4L08A

Crystal structure of the maleamate amidase ami(c149a) in complex with maleate from pseudomonas putida s16
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
206
structure length
206
Chain Sequence
QKEVYDAAGFGNPVSRGVHPAIIVVDFSYGFTDLQYPTASDASLQMSRTKEICDLARALEFPVIFTTIAYHPGEIPMLPWLEKSSGMAALLYGSRLVEIDMATGIQPNDVVVVKKGASSFFGSTLSSLLAGTNTDTVVVTGATTSGAVRATVVDAVQSGFKVLVPADCCADRAKGPHEASLYDIQQKYGDVTDSDDILKWLRSVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Hydrolase, isochorismatase family
publication title Structural insights into the specific recognition of N-heterocycle biodenitrogenation-derived substrates by microbial amide hydrolases.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 70
structure length 206
sequence length 206
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00857 Isochorismatase Isochorismatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.850 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isochorismatase-like 4l08A00
3PL1A 1ILWA 1NF9A 3TXYA 3TG2A 1YACA 4WH0A 3OQPA 3O94A 3O92A 3S2SA 3HB7A 3LQYA 3UAOA 3IRVA 3O93A 1IM5A 3TB4A 1NBAA 2FQ1A 4H17A 4L07A 1XN4A 3MCWA 3R2JA 3HU5A 4L08A 3KL2A 3OT4A 1NF8A 2H0RA 2A67A 1J2RA 2B34A 1YZVA 3O90A 3R77A 4WGFA 1X9GA 3O91A 2WT9A 3V8EA 2WTAA 3EEFA
chains in the Genus database with same CATH superfamily
2F62A 3GMTA 3JQFA 5DBGA 2I5PO 1U65A 1DWUA 2ZXEA 4I9GA 3GK3A 3NHBA 1L1QA 3G0DA 5DGIA 3BD7A 1F14A 3E61A 1VQ1A 4P4LA 1NZJA 3W7VA 3P9CA 5HVNA 2F48A 4MV4A 1K7YA 1R0SA 2Q3LA 3FPGA 3Q5EA 3LBAA 1YD7A 1TEXA 4EUKA 2FFRA 4QLOA 4CLOA 1XDDA 4L3OA 3V8NA 1FBTA 3HCDA 3T1VA 1USKA 4B8YA 1IZ0A 2O8FB 3FPHA 1X13A 3U80A 3JZMA 1RP1A 1SCJA 5KNBH 5T4BA 1R6XA 4ESHA 5U1PA 5B2ZA 1ZJ4A 3A36A 2O8CA 4AWXA 3ESXA 4J43A 5KQRA 1W36D 2A57A 5TQ0A 2BRUA 1N6LA 5I7EA 3I01A 1TU3A 4YN3A 4AT1A 1GAWA 1X80A 4CDMA 3AR3A 4EYGA 3REQA 3EJWA 4JI2B 5G1NA 3ENWA 1B16A 3NATA 3VO8A 4RKYA 4JL6A 4NOKA 1N7HA 3GQBA 4H7DA 1S5PA 4C3OB 3PR2B 2PXXA 4FKMA 4IUCS 4EY7A 1KTIA 1K6JA 1ZK4A 4RTKA 2PIDA 2PL5A 4ZI7F 3TBFA 5HDQA 1RI5A 3RC9A 3WYAA 3NASA 1YR9A 1YC2A 3IBYA 2NYRA 3CXRA 2P62A 2WFZA 2IVZA 4HN4B 1ZYUA 1LLUA 3DPUA 1XTSA 2FYTA 3O1IC 4M0KA 4MV0A 4RHXA 1L5SA 2VQDA 5SY4A 4COKA 3PEFA 2X4GA 3D5QA 3BUSA 2I2XB 4MS4B 2CV2A 4LCEA 2QEQA 2GBLC 4YRMA 2FPGA 4CG0A 3CLSC 2NTNA 3K7EA 4V2IA 4KR9A 4EO4A 4CQLB 5J4KA 3CW8X 1W581 3CB2A 3MB8A 1E1MA 1VDMA 4HLUA 4BU0A 4DIFA 5DHRA 3B38A 2QG9A 4U9UA 3WL6A 2ZIVB 1ZH0A 4EO9A 4UTRA 4X5OA 5CUQA 2VATA 3ANSA 5TJHA 1LWNA 3SDZA 4OIMA 4YWJA 5IDWA 1YZQA 4C4XA 1PX0A 3ROZA 3FSEA 2E85A 1U4SA 2F6RA 3OUTA 3DE5X 3HXTA 1D1QA 5F7ZA 2QLFA 2IGBA 2FKNA 2DH5A 1PFUA 3IELA 2VZ0A 4YXFA 3TTWA 5GIPE 4Q48A 1NLZA 1X7XB 3ILVA 1E4VA 2E1PA 3B6JA 5KOJB 4XASA 2Q50A 3ETLA 3OJ0A 2JLUA 5CT6A 5LFAA 1XN1A 2DE0X 4KEAA 2NTYC 4ZVKA 1P72A 5JXHA 1NVAA 4MR9A 1B8UA 1ZH6A 1YQQA 2IXEA 1M2VB 1TUEA 1YT5A 2LKDA 4RD6A 4D1YA 2X4LA 4AD8A 3E53A 1CJTC 2C5BA 4IKOA 3V7FA 3AJDA 1MB3A 2PR2A 4W7SA 3HPQA 1QAMA 1WA5A 2O20A 1VIAA 5CLLA 4E08A 4M0LA 4GL4A 3VKFA 4Z7OB 2ACKA 3CYFA 4ZP1A 2CL0X 3WP0A 4EGFA 2W6JD 1Q0LA 1SQ6A 1R2QA 1U7XA 2IYYA 2ZUSA 4UBKA 1QTNA 4YV0A 5DM4A 3BGSA 1WWKA 2NUBA 4ND1A 2SCUA 4P8RA 3MHTA 4F4JA 4DCJA 1IEVA 4EG7A 3QYPA 4YMSA 3WMFA 2CDNA 4DV2B 1K92A 1L8QA 1EXDA 4E30A 3N9IA 4CQJA 3TD9A 2NVOA 2HYIC 1HT1E 3E2IA 1AGYA 1TO1E 1R00A 1JSZA 4QX6A 3JQ9C 2O2JA 3LVQE 1TM4E 2DKOA 2F8LA 2VHTA 3L0IB 4NJMA 1Q3TA 2XGOA 2Y0EA 4PYOA 3WLTA 4B83A 3SS7X 2PRKA 2VHXA 3QJGA 2HYDA 4QXPA 3WAKA 4BP1A 4C1NA 1JSRA 4UTZA 4WAUA 4WBNF 1FYXA 1PK8A 1TGYA 1UEJA 2AC7A 2C2ZA 3EC1A 3T9BA 1ZVVA 1JLRA 4LBZA 2OCBA 1QKKA 2VA9A 2GZHA 4GE3A 4PX3A 3NHYA 4O2AB 1UZNA 5MFZA 1F2DA 3ZLTA 7REQA 2DFPA 4Z1MA 3DBLA 4B6RA 5JAOA 5CBPB 4LDNA 3RWOA 4KHZA 3PF8A 1M73E 4Q3DA 3JD0A 5FWYA 4CV3A 3EA4A 2A0YA 1XCGB 3H1TA 3TFQA 4F7WA 1KNXA 3EFHA 1YACA 2ZBGA 4CKYA 3K31A 1U0RA 2WJPA 2OQRA 3SR4A 4LMAA 4PXAA 3LZ6A 1C4OA 1ESMA 2AZXA 4YMUA 2QTBA 4WL0A 1Z7GA 3GELA 1IBCA 3G0GA 3FPFA 2GI4A 1GYRA 1SJ9A 2WA1A 3DWGA 3E9RA 3QF7A 4NONA 4P3KA 1MABB 5K1ZA 4UUMA 4F5YA 3U7FB 2PBRA 1OF1A 1PBTA 3AVQA 4JBHA 3BD8A 3NBMA 4QFDA 4QPZA 4ZVLA 5IAGA 3GAFA 3SN6A 2NU9B 4OM7A 4V2UA 4XSVA 1RPAA 4WBSA 5CURA 1FLVA 1W2WB 1Y8CA 2DBYA 2LDXA 3NTRA 2A88A 4G86A 4YUVA 1W52X 2I6UA 1IUOA 1SFRA 2HJ9A 1Q1BA 4IHKA 3JARB 2JGFA 2P7IA 1E5VA 5DHFA 1N92A 3TM5A 1QO0A 4BB5A 1AF4A 121PA 3CM0A 2JI9A 3G2QA 3OJXA 1P7PA 4PSDA 1F17A 5KTOA 4LI0A 5EHQA 1R9GA 3AG5A 3R4VA 4RLQA 1I7NA 2IX3A 4L27A 2BTEA 1FNBA 1AO3A 3NX4A 3A6EA 1COWD 4FZ3A 4JQCA 3DO5A 4TYPA 4X6UA 1E2QA 4U3JA 1EFPB 3KJNA 4MIOA 5LMNB 3HJCA 2QDKA 1CNMA 1D2RA 2QZ9A 4HH1A 3RJTA 2ZJ2A 3A7DA 3GMDA 3A1UA 2X7JA 1UFOA 1HT3A 2CUKA 1GPKA 4Y67A 4MVJM 5F2EA 3BORA 3H9QA 4WXHA 1U2GC 1RI4A 3DHNA 5IT0A 4UMEA 1WTAA 3VAYA 2F1KA 2YJNA 4B8WA 4E88A 4LXXA 3UJDA 3ZGVA 3GGPA 4G5HA 2C61A 1JMKC 1UR5A 2NT4A 4DLUA 4X20B 5FOXA 5BUZA 4K2AA 3LY5A 4X64B 3H2ZA 1R9MA 1ISHA 3LRPA 5CLGA 5ALUA 1DTWA 3DKPA 3L7LA 2PGXA 4E5UA 1GL3A 3AUXA 2DQSA 1NYRA 5EP4A 1M10A 3WGVA 4MCIA 3GJ4A 1IUKA 3EZ9A 3PWKA 4FFWA 4R1LA 1P60A 1GU7A 1X92A 3WGHA 1Q7CA 3ZCUA 4RTNA 4PN3A 5LMZA 1K8YB 3WBJA 1SVLA 1G0OA 3A6JA 3TE7A 3VHXB 