2VHXA

Crystal structure of the ternary complex of l-alanine dehydrogenase from mycobacterium tuberculosis with nad+ and pyruvate
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
371
structure length
368
Chain Sequence
MRVGIPTETKNNEFRVAITPAGVAELTRRGHEVLIQAGAGEGSAITDADFKAAGAQLVGTADQVWADADLLLKVKEPIAAEYGRLRHGQILFTFLHLAASRACTDALLDSGTTSIAYETVQTADGALPLLAPMSEVAGRLAAQVGAYHLMRTQGGRGVLMGGVPGVEPADVVVIGAGTAGYNAARIANGMGATVTVLDINIDKLRQLDAEFCGRIHTRYSSAYELEGAVKRADLVIGAVLVKAPKLVSNSLVAHMKPGAVLVDIAIDQGGCFEGSRPTTYDHPTFAVHDTLFYCVANMPASVPKTSTYALTNATMPYVLELADHGWRAACRSNPALAKGLSTHEGALLSERVATDLGVPFTEPASVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALANINE DEHYDROGENASE
publication title Three-Dimensional Structures of Apo- and Holo-L-Alanine Dehydrogenase from Mycobacterium Tuberculosis Reveal Conformational Changes Upon Coenzyme Binding.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
total genus 124
structure length 368
sequence length 371
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.4.1.1: Alanine dehydrogenase.
pdb deposition date 2007-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01262 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domain
A PF05222 AlaDh_PNT_N Alanine dehydrogenase/PNT, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vhxA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vhxA02
2FRDA 3NDIA 1H6CA 4AJ4A 1LSOA 2O50A 4GKVA 1P44A 2O7QA 5ICMA 4WGGA 1MG5A 5ER6A 3P7MA 2AE2A 5A4DA 5CDUA 1O89A 5MDHA 4JNKA 4Y98A 5KKCA 5A9SB 4OYRA 3INRA 2Y93A 3FCOA 4BNUA 4JCOA 3HJAA 2DU8A 3PXXA 4RDHA 4RZIA 3VKVA 3TL2A 5FEUA 1TT7A 1U5CA 1R0KA 1ZNQO 3GF4A 4PG4A 4ILKA 3HN2A 4M49A 4BNFA 3STHA 2OOSA 4BGIA 2DBRA 3KO8A 3GEGA 3FTNA 1GZ4A 1F0YA 4A03A 1C1XA 1UDAA 4CLEA 4NZ9A 4ZRNA 1MUUA 5KNLA 1AE1A 3BMOA 3PQFA 2B83A 3K30A 1JAXA 1Y6JA 5JLAA 1E7RA 3P5SA 1YBAA 2R00C 3GRPA 4XWYA 4LSMA 5KJCA 3WWZA 4BNYA 5MGBA 2EF1A 3SLKA 5ADHA 1YJ8A 3O03A 4BB6A 1FJHA 3RBVA 3BTSA 4XYBA 1B14A 2E49A 3WGOA 2VUUA 1GTMA 2QZZA 3OJOA 4J4TA 1KVRA 3RC2A 3M2TA 3RBZA 1IE3A 5TQVA 5A1TA 4U6SA 4WE3A 2GLXA 3V2GA 3WX0A 1NASA 4AJOA 5L51A 4GVLA 3O26A 3ANNA 3GK3A 2NTJA 2W2KA 4IGFA 4JP3A 3LF2A 3PWSA 3UGKA 2GYYA 1KVUA 3RROA 4NR0A 2JJYA 4Y9DA 1GYRA 1T26A 4JX8A 2NVUA 2B4TO 2VWQA 3GHHA 1B15A 3DBLA 4PLVA 1VSUA 2X58A 2W90A 4NU6A 4BQPA 3PQDA 4EJ6A 5IF3A 3HDHA 4JK3A 1EDOA 4CLDA 