2VHXA

Crystal structure of the ternary complex of l-alanine dehydrogenase from mycobacterium tuberculosis with nad+ and pyruvate
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
371
structure length
368
Chain Sequence
MRVGIPTETKNNEFRVAITPAGVAELTRRGHEVLIQAGAGEGSAITDADFKAAGAQLVGTADQVWADADLLLKVKEPIAAEYGRLRHGQILFTFLHLAASRACTDALLDSGTTSIAYETVQTADGALPLLAPMSEVAGRLAAQVGAYHLMRTQGGRGVLMGGVPGVEPADVVVIGAGTAGYNAARIANGMGATVTVLDINIDKLRQLDAEFCGRIHTRYSSAYELEGAVKRADLVIGAVLVKAPKLVSNSLVAHMKPGAVLVDIAIDQGGCFEGSRPTTYDHPTFAVHDTLFYCVANMPASVPKTSTYALTNATMPYVLELADHGWRAACRSNPALAKGLSTHEGALLSERVATDLGVPFTEPASVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords ALANINE DEHYDROGENASE
publication title Three-Dimensional Structures of Apo- and Holo-L-Alanine Dehydrogenase from Mycobacterium Tuberculosis Reveal Conformational Changes Upon Coenzyme Binding.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 124
structure length 368
sequence length 371
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.4.1.1: Alanine dehydrogenase.
pdb deposition date 2007-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01262 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domain
A PF05222 AlaDh_PNT_N Alanine dehydrogenase/PNT, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vhxA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vhxA02
2YFHA 3MTJA 4D0RA 3LF2A 5TLSA 3WJAA 1EUDA 3EGOA 3F4LA 3VPHA 4OOEA 5DBFA 3PDJA 1EVIA 2A35A 4ZQGA 4ZRMA 1NYTA 2I3GA 3VHRA 5L9AA 3NYWA 3H65A 2AEMA 4GBJA 2HJSA 4PLHA 4GH5A 5HA5A 2Z5LA 4YQYA 2I65A 4ZVVA 5IF3A 1HYEA 1ZBQA 4J1QA 4M55A 2R6JA 3MZ0A 3ZHYA 3VZRA 1TLTA 2B35A 1R4MA 2YYYA 3WQRA 5IDWA 5ENDA 1GADO 1T25A 4L4RA 1L7EA 2Q4EA 1BMDA 4WUVA 3H5AA 3RI3A 3K31A 5BSFA 5B4VA 3GOHA 3Q0EA 5ES3A 3ROQA 4EW6A 4YEDA 1BW9A 3BTUA 5GZ6A 4AJ2A 5L40A 2W8ZA 4J7XA 2RBEA 3MCVA 1T4DA 3IKTA 3RQSA 1ZUD1 5DT9A 4FN4A 4R9SA 4J9VA 2ZCUA 3OA2A 3AOEA 4B3HA 5JDIA 2IZZA 1DFHA 4XB2A 1ZSNA 2CY0A 3RASA 1LSJA 5TT0A 4BNMA 4BNXA 3PWZA 1HL3A 1PL8A 3QWFA 2WD7B 4FOSA 4M1QA 3I4FA 1HDRA 1Z7BA 4IPTA 1M6HA 3X2EA 3C7CB 4TKLA 4YRDA 5CFZA 1FDWA 4XYMA 3FCOA 1U5AA 5I9NA 1Z82A 2Q49A 1L7DA 1VJTA 2ZK7A 4BB5A 1N7HA 4BO2A 4PFJA 2BMAA 3E9MA 5KOIA 3B1JA 3DXFA 2VWGA 3NUGA 1NR1A 3RJ5A 3TJRA 3DZIA 1PJ3A 2NVBA 2WTBA 3PJDA 4ILKA 9LDTA 4MOWA 4BNFA 2DUUA 1QRRA 3MJ4A 3WR5A 1KIFA 5CDSA 5A9RA 2ZB7A 4XYEA 3FTNA 4PG5A 2OUIA 1LC0A 4HWKA 2JAHA 3WGHA 1I0ZA 4L73A 2NQ8A 4BS9A 4MP3A 4XX0A 4AJHA 2B69A 2F00A 4IDGA 3RUEA 3TPCA 3M2PA 2EXXA 1B16A 3NT2A 5C7IO 2ZTMA 3UCXA 2YHIB 2H6EA 3UXYA 5JAIA 3DTYA 4F3YA 1RWBA 4KUEA 4EYEA 1Y8QB 1I33A 3KO8A 3KYDA 4ROSA 4XDYA 4IJKA 1JW9B 4I5DA 1C3VA 1P0FA 4ZRNA 3E5MA 4B7UA 1MXHA 3GZNA 3ORFA 4C7JA 1NVTA 3ZWYA 4CUZA 4HFJA 4KQXA 3GHHA 1ZEJA 4P4LA 3G1UA 4JP2A 3ZWVA 1GQYA 1SEPA 4TZKA 4U0KA 2D0IA 3OJ0A 5C7LO 4D45A 4UVGA 1ARZA 1UJMA 4CQMD 3LLSA 2DTDA 1D1TA 2I6TA 4GX0A 1E7MA 2PZLA 3Q1LA 3F47A 4I5GA 1FDUA 4LGVA 1YJQA 4B4OA 4E32A 2C2XA 3K6JA 3DBHA 3K9QO 2CD9A 2E6UX 2G82A 2Y1FA 1SPXA 3GPIA 2FY8A 3ZDFA 3H6KA 3ZNQA 4IDAA 4WEQA 1PU2A 3G17A 3E8XA 5L51A 3GDFA 4BO3A 1UXKA 1V6AA 4CLEA 4J0FA 2PNFA 1YE3A 1Y1PA 2C2YA 4GI2A 3EY4A 4E3ZA 2HKIA 1WAMA 1QG6A 1J49A 1GEEA 4Q9NA 3HSKA 5ILOA 3INGA 2EIHA 1A9ZA 5DN9A 5GZ3A 2VRBA 1TVEA 4IS3A 1O6ZA 3C85A 3BZUA 3WQSB 5IJZA 4EJMA 5F21A 3WYCA 4RDHA 2IXAA 2WJPA 1ISGA 4YVFA 2OORA 4CM7A 2NTNA 1N9GA 4C4OA 3WG9A 2X5JO 4XGNA 4UVEA 4NU6A 1M2WA 3C3XA 3DTTA 1YQXA 4J1TA 4MO2A 2YHUA 2GCGA 4BNIA 2D1YA 2DPGA 1PJ4A 3INTA 1X13A 1E6UA 2WWRA 1DPGA 3BMCA 1XDWA 3HHPA 4Q3CA 1LDYA 4Q3BA 4CODB 5IAAA 3GGPA 2Q99A 1MC4A 4L76A 2RHCA 2PH3A 2DQ4A 4NBTA 2HMSA 2E4AA 2PLAA 3BMQA 3VPGA 4JJFA 4XEHA 4RF4A 1SNYA 5G2OA 3AWDA 2C5AA 5JMPA 3DZBA 2C7GA 4AL4A 2X0JA 1Y8RA 4B7XA 3HN2A 3O03A 1NX6A 1XGKA 4BMSA 3GVIA 5KJCA 2D2IA 1U4OA 2WE8A 4NMHA 1E7QA 3TZCA 1F8FA 8ADHA 1XELA 4FS3A 4GWKA 3DEYX 4FFNA 4X54A 3WFJA 1Q7CA 3Q11A 5T64A 2QYTA 1GD1O 1PGJA 4L9RA 4E21A 5C7OO 4FD3A 3H5RA 4GPD1 1DHRA 2GNAA 1GQ2A 2Q2VA 2PZKA 1SC6A 3PYXA 3RU9A 4JP3A 1ZH8A 5DNAA 3FNGA 3IIEA 4ALLA 2VZ0A 5AVOA 1ADBA 3MWEB 3D5QA 4Q39A 4RLHA 1R66A 3QA9A 1WZIA 5AOVA 4E13A 2WYVA 3LVFO 3WWZA 1CRWG 1QLJA 3D3WA 3JQEA 1DLJA 4B3JA 5ADHA 5JE8A 4DLLA 2BFPA 3LYLA 1H93A 2I99A 3AM3A 2BFMA 4HFMA 2Q45A 1DBVO 3RKRA 1NQOA 1E77A 4YJDA 1E3LA 3JQAD 3JQDA 2FPPA 5KVQA 1VC2A 4Q3DA 2EEZA 3WXBA 4CLOB 1LNQA 4QSMA 1LLDA 4BIIA 3BMNA 3E18A 3KVOA 2YV1A 4YJHA 3X2FA 2HCTA 4CLDA 4MVJI 4NIMA 1NQAO 1GPDG 1YGYA 3BTVA 3GEGA 5HS6A 2FN7A 1SOWA 3VTFA 2PZMA 1A7AA 3A1NA 3DONA 4WK6A 4MVJM 1G1AA 1KBZA 4D43A 1R12A 4FC6A 2CUKA 4U8GA 3TZHA 3VH4A 1YL5A 5BQFA 4DGSA 1ZSVA 4AFNA 3BMOB 3WGOA 3OMLA 5CEJA 1U9JA 2V6FA 1OZAA 3AI3A 1Y5RA 2EKPA 3R6DA 4M49A 2OP0A 4H7PA 4CL8A 3IKVA 4DWVA 4ZJUA 1P33A 1ONPA 1E3SA 1MX3A 4BNYA 3S2EA 3QVXA 4Z9FA 1OOEA 3GPDG 4XCVA 4OQZA 2VT3A 1ORRA 5F1PA 1FDTA 1U1IA 4D0SA 2VOEA 2Y99A 1PTJA 3UOGA 4QTZA 3GMDA 2VT2A 4J2OA 3IUPA 1IZ0A 4KOAA 1BXGA 3TOZA 1I30A 2PH5A 4IS2A 2ILTA 4GLOA 2NWQA 4NBRA 3ASVA 4FB5A 4PLCA 2GN4A 1C1XA 1DOHA 3HDQA 3TNLA 3S55A 2HMTA 1ENYA 3JYNA 1PL6A 3RVDA 5CDYA 3L9XA 1YVEI 4YRAA 4E2ZA 4J9UE 2BGMA 2Q4BA 3IJRA 4B3IA 3O8QA 4D41A 3LT1A 2YFQA 4QEDA 