4L08A

Crystal structure of the maleamate amidase ami(c149a) in complex with maleate from pseudomonas putida s16
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
206
structure length
206
Chain Sequence
b'QKEVYDAAGFGNPVSRGVHPAIIVVDFSYGFTDLQYPTASDASLQMSRTKEICDLARALEFPVIFTTIAYHPGEIPMLPWLEKSSGMAALLYGSRLVEIDMATGIQPNDVVVVKKGASSFFGSTLSSLLAGTNTDTVVVTGATTSGAVRATVVDAVQSGFKVLVPADCCADRAKGPHEASLYDIQQKYGDVTDSDDILKWLRSVAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydrolase, isochorismatase family
publication title Structural insights into the specific recognition of N-heterocycle biodenitrogenation-derived substrates by microbial amide hydrolases.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Hydrolase
total genus 70
structure length 206
sequence length 206
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00857 Isochorismatase Isochorismatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.850 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isochorismatase-like 4l08A00
3O91A 2A67A 3HU5A 3PL1A 4WGFA 3O93A 3TG2A 1XN4A 1NF9A 4H17A 4L08A 3O92A 3TXYA 1NBAA 3LQYA 1NF8A 2WTAA 3R2JA 4WH0A 1YZVA 3HB7A 1YACA 3S2SA 2FQ1A 1ILWA 3IRVA 3MCWA 2H0RA 3TB4A 3R77A 3KL2A 3UAOA 3O90A 1X9GA 3O94A 3EEFA 3OQPA 3V8EA 2WT9A 4L07A 1J2RA 1IM5A 2B34A 3OT4A
chains in the Genus database with same CATH superfamily
1CY8A 2EFCB 5CLFA 4EG0A 4BRSA 4HWKA 1AK1A 2N75A 1JQ5A 1MIOA 2XRYA 1D4FA 2B21A 3G5UA 4UHFA 1KSHA 1P7VA 1JU9A 3R5JA 4ENPA 3BF8A 2X0EA 1RKVA 2B37A 4IHJF 4U1RA 2VDJA 2RBGA 4FCVA 4BEWA 2VNKA 4CEHB 4CL2A 4U9HS 2NP6A 2FUG6 1HNNA 3A4LA 3DLAA 1XTBA 2HMUA 1T2CA 1GQFA 5CTJA 1FPQA 3P9YA 4DLWA 3R6WA 2Q3HA 1KDVA 1OVGA 4Z54A 4NOJA 2NT3A 3L49A 1B26A 1Z5ZA 3UATA 2PHZA 4CCYA 1YQ9A 4M7WA 1HE3A 3CX3A 3PQ3A 1JJAA 4N9QA 1BG6A 4I4IA 1SUPA 4M0UA 3ETJA 1WSAA 3UOAB 3HDVA 2QQ5A 3QHPA 4Y1RB 2EJCA 2CVOA 4F2DA 4OLBA 4MLZA 4CKXA 4U2FA 5KYKA 4R71A 3ZIAD 1MEOA 3RADC 1RMQA 1SXJC 3OTGA 1T9CA 2PV0A 2QOEA 4DT1B 5JJCA 3TKYA 5K4HA 4INPA 3X0DA 3ZNNA 2EWVA 3ZDBA 3AUFA 5DV9A 3JD0A 1OWNA 5WRFA 2QF7A 3GD5A 4US2R 2NQ8A 4B80A 3WL3A 3EWSA 1RZVA 2CXSA 3D7MA 5J5CA 1AZSC 1NI4A 3TNLA 3CZPA 4YRNA 5IDQA 4YH1A 6CHYA 1X15A 2IX3A 1QK5A 2EZ4A 2QTWB 1VP9A 3H83A 4C7VA 2XXBA 5DX0A 1M73E 1FE8A 4ECAA 1Y9JA 2ZBPA 4OXNA 1B0AA 1QBGA 2OA0A 1DIGA 4PRKA 1SBQA 4H3SA 3MELA 4PAMA 2R00A 1NUQA 2BFCB 1R64A 3IMFA 1M1NB 3DUWA 1EWRA 4GQAA 1Z17A 4EL0A 2J32A 1FS5A 4R3UC 3UK0A 3L07A 3HYSA 1VJ0A 2O5CA 4FKBA 4HF7A 2RB5A 1CUZA 1CZHA 4K40A 4PPNA 5FV7A 5JZBA 1PLKA 3CB2A 4FFMA 3CNNA 2XLBA 4FYWA 4INOA 5BT9A 1A9XB 3HVIA 4L3VA 1SKYB 1L7QA 2ONZA 3QBTA 4LXIA 1GM5A 1MH1A 2VAMA 4IIDA 5IUJC 2VCHA 1V48A 4QGBA 4ENVA 2C2KA 2C4KA 3TW4A 2XOKD 4O4JA 3DH0A 5CFZA 4CTNA 4OQQA 1CQIB 1CJBA 2MSKA 4QFBA 1J1UA 3HVJA 1UIMA 4L5AA 3BFJA 1K2WA 2JHFA 3HFRA 3KOMA 4ZHQF 4PR0A 2RHLA 4HH4A 2O1XA 1HE1C 5DM2A 1X8JA 1EJ2A 2ADFA 1F12A 4C4YA 1A71A 3E6AA 2IQ5A 5IJ9B 2BGKA 4EKEA 2C5HA 3V42A 1KI1A 1Q77A 1BXRA 4E5UA 3KE8A 5ELXA 2VXBA 4WIAA 1UOEA 4F71A 1P1CA 1R6TA 5KJEA 4DR3B 3NXSA 1RBQA 4Z7NB 2XIQA 1IK6A 4ZKEA 4F4IA 4II3A 4ZARA 3Q7EA 3VBEA 1HGXA 4G5OA 1P0PA 1ST2A 4PX2A 2I67A 1L5LA 5C51B 5LYJA 4OMDA 4GRAA 3NLLA 1WM1A 3WHLA 5BR8B 3DAGA 1N2JA 1U1GA 1RYBA 3KHTA 3FTNA 3ZCSA 5U4QA 3V2UA 1RRGA 3G02A 2WC1A 4R9UC 2IU4A 1KQPA 4H4DA 4B4KA 4U8HA 4MHTA 4I8IA 1R4NB 1UC8A 2R8PA 3MK31 4O2LA 3WGQA 4GVPA 3ESAA 1BKYA 2ZWOA 3GAAA 1E9FA 2BMVA 3NO4A 4DKXA 4OVKA 1UBUS 3EZ2A 5DOVA 4H9GA 4DAEA 1YFLA 1NC3A 4X5OA 1X8LA 4HOYA 2P91A 4F4HA 4JNCA 2RKWA 2YR0A 4IJMA 3Q5EA 3VR4D 4RTSA 2P69A 5BWMA 4KSCA 4F4JA 5T6MA 2H17A 3L1JA 4ZJPA 2JGMA 3INNA 2AZXA 1I3NA 3R7LA 1XU7A 1PZNA 4EM6A 5E2AA 4X6YA 1AKWA 4I5EA 1V7CA 1W34A 4B3MB 1JBEA 5LUAA 4UAGA 3V1LA 2CL5A 2Z1MA 1NUHA 1J09A 2WSMA 2FPIA 2GEFA 3JYHA 4X1IA 1O6GA 1WU7A 3RSFA 4B83A 3VPBA 3KETA 3RABA 1AV6A 1E4OA 1TKAA 2XQVA 1RP7A 1G5TA 3BFPA 3R1IA 5DXFA 3ZXUB 1AQIA 3QNMA 2PTGA 4DBVO 1C4KA 3N7AA 3NTQA 3P2YA 3RAPR 1BEUB 1ECGA 4KX3A 2W98A 3D3NA 5TVKA 2I62A 5KYYB 2A1UA 1GGEA 4Q9IA 3VA7A 1DJQA 3H18A 3DMYA 2OLKA 3QLUA 3VKVA 5JH7F 3GPLA 1BHO1 1W0JD 2OM6A 4PNPA 1UMBB 3JALB 4PPYA 1EU1A 3BBPA 4OLFA 3U4CA 1M1YA 1Q3KA 3U6BA 5AIBA 5F9HA 1NJ6A 4I8XA 4MPPA 2I91A 3TCNA 3TWOA 2EP7A 3DDUA 1US8A 1FMLA 3SQNA 1PJLA 5G0TA 1TVCA 2ZIUB 3N8NA 1BHJA 3JRWA 1VCMA 5A5DA 4Z4HA 2ZEJA 1L7EA 3HCEA 5LQCA 4LFBB 4N12A 4Y6RA 1V5GA 3TLGB 3VVCA 4RUKA 1L1RA 1NOJA 5ER9A 5IHPA 3C7KA 1U04A 1MJ5A 1U5BA 1W0KA 1W25A 2JLBA 3EWIA 3IQXA 4HDMB 4PE5B 1M0TA 1QIIA 4FDAA 4QASA 2WSSA 3KELA 4NARA 3VOSA 5ICCA 3USES 1T8PA 5EFOA 4B17A 1B23P 2W0MA 3OMLA 4WWHA 2P4UA 3AF3A 5K51A 3BH7A 5FUVA 1RBYA 4XPIB 3NM4A 2E4VA 4TMKA 1E6CA 4UTVA 3NDJA 1QHHB 3KB2A 2WAOA 1SPXA 4NC9A 4MP6A 4QRIA 5KI6A 1LI5A 3OQ6A 2XE8A 3WGGA 4JLDA 3RYFA 5CT9A 4CN8A 3I3SR 3RT9A 5DK6A 3A31A 4G5HA 4EY7A 1CUJA 1SZJG 1J0BA 2FPUA 4XGKA 1PI3A 1KOFA 3SWWA 3I0MA 1NI3A 1UJ5A 1Z2PX 3P9ZA 2WD9A 2WKQA 1RCFA 2G82A 3O8QA 4Z9AA 2DBRA 4FEGA 2IUTA 1GN9A 4YT5A 5DCUA 1YKFA 2I6QA 4X44A 3AHGA 1P5RA 4N03A 4PXSA 4WKBA 1LUAA 2VDQB 2VZ0A 3D81A 1I4DD 5H70A 3TZHA 4BTLA 1PSWA 4F9TA 2XNHA 1SC3A 2W71A 3M2PA 2ZAYA 3O8NA 4WZAA 3FBTA 