2BMJA

Gtpase like domain of centaurin gamma 1 (human)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
176
structure length
174
Chain Sequence
MRSIPELRLGVLGDARSGKSSLIHRFLTGSYQVLEKTESEQYKKEMLVDGQTHLVLIREEAGAPDAKFSGWADAVIFVFSLEDENSFQAVSRLHGQLSSLRGRGGLALALVGTQDRISASSPRVVGDARARALCADMKRCSYYETCATYGLNVDRVFQEVAQKVVTLRKQQQLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Centaurin Gamma-1 Gtpase-Like Domain Functions as an Ntpase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords CENTAURIN GAMMA 1
total genus 62
structure length 174
sequence length 176
ec nomenclature
pdb deposition date 2005-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2bmjA00
3D31A 1MKYA 1BYUA 2XTZA 2K5UA 2VP6A 3FDIA 1M6NA 1COWD 1JI0A 2QT1A 4P4TA 1OW3B 2DFLA 2YC2C 2YVUA 1BS1A 3GLHB 4LBWA 2QT0A 1KI2A 5CLQA 3C4JA 3UATA 2L0XA 3AVQA 5ELXA 2FNAA 1OH6A 4IOLA 4Y0AA 4HSEA 2CE2X 3VU9B 2P5TB 2EW1A 3D8BA 4DDUA 2JLZA 5JRJA 3O8DA 2ZRGA 2VQSA 4FCTA 4MUBA 4C7OB 1DS6A 3FMPB 3R8CA 1FQJA 5C4GB 2ZJZA 1XPUA 3DKVA 1U2RA 4GOKA 2D2FA 3BFKA 2B8TA 2DCUA 3BB4A 1E9RA 2QMHA 4PPGA 1IN8A 1PLLA 3CIOA 3THXB 1NBMD 4DB2A 1Z22A 2F7SA 1CRQA 2KJQA 2X1VA 4HB3A 5HE8A 4XWOA 1E2JA 1AJEA 1T3SA 5GVSA 3MD0A 4G5SA 2FJUA 1IN5A 1G41A 4S35A 3EZ7A 1U8ZA 1ESNA 1ZNZA 4KITB 1OT3A 2QPTA 2MSCB 3NEYA 2HCBA 3HWSA 2AKAB 3LAWA 1FUUA 3X1DA 2G1KA 4W9MC 2IYVA 1P2UA 4TLCA 4RJLA 3GLGE 1XEXA 3D3QA 1UEJA 4NKRA 3WP1B 2CHGA 2GBLC 5JECA 1SKQA 4C0BA 4UNSA 4DVGA 1HY3A 2FEOA 1NJGA 3EA0A 3FYHA 3OEEA 2EWWA 2J41A 2ZUDA 5JI2E 4DIDA 1AK2A 2D06A 2J45A 2PLRA 3C8UA 4FMCB 4LC0A 1Z0IA 2R6FA 1JR6A 3ADCA 2D74A 2ATXA 1N5LA 2AD5A 1II8B 3LD9A 1ZU5A 3HDTA 5FTKA 1BYIA 1EFRD 2C78A 3QOFA 2VH5R 3OFNA 4M1SA 3THOA 2QMOA 2OESA 1XJQA 4RZXA 5DHAA 3A8TA 3CX7A 3IQXA 4FXPA 4OKSA 1CBUA 2WPDD 2CLDX 3ZVLA 4ACAA 4ZKEA 2IL1A 4A8JC 4TLEA 4NPHA 2ZEJA 1SVOA 4A92A 5AR1A 3VAAA 4B3CA 3K9GA 1E32A 4MYTA 5H8WA 4OHVA 4OHZA 5H1YA 1OIVA 3ASZA 2PLFA 3BWDD 2FN4A 5L8VA 5J40A 2AK2A 2GF9A 1GFIA 2FMXA 3GLIB 3D7MA 4E5UA 3TKLA 1E2GA 4V0ME 2J0QA 1IQPA 2REBA 1JALA 3VR6A 5GADl 2VHUA 4DLXA 3AUXA 1Z6GA 1P72A 1Z2AA 4JL6A 5EE0A 1XCPA 3EW9A 5IDVA 3SYNA 4RVCA 4B76A 3MLEA 2XSZD 2Z4SA 4TWZA 4LJ9A 2PBRA 1VG9B 1JNYA 1KY3A 2QPOA 3GEHA 3N70A 4FMDF 1KI1A 4F38A 1U99A 2NPIA 3L0PA 1GILA 4A15A 4OHXA 4BLTA 4BLPA 3B1YA 4A2PA 2ZJBA 3SJCA 2OXRA 2ZREA 2W6JA 1YZGA 2V55B 1XTRA 3IIMA 2OBLA 3C15C 1E0JA 1E2QA 1KKMA 2OILA 3LY5A 4Q4JA 2ZRDA 3LA6A 5AJWA 4AC9A 1P9WA 4CEHB 2BM1A 2G83A 2XB4A 2ZS8A 3IO3A 1CIPA 2C04A 5EUQB 1JXMA 1WQ1R 5EE1A 3M1IA 5EP1A 5FTNA 5HZHA 1HH4A 3BORA 3NC1C 1WB9A 1TX4B 1ZM2A 3FFAA 3T34A 1TTTA 3SJZA 4C0AC 1GSIA 3NDPA 4B3BA 4Q9IA 2ASEA 1VCMA 2WM9B 5JMTA 1Z06A 2NO0A 1F2TA 2MSDB 4Q19A 4RKFA 1YRAA 4RD1A 4AYTA 2BV3A 1P6XA 5AUQA 2YOGA 2A9KA 4RD2A 1FP7A 2FF7A 3MRSA 2O8CB 4QNMA 2GJ9A 4A2WA 4W5JA 4U7DA 2REXB 2ZSEA 5D3QA 4TTRA 1NY6A 1N6KA 1XTKA 4LOAA 3KQLA 2I3BA 2CCKA 2QL6A 2F6RA 1ZJ6A 2WTUA 4RCZA 2VSXA 1NVUQ 4OI4A 4CZ2A 1G64A 4UXHA 4YLGA 1Z0FA 3C5CA 1J8YF 4DHEA 1NN5A 1E2NA 3QY0A 2KBEA 3BE4A 1A2KC 4PSVA 4UXIA 1OE0A 2N42A 5FPSA 5SZHB 3C41J 3CPHA 2IHYA 1RIFA 2PZFA 4RZUA 1XEXB 2JJ1D 2IYZA 3R9XA 1CJTC 1R7RA 1L4UA 1UAAA 1N3BA 1H8EA 4G5OA 2IYRA 2AD1A 3K0FB 4MH0R 3GLGB 1XMVA 2JEOA 1D9ZA 3TRFA 1IAQA 4JJZA 1E9SA 4GP6A 5G41A 1N6OA 3PUXA 1D5CA 5AJVB 5CIWA 3VFDA 4A8JB 2G88A 2WBLC 1AZSC 3RABA 3RS7A 2OCBA 3JVUA 3HP1A 1VTKA 3TGPA 4FWIB 2CCJA 3EZ2A 2JLXA 3T5GA 2WIAA 4C0QC 3ZVNA 2BBSA 4CEJB 3W5JA 4Q21A 2QM8A 4URZR 5BN4A 5KDOA 4QNRA 4Q1FA 5KTYA 1IXZA 3WBKA 4BFZA 2OLKA 2BC9A 5CJ2A 4IJMA 1E99A 1KNQA 3BERA 1QHIA 5CIQA 3X1XA 4F93B 3CPEA 3HYRA 2QY9A 4LZZA 3FMIA 2HDNB 4KYUA 4OK5A 4Z54A 2ZRFA 3W90A 1ZNWA 2ODNA 4Q5IA 4Q47A 3E1SA 1ZBDA 3K0FA 4YXWD 3GLGA 1BMFD 1XMSA 2NGRA 1J99A 3DKPA 3VHXA 1G7TA 1NI3A 3IBGA 4HLDA 4O3MA 3AVWA 1E9EA 3IILA 3OEHA 4ARZB 2LKCA 1D2MA 4FWTA 1G17A 1TQ4A 2F1RA 1OXTA 4CGZA 1YRBA 1UEIA 2JCSA 5FH9A 1E2HA 3F3YA 1OSNA 1SHKA 4WBSA 5JJKA 2FX3A 1ZAKA 1A4RA 2XZLA 1SGWA 1JQJC 1R2QA 1W44A 4V0OA 4PHGA 4DLSA 3U7HB 3OFND 3WHLA 2FSFA 2FGJA 5L3SB 1KSJA 1QG2A 3GLFE 3WRXC 2Z4RA 5DYIA 1IXSB 2WWWA 2FV8A 2VSFA 3AEZA 2PX3A 1SVLA 2Q9CA 2WAXA 1Z47A 1XEWY 4EFNA 3AKEA 3EWAA 5F2EA 4HEJA 4JLPA 4DDWA 1F5NA 1K8RA 1NLYA 4UJ3A 3I8SA 3SS8A 2YWEA 1E9AA 4IOMA 5GJVC 3TIFA 2QP9X 4C3ZA 1G3RA 5DSZA 1IXRC 1T0JB 3A58B 4NYJR 4JMPA 5EUMA 4KBFA 4UNRA 1DAKA 3L0IB 4ZDWA 3SDZA 5TB5A 1KI7A 1Z8FA 4FMCF 5KNBA 2BEJA 1XXHB 2CL0X 2JA1A 4BZXA 2XXAA 1BKDR 2Q0HA 2JJ8A 1U94A 1P62B 1TPZA 1T5LA 1EX6A 2VSOA 3DL0A 1Q57A 4X8MA 2E9SA 2OBNA 2P2LA 4ILEA 4LHVA 1DOAA 3EIQA 4CYMA 1T4GA 3AUYA 1OFUX 4CT5A 4CEIB 1ZM7A 2X2EA 1U98A 1G3UA 4H9GA 4P0TA 1JEEA 5LD2C 4HDCA 4O25A 2J7KA 3AVVA 2V7QA 4ZCIA 2JIZA 1JR3D 1SHZA 2CMKA 5CB8A 1EFUA 2BWJA 2V54A 2WV9A 1SXJA 2OFXA 4WXPA 5F98A 2ZE5A 4DCTA 2ZVQX 4RD3A 4JBYA 1R0ZA 1XTJA 3B5JA 4HAYA 5J4YA 3R20A 5HZKA 1GTVA 1GNRA 3TAHA 4QJ4A 2E87A 3WHKA 1KDPA 1WRBA 2NZJA 4GI7A 3B78A 4H1VA 5KDLA 3I5YA 2GCOB 3KXKA 4Z8XA 2ZM5A 4RD6A 5C2JB 4YONB 4Q1DA 3UMSA 1Z2CA 2O0HA 3WYAA 3QEJA 2GTPA 4KFUA 4Q4JB 1E0SA 2W83A 1RW4A 5EXSA 1AKYA 4M1MA 5FBWB 1D8TA 3WYGA 3U4QB 2HUPA 