1CIVA 3T7CA 3EMKA 1WPQA 3KBOA 3RUCA 3GQVA 2QG4A 2HMWA 3C1OA 1O0SA 2B37A 1ZSYA 3ZNPA 4CLXA 1DB3A 2P5UA 3QHAA 5CPFA 3PJGA 4MVJA 3IAHA 4BKQA 4QO8A 3VVCA 3C8MA 2D3TA 2PZJA 3TZQA 1B3RA 1JN0A 3RJ9A 4WASA 1UDBA 3PHHA 2VUTA 1UDCA 5G4LA 4U0JA 1W6UA 3QSGA 1OI7A 4RQTA 1IPFA 4L8VA 1VL8A 4JBGA 4RGBA 1YBMA 4PLTA 4CMHA 3LT2A 3PQFA 2R00C 5MGBA 1PL7A 1F0YA 3DZHA 5I7VA 1I24A 2GN8A 1BG6A 4QQRA 3HE3A 5L95A 3DAPA 1A5ZA 4WCDA 1XYGA 3A9WA 1HF3A 1V3TA 3I9JA 4KQWA 1A27A 3D4NA 4B79A 2OXIA 4LISA 5JAMA 5FF9A 3QP9A 3E48A 1XU9A 4WLUA 3RFXA 5AXBA 4XWYA 3OM9A 5T6BA 1YB4A 1CETA 4J1NA 4OAQA 3M1AA 1R4NB 2V6BA 3W4JA 4B7CA 3KXDA 3JCZA 2NACA 4CLRB 5KJFA 2VWHA 4XGKA 2NADA 1DJQA 3OFSA 2YDXA 1X7GA 1ENPA 4RO0A 3ZH2A 4PZCA 3DAGA 1QORA 5KKCA 4BQPA 4JBHA 4B8ZA 3NEPX 1XQ6A 1PZHA 2G17A 3R3SA 2VRCA 4RZHA 1CEQA 5TJ9A 2HQ1A 4RJTA 3HQ4O 2OHXA 1GZ4A 4R3WA 4WE3A 4MIEA 2IDZA 4OSOA 2RH4A 5GMOA 3WOHA 2WYWA 4GGOA 5LC1A 2DFDA 4LCEA 4Z9YA 1GYRA 1BXKA 3GNQA 5JAQA 3V1TC 2Q50A 3WICA 3WB9A 2HU2A 3JQ9A 1ZXLA 1KYQA 1PJSA 4BO9A 1MP0A 2ZTVA 1RM3A 4EJ0A 3JQ7B 2X23A 3M1LA 3AI1A 3S8MA 5CG1A 5B1YA 1JAXA 2HRZA 2E48A 1GL3A 2Q3EA 1GFSA 4L74A 2I5PO 3JQAB 3UUWA 1LLCA 1XSEA 1P1KA 3F5SA 4CMCA 3GUCA 4NFHA 4MDHA 2EHDA 4KTVE 4PRLA 2D5CA 4HY3A 4K9DA 3BTSA 2OGUA 3F6YA 1GUZA 3HG7A 1OC2A 4WEOA 1AHHA 2W2KB 3JD1A 1P1JA 2I76A 4Y9DA 3MOGA 2X0IA 4ZN6A 4PLVA 3K5PA 3ANLA 2JD0A 2XOXA 4D3FA 4D3SA 1W73A 4OH1A 4NR0A 5IZCC 3MWDB 2DTXA 5EJ2A 4BL5A 4F6CA 1MA0A 3O4RA 3GLQA 1UP4A 3QV1A 4KDEA 1MV8A 3QVSA 4DC1A 1P44A 1UXJA 1JLLA 5A5EA 1TA4A 4BO8A 4ZU3A 2PA3A 4R01A 3EAGA 2QZ9A 3AY3A 5FEUA 1DAPA 1N1GA 3CE6A 1I3LA 3WIEA 1DC6A 4XYGA 5KVSA 3OH8A 1VJ0A 1AN9A 1XIVA 3EZLA 1J6UA 1HDCA 4OYRA 2Q2WA 1VJ1A 3PRJA 4OHUA 1GAEO 4W4TA 3TSCA 1HSZA 4ID9A 4Z0PA 3KYCA 1ISIA 4PLYA 4II3A 4IDDA 2EJWA 2GD1O 2VYND 1H2BA 4UUOA 1E7RA 3WTBA 2GSDA 4IDFA 3AUUA 1QXSA 3UF0A 1N2SA 1LBEA 1T4BA 3RIHA 4FSHA 4AJNA 3OQ1A 4TSKA 4RV9A 1A72A 1JTVA 1KC3A 1UXIA 5ER9A 5BT9A 2CDAA 3DBLB 1UAGA 3V1YA 1D1SA 1R0KA 1W8DA 3GK3A 1SAYA 4TMFA 1CF2O 4BNVA 4RORA 3I9OA 4I1IA 2PY6A 4CMEA 3HNPA 4FFLA 2UVDA 2ZCVA 2PGDA 4CR7A 2GF2A 2IYOA 3OSUA 1OC4A 1NR7A 4RF5A 4D44A 3CZRA 5IG2A 2Z95A 3PQDA 2W98A 1D8AA 2BGLA 2Y1DA 3CXRA 1KVQA 3JD3A 3QE3A 4I5EA 4E5KA 3JYOA 4IJUA 3ONFA 3AUSA 2VHYA 3OQBA 3DMYA 2J5RA 3N58A 3O26A 1NAIA 4YBZA 5K6AC 2XXBA 4NK4A 3RWBA 3W1VA 4YWJA 1GU7A 4TKMA 3VH3A 4DLAA 2QW8A 1DIAA 2FR1A 3D4PA 3DBRB 1Q1NA 2YV3A 1H6CA 4K1LA 5JO0A 4DTIA 4EI2A 1Z7EA 1XLTA 2ZYGA 4ALIA 2J6IA 3HB4X 3OHSX 4YJFB 2EKLA 3PHLA 1H6DA 4BO7A 3FR8A 4IY1A 5CDUA 3EK2A 1NP3A 3OF2A 1Y9EA 2UYYA 3OBBA 1CQJA 2VUUA 4N54A 3PZBA 2DC1A 3D4OA 3RKUA 4DPKA 2WE7A 4NG5A 3O38A 1SMKA 4J3FA 5KJ1A 3U09A 4XQEA 3IUSA 1FJHA 1RKXA 1SB8A 1WWKA 5ITWA 1C0IA 4JCOA 3SX2A 4DBVO 1A7KA 1B7GO 5TJHA 4DMMA 3NDJA 1W4ZA 4WLFA 3I3OA 1GQQA 3ITKA 1NNUA 3ZWPA 2VYVA 4R9RA 5A9SA 3JQFA 2X0RA 4PN3A 1JU9A 1C14A 4FJ1A 1WZEA 4LK3A 4E4YA 4AJPA 2HRBA 1I36A 3PFWO 3SJUA 3FNHA 4RPKA 3JD4A 1Q0QA 3FWZA 2Y05A 4HNHA 4A5OA 5EQDA 3N7UA 3ZU5A 4G2NA 5IXSA 1ZIDA 1J4AA 4YDRA 1DAOA 3RUDA 3RBXA 5THQA 4BNTA 1BDMA 1LEHA 1E1NA 1AUPA 2X5KO 2IEBA 1E5LA 1EBUA 4ITUA 3UGKA 3VAZA 4MKZA 4RPGA 3QW2A 1PZGA 3AU9A 1QR6A 3S2GA 4KMSA 1HYHA 4Y98A 4CMKA 4J16A 4R69A 2DM6A 2VHXA 1QSGA 5G0VA 3KZVA 1WMBA 1HE4A 2JHGA 1VL6A 2O7QA 3IC5A 3AFMA 4R68A 3ETDA 4GMFA 4UEJA 4FBGA 1KVRA 1LRJA 1EQ2A 4BKUA 2AG8A 2O2SA 3AU8A 4WNIA 4E5MA 4HX5A 1U28A 4YCAA 3SEFA 4UAGA 5JS6A 1CYDA 1FK8A 1DRUA 1YH3A 1EUCA 4YJGA 3T4XA 4D46A 5ICMA 1ZK1A 1QYDA 4RVGA 4D79A 3JD2A 2TMGA 1N1EA 9LDBA 5EERA 2B83A 5JC1A 5DBGA 2DT5A 1VLLA 1YO6A 2CDCA 1PGPA 4LMPA 5BNIA 2FWMX 2O3SA 2WMDA 2O23A 5G0SA 1ZMTA 1EMDA 3RD5A 3ZV6A 2GLXA 1I10A 2GRAA 1E7SA 3FR7A 4CM6A 2O3TA 3P5SA 3OA0A 3F5QA 4KZPA 4IIVA 2OBNA 3H9GA 3TN7A 3ULKA 3LC2O 1X7HA 4NI5A 1NVMB 4HUJA 4CV2A 2Y0CA 3DMTA 4IMRA 4XB1A 1ZW1A 6ADHA 1FDSA 3DFZA 1DLIA 5IDQA 5DBIA 2X58A 4DPLA 2PKRA 3RFTA 5T67A 1KEVA 3GN1A 4FGWA 3OICA 2NU6A 3RUFA 3WGGA 1ONNA 2FR0A 4K6FA 1PQWA 3NGLA 2QIOA 3V2GA 4RCVA 4CMJA 4XRRA 4J6FA 2NVUA 1T26A 1B0AA 4O1MA 4YA6A 1ML3A 5DCUA 2Y0DA 4WPGA 1BTOA 3GUYA 5JDCC 4NPCA 4KUHA 1N92A 4NH4A 2JFGA 2C20A 4TQGA 2V7PA 2XXJA 3ZN2A 4R3NA 4AG3A 1HE5A 1HKUA 4GGPA 4RVFA 3TL2A 4XYLA 5C5IA 2Q46A 4R51A 3JYPA 4DA9A 1BXZA 4QECA 4TRNA 5TSDA 4JX8A 3AI2A 4JK3A 4QFCA 2NU9A 1QYVA 1XQ1A 1LQTA 5EIOA 5JAZA 5L7TA 3ON5A 1P1HA 1X7DA 1YONA 4IIUA 3AFNA 3KTDA 4QX6A 5DF1A 1CJCA 4OKNA 2BH9A 1LQUA 3NT4A 3ROPA 2BD0A 2F1KA 4AVYA 5TIIA 4CM1A 3VZQA 2O2YA 3HDHA 3ONDA 4GX5A 4QUKA 1B2LA 3I1JA 3FN4A 3L77A 5IXYA 3FWNA 3MJTA 2G76A 3RC7A 4BKPA 5C37A 3WGIA 1EEHA 4BNJA 1X0VA 1PGNA 2NU7A 1TB4A 2XPCA 3GGOA 3EZYA 2PGLA 1TEHA 3D0OA 3OETA 2AQ8A 3EVTA 5FI3A 3TQHA 1WLYA 5EPOA 7MDHA 1DIBA 3OIFA 4R1SA 5B37A 2FHSA 1ZCJA 4OJNA 1C1DA 3I6QA 2VHZA 3HUDA 4YT8A 3UAGA 2AQHA 3PLRA 4F46A 3AOEC 1LDGA 3CUKA 4KDFA 1CWUA 1X14A 3T7EA 5JDIC 2P4HX 1NHGA 1YXMA 4BVAA 2ET6A 4CQMA 4ALMA 4BNUA 5AQ1A 1UP7A 1E3WA 3QWBA 1BRMA 2D59A 1NM5A 2B4QA 1NBOA 2AHRA 3NRCA 4J43A 4CM4A 4IJVA 4ND3A 4Z6KA 2H63A 1KEUA 2I3AA 1QKIA 3CMMA 4RVSA 5CDTA 4W9NA 1NAHA 5ICSA 4LN1A 3RBVA 2EF1A 3GNTA 1LXCA 5AXDA 1HE3A 3PYMA 3ZU2A 3E9QA 4K26A 5A9TA 1MGOA 1KY4A 2G1UA 2NM0A 3S2FA 3ZHZA 