2B4KA 4BUJA 2H07A 3GUZA 2JGDB 3IKTA 3DZHA 1IHXA 1T43A 4GOXA 1N5LA 2X2PA 3EG5A 3LXMA 1R6VA 5FPYA 4BO1A 5JI3E 2ATXA 3I9NA 1XZIA 1KVQA 2BFWA 2VJCA 5BUSA 3F6RA 4X24A 3UYLA 4EFKA 1XTKA 3RVOA 1Y3FE 4QC2A 4CG2A 3RUFA 4TVKA 1GT6A 1OYYA 2FQ1A 5TMEA 3IEXA 1WXQA 4I8DA 4Q4DA 2OO3A 4G8CA 4IH4A 3ZWXA 1TQHA 3GYGA 4JOCA 4QBGB 3BTVA 2DRIA 3HFGA 4KE9A 1BH2A 5K03A 1J9EA 3JQ7A 4EUNA 1X92A 4JCOA 1TUBB 3DKRA 3M1YA 3ZU3A 3JWIA 4ZT5A 4UBJA 2C2YA 5KNBH 3SLKA 1MEEA 2HSDA 2NQTA 2Q0QA 4KO4S 1GG5A 1R0SA 1ZP6A 4CM8A 5LNK6 3BE6A 4TN5A 4QX6A 3FDJA 4JOSA 2R8OA 3KYBA 4TKLA 4C7BA 1L5WA 1Z4NA 3JARB 4H6XA 5IXSA 1KIMA 1ODIA 4UAVA 1DAGA 3B1YA 2V8OA 3MTGA 1DUVG 2V7QD 2ZRKA 3BHIA 4ZO9A 3V8MA 3OZGA 4KXQA 2G3YA 2JI4A 4NBLA 2NYVA 4RVGA 4J0IA 3WLIA 4EEZA 3KPYA 5A02A 5F9FA 1FNNA 5KWVA 5HBGA 4N0MA 1RQ2A 3OE4A 5L6MB 3RS9A 3TRKA 2FEOA 1C7FA 4E7OA 2N9UA 1E3WA 5EXEA 4EITA 4YT8A 2AG1A 4FDUA 3FLBA 2BKVA 4XASA 4MZDA 4GEKA 3GQBA 2QJTA 4L75A 4U3JA 3DMNA 4C88A 5EINA 5CW1A 4X45A 1UZMA 1RPJA 2AD5A 3B9QA 3NWEA 4R51A 3A4MA 3TK1A 2EZUA 4TL9A 3P9QA 3QBEA 2DUJA 4XD7D 2DUUA 3NKLA 4P82A 1HT0A 3HEMA 1II0A 5EJ6A 1WX1A 2LP4Y 3H16A 1F48A 3MT9A 4IOJA 3DV0A 3EC7A 1L5SA 2C82A 1QKKA 1XD9A 2A9RA 4XSHA 1QAOA 3BORA 1VE5A 1Z0FA 5EEHA 3L01A 4CEJA 1RXIA 3NVDA 5I9LA 3DF7A 5F9MA 5ECDA 4MRMB 3DZ8A 1U65A 5D01A 3I05A 4BNKA 2G7ZA 3HJUA 1P44A 2CMFA 2V7PA 4RPLA 1G8PA 3BB4A 2ZIXA 4JBWA 3PV0A 4DIMA 3NYWA 3W4KA 5K7SA 3EARA 2R65A 1ZXBA 3MF4A 1X3SA 2DE0X 2NTEA 1RWKA 3WK8A 1AQLA 3IUBA 3B6EA 1NYQA 1I1QB 1SBNE 1ATZA 3EEBA 3Q12A 3AVXA 1II8B 4V38A 1LH0A 2AK3A 2CUZA 2JHPA 2AUMA 5LKAA 1I2CA 3I9KA 5HKLA 1E63A 5U4XA 2MSNA 1NDUA 3CSUA 2QRZA 3H42B 3SIPA 1VA5A 4XR4A 3LX5A 2H2AA 4XGQA 1Z83A 4KLAA 3ROEA 1O87A 1ZN2A 4KXVA 1E62A 5IXJA 2O8BA 1KJ9A 5DNYB 1HR0B 3GEBA 3KJGA 1R0LA 5LXTA 4F91B 2QTTA 3F67A 2C2XA 1KXJA 1JVNA 1GCGA 2GLXA 1IJKA 2DFDA 2PKCA 4ZO4A 4IV8A 4RLQA 1HE8B 2Z0MA 3MT0A 1P4SA 2RGUA 1UBFA 2X3UA 4EEKA 1JT2A 5F7XA 5BQOA 2YRXA 2CLHB 2BMWA 2Q4TA 3GGDA 5FOUA 1T0JB 2FH5B 1KU6A 2FP4B 2UVPB 3LYAA 4NHOA 4E7PA 1XIVA 4N41A 3PKZA 1YB4A 4IP0A 1N6KA 3ZGLA 5KTYA 2GILA 2NUBA 3D6TB 3ML1A 3PUIA 5AXAA 2EYQA 4GPD1 3B9PA 2R60A 3WIEA 5ICMA 2YQ4A 3AKYA 3DHVA 1HSOA 3VU0A 1B14A 4LE0A 3AEUB 5FHQA 3IQFA 1BGWA 1PZHA 1RE0A 2EYUA 2QTZA 1EFLA 3K5IA 4HS4A 5DIFA 7YASA 1B1CA 5IZCA 4DARA 1AQ6A 2F1KA 2R1VA 2C0PA 4ZVUA 4MDHA 2CD9A 2PMDA 3F3YA 2DQYA 1Q1NA 5AOAA 3T3DA 2CWWA 2Z2KA 5B2EA 1TYZA 1QV7A 4O02B 2WAAA 3FYUB 2B5WA 1RYNA 3PT5A 4Z8YA 2VBCA 4OQDA 2EKDA 3WLNA 1Q0PA 2ZRCA 4P0TA 1GU7A 4I55A 2QR2A 2V97A 5DJ5A 2IYYA 2ON6A 2MDTA 3H1EA 4FQ5A 4H27A 4LDRA 4OH7A 4QA9A 5LR6A 1GZ3A 4E07A 3F8TA 1JXQA 4BVLA 4D4IA 2I71A 1DDIA 2OXIA 4HRYA 1CUCA 5IJAA 4PYJA 3EAGA 1UOQA 5GVSA 2ECPA 2JKYA 1G63A 1GPH1 2MMGA 4HH3C 3SSOA 4FFPA 4A16A 3U4QB 4L74A 3D0RA 3MJDA 3HY6A 3EMKA 1FU4A 1HQYE 2AOXA 2GCOB 4C01A 1OWOA 1NGSA 2A9FA 4Q6BA 2VZ9A 2IHYA 2P9CA 3B1WA 5JVDF 5LIPA 4EI8A 1O5OA 2AQKA 2MR5A 1YOBA 5DNDA 2HEIA 1E9BA 5KTKA 3WK6A 4E1AA 4YACA 1V8BA 3DLBA 2HRDA 2Z30A 4X95A 3R24A 4YUXA 5B57C 4CJXA 5ILOA 5HNKA 2XZLA 1J0DA 1PJ2A 3KZVA 2VRWA 3JQ9A 3K4HA 2IOFK 1N5RA 3P0FA 4ARZB 3CF2A 5KIAA 3EZ9A 1DRKA 3IP3A 1LF0A 2GNAA 1WKBA 1CVLA 4PPGA 3WLLA 1ZN8A 3EVNA 3NBYC 3I6QA 2OHXA 5EIEA 5JAQA 1WMDA 2EZ9A 4BVEA 4IICA 1R37A 4IWXA 2XWSA 3RVNA 2YWHA 4AS1A 1QH9A 5CA1F 3DW1X 5AKZA 1P2VA 4O1MA 1TTTA 1ITZA 1EBFA 4HGZA 3LC7O 1ATIA 1WTCA 2ORWA 2P30A 4WXPA 5DEIA 4B3SB 4WLEA 3PVSA 1NVKA 2RI1A 5JRJA 2J9FB 4XVCA 4YWHA 4YJ3F 5MF6A 1N33B 2A94A 2WHPB 4RD0A 4DWWA 4KOAA 4F92B 3F71A 5IPFA 3DLTA 3TLAA 1RHKA 2ZZMA 4QM6A 3A1SA 5HQ3B 1GNSA 1KY4A 2VT3A 3QRWA 3C1AA 4JLVA 4Q7LA 3TTUA 3MQ2A 5DCWA 4G25A 1TNDA 1N6LA 1KEWA 2BGWA 3A2KA 4Y6SA 2ZR0A 2Y1KA 4GMHA 1TVKB 3F9CA 2FPPB 3OZRA 1I7PA 3UCEA 5LZ9A 1X42A 2I2DA 1D2GA 4LGMA 5DHTA 4DDKA 3VU3A 4G84A 1DHRA 3ZLJA 3K0FA 4BMPB 2I2FA 3CWQA 5AM3A 5KSZA 3A14A 3SF8B 1FQKA 4S1VA 4BP3A 4EA7A 4PG5A 5IX8A 2JFYA 1DUIA 1L5ZA 2RGBA 3HA7A 1IXRC 4N8SA 3A7EA 3M70A 3IMCA 3QELA 4ZD6A 1FTNA 1QH1A 1TC2A 1XJ5A 1A50B 1SIBE 2BIFA 3I83A 3L1HA 3S2YA 3TX2A 4DB2A 2SKCA 3H17A 3GR6A 3UBMA 2HU2A 4QYIA 2PKRA 1YMUA 2BM0A 2Z1DA 3V46A 2HSJA 4ZJYA 4BNLA 5GPBA 3AXSA 4R3NA 4B2PA 4L8VA 5F4BA 2PT9A 3B9BA 5IZCC 2B9VA 5AKKA 1GLVA 4I4TA 5FBRB 4KMOA 3S2UA 4DEYA 2HQRA 2J0VA 3DZCA 5JFTA 4IRUB 2RHCA 4C0AC 4KDEA 2WKWA 2GPAA 2XZOA 2OILA 3DCJA 4H1HA 2BDUA 3GL9A 4UNNA 4US1R 5D8DA 4XJSA 2FQXA 3FBGA 3ECSA 3L1IA 4EJ6A 1WMSA 4KPYA 1PAUA 1Y8QB 2BI8A 2FFJA 3C24A 3F6PA 1ZXLA 2DT5A 5DHFA 1OAKA 2C9ZA 4ZYYA 4CETA 5KDOA 1S2IA 1DIHA 2ET6A 1VE6A 2EDCA 2QN1A 4OB6A 1L4EA 1SCJA 1GFSA 1YDWA 2AG8A 1DXOA 1D2HA 1NJGA 2Q3BA 3E5HA 5HIJA 5F23A 5MFPA 2YOHA 2QMQA 3LY7A 5KCMA 4D9KA 2IW1A 3O3CA 4X66B 2WIAA 2Y77A 1R6BX 2G0TA 2WU3A 3CE9A 4Q4HB 3W05A 2AX3A 5AXDA 3QTBA 4WHMA 2CNLA 2IHKA 2A4MA 2BI4A 2VK4A 1HDYA 1A5SB 2PCJA 4RU1A 5IVPA 2G1AA 5EJ4A 3BH0A 3CE6A 1W87A 4J90A 2VDKB 3KD3A 1ZGHA 3R7FA 3SVLA 4UM7A 4HAXA 2C3PA 1ZISA 4OK3A 5LLSA 1NBEA 3BERA 3DE2X 3KJNA 5HTOA 4WW0A 5JYDA 1U8EA 3QVKA 3EVFA 1USIA 2NTNA 5JAPA 1VI2A 5BMVF 1XNGA 3DMPA 3JQ9C 1R0XA 1UWVA 3QIAA 2JBHA 3G49A 2FEAA 4GD3Q 4GOMD 5D3QA 2GAIA 1JIKA 3CNQS 2DHQA 5BUQA 1UFQA 2O6LA 