4L08A

Crystal structure of the maleamate amidase ami(c149a) in complex with maleate from pseudomonas putida s16
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
206
structure length
206
Chain Sequence
QKEVYDAAGFGNPVSRGVHPAIIVVDFSYGFTDLQYPTASDASLQMSRTKEICDLARALEFPVIFTTIAYHPGEIPMLPWLEKSSGMAALLYGSRLVEIDMATGIQPNDVVVVKKGASSFFGSTLSSLLAGTNTDTVVVTGATTSGAVRATVVDAVQSGFKVLVPADCCADRAKGPHEASLYDIQQKYGDVTDSDDILKWLRSVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydrolase, isochorismatase family
publication title Structural insights into the specific recognition of N-heterocycle biodenitrogenation-derived substrates by microbial amide hydrolases.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Hydrolase
total genus 70
structure length 206
sequence length 206
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00857 Isochorismatase Isochorismatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.850 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isochorismatase-like 4l08A00
3R77A 2FQ1A 3IRVA 2WT9A 3O90A 4WGFA 3MCWA 3TB4A 3O93A 2B34A 3OT4A 4L07A 3O92A 1XN4A 3HU5A 3TXYA 3TG2A 3V8EA 3O94A 4H17A 3HB7A 3PL1A 1NF9A 1YZVA 3KL2A 2H0RA 3S2SA 3OQPA 1NBAA 1X9GA 4L08A 3EEFA 1J2RA 1NF8A 2WTAA 1IM5A 3O91A 3R2JA 3UAOA 1ILWA 2A67A 1YACA 4WH0A 3LQYA
chains in the Genus database with same CATH superfamily
3LC7O 3A1WA 3AJAA 3PRHA 4JA0A 1AKMA 2ZAMA 3LOPA 3GIDA 4JYCA 4ZJPA 5BN3A 2YWCA 1NW3A 2XWPA 3ZVLA 3W6PA 4KNYA 3F47A 3KVNA 5A5VA 4CFYA 3JYLA 4MGHA 1X1DA 3MTJA 3U19A 2RHHA 1OAOC 3I1YA 1JS1X 4R5MA 1VE7A 2HDHA 2Y05A 2XTZA 3A37A 3LGXA 4HCJA 1X74A 4DUGA 5ALGA 2QSZA 4MVJI 2IKQA 1NBEA 1P2DA 1ISFA 1IPFA 1K7YA 3L8YA 4RWZA 4D57A 2NUTA 4I5GA 4ZEXA 2JLXA 1IEWA 3CNEA 5EC8A 1TRKA 5HDQA 1JWAB 3V42A 2ZLBA 4NXMB 2ZUUA 1QRSA 3ZWDA 2G70A 1XHLA 2QX4A 1MJGM 4IGIA 2W48A 1H8ED 1M6VB 3PXDA 1C9EA 1R00A 2PD6A 4PPYA 4L3WA 1BWRA 4UBLA 1GNTA 1NN3A 2NTEA 3T5TA 4DPKA 4TOIA 1EK1A 2X15A 3R74A 5ICMA 5EUBA 2VWQA 2QJFA 1SZPA 3I3SR 4YUZA 2RK3A 4REQB 4ZCSA 4A10A 1G6OA 2PAAA 2GN9A 1QAOA 4NEGA 3WZMA 5F33A 4B3RB 2B8EA 4MP8A 2BGMA 3GBVA 3GX1A 1P62B 1P6UA 4WXMA 4MOWA 4XASA 3WK5A 4C0WA 2WQ7A 4RENA 2JK0A 4IF6A 5AHWA 5KC8A 4F5DA 4PSKA 3E22A 4JCOA 2IP1A 2B98A 3V1YA 1BS2A 3WAGA 3WSTA 2ZUWA 3HKDA 1DGQA 5IT5A 4IRMA 3R7DA 4F56A 4DR6B 2I1LA 2YDYA 3OE4A 5IJ9B 3ZV5A 3GZNA 4UE3S 1UDAA 4PQYA 1PQYA 3IE0A 2BSXA 2PH1A 3BH7A 3SYNA 1JJAA 1EB9A 2D5AA 3KKZA 3W9YA 1KAHA 3SQNA 1UBHS 1H22A 1UJMA 2FGKA 3A4LA 2FDCA 1GSOA 5BXYA 2LW7A 2ZG6A 3MCTA 3AY6A 2OZLB 1P2TA 1JP7A 2IXDA 3GFBA 3RANA 2QDXA 1KZ7B 3L84A 5JNRA 4LNHA 4Y6GB 5LM3A 2B6NA 3FTDA 3HU3A 3MJDA 4PX2A 2ZXFA 1IN1A 1V4BA 4IDBA 4EW3A 3B3FA 2JAHA 2XOKD 3I58A 2P4EA 4RVGA 2IU0A 1CX9B 1ZD3A 4N12A 4KZPA 4GKJB 4Q3EA 2JI8A 1SUWA 4BJ6A 1N0VC 1JW9B 1NATA 3BMOB 3U7RA 5EINA 1QH8B 1RWWA 3R5FA 3T7JA 4B84A 1IUKA 1QDEA 2OHXA 1VBFA 4C0BA 1QIGA 1O6BA 3VHLB 1UBCA 4Q3DA 5JAMA 3EWAA 1JQDA 3I5MA 3AV0B 3BCHA 4WNCA 2A0YA 1YBVA 3FNBA 1AQIA 1ZMRA 2BAGA 7AT1A 1EDZA 1JH8A 3LP5A 2WSLA 3H9GA 3ICQB 1FB5A 2QR2A 4FMBB 4M1WA 3CVXA 1YFJA 1RHRA 4MDFA 3M4JA 3AIIA 1K89A 2RAFA 1UMCA 4YJ3A 1XB2A 4XQCA 3WO1A 3N2ZB 3EK2A 4AG6A 1LLQA 1FPMA 4LWQA 5KWJA 3B5IA 1LTKA 4GLLA 3FYUA 1YHYA 2A67A 2I62A 1W0KA 3MS2A 5KTKA 1JR4A 4MQLA 1Q74A 3R5SA 4AUEA 3KLBA 5J2UF 2P8JA 2PZBA 5JO0A 5LA6A 3MJEA 1CE8B 1PTJA 5BWBA 1QS0A 4EPVA 3L6RA 4NRDA 4NQZA 2HQ1A 3WDKA 2J9GA 3OZSA 4LYEA 4B81A 3CIOA 3D8RA 1FFSA 1WY7A 3E3LA 1ZICA 2NZJA 1R4NA 2JF0A 4JUBA 4AMUA 5A1JA 2NQ2C 1P0CA 1NT2A 2DQYA 2P9BA 3ELUA 4MP6A 5FBQB 3AF2A 1DSSG 2H48A 4TKVB 2YRXA 3UMFA 4FYKA 1J39A 3L07A 2JLRA 1XAHA 4M9CA 2RHCA 3CGGA 3V3TA 4I3GA 4CU2A 3DWFA 4Q39A 4B82A 1XTUA 4RY0A 5H3LA 4C20A 1NJ5A 3LVBA 1U0RA 3QPCA 4DA0A 1PL7A 1QZZA 4IL5A 4QXAA 3D0QA 4XWWA 4XPZA 4IQFA 1QP8A 4WECA 1Q17A 3VZCA 4EABA 2C9CA 1TTQB 1Z4NA 2Y6UA 1WE2A 3FROA 3G8AA 1E5QA 5FOUA 2VHYA 1H6DA 2ZJ8A 4OHVA 3RYFB 3EEIA 1VMEA 2P11A 4I19A 3LWDA 3ZBUA 4RZHA 1T35A 1UINA 2WUFA 4KL8S 1KQ3A 1IOZA 1WXFA 4FKMA 2CVHA 3N0XA 4IFIA 1AUVA 4Q24A 1Y6FA 1THGA 2D4AA 4OQEA 1WD7A 3I9MA 4WZAB 3P97A 4MVJP 5AJXA 4BO7A 3ZTTA 4HDSB 4JZKA 3CBQA 1L5MA 2XMBA 4UBKA 1QIDA 3KQKA 1NLFA 2AQHA 4UM5A 5AVQA 1W48A 4EAAA 1ZM7A 3WWPA 2Y68A 4G9BA 2Z5VA 3ZW8A 4FJ2A 4K03A 1W44A 3AVUA 3GYBA 4HAOA 2AEEA 1ZUIA 1N5DA 3GCGA 3TW8B 4AMGA 3ROMA 1ZUHA 4UCXA 1YBHA 4ZT7A 1E69A 4IHJF 4PSVA 5A9SA 5KWIA 1NT4A 4D4LA 4BJ3A 1SQFA 3B2NA 5E1OA 4ARZB 5DOVA 1D0SA 1X1TA 1XU7A 3C24A 4WK0B 4UTNA 4QLOA 2DTEA 4ZICA 1B1AA 1P72A 3T9CA 1M6EX 2OO5A 1IUPA 2QLMA 3TOVA 4DIFA 3KQLA 2XDQB 2ODWA 3A1TA 3KU1A 4HYQA 2B5OA 1N2OA 1NKSA 4KYTA 3VSDA 3WIVA 2D59A 3I23A 3VVLA 3RUEA 3QWFA 3FM9A 3LCUA 5EHXA 1U3DA 3AHGA 1D6MA 3EXEA 1KS2A 3P26A 1TO1E 4L5AA 4YR7A 4DV4B 2BISA 3CISA 4PYJA 1W7AA 2CCGA 5D2CA 4XGKA 2ZSHA 4UARA 5BWNA 3K6KA 1W0JA 4ACBA 4DC1A 2A5FA 2HQRA 4YJ2A 4MA0A 3C8HA 4N0MA 3ZK9A 1GAWA 1FFHA 3GPBA 1GGVA 4Q47A 5AVXA 3BWYA 3SJBA 4BKQA 3UENA 821PA 3S40A 3NBMA 3OZTA 2YYAA 4QDZA 2ZVDA 3UCXA 3QFTA 2JLUA 4EOGA 1GUBA 1KJZA 2QMZA 3KYCB 1QVRA 5JZOA 3RWBA 4L08A 1FW8A 4Q34A 3SBOA 1RXIA 2PYZA 3U62A 3AM3A 1F2VA 1IMOA 1CR4A 2ZTUA 4L8WB 2VIIA 4P58A 