2LDBA 1J5PA 2PR2A 4BO0A 4J4TA 4PGFA 2W2LD 2ZTLA 1BW9B 4HFRA 1NTOA 5JPIA 3QJ5A 2Q1TA 3AJRA 3JQBA 3U49A 4OGWA 4IQGA 3WLFA 2R2GA 3PWKA 4OM8A 1GV1A 3GEMA 3B1KA 4HFNA 1H9BA 4JJGA 1J0XO 2V6GA 3CH6A 4YAKA 3ETGA 4ND5A 3ENKA 1V3UA 3H9QA 4XYBA 4ND1A 1DHTA 2FSVA 3WGTA 4FQ8A 4ESOA 3UFXA 5A04A 2X22A 1EVYA 2Q1WA 2PWZA 4EGFA 4EBFA 4ALNA 5JXWA 4UVDA 3EUWA 3C7AA 3E03A 3U4IA 4I8XA 4IDBA 3SC6A 4BNNA 4W7HA 2Q1SA 4ONEA 3O9ZA 2HAEA 4I5FA 1XG5A 8LDHA 1O5IA 3DL2A 3NX4A 2DBQA 3B20A 7ADHA 5JBIA 2TMDA 1H9AA 4TROA 3FI9A 2DUWA 3UH1A 3GAFA 3IMFA 1DDOA 5BSEA 2QRLA 4PG7A 1QYXA 4HP8A 1K2WA 3LF1A 2O4UX 4XIYA 3UHAA 1E1LA 3PPIA 1IL0A 4CPDA 1U3UA 3AY7A 1P0CA 1Z75A 5FI5A 5IN4A 3FPLA 1PQUA 2YV2A 1R0SA 1JAYA 1ZK3A 3VVBA 4I9NA 1P9LA 4LSWA 4ZD6A 1I8TA 3Q3CA 5KVCA 2DFVA 1GCUA 3F9IA 5AYVA 1YS4A 4OXNA 3KYDB 1YL7A 4LVUA 5JFOA 3F1LA 1VL0A 5F5LA 2EW8A 1DFIA 2O3RA 1EK6A 3Q2KA 4OXKA 3GZNB 4LSMA 3UKOA 4J1SA 4D3DA 3SXPA 2P68A 1FDVA 3ZWWA 4XA8A 4FFRA 3PK0A 4BKRA 1MG0A 4IZHA 3BYZA 3EDMA 4PLPA 3WWYA 1N7GA 3WYBA 1A4IA 1LSUA 3IDSA 2EV9A 4DIFA 4RPLA 2AG5A 5U4QA 3PIDA 1IYZA 5CEEA 3DBHB 5T8KA 3WYEA 4CR6A 1YDWA 4N18A 3JYQA 4PG4A 1MUUA 4S1VA 4PIVA 5I9LA 3VOSA 2RAFA 4UUPA 1UZLA 4IZIA 1ADFA 1YOVA 3KEOA 4E30A 3BIOA 1F8GA 1YRLA 2JL1A 3GVPA 4N5MA 4R16A 3I9KA 4XJSA 1H5QA 1HETA 2G5CA 1YDEA 2V6MA 3DBVO 3TOXA 1Z73A 3QWAA 2AEJA 1XR3A 5EINA 3H2SA 4R1UA 3GR6A 3ADPA 3HDYA 2WM3A 3ONEA 4Q3EA 4F6LA 3V1UA 4WKGA 1Q0LA 5DP2A 3NAQA 5CDGA 4YR9A 3K92A 3U4HA 2EW2A 3L6OO 2GZ2A 2UV8A 3DZFA 1MC5A 5EESA 3LSYA 2HJRA 1X1EA 3PWSA 4AJ4A 1E6WA 2POQX 1QP8A 4QO7A 3WLEA 2GR9A 3DZKA 4DMLA 4J4HA 1HLDA 1MLDA 4GX2A 1N9GB 2HK8A 3H9JA 5TS3A 5G0WA 4FFMA 4MJLA 4W82A 3KEQA 4W6ZA 4CMGA 4OMUA 5KNLA 1HZZA 4UREA 4Q3AA 3IP3A 2OFPA 5F1OA 3ZWBA 2CF5A 4E0BA 3BMCB 3D7LA 3M2TA 3EVNA 4GSLA 1DFGA 4B4UA 3MTGA 3PYLA 2V65A 4FW8A 5J23A 1SBYA 3NT5A 1PJBA 4XD2A 3P19A 3V5NA 3COSA 4YT5A 4JNKA 1GUYA 4FGSA 1D7OA 2O50A 3FHLA 4XGIA 2ZJ0A 5CPBA 2EGGA 5F3RA 2X86A 3BMQB 1KC1A 2E82A 4NBWA 4GAEA 1JDJA 1M75A 2P91A 3CIFA 3WDSA 2NVWA 1Y8RB 2NQTA 3AK4A 2RCYA 2UAGA 4NJMA 5JY1A 4NBUA 5F5NA 4H16A 1LLQA 1ID1A 2DTEA 3I9NA 5KJEA 5JW6A 4Z3KA 1T24A 3LC1O 2H9IA 3JQGB 3FBGA 3F46A 1T2EA 4CV1A 2HUNA 1EFKA 5B4TA 2NSDA 2DLDA 4BMVA 5IN5A 2DU8A 2VN8A 3WBFA 3IOYA 1TT5A 4G81A 3WX0A 4BMNA 1DIRA 5LDHA 4ND4A 1P77A 5JCJA 1A71A 2CSUA 3VDQA 4JN6B 3OP4A 3MEQA 3AUTA 1UXGA 4WCFA 4U7WA 1GYQA 4YACA 2AE2A 3PGJA 4CUJA 2ZYAA 3PEFA 4Z3DA 3RUIA 1JQBA 1EVZA 4CMIA 4XIJA 4EUEA 4EUFA 4J90A 1TXGA 1IB6A 5TNXA 4RF3A 1K0UA 3D3WB 4GKBA 3ST7A 3D3EA 4MP6A 3ADOA 4PG8A 1ONOA 4KWIA 4M89A 2B4RO 3L4BA 3U4CA 2OL4A 4IJWA 4M86A 2X9VA 1U3WA 4NU5A 1E3JA 4OQYA 1R15A 2BELA 1BVUA 1LU9A 3GFBA 3OECA 1QYCA 3JYLA 1PJ2A 3PJEA 3GT0A 4YT4A 5A03A 2YJZA 3HWRA 3JQ8A 1FXSA 2AEFA 2NNLD 3BMNB 4HXYA 3TZKA 5HRUA 4JLWA 4YJHB 3KETA 4R5MA 1SO8A 2QX7A 4CQLA 4MIOA 4QFDA 1V9LA 3PQEA 1EDOA 1CERA 3DHYA 4B4VA 3ZWNA 4CM8B 1NXQA 3PLNA 3H4VA 4RVUA 1M67A 4JBIA 3CZMA 4TZTA 1OAAA 3D5TA 3Q2IA 3DAFA 1AHIA 4M54A 1IOLA 2P9CA 1RM5A 4OL9A 5DP1A 5GY7A 3Q9NA 4MINA 4HBGA 2YQ4A 3SLKA 5I7EA 4E2YA 1LDNA 1LC3A 1Y7TA 4CV3A 3TFOA 1P1RA 2W90A 1WVGA 3GRKA 4RLSA 3AM5A 4MVJF 3OJLA 3OJOA 1VKNA 4Z9XA 3IS3A 5KCZA 3HDJA 3RUHA 3L6EA 4BNGA 4L4SA 3WNVA 4Z0TA 1YB1A 2OP1A 4P38A 1BXGB 3L07A 1YBAA 4CL3A 4XQGA 4CLHA 4DL9A 3I83A 2JJYA 4YAJA 5K9ZA 5A4DA 4BNHA 4YTEA 2O3QA 4CV0A 4Y67A 2YY7A 4DC0A 1AGNA 1HT0A 1C1XB 2GZ3A 4E5NA 2B36A 3ZWCA 1PJLA 2BF7A 1GTMA 1PZEA 1XCBA 3GVHA 1RYDA 5G4KB 1WDKA 1V8BA 2ZB3A 3O8QB 2GN9A 2Y1GA 3PZRA 4L75A 5H82A 3S1LA 1VI2A 2ZYDA 2B5WA 3FD8A 3NTRA 2O3JA 5COBA 2J3JA 1HSOA 3QLJA 4URFA 1BGVA 1EFLA 2JKVA 2GPTA 1I2BA 4M87A 4H3VA 1GV0A 3EYWA 4ND2A 1U8XX 1GPJA 2C29D 3CEAA 1O95A 4UULA 3U4DA 3JQ6A 3I9LA 1SEVA 5COAA 3GEDA 1GZ6A 3FPCA 1HRDA 5IDYA 3NJ8A 3HFGA 3TRIA 2OZPA 4XR9A 1F12A 2VNSA 2D4AA 1U8FO 1EK5A 2CVZA 2B0JA 1T2DA 4DIBA 1I3KA 4PCVA 3UW3A 3K73O 3ABIA 3U3XA 1UP6A 3V2UA 1H2HA 4NJOA 1IULA 4NQZA 2QHXA 4OSPA 1NPTO 2UUOA 3PHJA 3JD0A 2JCYA 1LLUA 4O0LA 2AQIA 4BGEA 2WD7A 3BHMA 2A94A 3JQ9C 5I8WA 5L7WA 3I4CA 4ZHSA 3GMSA 3G1TA 4WLNA 1U7TA 3NJ4A 3QIVA 1KOLA 2ZJ1A 1OFGA 3BAZA 4BGIA 3RU7A 1LI4A 2VYNA 4IBOA 1ZFNA 3CPSA 4GVLA 1LDMA 2UUPA 3A28A 3G79A 2BLLA 3U9LA 1R37A 3QY9A 1K89A 1RJWA 3D64A 4CM9D 2GERA 3P2YA 5JYDA 4DREA 2VYVD 5KIAA 1LDEA 1AXGA 3WGQA 4DIOA 1DSSG 1W0CA 2AE1A 3AOGA 1VE9A 5FWNA 4ZQBA 4IXWA 4FFOA 2J3HA 1GDHA 5B12A 2EJVA 1TT7A 3RROA 3HN7A 2RH8A 2WYUA 3VKUA 3H3FA 5IDXA 3MJSA 1KY5A 3H9EO 4GLLA 4WGGA 3CKYA 5H83A 1ZXBA 2YHIA 1DRWA 2FSSA 5ILGA 2C7VA 4JJIA 4ALKA 2X9GA 1T2FA 1Z45A 4W99A 4EUHA 2J3IA 1Y8QA 2DBZA 1V35A 4WECA 1E1MA 1HDXA 1IUKA 2EP7A 4PLZA 4AJIA 4GKVA 2BFOA 4UVIA 1EVJA 1KVUA 1ZEMA 2GGSA 2QRJA 2IXBA 1H6AA 2VWQA 3TWOA 3EC7A 4HNGA 2HK9A 3IJPA 4EEXA 5JSFA 1EBFA 2FP4A 4WNCA 3U5TA 3AW9A 2J5QA 3VTZA 4YYZA 1C0KA 1D3AA 1LSSA 3ITDA 2EGHA 2Y67A 5HS4A 1ZMOA 4JXKA 2Y93A 2QRKA 1LTHR 2JD1A 1V3VA 2VQ3A 4RF2A 2VHWA 4KP7A 1QV6A 3OQ6A 2Y68A 2BI8A 3GC6A 3GVXA 4QT0A 3ZCXA 4BV9A 3C24A 1YL6A 1RYEA 2WD8A 4II2A 1O9BA 4GSKA 3JSAA 2PD4A 5BNFA 4TRRA 3KOUA 4RPJA 3HZZA 3SVTA 1I01A 3KLMX 3GDGA 3DFUA 2WSBA 4S3MA 1P31A 5L45A 3OIGA 3A14A 4BO4A 1VPDA 1PSDA 2O7SA 4PG6A 3E1KA 4KTTE 4CMEC 