3K1JA 1Z07A 3GLHA 2ORIA 3CWZA 4M21A 3RRZA 5KNCA 1HTWA 4O2RA 5CK5A 2RMKA 2BBTA 4M1WA 4B6FA 2VHCA 4GL2A 3QXCA 1WBBA 1HE8B 4B6EA 2JLWA 4PR0A 2E1RA 2IF0A 4TT3A 5JCZA 3LDAA 4LYFA 4TYYA 5HR5A 2ODBA 1QHHB 4OQLA 4C0SA 3QNUA 2OCPA 4DLUA 2CLSA 4D4LA 3RANA 1KHTA 4G01B 2DR3A 5G40A 1YZTA 4MQBA 1VG0B 1UPTA 2FFBA 3ZZTA 1FW6A 1R10A 4B48A 1N6RA 5B2ZA 3PXGA 2OFOA 1A7JA 2D2EA 2WMOB 3KX2A 1ZMXA 3AV0B 4GRAA 1LTQA 5E3HA 4U02A 4CDGA 4B3DA 4Q1AA 4D6PA 2P6UA 2WHXA 4L16A 2H57A 3T1VA 3KXLA 2CLCX 1RRPA 5BQ5A 3DZ8A 4LWZA 4AI6A 3H84A 1NG1A 3U3JA 3SI7A 3WMFA 1M2OB 2WJIA 3IO5A 5J4KA 1ZCBA 4DWJA 2ZS9A 4QGAA 5BWMA 5F3WB 2BJWA 4IEIA 1Z63A 1OXXK 1IY2A 2ZSDA 2Y8EA 1G7RA 3CLVA 2R2AA 2C77A 621PA 2ZRAA 3GJ8A 3HR7A 3VU9A 1CU1A 4C0HA 1ZM4A 1NKTA 1B23P 4QXAA 1BMFA 4PC1A 4MRNA 4N3NA 3A1WA 3CONA 4M53A 1FMJA 1G8PA 3IBYA 3LXXA 2CNWD 3ADDA 2WJHA 3IKJA 2VHTA 1M34E 3Q7PA 2PCLA 3O8CA 1XTIA 1G21E 3TR5A 1W0JD 1BOFA 2J1LA 1VMAA 5E4FA 1S1CA 1VIYA 5KSYA 4MYUA 2HF8A 3M0EA 1YE8A 1W1WA 1N6IA 4UKDA 1GP2A 4ZCLA 4D25A 1Q1ZA 1R6BX 3UWOA 5JCPA 1IBRA 2W2TA 4BLSA 2PEZA 4P31A 4TLBA 3L0OA 5TXGA 1U0LA 1RRGA 2V3CC 1XTQA 2IBMA 1Z0DA 5L3RA 4PAQA 1DAGA 3ZVMA 1W2HA 4TSFD 4AWXA 1IOZA 3OEHD 3K0AB 4BFWA 1NN3A 2DFNA 1YKSA 2QP3A 2JATA 4BE7B 2QTVB 3EC2A 4G5RA 2ODEA 1N5IA 2QA5A 4PFSA 2BHRA 4JIMA 4HUTA 2RH5A 1F6BA 2C9CA 2V1UA 3EZ9A 4DIEA 1NRJB 2AK3A 2HYDA 4MKIA 3BB1A 1OPXA 1W0KD 3B9QA 3NBZC 2W0MA 4A9AA 3RLFA 1OH8A 2FE4A 3R8FA 4M1OA 1KKLA 3RAPR 1OYYA 3DPUA 1I2DA 3I1FA 1OFTA 4TQAA 4POAA 3QXJA 4M1KA 3VR3A 5DGXA 5BXQC 4TL9A 2G0TA 3RC8A 1EWQA 4FN5A 3KJEA 3EPJA 1OIXA 5E7JA 4IEEA 4IDHA 1KK0A 1IN4A 4ZDJA 5HCIA 1U9IA 4DLWA 3B2EA 3W8NA 4PPFA 1F2UA 1D6JA 2XNDA 2AHOA 2EFCB 2F3TA 3AP3A 4GOXA 1HUQA 2DFKB 1GWNA 4B43A 3DO6A 3U3RA 2XITA 3B13B 3FTQA 1S8FA 2ZYVX 1KDRA 1LS1A 3E2IA 1B0UA 1KK3A 2FFQA 5FI1B 5FBVB 3KZ1E 5DNYB 3BC1A 3BB3A 3LW7A 3MJRA 2EVWX 3V4RA 4DT1B 1Z6YA 1GUAA 4HI0E 3ZGXA 2V1XA 4NDZA 2BBOA 2QQEA 4YMTA 1KSHA 4JBWA 3EZFA 2YJTD 2XOKD 1OH5A 2CDNA 2OLJA 3QIAA 3OE7D 4C30A 1FNNA 1Z5ZA 1Q0UA 2J7PD 2B6HA 2ZJAA 3H86A 3H4MA 2GZHA 4MUAA 2JIZD 4OQFA 2IUUA 3W5IA 5AUNB 2I1VB 4M1YA 2CJWB 2HJGA 4R71A 1JB1A 1VCNA 3CO5A 1AM4D 1E2MA 3AF0A 4Q4HB 1RE0A 1SXJE 2RGNA 2ZE7A 4Q66C 3LV8A 4M9ZA 4HAZA 1SQ5A 2RCNA 3LBNA 3K09A 3EPLA 3SHWA 1TF7A 1OKKA 2H17A 2WOJA 3LRPA 4GBMA 4AURA 5EE3A 1CRPA 5JS7A 3U3OA 3GJ4A 3CH4B 1Q3HA 1W0KA 721PA 5B58C 3T61A 1VIAA 3V9PA 1Z0AA 1I2MA 1W4BA 2EWVA 2YC4C 1JPNA 4QGGA 3QKSB 1UM8A 4JLJA 1ZM9A 1G18A 1G4AE 1KO5A 3K8YA 3LLMA 1XMIA 5FTLA 4JVMA 2IEZA 4WVFA 1N0UA 2BMEA 2RGNC 4GP7A 2D7CA 3OIYA 1OHHA 4JLMA 4FI3C 2W6ID 3K70C 2XZPA 821PA 2QZ4A 1MH1A 1JAIA 1L7VC 1KSFX 3K0EA 3T1TA 1KO1A 4RFSA 1KZ7B 5B57C 2VF8A 1XPOA 1QVAA 1E79D 1WCV1 2Q3HA 1SKYE 3NBFA 1I4DD 3GJ3A 4DCNA 1WF3A 1W36D 3N2EA 3IGFA 2PT5A 4U5XA 1G3QA 4A0FA 2JJ1A 3TR0A 3R9WA 2ERYA 1WA5A 3TE6A 4Q00A 4PANA 4E09A 1E2EA 1MOZA 3NVAA 2ZSFA 2F9MA 4K46A 3U5ZB 2YWFA 4Q9LA 3CRRA 4KAXA 2P0EA 2ZJ8A 4QKQA 3W34A 1DEKA 2ORVA 3OAAA 4LPSA 3WRYC 1F48A 1N25A 3IEUA 4HB0A 2G9NA 4LBVA 1YR7A 3AF1A 3CWQA 5FL3A 2ZQ5A 3VKHA 3PFIA 2GJKA 4Q4AA 1K5GA 5CYPA 1ZRHA 4Q1EA 4QBHA 2Z6VA 2ZS7A 3QXSA 3QENA 1G6HA 4RFVA 1VDZA 2ZE6A 4B2IA 2GETA 3C14C 4D0NA 4KVAA 2YKGA 1KK1A 2R9VA 1M7HA 4GSYA 4LJ6A 4XVQA 2ONKA 1PLKA 1XDBA 2D3WA 4L15A 1G5TA 5CITA 4M22A 4J0QA 5G53C 5CLLA 4MRPA 1GKYA 1R8QA 3ZQ6A 2ZRNA 2ZU0C 2PJZA 2I4IA 1P2TA 1UBGA 3LX5A 3KKPA 4DRZA 1GG2A 1XCGB 2DWQA 3KJHA 5J47A 5DE3A 3ND8A 1E2DA 1NVXQ 1UBCA 4KO8A 2CCGA 3SQWA 2H92A 4Q9HA 5JRZA 3ONWA 1NVWQ 2N46A 4TMWA 2WVJA 1T9HA 3P26A 5A5GA 4LCBA 3PUZA 1YZLA 3CBQA 5EP3A 5JBQA 4PPNA 4BZQA 3LXRA 3U6BA 2ZJYA 3AVOA 5H70A 4WIAA 5J5CA 1GDDA 4F91B 4HUQA 4Y0VA 1HT2E 3SOPA 4KSBA 4M2LA 1XD9A 3PEWA 4MKHA 5KSOA 1EFRA 3L0SA 1F3OA 4HAXA 3ZDQA 4G1UC 1TQ6A 3IPYA 2YV5A 5H68A 4EAQA 1P4SA 1ETUA 5EXPA 2J59A 3FGNA 2ZYUX 1LS6A 1DG1G 1MABA 3CF2A 1GKIA 5CJPA 5P21A 1DPFA 3FWYA 1T0HB 3P4YA 4F7WA 2RGBA 3P27A 4NYIR 5FUYA 2B7CA 1II0A 2GJSA 4M4SA 4PSAA 1W36C 1E2IA 4HAWA 4CIDA 1T8UA 4A0HA 1ANKA 1GVNB 3D6TB 4EQ6B 1EESA 2IYTA 1M7GA 2ZVPX 4HATA 3TLXA 4TLAA 4UQOA 3IEVA 5JEDA 3AVUA 3LVRE 3CRMA 4MITA 5EZ5A 1OF1A 4E03A 1PJRA 1CF4A 3MGCA 3SFZA 1HQCA 1NIPA 4WW0A 3ZLJA 3GQBA 3K9HA 1FMLA 1UJ2A 3DDCA 2RGXA 2YOFA 3VQTA 2GEDA 3OEED 1OH7A 1P2SA 3GJ6A 2NO1A 2LKDA 4EUNA 1UKEA 1S3GA 2ZRPA 4JT4A 4IDPA 1OB2A 2NG1A 4MGYR 5DYGA 3CNOA 5L3QB 1VG8A 3QF4B 5FFMA 2J0UB 1R4AA 2HXSA 4RZ3A 1XWIA 2Q9BA 3KJIA 3CR8A 1ODFA 2A30A 3QPUA 1Y63A 4Q4HA 2VTKA 5DN6A 3QKTA 1J8MF 4Q48A 5KSPA 1KI4A 2DBYA 2YINC 4DEYA 3EA5A 1N2CE 3GP8A 4IW3B 1KDOA 1VECA 4URXR 1MR3F 1SVSA 1N0VC 4P33A 4LSGA 5G3ZA 2LCFA 1GNQA 1ZC3A 4QFMA 5DISB 4EQ6A 3QVUA 1DO0A 2G3YA 3NTUA 4PC3A 2V9PA 2KI5A 3SBDA 4LYHA 2QGZA 2JAQA 2IS4A 2VRWA 1RRFA 3EPKA 1PLJA 1CJVC 1Q22A 3VTKA 2GK6A 2YWHA 2GEVA 4XVUA 1MABB 2QM7A 4QGHA 1G8HA 4EJSA 4JT2A 3TW8B 4TLDA 3BOSA 4B32A 3KUDA 3UG6A 2WWYA 2H8KA 4Q7LA 3FKQA 3I4LA 4BEJA 5LB4A 4LBYA 1G3IA 2GBLA 5B64A 3HYTA 1IJEA 4HUQB 3FHOA 3WBJA 1U9IC 2J9RA 2XZOA 3TUZC 5AUPB 1KI8A 4BZPA 2J87A 4MGKR 3UXMA 3EAQA 2QE7A 1TEVA 4TL6A 4BFUA 4CEJA 4H1UA 4D4KA 3VMFA 4YDSA 3NG1A 2N1BA 