QPAA 1DAFA 1HURA 1XP8A 3CKLA 2VP0A 2GXUA 2CLCX 5KU1A 5L3RA 3S1AB 1EK0A 3Q8XB 3KQHA 2ZRAA 1KI2A 1AQUA 2ZRNA 2CXXA 1G16A 2QPOA 3MAAC 2ORWA 4URYR 4D82A 3UIEA 3LVQE 2JDIA 3A4MA 5AJXA 2ZTSA 1W1WA 3QVUA 3MLEA 1KIMA 2BM1A 4RZ2A 5JRZA 1KAOA 4V02A 1UKEA 2FNAA 3EARA 3SYKA 3BD9A 4NKRA 1T5IA 1G3RA 4PHTA 4QM7A 1AGRA 3TVTA 2IXEA 2WZQA 3PCRB 4EPYA 2VHJA 2FV8A 1PLLA 2J87A 1TQ4A 2WAXA 1C1YA 3FMPB 3TMKA 3LO5A 4DDVA 1EFTA 1JB1A 3QF7A 2A5YB 2ZR0A 2QGZA 2XZOA 1W0KA 1GL6A 2IF0A 2IX3A 5K8TA 5CIWA 1XD9A 3B8HA 5IDVA 1UAAA 1Z0IA 4NL4H 1NLFA 1OFIA 1FQKA 4TZ6A 5EE3A 3RLFA 2MSCB 3TR5A 2ZRKA 3FMFA 3WNBA 3BXZA 1HQYE 1K8RA 4A92A 1A2BA 4R2HA 4FINA 2UZIR 3C41J 1N6HA 2V7QD 4A82A 3NHBA 2WJJA 2MMCA 2P67A 1K5DA 2X1VA 2ZRLA 2EWVA 2IYZA 4QGGA 3WRXC 3IEUA 2QQ0A 3GLHA 3ASYA 3FHCB 4JVLA 4AC9A 1NN0A 1CJTC 1G7CA 2WKRA 4FMBB 1NMZA 5GJWC 3B9QA 4TWZA 2HLDA 2JA1A 2NO1A 4HAWA 3VFDA 3I72A 4ASUA 1S9HA 3AKDA 2GEDA 2VHCA 1D2MA 4TTQA 4XTRA 4QJ4A 4MYCA 2OV2A 2WMNB 4GOJA 4XH9B 3W90A 2KE5A 3BBPA 1JEEA 1W7AA 3TVDA 3UMFA 1M2OB 4KFUA 2G77B 3RVBA 1H8ED 2R62A 1DAHA 1HQCA 1KDOA 3ADCA 4DCUA 1TAGA 1SULA 2FZ4A 2J0VA 2QQEA 2DWOA 2JCSA 1UKZA 2ANCA 1E79A 1FTNA 1R6BX 3B85A 1X1RA 2JLYA 2XEXA 4PPGA 2ZSBA 5A5GA 1NP6A 2ZJYA 4KLZA 4DUGD 4KO8A 3K8YA 5L3VA 3T61A 4IXNA 2J7PD 2VYFA 2NPFA 3U2QA 3CX7A 2OLKA 3C14C 1E9BA 2ZI7A 2QSYA 1U2RA 4RFSA 4TYNA 2Z83A 3OAAA 2F43B 1PUIA 4PC3A 1R5BA 5L3SA 4ZDJA 2XTMA 3K09A 3FE2A 1JQLB 3HPRA 5SZJA 2EQBA 1TNDA 5G53C 3KL4A 1Q3TA 1XPOA 1COWD 1NMYA 1C9KA 2GZHA 2Z0MA 1S8FA 3L0PA 4PHGA 3EPHA 3BORA 3R9IA 3S1AA 4M1MA 521PA 4PQFA 1YR9A 3FDIA 4GI7A 3K53A 2ZSEA 5E7MA 1HV8A 2H16A 4RVCA 4LC1A 3C8UA 2GDJA 3NC0C 4JVSB 2HLDD 2W0SA 5P21A 4AKIA 4XWAA 1E9RA 1NBMD 3K0FB 3ZD6A 4YMTA 1P9WA 3AQ4A 3UG7A 1NVWQ 1PV4A 2DWPA 3TLXA 3UANA 2QORA 4FMDB 5IF9A 2FSHA 2O0JA 1ZNWA 4C0QC 2QBYB 5L3SB 1W0KD 5L3QA 2ZAMA 2R65A 1P9RA 1ZD8A 2V4ZA 1KSHA 5JJLA 1KGDA 1NN1A 3R7WA 1ZUNB 4PFSA 4ZI2A 1OFTA 4TMTA 3GJ8A 2ZYWX 4D0NA 4DRZA 3CPJB 4QOSA 4B33A 4MYTA 2HYIC 3GLFB 5AUPB 2WICA 5CJ2A 3HP1A 2QSZA 2Z5FA 2V7QA 2Z43A 1YVDA 1I4DD 2CL0X 4TSFD 4D0GA 1DG3A 721PA 3FOZA 3RANA 1U8AA 4LZZA 4DLZA 3PUZA 5LPNA 2GXAA 1HEIA 3CNOA 3QXSA 2Q3FA 1NVXQ 4B2LA 3A58B 1VYTA 1SKYB 4EFNA 1KK0A 2J7PA 3NH9A 4ASUD 1XRJA 5E95A 2ZI6A 3LY5A 1P6XA 3QBVA 4LYJA 4RSGA 3PVSA 2BJWA 2FFBA 1YE8A 4KFTA 2RGGA 1U0LA 1N5IA 3I4LA 1SGWA 1ZW6A 4HZUA 4D4MA 5C4MA 5EP2A 3LH5A 4F93B 5JJKA 3LW8A 3B78A 4TYPA 3EIEA 2W2VA 2AD1A 2PT7A 3OEEA 1AKYA 1UEJA 2W00A 5E7IA 4HUTA 5B64A 1RRPA 3WBKA 1KMQA 2GVDC 2AFIE 4JSTA 4JZKA 4W7SA 1RKBA 4BEBA 2EFEB 3RRNA 3WMEA 4LGMA 2QMOA 3R9XA 2V54A 3GLHB 2OXRA 4J0QA 3FPAA 3GFOA 1UJ2A 5FH9A 4HAUA 1XFAA 4BLQA 3AM1A 2QRZA 2NGRA 1E9EA 4OHVA 5DGXA 5FOTA 2D2EA 3QKSB 1KK3A 4TYWA 3L2OB 1VHLA 2OUKA 2J5XA 2CCGA 3B1WA 1RE0A 2ZU0C 3DKVA 5AUQA 4DCNA 2V6JA 4IVPA 4W5WA 1G3IA 1SXJE 4GRAA 4QHTA 4PSAA 4TL9A 4JSYA 4GZMA 4TN1A 1DE0A 2REXB 3U3KA 4M21A 2BBTA 3PR1A 3N5CA 3K9GA 5H70A 3T1QA 1KI4A 1XD8A 2CVHA 3CX6A 3M1IA 5FPYA 1II0A 2A5FA 4OQNA 3TE6A 5DI9A 4C0JA 1YJ5A 4NYIQ 3TR0A 4Q00A 4DC9A 4LJ9A 3AEZA 4HYYA 4JYBA 4TMXA 2E9SA 4LRWA 4OK3A 1ZJ6A 3ZGXA 1ZRHA 1LS1A 3LBNA 3RSLA 4A15A 3DEFA 1SQ5A 2B7CA 2QI9C 1CS4C 5SZKB 3DMDA 3P4XA 4LV5B 3AUYA 1XZQA 3CUEF 4US1R 1U0JA 1VIAA 3P27A 1G5RA 4JYCA 2AFHE 3NH6A 3OFND 1S3GA 4QJ5A 3PUWA 3UWOA 1N6RA 3P4YA 4LK2A 4JLOA 2ZJBA 2QG6A 2VPPA 4EKDA 4I1OA 2FZLA 2BIFA 2O8CB 2ATVA 1YRBA 1E9SA 3I5YA 1AQYA 2J46A 5DYGA 5BN4A 5KNBA 3GLIA 3C4JA 1J70A 2F1HA 4PPNA 3IBGA 4DT1B 1NLZA 4BLSA 1KNXA 1QZXA 5KSOA 3X1DA 2EW1A 2GA8A 2RHDA 1NVVR 2BMFA 2CJWB 2R44A 3NWJA 1G64A 4PO8A 1KK1A 1GRRA 2IXFA 3TSZA 1GKUB 2CHGA 2CMKA 4LPSA 4BEJA 3TH5A 2ZYTX 3TKLA 2B21A 3ZS9A 2HT1A 2G1JA 5G40A 1UADA 1QG4A 3JVVA 3PFIA 2AKAB 3GLFE 3VKWA 2JLQA 1FOEB 3LX5A 1FNMA 4TMVA 2VO1A 2CK3A 2OCYC 3RS4A 4HLDA 2RGEA 4MKGA 3V4RA 1A4RA 4PC2A 2RGNC 3GEEA 2OAP1 1T3HA 3O8DA 3DZDA 4AKHA 3T5DA 3RNLA 3T06B 3DHWC 4HAZA 1T3SA 1T3LA 5DIFA 3K09C 5JCPA 2XTZA 4V0ME 1ZINA 2J9RA 1N2CE 2QA5A 1F60A 1A82A 2IUTA 4JLNA 2BKUA 3OESA 1FUKA 3ZYCA 1G6HA 1UKYA 1NN3A 1Q1QA 1KI1A 2XOKD 1D9ZA 5EUMA 4DCTA 4A36A 4MRVA 3MJHA 2VA8A 4JJKA 1RW4A 2JLZA 1DS6A 3GJ7A 4C7OA 