1U3VA 1GZ3A 2I67A 3RC9A 5JMWA 3ZGYA 2Y1EA 1DC5A 1PGOA 1VKOA 2NUAA 3K2EA 3VC7A 2X7HA 1VM6A 2IZ1A 1X0XA 3HFSA 4ALJA 4AJOA 3NTQA 3KYCB 3ZZNA 4U5QA 1ZK2A 4K6CA 2IEDA 2AXQA 2CVQA 1PJQA 3I6IA 1R6DA 3DHEA 1E92A 3QVTA 5JYEA 4PRKA 4A73A 5TQVA 1Z74A 1MB4A 3PJFA 3E6AA 4N5LA 1M76A 3WGYA 4CM3A 5DZSA 4A2CA 5CG2A 2NLOA 2J8ZA 3KV3O 3L4SO 3FSRA 1PQPA 1GYPA 1X15A 1GEGA 3PHGA 3IL2A 2YDYA 1YQGA 2ZQYA 2I66A 1PS9A 3F1KA 4I08A 4LMRA 1NWCA 1HXHA 4BB6A 2DAPA 2FR8A 4FPXA 4E31A 4IDEA 1E3EA 2YUTA 1JWAB 5BSGA 4M8SA 5I8ZA 4PLFA 2O48X 4IGFA 4IQ0A 5ENVA 4DVJA 5G0TA 2CDBA 2NTVA 4OKIA 2PD6A 3U62A 5KVVA 1ISHA 2O3UA 4U6QA 3ZHXA 1EE9A 1P74A 5A3JA 1LUAA 3JQFC 4BUCA 4PLGA 5DCYA 1P45A 3HB5X 4BNZA 1R0LA 2H1SA 1VSUA 1KVSA 2ZIZA 1L1FA 2AW5A 4JROA 3VZSA 4IGEA 2AA3A 4FDAA 5TRTA 4RZIA 5TT1A 3CINA 5I7FA 4BQRA 1FF9A 2VZ8A 1WDMA 3DR3A 3KSUA 4R4JA 1A4UA 4A27A 2Q1UA 4EEZA 1KS9A 1O89A 1Q7GA 3KYBA 3JQCA 2RHRA 4UUMA 2FRDA 4IM7A 4AJEA 4DYVA 2PGJA 4WLOA 4EJ6A 1AE1A 1IHYA 4BO5A 1PX0A 1G0NA 2AMFA 4JIGA 4B8WA 2VTEA 4YQZA 1MXFA 1PJTA 3ZW8A 4E2XA 4NZ9A 3LQFA 4FJ2A 4RDIA 3EHEA 3RCBA 3QQPA 5A05A 5A9SB 2DBRA 1U7HA 4WLEA 4XZ3A 3GVCA 4CLOA 3MJVA 3TZ6A 1NFFA 4RVHA 4YAIA 1PZFA 4R1TA 1SCUA 2ZTUA 2HLPA 1K6JA 1F06A 5CP8A 5L53A 3AUAA 1P1FA 3Q6IA 1I3MA 3NTOA 4FFPA 4J49A 1D4FA 4ZGWA 1U2DA 4A10A 1IPEA 3OEYA 5TC4A 1F17A 3JTMA 3W8DA 1Q7BA 1E7YA 3UCEA 4OOFA 4G5HA 3GG9A 1QMGA 1XWFA 3MOIA 4IMPA 1HWYA 1PR9A 4AJJA 3TL3A 1XA0A 3DO5A 3BMOA 4BNKA 4DBZA 3I52A 1E3IA 4HV4A 1NWHA 4IINA 1IE3A 1HE2A 1U3TA 4LCJA 4UEOA 2VHVA 3HADA 1AXEA 2ZQZA 2P4QA 3WQQA 5TX7A 3DWFA 2WDZA 5KKAA 3QWIA 1LA2A 4W7IA 5JLAA 1UDAA 2HDHA 4A03A 3DZJA 1R4MB 1JWBB 2FZWA 3BA1A 3DMTC 3PP8A 1E0DA 1ULUA 4YJGB 3VZPA 4PVDA 5JC8A 2QYSA 2OOSA 2NV6A 4MKRA 2HSDA 4XKJA 4Z0HO 1PS0A 1P3DA 5L4LA 1NHWA 2W4QA 2FPIA 4R54A 2PKQP 2HMUA 1GCOA 4WLVA 3W6UA 2D5AA 3C1TA 5BSHA 4PZEA 1H6BA 1KEWA 3IP1A 5DDIP 1I2ZA 4OIMA 3SLGA 1YJ8A 2BGKA 4E2WA 3MJEA 2BI7A 3WSWA 4G65A 5HM8A 6LDHA 3BHJA 1QV7A 2H5LA 4JQCA 3ZU4A 2Y0EA 3OIDA 2GYYA 3P2OA 3WMWA 2BHLA 3FRJA 3F3SA 5L4NA 1NQ5A 2C59A 1LX6A 2AQKA 4LRSB 1E7WA 4XJTA 5KTKA 4H15A 4C7KA 4INAA 4D7AA 4HKTA 1E6EA 3RC2A 2FOIA 4R41A 4YRBA 1HDZA 4GMGA 1K6IA 1ISFA 3BHIA 2IZ0A 1WW8A 1UZNA 2NVUB 3SBOA 1EDZA 3P7MA 1Y9AA 4WOJA 1JVSA 1CQIA 2W2LA 4UUNA 1LJ8A 1PJCA 1ZVMA 2DKNA 1LDBA 3E82A 1HDOA 2YQ5A 3JQGA 4FCCA 1XHLA 3RUAA 3SJ7A 1I3NA 1B26A 3DB2A 1WMAA 5EL0A 1WNTA 3GNSA 3ASUA 4GQAA 2PK3A 1R4NA 3A4VA 3WIDA 4A26A 3KB6A 4CLRA 1FMCA 5I9MA 1V0JA 2A92A 4BV8A 3OJEA 4P4NA 3WSVA 5JNLA 4NDNE 2P9GA 5L4SA 2YW9A 4Y6RA 3BXXA 3IQDB 1PWXA 1LSOA 1M6WA 1Z6ZA 2C82A 4RL6A 1XKQA 1XU7A 3ZHBA 4BO6A 1ENOA 4J7UA 2BKAA 3H7AA 2R00A 1DC4A 4AICA 5HTOA 2EKQA 3W4IA 2E37A 1ULSA 5C3MA 3ZWXA 4IDCA 3U0BA 1YWGO 3UCFA 1G6KA 4J2HA 3RC1A 1RM4A 2Z1MA 3PDUA 2OO5A 3KLPX 2CMDA 3R1IA 1HDGO 3C7DB 3ANMA 1E1KA 4W9NC 4NHEA 4BGUA 1MFZA 3KHUA 1B3BA 2ZB4A 1TI7A 3B1FA 2BRUA 5HBRA 4BKOA 2ZKLA 3JQ7A 3G49A 1KERA 3DOCA 3L0DA 4YT2A 4XQ9A 4PLWA 1ZJYA 4CM8A 1C1DB 4GL4A 4BOYA 4RVDA 3LT4A 3W8FA 4U6SA 4I9UA 3JQAA 3H3JA 4IXTA 4LW8A 3JQBC 3ROMA 2HO5A 5KJ6A 4CJXA 4MVJE 5A1TA 1ADCA 1C0PA 4PZDA 2UDPA 4D42A 2IYPA 1MG5A 4XR4A 1B14A 1UXHA 4CQMB 1JVBA 5CHEA 1GR0A 1PIWA 1E3WB 2C07A 1S7CA 2W2KA 4MVJD 3DC2A 3PXXA 1PR3A 2NU8A 5I7SA 4P8RA 4CM4B 2FZEA 4TWRA 4BNWA 4DUPA 2Y1CA 3NGXA 4DXHA 1JKFA 1K6XA 4Y6PA 3JV7A 2VOJA 2HK7A 5ER6A 1P1IA 4CR8A 1B8UA 4N5NA 2XF8A 4O63O 5TGDA 2QZZA 3WFIA 1F14A 3NKLA 3STHA 4FR5A 5B4UA 4TRJA 5DCWA 4DQVA 1BDBA 4DRYA 4BHTA 1N8KA 4RQUA 4CMAA 4ZA2A 1RM0A 5KWEA 2CNBA 4ZICA 4MKXA 3FTPA 5IFLA 1ZK0A 4XRGA 1OBFO 1DC3A 1JKIA 4QXMA 1EE2A 1NQTA 4XDZA 2X0NA 4WOKA 5G4KA 2P2SA 4MPDA 2GASA 3DHNA 4N7RA 4NFSA 4DYDA 5JCJD 2NTJA 1RPNA 1YKFA 5JY6A 5F1KA 2YZ7A 1Q2XA 2PTGA 1KETA 1C0LA 1B15A 3GFGA 3DDNA 2DPHA 3T4EA 3CSDA 3B6ZA 2JCVA 1KEPA 1ZJZA 3FBTA 4DLBA 2Y1OA 4GX1A 3W6ZA 5IZCA 5DOZA 2JAPA 1HDYA 2X6TA 1VSVA 5DOVA 3L9WA 1B8PA 4PVCA 2VRCD 4O6VA 3DBLA 1NPYA 3PFFA 4KWHA 2VTDA 1NFQA 4CM5A 3KUXA 3TFQA 3RBZA 3ENNA 4P22A 2EG9A 1HZJA 3G0OA 1E5QA 3DZGA 3GAZA 1VRWA 3KSDO 1LRLA 1U5CA 3BTOA 5T8KC 4OXYA 3H5NA 5EQFA 4YAGA 3V8BA 4DQXA 1DO8A 4J91A 3E5RA 1PWZA 1GUFA 1QLHA 2GUGA 2OMEA 1ADGA 1X1TA 5GZ1A 3NDRA 3FNFA 3ICPA 3GN2A 2P5YA 1T2CA 3HJAA 3V2HA 2VCYA 3F4BA 3PTZA 4GVXA 3Q9UA 1UZMA 2GZ1A 3DBRA 3FNEA 2PFGA 3I5MA 3CMCO 3QVOA 2X5OA 1PS8A 5FFFA 2GN6A 3VDRA 3ZV3A 2WEKA 1M66A 4NNJA 2B5VA 4LRTB 4F45A 4YJFA 1ISMA 2X4GA 2J5KA 3DQPA 1H0KA 2IE0A 3N74A 4EDFA 4O59O 3RAJA 1Y6JA 5CAEA 1UR5A 5K0ZA 4EZBA 3TDKA 3QVWA 5THKA 3VPSA 1EUZA 3H9UA 1KVTA 3E9NA 3K2BA 3MJCA 1YOVB 1MFPA 2E49A 3EW7A 1YQDA 1R16A 3GG2A 2CVOA 5K6AA 3GF4A 4B4WA 4TRMA 1Q0HA 4Y6SA 3GY0A 3W4KA 1DRVA 2SCUA 5DULA 5LDGA 3H2ZA 3GRPA 3M6IA 1QYWA 4J0EA 1U2GA 4WJZA 3WNQA 4MVJH 4L4XA 3ICCA 3ZWOA 3ZV5A 4LVCA 3ANNA 1NFRA 1JA9A 3RSHA 3A06A 3ZW9A 1DIHA 4E6PA 1UUFA 4J7CA 3NV9A 1SZJG 3ZV4A 3S2IA 4XQCA 2B4TO 5H81A 3UN1A 2QQ5A 3AM4A 4Y8VA 3R0IA 1WP4A 3VPXA 4OO3A 5A3VA 4NK5A 4ZQEA 3GGGA 1SB9A 3WJ7A 5ITVA 2ZB8A 4BGVA 4RPHA 2JHFA 2GDZA 3H8VA 1BVRA 2XAAA 4BNLA 5BNTA 1UH5A 3LZ6A 1BWSA 5U1PA 4FJ0A 2G0TA 2VNAA 4E33A 1HYGA 1PEDA 3W8EA 2X1HA 3AY6A 1LRKA 2X9NA 3R3JA 4DPMA 1Y81A 4R1NA 3I9MA 4FIZA 3VPFA 4A0SA 