1HSZA 1ONNA 4FFPA 4MJLA 1U2GA 2AQKA 2V6BA 2VQ3A 3LC7O 3U3XA 3GGOA 3E1KA 2XOXA 3GEMA 3EDMA 1YONA 4GL4A 4YXFA 5T64A 3BAZA 4BNWA 4XQEA 1WLYA 5GZ6A 1D1SA 3OSUA 3JQ7A 3L9WA 4HWKA 5JCXA 4I5GA 3AU9A 3DAGA 1YVEI 3DBHA 1I3KA 1JKFA 2H9IA 2FHSA 3KOUA 2X22A 2XXBA 1BXKA 3ZWCA 2BMAA 3JD1A 3I9KA 4YJFA 3OIDA 4JGBA 1VLLA 3JQEA 4EEZA 4LGVA 3WOHA 4J4BA 1GQ2A 3KHUA 3L6EA 4DYVA 2NACA 3Q2IA 4XEHA 5KJ1A 4R41A 2BI8A 2ZB4A 2B4QA 4YAKA 4ZHSA 1Z7BA 4GX2A 2Z5LA 4BVAA 1SBYA 4CR8A 1PZGA 3FR8A 2D0IA 1ZMOA 5JPIA 3ITDA 3ROPA 2IE0A 3DEYX 9LDBA 1O95A 2B4RO 3KXDA 1H5QA 2J6IA 2X9VA 2TMGA 2DPHA 3F1LA 3GLQA 3GVCA 1Q7GA 4MINA 1ZK4A 3D3WB 3KYCB 1RYDA 4IDGA 2PFGA 1AHHA 1QYDA 2JAPA 3OIFA 1C0KA 3NKLA 1UXHA 1N5DA 2YFQA 4QSMA 4UUPA 4XYGA 5JO9A 4XIJA 3D64A 5F1KA 4CMEA 5A9RA 6LDHA 4LCEA 4J90A 1B16A 2VUSA 2FZEA 2ZTUA 2PH3A 3JQ8A 2CNBA 3OP4A 2BFPA 4PLFA 2UV8A 4FJ2A 1Q7CA 3C7AA 4TMFA 4XR9A 3WSVA 3ULKA 2G5CA 3KSUA 4FFLA 3P19A 4IINA 2X86A 3WJ7A 3RWBA 4TRMA 4RQUA 4Z3KA 1RYEA 4M55A 1D8AA 3ZWOA 1R16A 2BGLA 3D0OA 2J3JA 4E21A 1MXFA 4KWIA 1X14A 1UZLA 5GY7A 1R4MB 2VHWA 2FZWA 4ALIA 4CQMA 2Q2QA 4L4SA 4H16A 2CD9A 2EKQA 4YCAA 4DPLA 2E4AA 2CFCA 3IDSA 5HWSA 1PZEA 1R37A 2P2SA 3PK0A 3MTGA 2DLDA 2PD6A 1K6IA 4FFMA 1AHIA 4LVCA 4BO4A 2XXJA 5I7SA 1FMCA 2C0CA 1XKQA 2PGJA 1M67A 2VTEA 4I9HA 3ASVA 1ADGA 3JQFC 2NSDA 4PLPA 2IZ0A 3JQCA 2FWMX 1LSSA 1VL6A 1YBVA 5DN9A 3TZQA 4EYEA 3T4XA 3UHAA 1OZAA 3NTOA 3BZUA 4PLYA 1JA9A 3EUWA 2Q99A 1L7EA 4J2HA 4KDEA 4DWVA 5AOVA 1ULUA 3E8XA 3IIEA 1FK8A 2G76A 1A27A 2CVQA 1LLQA 2LDBA 4UAGA 5AXAA 2AQ8A 5KVCA 3VZPA 1X1TA 1WMAA 3N7UA 4CUZA 3PIIA 4CUJA 2Q1WA 4CL8A 2GASA 1GQYA 4K6CA 4E6PA 4NFYA 4BNNA 5TX7A 4QO7A 1E3EA 1KEUA 2QHXA 4J0FA 4F45A 1BW9B 3PHJA 3L4SO 3WMXA 1AGNA 1CJCA 4AJNA 1VM6A 1ADBA 4RO0A 3DTYA 1T1RA 1LRKA 3PHLA 1MG0A 3CMCO 3BMNB 1VC2A 3CZRA 3D3EA 3F6YA 3HADA 3IOYA 4BKPA 2B5WA 4YAGA 4ZJUA 4A27A 1ZK2A 4NIMA 5AQ1A 3DDNA 3KYBA 5TC4A 1E7YA 1XYGA 1KVSA 2VRCD 4KWHA 5F1OA 3K73O 5JY1A 3OA2A 4EUEA 4BGVA 4L9RA 2EHDA 5IXSA 3DQPA 4WASA 1BHSA 3AM5A 1A9ZA 2P9GA 5H82A 4EEXA 2GSDA 3WWYA 4DIOA 4DUPA 1B2LA 5A5FA 4XZ3A 2O3TA 3GR6A 3FD8A 3D4OA 2H1SA 4IZIA 1HF3A 5EPOA 1KS9A 3WIDA 1R6DA 4W7IA 2QYSA 4RPJA 4YRBA 4URFA 3LT4A 5A06A 2WD8A 2A94A 4L4XA 3S8MA 4L74A 2Z1MA 1HWYA 3KLMX 5U9CA 3WS7A 1DJQA 1GV1A 2R00A 5C3MA 4GI2A 3MWEB 1WDMA 1Q2XA 2YHIA 1GDHA 4TZKA 2C29D 3TZ6A 1RM5A 3EYWA 5C7IO 3UICA 3RKUA 