5DN6A 3EN0A 4A7PA 2VXYA 1EMDA 2CDAA 3JZDA 1Z6YA 4K86A 4DC0A 3EOZA 1MX3A 1QHHB 1UP4A 3M2TA 4L72A 3RJZA 1A76A 1HT1E 2IXGA 3GJTA 3PDWA 4QOJA 1XRLA 3QNMA 3W1EA 4LRQA 4UOZA 5IEBA 1XVVA 1F51E 4FKBA 3ZH9B 5HF5A 3UAZA 2O3TA 4UKDA 2FSHA 2G3YA 5CNMA 3D8SA 4I99A 4Q05A 1S9DA 1UP7A 1HMYA 2HIAA 2VEDA 3Q6IA 2OXTA 4ZCIA 2VNHA 4NPCA 2QUAA 2WOJA 2UDPA 4MHOA 1D07A 4LGCA 4LZOA 1H4SA 1ZUD1 4UEJA 3H4TA 1VFNA 3CTPA 2NXEA 3RU2A 1QU3A 3R40A 4G84A 3N8DA 2V0NA 4GBMA 3COSA 5JC8A 1SC6A 3DUFA 3B85A 3L6CA 1Q3KA 3UJ9A 2H0QA 3SKYA 3TJRA 3THXB 3V2GA 3V48A 4P4LA 4RK7A 2L0XA 1T4CA 4AWXA 5BR8B 2O1SA 4W7SA 1ZCZA 1FS5A 4PO9A 5LP6C 2AR9A 3U7HB 1KIMA 4GXNA 3T5CA 3W5DA 3STYA 4L4ZA 4C7OA 2FUEA 2IPLA 5TPZA 4I1RA 1O58A 2II6A 2YVAA 5BMOA 3GJ5A 3DE0X 1K4YA 1ZESA 1TA4A 3MRVA 3HCRA 3GUHA 3BB3A 2HJSA 4LF4B 2QUHA 3HXPA 1A5ZA 1QK5A 2ET6A 3B6KA 4LE1A 1JSRA 3TD9A 1KWGA 3ANTA 2NO9A 1IXZA 2BIFA 1H1TA 2JCVA 5CT8A 1WCXA 2EZ8A 2F4NA 1LXCA 2B20A 4L5YA 4LNUB 5JSYA 3RTEA 1U98A 1V3TA 2BC9A 3PNBA 3HA3A 4MUJA 4XRRA 3R76A 5BVHB 5CDUA 5LKRA 4TKLA 3E4DA 2QX9A 5JAQA 5FEMA 1NBWB 5HIIA 1O87A 2OBMA 1H2RS 3HJNA 1B43A 2OGZA 3FJYA 3KZKA 3PHIA 4BBAA 3KFXA 3LGSA 4AJLA 4YRBA 4K0RA 2BKUA 5KTYA 5BVGA 1QV7A 3I9V6 4MW6A 2P4QA 2R47A 2QW0X 3CF2A 4HY3A 4POOA 4MWGA 3BD8A 4EJFA 1IXKA 2BDUA 2J6BA 3K72B 2PSHA 3ADOA 3R5JA 4UUPA 4C7VA 3K5PA 1KAGA 3C2QA 4QPZA 2X3UA 4RDIA 5FBWB 5AXBA 4A2QA 2GA9A 4W1RA 3U13A 4O08A 5AM1A 3AH8A 2WD9A 1GQ2A 2VDWA 4RQAA 2XCLA 3EVEA 1AXRA 4NZ9A 1LX6A 1MJ5A 1UWCA 1QHNA 4CIXA 4DBLE 1XV5A 4G0OA 2ZSEA 3H11A 4WW0A 1XZEA 3C14C 4S0XA 1QFSA 2CWDA 4DA4A 4JL8A 1VG1A 5T3UA 2VXBA 4UULA 3C16C 1DIHA 3ESCA 3IBFA 4XTRA 2B34A 3WYAA 3O92A 3FNRA 4A8JA 3IIKA 1CJKC 1V35A 4NR0A 5B7QA 2OC9A 1EU1A 3SYTA 1F3OA 3W4JA 2HHCA 2CDCA 2NX2A 3G7NA 1LH0A 3K9QO 4IXNA 1T5IA 2ZJ1A 5REQA 4Z4IA 5AFSA 2QXYA 4P34A 4RM3A 5AKGA 1G1AA 2D2XA 4XWAA 1XZKA 4GOJA 4YROA 4IDHA 3QEAZ 4TPKA 3KR2A 5LR6A 2NU8B 5JSQA 2B5WA 2ZIWB 1H1LB 4RMJA 3QV2A 4F12A 1MIOB 2MYNA 1MB3A 3BXXA 1H1DA 3MQ2A 4LECA 3ZVKA 4GT1A 1N1DA 5E6UA 4JUIA 5FTJA 3WNDA 3EG9A 5HR5A 5GIPE 1VE1A 3TDKA 1RABA 4X65B 3O7MA 1N5RA 5H4GA 1QGED 5CDTA 3C39A 5A02A 3ZLTA 2VT2A 2WPDA 1P80A 1UWLA 2QX8A 2EATA 1CFJA 5L7WA 4OQMA 3N8KA 1E62A 4M4SA 5LIRA 1KAOA 3GXBA 1TVEA 5CB8A 4E5NA 4P2BA 3SEFA 3E18A 5C37A 1QO9A 1T5SA 3GPLA 1U2DA 3D2AA 4PYNA 4UHKA 4IJMA 5IZCC 2F3RA 1HA3A 1EE2A 1KBOA 1Z06A 6ADHA 3ZZ0A 1HY3A 4G5QA 4PSDA 1XXHE 3SHQA 4E4RA 5GADl 2A3RA 2H9YA 3ZLBA 5CT9A 5I5EA 4UEWA 3SIWA 1OGIA 5DCWA 3BJIC 1ZCJA 4R41A 2Q7DA 3T7KA 3GIWA 3U6KA 1V7ZA 1DCMA 4XM1A 2QRLA 1WTCA 3DPUA 3NHRA 3T12A 4Q7QA 4Z86A 5LOVB 3EXHA 1N5JA 2QUKA 4YX9A 1OF1A 1PDOA 4YT4A 3FGPA 4D98A 1SUEA 5JCOC 1CY0A 2WHXA 4OQQA 5CFMA 5DTEA 5CG2A 3O8DA 4LTMA 4MV1A 4X63A 4JVMA 2LKCA 1N5LA 3I39X 5IT0A 1QMGA 5DHFA 1RYZA 4RV9A 5F5XA 5BP7A 2EG5A 3CX6A 1L4KA 1NQAO 1NWCA 3EHEA 5DW0A 1UXGA 3OCXA 4YV1A 3GNSA 4QTTB 2H4XA 3FGOA 3D5TA 4A5OA 2V3CC 3FN4A 1A9RA 2QD3A 1NJFA 1ACJA 2Y1LA 2GHTA 3AFMA 4QRHA 2WF9A 4V0RA 4CL3A 1VSQA 2BEWB 2AJLI 5BW6B 3ME5A 4FR5A 1ABBA 4MP3A 1XCPA 2ZYWX 3ZHBA 1YA8A 4JROA 2WSSA 3OIFA 5EHGA 4EI2A 5IVPA 1QPZA 4HQOA 2VT7A 3PI6A 7ABPA 3T7RA 1ZKDA 4YECA 5B53A 4CV1A 2GZDA 4RIFA 2IYNA 4MVJG 4C6HA 5BW8A 1A82A 1GN9A 2C4TA 5CPBA 1ECLA 4QVIA 1KR5A 2H3HA 2QD2A 3B9QA 3F3KA 3IOMA 5THXA 1SG6A 3ROKA 1QVVA 5IANA 1ID8A 1E5LA 3N75A 4TUYB 4BIIA 2OP0A 5AMXA 2HO4A 3PQ5A 4UAJA 4OI4A 1QIEA 2YZ7A 5GZ1A 1NY5A 5JWOA 1E9DA 2FFBA 5D51S 2F17A 1PKEA 1QMPA 2VYCA 3GMIA 3KHUA 1YFLA 4C22A 1E9VA 2NXNA 1K8QA 2FQXA 3E5RA 1FNBA 3L0BA 2C4WA 1SB9A 3GY0A 1QVZA 4NU6A 1RZRD 4G5SA 4PQGA 4JBIA 2IH2A 1N8NA 4M22A 3ZCPA 4YT5A 1JDNA 2YZGA 4CKXA 3K71B 2SKCA 4E5YA 3QOFA 4EO4A 3CLHA 4F38A 3B8EA 3Q6NA 3AEKB 2HRCA 1N2GA 4I5EA 1IAVA 1HT0A 2B2CA 4ZDKA 2JIZD 4ILEA 1CUSA 1I32A 4LOJA 3KTAB 3U4GA 2XQVA 5CUQA 2D1TA 3V2UA 3W5SA 1QRDA 3C4QA 4WXHA 5A62A 5JQGF 4Y2UA 5CD9A 2XQGA 4GKBA 3VJMA 2KMLA 5AQ1A 1EE9A 1WMAA 3FLEA 3C1AA 4H9GA 1JA0A 3RW9A 1UPUA 5HXAA 3FZNA 5IDYA 2HBYA 3F6CA 1F8GA 3JAKA 4RZXA 1RRPA 3V00A 3ZWQA 3H1AA 3BXZA 4BC0A 3FZYA 2C8KA 1ZQ9A 2ONYA 3O4RA 5K3AA 4AB1A 3C3JA 2ZWIA 3EEOA 3ZDFA 1OAKA 2IBSA 4D8TA 1Z34A 2GS9A 1A7UA 3GA5A 2OOSA 3N5CA 3VDXA 3VGJA 3FPHA 3ZIUA 1FDUA 3UT0A 3CUVA 5K0CA 4ZQIA 5EJGA 4N5IX 1Z28A 2FW0A 3CUEF 2FSIA 4G1CA 3SXPA 1NP7A 1W46A 3MJCA 1MXHA 1FVXA 2UYOA 2D0OB 3PF8A 2V4MA 1ATIA 2JFPA 4NU5A 4J4HA 3GEBA 5HVNA 1NUUA 3HB4X 1DPFA 1GARA 1XF9A 1IQPA 2O06A 1US8B 1V3UA 2XD9A 5IAGA 3SCZA 4KWCA 1E3TA 1ZEJA 1DIOB 3LE8A 4HLQB 2E5FA 3GD7A 1WCIB 4OQYA 1VCHA 2J0SA 1GPKA 3AFOA 3BG5A 4RQTA 1D2MA 1PX0A 4FJ1A 4WLUA 5IUKC 1CDOA 3EZNA 1OR8A 2QTMA 2QRGA 3BFPA 5A2GA 4G0QA 5KOJB 4R05A 1KYYA 4XWKA 3NAQA 3A6ZA 2W71A 4YUXA 3L5KA 1WTAA 2DHRA 3K73O 2C9DA 3NO4A 1DEKA 3O73A 1RR6A 2YXDA 3M5WA 3QEJA 1SQGA 3O21A 3NTXA 2AN3A 1JKFA 1ESZA 4Z9FA 5ER9A 1ADCA 1YRWA 4AZTA 2JJ2A 4KVFA 5KTSA 1XP8A 4MUAA 2HPVA 3O3CA 3RHFA 4N0QA 2VJQA 3K1AA 1EJBA 1GPAA 2YZMA 5DULA 2YV3A 3TTXA 1CP2A 3ONFA 3GJ6A 5CAEB 3L43A 2IUSA 4ZA2A 1P1CA 1TF2A 2KSQA 5EJ4A 3QUTA 3ZR4B 5KHOC 1WMFA 4ZD6A 4EGCB 2XCIA 2O0LA 2ZYRA 3K7EA 3IEMA 5KYNA 3G49A 1PFWA 4ZJUA 5HDBB 3GLQA 2IEGA 3GJ4A 3OURA 2D7DA 3K6SB 