4NFYA 4TVBA 2X8LA 1G0OA 4YPOA 4MP8A 2IRWA 1UAYA 4A7PA 4YXFA 4K28A 4WCFC 1JKJA 4GWGA 3GA0A 5L7YA 5T5QA 2PKQO 1N5DA 3C1AA 3NDIA 3KM0A 5L3ZA 4O5OA 1WXDA 1ZNQO 1BSVA 1HEUA 1YB5A 1U4SA 3LLVA 5AXCA 3ZWAA 2FPGA 1IZ9A 3OJFA 1A9YA 2BFAA 4NJMB 2J3KA 4AJ1A 4CMBA 3OEWA 3PVZA 1HTBA 1ZO8A 4L0QA 3KSZO 3L4BC 4UEKA 5A06A 3ZI0A 4I9HA 4UVHA 1DEHA 3PI7A 4IUYA 1O8CA 2A4KA 2JFFA 3LC7O 3WTCA 5FYDA 1GY8A 3CTMA 3ETEA 5EMHA 1EZ4A 3GH3A 2DBVO 5G0UA 3K96A 1T1SA 2EERA 2JD2A 1IY8A 1TT5B 5CEFA 2VZ9A 4AJKA 3B70A 4ZQFA 3RFVA 3ZNOA 4KUGA 4AJLA 1ENZA 2RIRA 3DOJA 4HADA 1NVGA 3VH1A 4WCFB 2VWPA 4J4BA 1SOVA 1K3TA 2CZCA 2Z1NA 2ZATA 4E5YA 3K30A 4YB8A 3L6DA 1I2CA 3ZWMA 5A02A 1K5HA 3LT0A 4CMIB 3WMXA 4IQ8A 1H94A 1NASA 3INRA 1PGQA 1CDOA 5HWSA 5MDHA 5JCXA 3G3EA 1DIGA 2CFCA 4TVOA 5BR7A 2JFHA 3QWHA 1S6YA 2Q2QA 4MVJG 4R5HA 3VKVA 4E12A 4MVJP 2HMVA 2OBYA 3KRTA 5U9CA 2PD3A 2LDXA 5A5FA 4ZQHA 3WS7A 3GDOA 2O4CA 3FF4A 1ZZEA 3PGXA 3PHIA 3JQ8B 3VH2A 1OMOA 3ZNNA 4JGBA 4CQLB 2PV7A 5IZ4A 3TF5A 1DXYA 2A9FA 4Q3NA 2EWMA 3I23A 3WGZA 1XEAA 1T2AA 1YBVA 4MIYA 2P9EA 4EITA 1IHXA 1DJNA 3ZU3A 3SC4A 4DQUA 1BHSA 1NPDA 4P4GA 5EN4A 1B8VA 3PIIA 2DVMA 2I9PA 4NBVA 4CM9A 3DOOA 5TF4A 4BO1A 2IODA 3GHYA 1ISJA 5JDCA 3LDHA 1Y5MA 1WDLA 1O94A 2EP5A 2D8AA 3GZ4A 3D1LA 1I5RA 4E5PA 2C5EA 2Y66A 2VUSA 5JO9A 3UVEA 2GO1A 1T1RA 5COQA 4FC7A 5LCXA 3WBBA 3UICA 1ZKMA 3LK7A 2CF6A 2JCXA 5T57A 1I32A 4CUKA 1ZK4A 1HLPA 3LU1A 5AXAA 1EQUA 3K8ZA 2C54A 3ROKA 2C0CA 3QRWA 2FMUA 4YAEA 4FOOA
chains in the Genus database with same CATH superfamily
4LNHA 1RQNA 3O94A 4IIDA 4B83A 4N39A 3WJAA 1E98A 3FCCA 4OF4A 5H3HA 1JLKA 3IMEA 4OOEA 5K6RA 3HDTA 3I72A 4FFVA 1NQXA 1UFVA 5F2KA 2ANCA 4ZRMA 1NYTA 3OP1A 2I3GA 3VHRA 4I4TB 1PDWA 3V00A 5FTJA 2J4CA 5HA5A 1S8FA 3D2CA 3IDAA 4UMVA 2Z5LA 1Q1GA 1ZAKA 3GWGA 1IEQA 5KSPA 2BJHA 5IF3A 1ZBQA 1O1YA 4I19A 5JXIA 4OHRA 5I47A 1TX4B 821PA 1WF3A 3AI7A 3VZRA 1TLTA 3T5TA 2ZJAA 1R4MA 2Q6VA 4OP3A 5FRDA 5K0CA 4GMKA 1LJLA 3T06B 1GADO 1QJ4A 1CB0A 2J0EA 2WFLB 2PMKA 3ZDZB 1NR5A 1TZKA 2IYTA 4XVRA 3VO1A 3AILA 3QUSA 5LQRA 3UJAA 3H5AA 3HCBA 1GAJA 4HDKA 5C0OE 4EF5A 4U7HA 5FKJA 1UJNA 2WU1A 3PCTA 4EW6A 1OREA 1V96A 1CU1A 2Z3WA 4K9OA 4D4KA 3BTUA 5A2QA 2IU0A 4J7XA 1QF9A 2RBEA 2ZUFA 2YNMD 4XFKA 2PLWA 5DH9A 5JXHA 1KYZA 2ZCUA 1RP7A 3FYHA 3OA2A 3AOEA 3QE9Y 3LHSA 1AN0A 1NLFA 5JDIA 3EDYA 4P9NA 4U7TB 3RASA 2IYNA 5TT0A 3STYA 1PBTA 4AMBA 5CLQA 1XYVA 3SF8A 4CF4A 5T4EA 2RSLA 2FHPA 3LP6A 1JEOA 3AEKA 3I4FA 4FOSA 4IPTA 1NXTA 3AEUB 3C7CB 5CFZA 3A1UA 1FDWA 3TAHA 5KQGA 7MHTA 3PEYA 2ZPUA 2HBQA 2Y2UA 1Z82A 4NX2A 4X1IA 1VJTA 1GFWA 1ACJA 2PT7A 2ZK7A 3N8NA 3ZI7A 3U17A 3H5WA 4ZVNA 1WB6A 1ZCBA 4BO2A 1G291 1OV6A 1PQYA 4ZYVA 1UK7A 3E9MA 1UEXC 3A6LA 1N6HA 1SIOA 2ZT5A 3R9XB 4V03A 3CURA 2BKEA 4ILKA 9LDTA 4KQGA 1VJ5A 4MOWA 1KJIA 4BNFA 2V3WA 3OIWA 5ESRA 3WR5A 1KIFA 2PM8A 4H35A 4UATA 2P5SA 4HSGA 1Y7HA 2A7XA 5FWDA 4DLRA 3ZDRA 3MLBA 1XD8A 3FTNA 4KR0A 3U48A 1HX7A 2P41A 1L7NA 1G7TA 1UMCB 3MSXA 4L73A 3SP1A 3OCCA 1DEXA 1Y82A 3CQ9A 1EGVB 3OZDA 4MP3A 4AJHA 3D4IA 4BS9A 3KXIA 4ZI7A 4ZCLA 4IDGA 3E15A 1UPXA 3M2PA 3SKXA 1B16A 1U0RA 1KDVA 2ZTMA 3FI0A 2YHIB 4E3WA 4ER6A 3DTYA 1DXOA 5SY4A 4LJ4A 1N9ZA 3CX8A 4ZK2A 4BZZA 4EYEA 5LSAA 3KO8A 2V55B 1T9GR 1QE0A 4D8VA 3GAAA 4LXGA 3EARA 3TQOA 3ZXUB 4EW3A 2R4UA 1WSAA 2YZKA 3GPCA 1OPXA 1PKXA 1H2FA 2WNHA 4NBLA 4B7UA 1CVIA 1UBTS 4YCBA 1N5KA 1Z38A 5JNWA 1NVTA 4CUZA 2ONYA 2MSKA 3GHHA 1ZM2A 1ZEJA 2LCFA 4YALA 2FSGA 5DHQA 5IBQA 3WZLA 4TZKA 2K4MA 3ZWVA 3VFDA 4QU9A 5EY5B 4D45A 4BX0A 1DUSA 3WAGA 3LLSA 3HRKA 1D1TA 5DXAA 2ZYWX 1IVNA 2M1ZA 1SZCA 4NMXB 3SJCA 4B71A 2JA1A 2O0MA 2PZLA 3Q1LA 4ZAYA 3MWFA 3J7TA 4KJZA 5JISA 5F77A 1DARA 3ANSA 4GDMA 1GITA 3CPHA 2LTAA 3Q15C 4MO9A 5A7HA 2ZOSA 3U1TA 3AR9A 3U26A 2C2GA 4K81B 4KQHA 4TSRA 2GXAA 2CD9A 3JWJA 5KS2A 2CMHA 3G2QA 3ZNQA 2OBMA 4IDAA 3R8FA 3B3QA 2EL7A 2H00A 4M0FA 1MVOA 4POAA 5EMMA 4OQMA 5GAJA 4A8JA 2PA0A 4EGJA 3NDPA 2WHQA 3AP2A 1L4YA 1OI4A 4BQSA 5L51A 3MS4A 1JH8A 1UXKA 1UBHS 4QWWA 1IUOA 2FEWB 4CLEA 2I2CA 1GAQA 3DA8A 4EHIA 1Y1PA 3J81k 2IBTA 2QUIA 4GI2A 1K92A 1NE2A 1UEJA 3L8ZA 2HKIA 2WTEA 5FTMA 3RREA 4YCMA 5KVQA 1U94A 4GLJA 1A9ZA 1LD3A 4RY9A 2QN7A 3LRPA 4J3NA 5AVKA 4FUTA 5CLJA 4TS4A 1ODJA 1TVEA 3EIOA 4IS3A 1AKYA 2I7VA 5HE8A 3WQSB 5LOVF 3EZGA 2YWHA 3B6IA 3PNBA 3UAWA 5IJZA 2R48A 3E2IA 3TI9A 3WLQA 3AB3A 4ZO4A 3SM9A 4R7TA 5F21A 3WYCA 2RBGA 2H1WA 1ZC4A 2WF6A 1E4EA 1YCDA 3C48A 5LZ5A 1CNMA 4YVFA 2OORA 3LYHA 4JLBA 4FHZA 1FXWF 5EOVA 2XNHA 5KYVA 3FRHA 3VUFA 1OH5A 4HQ6A 4XGNA 4NU6A 1H4QA 4PONA 2I2XB 3NP7A 1YQWA 3O82A 3EPLA 2VYQA 3DOHA 4NY1A 2YHUA 4DMFA 1EFRA 4F4JA 2D1YA 1WZNA 2NO1A 1PJ4A 4WZAA 1XDWA 3KPYA 4HDQB 2DERA 2R97A 1JHPA 1MC4A 5BW6B 3GRZA 3INNA 2ZDGA 4G5RA 1U02A 1ZD3A 5FX2A 4LZPA 4WY5A 2JIRA 5K03A 1T3TA 4IFBA 4UNSA 1ZUNA 2E4AA 1NVWQ 2PLAA 2XCIA 1Z6AA 3IVGA 4LV6A 5JASA 4XEHA 4RF4A 1V9CA 1SNYA 1IWOA 2XWJI 2C5AA 2FZ5A 1JFRA 1FQJA 2OCLA 3DZBA 3C6QA 3PNSA 3UTDA 4AL4A 2X0JA 1Y8RA 3ZUGA 3KQVA 4EX7A 1MMFB 1E5VA 3KQQA 3I37X 3HZRA 3T94A 2JFXA 3TZCA 8ADHA 1GT91 4FS3A 4GWKA 4FFNA 5EMNA 2OY0A 1Q7CA 5T64A 1RAFA 2GCEA 1PGJA 2OM6A 4RBNA 1XPOA 2GNOA 4QM6A 3L7DA 4WOCA 4EG3A 2ZITA 3VR6D 1R8YA 2WAMA 2Q2VA 2PZKA 3R5HA 1FTNA 1SC6A 5B58C 