5FOTA 5CM8B 5TV2A 1ZNXA 3AKYA 2QAGB 2P6NA 5L3QA 1XU4A 5EQTA 5BN3A 2WWFA 1ESMA 1G20E 3C16C 3BIFA 2DYKA 1Z6XA 4V0LA 4RZ2A 3GPLA 2WKRA 1NY5A 1EGAA 1XTSA 2CL7X 2VP4A 3G0HA 4LC1A 4A8JA 1E3MA 2O8FA 4LHWA 3Q8XB 1AGRA 4EPYA 3QXHA 4TL7A 1GNPA 5JWRA 1QHNA 2JASA 3EIEA 3QE0A 1ONBA 1DAEA 4A6PA 3B82A 2O8CA 2R8RA 4NCKA 2VO1A 3KUCA 3UK6A 1NN0A 2J5XA 1E2KA 4GT1A 1D2EA 3I62A 1M8PA 2GRJA 3GFOA 4YMVA 2F1IA 4MRRA 5E95A 3TK1A 2GJAA 4O0MA 2BMFA 4GNKA 1ZM3A 3RHFA 1Z83A 3GFPA 2X19A 2AWOA 2QENA 4US0R 4XD7A 1GITA 3GCGA 3OHMA 1S0UA 2JJ2D 4W7SA 4NZYA 1NMYA 2IC5A 2VHJA 2ZI4A 3PEYA 3A1TA 1FZQA 1G7CA 1QDEA 4WZAE 1D2NA 1IN7A 2ZR9A 4DUGD 1NN1A 3S1AA 2X2FA 3DOFA 3FHCB 3ZS8A 3PG5A 2ZANA 4QHSA 3TSWA 3QXXA 1S3SA 2QN6A 4Z51A 5JI3E 2G77B 4LHZA 3GJ0A 3AM1A 5CDFE 3MCAA 4JLNA 1QHYA 4IVPA 3EASA 2X8AA 4TYQA 3W9YA 4FCWA 4LYJA 3QEOA 4XTRA 2H16A 4YQFA 4ZIRB 5KO2A 3TSZA 3GLFB 2WSSD 2WJVA 4QGFA 5KNDA 4IFBA 3QF7A 2MSEB 4RFSB 1XXHE 1KI9A 1QHXA 1T91A 1XD2A 1T5IA 3R7WB 2OXCA 4AG6A 4TL8A 4EFMA 3A6PC 1QG4A 1E0AA 1KOFA 1US8B 4HZIA 5SZKB 1S2MA 3NHBA 1NL3A 4HLUA 4GDFA 4NBSA 1IONA 1J7KA 2O8BA 1H8HA 1VYTA 2B21A 3HU1A 4LV5B 1II8A 4DZZA 3QG5A 4B3FX 3PJRA 4LJ7A 2ATVA 3Q5EA 1IJFA 2GCOA 2BDTA 3KFVA 3A1UA 4TTPA 4U00A 4MYCA 1YVDA 1YR6A 4JVLA 3AF3A 4LI0A 1X1RA 3LBIA 2GKSA 4PAMA 3ZZUA 2CBZA 4Q1BA 1T8TA 1NLFA 2ZE8A 3EXAA 2IXEA 1W0JA 3KB1A 4LYAA 5JHGB 1A1VA 5BW8A 1W4RA 4M0LA 3DM5A 3FFBA 4NP6A 3CRW1 3MMPA 3TBKA 2RGCA 4JBXA 2A7QA 1Z3IX 3T12A 4FW9A 3GLFA 5TMPA 3FMOB 2FOLA 3KTAA 4M9QA 2W6IA 4AK9A 3EPHA 1O3YA 3W6PA 1WXQA 2VP0A 3KQHA 5FTJA 1BH2A 1U8YA 2CK3A 2I1QA 8OHMA 4GOJA 3G5UA 2ZIAA 2OZEA 1UFQA 4MGZR 1IY0A 2HF9A 4ZI3A 2XJ4A 2MMCA 4NH0A 2IXFA 3I5XA 1OJLA 3CF0A 3A4NA 2KE5A 4BFYA 2ZUCA 4LBZA 1DTSA 1NKSA 3K9LA 4GMDA 4DT1A 3AKCA 2JLSA 1Z6TA 2EFDB 4KFTA 1NVVQ 3KQUA 5FOUA 1HE1C 5M04A 4C7OA 4Q1CA 3M4YA 3ZZ0A 1ELOA 2ZRKA 2PZEA 1E2FA 3GJ5A 4R2IA 2J0VA 2H1LA 3KL4A 2H5EA 3LWNA 3GEEA 1OV4A 4OI0A 1ZD1A 4QM6A 1RYHA 1QHGA 4UJ5A 1UF9A 1NIJA 3ZVRA 4HZUB 2ZYWX 4ZIRA 2BKEA 1A2BA 3B1XA 1C4OA 2FZ4A 2ZR7A 3FB4A 2JLVA 1JR3A 3GJXC 4IXMA 1AKEA 4N0EA 4KFRA 2BBWA 1AS0A 4F4JA 1RPZA 2QAJA 4I1UA 3CRQA 1KJWA 3K53A 1HURA 3FVQA 4AYXA 3U60B 2JDID 3MUFA 3WXMA 4X8OA 2QP4A 2IWRA 1S4QA 4IVQA 4OJQA 2PJRA 4MRVA 1DAFA 3X1YA 4BGDA 3BH0A 1Q12A 3F8TA 2AWNA 1KK2A 2W00A 1TQDA 3KXIA 5JSZA 3THWB 1KJYA 4HLUC 4KCGA 4A6XA 1RJ9A 2PEYA 4ESHA 3K0SA 2W6JD 3BGWA 3RS5A 4BRUA 3T1QA 2XAUA 1FPMA 3GLHE 5EXTA 4PC6A 5TY0A 3U2QA 4OI2A 4LJ8A 3ZD6A 2FSHA 4FINA 4N1AA 3RWOA 1HA3A 2KB0A 3F0TA 1R8SA 5SZJA 4TMKA 1TUIA 2ZI9A 1NF3A 1KGDA 3PR1A 4B3GA 2H7VA 3IPXA 1QRAA 4FMDB 4NCIA 3V00A 3IIJA 1K5DA 2V8OA 1ZD9A 3JVVA 2ZR0A 4PZYA 4P4UA 3QKUA 3REGA 5FOVA 4D82A 5FI0B 1XFAA 2IEYA 3DEFA 5HCNA 4JZKA 1KSGA 4EPRA 5DH9A 1N6PA 5AK0A 1K6MA 3EIHA 2D62A 4E07A 3QJYA 1CJUC 2OE2A 1P5ZB 3T15A 4LJAA 3QBTA 2PX0A 3VKGA 3DZDA 5J4LA 1W36B 1HEIA 1VPLA 1JAHA 1ZUNB 2V6JA 1DELA 2EU8A 4M9XA 3QPWA 1VCIA 4NYMQ 4LHXA 2AR7A 2JLRA 5FPYA 4B35A 1E2PA 4ZV4A 1HT1E 5HKKA 4XD7D 1T3HA 3ECCA 2W0SA 2XSZA 3QKRB 4NCJA 4URUR 3WNDA 1E0KA 1W5TA 3FKSA 1KO4A 1U0HC 4EJSB 4A0RA 4RD0A 2XEXA 4DUGA 4Q9JA 2QAGA 2CNWA 3PV0A 3ICEA 4YC7A 2YNMA 2J46A 2HEIA 4CVNA 5FL7D 4DCVA 3JZAA 1PVOA 3L2OB 4X8LA 5JEEA 3OF5A 3Q7QA 4ZPXA 2DB3A 4KSCA 3RVBA 2GESA 4BFTA 1OYWA 2YWGA 3CRVA 2IYWA 4CF7A 4C2TA 2GF0A 1N6LA 4KI0A 4OQMA 3SEAA 3K70B 1R5OA 4IOJA 2OO7A 3UWKA 3WNBA 1ZYUA 5HE9A 2EQBA 2QEQA 2AX4A 1MT0A 1NSTA 3UMRA 1VYVA 1L2TA 2XJ9A 2C96A 1XXHA 2QTFA 4GPTA 4LPKA 3UIEA 4BLQA 4QHTA 4Q9KA 4OHWA 4A36A 4JS0A 5FR1A 4JSTA 2P65A 4LJ5A 1P7CA 2VPPA 3KQKA 4TZ0A 3M6AA 4KVGA 1ZCAA 4PX9A 5JWHA 5KYKA 1VG1A 3HU2A 3CM0A 4ZDKA 3AQ4A 2W58A 3EG5A 2AXPA 1KI6B 4ZDIA 5LBIA 5C1BA 1VYUA 4D0GA 2C99A 2BEKA 4M8NE 4S2EA 1P2VA 4UNQA 5C46F 3VX4A 1G8FA 4R98A 4JLBA 1V5WA 1XCMA 2VEDA 1L4YA 3F5FA 2OG2A 2WJYA 4ZI2A 4X8HA 3A36A 3NDBB 2O8FB 2IYLD 2Q21A 1G16A 2VL7A 3PENA 1RJ9B 4BRWA 3RYTC 2QRZA 3R7WA 4D26A 4PHFA 1E94E 1QVRA 3P4XA 1W49A 4TQ9A 3CX6A 2BCJQ 4B3XA 4PO9A 1OXVA 1SVIA 3LW8A 1O87A 1US8A 3SNHA 4FCVA 2QE7D 1Z0KA 4IOKA 4DC9A 2HT1A 4URVR 2HYIC 3BH6A 2IT1A 4I1VA 5KUTA 5FPHA 1YR8A 3SC3A 1QHSA 2RGDA 5CYOA 4GZMA 3U4QA 1E4VA 1XX6A 5LD2B 4V0NA 2A5JA 4TQUS 1ZC4A 4JSYA 5FPTA 2QU8A 3TH5A 2JLUA 3QUSA 2WKPA 2ZSBA 5JHHB 2Z83A 3SR0A 5DN6D 2NIPA 4FD2A 521PA 2VP5A 1OB5A 4I4LA 4PZLA 2WWGA 1Z6AA 1N6NA 2O52A 1X1SA 4V0MA 2ZJ5A 1YQTA 3BFXA 2IWHA 1TF2A 2Q3FA 1R0YA 2DHRA 4NONA 4A0GA 1OXSC 1UDXA 2BMJA 1XP8A 2DPXA 4QHYA 5LPNA 4TYWA 3LFUA 2ZETA 1S9DA 2VBCA 3CNNA 2GA8A 4AKEA 4L5BA 3PUYA 4AKGA 3E5HA 1KO8A 1ZP6A 1QZXA 1TEXA 1YZKA 1GOTA 3SU8A 3LQRA 1C1YA 1VCOA 3MSXA 4IFEA 3VX3A 4DSOA 1XF9A 1EK0A 5KPDA 1C9KA 3B6EA 4TTQA 2W2VA 2QMUA 5JSZB 221PA 3THWA 3UMFA 4ASUA 1V43A 3WNCA 1A5TA 1BO6A 5FOWA 2D4HA 4Z1MD 3RDPA 5UKDA 1W4CA 2UKDA 3TVTA 3BS4A 4C0JA 2KBFA 3ND9A 4RD4A 2QQ0A 4OL0A 3X1WA 4TYNA 2FWRA 6Q21A 1SVMA 3T06B 4XWAA 3TQCA 4GZLA 4D81A 2ECKA 2BOVA 4ZO4A 4DLTA 4QM7A 3AKDA 4BASA 2FGKA 3E70C 1S96A 2ONJA 1UADA 2PMKA 4LV8B 2UZIR 1NG9A 1E6CA 3MWLA 3ZIAD 4BFXA 2XX3A 3Q5DA 2OM2A 1S1MA 4JKYA 4PPQA 1TU4A 3TW4A 1SXJC 1G8YA 2WICA 3KQNA 2OAQ1 3U7GA 