2BMJA

Gtpase like domain of centaurin gamma 1 (human)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
176
structure length
174
Chain Sequence
b'MRSIPELRLGVLGDARSGKSSLIHRFLTGSYQVLEKTESEQYKKEMLVDGQTHLVLIREEAGAPDAKFSGWADAVIFVFSLEDENSFQAVSRLHGQLSSLRGRGGLALALVGTQDRISASSPRVVGDARARALCADMKRCSYYETCATYGLNVDRVFQEVAQKVVTLRKQQQLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CENTAURIN GAMMA 1
publication title The Centaurin Gamma-1 Gtpase-Like Domain Functions as an Ntpase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 62
structure length 174
sequence length 176
ec nomenclature
pdb deposition date 2005-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2bmjA00
1E4VA 4LHXA 2VTKA 4KSBA 1OHHA 3LNCA 2AR7A 4WZBE 3ZIAD 5C46F 3U6BA 3K70B 3WMFA 3H1TA 1ZAKA 3GLGB 2P6NA 3BBPA 4DDUA 2RGAA 3LBNA 5B58C 4QHTA 3EC1A 1PJRA 2IUTA 1N6KA 4M1YA 2J7PA 1FUKA 5IHPA 1F2TB 4QNMA 2CHGA 3A4NA 2OBMA 4QOSA 2VP6A 1A2KC 1NSTA 2CNWA 2GCOA 2I1VB 3PEWA 4RD6A 4AC9A 3LLMA 1KO4A 1NG1A 4YMSA 4JBXA 1BYUA 1TL7C 2NO7A 2BWJA 3BD9A 3OEEA 2GWHA 3N70A 3R9XA 3AKCA 4KSCA 1IN5A 1PV4A 1OKKA 1KZGB 2CK3D 2JDIA 3AEZA 3IIKA 3FGNA 1KDTA 2ZR7A 4KODA 5EP1A 5GJVC 3FDIA 2WSSD 2ZRAA 3EZ6A 3OE7A 4UJ5A 4AG6A 3V00A 4TSFD 2ERXA 3O8RA 2VRWA 3CWZA 4M1KA 3KFVA 1U9IA 4LV6A 4Q9KA 1N6LA 3U3OA 1FW6A 2RHDA 1KSFX 4DZZA 3B2EA 3GEIA 2CHVA 4ZCMA 1WCV1 2JIZA 2RGGA 2ZI7A 3W8RA 1CR2A 1HUQA 2NMVA 3GLGA 1NG9A 4OQXA 5JWRA 4UNQA 2FGJA 2WWWA 1HE8B 4OJQA 4B6EA 5JFGA 5L3QB 1J2JA 4UNRA 3Q5EA 2ZANA 1YZTA 2O8CB 3AGPA 2ZI5A 2WVJA 2DWQA 3D8BA 1RVDA 3FYHA 1P5ZB 4A15A 1XMIA 2QTFA 5E3HA 1SXJD 3QXXA 3CB4A 2A7QA 3WHLA 2QY9A 4CT5A 1P2VA 4D4LA 5GVSA 3H4MA 1XD2A 3EZFA 4S2EA 3GJ4A 2G9NA 2JLVA 1BMFD 3KKMA 2IXFA 4NYMR 3I5XA 3OF5A 3A1VA 2H5EA 3FKSA 3T15A 4Q02A 2DFKB 1ZUHA 1N0WA 2FPKA 2QT1A 3HU3A 5DSZA 2EWWA 3QG1A 1CIPA 4NPHA 4TN1A 2O8DB 4EIWA 1KDPA 1BO6A 2CVHA 2DFLA 1G17A 1VIYA 4NE2A 3T1TA 1DADA 2IK8A 4OK3A 1YQTA 3HPRA 5CK4A 5JRJA 1MT0A 2WBLC 1YKSA 3W8NA 4RKFA 3IKJA 3EASA 5EE9A 5DYIA 4MKGA 5CDFA 3IGFA 5M04A 3ASYA 3G82C 3N2IA 4YLGA 3X1YA 3QY0A 2OCYC 4K8OA 1KJYA 1H8HA 2ZSAA 4B3GA 3TRFA 2GF9A 3QNUA 1KI9A 4POAA 4BLQA 1ETUA 1E9SA 5C4GB 2UKDA 4Q01A 4Q1BA 1CLUA 2F1RA 3OIYA 2UVQA 2PH1A 3CRVA 1IM2A 1OV4A 4PPNA 4LC1A 1MO5A 1OLOA 2Z43A 4MGZR 4MUAA 4KBGA 5A0FA 2ZJ5A 4L9SA 3C41J 4DIDA 1ZYUA 1NIJA 2DWOA 1HY3A 1N6IA 1NN3A 3QG5A 4UXHA 5KU1A 2CE7A 4DWJA 3BFKA 4ZKDA 1TQ2A 3VR5A 2WPDA 3ZS8A 5CLLA 4C2UA 5FUXA 1WMSA 3NXSA 2W83A 4DDTA 2O8DA 4Z8XA 3VMFA 2XTMA 3E70C 4MDFA 2G0TA 3QKSB 4C7OB 3MRSA 3P26A 3CKLA 1OIWA 2JATA 3PEVA 4F4JA 3EC2A 4EPXA 4HB2A 1VKJA 1P62B 1E2QA 5FPKA 1E9RA 2CLSA 4I1SA 5CIQA 1ZNYA 4TYPA 3LW8A 2OV2A 2GZHA 4US1R 2WJIA 4I1VA 1G20E 3T1OA 3LLUA 5FFMA 3UWKA 5J4VA 3GJ3A 5JWOA 2YWHA 3AP3A 2CBZA 4JLAA 3SHWA 3JVVA 4A0RA 3TGPA 1MABB 4OJKA 4CZ2A 3Q8XB 1G291 3IQWA 4Q5IA 4TYWA 5HE9A 4NCHA 1QHYA 3DM9B 4OHZA 1OXVA 5BQ5A 1E32A 4Z51A 4LBZA 1GDDA 4ZO4A 1ZM4A 5FTNA 3VNVA 3SQXA 3C14C 5AJZA 3KKOA 3QSYA 4GFDA 3AH8A 3EIEA 2ZSDA 2F55A 4LJ9A 2QPTA 4JLMA 3GQBA 4BLTA 3B82A 4EQ6B 2EFDB 1S1CA 2GJSA 1FP7A 2NQ2C 2FSFA 2WKQA 4O2RA 3EA5A 3GJXC 1A1VA 3W5JA 3QKUA 4BZQA 4D2IA 2LWIA 1DG1G 1JR3D 2ZU0C 4JSYA 2W0MA 3IUYA 3CF2A 3IPYA 5AK0A 3RAPR 3GLFB 3RRYA 2IYUA 2WTUA 1MRSA 1P9NA 3ZZTA 1CXZA 4C7OA 2NO9A 5KSPA 4F38A 1KHTA 2Q3MA 4Y0AA 1XTRA 5LDDC 4PHHA 2D62A 4HUQB 2J41A 1K6MA 4O0MA 4Q21A 2Z0MA 4KYIB 2GKSA 1E2IA 2VP5A 2VSOA 5TVKA 2O8EA 2Q9BA 2VSXA 3EWSA 2VHQA 3EAQA 2O0JA 4G1UC 2R6AA 1XPRA 3UKDA 4YXWA 2ZSFA 2ZITA 3AVTA 4D0GA 1Q57A 4B48A 1W0KD 2C9YA 5G3ZA 4KFUA 1UKZA 4C4PA 1XPUA 2YJTD 4RCYA 2FZ4A 2AFIE 3PJRA 4LPKA 5FOUA 1MABA 2ZI4A 4LYFA 4PHTA 1LV7A 3BS4A 4DBLC 1E2NA 1U0JA 4XWAA 3GP8A 2GXSA 3KQNA 4NONA 2VHUA 5EXTA 3CX7A 1O87A 2ZPTX 4RSGA 1EFRD 3KX2A 1E98A 3G5UA 4I99A 2C9CA 1P61B 3SJCA 5K8UA 1R5NA 3TAUA 4EFNA 1GITA 2ZYVX 2I3BA 4DXAA 4EQ6A 4WZ6A 4BFVA 1G8FA 4FD2A 5FPHA 3RC8A 2RAPA 2ZROA 2FEOA 1E6CA 4BRWA 4CGZA 1GTVA 2RGCA 2VIIA 3PUXA 2IYRA 3WYFA 1G6OA 1CP2A 3U2QA 2VEDA 3RSOA 5F9FA 2KSQA 2P0EA 4CF7A 4LPSA 3EZ2A 2XEXA 5E95A 1UKEA 3AVWA 4DLWA 3L0PA 4C9BA 3GLGE 5AJYA 1Q3HA 3Q9LA 2NZ8A 4JBYA 1E2PA 2DFTA 4JS0A 4DSUA 3T06B 2F1JA 3LQQA 1P6XA 3H2YA 4AYTA 5LPNA 2E1RA 4TT3A 4OHYA 3UIEA 1U0HC 1TU4A 1NNEA 4TL8A 4NH0A 1UEIA 2ZE7A 2C95A 3CNLA 3KUCA 3RLFA 4D4KA 2ZRPA 4MRPA 2IYXA 3TQFA 4I1OA 1KYIA 5C2JB 3VKGA 3UMRA 3FWYA 4QM7A 1COWA 1P9RA 2G1JA 1E0KA 1AGPA 2FPMA 4Q4HA 2BBTA 4DLVA 2NO1A 4HAUA 1KMHB 2OFOA 5FOSA 4BLRA 2BJWA 3VNUA 1TX4B 1ZM9A 1GM5A 3ASZA 2RB4A 4CT4B 1G8YA 3WNCA 3SFVA 2CHQA 3TUIC 3FPAA 3GPLA 2ODEA 4KCGA 3P20A 2EWVA 1GVNB 2GEUA 1LF0A 5CITA 1W44A 4DSOA 1JAIA 3MWYW 1QF9A 1W4CA 1DAFA 1FMLA 4PPQA 2F3TA 1YZNA 3ECCA 1W36B 1KI2A 4BRUA 2XJ9A 5KPDA 4WOPA 2IYWA 1E3MA 5EP3A 4CRWB 2QBYB 1MV5A 4QKQA 4NCKA 2AD5A 4IKEA 3JVUA 4X8LA 2IS2A 4X8HA 1JPJA 3SDZA 2REXB 4AIIA 2XZOA 3VR2A 3V4FA 2D74A 4DCVA 4AKGA 1NLZA 2G0NA 1N3BA 4M0LA 3FHTA 2B8WA 3OIUA 1A5TA 1VG1A 3PEYA 1OXXK 1PUJA 5AR1A 4CYMA 3EPLA 1Z6GA 4ZDKA 1XX6A 5EXPA 2QAGB 1XCPA 1ELOA 1DBSA 1SKYB 4Z1MA 4DT1B 4DVGA 3ZYCA 2V3CC 1A4RA 2BBWA 3FMFA 3Q5DA 1A7JA 3K0FB 5KNDA 