4UBJA 1L0BA 4M9XA 3RU9A 3UB2A 3WGMA 3RAEC 1QTNA 3BIXA 3MCUA 1J22A 2W43A 4I0WB 1RXWA 2ZANA 2OQRA 1ZHOA 2OEPA 3I0NA 2XZLA 1Q0PA 4WKOA 1PYDA 1AO3A 4ALLA 3HA7A 1NC1A 1ADBA 4JLJA 1GAWA 1M54A 3QXCA 3D5QA 2ST1A 1W48A 2QXUA 1S4MA 1CY8A 2JEYA 4JUBA 4RLHA 3AHHA 4A82A 4MV5A 2NU9B 4ENPA 5LMNB 3ADKA 4E13A 4O4LF 1U1EA 1UDRA 2WYVA 2JRLA 4RH1A 3LVFO 5KINB 3RYIA 4OQPA 3D3WA 4UUBA 1QIGA 3LYLA 4NLLA 1AURA 2LW7A 3Q3VA 3AM3A 2BFMA 1O2DA 1DTWA 1BH2A 3AR8A 2F3QA 2V7XA 4KXFB 4YJDA 5KZMB 1E3LA 1FPMA 2PWYA 5JTTA 3DE3X 2XOEA 3PNVA 1PF7E 4JV5B 2O5RA 3MBIA 1ST3A 2I6UA 1M6EX 2QVXX 1C7ZA 4HD8A 4IP0A 4PINA 5DK4A 3F8TA 3RSQA 1T8SA 5BWCA 1P73A 1UF9A 5EXPA 2WWIA 3UB4A 1CIPA 1LLDA 3KFLA 3QE2A 3QPBA 4HJRA 3JAKA 3ZBPA 3E1GA 5KTPA 3DKKA 5LJLA 3TTXA 4YJ2A 3BMNA 5E1BA 3U1VA 2D1QA 3TD6A 3QG5A 5CITA 1XK6A 1P2FA 4RV5A 2CC2A 2FZLA 3K1ZA 4G1EB 4GD3Q 4I55B 2ZIAA 3IDOA 4GPBA 3X2FA 4C5CA 1NQAO 3PC8A 5C1PA 4H7IA 3TD9A 5KMGA 1XFDA 1ECLA 4LKOA 3NYIA 2O2GA 2WMYA 1L5MA 2FN7A 2J7KA 3V80A 3ZE1B 2PZMA 4ZQCB 3HPRA 3EGDA 1S2LA 5ADVA 4AY3A 3FGPA 2J6HA 3OQIB 2Q27A 1Z4KA 5ERXA 1OXKB 1B42A 1OFIA 3H11B 4V0ME 3VH4A 3VJLA 4DGSA 4DQ0A 2P9HA 2QMHA 3BMOB 4QU0A 5LBUA 2O8CA 3I2KA 2NO9A 1EEXB 4YUVA 1EYZA 1LNSA 1RZUA 1T13A 4HB2A 5LN1A 1Y5RA 1F6DA 3HV0A 4CL8A 4DWVA 2ANBA 2O8BA 4W5RA 4KG7A 1ONPA 1E3SA 2ECQA 2WSYB 5EJFA 3RIGA 3VOBA 3S2EA 2YZMA 4DJJA 1GFIA 1Y8CA 1DTSA 2OGSA 4V24A 1WE2A 2IHTA 4R6WA 3GRYA 2VT3A 3U4MA 4DA0A 4ER5A 1P75A 3R09A 4BLPA 1JQ3A 5GONF 3HGQA 3WLTA 5DHSA 1IBLB 2Y99A 1PTJA 2PMDA 4OJKA 3A25A 4J2OA 1U31A 8GPBA 3GD5A 3Q3IA 2V9CA 3CN9A 1TC1A 3NHWA 1SXQA 3SEQA 3JW8A 2PH5A 4IS2A 2WNSA 3F6CA 1FLAA 1NN5A 2HJVA 2CK3D 2A30A 4YRRA 2Z43A 4PLCA 3ZTYA 1XV5A 2WWHA 2OXCA 5LL6P 3GCWA 4DVGA 5AK4A 1GQOA 2CBXA 4NS4A 3MXOA 4XGRA 1XJ5A 4AF7A 3VBCA 1YVEI 2IGBA 4KLRA 3CCBA 2QSJA 2QRNA 1C41A 4J9UE 4TKUB 2BGMA 2CNOA 2AK3A 4GZLA 5AW9A 4B3IA 2EZUA 2H2HA 5HSGA 7AT1A 1VKZA 2ENWA 2YFQA 3AZOA 2WU3A 2P35A 2XYHA 2YXLA 4M9ZA 1WPQA 1ILEA 4JI7B 4QM7A 2G28A 3K0CA 2IGTA 3ZVLA 2QOEA 1TE2A 3CE9A 2RK4A 2PZ8A 1DB3A 2P5UA 2DUMA 4R1MA 5CPFA 1UBGA 2MSLA 2ZB2A 1WA5A 4V0NA 4CHGA 1GCGA 2AMJA 1WU7A 4UXHA 4ZRDA 4V2UA 4LJ9A 2D3TA 3VVCA 5DU2A 4FGKA 1B3RA 4MVWA 4Q37A 4WASA 3PHHA 3TQCA 1W46A 1QHNA 2A57A 3E61A 1MENA 1TO1E 5AJWA 3Q8MA 4UNRA 2GHTA 3MGBA 1OI7A 4L22A 3FCYA 4L8VA 1VL8A 1XHFA 4Q16A 1ZRSA 4RGBA 4YRQA 2ZIEA 5JARA 2TMYA 4WN9A 3TCNA 4YRMA 2C57A 3SC2B 2XB8A 4CMHA 1ULHA 2CDRA 4TWJA 2YVKA 5MGBA 1F0YA 4AZ0B 4XVUA 5JSQA 1W2WB 1YRQA 2AFHA 5KDDA 1B23P 4QEKA 2FUCA 1NL3A 2IW1A 2XT0A 3CBQA 3HE3A 4MAMA 3SKVA 5CB4B 4WCDA 3A9WA 2A1UB 4ARZA 3FG9A 1V3TA 2NV0A 4UDXX 4WERA 4LISA 4DLPA 5JAMA 5LYJB 3KK0A 4E22A 3DQZA 4HVAA 3ZGOA 3RFXA 5AXBA 4QDKA 4XWYA 4M1TA 4BUZA 1YB4A 4JLVA 4OAQA 5A6SA 5KTSA 3M1AA 3RVBA 1NVKA 3IV6A 4YQEA 2G3YA 4B7CA 2YUIA 2GB4A 4OJMX 1QE5A 4XGKA 1ITZA 1C3OB 4PRZA 2LIVA 2WU0A 3HKCB 3F7TA 3RRNA 5KUTA 3HWWA 5K05A 2VP0A 1VI5A 4PZCA 4DM4A 2H5EA 3PFGA 2VF4X 2HREA 4HNSA 5TEVA 2H1RA 1PKEA 4PO8A 3Q7TA 1FUYB 5CYFA 4B8ZA 1E79D 5EJGA 4JT2A 5IBRA 1OHHD 1EPUA 3VMMA 1PZHA 1R27A 5E4FA 3QKSB 1OX4B 1W0JD 2Z4TA 5K4AA 5IUNC 5J4YA 2BFEB 1UOOA 1E58A 4RZHA 2OC4A 3D6MA 2CLSA 2K2QB 2W0SA 4HDRA 4CE6A 1WCIB 4IX9A 3BB4A 3RVNA 3DLPX 1C4XA 2OHXA 4XWGA 4RJTA 3AEQA 3EN0A 2C3YA 4MIEA 2VP6A 4OSOA 5JZSA 1CD5A 3EGCA 4ZOCA 5FA5A 1EJ6A 1NDHA 2WYWA 4GGOA 3SX0A 3UJCA 4DN6A 3RVLA 4Y6OA 1AKNA 3L1UA 5BN4B 2D13A 3GW8A 4FIDA 3V1TC 2Q50A 3H1GA 3WICA 3NYQA 3WB9A 2JA2A 4DMCA 1SKMA 1KYQA 1L5ZA 1SU7A 2ZTVA 3C70A 5CCBA 4M7WA 4F4IA 4KHPB 1ZWKA 4HAOA 4FOTA 3AI1A 3UT0A 5CG1A 4QYXA 1JAXA 1UJ4A 4QUAA 1HTWA 2P2NA 2RK3A 4DA4A 3JQAB 3D6JA 2W6NA 3KSRA 3EGWA 2QUBA 4Y7DA 4KFRA 4CMCA 3T9DA 3DAOA 2CBZA 3HKEB 4KTVE 4DLXA 2NO4A 3RYCA 2D5CA 4HY3A 4K9DA 1R0ZA 4RD2A 1FW6A 5AW4A 1GUZA 2RGNC 4D9BA 5KPJA 1YFZA 2W2KB 4M7PA 2VXOA 5FULA 1VJRA 4IIJB 3W2IA 5KU1A 1X70A 1E99A 4MWCA 3AO0B 2BBOA 3HJBA 1DAGA 1YR9A 2VF7A 4YIHA 5I4KA 2I9KA 4D3FA 1O95D 1NMSA 3IURA 2ZULA 3RS3A 1KRWA 2IL1A 4OH1A 3BE4A 1Z13A 2C9DA 4NR0A 4W7SA 3UV3A 1D1PA 5IZCC 5HJEA 4BCBA 5EJ2A 5AKHA 2X7JA 1T9HA 1NY6A 1CJKC 3H1TA 4H6XA 3I64A 2MIIA 2R60A 3VGPA 3ZUPA 1KO5A 4ZT3A 3V4VB 1PR1A 1YTLA 4I50A 3MS7A 4K9QA 4Y0NA 3QKWA 1L4EA 3LKVA 4OU5A 3N2KB 4PZAA 3IIIA 2BYTA 2X15A 4ZT7A 1TA4A 2ZRIA 4TLDA 4DC9A 4MCIA 4ZU3A 2PA3A 4ARUA 5KWSA 3GP8A 3IB6A 3PDIA 2NSLA 4R01A 1ZU4A 3ROXA 3EF1A 4EFMA 4J76A 4P6VF 1N1GA 3CE6A 4F2WA 2OXRA 3WIEA 1DC6A 1MTOA 1GXSA 4INZA 1R8SA 3EZLA 4NQRA 2FSHA 4OYRA 3WBKA 4B2IA 1VJ1A 3AUFA 4C4RA 4L2IB 4Z8XA 4NNPA 5EGSA 3QSYA 2VSOA 2KE5A 3Q7SA 1G5IA 4DIMA 2BMVA 2RAVA 1ISIA 2PVPA 2VQDA 4FYKA 4RQAA 5HQ3A 1IM5A 5G1PA 3FUVA 3W3ZB 4HHEA 5E7IA 3H05A 4MRAA 2BISA 2ATXA 1L7MA 2H3HA 5JCOA 1AGPA 3CN7A 5CMLA 5BR4A 5JRDS 4G6ZA 3SY8A 3ILVA 5FOXA 1T4BA 2F8TA 3RIHA 4FSHA 4AJNA 2ZKIA 3MTQA 3NM6B 2EFJA 3LTNC 2JLWA 1A72A 1JKXA 4Y2GA 1KC3A 3IXQA 3DBLB 2PS3A 3V1YA 1FFWA 4IIXA 2V7VA 1CY7A 5AKXA 1SAYA 2Y4NA 1Y3FE 1LGYA 5B2EA 5REQB 1G5TA 1QVZA 3KKMA 2IYOA 4LXHA 4NOLA 4D44A 1Y48E 3CNQS 3CZRA 4HLUC 4KBYA 4RE5A 2ATIA 3DE4X 3PQDA 4DR5B 4I5EA 1ZIPA 3JD3A 4LSGA 5CX1A 3OE7D 4IJUA 5E1DA 1KI8A 4DKJA 2DQKA 3AUSA 1SUPA 4QPCA 5JYCA 1KFCB 2P27A 1MNAA 4BB9A 2CMFA 2XXBA 