5F2OA 5IVKA 1ODCA 3A11A 5B7NA 8LDHA 1E5DA 3P2YA 4RYLA 5ALUA 2WTMA 1JLKA 4F86A 5JJLA 1YB5A 3HBNA 1Q22A 3FCUB 1XJ0A 3KAQA 3MEQA 2O8CA 1JEAA 3GARA 1S02A 1U1GA 3TN7A 4YPFA 4CMAA 3L92A 3QJGA 1KDVA 4Z9AA 4BMXA 1E6LA 1K8RA 1PT5A 1D5CA 2AA3A 4UMFA 5ALHA 3ZJUA 4BNTA 1QOQB 3I2HA 3OX1A 1G8SA 4ETWA 3P9NA 3UJ3X 2JAQA 4DNOA 1MAVA 4MKHA 5TNXA 3KEFA 4BQIA 4CYMA 5JW6A 1G3IA 4OI0A 2NUBA 3KSAC 1ORDA 2MSEB 2ZROA 3QVUA 4FI3F 4IDAA 3V5NA 3KFVA 5DTQA 9LDTA 1LK0A 1ZC3A 1PZEA 2A0WA 3V33A 5FX2A 5FIUA 1KHHA 2VF5X 3A10A 1P4HA 2JG3A 1F2DA 3OEHA 4JQYA 5JBNA 2IYSA 4G4SO 2E4WA 5CDFE 1S2IA 1E89A 4KQKA 2ZRIA 1FXSA 3C3YA 1V4VA 2BMDA 3KETA 1FSSA 2R6CA 5DH9A 4MWOA 1APBA 3ZHSA 3T7EA 2YWHA 1E2JA 1EVZA 1KKLA 2G63A 3QVOA 3S27A 4AYXA 1GRCA 2NZ8A 1CUZA 2PL3A 3QVWA 3SNHA 5CXUA 3IEUA 4N0DA 3ETLA 4MRAA 5BQ3A 3CG0A 3EY4A 4NENA 1KOLA 4D8WA 4HX9A 4TVBA 4X20B 1Z0IA 1FUKA 2FB9A 2NVBA 1DKUA 4C6RA 1S4QA 1UZMA 4TGLA 3AQIA 5IEJA 1UZLA 2I22A 2REBA 3DM5A 1Y8AA 4BMDA 1OU0A 4US0R 5F5NA 5L3QB 3IDZA 2IV3A 3NVDA 1J2RA 4R7GA 4CM7A 3FWZA 4EI8A 1CZHA 4RD4A 1QHFA 1JBQA 1JGTA 4FX5A 5TMPA 2O8DA 1RE0A 4OIFA 3UHPA 1TAGA 3ISTA 4AQDA 3BIFA 3HJGA 1F6DA 4I50B 1QE3A 3C7CB 1PEAA 5FNVA 4BN4A 1XA3A 2G8NA 3UHAA 2D6FA 2HMTA 1Z83A 2EJCA 3IE2A 3MCUA 1LPPA 2N47A 1ITZA 3GAFA 4PLZA 4QBFA 1HLGA 5FWAA 4MPJA 5JNLA 4KACA 1ISMA 2JGDA 1JAYA 3DVSX 4QBHA 3MN1A 4A8JC 1Y4UA 4XUDA 3ZE1B 3WSVA 4HDKB 2Q3LA 4L74A 4W8HA 3V1LA 4EGQA 3GVXA 1LGYA 1KK2A 3UAVA 1R5JA 3MT7A 4JLSA 3UK1A 4HWPA 5IVHA 3FOAA 1IQ0A 3F0TA 3RU9A 3ZTYA 1KQGA 4M8NE 4RQBA 1Y33E 2W58A 3HWX1 3NRBA 5AVVA 2NPIA 3BRWA 4E21A 1CUJA 4HUJA 4ND7A 2DPGA 2DTXA 2QNRA 2RI1A 2Z98A 1U4OA 4PAQA 5CK5A 2GCOB 4ED9A 5GM2A 1Z4IA 1SZDA 2QQ0A 4JOQA 3U3KA 2AUNA 3WKCA 1DG3A 2BPOA 4Q9IA 3T5MA 3ISVA 4UTZA 4QNMA 4J0JA 4BWGA 3NATA 4E3ZA 4Z2AA 4YDHB 2AG8A 2WFAA 2GCNA 2XI4A 2Z95A 3PNSA 4G23A 1Q50A 2RGGA 5F12A 4DARA 2NU7A 5F21A 1BGWA 3THWB 2YHUA 1H4VB 3P4XA 3GDGA 1II8B 2GPBA 3TR6A 1K5GA 1OHHD 2I6TA 3FNIA 3HYTA 2HJHA 3EE6A 4BNIA 2ODAA 4EA7A 5KX5F 3DW1X 1QKJA 3RVQA 1NI5A 3ZK8A 1FP1D 3DLIA 4YLYA 2IWRA 4PZEA 4MIEA 4L2IB 4P5PA 1GEEA 1ZSVA 1A9XB 1P5ZB 2VP6A 4RCZA 4LF6B 3G5AA 3KB2A 1ZL2A 2IYFA 4IEFB 4KXVA 1J09A 1MAHA 4RLSA 3LY8A 1T13A 3UMSA 4UMDA 2B2NA 4CN9A 5EMJA 1TGYA 3DWEX 1L4EA 3S1LA 1PN3A 3Q15C 4GI3A 1IOWA 2PWPA 4EG0A 1F60A 3PPWA 5DSXA 4DCNA 4QJ5A 2H1HA 4ALLA 3WWZA 2YWDA 3NUZA 5E2AA 1W75A 4NYMR 4BMOB 1LFAA 1ZIPA 1NF8A 1IG0A 2CXRA 2GHRA 2HT6A 2VSXA 2ZT5A 2OYRA 2GUWA 3RJMA 4LBYA 2WHQA 5HUHA 1JV2B 1CUYA 2W6PA 3OM0A 2VF2A 4MIYA 4RNDB 4TZ0A 2VOEA 3EG5A 2I4MA 1CUDA 2P7IA 1IVNA 2Z4RA 2VDPB 3AJ9A 1QGYA 4WKPA 1SK9A 1A9TA 1YE5A 5A03A 3A0RB 3PQ3A 1F0KA 1J7KA 4OMDA 4K05A 1MC8A 4FFVA 1SCQA 4YASA 1AHNA 4AZ0A 3L8EA 3HY6A 4P5DA 2HPAA 1O5OA 4R8VA 2J67A 5GAJA 4DG8A 4E1VA 5ARBA 3RYHB 3DEIA 3G88A 4BUJA 3GFVA 1XRJA 4KYIB 1XXHA 4YCBA 1T9BA 5DBHX 3VX4A 3WGQA 3DUWA 1T25A 1ONSA 3D6TB 4YALA 4OX9B 1ZZEA 2PQMA 2HCBA 4JLVA 4Y2RA 1GPMA 1UBTS 3RSOA 1Y9DA 3AK4A 5GGYA 4LXYA 1C7IA 2JZOA 5TB5A 2G25A 2JA1A 3A1DA 3PLAE 4KDFA 2X2FA 4PXSA 1AK2A 3I6MA 2PD4A 4R2JA 4FCWA 4R9VA 5B36A 3CUKA 4X6UA 2PM8A 4XIJA 5IJ0A 1BQ4A 4MGEA 1BH2A 3W9BA 4ZXFA 1T6XA 4ZAXA 4FWIB 2VDNB 1BE0A 3KKQA 3ANNA 3OA2A 3FW1A 3BPSA 1VXRA 5TF4A 3UO8B 1TK2A 4IDGA 4MWSA 4OP1A 4CHGA 3E9DA 5ALLA 3RAGA 2DBZA 1ZUNA 4CQMB 4IDCA 2FJUA 2RJNA 4QVGA 4Q1DA 4NOLA 4MNTA 2PX8A 3Q2IA 2HZBA 3GVHA 2C2YA 2R6JA 3WLPA 1E3LA 2BFEB 5AM2A 3ASZA 3L49A 2D3TA 2JANA 4BFTA 3D2CA 5TVGA 2EBHX 2QVZX 2VPPA 1HE2A 2R25B 4H3KB 3SG0A 5C0OE 1P4AA 4UU0A 1NLZA 4G5GA 3LKVA 4MUXA 1XCGB 1XE3A 4CM9D 2J5QA 4YUWA 1VPLA 3F5MA 3LQYA 3LBFA 4M6WB 5JNWA 1I2MA 4YMVA 3FTQA 2FOXA 1IZ0A 3WV5A 2J9RA 4RZSA 4IIUA 2QRVB 4MQ6A 3RLFA 3ETHA 2F90A 4B33A 5JT1A 4J94A 4R7TA 2ETVA 2Q1WA 5GWXA 4UW9A 2P5UA 4FFWA 4K1LA 2WNIA 4Q3LA 4WKOA 3ZE2B 4R81A 2QTLA 2ZJ5A 2AI3A 4ALMA 3QNWA 1NQWA 1CUWA 3IQGX 4MZDA 5H68A 1JALA 1UMBA 1W0CA 1GEGA 1WLSA 1NQVA 2PZLA 3A9SA 1U9IA 2W2OA 5LLDA 2PQ6A 4JBWA 2IGTA 3BD9A 1A2KC 4DLBA 4F04A 1C81A 3PPIA 3B3QA 2W2XA 3EVDA 2PX6A 1DAOA 3A3NA 2E37A 1E7WA 1M2JA 2D1YA 4BVEA 4DNPA 3HYLA 2CMGA 4H6XA 4D3YA 1H05A 1SXJC 2VHCA 4G9EA 3VDNB 3NHYA 4BFCA 2CV1A 4HSGA 2XRZA 4N3BA 1FTQA 2AS0A 1NZJA 3MB5A 3N2LA 3UYLA 4LWZA 1Y7HA 3A1EA 4PIPA 3GU3A 3HEMA 3WJ7A 2XY4A 3LPDA 3RBVA 4QLBA 3TG2A 4NBSA 4E22A 4M1EA 5C3MA 2HPHA 4B4UA 1PE0A 1C4KA 1TZ2A 1LI5A 1HDOA 3Q3GE 3KQYA 4L1KA 5FPYA 4KNWA 4AKSA 4Q4AA 4TMFA 1UZUA 1N6PA 2TECE 1XTSA 3CLTC 3KALA 3M34A 5DWQA 5HFAA 3SHOA 4YO8A 5CFLA 4KE6A 2GTIA 4O4IA 3H87A 3HKBA 2BR3A 1ORRA 2R4QA 2Z0MA 3M82A 4PZ9A 2VF4X 4J1QA 4ND3A 2IU6A 5KVSA 4KYUA 3C6XA 5LQNA 3K9FC 2H5IA 1UIRA 2VNSA 3E1SA 4HNRA 4OREX 4PCLA 1EHIA 4M0MA 4Q9AA 2YFKA 1YBMA 3BRCA 4YJGB 4JJ7A 2DFPA 2EFHB 5DNWA 2ATIA 3PWKA 4IXWA 1BXRB 4ZDIA 4O4JB 3ZHYA 1XNGA 2OQRA 1VCMA 3IT2A 2YMLA 1DAKA 3TIGA 2X0KA 1NQUA 5A4AA 3CNNA 3PTLA 1NVUQ 5HZMA 1RNLA 4BY9E 3IQIX 3NGLA 5DWVA 3RFFA 1RMQA 1M2VA 4JS0A 1ZINA 1EQUA 2BI4A 4C78A 3EMDA 4NBUA 2Y9PB 2J09A 4C0SA 2B8TA 1UDWA 5ALWA 3UGTA 4X1IB 1PYOA 1XRSB 3MIIA 1VSBA 3AHJA 4HXFB 1ABFA 2O2IA 3MB8A 4BV8A 4V3BA 3SSOA 3E9NA 1OLXB 4MS1B 4X6LA 1JIUA 5BSRA 3RADC 4ZMBA 1OXBB 1YOVB 2HT1A 4ZV7A 