3BJIC 4DRZA 5LBIA 4BZPA 3LVQE 1SVIA 2DHRA 4XVUA 2XB2A 3C7KA 3QVVA 1ESMA 3TSZA 2HT1A 3T5DA 3HU1A 3GFPA 4US0R 2FV8A 121PA 2OESA 3MGCA 5DGXA 4ZDIA 4LJ4A 1SGWA 2IWRA 2GK6A 2FEMA 1Z07A 3E5HA 1MH1A 1RJ9A 3A1WA 4HAXA 4NTZA 4M1MA 2OXCA 3VR6A 3X1ZA 4B3XA 3U61B 5FH9A 4KXFB 2GHIA 2B92A 4Q1EA 2OSBA 4GDFA 2IF2A 3FTQA 1Z6AA 5BYKA 4FCWA 4A8JC 1UKYA 4NYMQ 3U4QA 4JL6A 1S1MA 3D3QA 1X3SA 1XMVA 1ZU4A 3PIRA 3WRXC 2QBYA 1VPLA 3VR3A 3KFXA 2WWHA 5JRZA 2JAQA 2QI9C 4KFTA 2HF9A 1K5GA 2H18A 4EPTA 3IHWA 1XTKA 2BCJQ 1F2UA 2XNSA 4DUGA 2IW3A 4P3YA 3SBEA 4DLRA 1G16A 1ZM2A 4DC9A 2R6CA 1D9XA 2SHKA 3FOZA 3NDPA 2ZI9A 4LZZA 2ZE8A 1XTIA 2XZPA 1E0SA 3AVPA 2FNAA 1NN0A 5G3YA 3MCAA 3SOPA 3K0FA 2O8FA 2HCJB 3VHXA 1WA5A 3NKVA 5JEEA 2PLFA 1GRRA 3CH4B 5E7IA 3B1VA 1E1QD 1YR8A 1YZKA 3PUWA 3RS5A 3ADBA 5FBLB 3HWSA 4R2IA 1OFHA 5B30A 4KAXA 1ZJ6A 2FA9A 1J99A 2LKDA 1C1YA 2ZETA 1N5LA 5K8IA 3AVYA 1TPZA 1R0YA 4XH9B 3W90A 3OEHA 4D4MA 3BERA 2QNRA 2GZAA 4GMDA 4JJZA 4MYHA 4NYJR 3OAAD 2XGJA 2J7KA 4ARZB 3NDBB 3TLXA 2MSDB 3K0CC 2RGBA 1W4BA 2XB4A 1UAAA 2O8BB 2ZRJA 3KJGA 2A5FA 4DHEA 3QUSA 4CDGA 1XCMA 2W2XA 2F1IA 1CR4A 2AWNA 2ZRHA 2AK2A 3N2EA 4GSYA 4MKFA 1T3SA 1RZ3A 4TTPA 4URWR 3KKNA 5HR5A 4KO8A 2OT3B 3CW2A 3ADKA 4U5XA 4HI0E 3TSWA 1Q20A 3U3KA 3K0SA 4FW9A 4QNRA 3DPUA 3KQLA 1R6BX 3W6OA 3A8TA 3T1QA 4MQBA 1NY5A 2P6RA 2JEOA 4D25A 2GXAA 1NKSA 1CR0A 2W6JA 1MKYA 1OHHD 2HLDA 1FTNA 3NEYA 2R6FA 2PT7A 3H84A 5FTLA 4Q9IA 4IVRA 1EX7A 4C0LA 1GNPA 4OI0A 2XXAA 2WJJA 2HF8A 3AVXA 4TLBA 3T5GA 4C0AC 3Q7PA 1FQKA 2PT5A 2G1KA 3MG9A 4YC7A 1YRBA 1X8LA 2EVWX 2D2EA 1DG3A 2QE7A 4FWIB 3U60B 3Q85A 4FMCB 1FMJA 1IN4A 1JECA 4PC1A 4URUR 4B34A 1JALA 3GJ8A 1IY1A 4Q7LA 1ZW6A 3ND8A 3QF4A 1Q12A 4URVR 3BH6A 2GILA 421PA 4IXNA 4W9MC 2HXSA 4J0QA 3NTUA 2ZUCA 1HH4A 4PHGA 5C18A 2PCJA 3ZQ6A 4V0MA 4C0SA 4JMPA 5H68A 4RZUA 1G3RA 3TVDA 2BIFA 2YHSA 1E9EA 3OEED 4FMCF 4WZAE 3REGA 2ZREA 1Z28A 4II7A 2O8BA 2QP9X 4IXMA 4KVGA 2QORA 1AZTA 2Z4SA 4EPYA 4LHWA 1W0JD 1GKUB 3MSXA 4GPTA 1E2EA 1NBMA 5KDOA 3OE7D 1QHGA 4ACAA 3GCGA 2WOOA 1JEEA 1B23P 1JJ7A 4OBEA 5FOWA 3I5YA 2RGDA 1IN7A 2IYYA 5AJVB 1NP6A 5J4HA 4RZ2A 1XTSA 1SHZA 1ZP6A 4F91B 3MJRA 5CIWA 4LDJA 4UXJA 3K0AA 3RSLA 1Q1ZA 2BKUA 2X19A 2ZRBA 2WAYA 4MGYR 3MUFA 4ZDWA 4QXAA 4MKHA 2FJUA 1VHLA 5HPYB 3I92A 2OEPA 4G5OA 1I2DA 1X1SA 4P0TA 4Q03A 4UXIA 4DCSA 2ANBA 4QGHA 3A1SA 1XCGB 3EZ7A 3CH5A 4UKDA 3CM0A 4RFVA 2MSEB 4A8JA 3KKQA 1UBFA 1G7TA 4A6PA 2JLYA 4CIDA 1BS1A 3TW8B 1G8PA 1VMAA 1QZXA 2GNOA 3RHFA 1AGRA 1EG7A 3X1XA 5H8WA 2PBRA 2QEQA 2QROA 3THOA 1N0VC 2FFBA 4PC3A 1ANKA 1ZD9A 2KE5A 4C30A 4Q4LA 5L8VA 5C4MA 5HTKA 1JPNA 1HT2E 1E2GA 4TMWA 1KK2A 2ZRNA 3BOSA 4TQ9A 2BEKA 2DY1A 4PSAA 3ICQB 3VU9A 1NN1A 3BB4A 2ZUBA 5DHAA 2QP4A 1KI3A 4L16A 4C0BA 2C99A 2PEZA 5A5GA 3QE0A 1O3YA 2HJVA 4NBSA 1XTQA 2F3RA 2FG5A 2ORIA 2C5LA 4TMTA 3W6PA 1H8HD 4M8NE 3S1AA 3NIBA 4JKIA 4CVNA 1YJ5A 1XZPA 2XTZA 1L2TA 2V6JA 3A36A 4CEJA 2CJWB 2YVUA 3EIHA 3NHBA 3SI7A 1JQJC 4AK9A 3WBJA 1IN6A 4LUCA 2IX3A 3B1ZA 5DI3B 3EPHA 1HE1C 1EWQA 2YINC 2YWGA 1Q0UA 1ZC4A 1XXHB 1BYIA 4ZDJA 3K0CA 5FTKA 5LD2B 4IVPA 2J46A 1IJFA 1II0A 2J0VA 5C1BA 2PL3A 2CLCX 5CM8B 5EUMA 4IOMA 5JCPA 4I1UA 4UNNA 4E22A 1G3QA 2NOAA 3WNBA 2A30A 4AKEA 2WPDD 4BASA 2KJQA 5FTJA 3EW9A 3L0SA 5JWHA 3H0KA 4B3CA 3AVVA 4M22A 2C78A 1SKYE 2CL7X 2O52A 3BAFA 4Q19A 4UJ3A 2BEJA 4EUNA 1CJTC 4BFTA 3BFXA 4B33A 1Z0JA 2JJ2A 1ZC3A 4JSTA 1OB2A 3CO5A 2FSGA 4NZYA 3CZPA 1XB2A 1N6RA 4HAWA 3W9YA 1MR3F 1QG4A 3A58B 4IOKA 4LBYA 5FUWA 3W6NA 5F98A 1Y63A 3I1FA 4LK2A 3LW7A 3KB1A 1R10A 1ZIOA 3LV8A 4KHZA 2PZFA 3VHLB 1D2MA 1BIFA 1I4DD 1WP9A 3SR0A 5TDHA 1SVMA 4B71A 2XSZA 4G5QA 4PFSA 2CJWA 4TMVA 4B74A 1IY2A 4G5RA 5CM9C 1KKMA 3R7WA 4BFUA 3FMIA 4MRSA 3LVRE 4TYQA 5GJWC 4TLDA 2QMHA 4LYAA 4EDHA 3K09A 2PZGA 4JLOA 4PAOA 3AP2A 4M21A 4MYTA 3X1WA 3EARA 5G53C 3KXKA 3LAWA 3SU8A 5L3SB 4OQLA 1DS6A 5GVRA 4NP6A 1R2QA 2GBLC 2H7VA 4BLOA 4N3NA 3NBXX 5AJWA 3RRZA 4LBVA 5DN6A 1CJVC 1F2TA 4R9UC 5EJEA 3C16C 2REOA 1G8HA 1DAEA 3SYKA 1AS0A 4LWZA 4BZXA 1SXJC 1IBRA 2ZI6A 1KIMA 4NCIA 1HQCA 1T5IA 1BKDR 3LRPA 2QMEA 3TR0A 4A1FA 4MKIA 4B43A 1Z47A 1K8RA 2BBSA 1XEXB 3PITA 3SYNA 1SKQA 3HR7A 2G3YA 1TF2A 4JLKA 2WIBA 3A4MA 1M6NA 3SEAA 1Z6YA 2JJ1A 1CULC 2X1VA 1T8TA 3QBTA 2OCBA 4PO8A 1EFUA 1E79A 1QHHB 2Q9AA 1SVKA 1II9A 5E7MA 1S3SA 4M1WA 3BC1A 1DAMA 3RS0A 4NU0A 3R8CA 2J5XA 1NLFA 3DM5A 2NZJA 4IDNA 3ZGXA 3LQRA 4V0ME 3KB2A 4B2LA 4BLSA 1U90A 2QENA 1KGDA 1KK3A 4AWXA 1LF5A 1NMZA 4TMXA 3TNFA 3HR8A 4RZ3A 3K0EA 3NHAA 1P9WA 1NSFA 3CF0A 1TEXA 3QKTA 3QIAA 1XNJA 3U7EB 5KYKA 1G4AE 1LY1A 4K46A 4HUTA 1OE0A 4H9GA 1NBME 1YR9A 5D3QA 5F3WB 1SQ5A 2WSMA 5ANRB 1KSJA 4N0EA 5L3QA 1RYFA 4NYJQ 4OK5A 2PX0A 2ZE6A 2O8CA 2CXXA 5HKKA 1OH7A 5FOXA 4BFWA 2IYSA 2BM0A 1KK1A 4G01B 1UF9A 2PMDA 2ZRKA 4XSGA 2WJVA 1DO2A 4X8MA 1FOEB 1NMXA 2MSCB 5IRCD 4MGIR 1J7KA 1G5RA 1ZUNB 1KKLA 1W1WA 3RWMB 1T3HA 4H1UA 4GP6A 5DO9A 4NHOA 1AKEA 1B0UA 3K9NA 4LI0A 2NO6A 4QGFA 1WBDA 2CL0X 4IFEA 4KI0A 2QN6A 3IO5A 3ND9A 3LH5A 3QPWA 4QBGB 4TT3D 2XTNA 2BMJA 2R9VA 4PSKA 5JMTA 5JJLA 1QHHA 4Y0VA 1XJ0A 2EFEB 1A2BA 5IDVA 1CF4A 1KAGA 4QBFA 1A82A 2ZS9A 1R0XA 2V4ZA 2D4HA 3CRW1 3ZIAA 