1G4AE 2CL7X 3KQUA 3EZFA 1KYIA 1L4UA 4RD1A 2YOGA 3SJCA 2BBSA 2V1XA 4TMWA 4HUQA 1DAKA 2FGJA 3RDPA 1JJ7A 1R0ZA 4H9GA 4TL8A 3IEVA 1AGPA 1KI8A 1GRNA 3ZH9B 2GKSA 2YOHA 4FI3C 2NIPA 1NMXA 1QHGA 3U7HB 4V0NA 2YINC 1JEDA 3UMRA 2GWHA 2YOFA 4D25A 3X1WA 3KKNA 1OT3A 4URXR 5H1YA 3LXRA 4EPWA 3QJYA 1OKKD 1XMIA 2FF7A 3A1VA 4JLBA 5GVSA 2AK2A 3W34A 1MOZA 1X6VA 3IPYA 1GFIA 5CJPA 3VKGA 1KI6A 3MWKA 1X86B 3JZMA 5UKDA 1LFDB 1DO2A 3GJ3A 3K9NA 2H18A 2JATA 1WXQA 3SEAA 3SYLA 4L5BA 4Q02A 5JZVA 1AS0A 1Z0AA 1VG0B 2FSGA 4A1FA 1VHTA 4FD2A 1Z22A 3A4LA 3FTQA 3P32A 1KSGA 4DSUA 3U4QA 1P9NA 3EASA 4LJYA 1OH7A 3BS4A 3U3OA 2O8BB 2OXCA 1G21E 4JL6A 4HEJA 2NTYC 5EZ6B 4V0MA 3P26A 2ZI9A 3GP8A 5HTKA 2EWWA 1M34E 1Z0JA 2RGDA 1VYUA 3IIKA 4Q4JB 2CNWD 3UK6A 2C78A 2HV8A 2QROA 3QE0A 5CB6A 3VQTA 1XTIA 5J4HA 1P2TA 2WPDA 3RABA 4LBWA 2ZXUA 4OI4A 2W6JA 3DM9B 4A2QA 2IK8A 5FPTA 4RD0A 1Q1BA 2CEAA 4GPTA 1SXJD 2GAAA 2V55B 4L16A 4LCBA 4UJ5A 2ZRMA 4ILEA 3BB4A 5D3MA 2ZM5A 1J90A 1X8KA 4NPHA 1E2IA 1L4YA 2W0MA 3GQBA 4N3NA 5C46F 1KY2A 1G20E 1Y3AA 1JBKA 4UXIA 3DL0A 3GEIA 3R20A 5GJVC 1XEWX 2JLVA 4B3BA 3KXKA 1S1CA 2FA9A 4L9SA 4MRRA 1UBCA 3NBYC 3SBEA 2Q6TA 3QF4A 3ZQJA 3ADBA 2DB3A 4DLTA 3I1FA 3OIUA 3W3AA 4BFWA 1Q21A 5C4GB 1F2UA 2BDTA 2WJVA 2QP3A 4RD3A 3QXHA 1I4LD 4Q4AB 1JQJC 4Q5IA 4QM6A 5E3HA 4TTRA 5GJBA 4WZBE 4Q4AA 2GK7A 5LBIA 3L82B 3W5JA 4CYMA 4EIWA 1NN5A 1RYFA 1RVDA 1H8HA 5EE5B 1DEKA 1MRNA 3QF4B 2PL3A 4IEIA 1Q57A 4F91B 4HB0A 4C9BA 4GMDA 4YXWD 2ZI4A 4Q03A 2GJ9A 4TTPA 3FFBA 2XJ9A 3U60B 4IDHA 1O87A 4URUR 1Q3HA 4MUAA 2BEKA 2OFXA 4NTZA 3GPLA 3EZ9A 1RPZA 3G5UA 1OIWA 2ZRPA 3QENA 5B58C 1HE8B 2C99A 4P31A 1E2HA 4F92B 4PHHA 1MH1A 4JLAA 4ACAA 2GTPA 1BO6A 821PA 1E2NA 1E2FA 1X8LA 1M74A 1W44A 2DHRA 1E2DA 3CIOA 1VCMA 4GT1A 1CJVC 3EX7C 1CXZA 1M7BA 1T4GA 3CR8A 3BH0A 4CEJB 3TJZA 2AKYA 1TEVA 1RJ9B 2FEOA 3K70B 4DLWA 4X8HA 4Q21A 3VR3A 2EFGA 3TUZC 1N5JA 4K46A 4MGYR 3WBJA 3CZQA 2ECKA 4ZIRA 4LI0A 1DELA 4BLOA 4ZI3A 1W2GA 2V3CC 3CH5A 4YMWA 3GLGA 1KZGB 1US8B 4KCGA 4DB4A 3SQWA 3VR5A 3VX3A 1KTVA 5KYKA 1W0JD 1E2JA 4UNSA 1JECA 3ZS8A 2AD5A 1N6OA 3B1ZA 4OHYA 4KBGA 1YU9A 2ZSDA 1N6KA 1KI3A 1UEIA 4BFXA 5IRCD 1SHZA 4G5RA 1AN0A 2ZR9A 3AKYA 5TVKA 5FBLB 4Q4HB 5DN6D 3T1TA 3BH7A 4TMZA 8OHMA 2P6RA 1W4RA 4KI0A 4NU0A 4Z54A 1U0HC 4Z8XA 3QBTA 1GM5A 4QHYA 5G3ZA 4CVNA 3G82C 2UKDA 2XGJA 4WA7A 2EFHB 2IWRA 4DUGA 1OFHA 1SHKA 3E70C 3BK7A 1U81A 3Q5DA 3TUIC 5AUOB 2P6UA 1LVGA 2X2FA 3AKEA 3ADDA 1OYYA 5FR2A 2BEJA 3AGQA 1GP2A 4QNRA 4NONA 5TARA 4GZLA 4DXAA 1ZM3A 3RS0A 3GLGB 4BRWA 5IT5A 3R8FA 2OSBA 1H8EA 1XNJA 2XJ4A 1H8HD 1FP7A 3L8ZA 1XTQA 2R2AA 5AUNB 5J4VA 2QTFA 1IN8A 4DIDA 2KJQA 3A6PC 4RD4A 5AK0A 4DLYA 3IHLA 2RGNA 2AHOA 4N0DA 4HB2A 2AX4A 4JL8A 4XWKA 4M1TA 2LKDA 3ND9A 5EQTA 4A0HA 1IHUA 1IY0A 1NL3A 4D4LA 2ATXA 3L43A 5HPYB 1NF3A 3HR8A 5F2EA 2IYLD 4Q1DA 3WRYC 2H92A 5K8IA 3THWA 4Q1FA 3WXMA 4M0LA 3EPKA 4AD8A 4WZ6A 1QHNA 1KZ7B 3DO6A 4TZ0A 4DDWA 3EG5A 3MG9A 4BZQA 3NC1C 3W6OA 2BVNA 2YWFA 4DLSA 2I3BA 5F9FA 1GZSA 1ONBA 2CHVA 2JLXA 2OFWA 3A1TA 1KNQA 1Z06A 3EWAA 3MGCA 3QKRA 3U44B 4LC0A 1HYQA 1QHSA 4QBIA 1Q12A 5FL7A 2XB2A 2GILA 2PLFA 5KDDA 1OXUA 1G18A 3GLFA 1F2UB 2ZJ5A 3QKRB 2QT1A 1BYIA 2ERYA 3TSOA 4LHYA 1MT0A 5G41A 3KUCA 1BMFD 1YHNA 1KKMA 1KJYA 3KTAB 4PR0A 1WA5A 2FJUA 3FKQA 4GBMA 4OK6A 4TLDA 4C0LA 4D4JA 3GLIE 3CH4B 3IO3A 1ETUA 2ZANA 1VMAA 1WDTA 3NIBA 5DLQC 3I32A 5L3QB 2G9NA 1ZNYA 4KAXA 3EA5A 1DBSA 2RGXA 3UPUA 4D26A 4DLXA 3ZVNA 1TUEA 3BFKA 3TK1A 4NBSA 3U61B 4NYJR 4KITB 3THWB 1MKYA 4WVFA 3ICEA 3FKSA 4BASA 1ODFA 1ZNZA 1KI9A 2Q3MA 4PTLA 2IA5A 3FMIA 5KOYA 3W8NA 2G88A 4OK5A 4XVQA 4EFLA 4CGZA 2IS4A 3RWMB 1CLUA 3HJNA 1OIVA 4PAQA 5FL3A 1EGAA 2ZJAA 3EXAA 4LHZA 4UNNA 1W36C 4JLDA 1GWNA 3Q7QA 3M0EA 4QL3A 2RKOA 3Q3JB 1GSIA 1R8QA 3SDZA 2ZI5A 1P72A 3EAQA 3EPLA 2ZE5A 3BERA 3CZPA 5M04A 2GZDA 1JR3A 5F9HA 1YZUA 3UWKA 4CDGA 1II8B 3VNUA 5EUQB 3BOSA 3F8TA 2OESA 1FMJA 1IN4A 1M8PA 3QG1A 3F5FA 3TBKA 4US0R 5IK2A 1P75A 2AWNA 3THXA 1D5CA 4BE7B 3I62A 4AG5A 2CVFA 4RFSB 1Z47A 4EFMA 1Z6YA 5FUXA 1RRFA 4MGKR 3WY9A 4LJ8A 4KXFB 4P4UA 2R6FA 3CF6R 5ANRB 2O8DA 2WJGA 4LHVA 1GILA 1FL9A 1FX0A 1OPXA 4H1VA 4MKIA 4Q4HA 5JWRA 4NMMA 4CT4B 1ZYUA 1NVUQ 4C0AC 4DLUA 