3I5YA 3C5EA 1HKUA 3OFNA 2J9YB 4YRSA 1MC1A 5E1DA 1NR1A 3JD2A 1VHWA 3ADDA 4KR9A 3IUNA 1RQGA 1VMAA 4HAIA 1MMFB 4TMKA 3UB3A 3I37X 1V5FA 1ZXBA 3EEFA 3MPOA 4IJWA 5J4LA 1HT2E 2V9PA 1EVKA 4PPNA 5JDIA 5A6SA 1FL9A 2ZSAA 1YVPA 2YICA 5AJWA 5J2TA 3UT6A 4PAWA 1QF7A 4M9UA 4E46A 5HFJA 5LFAA 4U00A 3K9GA 3T3EA 2VSNA 5EIAA 2P7HA 1TLLA 3O3MB 4BJ1A 4BL5A 3GVCA 3RRXA 4L9RA 1CRLA 1RYEA 2NSJA 5L6MB 1ZGBA 1COZA 3ZWMA 1TKBA 3H16A 5I9IA 3ITDA 5EE1A 4H6WA 3T4UA 4OGLA 4D41A 2VHQA 2B1JA 2X8WA 1I1OA 4C21A 2IZZA 2IDJA 4Y98A 3IL2A 2FQWA 3BE8A 3RODA 3KYJB 3DT6A 4LHYA 1CUFA 1W88A 2FOLA 1K3UB 3OLYA 3HWRA 4IQ8A 4QODA 1LRLA 3Q87B 2G28A 1GFIA 2VUIB 1GU7A 4OPMA 4P31A 3L4BA 1NSYA 1OKKA 4HPXB 1O95D 1L5HA 2A8YA 2L69A 2O07A 4EGAA 4CIDA 3FA2A 3ODPA 2QGFA 2XRFA 4NG4A 2O57A 1JIVA 2QV7A 3CX7A 4CUZA 1JG7A 1FQKA 4JYZA 2NZVG 2XECA 2FMTA 4UHFA 5CDFA 4HATA 2JGRA 3U4MA 1CS0A 2VAXA 5B6PA 1ISPA 4MH0R 4C4ZA 1XJCA 2NTJA 4KITB 4OLBA 2FY8A 5E6RA 3RH0A 4TTJA 3BB4A 4NFLA 1R8JA 4J3JA 5BR7A 1DQYA 1ENPA 4QUDA 2FN8A 4RE6A 1SU7A 2XTNA 1TTPB 2Y92A 1WDTA 4X92A 5C5DA 4AQ7A 3V7YA 1RI2A 2H4ZA 3JVUA 4HGOA 4MRMA 5CDYA 1LPMA 1M0SA 4GUAA 4CTNA 3CNOA 2YHAA 3FOFC 4DZRA 4B9AA 5IASA 5LQJA 4RLQA 4LTDA 1C0IA 2EKZA 2XWQA 2NADA 1YU6A 2QPOA 4RS4A 3ZH2A 4QU8A 1H2EA 1ZXLA 1REQA 1E4OA 4MW7A 4WUVA 2ZEJA 2GX6A 3QF7A 1L5ZA 2IOQA 4HV4A 1UCFA 4H1TA 5UKDA 4ER3A 1NF2A 9MHTA 5IC4A 2PL1A 4DB2A 4EG6A 4YRGA 1P73A 1GUDA 2B7CA 1IHYA 3SLGA 2XMQA 3DDZX 3P96A 4ZK2A 6LDHA 2ZR9A 3F6YA 1KSFX 3S8EA 5BOSA 2ZAIA 3PIRA 1YZFA 1LJLA 4MRRA 4KAAA 3STWA 4E5MA 4EFKA 1IDOA 2R6ZA 1KAEA 3RT1A 3R9IA 1YR1A 4GOMD 5DV9A 5LXTF 4F97A 4W9NC 3VR6H 2YJ5A 2PPLA 1C9DB 2R4UA 1MO3A 5JBQA 2YQ5A 1OXSC 2C2KA 2X2PA 3DHYA 3KOOA 3MYRA 1A04A 2VTKA 1FUYB 1MB2A 3FPSA 4ZAGA 3RO7A 4DQKA 1FJGB 2D2EA 2HF2A 3TH5A 2P2NA 5CFOA 4A23A 1NQTA 2B9EA 4HDMA 5ALIA 4WZBB 3J81k 3ETEA 3W0LB 4DLLA 5HIJA 1NC3A 1LDYA 3LF2A 3NQ41 3ILXA 2EC5A 4HN9A 1R9GA 1DTWA 3FKJA 3TLBA 3KZNA 4YMHA 5I5GA 3RS3A 3ESQA 3F97A 1DXOA 3DV0A 1A77A 3DQQA 1DKRA 5B3JA 1BXGA 1JI3A 2YTZA 4FZ5A 4JYPA 5CVVA 5EQTA 5A3VA 4LRUA 1YIOA 5FLKA 5BMVF 3BJZA 4YIKA 1K06A 4G0XA 2O14A 1Z45A 2H5EA 1DRWA 2DM6A 1CVRA 1N1GA 2NSHA 3DKPA 3HN2A 1A9QA 4K2AA 1WHSB 4LXTA 1RXUA 1VLJA 2D7CA 4DUGD 2PJRA 2AYYA 3TLCA 3I4LA 2C4UA 4B7AA 2JK1A 1XF1A 4CKWB 1GUZA 5K3SA 3MOIA 4CIAA 1FW6A 2GPAA 4X93A 1RKUA 4UREA 1JQKA 2GZ1A 1DC3A 3H5IA 4XUGB 3VA7A 2GXSA 1LDBA 4HVCA 4RSMA 2AFIE 1ONBA 2XCQA 5K09A 3T54A 3UIEA 3DNFA 4CQNA 1R8SA 4XCXA 3CSUA 4W8OA 3EMBA 1DQZA 4IJ5A 5AKIA 4MYUA 2X0FA 5AVUA 2FK8A 2FWPA 1T9HA 2JBHA 2R7AA 4AULA 4FGJA 2JKVA 3TE7A 4ZMSA 4JLWA 5C51B 4RHEA 2PRKA 2V7VA 4I7EA 5CW1A 4XDGA 1PNTA 2Q5FA 2VQSA 2YHIA 3U81A 5JFOA 1Y8ZA 1DJLA 4OK6A 2SNIE 4R3NA 2ZJ3A 4M8IA 4BQSA 4LS3A 1QM5A 3AONB 5JJ5A 4DR4B 3FBTA 3PD0A 2PFKA 1EH5A 4JUAA 5FOWA 4RYDA 1UZNA 3NHJA 4MPRA 2MDTA 3AJRA 4CMHA 1MQ8B 3GRPA 4XX1A 4ON9A 2PO7A 2RC5A 3NBXX 5AHRA 3WLFA 4RTQA 1AV7A 1QCYA 1QO0A 2HMWA 2EP8A 4ZWNA 2M2IA 5TC4A 4XIIA 1JG3A 3W78A 4P83A 5J4YA 1YB6A 3H2HA 5F98A 2G7MC 1D9XA 1IBLB 3MT9A 3N2KB 3ORFA 2OK7A 4J4TA 3KZOA 1NXWA 2QRZA 5FPQA 1QHEA 2IF2A 3IHWA 4S1PA 3Q2OA 1D0VA 3S44A 1M5RA 3L1HA 3ENNA 2CFRA 2P3OA 4TTRA 3ZPXA 1P5RA 5JADA 3L0YA 1CW2B 4NBKA 4B1FA 4XGRA 5FUQA 4KBGA 3P2MA 3RFVA 6REQA 4YDQA 3ESZA 3CUYA 4J90A 3NKLA 1XA0A 1PZXA 4K6CA 3BM5A 1KMNA 4RFSB 4OHBA 2ORED 1L4GA 1YJ8A 5D3ZA 3DFFA 3EZYA 5IMSA 4EY4A 3GL9A 3L1IA 4LDZA 2OAEA 3HFSA 1UWVA 2C5HA 4L28A 3AIMA 4UVGA 2XVXA 2AQIA 2I54A 4AC9A 4RF2A 2JZNA 2I7DA 3MJFA 3UN1A 3WGUA 4ZFNA 3AI3A 1M0WA 1F9AA 3MBIA 4DPMA 1HEYA 4KK4A 3GDOA 1NSFA 4KOEC 1NV9A 2HX1A 1T0UA 1Q57A 3G23A 3DE5X 4C4YA 2QKYA 4HBGA 5HJ7A 2C95A 3MZ0A 4PPGA 2I78A 4C88A 3DPSA 4EO9A 4PPFA 1P77A 4J2HA 1YVEI 5TE9A 1M6WA 2P2GA 4MW0A 4ZYTA 3PEWA 5GPBA 5SZIA 5JS2A 2MTBA 5B57C 1WPQA 1VL2A 1D8AA 2RGBA 1ZVQA 1YQ9A 4LUCA 2HF7A 2Q5CA 1E4EA 3T3NA 3S2YA 2QGZA 5J59A 4EM6A 1OYWA 2P1DA 3PHCA 3VAAA 5JNTA 2DPMA 1LDMA 2ZCUA 3KV3O 5JPDA 1HT3A 2W8BB 3CF4A 3FF4A 1YRAA 1DC4A 4R84A 3BSWA 2BF4A 1PR5A 4IDPA 4TVKA 4G1EB 1UDCA 5CBPB 2DQZA 1JUDA 5KJFA 4DV2B 1VBKA 3QBJA 2QLNA 3F3YA 3IRVA 3UJDA 4QU0A 1PVDA 2ZI5A 3H1TA 4TUYF 3DG9A 2V4UA 3FYTA 1TKRA 1DCFA 2QAGA 2XEXA 1XX6A 4N5DA 4YC7A 4XAQA 4M86A 2X22A 4ZOEA 4AW9A 5JSZA 4JDPA 4DV1B 3QEMB 5E7JA 2JZCA 3WP1B 2A35A 2BBTA 4OK3A 3BD6A 1PEKE 5BT8A 3HM2A 3AX6A 3RK0A 1DAFA 5KJ1A 4JLBA 2VYVA 4W1SA 3QVGA 3TTYA 3O9ZA 4KR2A 5I9BA 5GVSA 3EXFB 1LKZA 4OXKA 1V1MA 4AT1A 4JLAA 5EJAA 5JASA 3I9OA 4B34A 3JQPA 1MLDA 2C7GA 5KQGA 1UFOA 2EV9A 2QZZA 3OJWA 4KV7A 2W70A 2YOGA 2C61A 2H65A 1ZY2A 4HRXA 1V16A 1V25A 2IUUA 3F74A 3WIDA 3P5BA 1QHIA 4CM3A 4GC9A 4XYLA 1RJ9B 1XCBA 2PBFA 3A1CA 3CCCA 3MT0A 4FWBA 5CLIA 4YFVA 2H52A 1JYSA 1NP3A 3VH3A 4IX1A 1JR6A 1J5PA 4IMPA 2X0IA 4PINA 5IK2A 3U40A 1C3LA 5BQ5A 3HXKA 4V0NA 4Y6QA 3V8EA 2CD9A 3FBWA 4H4EA 6YASA 4OHFA 4JC4A 4F8JA 1MNQA 2MIIA 5C53B 4FB4A 3ROQA 1XO1A 5SYAA 3DO6A 5AKXA 3LUPA 1QF9A 2NOAA 3FKSA 3HLKA 5KPJA 3SC2A 1LVHA 2GRJA 4GZ5A 1J06A 4NESA 2ZM5A 4FYWA 1B0ZA 2QZJA 4U3JA 5IP5A 5BSMA 3ZGLA 1PZNA 3UNXA 4RVFA 1UC9A 3L4SO 3QX9A 4M9QA 2W9XA 3VV3A 5FV4A 2B3DA 2VR1A 5KEIA 4CDGA 4HEQA 4DJTA 2H1RA 1Z63A 1RKBA 1V9LA 