4C0HA 5E7JA 2QPAA 2IC5A 4HSEA 1JR6A 5D3MB 1HQYE 1U8AA 3DO6A 2ASEA 4FINA 1M2OB 3NWJA 1S2MA 2HXYA 5HCNA 2OXRA 3AVOA 5KUTA 2ECKA 2FDCA 2J1LA 4EJSB 3VR1A 1GOTA 1SXJB 3EPJA 3PUYA 4YDSA 5AUNB 4B32A 4HLQB 1E2FA 4RD1A 1KOFA 4RJLA 4KJZA 3A4LA 4ASUA 2VYFA 2VP2A 3VX4A 4IVQA 4BEJA 4DCNA 2G77B 3IQXA 4BFZA 1W5TA 2ODBA 4YMWA 2Q21A 4PTLA 3IHLA 2P2LA 4TQAA 2ZRCA 1G3IA 3T61A 2FN4A 1PLKA 3VTKA 2VA8A 4DDWA 2IXGA 2FOLA 1PZNA 2WSSA 1GILA 1Z0AA 4TSFA 3SBDA 2C2HA 3C5HA 1DOAA 1R8QA 1YZLA 1FNNA 3THYB 4AG5A 5KSZA 2BM1A 3P32A 2V9PA 4GOXA 1W46A 3LWNA 1E9AA 5JEDA 4ZCIA 2FE4A 3NH6A 4OI2A 1U94A 3TMKA 2OFXA 2IS4A 3F8TA 3QKSA 4RD2A 1Z63A 4QGGA 1FX0B 4O3MA 5TMPA 4DIEA 2X8AA 1W2HA 1N5JA 4A6XA 4HB0A 2IHBA 1W36C 4A2QA 4HZUB 1SULA 1AQYA 3U5ZB 5KSYA 4BLPA 4PHFA 3UG7A 4C0QC 2J59A 1RRCA 2QT0A 4M1OA 1G5PA 2Q3FA 3TUZC 1ZNZA 4LJ5A 5FBRB 1VYVA 1CS4C 5KHOC 2GF0A 4GOKA 4TL6A 1SXJA 3QVUA 1FUUA 2WV9A 2Z5FA 4BFYA 1TNDA 3B6EA 4Q1DA 3AUXA 3NC0C 2IYVA 4LJ7A 5SZKB 2GESA 1I2MA 3MWKA 621PA 1N6PA 4TWZA 5CYOA 5JJKA 4PZZA 4BECA 2QAGC 5DE3A 2F1HA 5KNCA 1YR6A 3LDAA 4IRUB 1EXMA 3PFIA 4PSVA 1W7AA 1AJEA 1E2KA 2HJGA 4YONB 8OHMA 3AM1A 3DKPA 221PA 1X8KA 4GL2A 1KNXA 1EESA 3U7GA 4NYIR 3HYRA 4HAVA 4M2LA 2BMFA 4I81A 1FP6A 4RCZA 4IJMA 3A1UA 3L0IB 1G1MA 4LJ6A 3QOFA 4TMKA 1W4AA 5FL3A 3THYA 1XPOA 1NL3A 3CNNA 4F7WA 3GLFA 5DH9A 2E87A 4Q9JA 2ZRDA 3W34A 3VR4A 4W5JA 4DSTA 1GAJA 5EE5B 4N0DA 3ZQJA 2FPLA 1NVVR 4L9WA 4QBIA 4HUQA 4MYCA 1QDEA 3GLIB 821PA 3C4JA 2YOGA 3Q72A 5EE0A 2J9RA 4I4LA 4IDOA 3CIOA 4W5HA 1GKYA 2XOKD 3WHKA 4E07A 3I61A 3I4LA 5DNYB 4GI7A 5CJ2A 1QG2A 2EFGA 1KY3A 4B2PA 2VBCA 4JLDA 4QFMA 5BN5A 3OEHD 1OH6A 2XNDA 3LO5A 1G8GA 2ZU6A 1R7RA 1DAKA 4DSNA 3GFTA 4HB4A 5FTMA 1XWIA 2IL1A 2V7QA 1QRAA 4JZKA 1Z5ZA 4ZPXA 4BEBA 2GAOA 1S4QA 1TMKA 2A3RA 5CYPA 2B21A 1G5TA 3D31A 2L0XA 2YYZA 3OZXA 4JLNA 5J4YA 3DEFA 4WXRA 2KI5A 3OFNA 1V43A 4EKDA 2QG6A 2NGRA 1Z3IX 1XMJA 3KJIA 3VKWA 1ONBA 3L43A 1Z6XA 3B5JA 2BMDA 1G7RA 1EWRA 2ZAMA 4FMDB 4Z8YA 3MJHA 1P73A 4IDHA 4A2PA 4HDCA 2R65A 2A5JA 2YOHA 3HP1A 3P1JA 4R98A 3T12A 2BMEA 2WMNB 5F9HA 2ZQ5A 3WYAA 4GOJA 2J0SA 2HUPA 2HLDD 4B73A 3GEEA 1KO8A 1X1RA 4UNSA 1D2NA 1E4YA 1KO1A 2XX3A 1R4AA 3A37A 3BWDD 4MITA 3UG6A 1H8EA 2Y8EA 3O8CA 2IS1A 2ZS7A 1XF9A 5KOYA 2JLWA 3GLIA 4Z54A 1PLLA 3PVSA 4FMDF 4IEIA 3KQKA 2PMKA 2IYTA 4ZKEA 3RS7A 5BN4A 1OXSC 2A78A 4KVAA 1T8UA 2OLJA 1WB9A 3SE0A 2D2FA 1L4UA 3ZZUA 1YZGA 5EXXA 3BE4A 3U7HB 2BKEA 4JL8A 1IJEA 1OYYA 5KPJA 1S0UA 5EE1A 4ZV4A 3GJ7A 5FI1B 3T1VA 3ZVMA 2HYIC 1SVOA 4Q9LA 1XFAA 2AKAB 1KMHA 4MRRA 4NCJA 4KFRA 4R2HA 1MO3A 5JLJA 1JR3A 2C04A 3TBKA 3E1SA 4E09A 2FX3A 4DCTA 2EFCB 3B9QA 1OB5A 1NBMD 1XD9A 2E9SA 2H92A 3DZ8A 2P5SA 1BOFA 1Q1QA 1YHNA 2QSZA 4RD3A 1AS3A 4XD7D 3PUVA 2AWOA 2QPOA 1D8TA 2C98A 3ZS9A 2X2EA 3KUDA 1VCNA 3CX8A 1TF5A 4V0KA 4E5UA 1D5CA 5P21A 5CJPA 3KQUA 2O0KA 5EUQB 1W0KA 1BH2A 3BRWD 4O2LA 1OT3A 4B3DA 2R8RA 2OFWA 3U3RA 3UMSA 1Z0FA 2QTVB 1FQJA 2VHTA 2ZRFA 4ABYA 3BB1A 1KI7A 1ZVQA 2FU5C 2QAGA 4DT1A 3VQTA 4Q47A 2PLRA 1C9KA 2ZJ2A 4B3FX 4DEXA 1J70A 1RRPA 1NY6A 3DKVA 3AKYA 3QXCA 2ZYWX 4WVFA 4URXR 3RNLA 1RKBA 1OPXA 2ZR9A 1KK0A 2PZEA 3AVUA 3VAAA 1SVLA 1TQ6A 1U2RA 2R6GA 3PENA 4URZR 5EE3A 3D6TB 1TAGA 1AA9A 2X77A 5CK5A 2P3SA 1OXTA 1G21E 1IQPA 2GJ8A 2OCAA 5FPYA 5IT5A 4XVQA 1NF3A 4UNPA 4R71A 1Q22A 2N42A 2TMKA 3CZQA 5TY0A 1CJKC 3G0HA 5IK2D 1HA3A 2GDJA 1IN8A 2NTYC 2AN9A 3LX8A 2ZEJA 1Z08A 1S8FA 5AUQA 2F7SA 1RRFA 3QF7A 4Q1FA 3AVQA 1E2DA 2W6IA 1TUEA 3ZLJA 1JB1A 1G6HA 1G3UA 1DTSA 4BFSA 1AK2A 5FL7D 4M9ZA 3J81k 2V54A 4CEHB 2IS6A 5FBWB 1SXJE 2CCJA 1UFQA 2FGKA 4HDQB 4BQSA 3UXMA 5AWFC 1HTWA 3QBVA 4P4SB 1GL6A 2QTHA 1GNRA 1IXRC 1T9HA 4YDHB 2FSHA 3WMEA 2ZVPX 4AKIA 2CEAA 3AUYA 1XZQA 1HEIA 4DDVA 1P4SA 2DCUA 4QM6A 4LYJA 3QQ5A 1JXOA 5KTYA 4MRNA 1OW3B 1KI4A 3ETLA 3TVTA 4YMVA 3ADCA 2WIAA 2ODWA 1Q44A 1XU4A 3LD9A 4U02A 2OAP1 3KTAB 3K9HA 3X2SA 1M8PA 3T34A 2DWPA 2J7PD 4P4TA 1GSIA 2W0SA 2F43B 5CB6A 4LCBA 4LSGA 4WA7A 2ZYTX 1GFIA 3HU2A 4DLZA 2GJAA 3GLFE 1ZCBA 2CNWD 2IHYA 4TLEA 3MWJA 1S3GA 2NO0A 2ZVQX 4QL3A 1F60A 2N46A 5JSZB 3CBQA 4PXAA 4QBHA 4A0HA 2WAXA 4JJKA 2D7CA 4KU4A 3ONWA 4ARZA 3QKRB 4PPFA 5H70A 2DPXA 1C4OA 5LD2C 2ZSBA 4JT2A 1OKKD 4L4UA 1DPFA 2JDID 1U8ZA 1UBEA 4HDOB 1RRGA 3GLHB 5HCIA 2HCBA 3AP1A 2VP0A 3LXXA 3QEJA 5EP2A 2GK7A 5LB4A 1RW4A 4LV8B 2XSZD 2KBFA 1L7VC 2A5GA 4P4SA 2MMGA 3B85A 3P4YA 3HDTA 3IEUA 3CLVA 3CF6R 4Q1AA 4WIAA 3SC3A 5EZ5A 3SJZA 1DAHA 4CW7A 3AF0A 3PG5A 3SN6A 2RMKA 4KBFA 4OKSA 4CEIB 1Q1BA 2GXUA 1VECA 2JIZD 4RD0A 5AUPB 3K70D 1FPMA 3E2IA 2ZM5A 3CRRA 5EXSA 1T6NA 3B7GA 4Q4AB 5J4KA 1KI1A 1M74A 2RKOA 4Q00A 2H17A 4D0LB 3C8UA 3L8ZA 1VG9B 4KV9A 1IONA 5TARA 3CR8A 5DYGA 3QJYA 4D82A 1R5OA 5HZKA 1VCMA 4W7SA 1US8B 2P5TB 3AF2A 4IFBA 1W4RA 4JBWA 1SVSA 3IBYA 4LV5B 1P2UA 1WRBA 2QZ4A 2GRJA 1FZQA 1P60A 5JSZA 1MO4A 1P2TA 3R8FA 4F4IA 2IF0A 2I4IA 2N1BA 3D7MA 4TLAA 4EFMA 1RYHA 1Q3TA 3BB3A 4NYIQ 4OYHA 1FTSA 3FKSD 2YC2C 3GLIE 4KYUA 3QKRA 2ZJ8A 1CEEA 3EZ9A 3IPXA 4V0OA 1E79D 5JBQA 2OG2A 3ZDQA 4PANA 2IUSA 2YWFA 4JT4A 3U44B 2J45A 4XTCS 3L8YA 3MFYA 3GLHA 4NCNA 4B6FA 2HEIA 5JS7A 4D0NA 4AI6A 1N6NA 3LY5A 2VP9A 1Z0KA 2ZJYA 1NVVQ 