4E03A 3EC1A 2BKEA 3ZQ6A 4BFUA 2A9KA 3VX4A 1GIAA 2Q9AA 4UQOA 1F3OA 4QGAA 2I1VB 1ZM2A 2ODNA 4LBYA 3I8SA 3MWJA 4C7OB 3MSXA 3WYGA 3N2EA 1BS1A 1QG2A 2Y8EA 3GJXC 1OH5A 5JS7A 4WIAA 1G3QA 1US8A 3X1XA 4CEIB 3FHTA 1MABA 2GEVA 5CITA 4OYHA 2KBEA 2Q21A 3VR4A 1IJFA 2N42A 4ZIRB 3CM0A 4CW7A 1Z0DA 1YR6A 2OFOA 1NG9A 5HKKA 1P60A 4HB3A 1T0JB 1CJKC 2H57A 1D2EA 1AZSC 1IXSB 3H2YA 5F3WB 1S0UA 1FFHA 1AS2A 1SKQA 1N25A 1SKYE 3NEJA 2IYXA 3ZVRA 4OL0A 4XD7D 1VPLA 3QKUA 4IKEA 3A1SA 1T91A 4PO9A 3QI2A 3KJHA 4MGIR 2P5TB 4A6PA 2VSFA 2WIBA 5FBRB 4AG6A 3ZLJA 3UXMA 4B3GA 1NBME 1JXOA 2FFAA 3IILA 2WTUA 3KFXA 1IJEA 1Z3IX 2A5JA 1F48A 3B13B 1Z8FA 2XB4A 4YDHB 1VG9B 2G3YA 121PA 5HE9A 3LDAA 5FTLA 2ZJ8A 3SC3A 2GRJA 2FSFA 1W4AA 2QMUA 3AF4A 2GETA 5EXPA 1N6IA 1OYWA 2BC9A 1XTRA 2DFNA 2D06A 4F7WA 4IOJA 5AWFC 1TQ6A 2R8RA 1CRPA 4HAXA 1W5TA 1XCMA 2ORVA 2XITA 4P4SA 2CJWA 1TU4A 4Q19A 4TLBA 2DYKA 1XEXA 4Q9IA 2VQSA 1E2LA 1UM8A 5BW8A 2AXPA 3EZ6A 4ZCIA 1Z2CA 4K8OA 4PZYA 3C7KA 5FBQB 2YV5A 4HDQB 1DOAA 2N1BA 1P2UA 5FBWB 1S96A 3MUFA 1IN5A 5EE0A 4TLEA 4WBSA 4DVGA 4MYHA 2O8CA 1JNYA 2P6NA 3CF0A 2DR3A 2NG1A 3OFNA 4NYMQ 3SHWA 4FMDF 1J99A 4Q1EA 4DSNA 4TL6A 2DFTA 4HZIA 1XMSA 4PHFA 3IBYA 2OEPA 2ONKA 3KJGA 5JHGB 5A4JA 1E2GA 4KODA 3Q7PA 2WJHA 3SOPA 4D6PA 2IYYA 4EPRA 4JT2A 3SJBA 4LBZA 4GOKA 1JJVA 1MRSA 3U4QB 1Z08A 2EVWX 2JJ2D 5G3YA 4G5GA 2PEZA 1G5TA 2A7QA 4NCHA 2BMJA 4RFVA 1Z83A 1GL7A 1CR4A 1XTJA 2VHTA 2R6GA 2GZAA 2ASEA 4NCIA 1XMVA 2KI5A 3UMSA 3I5XA 2F3RA 4XTCS 3GFPA 3AF2A 1AK2A 1E4VA 2QMEA 1N6NA 4BECA 2G1KA 2XSZA 1XTKA 4L4UA 2ZRGA 3KKQA 5E4FA 1F5NA 1XXHB 1TUIA 2YKGA 1DAIA 2FDCA 4HAVA 1Z0KA 2ZIAA 1YZGA 3FYHA 4BZPA 3J81k 1WBDA 4IXMA 5CDFE 2WVJA 1IY1A 4G0NA 4ACBA 1KKLA 1E2KA 2FEMA 1KDPA 3AP1A 1DG1G 4I81A 4B3CA 3R9WA 3QXCA 3KJEA 3PV0A 2LKCA 4BFZA 1GOTA 4A4DA 1KK2A 2YWGA 5J47A 3B1XA 1E2EA 2CE2X 2C77A 2ZYVX 2ZS9A 4NCJA 1XBTA 1AM4D 5EXSA 3ECCA 1IBRA 1OXSC 2BWJA 3O47A 4C2TA 5A0FA 1HA3A 1QRAA 2OG2A 5JMTA 2X77A 1JAHA 2ODEA 3BFVA 4P3YA 1Q0UA 5DI3A 5KDOA 1ELOA 4H1UA 4EJSB 2NMVA 1KSFX 2X8AA 1A1VA 2CDNA 1N0WA 2QE7D 1YR7A 5CLQA 3OIWA 1N5KA 2BBOA 3N2IA 2ZVQX 3ASZA 3SI7A 1KO4A 3B82A 4IOMA 3CRRA 3K9LA 3TQFA 5JI2E 4AYWA 2OHFA 2V9PA 3KXIA 1NLYA 2QENA 1ZNXA 2DFKB 2JIZD 2GCOA 4Q4LA 2FOLA 3M6AA 4P32A 5FL7D 2C5LA 3K0AB 4TMKA 4OHZA 3SYNA 5SZIA 4OI0A 4OQFA 4QC2A 1HTWA 3C5HA 4M4SA 4X8MA 2BJVA 5JRJA 1NKSA 1ZIOA 4G5QA 4OKSA 2A2ZA 1BIFA 2RH5A 1G5PA 1E6CA 1GNRA 1EWQA 1F2TB 1Z07A 3B5JA 4BWYA 1AS3A 2OT3B 2VP2A 2VTKA 4RZ3A 421PA 1GTVA 3B2EA 3AGPA 3WNDA 4B76A 3QUSA 1QDEA 4A6XA 1G1MA 5DHAA 1P62B 1XB2A 1Z6AA 3WMGA 2GXQA 2BHRA 5H8WA 1RRCA 4LDJA 3WP1B 3X2SA 1L2TA 2P0EA 1OFUX 1ZUHA 4S35A 4BFVA 5JFGA 4U02A 3WMFA 3THOA 2J0UA 1E94E 5FTKA 3NXSA 3EC2A 3QXXA 4GOXA 2R6AA 1ZD1A 3KB2A 4HATA 1DO0A 3E2IA 4OHWA 4W9MC 4LX0A 2ZS8A 3B9PA 3PENA 2ZJOA 5EE9A 4EJSC 4Y0AA 1HH4A 2IHYA 4JBXA 3NBXX 1RYHA 3BC1A 5EE1A 3PITA 5AJZA 1EX6A 1TU3A 3MFYA 3BE4A 3IHWA 4QG7A 4G3XA 1G3UA 5FUYA 1SVOA 3ZIAA 4CT5A 1AZTA 1NIPA 3L0OA 4O2LA 4O2RA 2F1JA 1RC8A 2JEOA 4MDFA 1LTQA 5CM9C 2WV9A 3NDPA 5B30A 3W9YA 1E4YA 1TADA 1OF1A 3U7GA 3AVWA 3BAFA 3KQNA 1E69A 4PSVA 1G41A 1G19A 2G0TA 2H8KA 4NYMR 5EXTA 4JBWA 3OHMA 1P2SA 3VMFA 1Z29A 3PUXA 4O25A 3LW7A 1BOFA 1UPTA 2VSOA 5AJYA 1SVLA 1IXZA 1VDZA 4AKGA 5JBQA 2XZPA 2AL7A 5J4LA 2WOJA 4JLJA 1NBMA 2ZPTX 3LBIA 4QBGB 2O5VA 4NCNA 3HYRA 5C18A 1YZTA 2C96A 3RS5A 4ESVA 5ELXA 3VNVA 1W47A 2F43A 2IYUA 4Q7MB 4M9QA 2HCBA 4PPQA 1W0JA 3FWYA 4HDCA 2J0QA 4PQYA 3OAAD 3ICQB 4IOKA 3UATA 1RFLA 2F55A 4RY2A 1E0SA 2VHUA 4QGHA 3RRZA 5KNDA 1Q1EA 3B60A 3T34A 2VIIA 2C9CA 1Q20A 2JASA 3CNNA 3GEHA 2HJGA 1XDBA 4RKFA 4YC7A 4DIEA 4NHOA 2DBYA 4Q9JA 4M1SA 1OSNA 2IYSA 2OBMA 2ZVPX 2J0SA 4GNKA 4FCWA 5BXQC 4TLCA 1XF9A 1G9XA 1GG2A 3KFVA 4IDPA 1CR0A 4PAMA 4A0GA 2F9LA 3IPXA 1TF7A 1E2PA 1EFHA 2GCOB 3LX8A 2J3EA 1Z6GA 2YHSA 2OLJA 1N0UA 1YQTA 3HWSA 1CF4A 4QXAA 1GAJA 5CDFA 1WP9A 1XXHE 4EPVA 2FMXA 1N6PA 3AP2A 5JSZA 4QKQA 3AF0A 1FPMA 1D9XA 1KO5A 4A0RA 1W5SA 2IF2A 1RZ3A 4GSYA 3REFA 2K5UA 4GP6A 4B3DA 2D7DA 1W36D 2VRWA 3IGFA 6Q21A 1E1QD 1ZVQA 3ETLA 3B7GA 4ZPXA 2ZU6A 2AK3A 3I92A 2PEYA 3CB4A 1CEEA 1KI7A 3K0EA 4BLPA 5JHHB 1WF3A 1E96A 3OIYA 