3PSAA 2OO5A 4MA0A 2IYSA 4NFHA 4IOKA 2YVKA 4NYMR 4PYMA 4R16A 4ENRA 1PDOA 4KO3S 4S24A 5G53C 4YRBA 4WQMA 1KAMA 1UWVA 2EF0A 3E35A 4JMPA 1DARA 5CFRA 5JS1A 1A8PA 1Q50A 3C6QA 1IB6A 2G4LA 3KOYA 3CVOA 4JLMA 3E7XA 2O2ZA 3FYSA 4B3TB 1Z5GA 4PBRA 2O14A 3F5SA 1GJRA 2BPOA 3CNEA 4QUDA 1I2AA 3LWNA 2CMDA 2DKNA 4BLOA 4LF4B 3ROXA 1QG4A 1QIIA 3SHWA 3EZ7A 1RCTE 5CB4F 4S12A 1I7LA 1K75A 2P9JA 4TTJA 4J03A 1DKRA 2AFHA 1RHUA 1KY5A 4OFZA 2ASEA 3NI2A 5HIIA 3TDNA 4BAUA 4PR3A 1TQ2A 1SB8A 3ANNA 1VHQA 3ECCA 4HQNA 3LYLA 3PR1A 4RA6B 4FFRA 2JHGA 1SCNE 2WHXA 2XF2A 2PD4A 4TXNA 2YQ4A 4X85A 4GLJA 2ZBVA 3HKDA 5TNXA 5AM2A 1KWKA 4AO7A 4K9PA 3EMDA 1TIBA 2I8AA 5TGDA 4ZJUA 3L7KA 2G04A 2FZEA 2Y2VA 3FSRA 1KQNA 1K6EA 4EAAA 3QLTA 1WKCA 4UQPA 2XQIA 2C03A 2WU4A 2AA3A 4LVCA 4M1SA 1QOQB 2WJ6A 1NJFA 2PUVA 1JH9A 1SUCA 2P2NA 4G9BA 1XHEA 3DHWC 1C7QA 4P38A 4BVHA 4IWXA 4ECAA 1ZDMA 2CXTA 3U7EB 1J1ZA 1UIMA 3FGOA 2SHKA 2O6LA 2PX4A 2RC6A 3K0FB 2X0JA 4HI0E 4JT8A 3WRVA 3U0VA 1NJ6A 4D99A 3TL3A 1NVVQ 3P9XA 1N5JA 2JD1A 3GIDA 3GDOA 3IL2A 3O0TA 1GQYA 5DP1A 1LTHR 2CLIB 3DAGA 1TUBA 4MRMB 1Q7TA 2I9KA 4P7JA 2QJTA 3WE7A 1L7RA 4JT4A 4KQHA 3R7LA 5F1OA 2JFBA 3NO4A 5K3OA 2VQ3A 4KQGA 5A6SA 4P4SB 1T2DA 5M3BA 2NO4A 3I5AA 1ULHA 1V11A 3DDZX 5JE8A 4UM5A 4O2BA 2CXNA 2G5PA 1AN0A 1BDBA 1BDIA 2I4TA 4GLLA 4TV9B 4NXMB 1EK0A 1TTQB 2AUNA 3TNFA 2HNKA 5LZ9A 1ORWA 3ICOA 2BEVB 3WA6A 2Q29A 4WY8A 3NJ4A 4I5EA 4IX9A 1AA9A 2GBFA 2G07A 3EXFA 3IIEA 4MQFB 1NJ1A 1FLNA 2QAGB 3HZOA 3OF2A 4IYJA 3JPWA 1ZK2A 2J41A 3OEWA 2C83A 2DHEA 5IULC 3TCKA 4DB2A 3E9EA 4P0TA 5D6OA 3EPJA 1T5TA 2J9FA 2RJOA 2G36A 2GF2A 3SK0A 1Z6YA 5EFZA 3M70A 2Z8XA 5TGTA 5FOQA 4FMBB 3N8DA 5THKA 5DWQA 2D5BA 5FULA 4L6CA 3UAYA 1CUHA 1ISFA 1A96A 2IJGX 2IQ5A 3G9QA 4MO9A 4D57A 2BE9A 1P74A 1MORA 1ZNWA 1TKAA 5DCWA 5KSWB 2NW6A 3AEQA 4AXXA 2Y1GA 2Z2YA 1PJQA 5K4AA 1NOJA 1GZ6A 4H4CA 4EB6A 3E9MA 3UG7A 2B9EA 2IEZA 1NNUA 4L5CA 4E5NA 3WLSA 2QTRA 2XGGA 3I9KA 1QVZA 1VHJA 1FTNA 3CQ9A 4NP6A 2P69A 1EAMA 3OEHD 1TZCA 4PY2A 5KX5B 4DIBA 1GHTA 5FBVB 1KI2A 3IEVA 4XFKA 4FYMA 3UEOA 4YXWD 1HQDA 4S35A 3WRYA 1V0JA 4QAJA 1QS0A 4ZRDA 3CVYA 2QPAA 1QOPB 2NO1A 3IE1A 2I3GA 4ZANA 1VMEA 1E61A 5TARA 4OLFA 3OKPA 3MEQA 2UZ1A 1TJNA 2BDUA 2ZR9A 4KFSA 3HABA 1E8NA 5L4SA 1Z74A 2X76A 3G2JA 3HXLA 4OPMA 5IJ9A 2MYPA 2FPIA 4PYKA 1PLLA 4XYBA 1YVUA 4I8IA 3W05A 3OTHA 4CQMA 5KTNA 4PAGA 1WDWB 1NG1A 4BAGA 1EB9A 3NXSA 1YL6A 4DKJA 2WAMA 3IYLW 3AJRA 4PG8A 3IP8A 2HJVA 3L8HA 4ZV4A 4B71A 1IOWA 1MC1A 3LKVA 4K1LA 3WLLA 3FOZA 1XK7A 3Q8WA 4QOEA 3SEZA 2PLFA 4P7KA 1M2OB 2QYTA 1CUIA 3AUSA 3VDXA 4LZWA 1GM5A 4D8TA 4J2TA 3BDVA 3U60B 4Z4QA 1WHSA 3H5NA 2XA1A 5AHOA 1BA3A 4J1TA 5JMWA 1L1RA 2NZ2A 3W3AD 3H2SA 2R751 4NU5A 3V42A 4X7MA 5AR1A 2HR1A 5H7XA 1XXLA 4NENA 2O59A 4BHTA 4B2PA 1WB6A 4CM8B 5D51S 1JYSA 3UANA 3WGJA 4DJ5X 4UAJA 1ZJWA 1C4WA 2WWIA 3EIFA 4CODB 1NMQA 5F7JA 2G9UA 4NZ9A 2RD2A 2YNMC 3CE6A 4G84A 1E9RA 1RVDA 1L2TA 2HBYA 4X1YA 3LV8A 4ENSA 1RWWA 4RC9A 1IJEA 2Z5LA 4WACA 5JFOA 2AJBA 1ZD3A 2Z6UA 3GUZA 1PS9A 2QRNA 1YTUA 3LY8A 1GPLA 4FX2A 3LYHA 2O48X 3ZXIA 3CLVA 3P0HA 4DDUA 2H4ZA 2J4DA 4WUVA 4CT4B 5K3SA 3VR2A 1N1MA 1Y6ZA 3BA6A 5CFMA 2O8BB 5JSHA 2PGIA 3PNBA 4C2BA 3T5AA 2NO5A 4R2MA 3EQZA 3L6UA 3VR5D 1W0JD 4X0EA 1T4GA 5JD3A 1MEJA 1O9HA 1R7RA 2N47A 4LYDA 1ULTA 3RKSA 2WQ6A 4OMDA 1L4NA 2NYVA 3KKOA 1VE3A 2IDZA 4YDHB 3H1PA 5F64A 1QYRA 5E4YA 3R5JA 4PAOA 5JIBA 4K05A 1Z12A 4COOA 1VG9B 4C04A 1T4CB 2R6R1 1HX7A 4QGBA 3NBXX 3D6TB 4TTTS 4WXPA 2VHQA 4L4XA 4CHGA 3K09A 4ZHSA 4ZOLF 4LE0A 4KOEC 2IUFA 1Y33E 5C5EA 4XPIA 1QAQA 3H5AA 3LUAA 4D8UA 3QEMA 1MC4A 4GWLA 2Y67A 4YAUA 3O8LA 1IU9A 1Q0PA 3ZEAA 4PLPA 4BC0A 1EVEA 4GE0A 3RKUA 3FTFA 1TDJA 3ZTWA 4M8SA 4B17A 3KYIB 1IZ9A 1OYYA 2AOTB 1OI3A 3L8GA 5F76A 1DO0A 3C3PA 2FU5C 4TMZA 4XARA 2DX7A 1C1YA 5K99A 2WUWE 4LOKA 1XNGA 1V37A 2DKFA 3HM9A 1UPCA 3L04A 4C1BA 1H1LB 2WUGA 4ZPXA 3UWPA 1XPOA 2DR3A 4CM6A 1AZWA 4MLDA 1NR5A 2QW0X 1LDBA 1WXGA 4MHTA 1DTEA 3BWXA 3COPA 5CW1A 2HN9A 1J90A 1NF9A 2WKRA 1E2HA 4KBFA 4HVTA 1VIYA 2C82A 2ZYRA 1ZBQA 3ELBA 1U9YA 3C70A 1JVNA 3TLGA 4G5GA 5DTMA 3KWJA 2I6QA 4QUGA 1SBHA 1WHTB 5BSRA 2VHCA 3HC7A 3IR5A 2FUNB 3NWEA 4PYJA 3IKVA 2VP9A 2QRJA 4LZOA 4D46A 3AUTA 5BSEA 3SNKA 4Q19A 2VDWB 1BH6A 1I94B 2O1EA 1RR6A 3QF4A 3A6DA 3EZLA 1JECA 3IV9A 4P92A 4BNDB 3OT5A 1SCQA 2JFGA 3R24A 3AIOA 1D4AA 4ENWA 3KT6A 4XB1A 1GTMA 5JCJD 1QTQA 2DUJA 1HDZA 3ZWVA 1FY2A 2YXEA 4FPXA 5HKBA 3H2HA 4DCSA 1CUEA 2QVXX 2Y1EA 1OGJA 4M38A 3L0BA 2ALJA 4RJJA 4P5EA 3RRYA 1T3SA 1TQ8A 1JKJA 1K9VF 1U2DC 3I42A 3JTMA 4Y2RA 3INRA 5D1NA 1XD2A 1F0PA 4NZNA 2QQ5A 3ZY6A 4DTCA 2P68A 3Q0IA 4INOA 3E03A 5KYYA 4GDMA 4Z6KA 4YTEA 3K6SA 3GJYA 4RU1A 4XJVA 2NXCA 2EEPA 1RPNA 1LVUA 2CBZA 1MAVA 2J3MA 3FTDA 3F8WA 4JJ7A 5E95A 4XD2A 5I7RA 2GS9A 2C42A 3QNUA 3V4LA 1EXWA 2I7VA 5B1YA 4RJ2A 3AEUA 3NBUA 2X0FA 1NQUA 1CJBA 1VMIA 2QD1A 5FPKA 2G8LA 4C6TB 2DFNA 3BWYA 1L5KA 5FV7A 2PRJA 2B9VA 3CISA 3RG2A 3QYFA 1UANA 2GRUA 3SC3A 2A84A 2HL6A 3OM8A 2OV2A 5H3CA 1GFZA 3NC4A 4CMEA 1F1BA 4II3A 1YWGO 3R8XA 1H6AA 1YB7A 1A4IA 5FTWA 2IHUA 5EI5A 1B42A 1C2YA 1RRKA 4WK0B 2J46A 3RS0A 3E81A 1UPUA 4L8YA 1G5PA 4PRZA 5FFFA 4B3DA 2CYBA 4B6OA 1EFVA 1FYFA 3L8ZA 3SM9A 3QUBA 