1NKTA 3QPUA 2CCKA 5BWMA 2HV8A 4ZIRB 2XZLA 5JHHB 1I4LD 1KSHA 1KNQA 1E1QA 3KDSE 1UBCA 1AN0A 4B35A 4CEIA 3I8XA 1OH8A 1JR3E 2EW1A 2VL7A 1G18A 2P67A 1G3MA 1G9XA 1RE0A 2WJGA 2FH5B 4TMZA 1T5LA 3ZZ0A 1CBUA 2V1UA 5HE8A 1VCOA 1PVOA 3WP1B 1DEKA 2WM9B 521PA 1PUIA 1ODFA 4LYHA 1US8A 5HKKD 3KJEA 1DAGA 4TTQA 3V9PA 2XITA 3NBZC 1ZD1A 1U99A 5FR2A 2DFNA 2RCNA 4UQOA 1U0LA 2GETA 1U81A 2VF8A 1XDBA 1Z06A 2FFHA 1N6OA 3EXAA 1AS2A 1EFHA 1XBTA 1D6JA 1E1RA 4Q18A 2Z83A 4XWOA 5SZHB 1JJVA 3IIJA 1Z0IA 2FZLA 1KDOA 4N1AA 2JA1A 2RGXA 1JBKA 3CX6A 4F4CA 5EQTA 1Z8FA 2O0HA 3DL0A 3GFOA 4HZIA 4R7ZA 3U44A 4B76A 4IDPA 4PO1A 1S96A 2G83A 1CU1A 4A0GA 1SZPA 2OUKA 3O8DA 3L82B 2V55B 1CRPA 4EPVA 4PC2A 2IXEA 1NI3A 4LHVA 1YU9A 2UZIR 1EFTA 1UADA 1E9BA 2ANCA 3DOFA 4GMXA 5FPSA 2V8OA 2W2TA 4IDQA 2ZTSA 2C77A 3I8SA 4ZIRA 3F3YA 5DHFA 1GP2A 1M1YE 2KBEA 5BYJA 2J3EA 1NLYA 4RVCA 2G88A 1Z6TA 3IDQA 1ZM7A 2GZDA 3N5CA 2VQSA 3B8HA 2EFHB 3AF3A 3OESA 3JZMA 4DLYA 2JJ8A 4QHYA 3SJBA 3ZD7A 2ZAOA 1M7GA 2BOVA 4C2TA 2VPPA 4AYWA 4BE7B 1XD2B 4OI1A 3TK1A 5DIFA 2GJ9A 4MH0R 5DI3A 5EZ6B 3FHCB 3FHOA 4QG7A 4ASUD 2CDNA 3GJ0A 4BUJA 3ADDA 3AV0B 5FBQB 4LRWA 1XXHA 1ZM3A 2ZJBA 2QGNA 5FUVA 2C8VA 2YKGA 3CWQA 1ZU5A 2P6UA 4JYCA 3BGWA 2QMUA 1M7HA 3P27A 5E4FA 1W0JA 1X6VA 5JJIA 2VSFA 2GVDC 4JVLA 1L4YA 3NVAA 4QRHA 1JNYA 4G0NA 2H16A 1R8SA 2QM7A 1FFHA 5BN3A 3DOEA 3QENA 2ZRGA 4G5SA 4TZ6A 3HJNA 4TQUS 4EJSC 2ZRLA 4LJ8A 1D9ZA 1U98A 4XJXA 5J47A 2BJVA 3B13B 1RFLA 4X8OA 2PCLA 3AF4A 2GAAA 1YR7A 1DVRA 1SHKA 4RY2A 1QHIA 3FMOB 2OILA 2OO7A 4TTRA 1TTTA 1T0HB 2ZE5A 1R0WA 3AKEA 4OK6A 2R62A 4YXWD 4Q7MB 4HLDA 2WWFA 2V1XA 3K9LA 1V5WA 2YWEA 5TV2A 4LY6A 1MRNA 2B7BA 4M9QA 3ZVLA 1IXZA 1R5BA 1G41A 3NG1A 4M53A 2VLIA 3CONA 2ZRIA 3UMFA 4GZMA 4JLBA 4RFSB 1LTQA 2LKCA 4W5WA 1YRAA 1GUAA 1SVWA 1GG2A 2J87A 2ZJOA 4M1SA 4Q9HA 4P31A 3I72A 5L3SA 2F9MA 3BXZA 1XJCA 2K5UA 4GP7A 1NN5A 2YZ2A 3VFDA 4LGMA 5G40A 3R9IA 4DLXA 3F5FA 3W3AA 4TYNA 3PV0A 2WWIA 1Z2AA 1HYQA 1G7SA 2ZIAA 3FMPB 3M4YA 4Q66C 4TL9A 1TQ4A 2QP3A 5EP4A 1I4TD 1P2SA 1U8YA 4GT1A 2F6RA 3PCRB 2PJRA 2ERYA 1XEXA 2BC9A 2DB3A 2XJ4A 5AUOB 4WXPA 4G5GA 4XWKA 2OBLA 4NKRA 4IHQA 1M7BA 4OHXA 4US2R 3BIFA 2A2ZA 3WRYC 4PQRA 4DLSA 5DISB 5L3VA 1GRNA 5J5CA 5JECA 3TW4A 4WBSA 4L8GA 4URYR 2HDNB 4O25A 4OL0A 3PUZA 4U00A 1TADA 2XNDD 3CPJB 1WF3A 2WWGA 3F0TA 3KJHA 4NDZA 4ON9A 1COWD 3B1YA 2V7QD 1KDRA 2NIPA 4V03A 4RFSA 3RRMA 1E0JA 5B57C 2KB0A 2AK3A 2ORVA 2VHCA 3NH9A 3RS2A 5J4LA 3JZAA 3IILA 4MYUA 1WBBA 3ZVRA 4LC0A 3NBFA 3GLHE 3UWOA 3OFND 3I32A 3LX5A 1AKYA 2OAQ1 2QA5A 1GKIA 2H1LA 3Q7QA 2ZSEA 3GD7A 4DB2A 1E96A 2B6HA 4JYBA 4PAQA 3TIFA 3RS3A 2WJHA 3TKLA 1UBGA 2A5YB 4A4DA 2RH5A 2ATXA 5FR1A 2CVFA 4Q48A 2W58A 5JZVA 2O8EB 1G4UR 4C0JA 5KSOA 1CRQA 2CK3A 3RABA 4TYYA 3AQ4A 3TQCA 4RZXA 1D2EA 1T0JB 4FXPA 3B1WA 1MOZA 3KXIA 1GL7A 1KI6B 3C15C 3UPUA 1H8ED 4KFSA 3UK6A 4BGDA 4JIMA 3A1TA 3U6KA 3RS4A 2GTPA 4PR0A 2X2FA 2IUUA 1XP8A 2VP4A 3MD0A 3SZRA 4BFXA 1XRJA 2AD1A 4F92B 2VHJA 4Z1MD 4LJYA 4KITB 1KY2A 1ESNA 3QXHA 5JHGB 2OBNA 1E9DA 1L8QA 4G3XA 2CE2X 2JLZA 4PAMA 4DJTA 5BXQC 2ZUDA 4C0KA 2DBYA 5D3MA 4FMBB 2GBLA 5KDDA 4DB4A 4TZ0A 2NG1A 2QQ0A 3B9PA 2C9OA 2IBMA 4TL7A 5J40A 1GNQA 4EJSA 3H86A 4K81B 5TB5A 4A36A 3FE2A 3QI2A 4B47A 3WNDA 2NPFA 2R2AA 4QJ4A 1JI0A 2JLRA 2IT1A 3CPHA 1BMFA 1G64A 1W5SA 1AIPA 4P33A 3B78A 3A6PC 1W36D 1CR1A 1JXMA 1DAIA 2OZEA 4DLUA 2Q0HA 4Q1CA 4GRAA 1M34E 4NL4H 1QHSA 3AGQA 4JLVA 3TAHA 1E2MA 2BDTA 2LCFA 2WOJA 2WWYA 3DDCA 1DE0A 3RDPA 3OHMA 2OE2A 1TQDA 4L5BA 1KI6A 4E03A 2KWIA 1WXQA 2CCGA 4DKXA 1OIVA 2DYKA 3B1XA 3FVQA 4DUGD 1R0ZA 1IY0A 4Q4HB 5LB2A 2BHRA 4EAQA 3I62A 1N5KA 1XXHE 2IYLD 1WE2A 4HATA 3O47A 3PEUA 4WAUA 1WQ1R 1FX0A 5SZIA 1CKEA 4DCUA 1XEFA 3KQHA 5FOTA 4HZUA 2QQEA 3CRQA 5F2EA 4D4JA 4LJAA 5KNBA 4GNKA 1OFUX 2IEYA 2WKPA 5DLQC 4JL5A 3TSOA 3NC1C 4KLZA 4LHYA 1LNZA 5FPTA 3MLEA 4MA4A 1YZQA 3EPKA 3DVLA 1GWNA 4HLCA 3LBIA 1JAHA 5H1YA 1IOZA 1Q21A 5CLQA 1LFDB 2OHFA 3KXLA 1UDXA 3L0OA 1LS1A 1YVDA 2W6ID 3SFZA 1GZSA 3SYLA 1F5NA 1AZSC 4HB3A 4HEJA 2J0UB 2W2VA 3WMGA 2DR3A 3BFVA 1J8MF 5DI9A 4EPRA 1UEJA 4PQYA 3CR7A 3BORA 1WDTA 1DARA 2EYQA 2QU8A 1TUIA 4OQMA 4S35A 1K5DA 1OFIA 5K8TA 3BH0A 4A2WA 1QHXA 2EU8A 2I1QA 4MGKR 1S9DA 3HPQA 3THWB 1TU3A 3OIWA 5AJXA 1P7CA 2ZJAA 1HURA 1N5IA 2JLQA 5GJBA 2A9KA 2RGEA 4ESVA 1S9HA 1RIFA 1TF7A 2H8KA 4L15A 2OM2A 3BK7A 2W6JD 2J0QA 721PA 1NMYA 4Q4JB 2GEVA 4A9AA 1LB1B 1RJ9B 3IIMA 4AURA 3L2OB 1F6BA 1LS6A 1EK0A 1NVWQ 3M6AA 2GJKA 2QE7D 1QBKC 3FFAA 2HYDA 4ESHA 5HZHA 2AXNA 4JLJA 1OF1A 5JS8A 5CDFE 3U4QB 2OLKA 2QRZA 3R20A 1N2CE 4A82A 2BV3A 2PX3A 1IHUA 1KJWA 4EPWA 5KO2A 1JEDA 2RGNC 3ZVNA 3LBHA 5G41A 4FI3C 4M9XA 3THXB 4M9SA 1LVGA 2CL6X 1CTQA 1DO0A 1X86B 4A0FA 5UKDA 3LFUA 1KO7A 4PPGA 2D3WA 1F2UB 1CJMA 3P4XA 5ELXA 2JLSA 1Z83A 1VTKA 3T35A 1W49A 1NIPA 4DEYA 2C96A 4WW0A 3SJAA 4ZI3A 2RHMA 4H1VA 3IBGA 4LHZA 2AX4A 1AM4D 3LA6A 2REBA 1T91A 1UPTA 3RWOA 1NVUQ 2F9LA 2J0UA 4XTRA 4V02A 4PC7A 2IEZA 4D80A 2YV5A 3HYTA 4OHVA 3IEVA 1YE8A 3TR5A 2GA8A 2JGNA 2FSIA 3SHFA 2ZI3A 3CRMA 3PQCA 2O8FB 2VF7A 4B2IA 4XIGS 1N0UA 2D7DA 4FN5A 4IOLA 1P75A 4FCVA 1OYWA 2YNMA 4HLUC 5KDLA 3THWA 4ACBA 2ZYUX 2QSYA 