1KQGA 1XPRA 4PX3A 1FYDA 2HU7A 3ACDA 3KT8A 3M1LA 5AKYA 3OD5A 1EVYA 3SHQA 1W30A 4YP5A 3TINA 4DG5A 3OPNA 5AW5A 3BTOA 4I46A 4OHXA 2ZQZA 4FWIB 4AUKA 4QT4A 5KHLB 4QGGA 3OBIA 5F98A 2IYPA 2YV3A 4BUZA 4BGDA 1R8SA 2GBLC 5CNKA 3SE0A 3RRNA 1E7SA 4HEJA 1FSPA 3CBQA 4J4HA 3U7RA 3SJZA 2SECE 3IOBA 4X93A 5AM1A 1ICEA 2Z09A 1LBHA 3NOQA 2YFQA 3NPMA 3I1FA 4E2WA 2YW9A 3BFXA 1ZX1A 2NZ8A 2HHJA 1A4XA 1Z7EA 3MHTA 4XR9A 3C74A 3CHYA 2NADA 4J2OA 2X9QA 1TM1E 2DWPA 3K05A 2WJ6A 3GAZA 3JQRA 1G3IA 4FIZA 4B71A 3O90A 5BN5A 5ER6A 4MHOA 2A35A 1JNXX 1LNSA 3MJHA 5FBWB 3R3WA 2ZJ1A 4JI3B 5IKPA 5COAA 5HE8A 4RJKA 4AQDA 2AMLA 2IIBA 2QN7A 1NY6A 1H5UA 1SY7A 2GVNA 4Q7KA 4B7ZA 2VLIA 4ZHQB 5BWNA 2O06A 3AV3A 1DXQA 2OXFA 3MW8A 1WEHA 2VQFB 3AINA 1KE2A 2RCYA 1F8GA 3ABIA 1LC0A 3IXMA 3ACBA 2JIQA 3W2IA 3EGOA 5L4SA 4L5IA 2E6UX 1EIWA 3HKEB 5IAJA 2YC2C 1QAMA 3LFHA 4X85A 1UWCA 1RYMA 1Z56C 2O1SA 1Z6QA 1AOXA 3AHHA 3DGEC 1Z7YA 1QG2A 2WQZA 5HE9A 4E15A 1XZCA 4O4HA 4PNEA 4PS1A 2O8DA 3T3MB 1ADGA 2CZGA 4ND4A 3SN6A 4HV4A 1O0CA 1E3LA 2JVJA 3QIVA 4MIYA 3V97A 2CVPA 3M34A 3OJCA 4QUHA 5EC8A 5CLJA 2XTNA 1E2DA 1LQ2A 2VAWA 4BNIA 2OV8A 4DSZA 3TE7A 1P2FA 1T3TA 2JA2A 3N0WA 4O4IA 3W1EA 1IEVA 2PUDA 4K6CA 1BJTA 1MC5A 1NURA 1Q22A 2HF8A 2PRYA 1GPJA 1ZUD1 4RVNA 5ALGA 3C5HA 5FR2A 3IEVA 1B0ZA 1PJSA 2V6IA 4OK6A 4AICA 3ETDA 2AE2A 3FOZA 1H23A 4IR7A 1QGYA 1S02A 2AXQA 5ALDA 3FYDA 2D2VA 5IANA 1XMQB 4MB6A 1DRVA 1VGQA 3FJOA 5CEJA 2OD2A 4DCTA 4TLLB 5JU6A 2VDNB 1GAQA 3A25A 4I3GA 1Z0AA 2ORVA 4QTYA 5KS2A 1K7XB 2XF8A 3KT0A 2PUVA 5DTRA 3W5JA 2UU9B 1Z0UA 3FETA 2JD0A 2XYPA 1T4CB 4XDYA 5CR9A 4W5QA 1WCXA 2Y1EA 5K0TA 3WLHA 4R16A 2NYAA 2PQ2A 3KYCA 3D8SA 1E8NA 2YQ5A 1GAXA 4R84A 1FU8A 3U6KA 1JXMA 3PIIA 2CLDX 4UPEA 3QOYA 2E4WA 2NP7A 3GELA 3HR8A 1ESDA 1ONOA 1P61B 4ZYXA 2OHHA 1S4MA 2YJTD 3V7UA 4FMCF 3FCOA 2O2XA 4KVFA 2AOTB 1Y9EA 4DS3A 3E35A 3L40A 3NNNA 1EFVA 4MJLA 3SLGA 3L4BA 3TEMA 2VHCA 3T9DA 1KDRA 4H7JA 5I9MA 3WNCA 4D7AA 2OYSA 4HAUA 3U37A 4Z1MD 1NN5A 1PFQA 5DSTA 1XZBA 1AB6A 3VZSA 2ZPAA 3S2IA 5JH7B 4L15A 3GZTB 1IM8A 4DVJA 3HKBA 1RLOA 4E88A 1ORRA 2IHTA 3IBGA 4MWTA 4UU1A 2ZE6A 4ZQHA 5A62A 5I3ZA 1SK9A 4HADA 4UCXA 2YJ3A 3AK4A 2ECKA 3DHYA 3LRXA 4IEEA 4CPDA 3QTLA 3AG6A 3OKCA 4ALIA 3PGLA 4OY3A 3E0QA 5K09A 1GCOA 1YT5A 2O0JA 4P7BA 4ZVOA 1OBHA 1NVBA 3IQDB 1FDVA 5COBA 4HDOB 1WW3A 1W88B 2VAVA 3DPUA 3QGMA 1NW7A 1ZUNB 2FUNB 2IDKA 3IBYA 2QTVA 4AN0A 1MQ9A 1PEYA 3UFXB 1S3GA 4P31A 2YYYA 4TZ0A 2F43B 5EJMA 1KS2A 3GCXA 2A0YA 3QLVA 1CS0A 2BFDB 1YQUA 3H5LA 3RC3A 1XKTA 2E21A 1G1MA 4RK0A 3T9BA 1YASA 3TTXA 5BP7A 4CKBB 1HYGA 4LMPA 3UH0A 1JLSA 4YDQA 1E92A 3FMPB 4RETA 5BSHA 2ZYWX 4LBYA 2Q7XA 3ILYA 2PPLA 3OJFA 1XVIA 5JCXA 1CY7A 1JWAB 2HNAA 1EFCA 3V1KA 5CEEA 1YC5A 5JAOA 1C3OA 5HRCA 3SDZA 1OPXA 1T2EA 1ZR4A 3ER9A 1V7ZA 1AXRA 2WPDD 4FONA 1HFWA 1JILA 3DO5A 2AR0A 3EODA 4FDLA 4L8GA 4XARA 1T8WA 4IZHA 3BD7A 2OQ2A 3MJCA 3KRTA 2OZLB 2EQ5A 3MERA 4DFDA 2DXIA 1KJJA 4CUJA 3N86A 3F74A 2ZI3A 1GAEO 2W5UA 2OMEA 4NZZA 2JGJA 1KH2A 4MRNA 2JGLA 2Y0DA 4QVKA 4HDAA 4PSVA 3HL4A 4W5JA 2W2QA 1XZGA 4TXNA 5C5IA 1LTKA 2RONA 4FU0A 3JWGA 3IULA 3EQ9A 4HATA 4RM3A 4D3YA 1VE7A 4NCHA 2N42A 1VYVA 2YFYA 3CZCA 1DIOB 3JYLA 4QSHA 2ZZNA 1T5OA 4EFMA 5I9IA 2WUEA 1QHNA 2PWBA 2Z1NA 4M87A 3G79A 3UMFA 3BWXA 2REBA 2QJWA 2QLFA 2VHXA 4WNCA 1N5OX 2L69A 3U17A 3IV6A 3ET5A 1Z36A 2P77A 3ZNOA 4DQ0A 1S6YA 2ERYA 3DFMA 4YRFA 4BZWA 2IOHA 4EB6A 1AD2A 1PQUA 4YRKA 2XCRB 3UUWA 3LY9A 4RK7A 4AD8A 3Q10A 2X7HA 1R0CA 3RS3A 5P8WA 3GIWA 4YMUA 1YA8A 1J4AA 4LCEA 3EXEB 4R54A 3W5AA 4D0GA 1JV2B 1DC8A 5BYAA 1H2RS 1SULA 2I6TA 2LGJA 1AG9A 2X5OA 3B5IA 3UF0A 2PMCA 1CRWG 2BR5A 2MINB 1AGYA 2DH5A 4N3NA 3A1CA 4YEDA 2E5FA 2WJWA 3PJGA 3CF0A 3L4BC 1IBCA 3BA1A 1Z2EA 3BKWA 2BF7A 2VDOB 4POAA 1MO3A 4ZCSA 5HGXA 3HU1A 4LOLA 2JDID 1X80A 4BGEA 4M9SA 1EPUA 4R1LA 4NJEB 3FNBA 1DKMA 4NY1A 3M6IA 2OC9A 1TO2E 2GEJA 4M86A 1TIBA 5AW7A 3EQ6A 1DB3A 3DE4X 3HC7A 4WRRA 2LCFA 3A0RB 5D3KA 1S2NA 5HSGA 1BROA 1C9YA 3FTFA 5I8PA 2PA3A 2BE9A 3FLMA 4IRMA 1G4AE 1HT2E 3OM8A 4CLXA 5MFZA 4LF7B 1Q5PA 1XLTC 4GWGA 1I1OA 3R7SA 5D85A 4IO1A 1FX1A 4KN8A 4B3XA 3CNHA 4E3ZA 4U2KA 4D0NA 5K0GA 2ZJFA 1Y82A 4WFKA 1UDAA 2QPTA 4G5XA 4JIMA 1NJ5A 2ANBA 5KVSA 4NJMB 5FUYA 3AZOA 3DFIA 4DJEC 1QRUA 1SHUX 2NYRA 3ET4A 4LVCA 3W1VA 1GTVA 3WO1A 4J4BA 1WZ2A 2FW7A 2KHZA 3IEPA 4KO3S 1HE5A 1S9HA 1ZNWA 5CJJA 1E3EA 1DTWB 1VIAA 4ZQCB 5FA5A 5CX4A 3DAYA 4U0KA 5G0UA 4B09A 4BU0A 2Y4OA 3ETGA 2ZETA 3BKXA 3QLVC 5B3JA 3C48A 4RMIA 4ZYLA 1FFEA 1XHLA 4JC5A 1C1XB 1W52X 3M5WA 3V1UA 2QRMA 4EW6A 3VSBA 4IIFA 1J7KA 1JA9A 1EJ6A 3PF8A 1LBSA 4HQRA 2B0CA 5I7FA 4ND6A 1PGJA 3AU8A 1DP4A 5DF1A 1EUQA 1JEEA 1V5IA 3VSAA 2P6RA 3MS2A 1SXPA 2IV3A 1N7GA 3GCZA 4J1SA 1QONA 2J8ZA 2JIMA 1EX1A 2FR8A 3JWHA 3KVYA 5D3MA 3GRAA 1V4BA 1NV8A 1TD1A 1E2IA 1UDCA 4JY7A 4OQYA 4XIGS 1P72A 1TZBA 1PNQA 3G5TA 1IDOA 3SC4A 4AY3A 4C03A 2GWRA 3S1AA 4ER5A 2Q4RA 1DNPA 2D5BA 3BSSA 2Y05A 4OKNA 2PIDA 3CGGA 1LGYA 4GECA 4DYDA 3JQQA 1N8TA 3NP9A 1K7SN 3FUXA 4I50F 4B48A 3KSRA 2O05A 4U0JA 3PGVA 3GUVA 3MMPA 4H35A 2EWMA 2ZWAA 4L0CA 3THSA 1WS6A 4C08A 1QH8A 3D1JA 2R1ZA 5C1PA 2FWRA 2IYOA 3P2KA 1GO2A 2BFBA 3VJRA 3D64A 4W8GA 4K28A 2C54A 3VNAA 3OOHA 4EENA 