3KDSE 2GVZC 2XOKA 1HT1E 3CWZA 1GRQA 2F9MA 4JLPA 4MA4A 2P2LA 3SU8A 4OHXA 3FVQA 4B43A 1E3MA 3CF2A 1HY3A 4HB4A 4TYQA 3SE0A 4B73A 3SHFA 4F4CA 4XVUA 1OXTA 3AKCA 1KMHB 4LY6A 2YZ2A 1Q44A 4IDQA 1P61B 4IVRA 5J5CA 1Y63A 1YZNA 2QU8A 3TW4A 2R6CA 2PZEA 1W4BA 4DSTA 4DZZA 1UFQA 4RZXA 1UBEA 3PIRA 4YDSA 1OB5A 1CJMA 1GDDA 2ERXA 1SVMA 2IYRA 1DPFA 3W6PA 1FQJA 3ZJYA 3CW2A 2P5SA 2XZLA 5DHFA 1JI0A 2B8TA 2V6IA 3AVQA 4AI6A 2ZSFA 3AF3A 4Q9LA 4MGZR 1TQ2A 1U94A 2YNMA 1OJLA 2RGBA 2WSSD 3AB3A 5FTNA 2O52A 1VIYA 3CX8A 3T5GA 2D2FA 1EFRA 1EX7A 1CKEA 4IHQA 4QFMA 4WAUA 2VP6A 3NBFA 3IQWA 3U6KA 2QY9A 4BFSA 5J4YA 5JEEA 2X19A 2ZRHA 5LB2A 4CIDA 1OXXK 1XX6A 3ZD7A 2PCLA 3QPUA 2YYZA 4RD6A 2IS6A 4BFYA 3SZRA 2A30A 2PJZA 3SJAA 3WHLA 1XEFA 3QIAA 1S3SA 4R2IA 1N6LA 3CBQA 2PMDA 3LBHA 3H84A 2PCJA 2IT1A 2ZYUX 4C0SA 1G8GA 2JLWA 4M1YA 1YZLA 1E2MA 2LWIA 4B75A 1AA9A 5FPKA 1LNZA 3GJ0A 4NYJQ 1YR8A 2F3TA 1JR6A 2J0UB 2C03A 2D62A 2ZRDA 1U90A 3GLHE 2XSZD 4DHEA 3RAPR 1QHXA 4LJ6A 4Q7JB 4P4SB 1YZKA 4FIDA 1FMLA 4ITRC 1XPUA 4BUJA 2N46A 2NO9A 2QEQA 1DTSA 4JL5A 3AVTA 1JR3D 1EFUA 4XSHA 3Q9LA 3WP0A 1W48A 1XU4A 2KB0A 3LLUA 2YWEA 1SVKA 2UZ3A 4LJ7A 3VU9A 1WQ1R 3A8TA 2PBRA 5K8LA 3PXGA 3ZZUA 2ZSAA 3LFUA 3TQCA 3DOFA 1F6BA 5FOUA 5C1BA 1FNNA 5BYJA 3ZDQA 3DZ8A 3ZVMA 4W5HA 1IONA 2RB4A 4I99A 1OH6A 1A2KC 2QP4A 3A1WA 1OB2A 5KUTA 4B6FA 2BM0A 2FFQA 2FGKA 3EWSA 1D8TA 4D4KA 1Z6TA 4Z8YA 1KO7A 3DM5A 4KBFA 1K6MA 2FE4A 4YXWA 2O0HA 1EFRD 4PQRA 2VH5R 4NZYA 1ZU5A 2FN4A 4N0EA 1COWA 1R0WA 1XPRA 2GXSA 2HYDA 2NO0A 4US2R 2IBMA 4U00A 4E5UA 2EU8A 2B6HA 2XNSA 3AVXA 1XWIA 2G6BA 221PA 5FOWA 1MO6A 1WCV1 4EJSA 2OO7A 4RKEA 3G0HA 3NTUA 1IY2A 3PEYA 4KFSA 2PT5A 1E32A 4UNRA 3WYFA 3DPUA 2QE7A 3ND8A 1SVIA 1G8FA 1ZD9A 2E1RA 1M7HA 1T9HA 3UG6A 2OZEA 4B34A 1GNPA 4JS0A 4XD7A 2ZRJA 1A5TA 2FFHA 2KBFA 2JIZA 3FB4A 1WRBA 2F6RA 3JZAA 3PEVA 1DVRA 4LV6A 4OI1A 5KPJA 1WMSA 4A8JC 2Q0HA 3T1VA 1LY1A 2VL7A 1P7CA 2VF7A 3AVPA 5TMPA 3V00A 3EIHA 3Q72A 2QP9X 1D6JA 1TF5A 2IEZA 2QAGB 2NPIA 3SN6A 4DLVA 1V5WA 1I4TD 4DEXA 3ADKA 1QVRA 3WHKA 2JAQA 4KVAA 4UNPA 1G8PA 4KYUA 3RRMA 2XXAA 1IM2A 1FW6A 4WZAE 3FMOB 5BN3A 1L8QA 2VP5A 3I3SR 2NZJA 4L9WA 3TUJC 1S4QA 3ZIAD 1II8A 1N3BA 1II9A 4UXJA 1S2MA 1K5GA 2VP9A 4C3ZA 1NJGA 2ZRIA 2J45A 4XIGS 4UNQA 2GBLA 1Q1ZA 1P5ZB 3H0KA 3W6NA 4KSBA 2W6IA 3NG1A 4XJXA 2WAYA 1KJZA 3LQQA 2ZI3A 2ZROA 5CYOA 1QF9A 2ZEJA 4POAA 4WXRA 4XVRA 4CEJA 2IYWA 2Z6VA 1DAEA 5EP1A 3ONWA 1AKEA 4BLTA 1FTSA 2ZJZA 2ZUCA 1Q22A 3PEUA 3QEJA 2R6DA 3K0CC 5HCNA 2A5DA 4JIMA 4UJ3A 4A8JA 1SXJC 4ARZA 4OJKA 3GJ5A 2QL6A 2WJYA 1UKVY 5DO9A 2QTHA 3SFZA 3OZXA 1XCGB 2ORIA 3KTAA 4AKEA 4NP6A 4I4LA 2BCGY 4MH0R 4LWZA 4LHXA 4M1OA 3BWDD 1CRQA 4UKDA 1S1MA 1O3YA 2QAJA 1IQPA 4LJ4A 3N70A 5FUVA 3SR0A 2YVUA 3VHXA 4CEHB 5KO2A 2QRNA 1KHTA 2P65A 5BN5A 4MRPA 1XJ0A 1UBGA 1DAMA 1GNQA 2JJ1D 2JLRA 2YWHA 3BB1A 5BQ5A 1MV5A 3C15C 4QHSA 4GP7A 4DLRA 2LCFA 3K9HA 4URZR 4ZCLA 1XCPA 2RAPA 1OE0A 3KQLA 3T15A
chains in the Genus database with same CATH superfamily
2WMOB 1BYUA 3JCZA 2XTNA 4GEKA 2QVGA 4JB3A 2NUAB 2H31A 5EXXA 1JNXX 1Y5LA 4L6AA 4Z1MA 2Q3HA 2NSDA 1DLJA 1CU1A 1UJNA 4PAWA 5TSDA 3TKYA 1QOPB 1Z4LA 4MA0A 5KYXB 1EI9A 4FW9A 4EKIA 4WW0A 1NFFA 2NU7B 3H7IA 2WR8A 2WBLC 5A5EA 2LD4A 2YFHA 4M1KA 3S8MA 2NQ2C 1XMOB 2WHPB 2ZQ5A 3O1IC 4IIFA 2WWVD 3D9QX 2C97A 4NK5A 1J00A 4HTFB 3GGCA 1V7QA 5DV9A 1X38A 5DYIA 5F33A 3WGTA 3OZUA 4PZPA 1EVQA 1W73A 4HQ0A 1XD2A 3EEIA 4F3NA 4EA6A 1XL1A 2C7QA 2FK8A 3AL3A 4ES6A 3B3JA 3WADA 4DNPA 3RU2A 2I6QA 2ZIZA 1HYGA 1LGYA 3AR5A 3K1AA 2Y27A 1WVMA 1M6VA 4JLKA 2QRLA 4Z9YA 5FPSA 1Z26A 4XDZA 5DLEA 1G98A 1JJIA 2W6CX 1JVNA 2XBUA 1E64A 3EFHA 4OJQA 1UK6A 5KJ1A 1ZEJA 4UZFA 2ZR7A 4ZDWA 5HZMA 4JXJA 2QT9A 2WTXA 4V03A 1XA3A 4IDNA 3WL5A 5IMSA 3EXHA 1DARA 2GBGA 1JR2A 4CLRB 3SS7X 1S2OA 3E7WA 4J1SA 3K1YA 3LOQA 5JH7B 3LFHA 2QG9A 3WC4A 4PX9A 3OE7A 3OVMA 1SWVA 2LTAA 1ZZEA 2GAJA 3VZRA 2I03A 4R1UA 2GHQA 2HHAA 3U5ZB 3OF5A 4F38A 3BRSA 3S8YA 3L7YA 1LW7A 3P9ZA 1HR0B 4G5OA 1M6VB 1I2MA 1W2HA 2I2AA 3EDYA 2GJKA 1GRCA 1XMJA 4N5NA 3RFUA 5L40A 1JPJA 1UPFA 5AXCA 1TAHA 1I3OA 1YDGA 3REQB 1JILA 5LQMA 4GR5A 1MTOA 4RHEA 3SHOA 3UBTA 1QP0A 1PFGA 2WSMA 3HDQA 1EHYA 4MR7A 3CMCO 3OT1B 