1TQ2A 3PVSA 4PQYA 2FDCA 121PA 2Z5FA 1LF5A 3W3AA 4UNPA 2JLYA 4AKHA 1NP6A 4JLOA 3U44A 3W6NA 2JJ2A 5A0FA 2WOOA 1PUJA 4CT4B 3KFXA 2R6AA 3OZXA 3DM9B 4DKXA 4A82A 3CW2A 1X3SA 2JLQA 3PEUA 4R9UC 1E69A 1XBTA 3CKLA 3NWJA 4TT3D 2OT3B 1P75A 2GXSA 2HV8A 2QUZA 3G82C 3PIRA 4XJXA 2O5VA 2FSIA 2IYUA 3FE2A 5JWOA 3RS3A 4CRWB 3IHWA 3SYKA 1OIWA 4LJ4A 1FTSA 1FNMA 2BJVA 3CZPA 2XTNA 2CHVA 3QPVA 3KKOA 3AGQA 4KLZA 2XGJA 2VF7A 1GIAA 3RSLA 4GMXA 1YHNA 5DI3B 2WKQA 5FOSA 2R6GA 3X1ZA 1E9CA 2AFIE 4PTLA 3KKMA 2NO6A 1PV4A 1DAHA 4B47A 3RC3A 3TJZA 3K9NA 5K8IA 4YMUA 3I32A 4DLVA 1KNXA 1NBMA 1SVWA 4HLQB 2BMDA 5IF9A 5LDDC 4B73A 1Y3AA 3MJHA 1DARA 2G0NA 2EYQA 4IDNA 4DCSA 3NC0C 2EFHB 3AB3A 4II7A 5KSZA 1TUEA 3U6KA 2GNOA 2VA8A 1LB1B 1W46A 2RGEA 2VP2A 1RRCA 2CXXA 5EZ6B 4TMVA 4P32A 1UKYA 4EJSC 1FQKA 4JL5A 3ZH9B 2OV2A 2VYFA 3EC1A 2GWHA 2IXGA 2QG6A 2QRNA 2RGGA 4QBGB 4US1R 1YJ5A 4L8GA 3SJBA 5GJBA 1P73A 2FH5B 2PZGA 2F43B 5JZVA 3TNFA 2GZAA 3DMDA 3NBYC 1FTNA 3U44B 3WMGA 1FOEB 5GVRA 4NHOA 4B2PA 3FPAA 3VHLB 1D9XA 4WOPA 1NLZA 2C9YA 2W2XA 4KFSA 2WMNB 4C2UA 3BRWD 5TVKA 2ZRBA 1Q44A 3K0CC 2XTMA 3Q72A 2ERXA 4MRSA 3H0KA 4DXAA 4BPBA 4BLRA 2ZRLA 4XH9B 421PA 2RHMA 4LV6A 1CEEA 3AF2A 2IS1A 4NYMR 2NMVA 1QHHA 1GKUB 3LBHA 4XVRA 1UBFA 2ZAMA 3PCRB 2JGNA 1AIPA 4M1TA 5ANRB 4JLVA 5IHPA 3TAUA 1X8KA 1MO6A 4BUJA 3BK7A 3LNCA 4IDOA 3MWKA 5EP2A 2BVNA 4TMZA 2GAOA 3HPQA 2ZROA 4B33A 5EE5B 5EJEA 4C0KA 3ZIAA 1KAOA 2BKUA 1CTQA 2QBYA 4AD8A 1XNJA 2ZAOA 2F9LA 1JJ7A 4FMBB 4OBEA 3REFA 3AH8A 1H8ED 5AUOB 3BXZA 2ODWA 5FBQB 4Z1MA 2O8BB 4Q4LA 2IS6A 1EFCA 2F1HA 2R6DA 2O0KA 1PUIA 2D7DA 1G8GA 1GL6A 1VKJA 4KBGA 1RVDA 2KWIA 3OIWA 2PH1A 4QRHA 5KDDA 4QJ5A 4B71A 4PSKA 1JJVA 1YZUA 5FOXA 3I73A 5FUWA 5BYJA 1GRQA 1CR4A 1H65A 2PMDA 3W6OA 2MMGA 1F2TB 2P67A 1RKBA 2Z0MA 1UDWA 1R0WA 4WA7A 1MO4A 3BAFA 3WYFA 4AIIA 2AN9A 3FKSD 2J0SA 1E2LA 2XNSA 3CUEF 5DI3A 3IIKA 5CK4A 4PHHA 1E9FA 2WJJA 2B92A 2QI9C 1NMZA 4HZUA 1FP6A 5FL7A 5FUVA 2NPFA 3CB4A 3L82B 3X2SA 1XPRA 2A5GA 4TSFA 2FZLA 1AZTA 4XOIA 3THYB 2Z43A 1RYFA 2R44A 2IX3A 3O8BA 3AVPA 2C9OA 2ORWA 2QBYB 1RC8A 2WZQA 3KJGA 4WZBE 1N5KA 2XXAB 1E1RA 3TUIC 1IHUA 3PQCA 5DO9A 1GM5A 1CS4C 2NZ8A 2RAPA 3RNLA 3RRNA 1I4LD 5F9HA 2ZSAA 4TYPA 4DB4A 1UKVY 4URYR 5J4HA 1XMJA 1TMKA 4YXWA 5JLJA 5FTMA 4KHZA 2ZITA 1GZSA 4G3XA 4PC2A 2VP9A 1UBEA 2C03A 2WSMA 1XZPA 4C0LA 4NE2A 4D4JA 3UG7A 3AP1A 2A5DA 1S9HA 2QTHA 4NMMA 5GJWC 3CNLA 5FPKA 1TU3A 3K0AA 4JJKA 1LV7A 1IM2A 4OQNA 2FEMA 1LF0A 3B1VA 3IUYA 1TNDA 1EX7A 2R62A 1KAGA 3ZD7A 3AVXA 1AQYA 4F92B 1W5SA 4RY2A 3IQWA 2UVQA 4PXAA 3SZRA 5C18A 2CEAA 4BWYA 1TADA 3T35A 5SZIA 1J2JA 2AXNA 4OHYA 2PT7A 1EG7A 2Q9AA 3J81k 3A1SA 2VLIA 3ZQJA 3AF4A 1OXUA 5E7MA 2IYYA 4NU0A 1W48A 3B1WA 3LX8A 1UKZA 3S1AB 1KTVA 2IUTA 3QQ5A 1HV8A 2ZRIA 1ZD8A 4LY6A 1NVVR 4YMWA 3GLIE 3HR8A 2ANCA 1E9BA 1KO7A 5HKKD 3C5HA 2FA9A 1COWA 2O8DA 3MFYA 3NH9A 5D3MA 3SE0A 2REOA 2F43A 3RS4A 2BCGY 4JVSB 4B2LA 4XTCS 4PAOA 2WWHA 4ON9A 3I92A 4D2IA 4B74A 1RFLA 4HDOB 1KIMA 1J90A 4DSTA 1W7AA 2GAAA 2GVZC 3ZS9A 1I4TD 5FBLB 3ZJYA 2YZ2A 1L8QA 3TMKA 1EFTA 1Q21A 1EFHA 1T3LA 4ABYA 3THYA 1JXOA 1VHTA 2Q3MA 2FU5C 2DWOA 3OE7A 4MYHA 1XZQA 3CX8A 4I99A 1KI6A 4W5HA 5HTKA 5D3MB 3H1TA 4BEBA 3W3ZB 5IRCD 4IXNA 5KOYA 3EZ6A 3VR5A 1OKKD 2GEUA 4UXJA 4XSGA 1NBME 4G0NA 2IA5A 3KKNA 2DY1A 2FFHA 3QVVA 1BIFA 4NYJQ 2QORA 4RCYA 2ZI5A 2J3EA 5K8UA 3B1ZA 2GXQA 4B44A 5AJZA 3K70D 1DAIA 2GCPA 1JPJA 1Q1QA 3K0CA 4K8OA 2GHIA 1KI3A 2C95A 1AS3A 5FUXA 4TZ6A 2ZI3A 3DVLA 4B75A 4P3YA 1U81A 3HJNA 1G5RA 1G9XA 3BFVA 2NQ2C 4PQRA 4XSHA 3BBPA 1YZQA 2V7QD 1MRNA 4GFDA 4TMXA 5DHFA 4HAUA 4EFLA 1KZGB 4DJTA 2J0UA 5JFGA 3GMTA 2WIBA 3IDQA 3KTAB 1F60A 4DLZA 1DAMA 2CVHA 4KV9A 1GL7A 3OESA 3I72A 1NJFA 2QROA 3L8YA 1M74A 2ZTSA 4EDHA 1WDTA 3WY9A 1DG3A 4ERNA 2AFHE 5CB6A 1A82A 3KKQA 1CR1A 2ZUBA 2QSZA 3W8RA 3I8XA 4BECA 4A4DA 1H8HD 2A5YB 3B7GA 1XJCA 3WMEA 3LVQE 3ASYA 4V02A 4DSNA 1SXJD 1SZPA 5KHOC 1Z28A 3T1OA 1DBSA 2IHBA 3VR1A 4AKIA 3VNVA 1CJKC 1KMQA 2VIIA 2ZRJA 4CEIA 3NHAA 3RRYA 4DDVA 5JJLA 3A37A 1MRSA 1ZUIA 1QBKC 3QKSA 3N2IA 4AG5A 5GJCA 5AJYA 2HLDA 5L3SA 4QBIA 4LX0A 2IYSA 3LQQA 5C4MA 4MDFA 1SXJB 1W2GA 2VHQA 5HPYB 2ZXUA 4F4IA 1N0WA 1SULA 3CR7A 2RHDA 4Z8YA 1KMHA 1OFHA 1Q1BA 3H2YA 3SN6A 4D80A 3KDSE 1JECA 4KU4A 2YOHA 3VKWA 5BYKA 4Q03A 4EKDA 2YHSA 3ETLA 4ARZA 1NNEA 4JLDA 4QBFA 2A2ZA 4JYCA 4YDHB 5E7IA 4KYIB 1P60A 5JJIA 3Q3JB 4QJ3A 1XJ0A 2FSGA 4MGIR 4Q7KA 1WBDA 3AVYA 5JS8A 4V03A 2QPAA 4ASUD 1WP9A 4L9WA 4NTZA 3I3SR 1LNZA 1G1MA 4O2LA 4BLOA 3U61B 1ZUHA 3R9IA 4A1FA 1ZIOA 4V0KA 2GJ8A 4L9SA 2WWIA 4AYWA 2OBMA 3B9PA 4OQXA 5AJXA 2O8EA 5EXXA 2WAYA 1JQLB 4C4PA 1LY1A 2C2HA 1GRRA 4EPVA 4WXRA 3O47A 2OHFA 2ZJOA 1G7SA 3ICQB 1AQUA 4LHYA 2ZU6A 4LGMA 2YYZA 4IKEA 2SHKA 2CE7A 1E79A 3U3MA 3QKRA 4G5GA 4DBLC 1N5JA 4HB2A 3P20A 1CR0A 2B8WA 4JKIA 2V6IA 3LLUA 3U3KA 3VR4A 4XWKA 3UPUA 4HAVA 2QSYA 1Z08A 4M9SA 1CJMA 4DLYA 4LRWA 1SKYB 4MKGA 1FX0A 2EFGA 3NEJA 4I1SA 1JR3E 1Z0JA 1LW7A 3DOEA 4RSGA 4URWR 3MG9A 1E1RD 3K09C 1AN0A 2B7BA 1WE2A 2H18A 1M1YE 1YR9A 1XD8A 4W5WA 1Q20A 2QAGC 3TVDA 1X86B 2CL6X 5IK2A 1AGPA 2JDIA 2GXAA 1ZW6A 3OIUA 4BQSA 3PUWA 3RWMB 4OI1A 3RRMA 5A4JA 3ADKA 