2AN4A 5AHKA 1XKLA 3UGJA 1HLFA 4JBXA 2F67A 2QW8A 1W0KA 4UM9B 3ZHVA 1SH7A 1UODA 4YRZA 2P1RA 2JDIA 4JJEA 3T1YB 3ESDA 3LZCA 5JO0A 3X3HA 1OE0A 5DX0A 4EI2A 4PNHA 2IOFK 3IP5A 1K3UB 4K9SA 1B8OA 1P2VA 2FG5A 4LXXA 2J6IA 5KNDH 4U7GA 1CT9A 2EKLA 3BIWA 3VPBA 3Q3GE 1H6DA 4BO7A 2WOOA 4KR7A 5ALOA 2GVZC 2PL3A 3AJEA 1STOA 3EK2A 1KKMA 3ZKAA 3NPMA 5CDUA 1XPJA 2PCJA 1E6CA 1Z62A 1QHIA 2IY8A 1K7FB 3RKUA 1I5OA 2EQAA 2WE7A 4JFAA 3DW3X 1ONSA 5KX5F 3O38A 1NXPA 5KDLA 2IOYA 3U09A 2AR9A 4CF5A 1WWKA 3CW9A 2J9YB 3TG8A 2YYZA 1NJFA 2XGSA 3KJZA 1NF9A 5JQGA 1Z68A 4PYLA 4DBVO 4BP8A 4DNQA 5HF9A 1R9JA 2C9ZA 2A5LA 5FWAA 2IXDA 2V7QA 4L5YA 1W4ZA 1VKJA 4WGFA 5DCLA 1RE0A 2H85A 3U7JA 4BZXA 1V41E 1G20B 3FVVA 4C6SA 4EENA 2VJPA 3IPCA 3HCNA 1TW2A 3O1JC 2ZJ7A 3OWXA 4K6HA 4R9RA 4DIKA 1JU9A 1C14A 4NPAA 3SBXA 2EFYA 3CZPA 1CS0B 1OX6A 3PGKA 5T4BA 2DX7A 2ALJA 5GIPE 4JYZA 2Y1XA 1G2IA 3FZYA 3ICOA 3L7IA 1FP6A 4U3JA 1NU6A 3ILHA 4ZMRA 2HDNB 4N7BA 4U63A 4Z4QA 2VPWA 2Z57A 5EQDA 3W2EA 3N7UA 1DJOA 2KB0A 2R6CA 5CW2A 1GU0A 5C8VA 4RGYA 2E1RA 4W8HA 1W96A 2FLKA 4RY8A 1IMOA 3KPUA 1BDMA 1LEHA 1FUIA 2PKYX 1HK7A 2HTFA 5AVWA 2Q1YA 2ZBEA 1WCWA 3CF4A 3QKRA 5WRFA 4O4IA 4KO8A 1K9SA 4HRAA 1V5WA 1V5FA 4KI0A 1GPLA 1IY1A 3UIEA 1CS4C 3AU9A 1CP3A 4JB3A 2QTHA 3LOUA 5BRNA 1IXSB 3IVMA 3N2EA 4Y98A 4BN4A 4P0PB 1TD1A 1BA3A 4M88A 4Z1OA 1HE4A 5AVJA 3ZTWA 3MTIA 3UM9A 1QGUA 2FEOA 3ETDA 4GMFA 4EVSA 1RVDA 2WLSA 5HUHA 1H1LB 1KVRA 2BN4A 3AJ9A 3LUPA 2I4TA 4KFSA 5BOVA 4RIIA 1I1OA 5ED0A 2IY7A 2GCOB 3BBLA 3AR3A 4WNIA 3SSAA 3VYUB 4E5MA 1JKJB 3ZPXA 3MTBA 2XOKD 1DQNA 2BEVB 4RACA 4UAGA 4RA6A 4YONB 1EUCA 4EATA 3OZBA 3PVCA 1ESZA 3LQ2A 3JVEA 3QMVA 4PS0A 4U2FA 3W04A 1WB9A 1NU8A 2EIXA 2Q8QA 4QREA 5E9WA 1FIUA 5KSYA 4TL8A 3AVOA 1N6NA 3JD2A 2ZGVA 5BNTA 4ZU6X 4KZKA 2B83A 1RYHA 1KJWA 2DT5A 1K88A 1L7XA 2OO3A 3JSXA 1KMNA 4G5GA 1OLUB 3Q7RA 3FF1A 3I04M 2G1KA 4BVFA 1Y5LA 1QS0B 4LMPA 1AK2A 1J99A 5JROA 3CX3A 3IMKA 4YHHB 1K7SN 1IWBB 1EMDA 1LW7A 3SC3A 1GDDA 1U7PA 4QOFA 3T12A 1UPTA 1TA9A 3BGOS 5CFMA 2BHSA 1E0JA 3LH5A 1X8LA 4ID3A 3BE6A 2ILVA 3GQBB 2QTGA 3CH4B 1U3GA 1VFNA 3AVTA 1KEEA 3KJNA 2FN3A 1JR2A 5EJ8A 1XZLA 2KJQA 3FWKA 4GYKA 1G5QA 2OBNA 3FOBA 3H9GA 3LVQE 4NI5A 4HUJA 1YZNA 2XVXA 1PFKA 1QV9A 2QROA 3GUUA 4HNAA 4IMRA 3WGKA 4E1AA 3DFZA 3O3MB 3N86A 3ZLJA 2DR3A 2E85A 3RO7A 4YY3B 4A9AA 2NYUA 2AZXA 4X1YA 4OFXA 3RFTA 1KEVA 1V47A 1LS1A 2G9ZA 5ICCA 1GGJA 3QOWA 3RUFA 1PSWA 2FR0A 4IX1A 3WHIA 4GOJA 5IVPA 4J6FA 4AZ3A 9ATCA 2FQYA 3KKLA 2PMBA 2A6PA 4A3SA 4O1MA 4YA6A 3FWPA 3KVNA 5DCUA 3WRWA 3EXHC 2CB0A 2AJBA 4JKOA 1UKVY 3QX7A 5ERGB 3TVYA 4OU4A 1SBTA 1S2MA 4QXOA 1U5BA 3KOOA 5A3SA 3UAOA 1W6RA 1W9MA 3HLKA 2DHEA 4NBNA 2QENA 2HYIC 3ZDAA 2C20A 4GI7A 4TQGA 1G9SA 1X38A 2QL7A 3PXCX 3TB4A 1G21E 4AMZA 5BQXA 2H51A 2VDLB 2V7GA 3M6LA 4X7RA 1J5XA 4RVFA 4NARA 2ZRCA 4GGPA 2O0LA 3IEPA 1QNFA 1ZITA 4U9HS 4C08A 1QHHA 1F8UA 2QWXA 3JYPA 4XJVA 3N28A 4TRNA 5TSDA 3MWEA 3GFSA 5K51A 4BFCA 2BCGY 3GB9A 4JK3A 3P9KA 4DQKA 2IKQA 1RAEA 4QFCA 2Z6AA 4XFJA 1XQ1A 1LQTA 5JAZA 2GYWA 1ECPA 2OAP1 1VCMA 3ON5A 3QFTA 2IA5A 1RQLA 4MDYA 2A9KA 2G04A 4PHFA 1XTZA 2G40A 3LPAA 2GMWA 2BD0A 4PSVA 4G84A 2IU4A 4KPUA 3VZQA 1M1YA 1D4ZA 5DPMA 4C5AA 2OHOA 3EXHB 4R0NA 2C2MA 1KKLA 2GN1A 3O3OB 1YVUA 2CXQA 3KUKA 5JD6A 4R1OA 3EPJA 4ZVUA 3FWNA 5EQJB 4HAZA 5LNK1 4ZARA 5BUSA 4D4GA 1CXZA 4BKPA 4JP1A 3QVGA 4BNJA 5CA1B 1KEZA 1X0VA 3DZCA 3P94A 2NU7A 1X7ZB 3GGOA 4N8EA 3CG0A 2OCXA 3E53A 5AESA 4WA7A 4EPVA 5FI3A 2G80A 2JVKA 4YMHA 3LJKA 4QSHA 3AHJA 4Z4IA 4OHPA 3N6XA 3OFKA 3T3NA 4AUMA 1LK0A 2QTCA 1T3ZA 4OJNA 3ENZA 4J7AA 1C1DA 4HATA 2HLHA 3I6QA 2ZR0A 2B92A 3N76A 2B30A 1VI6A 3O1LA 2FRVA 1XZIA 4CCSA 5D84A 1LQ2A 3SHWA 4X1KB 3CUKA 1X14A 3O95A 3OTIA 2CT8A 1EP9A 1NHGA 4PX9A 3ZYCA 5AQ1A 3H5IA 4RE6A 1UP7A 2WVHA 1E3WA 3LY9A 4K9PA 3QWBA 5DN6A 5A4AA 1NM5A 3FKSA 2F9FA 4FU0A 4IJVA 2QTZA 5EIXA 3OOSA 4GNKA 3JRWA 1KHHA 4YRLA 4ZVMA 2WU4A 4XM2A 4B34A 3TI7A 2R8ZA 3B38A 4MLCA 4RVSA 5LUAA 2ZJ6A 3FHCB 4RTQA 3TQIA 1FTQA 1QGAA 4AURA 3RBVA 1E59A 5FORA 3WI7A 4E08A 5K99A 4F2PA 3HP1A 1FCJA 4I1SA 5IM4F 5EIFA 3E9QA 4D82A 1QZZA 1M2FA 2E4YA 2R6FA 1KY4A 2PX3A 2XYQA 4AG5A 2WFMA 3ZHZA 3H97A 4BMDA 2LDBA 4JLKA 1ORHA 1QOPB 2WKWA 1SQ5A 4KXQA 3FPAA 3KR2A 4G23A 4M0UA 1K63A 4OQ4A 1SHKA 1U9ZA 1YQQA 1FYXA 2YTZA 2ETVA 3QJ5A 4HFRA 5JPIA 2XDQA 2GEDA 2JGAA 2XB9A 3U49A 3WMEA 4X8LA 1RAHA 1L8QA 2XB4A 2R2GA 3NI2A 2HXYA 3OZFA 4Q4CA 1U7XA 4GLFA 2RG7A 4MGYR 4KGDA 1ST2A 5K3DA 1T0UA 1XROA 3F97A 3MWKA 4JX9A 4EKGA 1IM8A 4WADA 4QNNA 4YAKA 3T6KA 4O4JB 1Q7RA 4WACA 4ZYTA 4OP2A 5MN4A 3ZHCA 1ZP6A 4FQ8A 4AP6A 4ESOA 5TR9A 1XTRA 2Q1WA 4EGFA 2JLZA 1NZJA 2BMDA 2WG1A 1AU9A 3N2IA 3O74A 4X94A 4ALNA 4C2BA 4D80A 4JUIA 3MMNA 1L5QA 4I8XA 3U4IA 5AUQA 4G8BA 2BEWB 4IDBA 3SC6A 1DZIA 3TTWA 4UBOA 1Z8HA 1M34E 2V0CA 1D2RA 3M49A 1E9RA 3L6BA 3VU0A 3ID6C 4ZIRA 3GLFA 4RFSA 3DL2A 1JHRA 1A3CA 4D3ZA 2O8BB 3B20A 1EHCA 7ADHA 5D8DA 1HQYE 3FI9A 4PZ0A 4FSDA 1NUHA 1IBCA 4I3FA 1E1QD 1NJSA 1QYRA 1DDOA 5F7JA 3AVPA 3FOWA 3OKAA 5BSEA 2H5IA 2QRLA 5FPYA 2OHIA 3FTDA 1B1CA 1Z33A 1K2WA 2FMKA 3CWQA 3LF1A 4XIYA 3REQA 4RLFA 1P9WA 4G0MA 1WS6A 3KZOA 3OF3A 1E94E 4QA9A 5KYUB 4G1VA 2R65A 1NMEA 3BWDD 4G8CA 5IN4A 3C7TA 4JNCA 1PQUA 3VVBA 3RU3A 4WBNB 2FMTA 