5CA0F 1VSUA 3SDSA 2O59A 3NAGA 3NALA 16PKA 1O0SA 5ALHA 2WQ6A 3GH1A 1DKUA 5GZ6A 1SA0A 2FDCA 3RH0A 2XBMA 2VJPA 5KUTA 3I72A 4MUFA 4NZ9A 5I9TA 1M2VA 2VHZA 4IDGA 5C7IO 2DR3A 4JNKA 3IT0A 3H9UA 4E51A 2QK4A 3GGPA 5FLYA 3K1ZA 5ALYA 2EVWX 4M1SA 3RFUA 2PH7A 1RIFA 2C99A 2W6ZA 3TR0A 4PCAA 5AKJA 1ESCA 3H8WA 3G0BA 5LQUA 2H9AA 1F0KA 2GI4A 2XOKA 3I6YA 3MHPA 1KPGA 2D3WA 4FKMA 4WVFA 1ZMOA 3UWKA 3TSAA 2O3TA 4MWGA 4FOPA 4PXAA 5EI5A 1A1SA 1E32A 1GZ6A 1XAJA 2IY8A 2QQ0A 2WWFA 1XL0A 3K8YA 4WNAB 5D87A 1GG2A 5DHSA 5BW6B 3IAAA 1W7AA 1O9GA 1Q3HA 1L4HA 3C3BA 2X2FA 5EIOA 2RK6A 4D3DA 1BVHA 3CX4A 3U61B 1F06A 1GTZA 5GVRA 2WJYA 4BAZA 2W37A 2ZYGA 3GDGA 2C4VA 2H4YA 3KP1A 4H3KB 2IHVA 1AK9A 3IB6A 4JLMA 3AKEA 4M0DA 2NVUB 4JEIA 1BX1A 1YS2X 2BLNA 4LYFA 4DMLA 5IT9A 4YCNA 4M1OA 1QQ7A 2UZIR 3QWAA 5JWHA 1D2CA 1JLLB 1THZA 4BQNA 5CFNA 1Y4AE 2NUTB 5A9SA 3I92A 5IK2D 1FS4A 2YHBA 4BO8A 4DIDA 1XTVA 3OZCA 2WTNA 1P7PA 4IVPA 3GFOA 3JVEA 5GZ1A 3IEIA 5IM5A 1VZ3A 2SICE 2UUAB 1JALA 4BKUA 5HM8A 3V48A 3VM6A 5B3JC 1AA6A 4JL5A 5HKBA 1VE9A 2O8EB 5CA1B 1HPLA 2VJNA 3PDHA 1KZYC 3OZWA 4K88A 2JFHA 2Q3MA 2NWQA 5LP6F 1KERA 4PCUA 2GF0A 1IZ8A 1YBAA 1EI9A 3FFBA 4A27A 3WLJA 1H8ED 2IODA 4YJ3B 1KJIA 2SCUA 4ZZ2A 1JLHA 2P6MA 2R48A 1GPWB 3K30A 3NH6A 3M33A 2W2OA 4GI2A 4JT8A 1K9VF 4DMFA 4L9AA 2FR8C 3CLRC 3G2NA 1B15A 2UYQA 3R6DA 4NCKA 4HAWA 3P4UA 1ILEA 3RK4A 1YR7A 3GPDG 3HA2A 3I2FA 3W5IA 1WCV1 4QU8A 4EI7A 3KD2A 2ZE8A 4YR9A 1WW8A 3BZUA 1EZZA 3HV0A 4ZPJA 5A4DA 4GWLA 2MSDB 4GPTA 1U2GA 5AKGA 1VL6A 4AN1A 3IQHX 3TD6A 5LBTA 1PK9A 2E48A 2XUAA 1QU3A 3ADBA 5FTNA 1JJ7A 1VCHA 1QM5A 3DWGA 4KZKA 1U6JA 4OREX 1PT9A 4LX0A 2VBFA 3NJ8A 3R3JA 4D9NA 2R68A 1JHYA 5KYTA 1GZUA 3PJDA 4HWSA 2B1JA 5T4HA 3CLSD 3Q3VA 5GOZA 1CR6A 4UHCA 6Q21A 3RAEC 2I9PA 2ZPUA 3GP3A 3OZBA 4DCUA 5IMBA 3QUSA 1TAHA 4Q3KA 4D3XA 1P80A 4WH0A 4O4LF 3PFIA 1AIPA 4YT4A 1YMQA 3VVMA 4EA9A 2VDWB 1EG7A 2JFOA 2JCSA 5CMLA 2QE7D 2I8CA 2P1DA 3N2NA 5EJAA 2WBLC 5H7XA 4GLLA 4NNPA 2NU9A 1SELA 1OTYA 3FYCA 3L8MA 3AJRA 2X9NA 4MVJH 4PZDA 3R8XA 3SICE 2FPSA 3JASB 3ZJ5A 1VLZA 4GQBA 3NBXX 2IZOA 2FZLA 1VKZA 3K20A 5TEVA 1BXZA 1R6AA 5SY4A 3ZGOA 1NRXA 1WNFA 4CQJA 1AZLA 1V45E 1CUWA 2VH1A 1C3LA 2H1HA 1ONBA 4JLUA 5B4VA 4KYUA 3VZQA 4WBNA 5B5SA 4UHDA 1N2BA 5F52A 1GOTA 1P1HA 2VSOA 2AGVA 5EXPA 3TJRA 3WDMA 2ZROA 3KR2A 5EAIA 5DYNA 3V1YA 1E79D 4YONB 3MIIA 3BMNB 4XJVA 3H11B 4P7GA 1WOYA 3EGXB 1XZPA 1RAAA 2IJGX 4LZJA 5FLEX 5B58T 1A7KA 4YUAA 2FTKE 1D1SA 5LJLA 1V1RA 2WABA 1WB9A 4TV9A 4IXWA 3EPRA 1TU3A 2GN0A 2NO9A 4MWDA 1VXOA 1BMFA 1ZL0A 4WQMA 3LDUA 1AN9A 3PG5A 1RXVA 2EG9A 1MJFA 5JRZA 4LF8B 4E4RA 2VP9A 2ZTSA 4EB0A 5HCIA 5H02A 1IXKA 2VF2A 3UW3A 3G3EA 3HVUA 1JG3A 2D8MA 3FOWA 1TTQB 2NUAA 4IIHA 4RDCA 1MVNA 2XOXA 3HXTA 4EF4A 2FX2A 5I7RA 4IMJB 1AKYA 2QLTA 3L0IB 5HF5A 1VLLA 4BECA 1CEXA 4FYKA 5EWLB 3AKZA 2DERA 5CPBA 5BMVB 2W42A 1E1LA 1FTGA 1O03A 3BWCA 2NPOA 1UXHA 3C6BA 3IUJA 2A1TS 2RGYA 4BLRA 4DIEA 4DV4B 1HFEL 1AKVA 4OX9B 5REQA 2AX4A 2YUTA 1N2OA 1UKYA 1W581 2GAJA 2O48X 3D8TA 4FR0A 4L1KA 1CZKA 1NVEA 1RMYA 1ZWLA 1SOAA 4U5QA 5DGTA 4DYHA 4XFJA 4JJ4A 4ONEA 2CVQA 3JQ8B 2W6JA 3OQNA 3RNOA 1N2CA 4EY8A 3LY5A 5T4BA 5LMUB 5CIWA 4TZTA 5J4HA 2FWIA 3VH1A 1I7SB 5KREA 3KKEA 1E9DA 1Z2DA 4OGWA 4Q1AA 3TIXB 3H0CA 4PHFA 3NHSA 4MYRA 4W7HA 5JFGA 3ND7A 4WY8A 1R16A 3TSZA 1M10A 5IN4A 5DMHA 3SDBA 1QUFA 4FVTA 1A2BA 1SIWA 2GN9A 2YUIA 4FNMA 1T9HA 3FN4A 3HN7A 4EO4A 5JATA 2H7YA 5M3BA 4RSHA 3E58A 1WHSB 1MA3A 2IY7A 2JAQA 4B3FX 1XEWY 4DNPA 1C7EA 1EJBA 2FPWA 5DW0A 3WL5A 4GE0A 3SYMA 3M7IA 3AUTA 4B40A 4NKRA 2FWBA 1UF9A 4QBTA 4BWYA 4YP7A 2P27A 3INTA 1U0TA 1Y6RA 1FDWA 1Z4OA 4B9EA 3OIUA 2CXHA 2I6FA 3E05A 1P1KA 5CT6A 2WM2A 3NAQA 4DV0B 2IYRA 5AHRA 1L5GB 2FF5A 4DLVA 4YUZA 1Z2NX 4E32A 3U7HB 3I2YX 1ST3A 1DEKA 5ED0A 3M2TA 5BSUA 2MYTA 1N3IA 1YU6A 3BE8A 4GM4A 3T1OA 3G13A 3U3MA 1OH7A 1CYDA 1BD4A 1BEZA 1MO2A 2A88A 3KWMA 3OF2A 3QU9A 3EVGA 4GG1A 3S2EA 4B6PA 1YR8A 3DONA 2HIHA 3Q0EA 2R7LA 3ZQ6A 5F3DA 3M82A 3CISA 1CV2A 2VWGA 3Q9NA 3I9MA 4YDSA 5F51A 3ZCTA 3ISTA 4K3VA 2QN3A 5A9RA 3B3JA 1SUAA 1V16A 5DSZA 1CKEA 3KEMA 3LQ1A 1CJVC 5FXMA 4CKCA 2ZIWB 2GLUA 2QTHA 3DL0A 4RZIA 4WK6A 3TAXA 5FX2A 5IP5A 4HK4A 3NT4A 2Q7DA 1P2BA 5EA2A 4B44A 1YJQA 4OA5A 2WA1A 5AKIA 1L5HA 3MOIA 5JPDA 4LRXA 2J31A 3RKRA 1A82A 4JQYA 5DX1A 1HDEA 4AF6A 5K3FA 2NO5A 3CZQA 1HA3A 2WRZA 4IY1A 4MGEA 1YIOA 2BR4A 2XWPA 5A6SB 1X7WA 2HQ1A 2ZSDA 4PFQA 3B2QA 4U2DA 5KNLA 1LXCA 4A2CA 2Q2VA 3KWJA 3O8BA 3S0JA 1AMUA 3AVUA 2W8BB 3JSXA 3MILA 1E1MA 1KI2A 1NFFA 1Z47A 3BXHA 2A5LA 3D3QA 3VR1A 1WJGA 4XSGA 5GP1A 2BFFB 3WS7A 4HNVA 3VHLB 3I9LA 1W1WA 1KZ1A 5CTAA 1QE5A 1FMCA 2PEYA 3IMKA 4JC4A 4PC6A 4UZSA 4W5WA 4XX1A 3RG8A 5IM4A 2HF9A 3HDQA 1RXUA 2X41A 3N9IA 4EVRA 1P5HA 1FRZA 3NGXA 1TLLA 5JVDA 1A2QA 1KZ9A 3TXXA 6ABPA 4B3DA 1NULA 2ZANA 1I2BA 3MWDB 5GONF 4XQ0A 3L7BA 2YV4A 3CUUA 4P83A 1LVUA 2HWUA 5THXA 4E5VA 1N0VC 4TTRA 4QLOA 3BS4A 5FNVA 1ZSVA 4KGXA 5K1ZA 9LDTA 5KNBD 3RC7A 4NAHA 1FX0A 1D5CA 4X8HA 1ZHOA 4BL5A 3AFNA 1U9IA 1Z68A 2CYBA 2I7DA 4PSUA 3HGTA 3EGWA 2WV9A 2PMEA 4LHEA 3L0YA 3FZGA 3NIGB 3OM9A 2HEGA 2XDQA 4B33A 2XCTB 2O5EA 3NC0C 5M04A 3ZG6A 3IAUA 3PITA 2VNHA 3KO8A 4GYWA 4BQOA 2ETVA 4HLNA 1GUZA 