2A3RA 1DVRA 1E4YA 1HQYE 1G291 2PL3A 3DMNA 2OCYC 2GVDC 4K81B 3BH7A 3NBXX 2CJWA 3SBEA 4IRUB 4IHQA 3Q9LA 1U8AA 4QC2A 4RKEA 1E1QA 1MO3A 1MO5A 4F4CA 3CH5A 4N0DA 1JEDA 4MA4A 2P6RA 4PZZA 3NIBA 4JVNA 4TN1A 2IS2A 4PC7A 1E96A 1X6VA 3LH5A 4HDQB 4JYBA 2OCAA 1ZIPA 2C98A 1N6HA 2HJVA 1CKEA 1LFDB 1T6NA 3SJAA 2C8VA 2OAP1 3C7KA 1II9A 2GZDA 1DADA 2IF2A 3U7EB 3NH6A 3NXSA 5TARA 3IHLA 4JLKA 3AVTA 1P9NA 3Q85A 4DSUA 3GLIA 3EX7C 1HYQA 1KDTA 2CVFA 1U90A 2HXYA 5CDFA 4Q7MB 4DDTA 1P3JA 1M7BA 1SVKA 1VHLA 2UZ3A 4OJKA 4Q4AB 4ESVA 3L8ZA 2KSQA 1E9DA 1ZNYA 5EP4A 4B34A 1XEWX 4EPTA 4CW7A 5F9FA 3MWJA 1ZU4A 5TDHA 1TL7C 4NCNA 1FFHA 2HT6A 2X77A 5LB2A 4PHTA 2F55A 2F1JA 2IW3A 3SFVA 1R0XA 2ZI6A 4P4SA 4EIWA 2XNDD 3T5DA 1DO2A 4I81A 2NO7A 2BM0A 2G1JA 2FPLA 1TAGA 2OEPA 3GFTA 1XRJA 2A5FA 3SQXA 4ITRC 4QOSA 4L4UA 3HPRA 1FL9A 3DHWC 2O8DB 2AL7A 1CXZA 4LDJA 4HLCA 3AP2A 2FFAA 3CZQA 2IYQA 4NYIQ 4XIGS 2GDJA 1CR2A 2V4ZA 2J7PA 4LUCA 3VR2A 1ZVQA 2FPMA 3FHTA 1E1QD 3FMFA 4WAUA 4R2HA 3RS2A 2XOKA 2TMKA 3MWYW 4TMTA 3EARA 4YMSA 1CP2A 1MV5A 3PUVA 2IUSA 4AY2A 1IN6A 1G4UR 3SHFA 3N5CA 4ACBA 3A1VA 2XB2A 4KODA 1FX0B 5AWFC 2EFEB 3U7FB 1G5PA 4I1OA 4HYYA 3LO5A 2RB4A 4MKFA 3QF4A 3MAAC 3V4FA 1RZ3A 2AKYA 2GK7A 1W47A 4UNNA 2DFTA 3KB2A 3OIVA 5FBRB 1R5NA 3P1JA 4QL3A 1NMXA 1YU9A 1EXMA 4Q18A 3O8RA 2ZPTX 4ZCMA 4MDEA 1CLUA 1DE0A 2C5LA 2Q6TA 2GCNA 4D4MA 4G5QA 2CHQA 4QG7A 4CEHA 2G6BA 2HLDD 4R7ZA 2A78A 5IK2D 1GAJA 1FUKA 2IK8A 3PITA 4KXFB 5EE9A 4OK3A 3CF6R 3SYLA 1Q3TA 4P4SB 5FR2A 2FG5A 2NOAA 3TUJC 5DI9A 2BIFA 4ZKDA 2IYXA 5J4VA 3CPJB 2WJGA 1WMSA 3B85A 3GJ7A 3VNUA 5L3VA 1PZNA 2FPKA 4LK2A 2ZRCA 4KLNA 2QMEA 1XB2A 1QF9A 1Z29A 1OFIA 1XD2B 3NKVA 4Q02A 3UKDA 3JZMA 3ZYCA 4BFSA 2ANBA 3B8HA 5BN5A 1X8JA 1LVGA 3TQFA 3TSOA 2GXUA 2ZI7A 1F2UB 3PEVA 2HCJB 4JLAA 1AS2A 2R65A 2O8EB 1OHHD 4HB4A 4DEXA 4DLRA 3FOZA 2R6CA 5KPJA 1IY1A 4IVRA 4LJYA 4BFVA 1ZINA 5DIFA 4WZ6A 4KJZA 3GEIA 1TF5A 2WWXA 4FIDA 2QGNA 3BD9A 3BJIC 1W4AA 2WSSA 1YZNA 4Q01A 1GL9B 3WP0A 4E22A 5K8LA 5B30A 5G3YA 1X8LA 1G3MA 2GILA 1EWRA 4Q7JB 5IT5A 4PO1A 4JL8A 4A2QA 4EPXA 2QNRA 3RS0A 1KMHB 3QG1A 4PO8A 2ZRMA 2OSBA 3B60A 1U0JA 2WPDA 3OAAD 2OFWA 2OUKA 1Q1EA 1OLOA 4OYHA 3A4LA 4D0LB 3A4MA 3ADBA 4PQFA 1NSFA 2RGAA 4NL4H 3QBVA 1GRNA 1KJZA 2P3SA 1AA9A 4C9BA 5KU1A 2LWIA 4OK6A 2ZJ2A 3HU3A 5DLQC 1KY2A 2F3RA 3L43A 1CULC 1KYIA 4NCHA 2RKOA 3UANA 4DCUA 2ZYTX 3AGPA 1XEFA 4US2R 1P61B 3RSOA 1J70A 3QSYA 4IDQA 3I61A 3QI2A 5CM9C 2EYUA 1G6OA 3THXA 1E98A 2NTYC 2ZRHA 2NO9A 1G19A 1R5BA 2DWPA 3EWSA 2P5SA 3GD7A 3P32A 4EPWA 1P9RA 1JBKA 5K8TA 2PCJA 2O0JA 2CK3D
chains in the Genus database with same CATH superfamily
2BP7B 5ER6A 6REQB 2XTZA 5L7YA 2MYTA 3L01A 3Q7TA 1A77A 1BE0A 1Q0HA 4J3NA 4H31A 4JT8A 2MSKA 4J7UA 3OUZA 3GPBA 5D84A 4HWGA 2YC2C 4D5GA 1BS1A 4UASA 5CDHA 3PUIA 1U63A 3BJRA 4K6FA 2QT0A 1KI2A 1UM9A 4N0PA 1ABEA 3W9SA 3VDQA 1NR1A 1Y1LA 2L0XA 2PUJA 2WU3A 1IBCA 2FNAA 2XVYA 3CW9A 4IOLA 1DLIA 4LOLA 4TWAA 4YP0A 5AJHA 3D8BA 1Y6QA 1FDRA 3GFVA 4XQEA 5DNEA 3HDQA 3GRYA 5A9SA 4IUDS 1AC5A 6PFKA 2XQKA 4FCTA 2EBHX 4IIJB 4IIHA 4CCAA 5AKJA 3R8CA 2VWGA 3VTAA 3EFHA 5C4GB 2CXOA 1LVHA 1NBWB 3DKVA 5AXCA 4OGGA 4GOKA 1O5TA 3EEBA 2B8TA 5EMNA 3L0ZA 2NYVA 4HDSA 2QMHA 4C5BA 4FFVA 3NFYA 4CQNA 5LP6B 1XLTA 1WMEA 2P1ZA 3SP1A 1ZOIA 3IKLA 3VPFA 2X8WA 1JKJA 2PXCA 2RAUA 5BY2A 3THXB 2ZT8A 4KQEA 1WX1A 2F7SA 1U6JA 2X1VA 2DXIA 4XWOA 1E2JA 1CUVA 1AXEA 2ATEA 1TTPB 4CLOA 1AJEA 2BISA 3MD0A 4AJEA 2I2FA 1ESCA 1GEGA 5E9JA 1SBNE 2CF6A 4KKVA 2Q3BA 2CMFA 2Z9BA 3G9QA 3DMPA 3AU9A 1ZD5A 1GPWB 3ZHCA 5DNAA 1J8DA 2G9ZA 4G4JA 3C1TA 3CUSA 3HWSA 4IIBA 2ZUEA 3Q2KA 3X1DA 3GA0A 3EXFB 3HCCA 4NMLA 1QMGA 4HNQA 5JS2A 1P2UA 3SF8B 3UT5B 4BBJA 3DL7A 4RMJA 1U9ZA 5A04A 3C74A 3SJUA 3D3QA 2ZIUB 5JH7F 1EG2A 2UV8A 3KPYA 3OZUA 1FFCA 4NKRA 1L0BA 1IPFA 5JECA 4U7FA 3NASA 4TV9A 2O7SA 3WK6A 4R01A 4UNSA 4DVGA 2FEOA 4UMFA 1TLFA 2XUHA 3FYHA 2FWBA 3ON5A 4GR4A 1ACMA 2J45A 2D06A 2FWNA 1U3VA 4FMCB 4X60A 1LNQA 1Y5RA 4LC0A 1G21A 4D97A 4YI3A 3MGAA 2HHAA 4LDQA 2RAFA 1N5LA 1P44A 1Y3DE 2J9ZB 1XF1A 3LD9A 5KREA 4LGYA 4DQVA 4KNWA 4ZP1A 3KT3A 4GKJB 2BTQB 1HGXA 3HCNA 4PIMA 3VR5D 3JQBC 2OESA 1XJQA 4IJ5A 3JV7A 1BTOA 1TYCA 3HVUA 4FXPA 4OKIA 5DHAA 1ZJWA 1GYQA 2G1AA 3T5TA 1CBUA 4HADA 3HJRA 5AYVA 1YCDA 4ZEOA 2WPDD 1A69A 4BFCA 4E5DA 1ECCA 1BHJA 2Y1OA 4ACAA 1QZUA 4D9EA 1QE3A 2IL1A 3D7KA 4JC0A 5FUMA 4TLEA 3TBHA 2HA4A 3F3SA 3RVLA 2E49A 3MS7A 3VAAA 5AW7A 1ISRA 3VDRA 3ILYA 2JLZA 4NNJA 1TAQA 2P8JA 4OHZA 1OIVA 2VYVD 1EGVB 2PLFA 3BXHA 2UDPA 3BWDD 4PFKA 3TL3A 3K9WA 3EPPA 4WVLA 1YACA 5J40A 9GPBA 5L8VA 1GNTA 1YO6A 4WFQA 4Z3DA 4RTRA 4PG4A 4O4HF 4CF4A 1IQPA 3AHEA 4M0PA 5BV7A 3MPOA 3VR6A 5GADl 1LBQA 1KEKA 1A9PA 5LXTB 3AW8A 5EE0A 1W5BA 1XCPA 1WKBA 2ZYAA 3K9CA 1ZVMA 4RVCA 4B76A 3MLEA 2IOFK 3G8BA 4UEOA 2AV6A 3TAXA 3BZBA 4UM9D 3SGLA 2Z8ZA 3IOYA 1F17A 3N70A 3P0HA 3MCVA 1LUAA 1CQJA 2JK0A 3OTGA 4F38A 1Z16A 2HMYB 4E12A 3CG0A 4OGWA 4AJNA 1CUBA 1EFPA 1F0KA 1XLUA 4LS3A 4OHXA 4PV7A 1JILA 3ANSA 4A15A 3L02A 3WIUA 4DV2B 3BRWA 4A2PA 2JGDA 1IAVA 5JBNA 5HUHA 3AFOA 2I54A 3NC4A 4O02B 4AP9A 1EUDB 1XTRA 2I6SA 2OBLA 3C15C 3ESDA 3GJQA 3SF8A 5B4VA 1E2QA 4TS3A 2J3DA 