2RGNA 3FDIA 3H2BA 1JDUA 4KRGA 4PFKA 4EVQA 5KTRA 3ROTA 3QOXA 4MYCA 3I1JA 2P6PA 3G0GA 4H4CA 3WGLA 5I51A 2H63A 1C9YA 1M2FA 4X3CA 1P1JA 2IYTA 2Q4TA 4GQBA 4I81A 4J0GA 3TCXB 4BU1A 5IMBA 4H16A 4UTOA 3F1LA 1DC5A 2X13A 3GEMA 5CVDA 4DKXA 1ZD4A 1NM5A 3I34X 3VU0A 1GPLA 4GPTA 2FRXA 3WRVA 4S2UA 1D1TA 1AA6A 3VNAA 3H5LA 2A7XA 2AC2A 4LPKA 4IIJA 1MG0A 2QTNA 2E1RA 4MIKA 3D6MA 3BL6A 1KY3A 3AI2A 3AP2A 2Q5JA 1P4RA 3KKEA 1GITA 1L7OA 2ID7A 5D1HA 4AJEA 4JJEA 1JF8A 3ONWA 4Q1BA 1OWLA 3GW8A 4RDHA 4M3NA 1W0JD 1Y4DE 1PF7E 3FDZB 1WX1A 2GCGA 2J6IA 3H2YA 3GQBA 5DWDA 1Z5UA 4INZA 1F0YA 1VJ5A 3RBXA 4L3VA 5HIMA 4RHFA 5BNZA 2YVKA 1SRRA 1RLUA 1A98A 4TZKA 2VT3A 4G4IA 5AW4A 4GLBA 4LJ8A 1IUOA 3NHMA 4LJYA 3RVSA 1W6UA 1NV8A 2XMRA 2FPUA 4HWGA 1TE2A 4KGZA 4ZZ2A 1A7JA 1JH9A 4Q03A 4PTYA 5DN6D 1OYVA 4RHUA 1ZRNA 4MB6A 3G79A 4FYPA 3CR7A 1U11A 1QIJA 1XBTA 4KQ6A 4M76B 2XHEA 3QU4A 2W6ZA 4RKFA 1PSZA 1CR0A 2CLFB 3ADPA 3AERA 1JL3A 2DHCA 3AL2A 3GRKA 4GBJA 1X15A 2RHRA 4KPUB 2Q5IA 3KQTA 2FPXA 4K3VA 4OAPA 4G86A 4OHMA 4X3OA 3TSYA 4QGHA 4B2LA 2JHPA 2O50A 2YMQA 3K15A 5K6AA 2BH2A 5BNFA 2CHFA 1ZUWA 1TVCA 5K0LA 3W8NA 4OM8A 1ZM9A 5F3RA 2YJNA 3HYRA 2VQ3A 4YRNA 1NAIA 4E5KA 2PDAA 3PZBA 1HI9A 3LK7A 5CIWA 3WDLA 3GDFA 2YJTD 4DY4A 5GMOA 1OPRA 1U90A 4XWOA 3HFJA 4D96A 3AR4A 1DKQA 4RPLA 3PJFA 3FVRA 2Q2OA 3A9TA 3OE1A 2J5BA 3LZ6A 1YCGA 4MV7A 3KQOA 4B2IA 2P0AA 5D3MB 5TRTA 5AH0A 4DJJA 4UBIA 3X1XA 3N3AC 5SZJA 2H59A 4ZTBA 1IBCA 3T1OA 3PHJA 3PP8A 4D9BA 1JQ5A 2G8LA 4CDNA 5JSHA 4M8LA 1G4HA 1XMJA 5CA0F 4BXOA 4V1CA 3BSSA 3BQNB 1EZ1A 3AR3A 5CJPA 3WX0A 3KYBA 3DP7A 3IB6A 2ATEA 3QENA 5IDXA 4G0UA 3HY4A 2B4RO 4IEIA 3S2FA 1MX5A 1GT6A 3OM8A 3OPMA 5JS7A 4RMGA 1T24A 5J3JA 5JYCA 4G4SP 2Q1TA 2Q4EA 4NDNE 4X5OA 1ZISA 4OM7A 3TLKA 5T7BA 4CEJA 4I9FA 2XZPA 1NTRA 3Q1LA 3ZI0A 5K8IA 2REQA 2ZP1A 3ZDCA 1FRQA 3LIIA 2H2DA 3EFHA 4EB6A 1E61A 2Y1XA 2K7FA 2FETA 4UJ5A 2XBUA 3ENVA 5I7VA 3VOTA 1WV0A 2SECE 5EWJA 2QQFA 1NZDA 3IXQA 2QQEA 4IHKA 1SOUA 1EFVA 1V1RA 1UFQA 1UMDB 3EDCA 1UANA 3WV4A 1ZD2P 2CHVA 1XWWA 2SCUB 3FNEA 5E9AA 1DZIA 2J3IA 5KYKA 3AC0A 2R8YA 1M7HA 5A5GA 4QBTA 1XMXA 2B4QA 5DHPA 2Q6IA 2B9VA 5G0VA 5HBGA 3VH4A 1KAQA 4JJ4A 5CFZA 1TUBB 2IY9A 1I51A 3EOBI 4C0AC 4BEBA 4A91A 1PSWA 4CCYA 1N6IA 4P38A 2PNFA 5ER6A 2H85A 3BREA 1X87A 3BJMA 2DR2A 1VFPA 5A4MS 2FQYA 1OBHA 2O8FB 5C5EA 5H4HA 2DFVA 3R3ZA 1GTVA 1N2ZA 2HLHA 3UC5A 1M3SA 4PW0A 2V7BA 4YRTA 2V9ZA 4PFJA 1JYEA 2CDBA 5GONB 1FP2A 1C9NA 1S8OA 1XZCA 4PC2A 5J2UA 3OG9A 1X1BA 2IDZA 1Y1RA 5F9FA 1QGUB 3U3RA 4BCBA 3AGPA 4TMZA 1JXOA 3HKCA 1E58A 2V6BA 3KTFA 5G4KA 2PE5A 4B48A 1EFPB 2QY9A 2G36A 1JQBA 1N3IA 2X9VA 3CRW1 4TWAA 5KMGB 4I9NA 3W5AA 2H1CA 3ZV3A 4DZZA 5H8WA 2ZT6A 1W1IA 3RABA 4X8MA 3FWHA 4XB1A 3K94A 3UH0A 1PWZA 1XU9A 2DRIA 1WU7A 1X7XB 3HZRA 4K7JA 2ZUTA 5DT9A 4BGIA 4D25A 1BOOA 1HM5A 3W06A 3X1MA 1Z6ZA 3KT6A 5C1BA 3IMKA 5I4BA 5K8VA 2AJBA 2DR0A 2A5GA 2NXJA 3K16A 4GX1A 4LJ5A 1A8HA 1KPGA 3EBOA 3E3AA 4ZVTA 3CX3A 2WPDD 2LRHA 3I4CA 4IYJA 3O8BA 3UC9A 4B3FX 1MEJA 3TQOA 4RTJA 4I66A 2GB4A 5B1IA 4E2XA 3N0WA 1WEKA 1B8OA 4EMTA 1PW7A 1WS6A 2JRLA 4ZRMA 4KWTA 1HLFA 2WDPA 5HWSA 2HUNA 2FLKA 1GOTA 3DBIA 4IDOA 3EWIA 3QRWA 1EFCA 4AF6A 1VG8A 2UZAA 3Q5GA 2IYVA 1JFFB 4BFZA 1R18A 3O5AA 3R24A 5TS2A 3BKWA 4AROA 1FFBA 4MMXB 3EW9A 5FKJA 1KSGA 1ILWA 2PS0A 2Z5GA 3VC3A 5HGXA 4J03A 1D7AA 3A6HA 3PSHA 4LYYA 5ELMA 5FYQA 2EOAA 4PU0A 1PS0A 1TQ8A 3HZOA 2VJBA 3S1AB 3DMPA 4DBVO 1IZ8A 1DTEA 2WSBA 3IQZA 3K6JA 2Q9AA 3W79A 2RHWA 3ECSA 3USCS 4PLWA 2JCSA 2I1QA 1SH7A 4GMHA 3SQXA 1NI4A 1XZIA 5AXDA 3NT5A 4RVNA 5JISA 3DP9A 4GYWA 1XQ1A 1NBAA 4EI7A 2QTTA 3CH5A 3CZRA 4UBOA 3LL4A 5TQVA 4WVLA 1N9ZA 4IHJA 2MSCB 1Q95A 1I0ZA 3CGWA 4R54A 2PBZA 3UV3A 1EHCA 2ZKIA 3VMMA 4DFDA 2HU8A 3TLEA 3JWPA 4GX2A 1F17A 2FNAA 2NN3C 2RMKA 1KI7A 2WYUA 5D01A 3IOCA 3L1JA 3DEJA 4JC8A 4XQ0A 3OZCA 3C1OA 4R2IA 4LDQA 1K6EA 2WSSD 4DXAA 5KZMB 3QI7A 2ZUBA 2PV0A 3O8OA 3CNBA 1ZJ6A 1BXKA 2ZRKA 4MW4A 3FPLA 3W5VA 1Q3TA 4R1OA 1ZRSA 3SIPA 4KIWA 3A3KA 1EI9A 1N0IA 1U8ZA 3W8RA 1XQYA 5KTMA 3Q9SA 1O9BA 3ZGNA 2X9GA 3F9IA 4KFTA 1IM2A 4KO3S 3G0DA 3U7QB 4B40A 1P29A 2FPGA 4G41A 1LZLA 4GC5A 1FQOA 4S0ZA 4ZAZA 4YRPA 1RJFA 5AXAA 1S89A 3QPUA 3J80A 1N2CB 1Y7TA 1UQUA 3UHOA 1PT7A 4HWOA 1AF4A 1Y5RA 4M1MA 3LECA 3PFHA 4A2PA 2YMMA 1PRYA 2H0AA 4BUZA 3OI7A 4GPIB 3LY5A 1BGVA 3VPCA 1QJCA 1M2KA 1OX5A 1W6RA 3ZWOA 1QHXA 1N2SA 5K6TA 3LX6A 2DWUA 4S05A 1I3NA 2ZQZA 2AFRA 4Y67A 4IQGA 2FPSA 3GJRA 5EXEA 1ZCFA 2BP7B 3GLHE 3VHRA 3U44B 2QMQA 3ER6A 3VOSA 1GPJA 4GDFA 3JR3A 3BVPA 3N86A 4CKCA 3B2EA 5LZ2A 2NGRA 2ZSIA 4AQYB 3ZGZA 4HLUA 2LNDA 4YCNA 3H8WA 2L42A 1JDTA 2D5CA 3ENQA 4CQLA 1P2BA 3G9QA 5KOIA 1ZHOA 3IP5A 1OI4A 1TEXA 3FVVA 1POXA 4Z8XA 3PEUA 4LC1A 3Q6MA 2YRFA 1VRVA 4LJ4A 3C6KA 4WT7A 3OUUA 4TTQA 3AETB 4KUHA 2Q5OA 3R41A 3WB0A 4EG5A 1VGQA 3LWZA 3AHDA 2YNMC 1LVGA 3CQ9A 4TLLB 4C04A 4HQRA 4RTKA 3KHKA 3H83A 4M9ZA 2ZRGA 2LXNA 3BBLA 2ID9A 3QKTA 5HE9A 1PYGA 2FPLA 2I99A 4PQRA 3LT4A 2CSXA 2IFTA 1U80A 2HJ9A 1GTL1 1FX1A 2HSWA 1RPZA 1L1EA 3G5TA 3O2QB 1VTKA 5HTKA 4GVXA 5TF0A 4JASB 3ZVNA 3HRKA 1YJ5A 2HMYB 2UVPA 3CR3C 2P8SA 3ZV6A 4NXNB 3TMAA 3GN2A 4TS4A 3H1GA 4FC6A 4MIOA 5E3HA 1BAPA 4D3XA 2AFHE 2NZ2A 2PZAA 3GGGA 2PWAA 