4RY2A 1OC2A 3WV5A 1I3KA 3EH1A 3NB0A 3TM4A 3ZBPA 1CZLA 1AO3A 1DKNA 2JW5A 3ZBUA 3JWPA 1CUUA 2I7XA 4L73A 1NBAA 1ZUWA 2YFKA 3QX3A 3I9OA 1QIDA 2X0KA 4JELA 2YWCA 5AI5A 1R1DA 3WGOA 2O7RA 2IYTA 1FNCA 1XMVA 2JVIA 4FQ8A 4GX1A 4U6NA 4UM8B 4X20A 2I2WA 2WY2D 1W2HA 3KAPA 2C4TA 3HMQA 1I80A 1U2SA 4EAAA 3SHTA 4FFLA 3KJZA 2ZRPA 3K2EA 3OE7D 1JH9A 2EKPA 3VC2A 1OT5A 3MWLA 3EF0A 2OHFA 1QNLA 1Y6QA 1ZOPA 2TECE 3NU1A 4CDRA 1J0CA 2X58A 4FYYA 3ZTYA 2WILA 3EQ2A 3A6KA 3HM9A 1N9KA 1M33A 1V3UA 1W1UA 1Y98A 2V6FA 1M3SA 3SXPA 4D3SA 2ZRIA 5GZ3A 1LS6A 4U5XA 3FCAA 1BZYA 1GZVA 3OFKA 4KC0A 4EA8A 1Y4DE 3ORSA 3AYZB 2XLCA 1O58A 1X7HA 2D5CA 3IAFA 4KE6A 1WRBA 1CQPA 2R66A 2VXOA 3OEED 5IAEA 3EVTA 1MH9A 4Q1FA 3KQMA 4DQXA 1GCAA 5DM0A 1ZI8A 4M98A 1VTKA 3NJ4A 1LNQA 2CXTA 2W22A 1J39A 2X3FA 4J76A 4Y9RA 4D9IA 2XCQA 4GP6A 3QVUA 1MIHA 1PJCA 1Y3HA 1NQVA 1ZN7A 5C18A 5IG2A 5IVHA 2EJTA 1ORIA 3RTAA 5CAEB 1N7HA 1G8SA 5AW9A 2EX4A 2G8NA 1CJUC 2BEWB 3R5XA 1EK0A 2DC1A 1ZMRA 1RCUA 3O47A 4CZ2A 1QFYA 4JBXA 3FPSA 2CXUA 2PKXA 4JROA 4CMIA 3TTVA 5EWJB 4TMFA 3LXRA 2ZBFA 2E18A 4A8JA 4HZGA 2QBYA 5FBZA 4HRXA 2WWWA 1EVLA 4YJ2A 2GTIA 1I51A 5EE9A 1SN7A 5HIMA 4WXEA 4B3TB 2YWEA 1QK4A 1UJNA 2OFOA 3VU9B 1B8NA 3DD5A 4TUYF 1K7FB 3WRWA 1ZC4A 2EQBA 5FHRA 2OCKA 3JYOA 4S1NA 3W6OA 2AZ4A 3BAFA 2ICAA 3OTHA 3D1LA 4JA0A 5E6SA 1YRBA 3ZLBA 4G41A 2PD3A 3FFWA 1QFMA 3SR4A 4CDGA 3RBAA 4NQZA 4COKA 1XALA 1IOZA 1N7IA 3DBVO 4JLWA 4NWIA 4E30A 1PCXA 4B9AA 2J9YB 4F85A 3KS9A 1L8QA 3QQ5A 4RY0A 4TKUB 1LPOA 1PDOA 2P3OA 2QW8A 2DPLA 1HL7A 1RZ3A 2GA8A 3H4VA 3KR9A 3R9IA 4DANA 4N0PA 2WFMA 4FFSA 4LDJA 3PQCA 4NONA 3T52A 1MX1A 2IU6A 2NX2A 3H5AA 4REMA 1WE2A 4HN4B 2VP4A 1RZRA 3MMNA 4GSLA 4NCJA 4BNDA 1HY3A 3CUTA 4W7IA 3FGZA 1EZ4A 1H8HA 2ARKA 2BHTA 5TGDA 2IS2A 4JD5A 1LRJA 5K2MA 1CVRA 1O95D 2LKDA 1U9IC 2Q5EA 3A6JA 3AIIA 3LPLA 4QUBA 5K8UA 1Y37A 3QSGA 3ZD8A 4PN3A 1W49A 3AVWA 2EHDA 3GDOA 3LCCA 1RKUA 1E64A 4G0OA 1NWHA 1PWXA 2RGNA 3JVIA 2IXBA 1M83A 2B4AA 1R3UA 2QPLA 1XCBA 1B6SA 3HZOA 2X1HA 3AFHA 1XXHA 4FFDA 4P1ZA 1Z06A 3P9PA 3ENKA 2IW3A 5JJ5A 1YE3A 1R15A 3B2EA 1ZVVA 3SXJA 1TT5B 2Q5QA 3LT2A 3AX6A 4WOJA 2XKAA 4MGKR 2BZGA 3S5UA 1SUFA 2Z95A 2AT1A 2IOQA 4JJ7A 4L2IA 5T57A 2ASEA 1PEAA 2I6SA 4D99A 5EMLA 2NAPA 5LIRA 3I39X 1PUJA 4D4JA 3I9JA 4YLEA 5HJEA 4P34A 1H0KA 3SHVA 3CB4A 1E89A 4KHPB 1W4CA 4C05A 1OHHA 1BEEA 2FEWB 5JPCA 3HNRA 1RS0A 2QM3A 3I8SA 2ZB8A 1ONNA 1BRTA 5ARDA 3TZ6A 2FPMA 3AZQA 5JMOA 1UP6A 2J0EA 2DHCA 1LB1B 4U2BA 1JEYB 3U3XA 2C61A 2P41A 4TRJA 1STOA 5AVKA 3NBQA 2C2HA 2FKNA 4KN9S 5ALFA 3P1JA 4WV3A 2JRLA 3CR3C 1MAAA 2FFQA 2DJ5A 3BC1A 2FZCA 2XDYA 3MCAA 3R5HA 2PL9A 1XZFA 3WWZA 2QU7A 3GFPA 5K0FA 1KP2A 1UC5B 1PX2A 3EQZA 2COEA 3HXPA 3Q6NA 4FFRA 4A6DA 4WOPA 4PZLA 5BXYA 1J0XO 3QG5A 2X0JA 3MJFA 1MD9A 3FSGA 4ABYA 3IVAA 3PFBA 4BE7B 2M1ZA 3KOYA 1ETHA 3T1YB 1JHMA 1SBHA 3RYHA 5K05A 4OKIA 1LWOA 3OQJA 1K5DA 4I50B 1UBCA 2C20A 4HEHA 3ZHYA 3K73O 4PIPA 3H04A 5AR1A 3KU1A 4HJRA 3EFEA 4Y98A 1P0IA 3EGDB 5HP4A 3T5TA 4QQKA 1E9VA 1JDVA 1H4SA 3N39C 1B8UA 4IIBA 3AI1A 1DG9A 1RKQA 2VYCA 4JUIA 4OQXA 4AJJA 721PA 1J2TA 1YL6A 4K8RB 3CLUD 4DA6A 5KSOA 4KQGA 4DCSA 5INTA 1XROA 4UOQA 3KTAA 3DBHA 4Y0VA 2QRGA 1G38A 3CPHA 3C39A 4AULA 3Q4GA 1QYRA 1VPVA 3GJSA 4UREA 4RC9A 3PFGA 4GXQA 3B1XA 4O8CA 3FCUB 3TW6A 2VPTA 3F47A 3N2GA 1TA9A 3SX2A 3KLBA 3L93A 4CM1A 5ICGA 3H75A 4RH3A 2GLTA 3W8FA 1U7DA 4ASUA 1HNWB 3VXKA 1JDJA 2FRVA 2H1OA 4PRZA 4I99A 2J6IA 4ADSG 4GKAA 4KYTA 2YYZA 4IVRA 3CPSA 3GC6A 1EDDA 4POOA 3U80A 1L7VC 5KMGA 2Y4NA 1MENA 3NAMA 2V6GA 4RJTA 1S7CA 2O2DA 4PYNA 3UT0A 1C5KA 2WDZA 2F9MA 1JHPA 2QTBA 4HAYA 4UBLA 4R2WA 1OJLA 4UTOA 3LU1A 2RGNC 2WFAA 3Q7SA 4NP6A 2R1TB 1UR5A 4CMEA 1EAMA 5IDVA 4BPBA 5JPIA 1XYYA 5LQKA 1GDDA 4DW8A 4YV2A 5F73A 5CB6A 3THXB 2CV2A 3KZMA 2E0IA 3I32A 5FT9A 1SU8A 3WGUA 3ESBA 1ZK3A 3QPUA 5JSZA 2ZLBA 1NF9A 1OLXA 1LY1A 1WQ3A 3BICA 1DAHA 1BWPA 4A0GA 5KQSA 3OVMA 5ADWA 1RWXA 4X54A 4H1VA 2HRZA 1DQYA 3ZGVA 7ABPA 1MHTA 3O0TA 4FZJA 3E84A 5EUCA 3DQZA 5IF3A 1I5OA 3UAVA 2YWXA 3A4VA 1SCUB 4IYRA 3D8RA 1ILWA 2RGCA 3CT4A 4WXRA 4E4YA 1K4MA 1YBMA 3K0AA 2X5KO 4WN9A 3K9HA 5SZHB 4HB2A 3WDLA 3Q7PA 4RZSA 1BFUA 5JW6A 5LP6B 3GGCA 1QPGA 3GA5A 3IA7A 4FYVA 4FB5A 4BHTA 1YSCA 3IH5A 1RM3A 3IUYA 5J2TF 3TOSA 4HLDA 1GGMA 1X94A 1JGTA 3ZHZA 4EVQA 4F8EA 4KWHA 4YCAA 4BNYA 4PCLA 3H5WA 5FF9A 2HPAA 4MV1A 4CGYA 3A26A 4RKWA 1XQXA 1OA0A 2NSDA 5MN6A 1PD0A 1Y8AA 3DBOB 4H18A 2D2XA 4KACA 2PYIA 5LOVF 2YRFA 1NF2A 2BGRA 1NXVA 2PAAA 1U98A 3C3JA 2H31A 1A9ZA 3GJRA 3NKVA 5JS2A 2HA4A 3DMHA 5JTTA 1JFRA 3PVCA 1P9NA 2HPHA 3LTNC 1L9KA 4B3JA 5BV1A 1T9GR 2DFNA 3MJRA 1HG1A 2AWNA 2FCAA 1YNSA 1SURA 2PL1A 1TB4A 1XR3A 2C7BA 2TMYA 2OWEA 1VIVA 2V7TA 4QE3A 5KWEA 4ZQGA 2ZJBA 2GRJA 4YQZA 3BB3A 4ZI7F 3KAQA 4H7PA 4CTMA 3OCUA 3TD9A 3KTDA 5JC8A 4IIVA 4RQAA 1NVDA 1L0BA 3INGA 3LWBA 3E9EA 4DVGA 1ZEMA 3P9CA 3LG2A 2CC2A 4DV5B 3GJZA 2YBEA 2BW0A 4Y6LA 5L7TA 1G5HA 1Z4PX 4O4LB 1C1DA 4PYIA 1J0EA 2P4QA 3H2YA 2N3ZA 1N34B 1WCYA 4B43A 5CVCA 4L8FA 5I9BA 1A88A 1GP2A 4JR0A 1J8QA 1U0EA 2HGSA 5EXXA 3KQNA 3MTJA 2BTQB 4MR9A 2CCGA 3TOZA 4KRFA 4DILA 4AJ1A 2Z6VA 3PJRA 3K6JA 2WUGA 1JPNA 1QIMA 3N6XA 4FSDA 1FQWA 1SU4A 3CKKA 3T3EA 1T2DA 2ECOA 2NPIA 