2D5CA 4UTPA 3OQBA 3G6KA 3EN0A 1U0RA 3D1JA 1UDXA 4P7GA 4QBTA 4U5XA 1M1XB 2HRZA 3RYFA 2GF9A 3MYYA 5BOSB 3TG2A 1PK9A 2O6HA 1PQUA 3NBZC 3IHTA 2DU8A 2ID7A 3CZMA 4UBJA 1HWYA 3G0DA 1SIWA 3HLYA 3V33A 4Y9SA 2QGNA 2QRQA 4B47A 5K0ZA 3P9XA 1BE6A 4ZOQI 1EZZA 4V0LA 4L28A 1Y8QB 3QUCA 3CB2A 3KL2A 5B4UA 1FU7A 1RXWA 1ONSA 3BL6A 3CWQA 4FXPA 5FOXA 4L8GA 1J2JA 1NUUA 2ZK7A 2I62A 4I5FA 3U9TA 2OECA 2VLIA 3KU1A 3L1VA 4CM3A 5TV2A 4CTOA 3RJ5A 2YWCA 3V6LA 4KJZA 1OLUB 4GOOD 1WNFA 1SXIA 3ZU6A 3SVZA 5KMGA 5AESA 2IPAB 1ORDA 2IXGA 4I19A 4MGHA 3QEMB 1Y8AA 3LHIA 4LXIA 4FEEA 2QVYX 5CH5A 2P6RA 1SPXA 3IRVA 1CRZA 1C9MA 1XZ8A 1IEVA 2B5OA 2IZ1A 3R3YA 3HR4A 3KVYA 3WHPA 3SEZA 1CDDA 2HSZA 3I42A 4GMXA 2WWWA 5KTMA 4ZCRA 3THRA 3RU9A 1PS9A 3GGPA 4FK8A 4PAOA 2YUIA 4L8LA 3AJEA 1QHHA 1XEWY 4PWYA 5IT4A 2X9VA 1A9RA 4B3RB 4KUEA 3AHDA 4JJZA 3R09A 2AFIA 1T0BA 3HA5A 1YB5A 3HZOA 3SP1A 5CX1B 3RC8A 4LQCA 1NVVQ 2HA6A 3FTPA 5KTRA 1Z2DA 4H6PA 2HF8A 4ZAXA 4U3JA 4DT1A 3MHPA 1Y5RA 3TDKA 2FWRA 4JUAA 1TTTA 1ND6A 3QVMA 1TVKB 1E92A 3AR7A 4UM7A 1IVSA 5B1YA 1W6RA 5HZHA 3KLMX 3M4JA 4ZZ2A 3QOWA 1OIXA 1U0TA 1PQPA 2BUBA 1CP2A 2HHCA 1VB3A 4R05A 4ZAVA 4P38A 5LD2B 2UXCB 2QUHA 4RNCA 1ZGAA 4ZALA 5CB4F 4C6TB 3IVAA 5I5EA 2MSEB 1DJMA 4CODB 5AVKA 1PGOA 3BQ9A 1IK6A 3NPMA 3MUEA 5EIAA 4J16A 4LYEA 4PSKA 3VOSA 4CDMA 1JAXA 2PWAA 2V7XA 1XPJA 2VT6A 1X3SA 4LOIA 1UK9A 3PGKA 1LLDA 2J5KA 5DBEX 1P45A 1M6NA 1SCKA 2QE6A 4MRNA 3FHOA 3HPQA 1QG0A 3M4XA 4RETA 1M2GA 4M1QA 3EGIA 2HTEA 2JGDA 4X61A 5E9QA 4ZT7A 2BF7A 2C5SA 3IOCA 3INTA 1KI6B 2M32A 4XKJA 3DO8A 3RUCA 3G17A 4BNNA 4DKXA 4LZAA 1J1ZA 4EL0A 1E3WA 3S40A 2XXAB 1G7TA 3E9YA 4J2TA 3V97A 1P3DA 3N7TA 2IV2X 1OHHD 5AM0A 3SZMA 5BQOA 1ZD2P 1YKSA 2VBGA 3IXQA 3OT5A 1KZ4A 3IDQA 5AOAA 3S99A 4KHPB 2GPWA 2J3HA 4BXOB 4QU9A 3HJRA 3L7IA 4C30A 1VIVA 3L07A 2DBRA 2YMMA 3KYCB 1W5BA 3FCYA 2YY5A 1Y1SA 3W0LB 3H87A 1KAGA 5JNRA 2BFDA 4BVBA 4OLAA 3TIVA 4OHKA 5FT9A 3RVJA 4J49A 3GT4A 1GLVA 5CFMA 3RLIA 4FFMA 1PYDA 4FDUA 2BFEB 4QFCA 2XYHA 3PFWO 1IDOA 3PQ3A 3LC1O 3BFPA 2DKNA 4JEIA 4EDHA 3R0ZA 4RANA 5IKXA 1RWWA 2X3YA 3LLMA 3OZIA 5GVRA 2MSNA 1ZIPA 3H8SA 4PO1A 3T5TA 2WWIA 4Z4EA 2G1AA 1MB2A 3IAM1 4JUDX 3OPNA 3UMGA 1NASA 1WBJB 5C1OA 1T6ZA 1RM5A 1NSFA 2VUIB 2YC4C 3F6RA 3MS2A 4K3VA 4MR8B 2ZUBA 3H5LA 1VJCA 1PLKA 3A14A 1I5OA 4XWTA 2IYVA 4KFRA 2HEIA 1N1MA 4WLEA 4HMOA 1DIRA 5ESXA 1RZRA 3SS9X 2HOQA 4DIUA 4HYTA 5EP3A 4ZVPA 2W6QA 3W8RA 1GTRA 1T6YA 3KUDA 3MZ0A 4H0NA 4BVJA 5LU9A 1LD3A 2HA2A 1KEKA 4F4JA 2FDRA 2IXAA 3EPJA 1QFJA 1R0CA 4CQNA 2Q3DA 3JQQA 1OLXB 4N5LA 1IN6A 3JTMA 1EIZA 2YIJA 3QNUA 1Z25A 3AFNA 4EQ6A 4JYZA 4H60A 5KNCH 1M6EX 1FLVA 4LGVA 2GF0A 4UDYX 4EVIA 4CMIA 2FQQA 4N3CA 4D57A 4HAYA 7MHTA 3HXTA 1HDYA 1PL0A 1Y7TA 5D87A 5IM4A 2RHLA 2DPYA 1ZUIA 2WSLA 4LSZA 3VDMA 5DNYB 3SHVA 4P35A 2CLSA 5L7YA 1SBQA 1E0AA 1YFKA 3LV8A 1G5HA 2R84A 4M8NE 3E5HA 2FYTA 1G4UR 1JG7A 2SHKA 5LUBA 1NVGA 1RJGA 3KKEA 3T7KA 5JW6A 3G9QA 5I6DA 3BCRA 3IUBA 4YJGA 3SJUA 3DE3X 4IP0A 1F1JA 4REOA 2Q49A 3LPCA 2I6UA 2XA2A 1K63A 3K32A 1G8YA 3B3AA 4YJHB 3LK7A 5THXA 3ZU2A 3BWVA 3KYDA 4CZ2A 5K0TA 4J8PA 4MW5A 3S2FA 3C6ZA 3NV9A 3STVA 5IDXA 1J49A 3R6DA 3MMPA 1TZ2A 1LWNA 4BNHA 2P9CA 1QRSA 4OXQA 3U49A 1GG8A 2N1MA 3EA4A 3P0EA 4ID9A 4C4AA 1FSPA 4ERXA 1EE9A 1CZKA 4MS4A 5BUZA 2ISQA 1UFRA 1ND5A 2CHEA 2VJLA 4W1SA 1T6BY 3CT6A 1NQOA 3FPSA 2V1UA 3BMCB 2VDWA 1QLWA 3UCXA 1W46A 2H1WA 3GDFA 2CUTA 3F3YA 2AOTA 3LAWA 5G4KB 2MYUA 4EG6A 1J0CA 4LMAA 2QI9F 2PQMA 4Q18A 4F60A 2HI0A 3GHYA 3AR2A 1HNNA 1T2VA 3KR2A 1Y6RA 3CO5A 4G5XA 1XDWA 1ADFA 1NQ5A 3PXAA 4I4NA 4QDKA 3TSWA 1TCBA 3OX1A 1SZPA 2K6GA 4Q1BA 3DLBA 4LE2A 3MD9A 4P34A 2NTVA 2C0QA 3E3AA 4IKOA 4K87A 3HL4A 2PUWA 1REQB 3EQZA 4OQDA 4Y9UA 1V71A 1I2CA 1R9GA 2FMFA 2D1YA 2A0YA 3M9WA 3PHHA 1Z17A 1JAIA 2VTDA 3H9GA 4ZO4A 1OBCA 5AI5A 1BEUB 2HDOA 3DVQX 3EXIB 2EOAA 3KV3O 3ZZNA 5KTKA 2OXEA 3QSYA 4EYOA 3G2KA 3OEED 1A4XA 3WIEA 4V0OA 4NBRA 1GGMA 5CAEA 3JQDA 4CF4A 1GD1O 1LBTA 4JI0B 3L3BA 4BV3A 3OBIA 2H4YA 4BKPA 1JWLA 4BFLA 3L8CA 5T4FA 2QAGA 2YC2C 2BEVB 3W5DA 1PWXA 1EIWA 2WHXA 1R0YA 3BFJA 1MQ9A 1ZCBA 3AEYA 3VPSA 2I1WA 2Z1MA 1DUVG 4M8LA 4X8LA 3RUDA 2WU8A 3LZ6A 1EAMA 3LUGA 4Q4DA 3WIUA 4D80A 1YD7A 