4HAVA 3LDHA 1MRZA 1X9HA 1PQ4A 4KREA 1NOIA 3N7UA 4E5VA 4DNXA 3SQMA 2HY7A 5EWLA 1HFEL 3E7PA 4L02A 2ZUEA 1UFVA 2XXJA 3AIOA 3IUPA 1VIAA 1AUOA 2ECPA 4QUGA 3CLRD 2CLKB 1W25A 3EDRA 5HILA 1YASA 1VKHA 3R0JA 4GZ3A 1ORIA 1ND6A 1ST2A 1XL0A 2F3TA 2JIQA 4Q93A 1Y1KE 1C0EA 1PNVA 1W5EA 2G0TA 4YUVA 1QF6A 5EZQA 4O4JF 4IFEA 2WU3A 3OETA 1DV2A 3CINA 3QH4A 1CIJA 4MGZR 3PD1A 1GA6A 1UJBA 3AEQA 4GGOA 3NC1C 1CJTC 4RA9B 4X8OA 2DMRA 4M7OA 2JJ2D 2OC4A 4YREA 2JJMA 1YR3A 3EAQA 2XDYA 3PGMA 5FXMA 7REQB 3HABA 3TZQA 3O4VA 1I01A 2V1XA 1MO5A 1SQ0A 2GHIA 2YXNA 1C1YA 2FMUA 2BFDA 5T4BA 1WG8A 3JQBA 3ZXIA 5C8VA 1WP9A 1JB9A 4OBXA 2AN9A 3V1UA 3ETGA 3JZMA 2CD7A 5K5EA 1IN8A 1UJNA 1E1DA 2A1UA 1YDFA 2VDVE 3FYCA 3COYA 4ZGWA 1E98A 1PZFA 2FVXA 3S8YA 2FG5A 4OFBA 4M1TA 1WZ2A 1WF3A 1IHXA 2GO7A 2ZYAA 1Z29A 1A9PA 1ZFNA 3BJRA 5CGZA 3WLEA 1RQ7A 2I6UA 3V4PB 1FYVA 3HJUA 4KBYA 1MH1A 1JTEA 2GK7A 3N05A 4OAQA 5BV7A 3N0RA 4YVFA 4A6XA 1AY0A 1PLLA 3RG2A 3GZ4A 1TC2A 4LRWA 3ZQJA 4CEHA 3UXEA 2IW1A 5BXQC 4KQEA 4NLLA 3JQAB 1L9KA 1N9KA 1VJGA 3LLMA 2J07A 3PHHA 4BNLA 3BH0A 2R60A 4UFPA 1E7SA 5AKZA 3DZJA 2MYUA 2HMVA 4LK3A 4DR3B 1FYFA 1TX4B 1W8DA 3GGPA 4RMNA 5H80A 2PJZA 1JLLA 3QSYA 1Y80A 2E4ZA 1T3ZA 1NF9A 1XNHA 1YA4A 2BBWA 4WVFA 3PNPA 5EZSA 3KBOA 3QG1A 1OB2A 3TAXA 3FWKA 4GNRA 1QO7A 4L73A 1RBYA 1RYYA 2VXOA 3LVFO 3OEHD 4Q4CA 4I8XA 5EYPB 3WBKA 4G09A 2PRZA 3A06A 4QUJA 5FJIA 5IKOA 3RC8A 2BCEA 4DGQA 2BCJQ 3HZHA 3L6BA 1JLHA 1EFUA 1EP9A 1T9GR 4OBWA 1TEVA 1ZIDA 4S1NA 4Q7JB 4B32A 5AOCA 3A4YA 1DDOA 5EIXA 1SU4A 4X44A 2XXAB 3K70B 1EUDA 2TSYB 3F7OA 4HBZA 4LYFA 4NTZA 3B3GA 3PUVA 5IVIA 3OEYA 4YS6A 3RHTA 5I7AA 3Q9NA 3STVA 1N5OX 1KMIY 2X4LA 3UJBA 1AV6A 5HJ2A 3URMA 1R4ZA 1N7JA 3U17A 1Q7EA 3HGTA 3VQTA 4F8YA 5KVQA 4CWAA 2XYHA 1KDZA 1Q0LA 4KR0A 3D1VA 4AJOA 2XUJA 1VPWA 1FDIA 3U3MA 1AIPA 4P08A 1D7OA 2HWYA 1J2YA 4I14A 4W5RA 5CP8A 4NS1A 4WOKA 5LN1A 1JSCA 1TJYA 3LA8A 4M7PA 4UVEA 4YXFA 1T5OA 3EEYA 5DSZA 3FMPB 2OZKA 4K5QA 4RX1A 1LK7A 3HRIA 4MS3A 2NU6A 2QMOA 1BX3A 1RYMA 4FGLA 4X90A 5TSDA 3TQSA 3W90A 1Q1BA 3PITA 5FL7A 4QAQA 3IMFA 4RGYA 2PKXA 4L57A 2CNOA 1XOIA 4QU9A 1L3CA 4WKBA 1VPDA 1Z0KA 2GH1A 4KXLA 4RIEA 2MMCA 4JNKA 4WIAA 5IAJA 1OWOA 3HXQA 3TZHA 4ZZ1A 1Q5PA 4JVOA 4F5EA 3C5VA 2DHQA 3BMQB 5CX1A 4E30A 3BRWD 1OFIA 3EASA 4IVRA 4MKRA 3KUDA 3N3BC 1L7NA 4WAUA 5BV0A 3ZCTA 3NHWA 4PYIA 3PQDA 4QFCA 5DYWA 4AAYA 1Q0QA 4A9AA 5HF9A 3FI9A 2XYQA 4J0CA 1O77A 2CC2A 4UCQA 1U2GC 3JARB 3JR7A 1I8TA 4O4LB 1ZM3A 4B7CA 1Q2UA 1TCAA 4GRIA 1D6JA 1XU4A 1SD1A 4RKWA 4YJFB 3RTDA 3A8TA 4YRCA 5K1ZA 5EUMA 1SEPA 4I9HA 2H0RA 3PYXA 3BZWA 3C7DB 3EDYA 3LOUA 1AT1A 1P0IA 1D2EA 3M1IA 1Y6GA 3LT1A 4G56A 4QARA 4KE9A 3NH9A 4L51A 4ZO9A 5K4HA 2XYVA 1XI2A 1UODA 4ZYUA 2IOFK 3LFHA 5IFKA 3OUZA 1YS1X 3W3AA 4RD0A 1IN7A 1OWPA 5IG2A 2Q4OA 2WV7A 1OYOA 2DPYA 2OV2A 1TGVA 4P6VF 1H9BA 2AN1A 1Y6ZA 4YBZA 3VAYA 1OW3B 1M33A 3AUKA 2Z58A 2WSIA 3RF6A 1IXYA 3PDJA 1B8UA 1E2DA 1R37A 3LLSA 1NTOA 4Z9XA 2ZBQA 1T0PA 4TV9B 3T38A 2DLCX 3BXEA 1XRMA 1NVAA 3EDMA 1VOTA 5C80A 2LCIA 3GO4A 2OFPA 2IZ7A 4NP6A 5JQGA 2XGSA 4AJIA 1X92A 2C03A 3T9BA 1TM4E 2P40A 5I7UA 2IYEA 3MUEA 2IXBA 4FHDA 1YO6A 2BD0A 4BE9A 1BFUA 3DYBA 4WXPA 5DOZA 1E96A 4A73A 1Y5NA 2FUG6 1Q77A 1U04A 3OAAA 4IIFA 3K05A 3QLVA 4DJEC 3LZDA 4JLNA 2KLBA 3JS5A 3QM1A 4J8PA 4DV3B 5FWYB 4MJ3A 3TEMA 2ORVA 4LMBA 5KAPA 1YKGA 2XKJE 2EX0A 3G13A 2DWCA 2C4MA 5KSYA 2CVFA 5ETJA 4DRXB 2OENG 4LCJA 3BCSA 1PUJA 1QH1A 2GESA 1I1NA 2J87A 3EBLA 4FNGA 2HBRA 4KU4A 3WYGA 3OX2A 4EPXA 2E6KA 2EIXA 3BCRA 4R2HA 3KQUA 1I9CA 2YJZA 3S2SA 2D7JA 1KRXA 2PH3A 1DUVG 2WWVD 1A4UA 4ERXA 1FX0B 3CKKA 2Y1DA 3DCJA 3KUUA 3TBHA 1RRFA 2Y2UA 4Q7LA 1TVMA 4I3FA 4URWR 1CETA 4IJQA 4KDCA 4XW2A 4AJKA 3KHSA 1NF3A 4UM7A 1KE2A 2AYXA 5CLGA 3OF5A 3V97A 1GYPA 4P22A 4WZAE 2A86A 2WT9A 3BXOA 3P5SA 2BUAA 1W93A 3KZXA 3T3DA 3DFMA 3WGYA 1YR2A 3MVEA 5EPUA 4FW9A 3ACCA 2FW1A 2ZRCA 1U3CA 2X6QA 5ERGB 1RQLA 2CXPA 2O2SA 1Y6QA 2GEBA 1RLTA 2XCSB 3JALB 4KIFA 4KUEA 4R0VA 2MT9A 5CYPA 3RAPR 3EGWA 4HLUC 2OZEA 1K68A 1T3SA 2BGNA 3G8BA 3IJRA 2J4DA 3EAFA 4RABA 1R64A 1CJMA 1W85B 2BW0A 4A3SA 1X94A 5E4FA 3EVGA 4Y2XA 5F9MA 4MR8B 4PN7A 1QDLB 3RASA 5JI2E 5K8TA 3MERA 1A8UA 3I9NA 1V95A 3KV1A 4HR7A 4MWBA 3OQ1A 1HZZA 2ID8A 4HNGA 1RI5A 5FUXA 3W6NA 4EUSA 2GXAA 1PJSA 5KWSA 3P7MA 4RANA 2IV7A 1YK0A 2HK6A 5KYYB 4DKJA 4Z5XA 2IH4A 4JMLA 1JDZA 2R5NA 4TMWA 1I14A 1FTYA 2XITA 4PXYA 4B79A 1QONA 1H9AA 4I55B 3LUFA 1FU4A 1MGOA 2BN4A 1MVNA 1XCJA 2IU4A 4XX0A 1M0EA 4E2FA 4E7PA 3BHIA 5ARCA 2Q3JA 1MF7A 2QN6A 3B9PA 3NCTA 1PS9A 2ECQA 4EEZA 1GUYA 2C00A 3IXMA 4LVNA 2V6FA 3V46A 2ATXA 3IQWA 2JFYA 2X7HA 3GLHA 1X3LA 1HDCA 4QIHA 5DIFA 3DD1A 2D54A 4O25A 4N8DA 2PMBA 3WNQA 3HCAA 1JMYA 1X8JA 4FKZA 3X2FA 1UK9A 1A0OA 5C81A 3CVWA 3F46A 5I8WA 1T2UA 2ZIUB 3H5TA 4BN0A 1X42A 2C5SA 2C58A 4DLUA 1CZRA 2BM9A 3KG2A 3VKVA 4RDXA 1J5EB 3Q0EA 1M67A 3WIUA 4EYKA 1KVUA 5IH3A 5L3SB 3SR0A 1K3TA 1FFEA 1PEDA 1RBQA 3RYIB 3SXJA 3WGKA 3MWEA 3ZDXB 1BW9A 5HQTA 4JH0A 5K4GA 1ZW1A 2G1JA 5DM1A 4J0DA 3MWKA 1BE1A 2HBZA 1FEZA 2PVCA 1HLDA 4HEA6 1BEUB 1EM8A 4RD6A 2FPPB 4PCUA 3E7DA 1PG0A 5KQSA 1W52X 1QWOA 2RGAA 2IS2A 4U0KA 4B73A 1E94E 1QCDA 4KQXA 5H9VA 2ZAOA 3EB9A 2K2WA 2AZMA 2ZE7A 