3VV3A 4XTCS 4OXNA 5CB6A 5JSQA 1U3GA 1DC4A 1U8FO 2O5RA 1E1LA 1CKEA 2WSSA 3A9WA 2HJRA 3EGXB 1HE3A 3ENZA 4IBOA 3U56A 4TMWA 3T7DA 4C0XA 4M9ZA 5FYDA 1C9NA 1I30A 4L76A 1XKXA 1EVKA 3CNOA 3VPGA 2EBWA 4O02B 3HR8A 4V0OA 4ZDJA 3EW9A 4LECA 1CC1S 2B8TA 2GK7A 3NV7A 4RPKA 1E4OA 2HSEA 2J7KA 1B8OA 1O4VA 2UUOA 3NYIA 4G0QA 5E6UA 4LJ9A 2K5UA 1I6LA 4DA7A 5HK9A 2V6FA 3JQAA 1HE5A 4HGPA 2BMFA 2I71A 4JVMA 4OHMA 3WB9A 1HNZB 5JLJA 1FNSA 1W0CA 4A3SA 4NI5A 1QP4A 4TTVA 2R44A 4RD0A 3SBDA 4Y1EA 1W5AA 4DQUA 2BFCA 2XE8A 3CLTD 3CUWA 1WX1A 5AKLA 1BMTA 3EVZA 1HE2A 2GAIA 1JHRA 1OLSA 2ACWA 3LI2A 3Q0EA 1FFXA 4UEQA 5I3CA 5DF1A 3E5MA 3N86A 4NNPA 1YBMA 2BL4A 3SZRA 4DMUB 4OHBA 4OHVA 4PSAA 5LJLA 2RCNA 2WAXA 2JAUA 1EXMA 1MENA 2B0JA 4J8PA 4OA8A 4YACA 5BQOA 5AW1A 1K4YA 3W5SA 5LVAA 5K8VA 1M34E 1US8A 2OGWA 3FHLA 4U2FA 4DWVA 2IEAA 4TTPA 4XX0A 4TMTA 2PH5A 3P1JA 2CJFA 2VA8A 2X9NA 3AJEA 9LDBA 1BXZA 3O0DA 4WFIA 1W87A 3D8BA 3GT3A 5FWXB 3CLRC 1OX4B 3L1UA 4D6YA 1MZVA 1RM5A 2A1UB 2OCLA 4TT3A 3PLNA 2IUYA 3VZDA 4D3ZA 5I8PA 1VKJA 4C0WA 4D0RA 7YASA 3AWDA 3MW8A 3N2YA 4NMHA 5K0LA 4O4HF 4LGYA 1FJ2A 5FNVA 5K01A 1GAXA 3DBRA 4OHUA 3X43A 3UM9A 4U7PB 2QTLA 2HRZA 3Q8MA 2M32A 4ZQHA 2FFHA 2HT6A 1WSDA 3K0AA 4I1VA 4ZVOA 4N8SA 3TUJC 4ZYVA 2DWPA 3D2BA 2B5VA 2XQGA 4M1EA 3V1KA 4BZZA 3IQZA 4OQFA 3QXSA 5MGBA 5ECWA 1SKUA 3VYWA 3CRZA 5IARA 1QJ4A 1RBZA 5CLJA 5KNDD 3FGPA 3QLEA 3R1IA 3CSUA 1Y1KE 2GERA 1NRIA 1SUWA 4JA2A 4TUYF 4WWHA 2XWQA 4YONB 5I7VA 1GL6A 3A2NA 4MTCA 4ND8B 2I7TA 4PBTA 4FSXA 1F2TA 1XG5A 1RXSA 1TIKA 2BGKA 1W6RA 3QSGA 1U28C 2A5YB 1YZLA 3KYJB 6NULA 2IPAB 4XI9A 1ZN8A 2G3YA 5I4KA 1SHLA 1MR3F 1XJCA 4ER7A 4O8CA 3V1TC 2A5FA 4KR0A 1KMCA 1BEUB 1H1DA 2G0AA 2HA7A 4OM8A 1JIXA 1JIKA 2CXXA 4IO1A 5J5CA 4EB3A 5CDFE 1FJXA 2H6EA 2V7TA 1N5RA 4FJ1A 5LD2C 1P4HA 2WZBA 1QHYA 2NZYA 3EFOB 2XGSA 4MGHA 5DIFA 2W2XA 3TK1A 3KZVA 3ZU6A 1I5RA 5IYZF 2VP0A 2FEMA 3DBHA 2AJLI 1I6KA 1DIHA 4QPJC 4GECA 1BWQA 3ESCA 3FRHA 3B8HA 5ALYA 2CJPA 4IVPA 2AN3A 2Z4TA 4JYAB 3FMPB 3OCCA 3E8XA 3P94A 4X1OA 4HNAB 2B83A 3D4OA 3PU6A 4DN6A 5GAJA 3ZCQA 5KVVA 5INTA 1DKQA 3Q7IA 4NU8X 4CV1A 4N6NA 4BXOA 2C00A 4ED9A 2YJGA 2FPMA 4KP7A 4N7RA 3K05A 1FPQA 4EGCB 1I2BA 3KL4A 3GDFA 1Z83A 2QMUA 4YFYA 2WJHA 3Q3JB 4HLCA 1XCLA 2HLNA 4GWGA 4EJ6A 2C07A 1R0ZA 1HQYE 3QKTA 2VG8A 3VU0A 1FSZA 5KNBA 1ARZA 2BFDB 2AFIE 5ALFA 3N0XA 3DM5A 3OBIA 1UBGA 1LZLA 2HRBA 4P4TA 4XX1A 1Q0SA 4IKPA 1P7CA 1FX1A 2QUHA 4CFYA 3COJA 1L5OA 4RZHA 3AV3A 1XDWA 4MWCA 1XUOA 4Y2XA 1U9JA 2WP0A 5EE0A 1ZJ5A 5JZVA 1QUFA 3ZU2A 3E27A 4HWTA 4HDSA 1Y89A 2XKJE 4YFVA 1DC3A 4DUPA 4KPFC 2IEYA 1P19A 4EFNA 1VB3A 4K0RA 4KIUA 5ENZA 3FYCA 4N3NA 1OI4A 1VCHA 4C07A 4FOTA 1ZEMA 1UP6A 3ANTA 1VKRA 1YGPA 1RAIA 4DLVA 1GCUA 1OXBB 2PQ0A 3Q5DA 1H4TA 1OT5A 2IYXA 2WM8A 3F2IA 1XE3A 2YWXA 3KSAC 4GPEA 1IY9A 4QTUB 1ZCJA 2BFOA 3RRJA 3UOWA 3ZHTA 4IHQA 4B46A 4CKEB 2QF7A 3EQ7A 3GRZA 3JQ6A 3GVIA 4NCHA 4UPDA 1BYUA 3WYNA 1NQTA 3S8MA 1CY2A 2D8AA 4P1ZA 3TQOA 2WD9A 3WFZA 2QVGA 4C0JA 4MWDA 5AUPB 3GGDA 1WXIA 3II6X 4C4OA 2HIMA 2AD5A 2FG7C 1KYQA 2I55A 1OH6A 2JIZD 4ZDIA 1BD4A 1UBCA 1VZ3A 4N18A 3BXGA 5AOVA 1TB4A 4FFLA 3FMOB 4C87A 1LS1A 1WDTA 2OV3A 1JILA 2F3SA 1KJNA 1L7AA 3QUAA 4Q7QA 1PHPA 3HS3A 1NRJB 3PEYA 5LP6A 1YRBA 2YFYA 5BV2P 2P3LA 5DBIA 5C32A 4XEHA 4CKBB 3ZR4B 3MGKA 1JVSA 5JU6A 1FFAA 1LA2A 3JRXA 2KBFA 2IRWA 3L7MA 2UYHA 4B31A 2WG1A 3ZVRA 1Y5NA 3IP3A 4J76A 3SBEA 4LRTB 3DUWA 1NGSA 3ZGNA 1T6YA 4EEZA 2CFOA 3H0CA 5U4XA 1WO8A 3QVGB 5I48A 1CEXA 5LZ8A 3V2HA 3D4LA 3THXA 2Y1OA 4W5HA 1U0LA 4YPOA 3KWMA 4XLZA 1IBKB 1FB5A 2XUOA 1MQSA 2Q5LA 1L4EA 1GILA 1QF7A 3UMBA 2X5JO 4MPRA 5BT8A 3NJ8A 3FPEA 1PWYE 3OOJA 2XHZA 4QODA 4H6WA 4L0QA 4DY6A 1OAOA 1EVQA 3HUFA 3DTTA 2QG4A 3V46A 1ZXBA 3DFKA 4Q82A 1N75A 1IIRA 1FTYA 3RVDA 3EXEA 3FUCA 4IIGA 2BBOA 3ROQA 1QP7A 4AJIA 1QIJA 2AJDA 4DRZA 1D1SA 3KR2A 1FFYA 5CX4A 4N3CA 5FXMA 1C4XA 4UASA 5IJXA 2A59A 5AJXA 1DEHA 5I9NA 1Y3BE 2XWJI 1XSEA 1UUFA 5JUWA 3DFMA 1XZGA 5BP7A 5IM4F 1JJ7A 1KWGA 1L7NA 4K9MA 4TQGA 2D0PB 4JBNA 5JNWA 4CCWA 1A9ZA 3OQJA 1EFLA 1PJ3A 5JTTA 1VBKA 2GZ2A 1Y8RB 1PQYA 3MD9A 4L2IA 1DKOA 2QK4A 1KXZA 1UZUA 3TOXA 3B2EA 4BBZA 1X7ZA 3KSMA 1ORHA 1Y9ZA 2HY7A 4YT5A 3LO5A 3LHDA 2OQVA 3ZBPA 4EX7A 5CCXA 3TKLA 1SZDA 3HCOA 4JLNA 2P4EA 1ZHOA 5K20A 1H3NA 1O87A 2IIQA 2QR3A 3KLPX 3MSXA 2YXPX 5JZSA 1CERA 2Y4NA 2YZKA 1G41A 4QASA 3SMVA 4HVCA 1H2XA 1WMEA 4IOLA 2BEUB 3WIVA 5BR1A 3Q7TA 1AXRA 3LVBA 4Z1OA 4UNQA 3ZX5A 3OZDA 1ADBA 5G40A 2ODBA 1PZNA 2OCAA 3QUSA 2TRSB 1Q91A 4TS3A 3TQTA 4HC4A 4AVYA 4ALIA 1HH4A 4QO8A 4O5OA 3LT5A 1A5AB 3NR2A 1DCFA 1P1BA 1GPBA 3AEYA 5K8UA 3IUQA 2I34A 3OSZA 1GQSA 2Z9DA 3DYVA 4P98A 3K70C 4O59O 3LP8A 5IX8A 2ONYA 4UD6A 1VP3A 4DV3B 1KI6B 5D7BA 3DO6A 1G20B 1OTXA 3M82A 3WGKA 2E5FA 1JQDA 4JSYA 5AVJA 1TVKA 2IUEA 4YPVA 1KDRA 3LHFA 3L93A 4BASA 4R2LA 2A0WA 1AA6A 3ZCRA 16PKA 8LDHA 1A9SA 2EWWA 3FCCA 3LOQA 5FBHA 4EBBA 1GITA 4QBFA 3AF2A 4KV9A 5AVTA 4U9IS 4ZT2A 4MRPA 1NN0A 1AHIA 1CDZA 2NYUA 4NDNE 4HT3B 1DEAA 2V7XA 2IEIA 1ISMA 2VUSA 2XLBA 3HB5X 5AK4A 5E4TA 2ZJZA 5KHAA 2A9OA 2WJWA 4RVOA 4MV8A 4AMUA 1NQVA 2CNWD 3DE2X 3JY6A 4G5FA 3HV2A 1XBTA 3WB1A 4BDTA 4MLPA 1EFRD 3GNLA 3WIDA 3P97A 3C1UA 5ILQA 1V41E 2APJA 