4CMGA 5L3ZA 2WT8A 2FRXA 1GVNB 2VBIA 1WIWA 1RXIA 1KMHA 3K0SA 4DJJA 2AC7A 2TSYB 3HBMA 4HUQB 1K7YA 4KRYA 4Q15A 4PGHA 4WJLA 1AC5A 4RY8A 3GZNB 1XRPA 3LM8A 4LUCA 3WLPA 2ARKA 2FQWA 4F72A 5C8YB 1HFEL 4INAA 5CIQA 1CT9A 1U2ZA 1K6XA 3TE7A 1N9KA 5B36A 3MMNA 1R8SA 5JWOA 1NW3A 4OSPA 4ZDIA 4HFJA 2I67A 3KQYA 1XYGA 3KKPA 4ZQHA 2AXNA 1MPXA 2J59A 1IQRA 4C20A 1R64A 4HQLA 2D13A 5CEEA 1C4WA 2JAXA 5DT9A 2W6NA 3V34A 2G0NA 1E1CB 2AJLI 4FX2A 1Z68A 2BGWA 1BKYA 1NR5A 3WAJA 4QDZA 3E3LA 1XTUA 2GAOA 2V58A 2XCTB 2EC5A 4POOA 4S2UA 5AW3A 1ENPA 4FGZA 3R2JA 4KRXA 4QU5A 3GEGA 2W2LA 1SMKA 3NQ41 4R2XA 3ZWQA 2CXPA 1JA0A 5JI3E 1EGQA 2PMEA 1NYTA 2ZUWA 3ACCA 4G84A 1EK6A 4IQGA 3OBBA 3L6RA 4GUAA 4QPCA 4BFTA 4V24A 3RFCA 3F9CA 3VKHA 3AILA 4ZD6A 3EWIA 5FI0B 4JA0A 4KHZA 4N3GA 5KDLA 3VU9B 2JZOA 3GZ4A 4RJTA 3ZY6A 4HLUC 4Q6BA 3DBHA 2W9XA 2P6MA 2DPXA 3AI2A 5CXXA 3U7EB 4F45A 4RGBA 4II7A 1ZN2A 1XHLA 4KYVA 4O3MA 1ZM7A 1V37A 2ZITA 4CWAA 4KAFA 1FPQA 3CMMA 3GI1A 4QNMA 3RHSA 3E58A 3FKSD 2C8VA 1PJLA 2L0XA 3H2ZA 1W88A 3W5IA 5J40A 4JVNA 1BDMA 1X80B 3KWFA 2RAUA 3K1TA 4JB8A 3GEDA 2OCBA 5A9RA 3WRWA 1X0XA 1UIRA 1AIPA 2IELA 1P4RA 4K6OA 2CL6X 3OJ0A 5CDHA 4A8JB 4OMCA 3PYLA 2WHEA 2FVXA 3KB1A 3NVDA 2WA1A 4HI0E 1LF5A 5LP6B 3ME5A 5CB8A 3KQKA 4JI8B 2G76A 2VWQA 2OO3A 3GFTA 3IKJA 3QEKA 3QKIA 3UKDA 4YJ3A 4L22A 1E20A 2BI7A 3TDNA 4CF7A 4WZBA 1PZNA 2IP4A 1VZ2A 5BRNA 4EF4A 1N7HA 2I7TA 5B7NA 4X93A 3FCUB 2X41A 3WNCA 1NTRA 1I1NA 2OY0A 2QM7A 2VSXA 2XUAA 3IO5A 1WHTA 3MJCA 3PPWA 4Q34A 3U9SA 4IGEA 5C52B 4L3OA 4AK9A 3I58A 5CYFA 4XWOA 2C0PA 4IAOA 3WIBA 2IEYA 1NXOA 2X40A 3IBCA 4BOYA 2WSYB 1POWA 2Q4TA 3ZZTA 2DH6A 3GMTA 1ESNA 1UMCB 3LS2A 2V9ZA 3L0SA 4H17A 3HGTA 2JC3A 1ORWA 3REGA 5BWLA 2YR0A 3IYLW 3K4HA 4HLUA 3OFVA 1NBHA 3NM5A 2DJIA 4WT7A 3UAVA 1BJKA 4R98A 4I1VA 3UYKA 5DP2A 4IW3B 3WSWA 3ZBTA 3KOZA 4D2IA 2V8OA 2RARA 2C59A 3I9LA 1T9BA 4QO7A 5AVJA 1NXQA 2BSXA 3TIGA 3H4MA 2H4JA 5ETJA 2FZ5A 3KT6A 1WD7A 3QFSA 1QHIA 3ELBA 4D9CA 4WTOA 2TECE 4BNGA 4RDXA 4DR7B 3O74A 4E5NA 1FMTA 2AW3A 2CEKA 2RI1A 3ZE7A 3UGJA 1U99A 2ZKLA 4MA5A 4N1AA 2CK3D 2D7JA 3H11A 5CTJA 1EH5A 4O1HA 4D8VA 4FXOA 4ER6A 5LNK6 4ESOA 5CA0A 4LC9A 2C58A 4E33A 4GS5A 4CMKA 3NKVA 4E6EA 1F2TA 3H2HA 5DB4A 2HQBA 4YY3B 2J07A 2HA5A 4YRFA 4CKBA 3WBFA 4MDEA 2CY0A 3JYOA 5TGDA 3HVJA 4PX2A 4RQBA 2C3YA 2ZRBA 1X1SA 4WXPA 2IZOA 4U0JA 4WESB 4PZLA 1BA2A 3HY4A 5D3QA 2G08A 2WM8A 3DEYX 4Q3BA 5E2BA 4M22A 3VYWA 2OYSA 1HNWB 3PD7A 2XMGA 3AV3A 2XX3A 4KQEA 3KPVA 1I7SB 4HNGA 3F67A 4CU2A 2FX3A 2AT1A 1QRTA 2BELA 4BAZA 3AP3A 2JD2A 4KLNA 2ODBA 1V8FA 2FG5A 5DSXA 4RWZA 2VHEA 3I8OA 1UFOA 3DHEA 3O6VA 3NANA 3CRMA 4BNWA 4ZT3A 3ABZA 2KSQA 1KQOA 5LB4A 2QPLA 1ECPA 1HTBA 3ILXA 3TAHA 621PA 5D6OA 5ALOA 1N4AA 4K8RB 2QM8A 2XDQB 3IAS6 3GQVA 3H4IA 4ND6A 2XA1A 3PJRA 1MAUA 3O4RA 4K0RA 2I1QA 4ZT5A 4EQZA 3RARA 1U2EA 2OQVA 5DI3B 3DZGA 2CCKA 2B4TO 3E2MA 1QGED 1XRRA 3SYRA 1Y7LA 5K45A 1KPGA 1CF2O 3Q85A 1JLHA 2IE0A 1CR1A 3X1ZA 6CHYA 1XKTA 4U7WA 3GEMA 1PX0A 3QMMA 1GGNA 2XBLA 1KYXA 4MYDA 3PUYA 2UVPB 4QUGA 2YCBA 4HLNA 4J0GA 5ADVA 4XFDA 3UHJA 1QYCA 1I2ZA 3I01M 1TVMA 5EZYA 1S4MA 3KLNA 2X76A 4BQEA 5JAPA 3GGSA 1VCOA 4GX1A 4AMGA 2DCUA 3HUTA 2P40A 1XZJA 2FWJA 5DBHX 3JQ9C 3VR6A 1B43A 1L3CA 5NULA 1FP4A 3ZZ0A 2UU9B 2ZUDA 1QHYA 1J8YF 2RSLA 3IC5A 1MD9A 5CR9A 2D5AA 1BE1A 2Z2JA 3NNSA 2D0PB 3LC2O 4ZT4A 4MYUA 3SKYA 1Z0FA 3Q8LA 3UJ7A 1ULHA 4AP6A 1M73E 1U4OA 1WHSA 3CNQS 4D7AA 3D4LA 1VIMA 4N82A 5EQFA 3F7TA 4DY6A 2C88A 1C3OB 3IUQA 1H0HA 1NU8A 3PQDA 1UJ6A 4NZOA 1JIUA 4Q9KA 2HLNA 5D00A 2JS7A 2P9JA 3ENZA 4QYIA 5DHPA 5BN4B 4F8EA 4RTOA 1AKRA 3GLIB 2YVLA 1B2LA 1CR2A 2ADOA 2EDCA 2ZT8A 3K8QA 1UP6A 1MO3A 2BMEA 2DR0A 5KYNA 3KX2A 1I7NA 4LYHA 2OGUA 4PZCA 3DKRA 1Y1PA 1XQ1A 4TGLA 3G2LA 4RF3A 3KSAC 1MJGA 4G0PA 5JMTA 2IHNA 1HURA 2WU4A 4KO1S 3CTMA 3WLSA 4BB5A 5DLYA 2WB4A 3P9RA 1SZJG 4FR2A 2MIIA 3CJRA 5FYDA 1I3MA 2DUUA 1QPZA 2RDMA 1B4DA 4MP8A 1IZ9A 1S6YA 2CXXA 2GT1A 2QPOA 3D2AA 3CKMA 4D82A 3LVQE 1ZW1A 2C20A 4IMIB 5C53B 2HBQA 3QVUA 4JQCA 4RA9A 1E7MA 2Z2KA 2XECA 2BGNA 3FSJX 4KE7A 2O3TA 5CPFA 4Z7JA 3PEFA 4IXWA 5JAQA 5J5VA 1KFEB 1T5IA 2G1UA 4GOMD 1KAQA 4HEHA 4HKTA 3VJMA 2HCRA 5HIIA 4MQEB 3W5UA 4ZOLB 4K6HA 