3V7YA 5BUSA 1P4AA 2PANA 2OILA 4MI9A 1BCSA 3JR7A 2O8CA 1Y89A 2G83A 1F3LA 2WVAA 3LXUX 3R5HA 3EYAA 3C3WA 2X22A 3AOGA 1ST3A 4MRAA 3SYMA 5FA8A 3K5HA 5TS3A 1ZGGA 4KQ1A 1VA5A 4MVYA 3E4DA 3ZX4A 5IJ0A 3NC1C 2AMYA 1XDWA 1UOOA 1I24A 1A96A 5EUBA 2WG1A 3HKCB 2OYRA 1M1UA 2B7LA 3NKFA 4UU1A 1J97A 1U2TA 4QGBA 3RV3A 1Y4ZA 4U3JB 2P90A 1XZEA 4MICA 4B5LA 3H4TA 1C7JA 1E3QA 2C2XA 2E4XA 4A1OA 3MT0A 3NHFA 1LBSA 1K6IA 4NJMB 1P80A 2BV3A 5LJIA 1SOVA 1O9GA 3THSA 1YRHA 2I55A 2W6ZA 2X3YA 2BUAA 1A5ZA 2YOGA 3FOWA 2O5RA 3PHCA 3R24A 4DKJA 2GN2A 2P4UA 3T6KA 4O2AB 3ZU2A 1TYDE 1QV7A 1JHYA 2PZBA 1CY7A 3M49A 4B3MB 2BUBA 3B6MA 1QFJA 5A5EA 3GFGA 4LDPA 4TTRA 1N6KA 5A4FS 4O4JB 1I5EA 5THXA 3NPAA 4J0DA 3IELA 1DBRA 3AF6A 4PEVA 4CZ2A 4F4DA 4TUYB 3D8UA 1VGQA 1G64A 2IBSA 2Q6LA 2FZ5A 3TQRA 2NZ2A 1VLLA 3DWIA 2Z5LA 1MTOA 1EXDA 4IH1A 2H51A 4PSVA 5AVRA 1ODLA 3HDGA 1Y8ZA 2J08A 3VUFA 1OE0A 1RHQA 4NFLA 5SZHB 4B8WA 1JEOA 2FVYA 1JL3A 3C41J 3CPHA 1H2HA 3OPVA 1RIFA 4L7QA 1TZJA 2WNIA 2OHIA 2P6OA 3PQFA 4GOLD 4QWWA 3WLFA 1O94C 2IYZA 5G4LA 4TV8A 1CJTC 4UE6A 1L4UA 4MJ3A 3ZTTA 2AFIA 2AD1A 5KTNA 1VJ1A 3GLGB 4AVYA 4LFAB 3A7EA 1TZMA 1WB5A 1SA0B 2AIRA 2ECOA 2JEOA 4G0ZA 4X41A 3TRFA 5LDHA 2JIDA 4GP6A 1F2VA 3FZGA 1KYXA 3R6DA 3PUXA 4XRGA 2E6UX 4B6PA 1TC2A 2NUBA 3PXEA 5CIWA 3O9MA 2G88A 3N8IA 4UBIA 5CH3A 4EO7A 5AHWA 2O59A 3UUWA 4U9IS 2ZSUA 3SD7A 4MW0A 2OCBA 3FPEA 3PI7A 3HP1A 4E5PA 4RF2A 5HJ7A 5G1OA 1XO1A 4OGKA 2I8LA 1NJ2A 3DAYA 3AEXA 4GWKA 3T5GA 1E5DA 1ZISA 2O2GA 5EERA 5TQ0A 3RI3A 5IN4A 2WIAA 1EUDA 1THZA 3FYDA 4RVSA 4ARVA 4OHKA 1FS4A 1QH9A 3A04A 3N9IA 1DJQA 1CFJA 1OR8A 4LQLA 3IALA 2LIVA 1V6CA 3R3JA 4KL8S 1H66A 1ADYA 1AUXA 3KD2A 5H3CA 4YRNA 1JFTA 2VRBA 1TMOA 2H0RA 2X23A 2R6R1 2G7ZA 3LGXA 4U7WA 2BC9A 4M54A 3CV3A 3ITKA 2CUNA 4ZT2A 5CIQA 1ZOLA 1QHIA 1JGTA 4UHKA 3CPEA 1TRHA 1AB6A 2R8YA 2Q45A 4LZZA 4URFA 1C1XA 3RC2A 3RF6A 4Q7EA 3PR3A 4QU8A 1M83A 5EYPB 5IC6A 4ZCTA 1FTWA 1YUMA 2NLOA 3DEJA 4Q47A 5IMSA 1Y6GA 5A3JA 1MC1A 1EVLA 3K0FA 2CNNA 3L1HA 4U7GA 3IQIX 5AW2A 4QEKA 4L0CA 1KJJA 1PRYA 2JJQA 3AJ8A 3KJZA 1V16A 2FKNA 4JKOA 3VHXA 3OZFA 2HY7A 3IBGA 3FYTA 4HLDA 2GUWA 3LSYA 3WLNA 1N33B 2NNLD 4FWTA 1C3EA 1G17A 4ZGGA 1AE1A 4DA0A 4DQLA 3OX3A 4RDHA 3PLRA 1VE3A 2JCSA 4QQFA 2UZAA 4BGUA 4CLEA 1U8UA 3VI4B 3OWOA 3L3BA 2HIMA 4GZ5A 2C4WA 2XZLA 3FLBA 2Z30A 4K26A 4DLSA 1M8FA 1VOTA 1GU1A 2FGJA 2CLHB 5ALWA 3LHKA 5K0TA 3GLFE 4S12A 2M9MA 5K0ZA 3FR7A 4RXMA 5J59A 1KARA 5DYIA 3WKAA 5KQGA 2FV8A 2F90A 4S1WA 3T9EA 3TIVA 4HFRA 2OWEA 2PX3A 2O7QA 1GZDA 5ERGB 2R6JA 3IE0A 3AKEA 3EWAA 5EWJB 5F2EA 1ND5A 1RWMA 4O08A 4B46A 3MK31 4RJ2A 4MK4A 4DDWA 5JCJA 1O0BA 1R18A 2GAIA 4TV9F 4UPEA 1QM5A 3OJXA 2V5VA 5H4HA 3SS8A 4IOMA 1IDOA 4BTVA 5HOQA 2DKOA 5DSZA 2GOYA 1T0JB 2UZ4A 2IYPA 2ONZA 2R8BA 5MGNA 3A58B 3A4YA 4HFMA 3TLBA 1M2FA 1IFXA 4UNRA 4FMCF 4LAFA 2O3TA 1XXHB 3T7AA 2XXAA 1GPDG 4E5KA 3CVOA 2Q0HA 1U94A 1QLHA 2PIAA 1P62B 2RCYA 4P22A 2R751 2VZEA 3REQB 4LRUA 4CMGA 3G49A 1ZVJA 5E8RA 4LHVA 4ILEA 3BMNA 4DHWA 3FGZA 3KJQA 4U7HA 1QUFA 4ZOLF 2XDYA 1DOAA 2B2XA 4CYMA 2QRKA 1GFZA 3DOUA 3JAMA 4ZO9A 2YV2A 4F2HA 5KB3A 1MXHA 3NHZA 2VQEB 4H9GA 4P0TA 2NN3C 1ATIA 4P9NA 4R7TA 2EDCA 3DZGA 5ELLA 2O50A 4DMGA 1M1YB 1NJSA 4XFJA 1NXVA 4R1LA 4LZLA 5F3DA 3TB6A 2Y92A 2V7QA 4ZCIA 2I6TA 2QRVB 1SHZA 2QUIA 3WK4A 4JBHA 1RCTE 2ZATA 3IHTA 4YJ2F 5DBEX 5HDBB 1V7QA 3EWNA 1TM4E 3T9DA 4RD3A 4JBYA 1RXUA 1JJIA 1XTJA 3B5JA 5HZKA 1IWOA 2VCEA 1QQTA 5JNSA 4YP7A 3TAHA 3M3PA 3ZE6A 4QJ4A 2UZ1B 2GN0A 5BNFA 4E14A 3WQRA 1PJBA 3PD7A 1ACLA 2PJUA 4GI7A 1U8TA 4Z8XA 4RC9A 2ZM5A 1RBQA 1E8MA 1A8SA 3VPHA 2A9RA 3UYLA 2HMSA 3SE7A 3WYAA 3QEJA 4DCMA 4NBLA 4E4YA 3HO1A 1KWGA 4D4HA 4OAPA 3MAJA 1AKYA 4M1MA 5FBWB 1D8TA 3TL2A 3WYGA 3U4QB 1M73E 3HJFA 3EXIB 1Z07A 4BNYA 3K3PA 4BCCA 5C7IO 2W6MA 2ORIA 3CWZA 1KHHA 1CUCA 3WYBA 1H2RS 4NJEA 1HTWA 2FEXA 2Y67A 4ZREA 3VZPA 3WQHA 1JIQA 2RMKA 4ETNA 1ZZGA 2LVBA 3A0RB 4IX9A 4B6FA 5JQGF 4MW1A 2BGLA 3AY0A 3V8MA 3IR7A 2VWQA 4KK3A 4B6EA 4YHHB 2IF0A 2N3ZA 1OWLA 2W11A 2VDVE 3Q6MA 2IELA 5EN4A 4CMCA 1HE3A 3LE8A 1WEKA 3V8EA 3SICE 1WZNA 4YYZA 3K71B 1P8AA 1QHHB 2XDQA 2J5RA 5IT0A 2PUCA 4LQDA 4YBZA 2GHQA 4DLUA 2FN3A 3LT1A 1MNQA 1JFFB 4D4LA 1YI0A 2DR3A 2YYAA 1YZTA 2ZBEA 4IV0A 3F74A 3ZU4A 3PXGA 1TQ8A 1IQ0A 2F4NA 2I4LA 2OFOA 1V3TA 2L69A 1BOOA 3JZDA 4TXNA 5I7FA 5J58A 1JDSA 1XNQB 2ZT7A 1U7ZA 1L5HB 3KX2A 4LNAA 2JIOA 4BB9A 2PRSA 1LTQA 3AIIA 1TCUA 2HMVA 1PR4A 1RAAA 1EWYA 4D6PA 4FLEA 3KHSA 1NV9A 2QTNA 3PNVA 5I8WA 3OPYA 5DCWA 3KXLA 3OTIA 3H5AA 1QO9A 2ET6A 1D4ZA 2BFDB 2XVMA 4J8PA 5JAPA 4OQDA 3H84A 2CB9A 4I4IA 1BS2A 1C9MA 3OQJA 3U3JA 3B53X 5A4IS 3SI7A 3WMFA 2GYYA 1GG8A 2EJTA 3GZJA 5F52A 1Z75A 3DL2A 5TPWA 1PFKA 3WYCA 4D3YA 3IO5A 4F2GA 1QHFA 4I55F 5B7GA 5AVTA 4DWJA 2Z09A 3KVVA 1LGYA 4KLCA 4QECA 4EHAA 3IPRA 4RPIA 1RXCA 1YA8A 4PLHA 3AIKA 1BJRE 1IY2A 2ZSDA 4XQCA 3BPSA 4KE8A 1G20A 5DEIA 3M3HA 3U0VA 3CLVA 2R2AA 1B7GO 1OFGA 1Z73A 2OB1A 2ZRAA 3KPVA 3HR7A 4HGNA 5TT0A 4C0HA 1ZM4A 3DEYX 5AVVA 1AA6A 1NKTA 4JI4B 4RK4A 4DQDA 4DABA 3H6HA 4Q3AA 3PNSA 4N3NA 2EXXA 5K2OA 3U17A 2SKDA 3OE4A 1IUNA 1ZK4A 3ZXXA 4JASB 1C4KA 1SQSA 1D2HA 5IBQA 2VSQA 3V1MA 2G40A 3S27A 