2Z4RA 3KZ1E 1RPZA 2G6BA 1XJQA 3I3SR 3IO3A 4DLTA 3EA0A 2IYQA 1Z0DA 3I73A 1NJFA 2IYZA 4C3ZA 1E2LA 2B8TA 4Q7KA 1ZD8A 4Q4JA 1KMQA 2A5DA 4BPBA 2AFHE 2QRNA 2ZS8A 4M4SA 1RC8A 1DELA 2GXQA 4ZCLA 4ITRC 2WHXA 5GADl 1J90A 1ZNXA 2WJYA 4GZLA 1G7CA 4Q7JB 4QJ5A 1P72A 3X1DA 2WMOB 2ZRMA 1EFRA 3GJ5A 2P65A 4XSHA 4LOAA 3WXMA 3THXA 2VO1A 4IEEA 4MRVA 2Q9CA 2JCSA 3ZJYA 1GRQA 3SNHA 3FKQA 3CUEF 1OIXA 2ZJZA 1NVXQ 4QGAA 1W2GA 1QVAA 1E9FA 3KKPA 1KJZA 3QEOA 1OSNA 2WZQA 3WBKA 3EG5A 2Q3HA 2O5VA 1QHNA 2CMKA 2ONKA 3CNOA 4BWYA 4YQFA 2XXAB 1N25A 2ZR0A 3BH7A 3MMPA 4HAZA 4KLNA 1FL9A 1UKVY 3W3ZB 1VG0B 1CJUC 4JKYA 4F93B 1OFTA 2XOKA 3QF4B 1E2JA 4QJ3A 1W48A 2UZ3A 2ORWA 4D6PA 2NPIA 2ZXUA 1OXUA 2XAUA 3VKHA 3GMTA 3U3MA 4D81A 2AXPA 3TUJC 3U3JA 4AD8A 1VG8A 3MAAC 2WKRA 4MDEA 1OJLA 3LXRA 1XMSA 2EYUA 4GBMA 3CPEA 1T3LA 1VDZA 1GIAA 3DHWC 1HV8A 4LBWA 3SS8A 4ZI2A 3EX7C 1OH5A 1KAOA 2Q6TA 2FMXA 2HT6A 2GCPA 2FFQA 1IXSB 1G19A 3REFA 2AL7A 4QHSA 1IAQA 1E1RD 1AQUA 1ZRHA 3NEJA 4PX9A 2QL6A 1TEVA 1ZBDA 1P3JA 3V4RA 1UDWA 1E99A 3WP0A 5JCZA 1E69A 5IF9A 3R9WA 1Z22A 1EX6A 3U7FB 2H57A 2BBOA 1HT1E 2QMOA 3VX3A 1ZCAA 3SQWA 4QC2A 1W47A 3K0AB 2OCPA 4V0LA 1XTJA 2ATVA 3DZDA 3FFBA 5SZJA 3MWLA 2JJ2D 3TH5A 1FNMA 1Z29A 1XEWX 3K9GA 1Z2CA 3Q3JB 4JVSB 3RC3A 4HYYA 4EFLA 5CB8A 2YC4C 2JLUA 2YOFA 3K8YA 1LW7A 4OQFA 2Z6VA 4A8JB 5GJCA 1QVRA 2GCNA 1E9CA 5B2ZA 1E0AA 4CEHA 1F48A 4XVRA 3RANA 5FBVB 3ZH9B 4PZYA 2VH5R 1YZUA 2PEYA 1T4GA 2RGNA 5BW8A 3AKDA 4V0NA 1ZMXA 4IOJA 2R6DA 1U9IC 3UANA 2BCGY 3M1IA 4A92A 3QXJA 2QGZA 2GEDA 4OI4A 4FIDA 2BVNA 1NJGA 2WWXA 3K09C 5L3RA 3K53A 1KO5A 1KZ7B 2WICA 3K70C 1Q1EA 4B75A 3B60A 4FCTA 4M1TA 6Q21A 3OIVA 2ONJA 5FUYA 3RVBA 4RD4A 2IA5A 2GVZC 4TLCA 3VU9B 5FOVA 1KSGA 3KTAA 5JI3E 2QM8A 1VYUA 1MO6A 1XEWY 3KL4A 5DN6D 2F43A 1II8B 4FWTA 4XD7A 3PXGA 2C03A 4HLUA 4B44A 2EQBA 3WYGA 4PQFA 1ZINA 3W5IA 4ERNA 5JI2E 3S1AB 3TE6A 3GEHA 4OQNA 5A4JA 4U7DA 3RRNA 1KI8A 4CEJB 4ILEA 1GL9B 1KTVA 1E2HA 3EWAA 2JJ1D 1EGAA 4JVMA 1JQLB 2CLDX 3DMDA 2W00A 3ICEA 3PR1A 1ZUIA 2D06A 2V6IA 5FI0B 3M0EA 1X8JA 3O8BA 4P32A 1ZIPA 2JASA 5B64A 4RKEA 1Y3AA 4YMTA 2FWRA 2R44A 4YMUA 1PLJA 2B7CA 3K1JA 4PC6A 3FB4A 1N6HA 3C5CA 3TJZA 4AKHA 3EIQA 4IW3B 2JLXA 1J8YF 2GCOB 1UM8A 1VHTA 5TXGA 2IWHA 1NRJB 1UJ2A 2MMCA 2QUZA 4Q4AA 5IK2A 3NBYC 4MUBA 3AB3A 2FF7A 1XD8A 4OHWA 1H65A 3OAAA 1II8A 4JVNA 1VCIA 2AHOA 4B3BA 4PO9A 5FL7A 4AYXA 1E94E 4PZLA 3AF1A 1F3OA 3WY9A 4NMMA 4JLPA 2ODNA 1VYTA 4AY2A 3QXSA 2QAJA 3UATA 4HAYA 4D26A 1ZNWA 3GJ6A 3QPVA 3ZD6A 3R7WB 4LX0A 3RYTC 4XOIA 4P4UA 1VIAA 5K8LA 3DMNA 2PJZA 2FFAA 2AKYA 1EFCA
chains in the Genus database with same CATH superfamily
1VJCA 1UPBA 2X9QA 5K8CA 2VTKA 5JFGA 4FSHA 3NHPA 1V35A 2H2DA 2H3HA 5B2EA 4KO2S 2C2WA 1WY7A 1QZUA 2Q4RA 5HTOA 4KNYA 4DOMA 1PJRA 1DIRA 2VPWA 1FUKA 4G6ZA 1GQOA 2P9YA 4OFZA 5BW4A 5IHPA 2IH2A 1I0IA 2VP6A 1A2KC 3O9ZA 3VYUB 1GSHA 2I1VB 4KX5A 4XAQA 3ZHRA 1PX0A 4F3RA 3K9QO 1UFOA 3T0FA 1YZYA 5IX8A 2J4CA 2XUJA 4AC9A 4EG4A 5BW5A 3A05A 3B5IA 3K8OE 1JSCA 2AFIA 5KJFA 4YMSA 3EYWA 3UJ9A 1EDOA 2E5WA 1ZIXA 2E55A 4RPGA 1FFEA 5JALA 3BJZA 2IEIA 4O08A 3JASB 3IEMA 3QW4B 4R84A 3QEMB 3AEKA 3N70A 4UAVA 4E32A 1PEYA 4DV0B 3MPUA 2PD6A 3KSBC 5ES4B 1KYXA 1J0CA 1DZIA 1PEDA 2A1TS 2RDMA 1KDTA 3DHNA 3H4IA 3LFTA 5HEKA 3ZGYA 3KTFA 4CQMA 1M33A 2CNBA 1TA9A 3KK0A 2V3WA 1KEVA 1NYRA 1Z4PX 2WA2A 3EZ6A 4HDMA 4UJ5A 4ROSA 2ERXA 4TSFD 3UMJA 3V00A 1Q0HA 3IUEA 4YREA 4B6QA 5J2UB 2VAMA 1TKAA 3OETA 4LV6A 2CXRA 2GCGA 5EZYA 5LQJA 1N6LA 3U3OA 5HDQA 2G63A 3PZBA 1AKVA 1YBHA 2HMYB 1DCFA 4WXMA 4DZZA 1X7ZA 1I3OA 4LOLA 1BH6A 2CHVA 3GEIA 4G2NA 1BKYA 1L5OA 1OASA 2EJUA 2BEUA 4YECA 4B3SB 4WKPA 4Z0PA 4EA9A 2BTQA 1ADYA 1VIDA 2AE1A 3PXUA 4R0VA 3WIOA 5IEJA 1RPJA 4C89A 3DD1A 4V1CA 5REQA 1RZRA 2QVYX 4OJQA 5BT8A 1J2JA 2LP4Y 3EF0A 4UNRA 1R18A 2XLBA 4EYEA 4MV3A 2WVJA 5JLAA 2O6LA 3RBXA 3LQKA 2BGUA 4RJIA 3RG2A 5L51A 4DDHA 2VPXA 4A26A 1SXJD 3FDJA 1AF7A 2A7QA 3WYEA 5JARA 4TWAA 1F9AA 3G88A 2A9RA 2XVYA 1XD2A 3P2KA 3EZFA 3I6BA 4C88A 3ND7A 4G4GA 3ACDA 4FHGA 1BG6A 1BMFD 1R4NB 3MW8A 3OM0A 4NYMR 5B6IA 1LDEA 4MUMA 3FPSA 3FKSA 3QVXA 3OA0A 4NR0A 1AQJA 2DFKB 1ZUHA 3L1IA 1ORWA 3HU3A 3QG1A 4UEOA 2O8DB 1PIWA 1EX9A 1YJXA 2DGDA 3OT4A 1BO6A 3T1TA 2HLPA 1G17A 3HO6A 4RGBA 2JBAB 4BO1A 3QFCA 5JRJA 1BWQA 2WBLC 3KOWA 4F9FA 3LP5A 5JH7B 2CFTA 1QTIA 4RKQA 3ZDAA 2PGDA 4QU9A 4EG7A 1WSAA 5ALFA 5EPOA 3EXIB 3OQOA 3DJFA 4MPTA 3ESYA 2C0CA 4MKGA 2M6LA 1DQSA 2F64A 3G82C 5WRFA 1DL5A 1NXQA 2AQIA 2Y1DA 4DV3B 4Y18A 1SXHA 4IWYA 2PYZA 2RCYA 2W2LD 4WWHA 4M99A 3ZLVA 5F51A 3RAGA 1A9SA 5IHXA 1JMVA 5TRTA 3SIWA 3AHCA 1J8DA 1KI9A 3EN0A 3PGXA 5BOVA 2FX2A 4CM4B 4Z2AA 5CB4B 3V1LA 2PO7A 3ML1A 5K1ZA 1W52X 5C4GB 2UKDA 1CLUA 1XTZA 2CL5A 4RQUA 2C4MA 3WTCA 2MCFA 2PH1A 3TSYA 3NO4A 1C3OB 1HQKA 5CW1A 4MGZR 3BXFA 1JHOA 2JI9A 2ZJ5A 4L9SA 1M2EA 1Z13A 1ZYUA 4U5QA 5LCXA 1NIJA 1ZHHA 3R6TA 3RVLA 1D5WA 4S0ZA 3V34A 3QG5A 2C3PA 3HU5A 1VSTA 2DQSA 1XIVA 5KU1A 3EBPA 2XQFA 3P19A 1LI4A 3I34X 1DNPA 2H2AA 1H1LB 3RU9A 2ZYIA 2QTBA 1NVGA 4C2UA 1KBOA 2Q45A 2VYND 4KN8A 1PWYE 2UV8A 4HVLA 2FEWB 3DBHB 2GM5A 1G8SA 1RYDA 4POOA 1Q15A 5IG2A 5E1OA 3VMFA 3E84A 4RWZA 1D03A 2D2VA 