2R6ZA 2E4ZA 1WUJS 4EPYA 1WHSB 2VHJA 5CGZA 1PLLA 4C0WA 1SRQA 6REQA 5T5QA 3F73A 5GIPE 3M9LA 3P52A 2PM8A 1JB1A 1R3UA 4RK6A 2CDBA 2A59A 3L4BA 5BMVF 2QGZA 3M6WA 3HHPA 5EUBA 2ZUTA 1ZVJA 4XQ9A 4UE2A 1INLA 1GL6A 1KAMA 1WNTA 2PV7A 2YY6A 2HPHA 4PRKA 4RZIA 3IT1A 4PLVA 5ARDA 1TZKA 3B8HA 3GGJA 4FPXA 4NL4H 1NLFA 1VKHA 4ISBA 2V3WA 4XVHA 5EHQA 3WGYA 1R4MB 4C6HA 4EY6A 2YASA 5J2UA 4AMZA 3U81A 2H51A 4JJ7A 3GJZA 4MWZA 4TKMA 4IJWA 1K8RA 3VGJA 5CG2A 4CKZA 5BYBA 3FYDA 1T24A 3FUWA 4JEMA 2MMCA 2H4HA 4B48A 5JSYA 2IOFA 3IEUA 2HNBA 3ND6A 3PA8A 4L1KA 4X0EA 1IWOA 4WSOA 1H9BA 1U7OA 3GLHA 2QUIA 3FHCB 4JVLA 4LOKA 3PFBA 1ETHA 4B9EA 3DT9A 4EZBA 1PCXA 2QNIA 4Z7OB 1PJZA 4RCVA 3WNZA 4FMBB 1NMZA 2C00A 1DCMA 2WQZA 5JPCA 2HLDA 3T94A 4Y2QA 5IJ0B 5JMWA 1S9HA 4KQGA 4QDXA 3UYLA 2C4MA 1PNOA 2CXQA 1V0JA 1NOJA 5I9BA 2ODTX 4H7JA 4MYCA 2OV2A 1E6MA 1EVIA 2KE5A 1B8NA 3BBPA 1JEEA 4JD5A 1W7AA 3BYZA 5TQ0B 1M2OB 3UMFA 3RVBA 1XZMA 2VJKA 1H8ED 3GLQA 4G4IA 4P80A 1YKFA 1FLDA 2RBGA 1CUGA 4KV7A 1NUPA 1JAZA 1KDOA 3ADCA 3L4BC 2AH5A 2QQEA 2DWOA 2VTBA 1UKZA 4ZZ3A 3DBRB 5BQXA 2ANCA 2FJ0A 2QN1A 5IXSA 3RASA 4C6SA 3B85A 3RVSA 1XVLA 4QPZA 2R1VB 2RBEA 4PPGA 3U4QA 2Z9DA 5CVTA 1NP6A 4KLZA 2P1RA 4ROSA 1EM6A 3V46A 5IP5A 2VSNA 4C7JA 1YU6A 1U31A 5I4CA 1AXGA 5L3VA 3V4ZA 4IXNA 2YXNA 3L41A 3VKUA 4CHTA 4LF5B 4E5MA 3UJAA 4W5OA 4RLFA 2O2CA 1VE3A 2OLKA 4MVJI 5JCOA 3EE6A 1U2RA 3H2GA 4RY9A 3UK7A 2Z83A 5E2AA 1J25A 1CR6A 1HOXA 1H6DA 1SKAA 3VAYA 4BCDA 3M49A 3FOEC 1R5BA 2HIMA 3NHPA 2D0OB 4NX2A 2WJ3A 2ZTHA 2FPGA 4NESA 1NT2A 3FE2A 3LA8A 4INOA 5I9MA 4TKLA 2E82A 2FPSA 4G41A 4O2AB 4RPHA 3K72B 3Q5GA 1ZQ1A 4I2VA 3U7QB 4BP3A 1C9KA 2Z0MA 4BNFA 5ARCA 3EPHA 1C0EA 2X0NA 1YZHA 2GFIA 1PFUA 3BORA 4YAOA 2HMWA 3R9IA 1LSSA 3S1AA 521PA 3FDIA 1Z35A 3TRKA 1N0IA 1X94A 3K53A 4I4TB 3KZKA 4I4CA 4J75A 2ZATA 2H16A 3ITKA 1HQDA 4G81A 3GCXA 4J90A 4KR3A 1AXRA 1I0ZA 2WAAA 1FYEA 1K4YA 1NVKA 4ZO7A 1XFDA 5P21A 4AKIA 5E7QA 5H80A 1WV1A 5KNDH 4L0CA 1V1RA 2YBEA 2YQ4A 3ZHCA 2X42A 2HEGA 5LP6A 4X6LA 1NVWQ 2BFFB 2MSLA 4IIBA 1PV4A 4FUQA 3X0DA 5ILOA 3DOHA 3PDHA 1JR4A 4LAFA 4CM8A 3FOCA 2OCXA 5IF9A 1ZNWA 3SOZA 2QBYB 4DRYA 3GC6A 1W0KD 4AMVA 2J0EA 1KGDA 1ODLA 3KPJA 3PLRA 5FUMA 4NHEA 1SM4A 5EGSA 2RKWA 4A26A 4AJKA 4ZI2A 3LO8A 4B79A 5JYCA 2GEBA 3V7NA 4KR2A 4KXUA 3MILA 3EUAA 2R751 2R25B 3M1AA 1RYDA 1QFXA 2QSZA 1Y6GA 3OQIB 1OR8A 2P4UA 2V7QA 5CA1B 1IXKA 1I4DD 2C1EA 4TSFD 4U2FA 3EZLA 3F4BA 4Z0NA 721PA 3FOZA 1MB4A 4U6QA 1U8AA 3ETCA 4LZZA 1T9GR 3SF0A 3U7RA 4DILA 4DLZA 2YN4A 4WNYA 3WI7A 1TYBE 1GZHB 4LYGA 1WZEA 2VHVA 1VLHA 2GD2A 2G5CA 1NVXQ 5JXWA 4B83A 4AJPA 5I7AA 4B2LA 1JLMA 1WXWA 3LWBA 1OOEA 1NVBA 2RHJA 4N40A 4RS4A 1XP5A 2FZKA 5E95A 2ZI6A 4FEAA 1B3RA 4F4DA 3PVSA 1SHTX 2FFBA 3HM9A 4KFTA 2DG2A 5HMLA 1CDZA 1U0LA 5LMUB 4F93B 1SGWA 2JGKA 4HZUA 4XQGA 4L5CA 2IDKA 5EP2A 1V11B 3BSYA 3RSSA 1XHEA 3LW8A 1E1CA 1DO8A 3NHRA 1AKYA 1UEJA 2W00A 4S12A 2QMQA 4B1FA 4QQRA 2VI5A 3HM2A 1KMQA 1LZLA 1PU2A 1U7TA 2GVDC 4QECA 3ZDXB 4BJ1A 1MAAA 3WISA 4ZJZA 1XN1A 3DC7A 1CG6A 3WMEA 4LGMA 3R9XA 2OXRA 3HZZA 3X1MA 4YECA 1UJ2A 4QEKA 4FX5A 1SBHA 2AYYA 5FH9A 5KVAA 1RPTA 3MBOA 3AM1A 3IUMA 2QRZA 5F5LA 3LKDA 2HK9A 2H65A 1E9EA 3GZNA 1QAOA 2WIFA 2Q6VA 4DG9A 5FOTA 4CM9A 5A5FA 2H11A 2IXTA 3ANNA 3QKSB 2CLFB 1VDMA 4X91A 3F7OA 5DYYA 4HO1X 1IRXA 4XCQA 3R7SA 5LYJA 2OUKA 2GLTA 1U0OC 2DUJA 3B1WA 3VNSA 3K0HA 1SBIA 3UJNA 1RQLA 1KH2A 4QHTA 4PSAA 4MV1A 5I4IA 1JU9A 3FBWA 5H0IA 3WG9A 4D9BA 3VNRA 4XWGA 5KSWB 2DHCA 2REXB 2C5EA 1I10A 2PMFA 1CE8A 1JJFA 4M21A 1JTEA 3N5CA 3RUPA 3K9GA 3OA0A 5H70A 1MIHA 1N8TA 1XD8A 2OV8A 3CX6A 1FJHA 3CHYA 5FPYA 4OQNA 5B3JC 5BORA 1FJGB 3QBDA 4N39A 1B6RA 3VR6D 3FWPA 3RVMA 3X2EA 1VGRA 1LPOA 4Q00A 3ZHQA 3RUEA 3BGVA 1PZMA 1XZCA 4HYYA 4DC9A 1BW9B 3E7DA 2XNHA 2XLBA 3SNKA 2PH5A 1YHYA 3KSZO 4CL2A 1X1BA 3C3AA 3ZGXA 1PZGA 4HTAA 4LOLA 3IKMB 4LY9A 3RSLA 4A8PA 3P7MA 3AYXB 4P08A 4BNMA 2KMLA 2Z2ZA 2B7CA 3DEFA 5E4TA 4DQ0A 4KLAA 5A06A 4LV5B 4L9RA 4LCEA 2C3PA 3R24A 3PKJA 4US1R 5AK5A 5F35A 3LY9A 1PJ4A 1G5RA 4ILKA 4JYCA 3OQHA 4X3CA 4DJEC 4IZOA 4OP1A 3JQBA 2B20A 3MJ4A 2AFHE 3T54A 3U3XA 3LHKA 1H23A 4HNAB 1OVGA 3VHRA 3PUWA 3UWOA 1SCIA 2SCUA 1X7GA 4I5DA 1EVLA 2VDWB 4DQXA 