3U9SA 1N3BA 1DLJA 3ESDA 1Q77A 3QE4A 5JQGB 2YYYA 1UZAA 2PG3A 1GPNA 1IPEA 1PHRA 2AG8A 3IBFA 3C15C 1U0GA 5AM5A 1Q22A 4NYMQ 3A9UA 2IDKA 4XB6B 3JQ8A 2W6NA 4ZRMA 4D4JA 1UCFA 3MGBA 1K97A 1AQLA 3L8EA 2AWOA 2XCUA 1HT0A 4DIOA 5TMBA 3VYSB 1FXWF 5EIBC 2OHJA 3FZNA 4HDKB 5BW8A 3TLKA 4EA8A 1R0KA 1U8CB 4C9BA 5H81A 4WNCA 1OKKD 2C88A 3LSTA 4Y3UA 4PG5A 4TVSA 1GRRA 1O94A 2YDXA 3M0EA 5L9AA 2TS1A 1CK4A 2WFLB 2C2YA 1J49A 1TLLA 1ZUNA 4ISBA 1SOMA 3PUZA 5ETJA 5H59A 5IAKA 3TRFA 5DN9A 2G0TA 4I36A 3TZEA 2CHQA 1DIBA 3DTVA 3WNDA 4FNOA 1Z0AA 3QA3E 5F5LA 1R0BA 2DFLA 4LUCA 2PSSA 3OQHA 3RWMB 3WHIA 1XDSA 2Y1DA 3CUUA 4CCYA 3EH1A 3CE9A 3M3DA 1XWFA 5HJ7A 5JBQA 3G6WA 2JEYA 2ZQYA 3RC8A 3CWQA 1QLHA 3SSMA 1LBIA 1W5FA 4U39A 5WRFA 4KMSA 1CR1A 4MVJI 1E3TA 2I1QA 1I5EA 4RVFA 2O1XA 3HCAA 3STVA 2WEKA 1U3DA 1U90A 2AQHA 4IZHA 3EA0A 3GZTB 4P84A 5IK2D 1JQLB 3O4VA 4R1UA 3IVXA 2VTBA 4P3OA 4FDUA 3HBAA 1HXHA 1FFDA 3LW7A 1E2MA 4QHYA 1H9BA 4A6EA 3B3FA 4Z51A 1WTCA 3P9KA 4LV8B 3G2HA 1EHYA 3OECA 1ND5A 4LX0A 4NE7A 4R3UC 5CTJA 3VPBA 5IJWA 1MEEA 3RYCB 3O94A 1M2HA 2BFMA 5JO0A 4MGEA 3HY4A 1M2JA 2RGCA 2FMUA 3H1EA 2GWHA 3ESQA 1MA0A 1GXSA 1PJ4A 3MYRA 5DGCA 3TR0A 1S4QA 3M9XA 4YYEA 2OOKA 1YB4A 2LCQA 3S1SA 3LKZA 2J0UB 2ZGVA 3SJAA 1W2HA 3B53X 4HNQA 2Z1MA 3VPXA 4RS4A 2W2LD 5EEHA 1D4ZA 1R6BX 3UK1A 1KYWA 3MJTA 1V9LA 2NV6A 2EG5A 1HORA 2PR7A 3OPYB 4S1WA 5DO9A 1JA1A 2A0FA 2INGX 3F3KA 1G63A 4UFOA 2YBDA 4E5YA 2R5FA 1VCMA 2ATXA 2OD7A 3PYXA 1XKQA 1W4AA 2WB2A 1DZ3A 1FFWA 3H1GA 1NIJA 3IAEA 4FT2A 4QU8A 1Z4JA 1NMSA 4ASUD 1E1CB 4FHFA 5A9RA 2V65A 2VK1A 4KN6A 4KPGA 4QGGA 4Z9FA 4DCNA 1Z73A 3VYVA 5DHUA 3FYUB 3LXUX 3CSSA 3NHRA 5JCOA 4C5BA 2D1QA 1DKMA 5EJ9A 1TJ3A 1D9XA 1N5OX 2MMGA 3TIGA 4CTOA 4BX9A 4EB0A 3RREA 4EUEA 4YQZA 2NXWA 1PWEA 4MS1A 4TXLA 1BQ3A 3C98A 3HJUA 3AR6A 3RYHB 4BQPA 1S8NA 1USGA 2LTAA 4S1VA 1IE3A 3T0FA 2HT1A 2HLHA 5FOSA 3KYCB 2Q2QA 2ZSUA 4OKSA 4JB3A 4QVGA 4UZEA 1XNJA 1IXYA 4DWWA 3OPXA 4OXQA 2BEWB 2XDQA 1E9CA 1XQXA 1XDGA 3VU9B 1JEJA 4PS0A 3RROA 2EBHX 5BV8A 1PR3A 3JD3A 1M2GA 4W5JA 2I80A 3OY2A 2V7VA 4MYUA 2M6KA 1UOEA 2PMKA 1U31A 3T3MB 3EEQA 5I51A 3OEEA 1I4TD 2DWOA 1G21E 5I6DA 4DDWA 1P61B 2AOVA 2HFKA 4P4UA 4PEVA 5F3WB 3PICA 2ZZMA 3WGNA 2I4OA 1VKNA 5AUQA 4OUDA 3ZDXB 1J8YF 3HRIA 4WCVA 4BX8A 2I2BA 4G8BA 4HLQB 3PHIA 1FMTA 4M4SA 3V8QA 1SPXA 4GR9A 1W30A 4JLWA 1AQUA 4MUMA 2E5WA 3QOXA 4OHWA 3VOBA 3QEAZ 5TDHA 2IZ0A 3A6ZA 4R4JA 1D5CA 1FQWA 3OLVA 5CVDA 4DILA 1AQNA 4QYIB 1P0PA 1MXFA 2I29A 2YHIB 2ZRJA 3GHYA 4L9WA 1SIOA 2Q3DA 1GQRA 2W48A 4Q1FA 2B8EA 1TJYA 1V2GA 5FPHA 3TR6A 5IKPA 4BX3A 1CZUA 2LCIA 4LI3X 5F23A 2VDKB 4N41A 3ZH2A 5IP5A 1N2EA 2REXB 2R8OA 3P2JA 2W8ZA 4IDBA 4TWAA 1ECCA 2XOEA 1T3LA 1KAHA 1YZNA 3ORFA 4A0RA 5FHQA 3ZCSA 4M87A 5LNK1 4DCPA 5JHGB 3AY6A 5AKXA 4LXGA 3LUCA 4QXOA 2WJZB 4C2UA 4IZOA 3EWAA 4XQ9A 1Q0UA 2X5NA 2WW8A 4HXGA 4ZQIA 1DKUA 4ONEA 3R76A 5IANA 3SJCA 2J3EA 3GFOA 3OKCA 3O26A 1X7GA 3DOCA 3ITEA 3UGQA 2RH9B 2RGAA 3PGA1 4G5OA 4YCMA 1E4EB 3WIEA 1F1JA 2Q4EA 2C0PA 1RWMA 5EJ4A 1U1EA 3KUXA 1F60A 1VLLA 3LKDA 1L7PA 2GEUA 4GVXA 4TRRA 4UJ5A 3RD5A 3SSNA 3VA7A 4R8SA 1T5SA 3EQ8A 1LRLA 4ZMBA 1TVCA 1AE1A 3OX2A 4CMJA 1TAHA 1LEHA 3PKJA 2PMDA 3OZGA 1ICEA 4DE5A 4GX0A 3WGUA 5CA1B 1GD1O 2CF6A 2X2FA 1XRQA 5J58A 2DC1A 4JI7B 1C1HA 4BN4A 5ES3A 1KDVA 4RJIA 4OQNA 1ORVA 2ONKA 2YOFA 3KO8A 3K53A 2ZBEA 1TAGA 4L07A 5FPSA 3IJEB 5TQ2A 1A7KA 4ZKDA 4OQDA 5IKEA 1VCIA 2VJNA 2FZ5A 5KDLA 4EB8A 5A9TA 3H2YA 4C7OA 1NVGA 3QVTA 1D2HA 3V33A 1RWPA 1SOWA 3BAZA 1QVVA 4YRQA 3TTYA 3UV3A 2BZ0A 1DX4A 4PAMA 4UMVA 3WR5A 1CD5A 5F1YA 3ZGOA 5CX1A 4NU0A 1WY5A 5HTKA 1P5FA 1SVOA 3BHJA 4GR4A 3RS8A 5LQSA 4B4OA 3T3GA 5KHOC 2WZQA 2V8BA 1NVFA 4EHAA 1ILEA 3KXDA 2EJVA 2QVLA 2ATVA 1RAEA 3VO1A 1ODCA 1O7JA 4RHCA 4OK5A 5BW4A 1D2NA 2FE1A 2HXGA 3NVMB 4EL5A 2UZ4A 3PYMA 5EJGA 1ZSNA 3BGVA 4ZVVA 4M7PA 4UJ3A 1P9OA 4B3HA 1H4QA 1QH1B 4Y0AA 2ZI6A 3VDNB 4EKGA 2PK3A 2OFXA 1T8TA 4AQYB 2P6PA 3MWGA 1K08A 3COVA 2FUG1 2W90A 3LC1O 2BGTA 1JFTA 3KOWA 3I9V1 3O9MA 3ZDDA 3PG5A 1HYQA 4GLOA 4TT8A 4FWBA 4C22A 4L50A 2HCBA 3GT4A 3K0SA 1YDHA 1SK8A 2H8GA 3ZE8A 1QE5A 3E8SA 4Q93A 1KYTA 4WRRA 4YRLA 3PXCX 5AKGA 4EY8A 1I6WA 3IAXA 4AG5A 2BJHA 2G7ZA 5HS6A 3RUHA 4KQFA 1ZN2A 2DTDA 3AIMA 3ZE7A 3QXCA 4C5AA 4PFQA 5LOVA 1KZ9A 1MNAA 2BH9A 1SELA 4UW9A 3JQEA 1GA6A 3EVTA 4D97A 2GARA 1YR6A 3UATA 3IP6A 1ZOOA 1M1UA 3HU2A 2OORC 4GH5A 2XCIA 4UVHA 2VP2A 3C3BA 1DELA 2R4QA 4MUGA 2FMKA 4F12A 4DV7B 5IUKC 3D7KA 1R16A 6YASA 3GCZA 3LG2A 3NB0A 4Q4HB 1JQ5A 2NPFA 3PUWA 4YMHA 1XJQA 2XHEA 1X2EA 3MBKA 4RDIA 2O7SA 4CVNA 1I2MA 5ALEA 4FOLA 1ST2A 3A04A 1QIDA 2NN3C 5IAJA 3U6KA 2DQZA 3OICA 4LNAA 4GLBA 5K3CA 3TZHA 4MQ5A 1GGEA 1SGWA 3C97A 3MWEB 3JWIA 2IY7A 4K0KB 2QV7A 3NTLA 1HV8A 3DE7X 1T3TA 2NSDA 4HQLA 2J3QA 3P9IA 4QYMA 1HWYA 4FHEA 4TVKA 2R11A 1L3BA 3G1WA 3NGLA 2F1JA 3TL6A 2CSXA 1M6WA 1PTKA 3PYLA 5I9MA 3GVCA 3PUVA 4X7BA 5AH0A 5JSKA 4FW9A 3VPSA 3AF0A 2FN9A 4ATNA 3BICA 2ODQA 2YIVX 5FBQB 1N8KA 2ZYWX 5AVVA 2EJUA 4YIKA 3RTCA 1KXJA 5HM8A 3W5JA 4QSMA 4FQ8A 3UMVA 1W1WA 4BJ6A 4RD3A 4EH1A 3ZQUA 3RYFA 3RODA 4OYRA 3KB1A 4ARZA 4QQNA 4L5BA 4BUZA 4K7JA 3OURA 4O8ZA 4AZWA 4EA6A 4EG4A 4RZSA 5A7GA 4O2BF 2FWBA 4FFBB 4GRIA 