4GD3Q 4DCOA 4BNGA 2YY7A 2VDMB 4RADA 4Z1OA 3AXSA 3IT1A 3MRSA 1RLJA 1YDEA 9GPBA 2DVMA 1TJ5A 2PSSA 1L4BA 3ZEIA 3RAEC 3VKUA 2OOSA 1GSOA 1CY2A 3O1LA 1V96A 2G4VA 3OZRA 1P62B 4DBVO 1E2QA 2ALJA 5JQGF 3ZHCA 4JYAB 4M7PA 1ZA1A 4I8IA 1UIRA 3UK2A 2CDCA 3FVWA 1YJ8A 3K6KA 4DM4A 1YI0A 2VWPA 3FVRA 1RQPA 1DZ3A 1WU7A 2OV2A 1N7HA 5K0LA 4L08A 4X6XA 4CKXA 3T1OA 4RPCA 3W5VA 4RENA 4GQIA 5AI5A 3BT7A 1JJAA 2P1ZA 1P7VA 4H3HB 4KQEA 2H2IA 1N7IA 3D6AA 3GP5A 2YWHA 3RIHA 5KQMA 1J24A 2YMPA 2ZUEA 4HEA6 3FWKA 2Q5LA 3AJDA 4MV1A 1PF7E 4S12A 4TYWA 1VE9A 5DNAA 2GCIA 2QV0A 3AY0A 4DABA 1OXVA 4BOYA 4LF4B 1P81A 2O6HA 1PQPA 3MLAA 2HMUA 4LBZA 3RBAA 2Q5CA 4ZO4A 2R68A 1ZLYA 4TTTS 2XT6A 4R5MA 3W5HA 4HFRA 1GGFA 1E0DA 4YPVA 3VNVA 1BDJA 2ES4A 1E1NA 1E3TA 3NR2A 2ZBFA 3EFOA 2F55A 3GQBA 1CQPA 2GJSA 3A6LA 2XUAA 4O2RA 1JIXA 3IRVA 4MI9A 1U63A 4X1OA 6NULA 1DBPA 2CMDA 3W5JA 3VRHA 4PAWA 3GEGA 2LWIA 1DG1G 2Q6OA 1CRZA 4HMPA 1SB9A 3RAPR 5A5FA 1ZGCA 2R7MA 3IPYA 3JALA 2F3QA 2HM7A 3AOEC 4HYQA 2NVUA 4RHEA 1MRSA 4EITA 3EGWA 1IEQA 4N5LA 5FV7A 4BO9A 4NOKA 2Y71A 4PSCA 2OQ2A 3R2JA 1KC3A 2NO9A 3ROXA 3GCZA 1JRLA 4DN6A 1ZG3A 2EP7A 3I42A 4F38A 1ISHA 4IL5A 5KAMA 5LDDC 2D62A 3D6JA 3E3OA 4P3NA 3VTZA 1W94A 4Q21A 4O5OA 5FB3A 2Z5LA 5JSUA 5AW3A 1FVFA 3GNQA 1KTIA 2O8EA 3IUSA 2VHQA 3EAQA 5IC6A 3HDJA 2L82A 5LL6P 2R6AA 1Z4KA 2ZSFA 1X7DA 3BWYA 4CU5A 1SIWA 4I3FA 4PLZA 1Q7EA 3Q11A 3GEDA 4KFUA 3D8HA 4HGOA 4NZZA 2G28A 4WINA 2FZ4A 4WOJA 4D57A 4ZU3A 3PC7A 3SQNA 2QN1A 1MABA 2ZTHA 4K2AA 1N8TA 1EUCA 4G85A 4LYFA 2WVGA 1LV7A 4DBLC 1U1IA 4QDOA 3LYAA 2E85A 4NONA 2VHUA 4QUJA 5EXTA 4ND7A 1O87A 1ULAA 2A9PA 1ZK4A 4RIFA 3DMHA 4XARA 4ILKA 1E98A 3G5UA 4OTZA 4F97A 4I99A 1O94C 1H23A 3KQHA 3TQSA 3H5RA 1HL7A 3FHLA 4EFNA 5K8UA 3OFJA 4OJMX 3WIDA 1NTOA 2I3BA 4EB6A 3EPPA 4EQ6A 1I32A 2ZDHA 3OLVA 3NGLA 1L5VA 1G8FA 2YRXA 5I8WA 2A7XA 2P0AA 2JPDA 2DRIA 2QOEA 3LS2A 3O95A 4B1FA 1E6CA 3LPNA 1YBAA 1BFDA 2PRKA 2RGCA 1MBZA 2ZWAA 3PUXA 4BBJA 1WSWA 1CJSA 4GVPA 3WYFA 1CP2A 2BEWA 5J23A 2FZ5A 4GXTA 4Z0TA 1J06A 2FRDC 5FAXA 4J1SA 2EXXA 1N0HA 2WUVA 2XBUA 3EZ2A 3GXOA 4FFVA 2W11A 2DBZA 3NTQA 2H63A 5AJYA 4QRIA 2K87A 1DMRA 3FF1A 2X0KA 4JBYA 4NNJA 4V0RA 3UY4A 4BNUA 4Z9AA 3LQQA 1P6XA 5CLGA 2HFJA 4LTNA 2E1RA 5D85A 4HX5A 3RVRA 5AKLA 1ISJA 3Q4GA 1U0HC 1O1YA 1TYZA 1NNEA 1ZMBA 1J0XO 4NH0A 4ENRA 2INGX 1DRJA 1A9XB 1ISPA 2BMVA 1YMVA 2RKBA 2ZQYA 1UEIA 3FD8A 3HNPA 2FR8A 2GYWA 3B6JA 5ENZA 4B31A 1SUPA 1R12A 3R3SA 1V6SA 1AUXA 2VDJA 1QB7A 2QX6A 1KYIA 4MAAA 4CKCA 4FUQA 1EDDA 2F8LA 4J0HA 3NFRA 4QM7A 2G1JA 5A4FS 1AGPA 1EVZA 2RGYA 3QV1A 2PKCA 2BP7A 2NO1A 1PQYA 1KMHB 2HL6A 5FOSA 4BLRA 3QKWA 3O5AA 1GM5A 3ASZA 4M1QA 1BAPA 1OJ7A 2D13A 5K09A 3U13A 4PINA 4MV6A 5A3SA 4BMZA 1YJCA 2H51A 1C2TA 2JBHA 2R6ZA 3PHJA 2N47A 5KVSA 1VPTA 4RJTA 1GVNB 2AOTB 3I2HA 1LF0A 4J0CA 4MTCA 5ALQA 3V1YA 1CY6A 2JIOA 1A95A 2RHOA 1GJRA 4PZ0A 5IVHA 1W44A 1KQNA 1QF9A 3DCIA 5ALTA 5KJCA 5EJAA 4B7AA 3HBJA 3E9ZA 3K2BA 4FYWA 1K27A 2AC4A 4XXHA 1U8FO 4MVCA 3UH0A 1NX6A 5DTRA 1A7UA 2PFKA 2PZJA 3L04A 2Q62A 2QBYB 1H0RA 1NW6A 2BL4A 1J09A 1HFJA 3OZ7A 2B1IA 4HFMA 1ORDA 3F5DA 3M4NA 2I4MA 3CN9A 5FTWA 5C1IA 5CXQA 2IS2A 5CA1B 1OLUB 4X8HA 2W7TA 1JPJA 3LC2O 2REXB 3MCTA 4HWRA 3H2HA 3IAAA 2VTVA 2AN4A 2WNSA 1XU9A 2J3IA 3AINA 3LDFA 3ILYA 3A10A 1UH5A 4BQNA 4AKGA 3VPDA 4LZWA 1TFUA 2AF3C 2ZJFA 2ATIA 2FF5A 3FNFA 1KC1A 1TLLA 3NPMA 4KUHA 3KLOA 2BKXA 1DTWA 1PBTA 4AMYA 1E5LA 1Z6GA 1G38A 1XX6A 5EXPA 2QAGB 1XCPA 4DT1B 3GJYA 1E6KA 2B8NA 2UYGA 3PICA 3MWFA 2IKSA 4DUPA 2WM2A 1FDUA 2CUZA 4X0EA 1T8SA 2HHLA 3DTVB 4MULA 5B4UA 2CMHA 3KOXA 3N8IA 5LBIA 2Z5VA 4UUOA 2XB2A 3QVVA 1N34B 4QFCA 4TXLA 1SOUA 3IUBA 5MFZA 3GK3A 4L57A 1P29A 2QW0X 2IEDA 2JI7A 3AHIA 3HU1A 3N2KB 4GPEA 4P7FA 4Y6LA 3T5DA 1YJQA 3WB2A 2OESA 3MGCA 1FNBA 5EYPB 1FLDA 5JJCA 2Q0QA 5C9ZA 4YGYA 1U5BA 2JB9A 2RH9B 4LJ4A 1IQRA 5GONB 3KU1A 2GK6A 2FEMA 1MH1A 2WSYB 3A1WA 3U61B 3H8VA 3A28A 1M0TA 1XP5A 2YZGA 1GQ2A 1H2YA 1WHTA 2R86A 2XA2A 2ADMA 3BJRA 1S2DA 4Q1EA 1JS1X 2FEAA 3FTQA 3TQQA 1JFFA 4FCWA 1UKYA 2YWRA 1VMIA 3STYA 3F90A 4XYMA 3D3QA 2JC3A 2KPOA 4GL4A 2H07A 2DPGA 3DBOB 1YMQA 4NBLA 3TD9A 3ZLBA 3KWJA 3ORSA 4GZ6A 5HK8A 5TQ0A 3TWOA 1XA3A 2VF4X 2WWHA 5IJAA 4CKWB 4NV3A 3WWDA 5DHPA 1ADBA 1TYAE 2QL7A 4JQCA 2BMAA 1VKHA 5IUNC 3IHWA 2XNSA 4KXYA 1E66A 2NVWA 4P3YA 3AIMA 2FWMX 3HP4A 4KXUA 4DLPA 4K3VA 3MCUA 1ZM2A 5H59A 1R0LA 2R6CA 1PR0A 4KDEA 4WESB 1QOPB 1XTIA 3FKJA 4MV7A 2XZPA 3EGXB 4AZ0A 4X7RA 4DMLA 3B7WA 1RCTE 2L2QA 3K0FA 3SJ7A 2PPVA 1RQNA 4KDCA 5AK4A 2AN3A 1K66A 4TOIA 5IC5A 2HHJA 3VHXA 1WA5A 2ZT7A 3WYCA 1N32B 3KKKA 4BGVA 4MW0A 2P7HA 5FJIA 4EHFA 3ADBA 5FUBA 2XUIA 5CCXA 5K3CA 2FRVA 2PD3A 2W2OA 2P91A 5CT9A 1Z5GA 1XSEA 2I4RA 4B4OA 2Y9MB 1ZJ6A 1T5DX 4X93A 2XCTB 1J99A 1EE9A 1YIOA 1C1YA 1L5RA 5E1BA 5K8IA 3QMMA 1QTRA 3MTBA 2EKZA 3PL1A 3JAWB 2DBVO 5C51B 3H5TA 4D4MA 5D8DA 3LZCA 2GZAA 4MYHA 4P08A 4KE8A 5C81A 1A8SA 3HKEB 4UUPA 1UQRA 1P5FA 3GUVA 4IJUA 4QUGA 2J7KA 5D00A 4TROA 3OWHA 1IZ8A 3TFWA 3TLXA 1BXGB 1QK5A 2B82A 2G9QA 3K0CC 4QQNA 1J2TA 3RBVA 1UAAA 2O8BB 2I4TA 2RJ3A 5DWVA 1PS9A 4DCPA 1NXTA 4BNDA 2DJ5A 3E0XA 1WXHA 2IZ6A 2W2XA 3GMIA 1CR4A 4LY0A 1MJHA 