3U19A 4KXMA 1PAUA 4ARSA 1NJ1A 2FZLA 1A76A 3ZNOA 4QYTA 2ATVA 3KKKA 4OF4A 4Z3KA 5DVZA 1O9BA 4WEOA 3BJZA 3WO1A 3HQ4O 2WAOA 2G70A 4GDMA 2XVXA 4N7BA 1CUIA 4RL4A 2F2TA 3EZXA 5DHQA 2PX6A 1E5VA 4EMUA 1KNXA 2R7LA 2C31A 5DBGA 2PQ6A 4ZZ0A 5KSOA 2PUTA 2XI4A 3H8VA 1QZ3A 2YQ5A 1GCUA 1L5SA 1PQ4A 2BMFA 2CJWB 2JCBA 2R44A 1KK1A 1GRRA 1EWKA 1L4NA 4IV5A 5BVGB 1GKUB 4A5OA 4BEJA 4GVPA 3LGXA 3I2HA 4LPSA 4BO9A 3LSTA 4BO1A 2B21A 3H7AA 1XN4A 3ZS9A 1I0LA 3A3KA 3D6JA 4BX3A 1N5DA 2CMHA 1BXRA 5K0LA 3JVVA 1TAUA 2AKAB 1TVEA 3JQ6A 3VNQA 1E3SA 1QZUA 3HL0A 3ZLBA 3TXYA 1M10A 3GUYA 1NPYA 2AC4A 3JD3A 3BCHA 2G04A 2DCMA 4H3KB 5L45A 3RS4A 1XG5A 2QRUA 3H5RA 2RGEA 3RKRA 3V4RA 2JCVA 4QU0A 4CMIB 2JIQA 2NXCA 3N2LA 4GP9A 1OZGA 3RVNA 3NYWA 3Q6MA 5CX4A 5ICEA 1WXGA 4DMGA 5CCDA 3DZDA 3JQBC 3N87A 3T5DA 4IIDA 5ALEA 5JDCA 3DQPA 3EW7A 2AI1A 5LD2C 2HA0A 4HAZA 1Q1NA 2EF0A 2HLPA 3WMXA 1GQSA 2WIDA 3K09C 4M37A 5F2KA 3TKAA 4EB0A 3JPWA 4TTVA 3DHYA 2XTZA 3AR3A 4V0ME 2SECE 2IZ0A 3FXAA 4XYGA 1N2CE 1O08A 4LQLA 3IEKA 5K0FA 2BKUA 3JWHA 4W63A 1FUKA 3OQ1A 2ST1A 4CKCA 3ED1A 1PR4A 3A6ZA 1KGSA 1YR1A 3DP7A 1V7PC 5KVVA 1OFGA 2QDKA 3BZUA 1H2RS 4KNWA 5EUMA 4MR8A 4A36A 3MJHA 1QHFA 1L5KA 4BC0A 4BKMA 2JLZA 4UAGA 4ZVUA 4QTUB 4X84A 4EGAA 4BVGA 2WG0A 1RLUA 4MQ6A 3GJ7A 4W8HA 5EMMA 8GPBA 4C7OA 4L4ZA 3FOBA 1ORRA 2CL7X 5HF6A 1KYIA 1L4UA 1H3EA 1JKFA 3CRZA 1X1AA 3V1TC 2BBSA 4O2AF 4PNEA 1NQWA 1L7DA 1I4EB 4YGYA 3RDPA 4YI3A 1AK1A 4D3DA 3M6MD 1TYCA 3FVVA 1EUDA 4NV0A 2W8ZA 3E1KA 1AGPA 3TZEA 4RMJA 5BNZA 3IQIX 1ZGHA 1A96A 3B6JA 3JALA 3P9QA 5HKLA 3U7HB 4QELA 2JHFA 3OY2A 3KHKA 4JFRA 5LXTA 2P6OA 1PWYE 3KKNA 1RXSA 3UUWA 1OKKD 1CUVA 3SLGA 5DRTA 1XMIA 1RHUA 4MI1A 4QUHA 3A1VA 4JLBA 2PKRA 3OZCA 1WQ3A 2JD0A 2QYTA 2I3GA 4KBYA 3PFCA 1FJXA 3ODPA 4BU1A 4BNYA 2Q41A 1KI6A 1OU0A 2D5IA 1LFDB 1DO2A 3N05A 2JATA 4GICA 4RGQA 3SEAA 3SYLA 1IPHA 4L5BA 4Q02A 1TO1E 1Z0AA 4GVLA 3AHEA 4LFCB 1Z22A 4QAQA 3BDAA 4R69A 4DIMA 3E61A 3P2OA 1XNRB 1ZGBA 2V4MA 2JHAA 2GD0A 4QDJA 4UCWA 5DXAA 2X0FA 3RTBA 4UEJA 3GA7A 1EBBA 2ZBGA 5EZ6B 3CEJA 4ND8B 2EWWA 4Q4JB 3UK6A 3AF6A 3IIKA 2R8BA 2C78A 2QROA 2QAIA 4C6TA 1ISSA 1DIHA 1P2TA 1XTIA 2AYZA 4WMLA 5CU7A 3RABA 3ZKWB 1V6SA 2AOVA 2W6JA 4P93A 4AN0A 4A2QA 3QVOA 5FPTA 5B37A 1IOLA 1YB7A 4GPTA 2P3OA 4RHCA 1DJOA 4ZN6A 4MQLA 4W8GA 4LCBA 4ILEA 2AMLA 2JHGA 3PT5A 2YN0A 1TVKA 3M6LA 1X8KA 2UV8A 1QZZA 1QUFA 5C46F 1IVYA 4N3NA 2PU7A 1Y3AA 1C3JA 4U7HA 4D74A 3DL0A 3R20A 3UWSA 1QYWA 4KGZA 4P0QB 2X2OA 1T2EA 1SN7A 3I76A 1AF7A 1QXSA 2ZBQA 4B3BA 3SBEA 2FA9A 2ZJ4A 4NY1A 1UBCA 2Z95A 4UZSA 3VOTA 4QYXA 2QX9A 4E5KA 3ABSB 4ALKA 4E08A 1ZJJA 5ES3A 2XWQA 3A32A 1Q21A 2XQVA 1Y4ZA 1M2WA 2BDTA 2HRCA 5CXQA 3QXHA 4Q5IA 1YUNA 5LP6F 2WD9A 2GM4A 4OXYA 4WZBE 2YDXA 4N47A 4CYMA 4EIWA 1RYFA 5FPQA 3OWOA 1H8HA 3HABA 1MRNA 5CNIA 3QF4B 2PL3A 4HGRA 4IEIA 1X92A 1RBZA 4HB0A 1U11A 2PKWA 4GMDA 4C9BA 4D3FA 2JF0A 2WB2A 4Q03A 2GJ9A 2BP7A 1DJQA 3OKFA 5KMGB 3I6MA 2NU9B 2XJ9A 1LWOA 1KTIA 5DM60 3WK5A 2OFXA 1P33A 1NV8A 3QW4B 3EZ9A 5K4AA 3G5UA 4RVGA 3QENA 1HE8B 5BWBA 5KBYA 4KGXA 1E62A 4O4JA 4PHHA 3T1NA 5TEVA 1Y8QA 821PA 3ENWA 1M74A 2DHRA 1W44A 1E2DA 3LGSA 1HXHA 3CIOA 1NVTA 1VCMA 2BTQA 3I1YA 3L06A 2PVSA 3B7WA 2C07A 1T4GA 3CR8A 5K0EA 4CEJB 1N3LA 3H5NA 4CQLB 3ZTWA 4HMPA 5A9SA 3K96A 5HKBA 1FS6A 2IH4A 4Z9BA 3QFCA 2DFPA 3PC7A 4EVSA 5TRTA 2EFGA 1NYRA 2H3HA 3TLBA 2C2WA 2VSYA 3GT3A 1PVDA 4RX1A 3IXLA 2HWWA 1SIBE 1IUPA 2W37A 3H42B 1PYGA 4WOKA 1KZGB 3GPBA 4YMWA 4ZWNA 1EX9A 5E9AA 1VMIA 5K0CA 3WWEA 4DB4A 1GDTA 4K7JA 1GG9A 4R54A 3VR5A 3PI6A 1SXHA 2IRWA 1KTVA 2VK2A 1UBUS 1M9NA 4UNSA 2C3MA 1YZVA 4OHYA 1CDOA 4KBGA 1YU9A 5P8WA 1QU2A 3CXRA 5KYTA 5REQB 5L51A 5IUKC 1JWBB 1R6DA 5IRCD 1Q17A 1SHZA 1FNSA 4G5RA 3TW0A 2HFJA 4HPJB 3ABOB 1FTQA 4QXPA 4RJIA 3K9WA 3V8MA 2HNAA 3DE1X 5J63A 4NU0A 3HB9A 1FE8A 1U0HC 2RAVA 5GZ1A 2ACKA 1PFKA 4FNOA 1RCTE 1VCHA 1ZD5A 2VKTA 1MQ8B 1VFPA 3MWEB 7REQB 1SHKA 3BK7A 1LVGA 2X2FA 1RWVA 3ZY2A 1OYYA 2ZTLA 1GL3A 3I12A 5B6IA 3Q6NA 4F56A 1P1HA 1W85A 1P2DA 2ZYDA 1RAEA 1JB9A 4NONA 5IC5A 4EUKA 2IYEA 3OKAA 3QNWA 4XSVA 5TARA 2CDRA 3NCTA 4GZLA 3SEQA 2HU5A 3RS0A 1ZK4A 3FWZA 1VHJA 2OSBA 4J4HA 2XJ4A 3HVRA 2DLCX 2G9QA 1ZI6A 4KIJA 1FP7A