3K9LA 4B4KA 3WWYA 2QYHA 3IIMA 4ZGBA 1KYWA 2FR8A 1G3QA 3JQBC 1J70A 1SHZA 2C20A 3GJXC 4KXWA 5BQOA 4AZ3A 4AUNA 2AFHA 1YQDA 2Z8ZA 2JW5A 2HI0A 4ER6A 1O7JA 5FB3A 3RV4A 1WVGA 2YVUA 3BE4A 3EYAA 1Z74A 1KY4A 3SXUB 2IYLD 3UICA 3HXMA 5K0ZA 4IIXA 1KH3A 5CFPA 1SB8A 1J8FA 1QCZA 2XUGA 4YMIA 5ALNA 1KMCA 5AJHA 3OIVA 4TWBA 4TMVA 3EF1A 4OH1A 1VP9A 3U9LA 5BR1A 4QOGA 5DF1A 2ZB8A 1AK1A 1R5BA 4I4NA 1BEEA 1YDEA 5DHQA 1CEYA 4RKEA 4RXMA 4EKYA 2PIAA 4OFXA 3FHCB 1I2CA 2WIKA 3FUCA 4QXQA 2DLDA 2AOWA 2NTNA 3BIOA 3OFND 3WKBA 2RHGB 4H08A 1MX1A 4FMCB 4UZSA 4DSTA 2ANCA 3ICWA 1HQYE 1Y9EA 4RV5A 4U9HS 3RRNA 4BV3A 4B6SA 1DADA 4PO3X 1H0RA 1O6GA 3PGJA 1OU4A 2HAEA 1SHUX 1AKQA 2QF7A 5FBLB 4D2IA 3I4FA 5HCNA 3PK0A 4G97A 1X1EA 2EJBA 3CNLA 1FRFS 2XYRA 3LXMA 4DCJA 2AVDA 1JAIA 1SQ6A 2YWXA 4EYGA 3I8XA 5M29A 3IT1A 2VBCA 4TQ9A 1Z4JA 2GF9A 3KB1A 4B2YA 3U61B 2IBTA 3F9CA 1YC5A 1KARA 4MPDA 3TW0A 5AQEA 2IPNA 1AGYA 2FQ1A 2DBYA 4OOFA 4EB0A 5KX5A 2XVAA 1MO6A 1BGXT 5AW7A 2ZR0A 4IZOA 1DVRA 1WNFA 1EWRA 3GPIA 3ENZA 1O0CA 3OOEA 4YO7A 2AK3A 2NZUG 4WXEA 1QIMA 3B1XA 3F90A 3ZDBA 4LDPA 4U2FA 2CW5A 3K8OE 3DBRA 4TRRA 3VR3A 1ZH0A 5C4MA 2R8PA 1U9ZA 4CKBA 1WKVA 3TUZC 4UDYX 1F2TB 1OKKD 2V7EA 3ZHTA 4C89A 3M0EA 4BOYA 4EL5A 4WBNB 3W05A 4ZYXA 2Z2KA 4OP3A 4BJ5A 4M53A 3PG5A 4G8DA 4GKKB 5A0TA 3TOSA 3ZDQA 2I4IA 1SY7A 2J4FA 1XVLA 3MGCA 3SZGA 3HUUA 3STTA 4OGFA 3HWSA 4YMUA 5ICGA 4U8GA 4LZLA 2JGFA 4P3XA 3B7WA 1XK6A 4NBTA 5IXSA 3DULA 2WQ6A 2O9JA 1XDGA 4MW1A 3H4IA 3WKEA 2H8GA 1BRMA 5DEOA 2R3SA 3EC1A 4E51A 2HW8A 2VPZA 5I4CA 1M6VA 4QWWA 4N3AA 5K0TA 1LV8A 3SHVA 3G2OA 4OLHA 2ORYA 3E35A 4M9XA 4WK2B 1XLUA 2AWNA 2QB5A 3QV1A 1EEXB 4O2BB 3KSDO 1ZK2A 5EP4A 3IESA 3BMCB 5JS6A 4FHZA 4GOND 8ABPA 1G63A 1T8WA 3GT0A 2IYOA 3HVHA 2Z6QA 4DDMA 3SC6A 4R2LA 3HRHA 4NBNA 4Z4HA 4K40A 3AKDA 2AD5A 3VUEA 1RYFA 2FSVA 1UC4B 2W2KB 2YW9A 4RY9A 4L8LA 4QYIB 4D6XA 1SC3A 4JGIA 1C50A 3OY7A 5BURA 4BQFA 1FS6A 1NXQA 5F1YA 5TV2A 5L3VA 3PL1A 3F7NA 4H31A 1K6MA 1IOVA 4MRNA 4PIVA 3B1WA 4JBGA 4ZDWA 3KT8A 4BFVA 2BOVA 3G2NA 2PLNA 4U6NA 1M73E 3OCJA 3ZY4A 3NW9A 2FR0A 3F3SA 3SZOA 5IABA 5A0VA 1I6WA 1AURA 2QMUA 4F6RB 3FPGA 4ZI3A 1NURA 2J6CA 3KJQA 3KWLA 3V4FA 4L4RA 3NHPA 4MHTA 2EQBA 5IM5A 5JJIA 3JAWB 2GN2A 3KXDA 4IV5A 5L7YA 4AWBA 5FNZA 4AS3A 4KSYA 2ZJBA 4PLYA 2VZEA 3H9JA 1DO8A 1H9CA 4E11A 2RGDA 3VSAA 3FPFA 3KHTA 4O5OA 2EFCB 1CJUC 3U2QA 3WL6A 5EWMB 3A14A 2I55A 4G26A 2WTEA 1KJ9A 3D9QX 4MKFA 2IRWA 1F4VA 1R9MA 3NM6B 3GP3A 4DLAA 1MO2A 1IEVA 5HQ3A 1QH8A 2EFGA 4MAMA 3L41A 4OHXA 5CURA 2QMYA 4PZYA 5G1OA 1NUAA 4FILA 4ZIRB 5DBOA 1JU4A 3E70C 4H1WA 5EA2A 2HIHA 3RIHA 5CX4A 4YWHA 5ALPA 3MGAA 3KR0A 3QLVC 1TXGA 1I6KA 1UJ5A 5IS2A 3VHQA 1OTXA 1T1SA 3KQHA 4LJRA 3GAZA 1IN5A 4RMIA 5K9ZA 1M74A 2ZDQA 1JDVA 5DHTA 4ZOQI 1QYRA 1ISIA 1P1KA 1X8XA 3INYA 4NPHA 3FOCA 3UA4A 4QXPA 3IAS6 4HLNA 1Y5LA 3G6KA 3TR5A 3U39A 1NG9A 3WK4A 1ZR2A 3DH0A 1J2EA 4PRKA 5ED0A 5GONF 4JXXA 3JRXA 2I6XA 1VXOA 2I2FA 3ZNOA 4YCCA 1TAHA 1ZM2A 4AKHA 1RHJA 4NK4A 1MT0A 4KQ1A 3TSWA 3PRJA 2WC1A 4Q9KA 1MDBA 2J31A 2WTNA 4LY9A 4GYYA 3LAWA 3WE7A 2WU1A 3QUCA 3OZWA 4BP8A 1FYDA 1T34A 3GUCA 4I1VA 1KI1A 1KMQA 4H6VA 3STUA 3DBVO 2WJYA 1TM5E 3C8ZA 3ZD8A 4D4MA 3K0CC 1OWNA 5BWOA 1MTZA 4J3FA 3LYUA 3GYGA 1K9VF 1QO0D 2GJKA 2G67A 1T4MA 3F7MA 4GF5A 4X8LA 2DXIA 3QKSB 4BNVA 5CLHA 1UBGA 1BTOA 4S1VA 4F6LA 3F5SA 4I1YA 4QHYA 2ON6A 2G9NA 4UUQA 4W5NA 3O4GA 3HO6A 2HNKA 2GTHA 1NX9A 2RH8A 3ESRA 3UAOA 1YL5A 3HBFA 2WB2A 1NPYA 1IN6A 1U28A 4JI8B 5K8JB 2DCMA 2V9CA 4L6AA 2AG5A 3RYFA 2CKMA 4KXQA 4CT0A 4LI3X 3VU9B 3PNKA 3A7EA 4WCFB 4IFBA 1WBJB 3UV6A 5JXIA 2AQKA 3R3HA 1LQUA 1OQAA 1C9KA 3SLKA 4YRMA 5A9TA 4WZAA 4OJMX 3B9BA 4HDSA 2CXHA 3G59A 1ULTA 1JHUA 4PXAA 2VNJA 3WLHA 2ST1A 2ZRNA 4FYHA 1CRPA 4IDQA 4RY8A 1XIVA 3OU7A 1DBQA 1JDBB 2DH5A 3MRSA 2MINB 2XBMA 1Y3AA 3TW8A 2ZJ7A 4WXYB 4Y0VA 5LVAA 1LJUA 1TRHA 4NCIA 2JGIA 4FI3C 4C0LA 2GAFA 4ARZA 1KEEB 1RRMA 1KO1A 2IJGX 3ECCA 3GLUA 4Z0TA 3TLXA 3KP1A 3NWPA 4AYTA 5LWQA 1GQQA 1T6BY 1W76A 5NULA 5BQFA 3QX7A 5FEUA 4BVGA 2XDQA 4G3XA 3HI4A 2C29D 2P77A 6ABPA 2BMWA 2W6IA 5EE0A 3Q3HA 2C0CA 3BWMA 3LWNA 4FDAA 4B74A 3HKEB 3C5WP 2D1RA 4PZDA 4EQ6B 2EF0A 1KO7A 1SCNE 1P5JA 2C2HA 3B7GA 3HFGA 1P2SA 5A3SA 3RSQA 3SD7A 1SU8A 3PRYA 4ISCA 4U8HA 1HTWA 5J43A 3LQRA 5FAXA 1U2ZA 3REFA 2DFNA 2LD4A 4YAUA 4TYPA 1VZ2A 1WXEA 2PX3A 4FEYA 4QUKA 1BDJA 4TMTA 5AHKA 2B35A 3H5RA 1NULA 2R48A 4RO0A 3RVDA 3UUFA 4AKIA 2OCYC 1FFXB 3FPKA 3IULA 3REOA 2V55B 3LCRA 1Z4KA 1U0LA 4B6FA 4F91B 2OSBA 2Y71A 1EDBA 1NMQA 2XE6A 3EXG1 2YCLA 1R3DA 2QD1A 1Y98A 2FWIA 2J7KA 1OXUA 1A8PA 1E9CA 1QLWA 4GSYA 1E4VA 2C1EA 3H1PA 2O0MA 4GM1A 3KYCA 1QORA 4O63O 1X9IA 3PEFA 4UEQA 4IVQA 4D0LB 2VYVD 1WXGA 3A2MA 1YR7A 1G9TA 1KL7A 2A0UA 2HK9A 4OHUA 5BPHA 5F7OA 3O4IA 4OJNA 5EJ2A 2BMFA 1T2FA 2B78A 3GT3A 5AK4A 1Q1ZA 2JCYA 3ML1A 1FCJA 4RF3A 1CY7A 2FZKA 2PD3A 1DP4A 5CVTA 4ENPA 5F4BA 3DV9A 3S68A 1T3TA 3C97A 2LDXA 2O6HA 5BQXA 3LPAA 1E2BA 4HEHA 2DY1A 2IP2A 1G8GA 1TEHA 3UCEA 3WA6A 2NTVA 2R84A 4PRYA 1CYEA 2MSDB 3KKOA 1FA9A 4PLTA 5HZHA 4HYEA 3UVEA 5IK2D 1P9NA 1L4LA 2OHIA 2R1TB 3M5PA 2HIMA 1D2CA 4WL0A 1QYDA 1L5FA 3TOZA 2ZUDA 3JQ8A 3N2GA 1FNMA 3ZJ4A 2GEFA 3ADKA 1OBOA 1Q91A 1TJ3A 1YWGO 