3W2HA 3TINA 4UM8B 4DR1B 2BGNA 1WKBA 1KK3A 2B4KA 4LC0A 4MJ3A 4A36A 2XUFA 1T34A 3QXXA 2H1SA 4Q9JA 3VR1A 2WHEA 3RS5A 4AULA 3R0QA 1H6BA 2ZSHA 3F4KA 1AUPA 2VHWA 3LVRE 1QLWA 3KEGA 4AP9A 4D2IA 3OWOA 4P32A 4GSKA 1FUYB 4IXMA 1GA4A 1VL5A 2IXDA 4I4CA 4LXYA 2CLDX 4R31A 4R84A 4UVGA 4OI4A 1YQUA 5HUJA 5KJCA 4DWJA 3KQSA 3TWOA 5JAIA 3RYCA 3MB5A 4FGKA 1Z82A 1AS0A 4GLFA 4MP3A 2C54A 3TBKA 3RGWS 1C8KA 2GN8A 4EQZA 2VYQA 3AJ9A 3QU5A 1DO8A 3REOA 4C0BA 2JLZA 3WK5A 4UU8A 3HB0A 4HWSA 1U7UA 2D0IA 4PC2A 2G5CA 3EQ2A 3CF6R 4PRLA 2FR0A 2JAHA 4K9OA 3JQ7A 2GO7A 4I4LA 2VP5A 1BS1A 3D64A 1PT9A 1OC2A 4C20A 5K6AC 2P5YA 3D4NA 4NBVA 4UE6A 2PU5A 4ZTZB 4ZYLA 2KX7A 3PA8A 3GT7A 4M83A 3WB2A 3GRVA 3I6MA 4CLOB 1UJ4A 2VUHB 4RADA 3LPNA 5A4FS 3KJGA 2DHRA 3PZBA 4R8VA 2KBEA 3BEDA 1PT8A 1Z2EA 2X6QA 5B53A 1CVRA 4RK7A 1HMYA 2JKZA 3RVBA 1T1RA 2O8CB 4R2HA 3ZK9A 3NTQA 1W5BA 2H5IA 3T06B 5FNZA 4XYLA 2H2HA 1TT5A 5TQ0B 4ZCIA 2ZXUA 1X8LA 2GM5A 2D0DA 3I1YA 5FD8A 4D80A 4EF5A 4YQFA 1G3UA 1T9AA 2W2NA 2P2DA 4OHRA 1RKUA 2RDMA 1JA9A 5FUXA 3ICPA 1B7GO 1WUHS 3KC2A 3TVDA 5CFOA 3REFA 2GKGA 1T8RA 2ZUEA 3GQBB 4B4WA 4MVCA 3K94A 5TQVA 2MR6A 3FKQA 2CCJA 1I51A 3LM8A 3EPLA 4TZTA 3UWKA 1J23A 3WWOA 1AMUA 4FIDA 1OE0A 1RZVA 4XWWA 5KNLA 2J3KA 1J99A 4WZZA 3OQMA 2A94A 4MDEA 2NLOA 2ZS7A 1YIDA 2BGLA 3AM1A 3L6OO 3RVPA 4AKTA 1EFDN 4MVXA 3W2EA 4IH9A 1JIVA 3RPEA 4N3GA 1OIXA 1UXJA 1Z5NA 1TRKA 3H4TA 4ZMSA 3VJMA 5A2QA 3HVHA 2LKCA 3F6BX 1PTJA 3OMWA 4O4LA 3PXUA 2FPGB 3AI7A 3KXIA 5EN4A 5LKRA 4CMGA 4KVGA 2C8JA 4X94A 3ZHQA 4Z0TA 3TJRA 1WP9A 3ITKA 4G09A 3H9GA 5BSGA 3CMMA 3U44A 4YEDA 1BAPA 3HJNA 3FF4A 4YUXA 3N5KA 2GK3A 3OC0A 1EBBA 4M0EA 3V80A 4Q1BA 3IMGA 3RH0A 4RTPA 3R7BA 3O7MA 4GMDA 3ZH9B 1QO9A 3C1AA 3CCFA 4BNJA 5IDVA 3MS4A 2Y27A 3W8FA 1LK5A 3KHUA 2P0YA 3IRVA 1KKMA 4FDLA 4OU4A 2JBWA 4Y2PA 4RIGA 2JJQA 2Q7XA 2YVLA 3B5JA 2ZPUA 4AU1A 1OBFO 3SNHA 3TFOA 1P1KA 3E2MA 3KXPA 3R2JA 1N2CA 4Q66C 3PRHA 3Q3VA 3U4QA 3VX3A 2O7NA 3PC8C 4MR9B 3UC5A 2QZ4A 4B4VA 3PDHA 3M5WA 1HL3A 3E0XA 3FF1A 3ND5A 2C5HA 3RAJA 4R83A 4KMMA 3CO5A 3STWA 3T7JA 3ZOKA 4BWVA 5ERYA 5E7MA 3B1WA 4DEYA 4KXLA 1TMYA 3PNLA 3OKAA 4A8TA 2H92A 4OATA 1C7IA 3AB7A 2ZTHA 4ER6A 3M1LA 1XQ9A 5COBA 4CTNA 4YS6A 3CG0A 2SCUB 2E6UX 3MOSA 3NWOA 4YJ2A 3G85A 4JR0A 2RHOA 3I2JA 1BKSB 2PRSA 1RRMA 4BNUA 4O29A 3PHBE 4MKHA 5DCUA 3EEOA 2P9YA 3BGIA 2IBSA 3SSOA 3UQZA 1GN8A 4CNQA 3V4ZA 5K4GA 1IY0A 3P45A 4KL8S 4KI7A 5FTLA 2JKYA 1G66A 2QL6A 1OILA 4OJYA 4ZVSA 2PNJA 2Q6TA 3LDUA 4LNUA 4NJMB 3G2NA 4NCBA 3FR7A 1NVEA 4BMOB 5C1DA 5LLSA 2MSEB 4JBXA 1YHYA 2NG1A 1A9RA 2YC4C 3R74A 1U6IA 4QEZA 2AYZA 1HMPA 4TV8F 1Y4SA 5F5NA 1XMIA 3S2GA 4YCNA 3KK0A 1IJFA 1QE3A 1YU9A 3MS7A 2WY2D 4HYTA 2JCXA 2XNHA 3BRQA 3FAZA 2Q3MA 3JD4A 2YV3A 721PA 1TM7E 3AY3A 4X24A 2CLEB 3TRKA 3MGGA 4TL6A 3DBLB 4YROA 5JAQA 3OZRA 4B3MB 5A9SB 1QDEA 5FWYB 2XODA 1OH8A 2Q21A 1NBMA 3W5IA 3UPUA 1U81A 5KEIA 1U04A 1ABFA 1NURA 1Y6JA 4BZWA 3X1JA 4UTOA 1VGRA 5T4EA 3WKDA 4IWNA 3FLMA 1WUTA 3GLIA 3FKSA 1UKVY 2GKSA 3BIXA 1AS2A 2VPTA 1JVBA 3H99A 3I28A 3IIMA 4CHTA 1EX7A 4C0HA 1U6JA 4CM9D 2YDYA 3VR6D 4D02A 2X8WA 1A8HA 3EZGA 2XOKA 3NJRA 4KQMA 3UICA 2GPNA 1HRDA 3RRBA 4QEDA 2ZS9A 1XVAA 3VGPA 3KALA 5JFGA 1Z29A 2F67A 3HDVA 3D1VA 1ULSA 3V8RA 3IUJA 3FPKA 3CW2A 1W19A 4DMHA 1I14A 1JP7A 2A5LA 2GAOA 4QOGA 1LNQA 2HSZA 2NAPA 2MR5A 2NNWB 4XUCA 5MF6A 3A1EA 2NXJA 1RQPA 5BXYA 4GZ6A 3HO1A 3W06A 6AT1A 1A2KC 1A5ZA 3C6YA 3BL6A 4YB8A 5BMOA 1FS6A 4WZAE 4KNYA 4A5SA 4AYXA 3EPHA 1XTTA 3PXEA 4P81A 3MMXA 1DC8A 4GOOD 1CR2A 2HCRA 1KYVA 2JASA 3EDOA 5H68A 3PWTA 2WWFA 4F2GA 2EG9A 1BFKA 2WU3A 2I76A 4KWTA 2CUZA 2FJ0A 4U3JB 5GWXA 4LSGA 1V7PC 5ITWA 2G88A 2PWZA 3K5IA 2VNJA 1G5IA 2CLSA 3GLQA 3KR0A 4AMGA 2WVJA 4GM0A 1QWSA 2BAGA 2HA3A 3ZE0B 3CZ4A 3DS8A 4TS4A 4ML3A 1AUQA 3DLBA 3LC7O 3AI3A 3GP5A 1DINA 4NYIR 2Y8EA 3BGDA 1XC7A 5LA6F 3HKEB 3B9QA 3DEKA 4Q4JA 2CDRA 3SCZA 2GFIA 4GSLA 3WV4A 4YT8A 1NJ2A 3SAJA 3MUEA 1DAPA 1YVRA 1Z34A 5EUQB 5E7JA 4ZEMA 3DNFA 1LJLA 4HF7A 4GUDA 4DR3B 1NLFA 3TLEA 4L22A 1SHTX 3OA2A 3W2IA 2RG1A 3QIVA 4OBBA 1T0IA 1BMDA 1TZMA 2PSFA 3UYLA 4KZKA 4KE8A 4BNWA 4ZI2A 2C4KA 3A4TA 4GX5A 4Q47A 4NECA 5H8WA 2G80A 5CH5A 1XTRA 1JALA 4JFAA 1QBKC 3HCCA 4JXXA 2FZGA 1N9KA 4JGIA 4YCDA 3I12A 4NV1A 3AHDA 3K35A 3KJZA 4LYJA 3DP7A 4PO1A 4YT4A 1B3BA 4UUOA 2V5UA 1R15A 3MD0A 3DV0A 4U8GA 5LCXA 1O0CA 1YZVA 4Y6QA 1V4VA 3QMPA 4JJZA 4RYLA 3VU8A 5F7OA 5JD4A 5KPJA 6Q21A 2DM6A 2F3RA 3I34X 4KE6A 3JAKB 4II2A 5KYVA 1XZHA 3V97A 1WW2A 1E3IA 1RYYA 2O8FA 4RH0A 2R00A 2VCYA 1MUUA 5FI0B 1TO2E 1W49A 2DFVA 2OZKA 2VLBA 1KH1A 3SYNA 3IVAA 3PBKA 4H9GA 3KE8A 1GLGA 1VI2A 3ZEIA 4D7AA 1IEQA 3A58B 3CRNA 4RKFA 3OETA 4D9GA 4WLNA 1JF8A 5B7NA 4PO3X 3ZLJA 4B1FA 2Q4OA 2IYPA 4UBMA 4ER0A 1PR0A 3IUEA 4OFXA 4CF3A 2I66A 5H0IA 4RIFA 3RRXA 3FFTA 5AKJA 2ZEJA 3LBNA 5IHXA 1DV1A 3A06A 1TC1A 1EUQA 1B00A 3CNHA 4FFPA 4EG5A 1DQPA 3DLCA 4BMVA 4KXYA 1G4HA 4UKDA 2AFHB 4XCQA 3UMCA 4AZTA 1SBCA 2ZAIA 2Q5CA 4MCAA 2PPVA 4R7GA 5FNVF 1I2DA 1XWWA 2LW7A 1J97A 2TMKA 3RU9A 4KV7A 2MINB 5DRYA 3LZCA 3QKSA 3ZBTA 4CM7A 2O2SA 3HKDB 4MWBA 3GWGA 4RMJA 3KOZA 4WZBB 1E1NA 2VO1A 3UAOA 3TB4A 2JH9A 4XQEA 4A23A 2JD0A 3PT5A 2QM7A 5FOWA 3T5MA 3PX3A 3NVKI 3NHJA 