1PL8A 3OEWA 4ZVSA 1T3SA 5JVDF 2PD4A 2CLMB 1KFJB 1RZ3A 3VJMA 4BO2A 2JZOA 1D2RA 3LHSA 2WZCA 4PZDA 3EUFA 4KO8A 5IJ0A 2HRCA 4LZOA 4U5XA 4AXXA 1Q20A 3DLCA 4FW9A 4LKRA 1R1DA 2O06A 4C07A 2NLOA 2O8VA 1VPWA 3D4BA 3A8TA 4MQBA 1B26A 2Q0SA 1MB4A 3DV0A 4O2BA 4E11A 5TMDA 1NKSA 5L53A 2W6JA 1MKYA 1OHHD 2WD8A 2Y1CA 3D7LA 3HKBA 4G4JA 5LA6B 1I7QB 4DSZA 1EMDA 3K94A 1L1RA 1SHJA 2O2DA 4BU0A 1EX7A 4OI0A 3UGQA 1P4AA 2EARA 3AVXA 3EVBA 3KV1A 1T9GR 1J2EA 1FQKA 3EQ8A 4HNAB 4U3JB 4C0AC 1YTUA 1YRBA 2QPLA 2EVWX 4MW5A 1PJQA 2D2EA 3U60B 4URUR 1FMJA 1JECA 3OKCA 2XRZA 4Q7LA 2OQRA 1E6LA 3QF4A 1QQ6A 3L0YA 4GMHA 2EKDA 4NG4A 1NUPA 4U4AA 3C3BA 4IXNA 2HXSA 4XQGA 1ISRA 2ZUCA 4WY8A 1JMKC 4DF3A 3A6EA 3CS3A 4N18A 3CE6A 3LHKA 1EM8B 3OOYA 4KE6A 4OB7A 1ZICA 4W99A 4RZUA 2HPZA 3TVDA 2JGDB 2AG0A 2AGVA 3GFRA 3HY6A 1HZZC 3ND6A 1L3CA 4PGAA 1C3JA 4WZAE 3REGA 1V5EA 1KY4A 4EW6A 3OBIA 4II7A 4TV8F 3QTBA 4KVGA 1AGNA 3PX2A 5F5LA 4CMHA 1LPAB 2ZM6B 5L7TA 4EPYA 4LHWA 1FE8A 4JOBA 2QI9F 2YW9A 4GPTA 2YFQA 2ZVJA 2HZ7A 2AOUA 3OLCX 1E1CA 1QIDA 3WYBA 4RMGA 1ML4A 2X8BA 3FCAA 1D4FA 1G8MA 2EKPA 3HS3A 3L92A 2RGDA 3F6PA 5D2CA 1QO7A 3E9RA 1Z0UA 4RCVA 2IYYA 3Q40A 2H1VA 3UFXA 3OQBA 3OOHA 1PI3A 4RO0A 3GPIA 3S8MA 3OPYA 1OAOC 4UXJA 4EJ0A 1Z68A 3PDCA 2CVOA 1GCGA 1WUJS 3K0AA 3RSLA 5CB0A 2BKUA 2X19A 3E3MA 1FA9A 3HCCA 3MUFA 5HMMA 1HC7A 2PLWA 3ELWA 3FCYA 1KERA 1LX6A 4HDKA 3ZV3A 3I92A 1JTVA 2OEPA 3L8CA 3L8DA 1I2DA 1X1SA 5G0SA 4P0TA 4X54A 4P0QB 1CT9A 2ANBA 2V7BA 1U3FA 2Q4BA 2FAXA 4PLVA 4CTMA 1V5GA 3DTTA 3EZ7A 2WT8A 4UKDA 4A8JA 5TIIA 1J0AA 4A6PA 1DXYA 5A0VA 3GZJA 2RHRA 3I2YX 3VDNB 3WRXA 2JKYA 2GNOA 3TLEA 4EGSA 1RLMA 1RLIA 5JNVA 1PL7A 1EP3B 4WCDA 4K9NA 1N0VC 1T6BY 2CUKA 3RTGA 3NQ41 2IY8A 3IEXA 4Q4LA 1L3BA 2E1PA 4GUDA 3HN2A 4LWOA 5HTKA 4BX2A 3D2LA 3P2EA 4K03A 1HT2E 3HJTA 3R7FA 3TRKA 1N9KA 4TMWA 2L17A 1EK6A 3MHTA 2PMCA 3DHYA 1C8BA 3EBLA 3DONA 5KWVA 4JUFA 4GM0A 3I9OA 1WHSA 4V24A 2BEKA 3E5RA 1PBNA 5HILA 3S2SA 3DP9A 2HW8A 2ZBEA 1U7DA 2HFKA 4YRDA 3FY4A 3BZBA 2BFFA 2ZUBA 3V5NA 2CXPA 1TYDE 4EI7A 5DTQA 4XM2A 4EG0A 2XMZA 4IIXA 1QAMA 1SUCA 1K63A 3AF6A 3HM2A 2ZB2A 2O7RA 3O4JA 4U2CA 4V0SA 1L1FA 1XMQB 2VNIA 3FJ1A 3LL4A 4RYDA 3BD6A 3F8SA 3EYAA 5JASA 3PGJA 3HWWA 3INGA 4F72A 1YJ5A 4QYTA 5E0OA 3RM3A 2OZLB 1VL5A 1THGA 2O7SA 2Q07A 3R3XA 4OOFA 5LWHA 2V6JA 5E8JA 2A33A 3A36A 4IGEA 1BD4A 4JHLA 4IIYA 1Q0TA 5CB6A 4WOCA 2CXNA 3WLTA 5JQWA 4ZREA 2WG0A 4QSMA 1EVQA 1GZUA 5KX5A 1NVMB 3G9QA 4R9SA 5M7EA 3CZ4A 1HE1C 2YFYA 4LXXA 3ZI4A 3EPHA 2I87A 1ZC4A 3CLRC 3OX2A 4BVBA 4ZEMA 1XXHB 4ZDJA 2ZB8A 5AXAA 3C8ZA 2KLHA 4RH0A 4IIUA 3UHJA 3TW8A 4E13A 5LIRA 1IJFA 3UT0A 4J0GA 1II0A 4LWPA 3BMNB 4I7EA 2PL3A 3FBWA 1J07A 5FPPA 5BP7A 3DAGA 4QUKA 5EUMA 1ZEJA 1Y7LA 2JIMA 3NHYA 4KZPA 3VH2A 4LGVA 4D97A 1AMOA 5G0VA 1WS6A 1VBKA 5FOQA 2KJQA 3EQ9A 1QE0A 2NXEA 3NATA 3P0IA 3S40A 4OHCA 4FGUA 5DBIA 3AMVA 2XQVA 3Q2OA 3QJ5A 4DBLE 2C78A 1LPPA 1JDZA 1BEEA 5ITZA 4D9JA 1MQAA 4QBKA 4UPVA 1BN7A 4DV4B 4W5OA 4DV1B 5B3JC 1XO1A 5DTJA 3ZCQA 4DTCA 4X60A 1ZC3A 4QU8A 2OGTA 4PX3A 4JJFA 5AJHA 4NZYA 1L5SA 5AM3A 1M1UA 1NVKA 5DWDA 1N6RA 4LK3A 1RMTA 2CNLA 4HEHA 4LX8A 3FOEC 1MR3F 1W1UA 1EE1A 2J4FA 4ZEXA 2IUEA 1HYHA 4HBZA 1RYMA 2C42A 3KB1A 1R10A 1T34A 1ZIOA 1P1CA 4H3SA 4DPMA 4MA0A 4AJNA 1I4DD 1IG3A 5AW7A 2Y66A 3REQB 4A0QA 3ORQA 4PFSA 2CJWA 1IPEA 4TMVA 1RMYA 4WSOA 4ZOCA 4BJ1A 1X80A 1TT5A 3BIJA 1KKMA 2MT9A 3HVUA 4BFUA 3A9VA 3FMIA 2BAGA 2ZIGA 1X70A 1TKCA 1PQWA 3MEQA 4TLDA 2I4NA 2QMHA 3TIXB 4JLOA 2J9ZB 4DQKA 5KQRA 3AILA 5CH5A 3G85A 4BQPA 1CDZA 1ZS9A 3SU8A 3LAWA 1NV9A 4OQLA 3JQFC 1BXRA 4ZAFA 4RY8A 3IAHA 5CVEA 2IHNA 1H2RS 5BRJA 3K9CA 4RMJA 5LMUB 2H7VA 4UAGA 4N3NA 1EFAA 1RU3A 3FNGA 3AL0C 1L7BA 2QR2A 2WU0A 1TLFA 1TQ8A 3LO8A 5A5DA 1CJVC 4IR7A 1PT6A 1NW5A 1NU8A 2G04A 2O0MA 2REOA 4EVRA 2CNKA 1DAEA 5DOZA 5AK6A 1H05A 4BZXA 1TT7A 1KIMA 5HS4A 1T5IA 3LRPA 4B7UA 2QMEA 1AQLA 3OCYA 1GU1A 1SRRA 2ZSUA 5B1IA 1DBWA 2WTNA 1LX7A 2YJ5A 4M0EA 1XEXB 3PITA 4E14A 4ZYTA 3T5AA 4LXYA 2BKLA 4YAOA 2C1EA 4JLKA 2QUAA 5CG1A 5MFPA 1G60A 2WIBA 3A4MA 3WLNA 5KHAA 4BRSA 4II2A 3D3WA 1BKSB 3H9UA 1ZO8A 3NTRA 2X1VA 1UBMS 3NRCA 4CTOA 2YZNA 4I14A 1SBYA 2DKFA 1EFUA 3DDUA 1E79A 1JIKA 1QHHB 2I6TA 3M6LA 4L4XA 4UMFA 4S1NA 4DCGA 1EGMB 1P1RA 1KAMA 1II9A 3F7OA 4M1WA 4UE6A 3WDSA 3HHEA 4JI4B 1NE2A 3USES 2QTZA 4JUCA 3N7AA 3UQZA 2WIKA 4PGGA 3PGLA 1LFAA 3FPHA 3LQRA 2K2WA 3KB2A 1VC2A 1QGOA 3ECSA 5JCXA 5MN6A 2DETA 1F8XA 1CVRA 5ADWA 2G9VA 3MN1A 1LF5A 2C4TA 3RR2A 1XF1A 4RZ3A 3TVYA 3NHAA 2VOJA 2Z30A 1P9WA 3CW8X 3PD1A 1P8AA 3CF0A 3PWTA 5KNLA 3QKTA 1VLJA 4UHBA 2Q1TA 5IN4A 2CKDA 3L6EA 4R1UA 5KYKA 5ALHA 4QGSA 4HUTA 1CY4A 1C0IA 3OJ0A 4H9GA 3VO9A 4FPXA 5F3WB 1FFGA 3TZBA 3DUFA 3D6MA 3T0IA 3EC7A 3BMOB 4BWGA 1KSJA 4N0EA 1RYFA 3QELB 1LC0A 2QUBA 1U4SA 5A9SB 4OUKX 2CXXA 2G36A 5HKKA 5FOXA 3I01M 3UPTA 5K45A 2J3LA 2Q28A 3ZY2A 3G8CA 1UF9A 1F2DA 4QNNA 2I3GA 2WJVA 4EPWA 1FOEB 4JHXA 1L4FA 4HK4A 3DMTA 5IRCD 1QVVA 1E1DA 1KFEB 2UZ1A 1PN3A 5JC8A 2G06A 3RWMB 1FXUA 4GX2A 5JDIA 4BO7A 4HKTA 4RSRA 3MWEB 2NO6A 4EYKA 2NZYA 4IFEA 4C5BA 2H08A 2XQKA 3P2JA 4QE3A 2P69A 1NR5A 3ETNA 5AOCA 3TI9A 1KU6A 4RS3A 5EFZA 3QI7A 2AW3A 2R85A 