1ADYA 4HQNA 4KX5A 3FKSD 1J20A 3LDFA 1N5IA 2EKPA 4OQXA 1RJWA 3A4MA 1SCKA 3RRFA 3EH1A 4MVJF 4ABTA 3IVAA 4MTLA 8ATCA 3C3AA 1U3WA 1XZQA 1U8TA 3FPEA 3ANLA 4HWKA 2IS4A 2ZI4A 3PRKE 4Q1EA 1WB9A 1W73A 1ACLA 3ZJVA 1JHVA 5CDSA 1ZHFA 3ZX4A 3T7SA 1R6XA 4R31A 4P98A 4Z99A 4BE7B 1GYRA 3PDUA 1WOYA 2O52A 1J0BA 2ZBGA 3FWPA 1H2ZA 2OXIA 2N75A 1AU9A 1MA0A 2FWRA 4MQFA 2QTVB 4CW7A 1V8FA 3Q12A 2B82A 4A4DA 3L1KA 1B4DA 4KMSA 4NOMA 5KDOA 3IPRA 4G1BA 4RAQA 3K0BA 5CITA 5C31A 4JI1B 3B52X 3V34A 1V8OA 3LQ2A 1MAWA 3FFWA 1FQJA 2O2DA 4O8ZA 4QFMA 2PRJA 4DOMA 3MWDA 5TJHA 3UKJA 4OMCA 4LNUA 5LXTA 1RVDA 3F98A 1WUIS 4KOAA 5MF6A 3DQPA 5BSWA 3M4YA 4LHWA 3LBIA 4G0ZA 1IJFA 1PD0A 1SCBA 2FXIA 2DG2A 2HQSA 4EX6A 1BA2A 1CVLA 1XEWX 4M98A 4C3OB 1IEXA 1VBMA 2XSZA 5IDVA 3H42B 1O0SA 3HV0A 1WB6A 1AKUA 3W6UA 1T9CA 3MMNA 4BNDB 3GD5A 1Z73A 2VUUA 1T5LA 3NHFA 4I4TB 3UJHA 5JJKA 1V2GA 2H18A 2QRPA 4HTFB 3T5DA 2OD2A 1GQRA 2QXTA 5IKMA 5JG7A 2JCXA 5ULLA 1SKMA 2Y0CA 1Q84A 1RC0A 1RRGA 1C0KA 2E7ZA 3KS9A 3KKMA 4FDTA 5DW3A 3RU3A 2IGBA 1OH6A 1Z6PA 3A1FA 1J2UA 5BMVA 2QTFA 3OTIA 2UUPA 1RVV1 4Q21A 4QUAA 5CHEA 4D81A 1L3IA 3WLJA 3OD5A 3NT2A 3E3MA 2GZSA 3WVNA 4HKTA 4QATA 3L79A 4LWPA 5D6OA 4DILA 3ZYZA 2F9FA 4U2KA 3RYCB 1VJ0A 1SC4A 2GEVA 1SN7A 2D13A 4Q00A 4JQCA 4Y0NA 4MCJA 5CH8A 5T4EA 5I7FA 3QE9Y 1EBBA 5F3WB 2QL5A 2WOOA 2Q1SA 4KN5A 4EUEA 5I9NA 2Z9CA 1IZ7A 4HOYA 3U31A 4KE7A 4ZAVA 1M34A 1O94C 3Q7TA 4PLPA 1VGVA 4MARA 1ONPA 1TUGA 3JASB 4RV4A 2LPMA 1UT8A 1YV9A 3UMYA 3FIUA 1ZJWA 2POQX 4N3NA 4R1SA 1P17A 4P7FA 5JPIA 2BGJA 3ZWXA 5TGTA 1H1LA 2JASA 3AY3A 2G6TA 1MIOA 5CFNA 4AKGA 1I4WA 4LIPD 2VPWA 4QYXA 2CMDA 3R7FA 4XDYA 2GK6A 3A4TA 4DCOA 4LCBA 1W4RA 4ZOLB 1KKUA 1FE8A 1A4IA 1E6UA 1TJNA 2PV7A 4KFUA 4TL8A 2OPHA 3VR6A 1T10A 3FDJA 4ZEOA 2ZJYA 1BNCA 2GFHA 2IELA 1KZ9A 2BFFB 4PWZA 3K3PA 5CXXA 4E1AA 3B82A 9GPBA 3F1KA 5KOHB 2WJHA 5GINE 2BEVB 1OXMA 1NW7A 4WRRA 1YR9A 3ND7A 1V8ZA 1OROA 5FLEX 2WEKA 2O23A 3OY2A 5H82A 1PVOA 3K53A 2PY6A 3BN3A 1ZGZA 1XKLA 5ITWA 4M89A 3OOWA 2FEAA 5BOVA 2V0GA 1DS6A 1EXDA 5DRTA 4EW6A 4LJ7A 3NHUA 3VKFA 1USKA 3U7EB 2QTGA 2CLSA 4KK3A 4CCSA 3GCZA 1G55A 4LW8A 4NH4A 3O8QB 2E4AA 1UM9B 5A5FA 3E7XA 4CXMA 3Q98A 3RIEA 1FDWA 5KVVA 2CK3A 3Q1KA 2IY7A 3UUWA 2I29A 4PAGA 4Q18A 3L7IA 4WLFA 4QOIA 3KOYA 2PSFA 4ZZ3A 1D6NA 4WY8A 5JSKA 3DB1A 4N8EA 1SHLA 3MQFA 2E18A 1ABEA 3L6EA 4IX9A 1R9JA 4TKMA 4PR3A 2O8VA 1ONOA 2PT9A 3WK6A 2WD7B 4F2HA 4YR9A 4G1MB 4F5YA 3UW1A 3W9SA 3I2JA 3GUZA 1XDWA 2W0MA 2DR3A 4D9GA 1D8TA 3C5CA 3O95A 1TAUA 4XKJA 1CUIA 2R0QC 3OIYA 2AI1A 1RQXA 1Z7BA 1F7UA 1UAAA 1GAEO 3SNKA 2BEWA 3EXAA 2Q1XA 1FTNA 1U0JA 3N1UA 4M54A 5FO1A 5MGNA 3R77A 4FOTA 4EHDA 1ZVKA 3ZY6A 2AKAB 1TKCA 3BGIA 3SEAA 3R7SA 3UM9A 1HH4A 2FG6C 3Q85A 4Q4LA 3KAKA 1JTVA 3ROPA 3AJEA 1GPH1 5JQWA 1HE1C 1W36D 5TQ0B 1Z0FA 3EWSA 5D7NA 3GLKA 1MV8A 1GG5A 4I5IA 3ETDA 4RZQA 4MDYA 3RJ5A 4A0RA 3RFCA 3R3WA 4BO2A 3HB7A 4YAJA 5BSVA 3BL5A 4OK5A 1G42A 2DF8A 3GLIB 4QHTA 2V65A 3FTPA 2KX7A 3DVAB 4PR0A 5CU7A 4TUYA 1RSZA 4A8HA 5H0IA 2NO5A 2Z57A 4IDFA 3G2LA 4KLZA 5JECA 3PL5A 1P8JA 1X7YA 1YDWA 3EPJA 4BP1A 2ZUVA 4HZIA 2R6DA 1LNQA 5KHAA 3FFXA 1XN1A 5INTA 3CIFA 3NBQA 4CKBB 1E3QA 1X7ZA 5IFLA 4L4UA 1QWSA 2XCOA 4KYVA 4CMGA 4OBEA 3W5JA 2VJOA 1E2NA 1FDRA 4AF7A 1AS2A 4M21A 3LXRA 3T3MB 1NQ5A 4TXNA 3DLCA 3I9V1 4NBLA 5A1TA 4DMCA 4RULA 1E18A 4MUBA 1NX6A 2YVLA 4WNIA 2W2TA 2WA2A 3KD2A 2GDZA 4JJZA 3MCAA 4KPGA 1WXQA 4F92B 3AEKA 3KSBC 2OY0A 5B55A 5B1SA 3TUIC 1Z0AA 4TV9F 4YJHB 1V8BA 1O6CA 4DPLA 2EX4A 3QU7A 5KKNB 1FSPA 3OZIA 1YQTA 1HPLA 1RFGE 1MQ9A 5TQ2B 4P0QB 2XWJI 3C48A 3S99A 5KPDA 3L8CA 1ZAYA 1PJQA 2EG9A 3D7RA 2EWWA 1ISSA 1NVDA 2I8AA 1TD1A 2WUDA 4OB7A 1G59A 1D4FA 3CVOA 3UPTA 3KZ1E 1HK7A 3TZCA 1QX4A 2KYRA 4ZT6A 1AHHA 4IIBA 4IIDA 3LSTA 3ZQ4A 1WCWA 4EB3A 3DAGA 4P7GA 2I8CA 5E1BA 4WKCA 4R0MA 4HXYA 3LUGA 1A2BA 2J0UB 3LC2O 4KQ2A 1L5NA 4HNAB 1M1YE 1TT5B 3ELDA 1NQXA 1PWYE 1C1DB 2QD4A 1KPIA 2C7VA 1US8A 2JD1A 3MTBA 3NPAA 4M0CA 4TXMA 4F2GA 1KTIA 2PVSA 5K2MA 4MMYB 1S3FA 3ESBA 1WCIA 1LK5A 1UXIA 4L5CA 1NDHA 1XZAA 4INJA 1GV1A 2WMNB 3NANA 4O4HF 2HRZA 3SS7X 4CIBA 2Q3FA 4EF6A 4FGSA 2P65A 3HCEA 4WNAA 2XPCA 4JVSB 4QUIA 5BRNA 1F5NA 5IF9A 1FRNA 2E82A 3IUJA 2JFZA 2PLAA 4UVDA 4V0QA 4CEIB 3OFKA 2FFJA 1YJAA 5G1PA 3KLNA 2YBDA 1D03A 2A1TS 2G5PA 4DSOA 4DABA 4GKAA 3WWOA 2OD7A 5EFOA 1CCWA 2LR0A 4UBMA 5AM0A 4N5MA 3KUKA 4CU5A 4M0DA 2VYQA 3OSZA 3RVKA 2CMHA 3DKVA 1H6CA 2AG1A 1BJKA 1G3UA 3LT2A 4QEKA 4AO7A 3V3KA 2EF1A 4EL0A 4M2LA 4A1OA 5L95A 4DQDA 3DMTA 2B8NA 3SZLA 1Q0UA 2CNBA 1LZKA 3Q5EA 4XVQA 5F4ZA 4EFMA 4QM6A 3EQ7A 2GUGA 1SQSA 4F2PA 2C31A 3EFOB 2VHZA 1J22A 2IEDA 1NDUA 4GDMA 4HI0E 1CQXA 4DLKA 1TMYA 1WMEA 4W5HA 3K6SA 3NEYA 1H69A 2CB9A 2GCEA 4G8BA 4B3BA 1Y1SA 1QHYA 3EVCA 3CW8X 3ZQKA 5AW0A 5I4KA 3RBZA 2NYVA 1J07A 4I46A 1H65A 5EKXA 1SXHA 4NMXB 4EDFA 3I01M 1TLFA 1B15A 2PX0A 4I55F 2Z4SA 3VPFA 4TVSA 3N07A 1CQWA 1KP2A 2SKDA 2Z1NA 1L5GB 4CNQA 3ZLJA 4O02B 5GV7A 1HRKA 1PJZA 3CH7A 3AHEA 2CJFA 1K97A 4J76A 1OH8A 4WDQA 3RNOA 2H1LA 4DMLA 4JI2B 3D7MA 1QRAA 4DTIA 3RPEA 2QIPA 2ZTLA 3ONVA 4IZHA 4Y1RA 5DGCA 3SF0A 4EW2A 2OORA 1I3KA 3BGOS 1RC1A 4ARBA 3W5HA 3MAAC 3OFJA 1M2OB 1MB4A 1NVVQ 1P7YA 1Y63A 2OAP1 3IT3A 4MAF