3HKCB 1XDZA 3KHSA 4X90A 5DX8A 5SYMA 3WMRA 1R4MB 1O6ZA 2JLZA 4AQ7A 3RIMA 1JPUA 1THGA 4H4CA 4KNYA 4U7WA 2XUPA 1PR5A 2WLSA 4PHTA 5JJBA 5LJIA 5CFOA 1BA3A 4BEJA 5EHZA 3N59A 5IABA 4B3RB 1E7QA 1U0GA 4P6VF 5C8YA 3SF0A 4LHXA 4D8UA 3FZQA 3MS4A 3U62A 3I04M 1PP4A 3VPDA 2IS1A 4QRDA 3ASZA 4LOHA 2PFSA 1QWOA 3CG0A 4R31A 2Z9DA 3WMXA 4ZCTA 1JDBC 2Z2ZA 2CNWA 1GA4A 1EGHA 3DOEA 3QX9A 4HC4A 3OTIA 4B6RA 3BT7A 4Q7QA 1NBOA 1G6Q1 1JI3A 1Q0UA 1T5HX 2GOYA 5BV2P 3I8XA 1A2OA 3JQFA 3L84A 2OHIA 3ZYZA 4DTIA 4MYUA 1XBTA 2VZ8A 3M5CA 3ORYA 4ZAYA 1RMTA 4RPGA 1I6WA 1NFRA 3KKZA 3GT4A 4Q9DA 1YD7A 4BY9E 1FVHA 2NAFA 3RIGA 2BZSA 621PA 2VYFA 1DJLA 3QFHA 3DD1A 1QSGA 4INZA 3RU9A 1IUPA 3WNQA 1ZICA 4C6RA 4TTIA 3M6VA 1JE1A 3R09A 3QVOA 4JLAA 3AJDA 2GK7A 2Y0CA 3HWWA 4Z3DA 3QG1A 1D2EA 2H54A 2RDMA 4MX8A 4BO6A 4EO9A 2R9VA 2LCIA 5J59A 3RT1A 4D02A 1TCUA 1WHTB 2GHTA 4C7OB 3EZLA 2PMBA 4RD2A 2R4TA 1PD1A 2Z5LA 3DB1A 5K0CA 1B74A 2XYQA 3KXIA 2C59A 1ISMA 2G1UA 4QVGA 3TKLA 1EDZA 1U31A 4EGAA 1J1ZA 2G70A 3H86A 4OQMA 1IM2A 4WLFA 3WGYA 4F97A 4DG8A 4NDZA 3HN6A 1Z8FA 3PYMA 3QXCA 1CQIA 3IPRA 1JLMA 4KQMA 3GHHA 1QFJA 2YV5A 3EIQA 3JCZA 3GLFE 1JR3A 4UASA 1FNMA 3KJFA 3OEWA 4BFUA 4BV9A 4V1CI 2HHLA 4IX9A 4A6XA 1KY2A 1LSJA 4EPYA 1AXEA 3U5ZB 4F45A 2OAGA 5ALNA 2EFGA 2I7VA 4WL0A 4URUR 5T4FA 2NNLD 3WYEA 3ON5A 3ONEA 3CJTA 3OQPA 1LW6E 2WWIA 1NXOA 5MN5A 1OXKB 1NAIA 2GPBA 2Q27A 3R3XA 4J2HA 4ARVA 3A6PC 1OILA 4RZHA 1MOQA 4JI5B 3RBZA 3SEFA 4A2PA 5BNZA 1CQWA 2GBFA 1F2VA 4YMIA 4C7KA 3OA2A 2NUPA 2JDIA 3T5GA 3ADCA 3TNDA 3VC1A 3MCTA 4OBBA 5K6AA 1JHZA 2Z8XA 3HV2A 1UQUA 4U7HA 3GJ4A 3RBXA 1FW8A 1QPBA 2FNAA 4XVUA 1XLVA 2ZT5A 4WGGA 3DDOA 2NLOA 2Z6UA 2FEMA 2EW1A 3BD6A 5DB4A 4XB2A 2R6JA 4LWZA 2DETA 4IUCS 4CIVA 2H1IA 2WG0A 3DR3A 1O9HA 1OAOA 2QUJA 3F5SA 3VISA 2G0NA 2QYTA 4RCYA 3CO0S 3GLGE 4M36A 3H19A 3ZZMA 1MABB 5FWNA 3BWVA 1R4NA 1TF7A 1GPUA 2I78A 1NL3A 4TS3A 1REQB 3MJTA 4YJFA 3GRUA 2BEUB 2HK8A 1LPAB 1J22A 1LC3A 4MLDA 4QPJC 3T34A 4BJ1A 2PZGA 1VP3A 3P4YA 1Z6TA 4JSYA 1Z8HA 1UWLA 4JODA 1O4VA 3ZVLA 2VTDA 1ZCAA 4C21A 2G9QA 1E2EA 4RZ3A 1O57A 4UNRA 3H2BA 3L6RA 1E3QA 2PQ6A 3HLKA 1Y1KE 1A8UA 3E3LA 3U26A 2GGSA 7ADHA 1YZUA 5ECWA 5EIWA 1G20A 2H2WA 4HX9A 3LHKA 2ZJ4A 3QLEA 4GYYA 3OT1B 3UV7A 4OH1A 3I2IA 1UFVA 5LMCA 4IDBA 1QO7A 2IPMA 3DEJA 3JR7A 3QWFA 1QQTA 3EOBI 2WSYB 3VVBA 5JO0A 4OYHA 3K1AB 4LW8A 4Q0MA 3OA0A 2XAAA 4X6XA 5FUQA 2ONKA 1NR1A 1E6LA 4R81A 2Y1LA 1GSOA 1HYEA 2RHJA 5J9FA 3OQMA 2CUNA 4UVEA 4CQLA 4AP9A 1JDPA 1V9SA 2D1QA 1L9XA 1Q14A 2HCRA 1H69A 1QB7A 2B6HA 3FCYA 3H2SA 3UJ8A 4CHTA 4DA7A 1VYUA 4UTNA 1XZMA 4NXMB 4BKQA 1CZOA 2V7XA 2O2CA 2VJMB 4HGNA 3G85A 2GN2A 5AD1A 3GCDA 4RIFA 5GONB 2F4NA 1O8CA 1U2DA 2I8LA 5DNCA 2QXUA 1M2JA 1EFKA 1GNRA 1PFVA 2VA9A 5DLDA 3PPVA 1YF3A 1QRTA 4JXJA 2PUFA 2QD4A 3PRYA 1DG1G 5LZ5A 1UMBA 4JUBA 2G25A 1MU0A 1VRCA 1MW9X 1XEAA 1EWTA 2QX7A 4M0LA 2XRZA 1Z63A 3Q7TA 2PXXA 1L8AA 3C3YA 3NOVA 3D6FA 1Z8DA 2GK6A 1BTOA 2ZATA 4C4TA 1L5FA 521PA 2HJRA 5CT5A 4M37A 2VJKA 2G36A 1IAQA 4ZA2A 2IHUA 1Z22A 2Y76A 1XQYA 3T6KA 1VBFA 2CFIA 1HLDA 5TIIA 1H6DA 2VVTA 2QVCA 3RC2A 2CJPA 2WK1A 3TLGA 1HG0A 3VDNB 4JLNA 2ZTUA 3FYHA 1U1DA 4UXHA 5EE3A 2B92A 3F90A 3GZNB 2XKJE 2JFXA 1I5RA 2RGEA 3O3OB 4WD3A 3ICEA 2ZYAA 3I6ZA 3PX2A 3EXG2 4QFCA 4YJHB 3B6JA 2P6PA 3UUFA 1XD2B 1MTZA 1JB9A 2Y92A 3E9NA 1GRRA 1V37A 2RHTA 4IPTA 3Q8LA 2NO7A 3IPAA 1ESZA 3WLFA 4DR6B 3T3GA 4FNOA 4PLWA 5JG7A 5IFLA 2H29A 2H5JA 4FOOA 4GZ6A 4YAFA 5JCJD 5K6AC 2JH3A 3L7IA 3FWPA 2E7ZA 2WT4A 1NVMB 3T7DA 2JFFA 1HM5A 1W9MA 4TYMA 2XKBA 1DJNA 3OPVA 5DN6D 3TBHA 3VO8A 4G1EB 1EP1B 2OFPA 3I42A 4MWCA 4RACA 1DELA 4DIOA 1UBLS 1KYXA 1U3CA 3LUDA 4PHHA 3G8AA 1TD9A 3I6IA 2B7BA 4FN5A 4BZPA 1WF6A 1UODA 2ENWA 1N5IA 2HA7A 2JD1A 3HDTA 4HTFB 4JEHA 1LZLA 1YBVA 4L50A 4N82A 3WG9A 3UC5A 3CPEA 4GE3A 2VRCD 1G2QA 3TVYA 5KWIA 1KEUA 2RC6A 1UPAA 1EHCA 2FWJA 3FUTA 4JU8A 1ORTA 2UAGA 1QJ4A 1WPXA 4G89A 4TXHA 3V34A 2PSSA 3ZCUA 3AF5A 1LRKA 5U1PA 3PZBA 3GEHA 1N4AA 3E8SA 2FWAA 5TQ0B 2FZWA 3HABA 3QKSB 3NVKI 2W2KA 3OZXA 4J94A 1UMKA 3LX6A 3MAJA 3VKGA 1TUBA 3IDOA 1QC5A 3LHIA 4TUYB 1TJNA 4N3CA 3ZR4B 1W76A 1FYFA 2WF7A 1OLUB 1GV1A 3RHFA 2CJWA 4FEEA 2ZSBA 4LRYA 4K7JA 4OG2A 4WZBA 1FP6A 1JSRA 2ZJAA 4KX5A 3H5TA 3NPAA 4CLOB 4ZCRA 4FT2A 1G3UA 1NR7A 3JARA 1PNRA 3DTVD 5IJWA 2J4DA 4HXEB 4F4DA 3D3EA 3U09A 2CVZA 3AM4A 4BX3A 2B1RA 3AF2A 2B4TO 5LYYA 1AS2A 1JAIA 4NEHB 4TWBA 4GO1A 1U2DC 3IV9A 3WIDA 3G7SA 2XA9A 3RGGA 1MA0A 5EXDA 4B3HA 2I9KA 1BX3A 5D6OA 2FSIA 2VPIA 2JGIA 4KRGA 2XQIA 3K9LA 3DHEA 3K1YA 4UBNA 5C53B 1T5IA 2HX1A 1K8QA 4J0EA 4RMJA 2HLHA 3ZU6A 4ZIRB 3SCZA 1K08A 3NETA 4AKTA 1C8KA 3DMGA 2GD0A 2A9KA 4M46A 3ILHA 1XAIA 3FSRA 1XZLA 1FC0A 1SPBS 4M83A 2VEOA 1JTFA 4EFDA 3G82C 4Y1FA 1P2TA 4N49A 3G5LA 2WD7A 4ZEVA 1SRRA 3EDYA 3PNYA 5KC8A 1YRQA 2XB8A 3O91A 4RM2A 3IALA 5DULA 5FPHA 3T9EA 3STHA 1D2AA 2FN3A 2W6ID 3WKBA 3R3VA 3W6UA 1M2HA 4C6TA 2B3DA 3I5UA 1XZ8A 3VSEA 2FDXA 1JT9A 1X7XB 5EJ8A 3BE5A 3T3NA 5JAIA 3MC1A 1IG3A 2WJPA 1KJZA 3Q3IA 4OLAA 4TS4A 2WJ4A 5K0ZA 1KO8A 3F78A 3WY9A 1YACA 4DLPA 3C3AA 1GL7A 3I45A 4DC9A 1ODFA 2UXBB 3SE7A 1UAYA 3VYWA 1UM9B 3EVDA 1JTEA 1TMKA 3H2IA 1KO1A 1HSZA 1O94A 1V3TA 2G7MC 2GPNA 3L77A 3HI4A 