1QWOA 2J07A 3QPUA 3WG9A 3SLRA 1F06A 1TCVA 1X9IA 1JV2B 2ORIA 2VCHA 3DJYA 4PZUA 5C8YA 4KPEC 3M4YA 2XUIA 2BGMA 1IN4A 1BE6A 1J56A 3LHKA 5DMHA 2VZLA 1HOXA 1BHQ1 1OYWA 2AF3C 2XIQA 3PP8A 4EYSA 4TLEA 4CI0B 3Q7SA 5IJZA 3EXHC 2MMCA 4OV6B 1X1EA 2OBBA 3C7CB 2E82A 3CPHA 4CG2A 2PRYA 5TB5A 1MHTA 1Y9DA 1VG0B 1WS6A 8ADHA 2WUVA 4DLXA 3EC7A 1NFFA 4GBED 4HZUA 4FXOA 4BGDA 2R86A 4PXYA 1X42A 2B0CA 3PSHA 3NC1C 1Y82A 1LJUA 3T7IA 2BMDA 2RAUA 4UMFA 5FQOA 4TMFA 1JLSA 2ONZA 4KO1S 1S8AA 5A6SB 1MO5A 2XIJA 3P9NA 4PC3A 5E6RA 1V11B 2QU7A 1BYIA 3OH8A 4GI7A 3SYKA 1BQEA 3OE7A 4RD1A 1ECPA 2PEZA 4MW9A 2J5KA 4X1KA 1WW3A 4MKGA 9ATCA 4RVCA 4G4SO 4Q05A 1GUBA 1P2VA 2ZSBA 2I33A 3L5KA 3GUVA 3OEYA 4EHDA 5C2JB 3GZ4A 1Z47A 3IOBA 1CR4A 1NSTA 3C8DA 1PZEA 1OPRA 2CVFA 4A73A 3THYB 3EXFB 2R5NA 3LU1A 3C0KA 5GY7A 1DRUA 1H6CA 5DNVA 4RTMA 4JC8A 1OFGA 1VJ5A 2OXCA 1KVRA 3P2EA 5B7QA 3F4LA 4Q3LA 3IURA 1N33B 1G60A 3TF5A 4GDFA 3ILXA 2FMFA 5CB8A 5JZMA 1YE8A 2XUPA 3BCHA 3IPCA 1N1DA 4O1IA 4CMBA 4YP7A 4BGIA 2KLBA 4HP8A 1R9NA 4F2WA 4FMDB 2WA2A 3G2MA 2XA2A 4BTEA 3ND6A 4K6CA 2OCXA 2Y1CA 3CURA 1TPZA 1CY6A 1ATZA 1BU5A 5GOZA 3AEQB 1I9GA 1XTVA 5LU9A 3BWMA 1JEAA 4DBLE 2P1ZA 2Y0DA 3HNOA 1SULA 3TQCA 4JGGA 4EB6B 1S7CA 4MUAA 4LE1A 2JI4A 2PUGA 1PQPA 3BIOA 1XK6A 2R6DA 3ICWA 4GYYA 4LHEA 3B78A 5GM1A 2L69A 1YBAA 2JNWA 2R85A 1GSIA 3EIXA 1DFIA 3PHGA 2ZYUX 2P75A 1ZD2P 5CW2A 3EG5A 1SIWA 2FPSA 1L7XA 1KFBB 1YKGA 3PC6A 2YS7A 2PV7A 3RIHA 4RESA 3O92A 4K6GA 5THQA 5EP1A 1NBHA 1CF4A 3T95A 3ZWQA 4UOEA 2GZRA 3KYDA 1UXGA 3R0XA 2O50A 3CB4A 3FOCA 2CN1A 2JGRA 2XEDA 3NUQA 2GO1A 1ODKA 1VA4A 1A95A 3DDSA 3PITA 4ID9A 4NPCA 3C45A 1FDRA 2UZ1B 5JVDF 3T7SA 4D6PA 1BDMA 2HK7A 3QKRA 3SWWA 1M3SA 3EG9A 3I5UA 1NVXQ 5KTYA 2FPIB 1I0IA 3IALA 1MO6A 4Z8YA 1NX6A 5DN6A 2HJHA 2QD3A 4HUQA 5AP9A 3ZY5A 2J9GA 2DZDA 4D98A 5ADVA 1HF3A 3LQ2A 4QNRA 3UJCA 3IAUA 1XROA 1E5XA 4MB0A 3IAAA 1UMBB 3KJQA 1LRJA 2D3TA 3NV9A 5AUNB 3EVFA 1YZYA 4MGYR 2AI3A 1ZN7A 4NATA 3TX6A 1K4KA 3RHFA 4A91A 5IJAA 4I2VA 2IOFA 5J2TF 1Q0HA 1RU3A 3GL9A 1BG6A 4IDFA 2Q07A 3K72B 3CU5A 1L4HA 5K0JA 1U9IA 1QCYA 1IHXA 4BO2A 2XMBA 1YR7A 3W6OA 1Q0QA 2BW0A 2I8LA 2PWYA 4QUKA 5F1PA 4BNLA 1FYWA 1JMVA 4OJKA 3NUGA 5EIFA 4HPXB 1VECA 4MW0A 2W6CX 3HDQA 4Q3CA 5SYMA 1I32A 1DOAA 4NENB 1D1PA 1ODFA 3ZLBA 2DCUA 4PFSA 3HJHA 2WIAA 4ND3A 2W70A 5I4IA 5K0ZA 2NZWA 2GBIA 3QNMA 4F6LA 5JJLA 3H18A 3LUHA 5H4HA 1I5OA 1N9GA 1AGPA 3C8HA 3WSTA 2VYVA 2G1AA 2NUTA 4YP9A 3AGQA 3ZYZA 2Q3HA 4X1YB 1PJTA 3H9BA 4UEKA 4KNWA 3IEIA 3NHFA 2YXBA 1HYGA 2EJBA 4KPYA 3MWJA 2F3QA 2XZDA 3WRXA 2W6ZA 4HQ6A 1P1IA 4L28A 2AR9A 5DEOA 4R9SA 3X1DA 3ICQB 1T6ZA 2XY4A 3USCS 4HBGA 2GBGA 1E6KA 4J0HA 2BGIA 2E87A 4X8LA 3EHDA 5ADHA 1X1RA 3PVCA 1CY1A 4QGHA 5EUCA 2JIQA 1G1AA 3SR0A 5BXQC 5K09A 1XVIA 5FF9A 5BVGB 4OSEA 2O05A 3NYWA 2C3OA 1A7AA 4GMXA 5ALMA 2OZVA 5FL7A 1V2HE 1CFZA 3KV3O 3DGFC 4ZVTA 2AX3A 4W63A 4ZQEA 4D74A 1XL1A 4B6GA 5IVPA 5JAPA 3I3SR 3KQHA 1KI1A 4QPCA 4I9UA 2IU3A 5B58C 1X15A 2GFQA 1KL7A 4KCGA 2RGUA 1NULA 1ZO8A 2PXAA 5TLSA 2B5OA 2WC1A 4JUBA 2YN0A 3AU9A 3FYDA 2VH5R 4V39A 3UT6A 2WPDA 1Q21A 3WHKA 5F2OA 2AKYA 1BEEA 1CQIA 4S04A 1QIFA 1LDMA 2PJDA 3UPTA 1NASA 5ED0A 1TNDA 1YSCA 2A67A 3NDJA 2VP3A 4K2HA 4XPIB 4NK5A 5BSUA 3ZY4A 1UKEA 3KBOA 4DLKA 3QEMB 1T0HB 4EGQA 3HN7A 3V2UA 2YJ6A 2Q7DA 1INLA 2WTNA 4C6SA 4DCTA 3VZBA 4F84A 4DDTA 3LK7A 3M5DA 1NI5A 1WLSA 5DYIA 2CLMB 2ACVA 5EGNA 2C5EA 5ALDA 5JRJA 3DLPX 5KI6A 1QX4A 3L0SA 3PEVA 4CMCA 5HKKA 3GBVA 1BVUA 3DL4A 2RGNC 2BTQA 1XTBA 3P4YA 5EMLA 3EQ6A 1YQXA 2MYNA 3AGPA 1LS6A 1UK6A 3OIUA 3IV7A 1I3CA 3PENA 1NMYA 3TNLA 5LM3A 3GOQA 5JCXA 3AERA 5FH9A 4AY6A 4DNQA 4PGMA 1S9HA 3TLGB 5BV0A 5T67A 5EWJA 3TB6A 1DJQA 2MYUA 4HMQA 3OLYA 1FFSA 3ZWPA 3H1BA 3LHIA 4URVR 3S44A 2XUQA 5BSKA 1ZJYA 4XJSA 1NBWB 5NLLA 2FEKA 2DJ5A 3HFJA 5A02A 3QF4B 4U1RA 1DIRA 3B9BA 3M1IA 4EW6A 1UMCA 2HQSA 2VPWA 4GXRA 1BN7A 3HLYA 4GOND 4UXIA 4ZREA 5HMMA 3WRYC 5JATA 4I6GA 2DG2A 3QUCA 2NZUG 3P26A 1F8GA 1M6NA 2B94A 3DKVA 3D6AA 5B4TA 4GZMA 4Q1EA 4NE2A 1YBHA 2K7ZA 4E70A 1JKJB 3GGJA 1Z2PX 4F3KA 2C1ZA 3CCBA 5U4QA 3GLGA 2LXNA 1Q44A 3HA2A 4LJ5A 4XGQA 4EABA 1N8NA 4JLBA 3ZDBA 5KYYB 3V8BA 4N7MA 2EFHB 1RFLA 2YMPA 1NYTA 2D7CA 3G23A 3O4GA 3CF0A 3NP9A 4INAA 2FSVA 1O97C 1LI5A 3SZ3A 2QXUA 4YR9A 4LA4A 4KSCA 5E3IA 5JR3A 2A78A 5DV9A 3V4OA 1D4FA 5C1BA 1S96A 2FN8A 3AEUB 1GOTA 1QPBA 5I4CA 4LZLA 2ZYAA 2WJJA 3L8CA 2G9RA 4ARIA 1T13A 2ZUFA 1HT2E 1OWMA 2P3SA 2FF5A 1KAGA 2DSTA 4TQUS 3ZYCA 4RKQA 2X1MA 4B3CA 3LCMA 2ZUBA 3TVYA 4YGXB 2AGVA 2EC5A 2ZB3A 3T3EA 4IGAA 1EAYA 4KK3A 3LMKA 5EQTA 4CR7A 2LVBA 1I7QB 2PT5A 3KKNA 3KU4A 4LJSA 3N0RA 5EIXA 1Z6TA 4RF5A 2AMYA 2P4UA 3LUFA 4Q9HA 2F43A 2AJCA 3IFSA 3RB8A 1E66A 1HC7A 4ETIA 4UHBA 1RE0A 1EFVB 4F2HA 2J9YB 4BJHB 1KOGA 2TMYA 3K8YA 3CLUC 1TUGA 2CNNA 3OAAA 3B1VA 2ZTLA 3WIUA 2IEDA 2PT7A 3J81k 3NH9A 3MJCA 4E5DA 3F4BA 5T4FA 3BM5A 2QUBA 1PVVA 4BMNA 1MVLA 5IAOA 4DMFA 2RAVA 2FK8A 2V6BA 1H4VB 2KJQA 3PT9A 4LJLA 3NHUA 3KL2A 4LPKA 1GTZA 5E6UB 1G6Q1 1T5BA 1VE6A 2Z4RA 2GCNA 3DW3X 2PVPA 3JQAB 4ND6A 5SZJA 3CA8A 4CM1A 3AHFA 4OJTA 1MXHA 2II6A 3KAKA 3TQRA 2O0KA 3TNJA 1O6GA 3HXKA 3I6ZA 3ZGXA 3HTXA 2BFCB 1D6JA 1FP4B 1U2RA 2QM3A 1DS6A 4EYEA 1MEOA 