4I9NA 1P9LA 2J9FB 4LSWA 4L27A 3D8UA 5JNSA 2XCRB 4L5AA 4TYNA 3A4NA 3Q3CA 4MR7A 5BURA 5KVCA 2XUFA 2CVPA 4RESA 2VPIA 5AYVA 1YS4A 1CBUA 3RS0A 3VSCA 3KYDB 4LVUA 3RG8A 4CN9A 2Q4DA 4D25A 3A37A 1M2KA 1KY3A 4KAJA 1TGYA 3Q2KA 1YA6A 3MC1A 5IEBA 1U0EA 3M6WA 1KARA 4TUYF 4PNEA 3IALA 3SXPA 3TQRA 2W2PA 4ZAXA 4D9GA 4AQ7A 1LK5A 2QM3A 3IFSA 2WPDA 3EDMA 1V71A 3AZQA 1QVVA 3SOPA 1SCQA 3MSCA 3DZ8A 4KK3A 4LBZA 1OT3A 1A4IA 3GT4A 4EYQA 5KREA 3LYAA 4J94A 2FW6A 4O2LA 4KNVA 2ZBUA 3VC1A 1Z26A 4O02B 3PCRB 1S3FA 3L8YA 1UPAA 3A6FA 3KHKA 3QU2A 1K06A 2VXCA 2GCPA 1JMVA 2D0PB 4OBWA 4CF3A 4N18A 3W3AD 4OUDA 3KJHA 3L92A 3INYA 1R18A 5AJHA 5F9MA 5HZHA 1NVXQ 3ESCA 4IZIA 5JS2A 3TSWA 1G8HA 1PR0A 3E58A 1ZGJA 1F48A 3ZWKA 3KEOA 1G8JA 4E30A 1T6BY 2XAUA 2DQYA 1F4PA 2PSDA 5G41A 1MIOB 2XCTB 1G8GA 3IOBA 4P3PA 1MJGM 3I9KA 2QI9C 3PIRA 1VCNA 2UXCB 1MZVA 3KVYA 3OE4A 5BPHA 3DBVO 4M6WB 3TOXA 1Z73A 1RLIA 5AW1A 4JYMA 2XNCA 3E1SA 4UOQA 2NP7A 3E4CA 5EWJB 2OM2A 2PRKA 3AF5A 3VPAA 3GR6A 1C30B 3PI6A 2YWRA 2WM3A 2XMDA 3ONEA 4Q3EA 2ERYA 2NZVG 2QAGA 4RVNA 1Q0LA 2ZI4A 2ZRDA 4XUDA 2Z6UA 3L6OO 1QO0D 1M0SA 2XB6A 4FX5A 3WLAA 2UV8A 1MX5A 4GBGA 1HNXB 1G8KA 4EDHA 1TJNA 1X1EA 1FYEA 3VR3D 1GG2A 2ZRNA 4QO7A 3WLEA 5BNZA 3I2YX 1MQ9A 1HLDA 2ISQA 3AINA 3C3CA 4HEQA 3U5ZB 2XUIA 2Z4SA 4J0GA 1FL9A 3FCEA 1N4DA 1W5SA 2EWWA 3BX1A 1OROA 1O4VA 4W82A 4W6ZA 5K8TA 1E20A 2RC5A 1LB1B 3B7WA 3D3KA 3MINA 1NP7A 1ZOOA 4UREA 2ZXUA 2OFPA 4BJHB 3ZWBA 4GXTA 1UM9B 2ORIA 4HGQA 4JVNA 4QXAA 5ETJA 3UQYS 3VV2A 3J80A 3EVNA 4GSLA 2WWGA 2XF2A 4BEJA 2ZI9A 3S68A 3Q7QA 1W9HA 1F0KA 1QUEA 1NJ1A 4XD2A 5DM60 3ZE9A 3P19A 1JR3D 3COSA 4JNKA 3T3IA 3G0DA 4FHEA 3WRXC 3QG1A 5BV1A 4QUDA 4BVKA 2WVJA 1MOPA 5EUCA 2EGGA 1TNDA 2OT3B 3QBVA 2X86A 1SCNE 5I3CA 4F6RA 1KC1A 2E82A 5IYZF 1WSBA 1XEXA 2PRIA 1Q0UA 4GAEA 1QOZA 2H08A 1EUYA 1FRFS 1LWOA 1RI2A 2P91A 1X7YB 2Q7XA 3R3WA 3WDSA 4EVRA 3C2QA 4I3HA 3VR6H 1ZOIA 5EWMA 1F5SA 1T9GS 2NUTA 1II8B 1L7AA 2NQTA 4RTJA 2PUDA 3TXXA 3KZMA 4JEHA 4OXIA 2UAGA 4RVOA 4BX3A 1EWVA 2XRYA 3VM6A 1QIDA 4A4DA 5F5NA 4H16A 2H57A 2ERCA 2DTEA 5DKFA 5K3CA 3ANXA 4N9QA 2W2XA 4C4XA 3U19A 4EHNA 1FQKA 2DFKB 3LC1O 2Z6QA 4YFVA 2VSXA 3DP7A 1D6SA 3EG9A 4PHGA 2YXEA 1JALA 3BF8A 5TMPA 3L05A 4BMZA 1JZSA 2MWMA 4LBVA 5CNIA 1ATZA 2NSDA 2G0AA 4FT4A 4OB6A 3KEGA 4B6QA 2DLDA 1YTUA 5IN5A 4ZHQB 1EZZA 2XWQA 3LPDA 2IQ5A 4O2RA 4UU8A 5LDHA 3HHEA 1RWKA 2CSUA 3OP4A 4PSUA 3SHOA 4JXXA 1N6RA 4WCFA 1JZQA 4K9MA 3FLAA 5AHWA 4HDSA 5BYBA 1X8XA 1DXHA 1G66A 3KOMA 1KYXA 1KMIY 2Z9BA 2HIHA 3M5PA 3OU7A 2I8AA 5KHOC 5F52A 5HZKA 2WQ6A 1EVZA 3ZHRA 4EUEA 2HBRA 5LA6A 2IUSA 2QE7D 4BQOA 1MF7A 1GTVA 1RHKA 3PF8A 4Q1CA 4JVSB 2HNKA 3HBJA 3PNPA 3ADOA 3R9WA 4X63A 4QULA 1HNNA 3EXG2 1YMUA 2IY9A 4M89A 1T5SA 1ZMBA 4Q15A 5BRAA 4KCGA 3ICWA 1FS5A 3CF6R 2WLTA 3EUAA 3A27A 3K5HA 2BGTA 1E3JA 2RHLA 2CXTA 3B5JA 1P6UA 3KAQA 2BELA 2B7BA 1LU9A 2VKTA 3PC3A 4L6CA 3GFBA 3O8CA 3OECA 1QYCA 2ZJ4A 2HV9A 3JYLA 3K09C 2QAIA 1PJ2A 1S3IA 3LTEA 3PJEA 3K1YA 4HMOA 4GZ5A 1RQ7A 3NS7A 4B35A 1FFYA 3D3NA 3HWRA 2Q5IA 4L50A 1JA1A 2NNLD 2AEFA 4HXYA 4JLWA 1A1SA 1KAGA 2D74A 4YJHB 5HMLA 5EZYA 4DQDA 4DYHA 3C3KA 2CNDA 3RJMA 4YCSA 2BBSA 2WG2A 4UTVA 3DHYA 3GJ0A 1PT8A 5GPBA 3ZWNA 3OQVA 2FOLA 2C3PA 4CM8B 1BHQ1 4K5QA 3BWYA 1XXHA 4TQAA 5BQ3A 1J2EA 4H27A 2RHWA 5JD4A 2EZ9A 5BMVA 5AVUA 3D5TA 3UENA 3BAFA 3DAFA 1Z4IA 3ZIAD 5ARBA 4V0LA 3JRXA 2C7OA 5B5SA 1IOLA 4HQ0A 5GY7A 3A3OA 5BPFA 5IT9A 3TOCA 1AG9A 1TUEA 1YBFA 2FSUA 1XAIA 2A78A 2TECE 3AJ8A 4EJ2A 4RLQA 1IZ8A 3K7EA 1ZYUA 4BN0A 1LC3A 1QO9A 4CV3A 5EE0A 2AF3C 1P1RA 3ACBA 4XVHA 2W90A 2Q0XA 4MLZA 1BQ3A 4BNDA 2R68A 1T6XA 3OJLA 2PRJA 3TE6A 1VKNA 1JR6A 4DA8A 1JDBC 5KCZA 4L6IA 1LKZA 4RMIA 3HDJA 4BNGA 4P4SB 2QD5A 2PPLA 3R7LA 2VAPA 4L4SA 3BREA 1YB1A 2OP1A 2WBLC 5KNDA 2WIAA 5FO0A 2I87A 5LB4A 4CL3A 5ED4A 1UT5A 3P32A 3RE1A 2NV2B 4NENB 3I83A 4YAJA 4C1NA 1FDRA 5K9ZA 2GJ4A 4WK2B 4B6SA 4AIRA 4KRXA 5I7UA 5INTA 3OJCA 4RSHA 4YTEA 3ZGLA 2IV3A 5BO5A 4KVGA 4YDQA 1C1XB 1CUDA 2C8JA 2B36A 2ID4A 2DYKA 1I3OA 4OAOA 1VMKA 4YUZA 1E2IA 1V5GA 2C95A 3WQHA 1PZEA 1U90A 1SXJE 1RYDA 1XCBA 1Z3IX 2FUNB 3GVHA 1V8BA 3NUQA 3O8QB 5B3LA 2RMKA 1KMHA 3O5AA 3RSCA 3HCCA 3PZRA 5BSKA 1L7QA 2H4FA 3P96A 4L75A 4BTVA 1VI2A 1J7JA 1I1HA 3P0HA 1DINA 5FHRA 4W5TA 4DLZA 2ZUBA 3IUMA 5E9JA 1ISSA 5EXDA 4FE3A 4NE7A 5CYGA 4MUBA 3W77A 3U56A 1T34A 3IE0A 1ZN2A 4URFA 5EP2A 1JDBB 3T7SA 5ALTA 1EFLA 5KC8A 1I2BA 2NSJA 1H2WA 1M0WA 2IPAB 2PL9A 1FDIA 2ZSBA 4M87A 4HF7A 1GV0A 3KVVA 4RADA 3UWDA 5LJIA 1OBOA 3DS8A 2AG6A 2C1ZA 2H2DA 4R6XA 3QJGA 2PUBA 1JFFA 1E4VA 4UULA 1C8VB 2WUDA 3I9LA 2QDKA 5ALDA 1II0A 2AZMA 2JAWA 4UTZA 4B46A 5IDYA 1KHTA 1YB7A 3HFGA 1A9XA 3AKZA 2A0YA 4YDHB 3WLJA 4BXOB 1EQAA 1EK5A 4BAGA 1DV2A 1I3KA 3CR3C 3ABIA 4DY4A 1U2ZA 3AUKA 3DGEC 1H2HA 3I01M 4NJOA 4NQZA 3VU9B 2PGXA 4S1NA 4DRZA 2CLEB 1EGAA 1QH1A 2FQ1A 2NPFA 3GEEA 3JD0A 3WK8A 3OIYA 2AIRA 4O0LA 1QHYA 2GM4A 4BGEA 3SICE 2A9VA 4HUTA 1URPA 5CXUA 3THWB 2HJGA 4G0PA 1MEEA 3SE0A 2C7QA 3I4CA 4A0FA 2NPIA 1Z06A 4KQMA 4PGMA 4JI1B 4ZHSA 3EEFA 3V4SA 1U7TA 1WV0A 2D2XA 2J5BA 3NJ4A 4GI5A 2VJBA 4F56A 4BLQA 3KPVA 2G0NA 2Z2KA 2ZJ1A 4RZQA 2FEAA 4BGIA 3GU3A 3W8NA 1Q14A 3CPSA 1LDMA 4GM0A 4KO1S 3B9BA 4R05A 4IQFA 3GFTA 2GJAA 2CVFA 4Z7OB