3MINA 2Q0SA 3CU5A 3Q9UA 1C9EA 1BWRA 5FI0B 4TLDA 2RK3A 5T67A 2QX6A 5D5PA 2JGEA 2GFHA 1MKYA 1A8SA 4MGHA 3PGXA 4LJSA 1GQ2A 2X9VA 3DZKA 5I8WA 3R6TA 2QE6A 3K8QA 3D6NB 4M1ZA 4ALMA 4XLTA 5JISA 2K2WA 3A1WA 3HU3A 5EHQA 2BLLA 2KSQA 3UWDA 1AK2A 1D4AA 3PR2B 4K86A 4C2UA 5FV4A 4AUMA 1VMEA 1BQEA 4U2EA 2CBZA 2HMVA 4IGEA 3T3OA 3L0CA 3A6HA 2RHHA 2FK8A 5DASA 1QGAA 5DCLA 5T3UA 2GH1A 5EGNA 1YULA 5IKOA 3SHFA 4BVGA 3V4OA 1DINA 3N0XA 2E4ZA 2JFGA 2YW2A 3FR7A 4LDAA 4RJ2A 5CCDA 3OSZA 4QG7A 3KKOA 3OUUA 5BUZA 1FYVA 2ZDGA 2HMWA 3AI2A 3C4QA 3TO5A 3AEKB 4CLHA 1UPFA 3IL2A 4HQFA 4L4SA 4MIEA 3UJ6A 5FPQA 4BO9A 4AJEA 4MLPA 5F76A 1HDIA 1AGXA 3IO3A 2XB2A 4UKDA 4F2WA 1MMFB 1SD1A 4MR8A 2PGAA 4H6PA 3VRHA 1IQUA 3RJTA 2WE8A 4N39A 5E6RA 1G66A 5LLDA 1YR6A 5EGSA 4F6RA 4TYNA 2HW8A 3X43A 2RHMA 4OLHA 4N9WA 2E2WA 3EOZA 3EC1A 1YB5A 3OETA 1VKNA 2LNDA 1Y5NA 2YVKA 3CRVA 4XQ9A 4UNQA 5KYXA 5EJ7A 3VHRA 5AI8A 3ZGNA 1MT3A 1N5JA 3IDQA 3O9ZA 4FOTA 4MVJD 1OF1A 3IESA 1FP2A 1VFNA 3ANLA 4RKRA 4M0EA 4Q39A 3OPYB 4WXHA 3M6WA 4TWIA 5CFPA 1WBJB 3EMBA 3G89A 4O5AA 4C4OA 1T25A 2J3HA 1JG7A 3AOGA 3HSKA 3FOEC 1YTUA 2BFMA 4BTEA 1ZLXA 2G83A 3UMJA 4RPIA 5A5VA 4D82A 4FYHA 3AQ4A 3QLJA 3KSMA 2IZ1A 5C35A 5ENVA 3GFBA 1ORHA 3BOSA 4KR9A 4XEUA 3T7SA 4YMSA 3RB8A 3C0KA 3OCXA 3U7QA 4ND5A 4RFSB 4DDVA 3A6FA 1J90A 3IDZA 4J07A 3WSVA 2FUCA 3A9RA 1GLNA 2HT6A 2TS1A 3KTFA 3N3AC 4JJ8A 3TLBA 3WLKX 4BFTA 3FZYA 5KOHA 2PUCA 1H2FA 4CQNA 2PS1A 1ZU5A 1IONA 1EWVA 4GL4A 4EPRA 3FTDA 2ZRLA 3B7PA 2F1HA 2WQ7A 1DAEA 3UEOA 4PHGA 4OU4A 3OZTA 4AZ0B 4B3BA 1GNTA 4YVFA 3HBMA 3VV2A 4IM7A 4MVWA 4XX0B 4KR7A 1FP1D 4FBLA 4PSKA 1LDMA 1BE6A 4XEHA 1FDRA 5EN4A 4D0RA 3UB4A 1KI8A 5GIPE 1NT2A 3VYVA 1UFKA 2YCLA 4IG9A 2CY0A 1QKJA 1RJWA 4MPRA 5JROA 4MW9A 4J2TA 3I0ZA 1X3LA 2MHCA 3EDQA 1EM8A 1U3GA 3H6GA 1XMSA 2CBGA 2ZWVA 4OXKA 4QJIA 1TUIA 2V7WA 3Q8MA 3HRIA 4L5YA 3PEVA 4A73A 1C7ZA 3F6CA 5LB2A 2GJSA 5LOVB 4HNTA 4GLOA 2Z3VA 2H2DA 4JI2B 1JB1A 3E3NA 5BORA 1M2NA 4KO8A 2V7UA 4N5LA 4U7JA 5HMLA 5D86A 3BWBA 1XEFA 3CSSA 5KC9A 2PH1A 5M7EA 2QRJA 1DBWA 2IXGA 2QGZA 1WCWA 3COVA 4DXHA 3V2IA 4XKJA 4MVJF 5B55A 2AA3A 2OUIA 2GA9A 1T8UA 1N57A 1YCHA 3SZRA 1M8PA 3W4IA 4CT5A 1OXXK 1MGPA 2OGSA 5EP2A 3R7WB 3H3FA 4DSNA 5KSYA 3KZKA 3OOSA 1PR1A 1UKEA 3GYBA 3MFQA 4F46A 4F3YA 3SBEA 4XUDA 3UJNA 2QT9A 3I30X 4P86A 3DKIA 2A30A 1U7OA 1XPJA 1VBMA 2HF7A 3BWMA 3H87A 4CG0A 5JBIA 3TI9A 3VR5A 3ORQA 1EK5A 2PX3A 1T0PA 3FH0A 1XWIA 1YI1A 2UYCA 2G63A 4EG6A 1XHFA 2HQSA 5ALWA 4CGZA 3AWDA 1OV4A 3EY4A 4NAUA 2ONJA 2JNWA 1VRWA 1WP9A 3WNDA 2A59A 3WXBA 2H5EA 3HYLA 2B2XA 2VBGA 2GTHA 4GPIB 3W34A 4DQDA 1Y8ZA 4JJGA 3ROTA 2DPMA 4R5HA 4FCTA 4CU5A 1SCIA 2G06A 2J6HA 3M9WA 4QXOA 1A4IA 4K9MA 1ABFA 2P5YA 1V0JA 2AJBA 4S0ZA 1FA9A 1TCVA 2PZBA 4OB8A 4Q3DA 3G9XA 4E2XA 4BCCA 2R5FA 1ZW6A 1DXHA 1NX6A 3RARA 1GPAA 1RYEA 2ODQA 2Q1YA 2GO7A 1DC4A 3CZAA 3U49A 4R2XA 4XCXA 2GZMA 2J3IA 3W04A 3FI0A 2D59A 2D00A 2R25B 3FHTA 4MVJE 3D4NA 2GNOA 1OH6A 3LMKA 4LZWA 1U7TA 2J67A 5A7GA 5ITZB 4CI0B 1W4ZA 3IIIA 4RKEA 2HV8A 2VHVA 1IN5A 2K4MA 1MR3F 1PTJC 3B1KA 3OZ7A 2WJ3A 2YV1A 2AJDA 3GLFB 4ZOCA 1GNVA 2D1YA 1AMOA 1YZGA 3RBVA 3UJ9A 3CTPA 4A4DA 2IP1A 5B1YA 2OXCA 2XRMA 2GN4A 1LZKA 2I3DA 2HIGA 3E53A 4MKHA 5FWYB 5IDXA 2XNDD 4ZEWA 5FJJA 3DDWA 1C14A 2R8YA 3Q8XB 4W8HA 1ZESA 3DZBA 3KT3A 4WCDA 3QWHA 4FJ2A 4K1LA 4FGJA 1YVUA 2PUTA 1EWKA 2PJZA 4EHBA 3ND9A 1H1TA 2YQZA 4WXMA 4BO4A 2XMQA 1QIHA 1Q0RA 3N5CA 2ID4A 1T8SA 2OHOA 2R4UA 3MA0A 5DBEX 1RLIA 5B58C 2E89A 1DZIA 1QVZA 3BRSA 2C7PA 4YRCA 1OIWA 4KQXA 2QLNA 4MTCA 2JJ2A 3GJQA 3P9NA 1JG6A 3I2JA 2ATIA 3PU6A 5LMNB 3UTCA 3M6AA 5BVGB 1KKLA 3OWHA 4IQ8A 6REQB 1FXUA 3SBDA 2VT2A 4YA6A 2XF2A 2YJGA 3SM3A 2HHHB 1KNXA 1JXAA 3GGGA 5TC4A 4CQMD 1MEJA 5EP1A 3EXHA 4N6OA 1G0OA 1EX9A 4ARBA 3GLGB 4GGPA 3DTNA 1G21E 3PSAA 4MQMA 2XMRA 4P4NA 2V7EA 3BBLA 3HUDA 5ADUS 2HR1A 2Q3LA 4Y6QA 2BM8A 1CY4A 2PO5A 1T4BA 2XHZA 1V6AA 5CYPA 1IQPA 2YVAA 1IBSA 1S7GA 3IQWA 5A3SA 3JYQA 4KBFA 1BU8A 2IWRA 5A03A 4YPVA 1FFDA 4E08A 2WP0A 3JW8A 2BRUA 1GTSA 3B70A 2FN7A 5A0TA 1F2DA 3LHFA 1XDDA 2JGKA 2FZ5A 2PPVA 2AOUA 2PSFA 4MV9A 4RD3A 2EV9A 1H1LB 3PDJA 5KNCA 4K0KB 5EMJA 2J7PD 3L6BA 3FRIA 3ZCVA 1H5QA 3KPUA 1RZUA 3DHNA 4D0LB 2C2OA 3HDYA 4HGYA 1CUIA 3JQGB 4LZZA 2ALJA 1CUHA 1J2UA 1CZRA 4IKPA 3LLCA 1P4RA 5MGBA 1LI4A 3V32A 5C34B 1DDGA 1PZEA 3VUFA 5BY2A 5HUHA 4PZPA 3K0HA 5JO9A 4Y0NA 3RRJA 1UBSB 1GADO 3P8ZA 1UC9A 4Y2YA 1O95A 4US0R 5AUQA 3VOTA 3X1XA 4ETMA 4JAVC 4K9NA 2BBWA 2QZJA 3ITEA 3PWSA 3P2OA 2XMDA 4WA8A 1L7PA 5ELLA 2PGNA 2JK0A 2VJDA 4PZ0A 2X14A 2D3TA 2HZBA 3JQCA 3IV7A 1NPDA 4KPGA 4QUIA 2JIZA 2FZGA 4UHJA 3H84A 1TF5A 3BJRA 4JI0B 1CT9A 3NHZA 2D7JA 3VH2A 1U5CA 2REQA 1DCMA 1QORA 2BF4A 3SZ3A 4BFWA 2ODTX 2C3UA 1RJ9A 1AE1A 1UMDB 3RSHA 1D1TA 3MBKA 5G4KA 1KNQA 1EHIA 2G08A 2G17A 2B30A 1QKIA 2XUGA 1FP4B 1XRNA 1V6SA 3I52A 2C8LA 3B7WA 1I2DA 5K20A 4BWGA 3ZW7A 1K86A 4FHFA 4TMWA 2ODAA 2RFLA 1SNYA 3NV7A 1XZNA 3NG1A 5CXUA 2V5UA 1ZO8A 5EYPB 1K8XB 4Q4JA 4C30A 5CVEA 1FFBA 2DLCX 5KVCA 4NK4A 3C6MA 3MTEA 4PX5A 1A7UA 5JMPA 1OLSB 2H1VA 3F8SA 1MAVA 2Z83A 3TQSA 4EH1A 3KK0A 1L7MA 4MJXA 5F5XA 4G09A 1TVMA 2AHOA 4HDKA 1W8IA 2CLOB 3JU3A 4NBTA 3V8EA 2BKEA 4DIBA 3P26A 1E2HA 