4L0QA 4EG5A 1OX6A 4JLUA 1YGYA 2X0IA 1TJPB 1R6VA 5AK3A 4EHLA 1XZGA 3IKJA 4D42A 1M34E 2EX4A 2PCLA 2FSPA 1U1FA 2H85A 5HK9A 1YJ8A 3TR5A 3CU5A 1W0JD 2J1LA 4Z3KA 3VZSA 4LSZA 1KQGA 3OPYB 1ISJA 2Y1XA 2WP0A 4LE0A 4EF4A 1U9JA 4Z9FA 3K0HA 5A3SA 4G1FA 2VWPA 3ZZNA 1DZIA 1WNFA 4R3UC 2PR2A 2HF8A 3TQQA 2GRAA 4UKDA 3U0BA 5CG1A 4D25A 1R6BX 3R3ZA 5KNBD 1IBRA 2BF4A 5I7HA 1QIFA 3DULA 3JWEA 3M6IA 2PEZA 1NJ1A 3L0OA 1EFVB 2P11A 1ISPA 1XE3A 2V3CC 4V3CA 4JY7A 2AE1A 4PAQA 4V0SA 1W76A 2AH5A 1W2HA 2QLTA 3K35A 3VSAA 1IOZA 1WSDA 2A33A 3WAGA 1TK3A 4JC8A 5CH8A 3L6EA 1LDYA 2JATA 4QUKA 4BE7B 1Y4AE 5EMJA 2ZWMA 1BHQ1 4JIMA 1ONPA 4HUTA 1F6BA 2RH8A 3WSTA 5CNJA 3LFTA 1NRJB 1WZIA 2AK3A 1P1FA 1FDIA 4IZHA 1NMEA 4F3RA 1W0KD 1PGNA 1FJGB 3UHAA 4B17A 3ZIUA 2WDPA 3DE3X 1Z88A 2FE4A 3R8FA 3OTOB 4M1OA 3TR6A 3WQSB 3WAJA 5JD5A 4RXUA 2PH5A 3E48A 3DPUA 3LDGA 3RAPR 4C5CA 1OFTA 3DDSA 1BDMA 3QSGA 5LP6F 1KFKB 5AM2A 1N5OX 4RH0A 1P33A 3VR3A 5AQEA 1EWQA 1DKRA 2AN4A 3V8RA 1H94A 4IDHA 5JNUA 1FFWA 1L3IA 2M1XA 2O2SA 3CH7A 3ZGNA 1U9IA 3TOZA 3OX4A 1UMKA 1RBMA 2B30A 3GW8A 1YRQA 3ZPXA 1NXSA 3AP3A 3FPCA 1A27A 1GWNA 3H97A 1JAXA 3B13B 3ELUA 4HNSA 3ZWNA 3T3IA 4K1XA 1C30A 5FI1B 1KYZA 1ISIA 2QKYA 2QD2A 5DNYB 3LW7A 3TZ6A 3RAGA 1U9YA 4HI0E 3QU4A 1YB7A 4IPTA 3AI3A 4OHPA 4E5SA 4RDXA 1A98A 2QQEA 2HRRA 3VNRA 1KSHA 2AG0A 4L5YA 4EH1A 5KOIA 5HM6A 1V7CA 1B74A 4QTTB 4AJPA 2FFRA 1MBZA 2LBPA 1VKNA 1TA9A 1YVUA 3A9UA 3CS3A 3FPLA 3NTRA 4D44A 3TG8A 3IRUA 1SUFA 3ZYZA 2PD3A 3AEUB 3ZWAA 2RHWA 5L6LB 3PNPA 5AUNB 1BDBA 1EAYA 1X94A 4M1YA 5ITSA 3PWTA 1H42A 1PBTA 1Y5MA 2CJWB 2FB9A 3CNQS 1LLQA 4L74A 1IVSA 3DW1X 2JCYA 3VNQA 3I9KA 3IPAA 3AF0A 4ZOAA 4BJ1A 1RE0A 2RGNA 2IQIA 4MQUA 4C4YA 4I1RA 4PYRA 2BGGA 4KSYA 2JI7A 2PSFA 1TXGA 2FPGA 4K9MA 2NNWB 5NULA 3CZMA 1C0PA 3HUTA 4QSHA 5BSRA 4V1CA 4OLFA 1A9ZA 4P4LA 4DRXB 3C7AA 1U4OA 3KBBA 1JWBB 4RZSA 1CRPA 3EDMA 5FT9A 2VQDA 3C1AA 2FW9A 1W0KA 1DDOA 1KBQA 4BP8A 5B58C 5IAOA 3ZDDA 4HH3C 5K3BA 3L41A 5B6JA 1N78A 3KRTA 2ZOSA 3LMKA 1JPNA 1DIAA 2WTMA 1YCFA 1KS9A 2H8GA 4IHJB 2JFZA 1XLVA 5SYAA 5JD3A 4UW9A 1T8RA 1RR6A 5T6BA 4XLTA 2WB2A 1QGDA 1IRXA 1QO0A 4JROA 1OLUA 2RK4A 3IT0A 3LLMA 3W77A 4RFLA 1DKNA 3R6GA 3ZE1B 9ABPA 2NPOA 1O0CA 2PGXA 4PO3X 1N0UA 4Z9BA 3GNQA 3OIYA 2GI4A 1BRTA 2DAPA 4FHGA 2A0FA 1KP9A 2QZ4A 4LSWA 2Q3CA 1XN4A 4EKIA 3HTXA 2IUYA 1JAIA 5TC4A 5B53A 3PUJA 3DT8A 3TRIA 1C41A 3WIOA 5B57C 1G2IA 2XMPA 4ZI7B 3PC6A 1GV1A 5J43A 3L7BA 1E79D 3ASUA 1FJHA 3MTIA 3R44A 1CQWA 1F0NA 2O23A 2Q3HA 3NBFA 3I58A 4DCNA 1W36D 4OF4A 3L6UA 3JQQA 2H5LA 3PIIA 2PT5A 5EQFA 1G3QA 4OSPA 3V2UA 4CTJA 4X1IA 1EWVA 3TTTA 4MVWA 4BQQA 3JQAD 3OKFA 1X7ZA 4Q00A 2DLNA 1IPHA 1QVWA 4K46A 2C7QA 2DBQA 2YWFA 1SK8A 3QVMA 1GPMA 4Q9LA 1FNCA 4KAXA 3JQ6A 4ZOLA 2CHUA 2ZJ8A 2V9CA 4PNHA 4XB6B 1DEKA 2ORVA 4NZZA 5DULA 4EHHA 3WRYC 3KWJA 1C7FA 4KBYA 4D0RA 4HB0A 4D46A 4DOMA 4LBVA 1IBKB 1SIBE 5LYJB 1F06A 5HRAA 1C8BA 3KJNA 4GBJA 2F3UA 5JFOA 2GJKA 3LK6A 3CPSA 4MB6A 5IDQA 3T9BA 3N6VA 4I50F 1BXRB 4MINA 4DJFC 2O8EA 2Z6VA 3QXSA 5ES4B 2FLKA 5K01A 4IFIA 3RVNA 1VDZA 1FK8A 4ZYTA 2W5UA 3C14C 3AL0C 4R6WA 4D0NA 3RVRA 2V6MA 5GP1A 3IODA 4XVQA 2R1TA 3RIXA 1JEYA 4Q3DA 5DX8A 4ZCPA 3ROFA 2A86A 4J0QA 3HBMA 3AESB 3QYPA 5KMGB 1DKOA 1N8KA 1T0IA 3T7CA 4U6QA 3H1AA 4PPYA 1O97C 1M34B 3PNOA 1T8WA 3ZLUA 4BTLA 1QCZA 2IIQA 2AOXA 4QDJA 3VC1A 4CM5A 1BRMA 4Z4CA 3S81A 4YROA 2I4IA 3KLBA 4P5PA 4H7DA 4OH7A 2IX9A 4I08A 3KKPA 5JVDB 4BJHB 1XCGB 3BK1A 4MEBA 5DE3A 1M67A 2X6TA 1NVXQ 1PFQA 3EGEA 3GRCA 3ISVA 3ULKA 5ITZA 4CV1A 4Q9HA 5JRZA 3WYEA 1B8OA 4PYJA 4G36A 4XUEA 4HF7A 3P8ZA 4HTAA 2CZGA 2XUPA 1OI3A 1RP7A 2ZZKA 4Q3NA 3DMYA 3SAJA 4DTIA 3O4FA 3PUZA 4JYPA 4F6CA 1L5VA 3QMPA 1YZLA 3CBQA 2XNHA 3LYHA 5JBQA 4N5IX 3N53A 5JASA 3LXRA 3MGGA 3KZCA 3O4VA 4FFBB 1RYDA 3TTWA 1BFKA 3DE6X 3N0WA 3UC9A 3AVOA 5H70A 5J5CA 2D1FA 1VJCA 3ANMA 4Y0VA 5SICE 1HT2E 5J63A 2BW0A 2XVZA 3H5WA 4KSBA 5HA5A 4M2LA 1CUHA 1G6KA 4MKHA 3UM9A 1MHTA 4HNAB 4MUHA 5BSVA 4RE5A 3NORA 4Q9DA 5LFAA 1RYEA 1TQ6A 2YV5A 3D6HA 5H68A 4EAQA 1ETUA 5CX1A 3IE2A 3LVBA 4R2MA 1S2LA 1GV0A 1LS6A 4YRBA 5P21A 1GKIA 1IBSA 1XTBA 3P4YA 4XM0A 1L8LA 1DTWA 2EL9A 1Y6ZA 2ZIXB 2X5KO 3VR4H 1Y8CA 5D85A 2GYUA 1E2IA 1TM2A 4EVIA 1KL7A 1J33A 1K7XB 1OLXA 1ZJJA 2JH9A 4NESA 3ZE0B 4QTUB 2IYTA 2QJFA 2ZVPX 2I2BA 2OGWA 3C3BA 3KOYA 3Q8WA 1SU8A 3QHQA 3ZU5A 4YAIA 4YJGB 3TLXA 4YRKA 3Q7SA 4UQOA 4MITA 4MQFA 1WPRA 3GOHA 4AQDA 1OF1A 2RH9B 2C2MA 4RHXA 3F7MA 3S6JA 4AJLA 1OX5A 3SFZA 3WRVA 1P7WA 2ZWPA 4L6CA 4B3SB 1HQCA 1VJDA 2GRUA 3VJLA 3MWDB 3V8QA 2OAGA 1UJ2A 3K9HA 3CSSA 1QG0A 2P9BA 1LK5A 1S3FA 2RGXA 5DYTA 2G04A 4DPMA 1RWPA 1H1DA 5FCDA 1SB8A 4JUBA 1E3WA 4MGYR 1MH9A 2HLHA 2OV1A 2YW9A 1PZFA 4BKOA 4BIIA 1XGKA 1SBQA 4GOMD 1T6ZA 5E2AA 3MQ4A 1ADJA 2GASA 3AXTA 1Q7GA 2HXSA 3USZA 3EFBA 4ITVA 1PV2A 3ESYA 3KJIA 1SIWA 3CR8A 3QLUC 4BN5A 2A30A 2V6BA 3QPUA 1MX5A 1BNCA 5T8KA 4BVAA 4AICA 5G1NA 2DBYA 1HOXA 2YINC 4WNCA 5LQDA 2JFYA 3EA5A 3UXYA 2Y1KA 1CQXA 3GP8A 1U3CA 4XWWA 4W1SA 5FPPA 1OWNA 1VECA 2H1WA 4ZQCB 1U2GA 3PUHA 5DXJA 1MR3F 3GLQA 3I9FA 5TF0A 3TD6A 1IXYA 1SVSA 2GSDA 1WLSA 4LSGA 1QTQA 2XB9A 3AILA 3CVJA 3DDZX 3QUQA 3S2GA 2VQFB 2BH9A 