5P21A 4CV0A 5EZQA 1KSFX 4E22A 4KLNA 1PD1A 3UWSA 1S9DA 3MCAA 1QZZA 1OLSB 1FFXB 1O89A 4OOEA 5BQ5A 4ZYYA 5IKXA 3UAZA 3OTGA 1CEQA 5J4LA 3QNWA 4W99A 3ZE2B 4KVAA 3TN7A 1YGYA 3FNHA 2F8MA 4YUWA 2QVBA 1PNTA 2XCRB 4FFMA 1P75A 3KR9A 1M2NA 1KZGB 2Y1WA 3KZNA 1ESDA 1QYDA 3WL8A 4URXR 1US8B 2VRBA 3MMPA 2H0QA 3QHQA 3AXTA 3QW4B 4IJ5A 3B9PA 5ITVA 3DF9A 3TX2A 5IXYA 2VXBA 3ONEA 1X0XA 1E9EA 5KVSA 4QBGB 4XX0B 5B55A 4R9NA 5ISMA 1UP7A 2D1YA 4ZYZA 3EUWA 4GP7A 4UCFA 1FU4A 1UQTA 5DLEA 3EGCA 5AK0A 4JI5B 3N05A 1VYTA 1Z33A 1E7YA 3EMVA 4GPTA 1WXEA 1ZKMA 3GBPA 2PZEA 4KLZA 3ZKWA 3CVVA 3PHLA 4DANA 4S0XA 2GFHA 4W1QA 3S2SA 5CFNA 2DGDA 4Z4HA 4Z1MD 2ZSFA 5AXCA 4G07A 3DXXA 1H2BA 2PDAA 5UKDA 1O1YA 2HZ7A 4MITA 3WMEA 3SOZA 2RAPA 2A5GA 2H4JA 1X6VA 3EVBA 4HJXA 4DLTA 5B6PA 1NL3A 2DB3A 2Q5QA 4GQIA 2FW1A 1VPLA 3KPJA 3N76A 4QXQA 1RC8A 2UYOA 1GO2A 3L5OA 1MRZA 5K2MA 3UB2A 4B9EA 3HR7A 1F2TB 1CP3A 4H1HA 4EDFA 3C2QA 4KQKA 4DSOA 3MJ4A 3I04M 4PS1A 3LT0A 4MUXA 1XAGA 1JEQA 4P3PA 3W0LB 1DDIA 4XB2A 2X9QA 1WSWA 2Z5VA 4JJEA 4XIIA 1HNXB 2JGDA 2GNPA 3TVTA 3HM2A 5KJFA 1FYEA 2P78A 1SQFA 2IS2A 3ETJA 1BGXT 2FX3A 4K6KA 4WK2B 4C21A 2W43A 1IY8A 1SCUA 1SXJE 2GYYA 2R8XA 2XWPA 2YIMA 3F90A 3TD6A 3VU3A 1KI3A 4D3DA 3FFAA 1EMDA 5LYYA 5ALZA 2OCPA 3EZFA 3M9LA 2ADMA 3DBHB 4LDZA 4RWZA 4TSFA 3BGOS 3DQQA 4X6XA 5EA2A 1QO0D 4A26A 4BLUA 2YINC 1K7XB 1I3NA 1KPHA 1SBQA 4CGYA 3HV0A 4DNPA 2RGWA 3FM9A 1NC1A 1SMKA 1YRHA 3CEJA 3WVNA 2YN4A 2PHZA 1YUNA 4WY5A 5JJCA 1W4BA 3HGQA 3HUDA 3N3AC 1E2DA 2VSNA 2JK1A 4ZU1X 5C51B 4BXOB 4OQQA 4Z9BA 3KPWA 1Q5PA 4GL2A 2DSNA 1X1BA 3EIOA 2FSGA 1MFZA 1L5HB 5EIHA 1SXHA 2QU8A 4TVBA 5FFMA 1V71A 4EYOA 1XALA 1B0ZA 3IVGA 1N2CE 4CMEC 3B20A 3V3TA 1U2GA 2WU8A 1ZK3A 1MW8X 3KKKA 2OBMA 2OXRA 5EJFA 2NVWA 1RI2A 1EP3B 3GRYA 4HRAA 4A9AA 3UUEA 2HDNB 2LGJA 1IUNA 1IK6A 4L72A 2XKAA 3FFXA 1FQOA 2CLFB 2XSZA 2J59A 3G79A 1Z3IX 2VAPA 3GW8A 1UJ6A 1SUAA 2P11A 1PJ2A 4LZPA 4G1FA 5HG0A 3SZMA 2QMOA 4Q4CA 1ZESA 1W93A 3SZGA 5KSZA 1XLVA 4B82A 4DS3A 3AYXB 4Z8XA 2ZG6A 5IH7A 3HP1A 5IZ4A 3DHYA 4CEJB 4EG1A 1ZC3A 4ZCPA 3U19A 1PNRA 1FP1D 3CRQA 1CUZA 2FG6C 4XWYA 4X00A 2WM2A 2ENWA 4WUTA 3GN2A 2O19A 3FPLA 1IBMB 3TW4A 1KC1A 4IDPA 3D2CA 2W9XA 1EQ2A 2ADOA 3EVAA 3QVMA 3SE7A 2BE7A 1TUIA 2ES4A 4M9CA 1T3HA 4RSMA 1P7VA 2NSYA 2VJYA 3AYZB 3QLJA 3BE4A 4HB0A 4MR7A 2JLWA 3FBWA 3C14C 2O7VA 2O0HA 9MHTA 3LPDA 1YRWA 3EUFA 1HKUA 3VH3A 2ICAA 1NU6A 3P9ZA 1G7TA 3Q7PA 4ZOAA 1LSUA 5HGJA 3RVKA 4Q7EA 1KQ3A 1QGUA 1Q92A 2NQ8A 4LY9A 5DOVA 4E12A 4E11A 4KQJA 5JEEA 4G65A 1NE7A 3KVYA 4Q6BA 2P2CA 3NAQA 1F6WA 4RIIA 1C30A 1IBRA 1JRLA 3D54D 5JXGA 1OXXK 5DH9A 1IM2A 1MO3A 1YXMA 3M4JA 1NUPA 4FZ5A 1PJCA 1AN9A 3HHEA 4IV8A 4L4ZA 1MJFA 2VC2B 3NDRA 1RHQA 3ROFA 4YMWA 2B4RO 5LP6B 4IUYA 2ZU0C 1G7CA 4W8OA 5DNUA 1AMNA 3EOBI 1EK1A 2R4TA 1J21A 4TX1A 4XQ0A 4OMCA 4IAOA 3OJCA 3I61A 3IDZA 4C4ZA 4P3XA 4RORA 1ZLYA 1S2MA 4O1HA 4HRVA 1UBUS 4CDNA 4JLSA 4JJKA 2Q9CA 1GU1A 1J06A 2OYRA 1TC2A 3S29A 2H4XA 3L0ZA 3RIYA 2NTJA 5JJKA 4ZAXA 2YWBA 4DCGA 1QFSA 2W2TA 2YZ7A 1Z0FA 3PDCA 4YAGA 2WR8A 2XPCA 1IUPA 1UXIA 2IUTA 2M6SA 2XCQA 4QHTA 5E8RA 4ZT3A 2H54A 3UAGA 4P54A 5CD1A 3QVLA 1LSSA 2O8VA 2CW5A 4GQBA 3U7JA 5FTMA 5HILA 1ENYA 1LW6E 3GFGA 1GNVA 2ZB8A 1RJFA 2HLDD 4YJ3B 3TRJA 3HG7A 1WM1A 1SEPA 1QOZA 1UBNA 2ZRDA 3MELA 3JQCA 4HSEA 4GS5A 1NY5A 2VKQA 2VTEA 1Z4OA 3ZNNA 3BL8A 3TTSA 4ZCTA 2NP6A 1JFLA 1XAHA 4RCYA 3HQ4O 5A4JA 1J5EB 2ZITA 3PHJA 4JS0A 3H8VA 1F8UA 3R5TA 5KYWA 2FUKA 3LE8A 4MKFA 4DLYA 1Z7WA 4IUDS 4KAAA 4P3YA 5BNIA 4NBTA 4L2IB 3LNTA 2WV7A 2ZJ7A 5T4HA 3U3KA 3UVEA 1EG7A 4J0JA 4YRDA 3HADA 1MQ8B 1X7ZB 3JVDA 4WK6A 4RV4A 2A1TS 5LLTA 3EY9A 5JYCA 4MHSA 3BRSA 3WKAA 2HK6A 4DR7B 1VKZA 3AP1A 3GLHA 5AT1A 5B4VA 2RHRA 5B3KA 4KK4A 2JAQA 1NRWA 4MS3B 4IX1A 1L5VA 4RHEA 3FSJX 4YIHA 4RVSA 3PNVA 1WE2A 1YRAA 2QLLA 1LBQA 4QG7A 3QVVA 3VFDA 1S01A 1O8CA 3RASA 2EV9A 4KFTA 4LQDA 4Y2SA 1I7PA 1QFJA 2RKOA 3H3FA 1GTJ1 3FCOA 4NNJA 4EFMA 1XP8A 3VHLB 3L0PA 3EN0A 1E0DA 2CE7A 1JU3A 3RTBA 1U3WA 2J5BA 2QENA 5CNIA 4QVKA 5E7QA 3U81A 3UV6A 5KMGA 3I6YA 4ENUA 1FUEA 3K0EA 3HLKA 5ICMA 1E7RA 2NXEA 2OSBA 1TKBA 1UBHS 2H00A 2E4ZA 3OIGA 4Y2TA 3EZXA 1Q12A 1T9BA 1Q2XA 2X3YA 1MGOA 4CE6A 2XNSA 3IDSA 3K96A 4R8MA 5JRZA 4OX9B 1NW7A 3CO0S 4BMPB 1D0VA 5CYPA 4YRGA 4BNYA 1T1EA 1TVKB 2ETVA 2YMLA 3IE0A 3V7UA 5BV7A 4R41A 3PQ2A 4F38A 4DA9A 3MQ2A 1XHFA 4MLCA 1GPMA 1OXKB 1GPWB 3ETEA 4CLXA 4D9BA 3ZI4A 3E1SA 1CR6A 3P9YA 2HU8A 4ENQA 2UUCB 3BIFA 4C08A 3HO6A 5DM70 3E82A 4CQMD 4ER3A 2ZRPA 4F5WA 3M1AA 4LJYA 4UD2A 4D3FA 4AB1A 4F5EA 3VKVA 3IKTA 3U4MA 1VSUA 3LK6A 3BF7A 4YC7A 4OB6A 3KETA 1T6XA 3AXSA 4PICA 3R5HA 4I46A 4UU7A 5AKYA 5B7GA 3BERA 1WZCA 3BN3A 1LW7A 4M46A 1SVMA 2I3DA 1T26A 1AF7A 3X1KA 2R4UA 1A9OA 3OTWA 5EQJB 1PYDA 4EELA 1DJOA 3GFTA 1SQ5A 4KRGA 1NATA 1I1QB 2P9HA 3R6DA 3W77A 1AKVA 2OZPA 4F8YA 2FTKE 4ZT5A 1QUEA 4GYKA 3IHTA 2BKXA 2RHGB 4RUKA 3JQ8B 5SYNA 5T64A 2W71A 2C8VA 3W6PA 1AB5A 1WABA 2VJBA 1QYCA 1U3VA 3OVMA 5EKUA 3UB4A 3VSCA 4AJOA 2YY5A 1XZPA 4L4RA 4BFCA 5IMSA 1VI6A 2ZW9A 2HGSA 3PE6A 3L7BA 3NTOA 2YNMA 1HDGO 4YAFA 1W85A 1TA9A 4HRXA 1NQAO 3AB8A 2P79A 2RGEA 3CLUD 1JIQA 2Z56A 1YZGA 4JIGA 2OFFA 2XKKA 1IJKA 1BJKA 1GZVA 1QQ7A 1XI2A 1XTUA 