3ROZA 1DDGA 3T7KA 3RTCA 4Y98A 4JCCA 3FOBA 4ZT4A 3EHEA 3KDAA 5IDVA 3SZLA 4QSHA 4YACA 1R0XA 1W29A 3RC1A 2D4HA 5EIWA 3ZIAA 1RSZA 3ZIUA 4C0HA 1UJMA 2IC5A 2VBFA 2ZTMA 5KTPA 4MW6A 2OL4A 2VRCD 4ZRNA 5D3MB 1BSVA 1HQYE 2OGSA 4HQ6A 2ASEA 4HDRB 1M2OB 4QU5A 4QBTA 2OY0A 3EVCA 3GLQA 1S2MA 5DHTA 3AVOA 1ZFNA 4IQ4A 3LGSA 4EJSB 1S8NA 1QR2A 4XDHA 1JFTA 4KQ9A 2CFSA 1CZLA 2HWWA 4Q24A 2ZSIA 4CMKA 1RBZA 5AXCA 3BMQA 3FLEA 3QPDA 4RD1A 1KOFA 5E0KB 4IPTA 3RO7A 3SHOA 3ZU3A 5CFPA 4KJZA 3A4LA 3GR6A 4U6QA 3V32A 2A57A 2FOXA 4BCCA 2J3KA 4WOBA 1FZTA 4DM3A 2VYFA 2AG6A 1QX4A 3CH7A 3JQCA 2D5LA 4FIZA 5HF8A 3IQXA 3F2VA 3I58A 1A9YA 1E1LA 1YDWA 1RAHA 2IDMA 4BFZA 4Z4QA 2ODBA 3G5MA 3KD2A 2YZ7A 5AOAA 5DGIA 4PTLA 1ND5A 3IHLA 4I4CA 2DSNA 3MGBA 3T61A 1X8XA 1FVHA 4X84A 5T41A 3GY0A 4RSMA 2NU6B 4LS3A 1PZNA 1GEGA 3SBDA 3C5HA 3EISA 3L6RA 4Q7QA 3D0QA 1YZLA 1BX0A 1XI2A 3L4JA 1C3LA 4X95A 4GOXA 4IIJF 1EFVA 5JAIA 1OBHA 4ZCIA 2FE4A 2OHOA 1RZUA 3DVRX 1U94A 2GZMA 3GFQA 4UMEA 3E8MA 3F8TA 3QH4A 2FUEA 3ODGA 1UOOA 4RD2A 4D02A 1Z63A 1WKCA 2IHVA 5C3UA 4LF5B 1DEOA 2X8AA 3F47A 1C4KA 4QDZA 4RVHA 5KTKA 1LNQA 4JB3A 4HB0A 2M6RA 3DPIA 3OTIA 4J8PA 4A2QA 3WGGA 2XCOA 3U5ZB 4IIFA 1W8DA 4B40A 1NJ5A 1SVUA 4BLPA 2FN3A 1ZWKA 4PHFA 2RARA 3E81A 3UG7A 3ZJ4A 2NXWA 3A1FA 1APBA 1RRCA 3QUBA 5CFOA 4R8LA 3LPLA 3TUZC 3I0NA 4M8LA 1BD3A 3S99A 1CS4C 1O03A 2XMGA 4F06A 1FUUA 3MCWA 2BEVA 3L01A 5ALDA 3ILHA 1JH8A 3EDOA 1Y5NA 2IYVA 3BGOS 4LJ7A 4Y1FA 3D5QA 4BVHA 1T2DA 2D1RA 3GNLA 4TKMA 3MWKA 5BQXA 2ZSJA 5DPMA 2R751 4G8JA 1N6PA 3IURA 4CM1A 2ADFA 3SD7A 2NSHA 5FEUA 4NXNB 2QAGC 1JSRA 1EJ2A 4Q93A 3UUEA 5KNCA 1EXMA 1UBRS 1W7AA 5LSAA 2HJGA 5EI5A 4YONB 2YVKA 1H2ZA 221PA 3R5FA 5HVNA 4FZ5A 1KNXA 3DEZA 3U7GA 2VJMA 1MQSA 4HFNA 1YOBA 2I2DA 3TQRA 3TAXA 3B2NA 1H5NA 3ZU5A 2VZ8A 1YRWA 1Z35A 3B2QA 4OJTA 4PPYA 1RCFA 1RAEA 4IJMA 3L0IB 1G1MA 3I30X 2DF8A 3LLVA 4LJ6A 1O89A 4MMYB 3QFSA 1RWMA 4TMKA 5FL3A 2DZDA 2VNAA 1FFWA 3OOSA 1ZISA 4K26A 2V0CA 2VUTA 4P93A 4UPDA 3R09A 1AKMA 2WU1A 4XPZA 4YO7A 5H0IA 5JVDB 4MK4A 3TL6A 2A59A 2I2WA 1E6WA 4Q9JA 1V1RA 1RJFA 3VR4A 4H2DA 2BE7A 4HRVA 4JI7B 3EDMA 1GAJA 4F1JA 5AW4A 3A6FA 1PP4A 4I9FA 4N0DA 4ZVTA 3SZMA 5I7VA 3HABA 1QDEA 3IUNA 821PA 1BVYF 3PPVA 3H4VA 3WV4A 2AW5A 4DREA 5EJ8A 4RVOA 1SRQA 2YOGA 3O8QB 3Q72A 4HJRA 2J9RA 5IDXA 1SUAA 4EMSA 3OTQA 1X87A 1M6VA 2B3TA 1LDGA 1Z5OA 2ABWA 3CIOA 4IDOA 2XOKD 2X15A 3OT1A 2WG1A 4E07A 5BSEA 3I4LA 4FGWA 2YXPX 4RVDA 3PKJA 1ISIA 2ZYDA 1KY3A 1SHLA 4B2PA 3ZHTA 1R9JA 4JLDA 2P41A 4QFMA 2PKQO 3OEHD 2WM8A 3LO5A 4QO8A 3I39X 4URHA 3OIFA 2CDRA 1G8GA 2ZU6A 5ICSA 1DAKA 2P8JA 3D8SA 3HUEA 3NHKA 2X0JA 4FEYA 1I7LA 5F9MA 2V7QA 1QIKA 5IABA 2XRMA 3ZZNA 4WCFB 1WMEA 5EFOA 5CYPA 2C8LA 1UJCA 2B21A 2W37A 3D31A 1CVLA 3FROA 4A16A 1FBNA 3OZXA 4JLNA 5EERA 2WQ7A 3EZYA 1I9GA 3OFNA 4LDNA 3SKVA 3W2GA 3WLAA 4EKDA 4DIKA 1JKMA 1VJ5A 4M8IA 3J7AC 5ALRA 1O77A 4ND4A 1Y6ZA 3WK6A 5H7XA 3FZQA 4JBHA 1EWRA 3HDQA 4FMDB 3Q9NA 4Z8YA 2YWCA 4JJ6A 3P1JA 3HP1A 3T12A 1D4OA 1MUUA 4R98A 2BMEA 4A8PA 4EM6A 5F9HA 2GSWA 4RMNA 2QL5A 1EQAA 3IR7A 2QQ5A 2VT6A 3OT5A 2HUPA 3UXYA 4AROA 1X1RA 3ZHQA 2QQFA 3HDGA 3A37A 2DQZA 4MITA 1OOEA 2DHQA 2H31A 3BWDD 3FZNA 4G9EA 4R40A 5ULLA 2GNAA 3HZOA 3WB9A 1GPKA 3L7IA 1BJKA 3LVFO 5BSHA 3SSAA 1RWKA 5LOVF 3GLIA 2BD0A 1PLLA 3PVSA 2PMKA 3BXGA 1Z39A 4G5XA 4NAHA 5BN4A 2WWVD 3O9VA 1T8UA 4KVAA 1WB9A 1BE6A 4HWKA 3V8QA 1NJ1A 1ONNA 4X7BA 1OX4A 2F8MA 3DMFA 3CZ5A 4FYIA 2BKEA 1KZYC 4YLYA 1I14A 4NX2A 4HQFA 4OX9Y 4JLSA 5EE1A 4MO2A 4ZV4A 2K4MA 5JSQA 3OBBA 2BI8A 1PK9A 1XFAA 2GD0A 2QIOA 1EPUA 1E3EA 3JATA 2TMGA 4KACA 1M1YB 3A6JA 4MI6A 4OHMA 3L7YA 4FM9A 3FVVA 4Z4FA 2IS4A 4OYRA 5JLJA 1JR3A 1MC4A 1W8IA 2C04A 3TBKA 1B16A 3ENKA 4JITA 3WKAA 1MAHA 3KWMA 1QXSA 2IBTA 4W9NA 1JLSA 3B9QA 5F1OA 2XMSA 4L8WB 3RG8A 3ZLUA 5CDYA 4AQ7A 4K1XA 1I0ZA 3ZNNA 1XHFA 1P80A 3COZA 1AS3A 1IJBA 3DZBA 3J81A 1R88A 2XUKA 2NTJA 1DDIA 1O9BA 3KUDA 4IDEA 2VWHA 2AMJA 4LG1A 4M54A 4TUYB 4QVKA 4AS1A 4FYYA 1DP4A 4L27A 3CVWA 5K6TA 2QYTA 3BCRA 4L22A 4R81A 1ILWA 1IM5A 1K9SA 1BDMA 2Q7XA 2P9EA 3UJAA 2O0KA 4RDHA 5EUQB 3T7JA 1W0KA 2CDBA 4O2LA 4CN9A 3IL2A 3M4JA 4CMCA 5A3QA 1DJMA 2B4RO 3UMSA 5JD5A 1L5QA 1Z0FA 2HNAA 3BWCA 1GVHA 1WCIA 3B1FA 2GD1O 1ETHA 2ZRFA 3I6ZA 1KETA 4FJ2A 5AM2A 1UC9A 3JVDA 3E7WA 1ADCA 4D9FA 3KNZA 4YX9A 5K7SA 2IJGX 4DMFA 2ZJ3A 2JIPA 2ZJ2A 5F4ZA 1C81A 3ZGOA 4DEXA 1VB3A 3MT9A 4BV8A 5HKOA 2ATEA 5IARA 5K4AA 3G79A 2DULA 4WVFA 3FRHA 1RR6A 4YT8A 4URXR 5I9BA 1KK0A 1QX3A 8MHTA 3KL2A 2AEFA 2R6GA 4UD6A 5E8RA 3PQ3A 5FQOA 3AEUB 1C0PA 1TAGA 1YQEA 4IQ8A 3A06A 4RXTA 4HV4A 4OXKA 1YQ9A 3RAFC 4MUNA 1D2HA 2OPBA 5IT5A 2HNKA 4AICA 3IT2A 4BZWA 2DPMA 3DVSX 4LVOA 2H4HA 3UICA 4YV0A 1CJKC 2AZ4A 4TMYA 3G0HA 1OFGA 2WUEA 3D3JA 1HA3A 2ODQA 1DRUA 4QUBA 1N2IA 2EFJA 4FYHA 3JX9A 2GDJA 1IN8A 1B8PA 2NTYC 1ZEMA 3O4IA 1C0LA 2P9TA 1N8SA 4MLZA 1E18A 1JG6A 2WIFA 2ZEJA 2QX7A 4YMLA 4QAQA 1S8FA 1M0EA 1C7JA 1NW4A 4LDQA 1YONA 4EF6A 3AVQA 3MPOA 4NZOA 5AD1A 2P62A 1ZL2A 4BMOB 4JU8A 1J5XA 1V4BA 2KMLA 3TLGB 1DTSA 2GPJA 3I5AA 1FXWF 1AK2A 3OZGA 4PLPA 1A9PA 2V54A 3I9FA 2R8XA 3STVA 2IXAA 4EA6A 2V7UA 5SYMA 3HCNA 4BQSA 1HTWA 4LZNA 3KQOA 4V38A