4QFMA 4XJTA 4DREA 3DT9A 1YBMA 4NAVA 5DYWA 3SBDA 2VDRB 2KI5A 4J94A 4TVSA 3IQHX 1TZCA 5EHXA 4CT0A 5B1IA 2IS4A 3WRWA 5L7TA 3M4XA 3EGOA 4MPRA 3KBOA 1K63A 1CVLA 4DA6A 1CJVC 2PUVA 1Q22A 4OCZA 4PONA 4P2GA 4CM8A 2GK6A 2YWHA 5C8YF 1RYMA 4TV9B 3I2JA 1MABB 4WERA 2FP4A 2JAWA 2YNMC 3IR6A 4QGHA 5ALRA 1KH3A 1NQ5A 3TEMA 5CA1A 2J5BA 4YRSA 1EP1B 4Y2QA 4TLDA 3H1FA 4PZEA 3U1TA 3S7TA 2PO5A 3UG6A 4JOCA 1NNI1 3QNWA 1XCJA 4L5JA 4BEJA 3BMOA 1UAYA 3QHPA 4F9FA 1HNXB 1J0AA 2X9LA 4IVNA 4YP9A 1L7BA 3FHOA 4O5AA 5BRAA 2C1EA 2VK1A 3MA0A 1Q84A 3D0OA 3BSYA 7MHTA 2PXXA 3JYNA 3VOTA 2XZOA 2B3TA 1SEVA 2QR3A 3ZDXB 5LMCA 1QH8B 3NHUA 1RMYA 4FZVA 4D3FA 1KFEB 1TEVA 4AG3A 5I7EA 4L9RA 2JPDA 2XRMA 2G1PA 5JSYA 3NG1A 3MTAA 2N1BA 5HZGA 5TQVA 4ARIA 1HC7A 4GWLA 2FZCA 3TGLA 1XU4A 3ABQB 3H2IA 5EQTA 5J2UA 2DETA 5BN3A 3HRKA 3OH8A 2ZZNA 4J0HA 4OBXA 5AVXA 3MUEA 3OM1A 2WKRA 3IXQA 1XTSA 4GI2A 4LC1A 3QELA 5FBHA 2RBGA 4AMYA 2V96A 1XMOB 1FVOA 2AW3A 2BGRA 3KOOA 3PHGA 2YY7A 1T29A 2JASA 3EIEA 3I2YX 3O0TA 3P2KA 3QE0A 4AMUA 4DJEC 4E2FA 3P9RA 1ONBA 1DAEA 4IICA 4CQMD 2LRHA 1GQ2A 4YRZA 3CA8A 3JVDA 5KX5B 4NCKA 2J6BA 2YHAA 3J7AC 1GA4A 3SBXA 4WK2B 1NJ5A 2J5XA 3GN1A 3IBCA 4IZIA 1FFGA 1ZA2A 1DZ3A 3HL0A 1WXIA 1D2EA 4BNTA 2Z2XA 2PKCA 3EVGA 1M8PA 1REQA 3GFOA 4YMVA 2F1IA 5THQA 3TK1A 4CM9D 5EJGA 3SX2A 4L22A 2EGGA 3RHFA 4J1TC 4K28A 1U8FO 1Z83A 3ITNA 2ODPA 2QENA 4US0R 2P2SA 1GITA 2PK3A 1LPOA 3GCGA 3OHMA 4HNAA 2VYCA 4HS4A 4BNGA 4W5QA 4AB1A 2VHJA 1YU6A 1FZQA 1SUBA 1QDEA 2IZOA 5B58T 3VR0A 1NN1A 1TLTA 2TECE 3FHCB 3ZS8A 1AQLA 2ZANA 4QHSA 3BGDA 1J6UA 4RACA 4DANA 2QN6A 1X8XA 2JCBA 3LDUA 3GJ0A 1F8UA 1XAIA 2RC6A 5GONF 3CUKA 3E22A 4DV7B 4J76A 5E7QA 3EXG2 3CHYA 3LCVB 2X8AA 5TPZD 1QC5B 1YDGA 1R27A 3PHBE 2YJGA 4FCWA 1GRVA 5IUNC 2VRNA 2JI4A 1DC4A 10MHA 4UTZA 3GLTA 3GLFB 3NEAA 1ZVKA 4IUCS 4WBXC 2QSUA 3FHLA 1W5EA 3ANTA 4X64B 4CN9A 5GTDA 3H5NA 5KNDA 4ABTA 5ALLA 5DNWA 2JD1A 5E2IA 1SRRA 1EUZA 3KZKA 3ZLTA 1KI9A 3ZGYA 5JNWA 3ERCA 3I83A 1ECJA 2YUIA 3R7WB 4TL8A 3VSEA 4DN6A 4KAAA 3MWDA 1SY7A 5CEFA 1EAMA 1US8B 3L6DA 1KPIA 1KYWA 3B1KA 4HZIA 4LEIA 4TKVB 1UPBA 1WD5A 4B82A 4GDFA 3I23A 4LXYA 4RYDA 1J7KA 4MP3A 2FN9A 1VYTA 4KN9S 4O59O 4B87A 3UB3A 2FF5A 5SY9A 3CUTA 2WHEA 1BX0A 4LV5B 4PNPA 4Y6SA 5AJTA 3U7QB 4B3FX 4NFHA 2XYHA 4PZ0A 3A4VA 2GCOA 1T9ZA 3KFVA 3JPWA 3A1UA 4U00A 1VGVA 3M5CA 4JVLA 1FDTA 2DUWA 3QY9A 4XIFA 3MRTA 2CBZA 2JAPA 3IX7A 4Q1BA 4ZRNA 1U2PA 1NLFA 3ZZUA 2ZE8A 5B36A 4OFXA 1DI0A 3QRWA 2G5CA 2IXEA 5IG2A 1L8OA 1W0JA 1XT6A 3IMKA 5JHGB 1KE1A 2JLCA 3FUTA 4GIBA 3FFBA 3QLVC 2GPSA 3UFXA 2BFFA 4YVFA 3HK2A 3K05A 4XXHA 3W04A 4G85A 2PH3A 2A7QA 1Z3IX 1ZQ9A 3I1YA 4JBXA 1A04A 1N1DA 1A8PA 1WP4A 4OMDA 4PSCA 3KTAA 3NBMA 3T4XA 5TMPA 3HA5A 1AQ6A 4AK9A 3W6PA 3QUAA 2Q1SA 4GG1A 4DIOA 3C3YA 2VP0A 4E2WA 2PXAA 3M7IA 4QFBA 3WL6A 4L02A 1EHYA 2CK3A 1JDVA 4JLSA 1V35A 4R1NA 4GOJA 4YPFA 3QH4A 4WBNB 2YS7A 3Q98A 3KR0A 4G1EB 4ZQIA 5E3JA 4TROA 5ISMA 4HOYA 1O03A 2I4TA 2IXFA 4ZTUB 1OJLA 3H9QA 4N3AA 4RK5A 5I9MA 5LMZA 2NSYA 2ZUCA 3L8DA 4GLLA 4LBZA 3RFUA 2AFHB 4MR9A 1W96A 2HWWA 1NKSA 1HE2A 2HQOA 5BVHB 1ZH6A 3IDZA 1ZOPA 3MC1A 3JQFA 4BKMA 1IH8A 2HJ9A 1YDFA 3A7DA 4N65A 1BWRA 1NVVQ 4Z6KA 4PWYA 2IZ5A 2WD7A 1VJRA 3QX3A 4C7OA 3QVTA 3L1VA 1RT9A 3IURA 3M4YA 4KOAA 2ZRKA 1E2FA 3GJ5A 5JXGA 4N40A 4N5NA 3GEEA 3ETHA 3KVOA 3BILA 1THMA 1ZD1A 4K86A 4QM6A 3GR6A 1JQAA 3GHYA 4G41A 4UJ5A 1U7DA 1PFWA 3M1AA 3KYIB 4AZTA 1DEHA 5GPBA 2ZYWX 1GLNA 4M8LA 3AHHA 2WAOA 3B2NA 4WTOA 3TTSA 1D5WA 2X0JA 2FZ4A 4DA8A 2ZR7A 4KGDA 4C2BA 3D7SA 3PYMA 4V0RA 5AVZA 2PUGA 3K1AB 3SDSA 1JSLA 2DH5A 1I14A 3NHJA 4KFRA 3WK7A 1P4HA 4F4JA 2QAJA 3TJRA 3NV9A 4AYXA 4OHRA 4EITA 4DCOA 3DBRB 4Z0NA 3FBTA 4IWYA 5F1KA 2FPPB 4UVDA 2HSWA 2PJRA 1TRKA 2BMVA 3X1YA 3BH0A 1PKXA 4ZAVA 1MV8A 3A2NA 3LUGA 2AWNA 3FTPA 3NHLA 1OXMA 2FW7A 2ZYGA 3WA6A 2B4YA 1Z7WA 1L4NA 1VMIA 2AOUB 3NETA 1KJYA 4HLUC 4RK1A 4A6XA 4ESHA 4OAOA 4ZHSA 1E3DA 3LF2A 1KF0A 2XAUA 1FPMA 1ZQ1A 5EXTA 3RASA 5TY0A 4E11A 1ODKA 3U2QA 3M89A 4YRJA 4OI2A 1P29A 3DBHA 5F7XA 2VH2A 1LBTA 1GUDA 2RHLA 4K9LA 4OGFA 3IXLA 3TI9A 1MB3A 2FSHA 3D4PA 3UCEA 2DX7A 4RKWA 1LBHA 1F4LA 2PAAA 2R00C 1JQEA 3VDNB 1OX4A 3F0TA 3P2YA 1R8SA 1XG5A 4JJEA 4F2PA 3LX6A 5C7LO 4WEOA 3H2KA 1JS1X 1PNVA 4TMKA 1UDAA 2LP4Y 1TUIA 3E8MA 2EG5A 4HAIA 4YGXB 1EE2A 3EW7A 4ZCRA 4IF4A 3ZHSA 1FUEA 3MJDA 3MTBA 4AWBA 2X9QA 3JVVA 4DQ0A 1BGWA 8GPBA 1K6XA 1LTHR 4OUDA 4CBVA 4G0WA 4O4IF 3VPDA 3D0QA 3FCUB 2VDUE 2YTZA 4FD3A 4FZRA 4OATA 4JZKA 3VZBA 4HNTA 4B6JA 1QU3A 5TR9A 1KVUA 1KSGA 3PCTA 4EPRA 1N5RA 1YL7A 3C6QA 2FEAA 5KTTA 3OQ1A 1QWOA 1CJUC 2DPGA 2O2ZA 2OE2A 1P5ZB 1HYBA 3IEPA 4YP5A 5LA6B 4DJJA 2UYCA 1R00A 2UYOA 4X6LA 5CR9A 5J4LA 1T5TA 2Y27A 3ET4A 2Z3WA 3LO8A 4JCOA 2IZZA 4DFDA 3AR5A 4EK9A 3BXEA 2QN3A 4QDZA 3HWRA 1YDHA 4LDAA 3J80A 4QRIA 3AM4A 5FPYA 1BH6A 4B35A 4ZV4A 4ETWA 1T3HA 2DTDA 3AWDA 2W0SA 3ECCA 4KQJA 5AW8A 1M0EA 1NZFA 1QU2A 2OP0A 3QKRB 4NCJA 2ZPUA 5AI5A 1KO4A 9LDBA 4EJSB 4TRJA 2KLHA 3GAZA 2XEXA 2CNWA 3M6LA 1JEAA 4UHEA 5D5HA 4EB0A 3W9BA 1TKCA 4MR8A 4LVUA 1XQ9A 5FL7D 1UODA 4ZQHA 1N1EA 3R6TA 3DE0X 4ZVLA 4TKLA 4B31A 2GVNA 2DB3A 2ZKIA 4Y2TA 4ZRMA 4FOLA 4D9IA 1CERA