3BEOA 2BMEA 3K9QO 3Q9LA 4MEJA 5AW3A 2GYUA 2XCTB 3M34A 1ZW1A 5AVWA 2OQIA 3RAEC 1PGPA 1MDBA 3M7IA 3N3BC 3TAXA 4Z4EA 2AT1A 3ANYB 1G98A 2WYIA 3IB6A 1RT9A 4KTTE 1GKUB 5ALSA 1JZSA 2QHXA 3I64A 3MQFA 4Z4IA 1ONPA 1V3QE 1PW5A 3L7CA 4IICA 4X8HA 4CCYB 4FJ0A 4HNGA 2BUBA 2C98A 3VR2D 4M86A 4A0QA 4D0LB 1RJDA 3FSGA 4GMHA 1XLTC 3FYHA 4OGKA 3GEIA 4IQ0A 2Z9CA 3KX2A 521PA 4AO6A 4LOJA 2FMIA 1SPBS 3C5HA 4MYRA 4YJFA 1IK4A 2QL5A 4JKIA 1GA1A 2Y93A 5ITZA 3BFPA 3FCUB 1TJPB 2R6ZA 4IFTA 2VTBB 1RMYA 4HOYA 4WCFC 3IUNA 5C8ZA 3PZRA 4BVFA 1N6HA 1A72A 1YNOA 3AB3A 4LRQA 3S1AA 2NM0A 1NW5A 1IATA 3BMQA 1GZ7A 2JIRA 1YS7A 3L40A 3ZE1B 4AO8A 1KC3A 3NP7A 1CQJA 3CUEF 2OGSA 1DAMA 1NLMA 3ONNA 3DV2A 3ESBA 3HDYA 4V02A 5ALWA 1L9KA 1QZXA 4KH1A 1JHZA 5FYQA 3VSBA 4E7PA 5GJBA 1GXSB 1H0SA 1QYWA 4J6EA 1S2OA 1IEWA 3J7TA 5DYTA 5HBGA 2ODEA 3ZD8A 3PUJA 3ZK7A 4A82A 1TAUA 3FUXA 4R9UC 1UM8A 2IY9A 4RSHA 4XIFA 3QIAA 1J0XO 1SKYB 3UGKA 5A4MS 4IEIA 2CDAA 1WULS 1R4MA 1U99A 2HWYA 2XRZA 4HZGA 4BBPA 4G5XA 3PUHA 3R3JA 1PWXA 2JBAA 2V7QA 1QH8A 3FW1A 4DCCA 4AX4A 5CBKA 5A3RA 1WJGA 1UPTA 2EEZA 2QYHA 3NMUF 3OLXA 1AK2A 4QECA 2Q9UA 4E0BA 3F5MA 2W98A 4MI6A 3ZHBA 3M4XA 4Y6PA 1KJYA 4NCXA 5TV2A 2OPHA 4IDGA 2EOAA 3KWFA 3P4XA 2HCJB 2O3UA 4XDHA 1OXMA 2VAMA 4CI9A 5KIAA 2IEGA 2CMHA 3B1YA 4GW3A 5BN5A 5D3MA 1KMHA 2H48A 1Z2NX 3UKJA 3RT7A 2H9YA 2AEEA 1H6DA 2AN5A 1JDVA 4OGLA 1Q6ZA 4DLSA 5F9FA 3HVKA 1K8ZB 1NOKA 1BU8A 4MS1B 4YASA 5AOAA 5ICSA 3DC2A 5DNEA 4UTVA 3MZ0A 3TLYA 2UUPA 3KHKA 2WVAA 1V48A 3RUIA 5GQSA 4BMCA 4MI3A 4EVQA 2EZ4A 4N3AA 4P0QB 3T9DA 4DSNA 1U2DA 2Q8QA 4JN6B 1PT7A 5D87A 1DFHA 2Z9BA 3BB1A 5D01A 3ZWAA 4BO5A 2IV7A 1YJ5A 3KAQA 5JMTA 4UUPA 4RSGA 1YZ3A 4GOMD 4X7RA 1VSBA 3RHTA 3QPBA 3IT2A 4KZPA 5COAA 4U2CA 1YQWA 1QF9A 1JDBB 5DGTA 1TRHA 4PVCA 4R3WA 2C2WA 3PPIA 4RGQA 4DG8A 3RUCA 2RONA 1ISIA 4OUDB 4CU2A 5JWRA 2O57A 2RHCA 1T9ZA 1E79A 2VP4A 3H84A 3EGDA 4HAIA 4PZ0A 1BEZA 3T8YA 4AN4A 4AL4A 4QM6A 2GZDA 2W42A 4QBKA 2XB6A 4A2WA 2BBSA 2QX7A 3AMVA 3L01A 1S2NA 3V6MA 4TXJA 5CU7A 1ML4A 2H06A 3DE0X 1OFVA 1E3EA 4LXQA 3OHSX 5DXFA 1V16A 3G5AA 1JEDA 5JNSA 3SVTA 1TW2A 2GYWA 3FCEA 4AY3A 1W8DA 2QZSA 3DAOA 3LT1A 1EWYA 4B84A 4MV5A 1DPFA 4TROA 2WIDA 1G8YA 1SXGA 1V8FA 1R27A 3L1HA 3G8DA 3PPYA 4HGRA 4OHXA 3WNZA 4BQQA 3MCZA 2J0SA 4TMYA 1AZTA 1Y42X 2QMHA 1NI4A 2CXHA 2CV1A 2GZ3A 1S02A 2WSSD 4ACBA 1RAAA 5EAIA 2X8LA 1ONOA 1H94A 1LPNA 4PLVA 2EP7A 3T4UA 3UMJA 3OJWA 4CEIA 1TYAE 3L9WA 3WP1B 1Z88A 4LF5B 2COKA 3UXHA 4ALJA 2FZWA 2RK6A 3GPLA 4FDTA 5FUWA 2JAPA 6PFKA 4QRHA 4MWOA 3RQSA 3ZZMA 5KU1A 3Q9SA 4N5NA 3JQAD 3EUAA 2JDIA 4LHVA 3DB1A 4RTRA 3LH5A 4BO4A 1YJXA 3ULKA 2AW3A 2VK2A 4FWTA 2GTHA 5TMEA 1AMOA 4YUZA 1XDZA 5TQ2B 1EP1B 4L4UA 4V38A 4RQAA 1MOQA 1UKCA 1QSGA 3Q3IA 1C14A 3H8SA 3LCJA 4M1KA 4RZIA 3MTAA 3RF7A 2NUAA 4JD5A 3WGGA 5ICFA 2AQ8A 4X45A 4IJUA 4OQPA 3HWRA 4NOLA 3BIWA 2QD4A 4Q02A 4B7UA 1OAKA 4Z4GA 5CX1B 1A5SB 1OMOA 1RYHA 2ZDQA 2UVPB 4CV2A 2XBLA 1EVIA 1EGQA 3IGFA 5LZ2A 2PJRA 5HYVA 2H9IA 2F9FA 2H7CA 3BE5A 4JK3A 4EJSB 1I2ZA 4U9HS 4KQCA 3LX4A 5ER9A 4HNHA 4CQNA 4PQGA 2R65A 4MHOA 2JLSA 3PA6A 4PPFA 3I2IA 4PZZA 3EJ6A 2KLHA 3Q8LA 1CWUA 5L45A 2DR2A 1YAJA 3W5BA 3UFXA 1N36B 4TT3D 1GCGA 4EY5A 4C0KA 4AC9A 1J33A 3DHEA 3BBPA 1MAUA 4LGCA 2HSDA 3IULA 5EZYF 1RKBA 3O03A 3E7FA 4BVBA 1ONNA 2B1RA 2FFJA 3SIRA 5L3QA 3EFEA 5E6SA 4DBLC 3ZZ0A 4ARUA 5J63A 4K6OA 3ANLA 5JAUA 5M34A 1ZM3A 1P4GA 1JHPA 4D44A 2OBXA 3UTCA 1NYLA 1BW9A 1VL1A 4NAHA 2JFXA 4RAQA 3X1ZA 3WGLA 2R1VB 2GAAA 3I9OA 3PPWA 4MW1A 3SLGA 4FYWA 4LVOA 1DSSG 3H2IA 2BHSA 2BSXA 4QC2A 2Z6AA 1JKMA 3BMCA 3CT4A 4Q3AA 3RBZA 2X8AA 3U40A 5AW5A 5LOVB 3LJKA 3D3NA 1U28A 4KJXA 4XJXA 1RLMA 1K1EA 1ZQ9A 3SIWA 4R3NA 3VNQA 3U5TA 2ZOSA 2PRZA 4IIVA 2XGJA 4IGIA 4LYHA 4UEWA 1VYUA 1Z37A 4UUQA 5FEMA 3WC4A 2FX2A 1Z6XA 3AUJB 4RVNA 3KOMA 1BJRE 1FNMA 1W1UA 5DLDA 4LZNA 1X1CA 5K45A 3HEBA 3HYCA 4QYTA 1ZICA 2PNFA 3EIHA 4BOYA 5GINE 1TEZA 2VDNB 1DEKA 2WKPA 4MR8A 1A8IA 3PIRA 4G0VA 1KSJA 3YASA 4XQCA 1SC6A 5AUOB 2AH5A 2EZ9A 1DT3A 4JT9A 4AZ3A 4WECA 2ZJYA 1F38A 1YKFA 3WIOA 4XAQA 3QXGA 4F46A 1H22A 3KBBA 2AR0A 2CVHA 4YO7A 2OA0A 3A4IA 1ZKDA 4DLAA 5G3YA 1G291 2JGLA 2QIPA 4J7UA 1YA8A 3V8PA 2C5LA 5I7HA 1IDOA 3L05A 4K9QA 1KI4A 3JZIA 4MVJE 2CMKA 1ESZA 2YVUA 2HIHA 2NX2A 2VH1A 3DT8A 3LT4A 3O31A 4IGFA 3QK7A 4UHKA 4Z3DA 1HKHA 2GGSA 4F21A 4L5IA 3VDMA 2QVYX 4FILA 1D2GA 1PG2A 1A7JA 3QM1A 1GSHA 4PZ9A 1DJNA 3BS4A 3OM0A 4IDNA 4P08A 1J6UA 3RYFB 4TYMA 4UDOA 2IZ6A 1FRNA 3OD1A 3QVWA 2GB4A 4X92A 5KNBD 1CU1A 1EX9A 1JE1A 4QUJA 5CTAA 4JLPA 2PS3A 3HNPA 4A03A 1ZU4A 4N0PA 4RFSB 3ZW8A 2Q27A 4ZFNA 1KS2A 2VDLB 3KEOA 1RC1A 4NZPA 3WNCA 4EO7A 1EWKA 2DU8A 5DCLA 8ABPA 2BN4A 2PH1A 4X62B 1OBHA 1K7FB 4IDHA 2OUKA 2H08A 1YC5A 3PVZA 5TQJA 3PQ7A 1PW7A 2QMZA 4JYMA 3EF3A 2CHUA 1VBMA 2B4AA 1BWPA 1B43A 3HCEA 3NHSA 5IWCA 1XYYA 2JFZA 1DE0A 3AHJA 4JOQA 1U0FA 1Q3HA 1XL0A 1BE1A 2WF5A 2QGZA 5A5VA 5CA0F 3ER9A 2WF8A 3G1TA 3ELYA 4F11A 3V34A 1M72A 2C4UA 3OLCX 4E1AA 2YJZA 5CFLA 1IONA 1QTIA 3P27A 4B3GA 3EZYA 3SQDA 1L5RA 3KT8A 4RYDA 1YQDA 5JS6A 4EYQA 4Y2QA 3T3DA 1YI0A 2WT8A 5SICE 1E6EA 4KUHA 4N01A 2WF7A 3UAVA 5K0SA 4AJ4A 3JQ7B 3ZHUA 4GPAA 4FOPA 2QR2A 3DMNA 4BV2A 5EIEA 5AW9A 3IOMA