3I37X 4UU7A 2HU5A 4ZCMA 1QO0A 3QNWA 4HAOA 3W2GA 3MWEA 4NICA 3OLZA 4W5HA 1XTZA 3QEMB 4NBUA 1D7OA 1DFHA 1XRQA 2X8AA 3EZ7A 4O2BB 4QOJA 5FTLA 3IEUA 5GJVC 1KMNA 2X6TA 3VTAA 2FW8A 4Z0TA 1XRLA 3OIYA 4BO5A 5BQXA 3WIOA 1PJTA 3TKAA 3WWYA 3GA0A 2FPRA 1MBZA 1JJVA 4KPUB 4XB1A 2FKAA 4TYWA 5KAMA 3ZWKA 4MI9A 4I0WB 2PVPA 2CFRA 5LWQA 3RS7A 1V96A 2OXTA 3UPTA 2QAGC 4J43A 5D5QA 3MM4A 2HI0A 1ULZA 2VIIA 3AFOA 4IHKA 1N3LA 4TMVA 4TKVB 4W1QA 4HNUA 5J2UF 1V8ZA 4Y7CA 2BFEA 2NNWB 1Y48E 3K92A 3MT7A 3ZGYA 2OCYC 1TEVA 4BNXA 3P9IA 3ZVMA 3DBIA 3L4KA 2Y0PA 1C0PA 1UAGA 4JEUA 1ZUNA 4KP7A 4PN7A 2WYOA 1QFSA 1XSEA 1F8FA 2WAXA 1VB3A 2WIFA 1KFCB 3ITDA 4FMBB 4L9SA 3QBJA 1YHNA 1RU3A 4PC3A 3DWEX 2BKAA 2AQHA 4BASA 1NP6A 2MSEB 4BAGA 2WP8J 4CNQA 1C7JA 4EY3A 1GTRA 3I01A 4BNUA 1FMJA 5AJZA 4DNXA 2YVUA 3NYQA 1EK6A 4Y1EA 4XSVA 1G6KA 3AUJB 4DM7A 4W9MC 3QF7A 5E4TA 3TH5A 4PXYA 3O2JA 1SVSA 4YQEA 1RFGE 2VP0A 2XYHA 4IXDA 4M1YA 5ICFA 3FMVA 3LPAA 3Q7QA 3DT9A 5HHTA 4IQ4A 3T1HB 3ZWDA 3LUHA 4MO9A 1VL5A 1Z0IA 4U7GA 3LF1A 1SAYA 4MAMA 2AFIE 4EG3A 1M0EA 1JKIA 2P3QA 1Z08A 4H3VA 4OMFG 4XIYA 5DYWA 3GLHB 1I6LA 1QJCA 3ETNA 4J75A 1O95C 4AURA 3HTXA 3D02A 4JT9A 3B12A 4G07A 5FADA 3RSZA 3T5CA 4OV6B 4J49A 1KI4A 1K1EA 2CFOA 2PWYA 3E3OA 3HP4A 5A4AA 1NLFA 1KEZA 5F33A 3AL3A 4IUDS 1PFYA 4H59A 2V7BA 1JAHA 3CT6A 3UXHA 4JP1A 4LJAA 3ONDA 3IAM1 1KI6B 1BHSA 4YP6A 4QTZA 4C78A 5BSTA 1EUDB 1VJGA 2UKDA 3UICA 4EYOA 4Z9XA 4B31A 3GVCA 2ZXFA 3JPWA 3U2QA 1QH0A 2YZ7A 1YDEA 2EW2A 2QZZA 4D4HA 9ATCA 5JNVA 3QQPA 2X77A 3PE4A 1TQ8A 2PO7A 3OLCX 1K0UA 4TMXA 5A6VA 3NUZA 5FORA 5TNXA 1W73A 1FUEA 1RI2A 1U28A 1WLSA 3NUQA 2B0JA 2BHRA 1F2TB 3N70A 1NG1A 2H11A 1ZFNA 2AE1A 3AHIA 4P3KA 1USVA 1Z4IA 3IUSA 5DT2A 4RDXA 5JTUA 5ENDA 1XJWA 2OBMA 4I4LA 2R3SA 1OGJA 3TQTA 2W8ZA 1KZ4A 1KEEA 5B1EA 3S55A 2JHAA 3TZCA 2QY6A 5E9QA 5KHAA 3R9XB 3LRPA 1JJFA 2ATVA 2BFOA 1GZ7A 2HNBA 3EXEA 2PVSA 2HAEA 2Q29A 3JV7A 2G71A 3U44A 3IT1A 2MINA 2IA5A 1WWKA 1WSWA 2RAPA 5SYNA 3HADA 1NP3A 4B7CA 3LX4A 3E8MA 5KTPA 4KQHA 5DIZA 1UH5A 2DPHA 4TM7A 3QKTA 4UHBA 4YCSA 3P2MA 2ZI5A 5LA6F 3RYCB 4KR3A 4CM4A 4RXMA 2ZB2A 3ZDQA 1OI2A 4XYMA 1HYHA 3B1ZA 5LMZA 1SMKA 4L6AA 4NK5A 5AVRA 3L05A 4YPOA 3KDSE 4ISBA 4HP8A 4ZVMA 2YHIA 4UXJA 1TUGA 3RQIA 3X44A 1RTKA 1XQ6A 3D8UA 3ODGA 1T34A 4X7PA 3ZXYA 3LX8A 4AY5A 1VMAA 1JP7A 3AMVA 4AKSA 5HVNA 4HXGA 3THYA 1CUVA 1Y8RB 3KBOA 1MNQA 1TAGA 3LLSA 1MJGA 3KQOA 4KQKA 4EATA 3KQLA 2PUEA 3O4RA 1K6JA 4TS1A 3PFHA 3D3JA 2QL6A 3QFRA 1NC1A 5DO9A 4AJHA 1HURA 4BMZA 3MLAA 2IEDA 1Y4SA 3PGA1 1KU0A 1OFUA 3UMMA 4FB4A 1DARA 1RHMA 5AH0A 3IOCA 1IH8A 2LPMA 3CLUC 3HUEA 4NOMA 3RODA 1OROA 1Y6ZA 1GPYA 3QM1A 3QOFA 3DXXA 4DLRA 1WAMA 3H5NA 1H2WA 2PZAA 2FPGA 2H7XA 3A70A 3REOA 3KHKA 3U4AA 3WP0A 2GRUA 2D13A 2GK3A 4MWSA 2XUQA 3WNVA 1V6CA 4ENUA 1FYEA 2VQSA 3INRA 2OZPA 2ISSD 1H93A 2Q6VA 2ZYVX 1QX3A 1DWPA 2J1LA 3HB0A 3HCNA 2AFHE 3RW9A 5GJCA 3UIEA 1U3WA 4GAEA 3W6NA 2JCGA 4RHXA 1DSSG 3ZI0A 2V4UA 2WKPA 5C32A 5ENZA 3PWTA 2FUEA 3VMMA 1RNLA 2VPQA 1SVUA 5TPZD 2AK2A 1ENYA 4OQFA 3R7AA 1ZYUA 3P27A 4MMZB 2XWQA 1QWSA 4KCGA 1TMYA 5U9CA 3OY2A 1RI1A 3VR4H 1S8OA 5FAKA 1EFPB 4MQUA 3DTVB 1M75A 3MRTA 2FW6A 2NV2B 3COJA 1TYAE 2IXDA 2R85A 3HXKA 3JTMA 4UEOA 5F1PA 3GJ7A 2JCXA 3IJEB 4OBXA 4ITUA 4U7TB 1CERA 5FRDA 3CRQA 3VYUB 4YIHA 5JWRA 1G3QA 5DI9A 4OIFA 4WKCA 3HCWA 1G2OA 1ZKMA 4NAVA 1H0RA 2DY0A 1E9SA 1G5QA 2YASA 1V2GA 2WEKA 2VNAA 3N2KB 2K87A 4ESVA 3ENQA 1SEVA 4BFLA 4RYDA 2K7ZA 2WJZB 3SK0A 1ISGA 3NHBA 1U28C 3DAPA 3PPYA 1ISSA 5DGHA 3VPAA 5CW2A 4WJZA 3DMRA 1FIUA 2POCA 2V7VA 3G88A 3IVCA 3GBVA 3NHUA 3L8FA 3WI7A 3O2NA 2GVZC 4EUHA 4KR6A 1T6BY 3ZWPA 4XGNA 4B32A 1UKCA 3MMSA 5BNFA 3RVSA 1LLCA 1VDMA 3EK2A 5H80A 1P2GA 4WMLA 1VSTA 3UAZA 4DA9A 5E7QA 1C2YA 4TL8A 3D5QA 4EUFA 2QVGA 4G1CA 2C2MA 1VCNA 3ZOZA 1Q1GA 1L7NA 1P0FA 1SVKA 4O08A 1RQ7A 4JUAA 3TRFA 3UG6A 1JFFB 2DR0A 2QKYA 3NV9A 3QE2A 1PNOA 4BGUA 5LD2B 1X9GA 5JDCC 3U4GA 3S8YA 1J0AA 1MPTA 1Z45A 1JHOA 1WXWA 1CLEA 3AJEA 3EZ6A 3FROA 3GLSA 3WGZA 421PA 1ZJYA 5H3LA 1D2RA 4KMRA 2NIPA 4MUBA 4RA6B 1OA1A 3ROKA 4JT2A 3ANTA 3VR2A 2JHCA 1ZGGA 3D3WA 2J0QA 2BISA 4MW5A 5AJXA 1TIPA 2C04A 5ALVA 1QE0A 5LDHA 3RKSA 3VKUA 2ZWIA 4NFLA 2GCPA 3ILVA 1IXSB 3KSZO 3EUFA 4UBKA 1TM5E 5AJHA 3GH3A 4REQB 5IVKA 1I32A 5CLGA 1MLDA 3C70A 5DYYA 2Q45A 3EZGA 1XCLA 4BP8A 5CYOA 4BVFA 4E6EA 1JLLA 4JENA 1IY0A 1ZJ5A 2AHRA 2JF0A 2OK8A 2P9QA 3N0VA 3QVXA 4MEJA 3UJAA 3ZWNA 2OQIA 3OTOB 1IBMB 2O2HA 2CXXA 2R2GA 2YS6A 3E3MA 2E5WA 3IOMA 3COWA 3UHOA 3ND8A 5L3RA 5EVCA 4EF5A 1NU8A 1E66A 1LRLA 4RHCA 3M89A 1Z29A 3P19A 1T5TA 3AEQB 2A6PA 3PZRA 4INJA 1L5NA 2OBBA 2F90A 3JYNA 1ZGCA 3HG7A 3ZTWA 1TGYA 2WFLA 2JFUA 2V6JA 2W2LA 1UQRA 3KKLA 3OFSA 5TY0A 4ARIA 5CXXA 3SQMA 4RXTA 1LBEA 3HJAA 2GDJA 3RLFA 1JXOA 1U3VA 2H9IA 3H1PA 4G67A 3O21A 4B3GA 1N6NA 2GYYA 3EC2A 4U8GA 4QVIA 4JH0A 3EE6A 1M34E 3EXAA 3K0CA 4JLJA 3MWYW 4ZT2A 4B6JA 1CU1A 4IS2A 4C5BA 1FDSA 1UT5A 4H60A 2CMHA 1VPDA 4AY4A 3K70B 4AJ9A 2ZGVA 2GXUA 1U8CB 2NZ2A 4URZR 5IKMA 1ACJA 2VI5A 3BG5A 3SIRA 1CYEA 3QU5A 4S04A 1OV6A 4BLOA 4BBJA 2WVHA 5E1OA 4ZYUA 2ZUBA 2QZPA 1JDZA 3A6ZA 3RWMB 1V2HE 3O4GA 5E8JA 2QZ4A 2RKBA 1EXDA 1E3JA 1NNUA 4B81A 3OLYA 4ZVQA 3EVAA 1YK0A 1ONSA 1KQFA