4EBFA 2Y0CA 1N7GA 5FI3A 4U5QA 3FNEA 5C7OO 4CR6A 4NH4A 4MO2A 4D79A 3OICA 2DFDA 3KEOA 4WLOA 3ZWWA 1NBOA 2HCTA 4J2OA 1Z73A 3ZNNA 1Y5RA 2C82A 3QRWA 4JBHA 5BT9A 1DLJA 2E82A 4MOWA 4YQZA 3SEFA 5HRUA 1DC4A 2DTXA 2Q3EA 3NT2A 1U4SA 4DQVA 2BKAA 4YWJA 2EERA 3DZKA 4FBGA 3KSDO 3W4JA 2JD0A 2VZ8A 3PHGA 3P2OA 4CMIA 1VRWA 3DZIA 1HDZA 1FXSA 3VH2A 2Y66A 2RCYA 1PQUA 1GPDG 4Z9FA 5CAEA 1IUKA 4MVJI 2EP5A 2Y1DA 1QR6A 2ZB8A 5T8KC 4CM1A 2JAHA 4ROSA 1O8CA 2VOEA 1MFPA 1E3WB 1LC3A 1LQUA 1RM0A 1KVTA 4P38A 5ENVA 1PGPA 4QO8A 3IJPA 4RLHA 2C7GA 1XHLA 3JYOA 2SCUA 4YQYA 2C7VA 5CFZA 4Y6SA 3JQ9A 2O3QA 2ZTVA 3ZHYA 4NMHA 2P5YA 3Q6IA 1PS8A 3GQVA 4E32A 3ROMA 3A9WA 4J7UA 3HB5X 4WCDA 2GZ3A 4A26A 2DTEA 4E3ZA 1G0NA 2OO5A 4JQCA 2X7HA 4YTEA 8LDHA 4DIFA 2CDCA 1EE2A 2Y1FA 4E2YA 1HE5A 4HADA 3WYCA 3S2EA 3NDJA 4UUMA 1GD1O 3QLJA 2EEZA 1UXJA 3ZWVA 4QECA 2WE7A 1EBUA 1ENOA 4K9DA 4L4RA 2O3JA 1ZKMA 4D41A 3B1KA 3AUUA 1A5ZA 3I9OA 3TFQA 2I65A 4BNMA 2RHCA 4CLRB 4OOFA 1WZIA 4EI2A 4PVDA 5CEEA 3GGGA 2YV1A 4P22A 4E2XA 3BMCA 1C1DA 3Q9NA 4MKZA 1X7HA 3RUFA 3PWZA 4OGWA 3PHHA 4TKMA 1E1KA 4JJIA 4BO0A 5L45A 3IKTA 4YJGB 3GAFA 1XU9A 4NBUA 5GZ1A 3KB6A 1Z82A 4BNKA 2Q46A 1W4ZA 3JQAA 4S3MA 3GPDG 4BNVA 4CM4A 2YZ7A 3MOIA 5KCZA 1NHWA 5DZSA 1GR0A 2FSSA 1E7SA 3COSA 3ZWPA 3GGPA 4PZDA 3S55A 4R1NA 3F5QA 5K6AC 2VWHA 3OECA 4CMHA 3H65A 5JY6A 1LXCA 1SO8A 5DNAA 4CM8A 1IPEA 1DHRA 2NTNA 4OL9A 3L6OO 3AUTA 4R3WA 2NVBA 4J91A 4WCFB 4ZQBA 3V1UA 1YOVA 3NT5A 3V1YA 1U28A 3VH3A 3GZ4A 3E9NA 1TT5A 3H4VA 5AVOA 5L9AA 4J49A 3HQ4O 5JO0A 3AY7A 2FSVA 3SXPA 1LQTA 1XDWA 4GGPA 1EBFA 3NYWA 1I3NA 3DZHA 4CV2A 3UW3A 5COQA 4DYDA 4K6FA 4CQLB 4AJHA 1U7TA 3WR5A 2D5CA 4CMJA 4D0SA 3ROKA 3DB2A 3G3EA 2FOIA 5EQDA 2HSDA 3RUAA 1IY8A 5T6BA 4G65A 1JLLA 2HDHA 4R3NA 4WJZA 3TNLA 4BNXA 1ZZEA 2Q1UA 3E03A 2YY7A 3AM4A 3NUGA 1EMDA 2F1KA 4UUNA 1H94A 1M2WA 3IQDB 3JQFA 4R1SA 3I9LA 4XQGA 1DAPA 4KTVE 1CQIA 4GX5A 4J1SA 1Q0HA 1QYCA 3ETGA 1GQQA 1JWBB 3I5MA 3FWNA 1PJ3A 3BMQA 3GFGA 1YWGO 5THKA 1Y9EA 3JYNA 3INGA 1C0PA 3W4IA 3KM0A 2X5KO 3JTMA 1I2CA 4LMPA 1LX6A 3UAGA 3AI2A 2ZQZA 1K89A 4HBGA 4S1VA 2UYYA 1WPQA 4BO2A 4XQ9A 1WDLA 4O0LA 1L7DA 3TL3A 1AUPA 1C1XB 4ND4A 4UVGA 4OIMA 1YH3A 2QIOA 2GZ1A 3I9JA 3GMSA 2A9FA 1U4OA 4P4GA 2GO1A 2YW9A 5G4KA 4CM9D 4WOKA 3G0OA 5HS4A 5J23A 3ABIA 1JKIA 4R69A 3PEFA 5B37A 1P74A 5T67A 3TWOA 3V2HA 2VNAA 1Q7BA 3HUDA 5TT1A 1JKJA 5DBIA 1ADFA 1T1SA 5EL0A 1R0LA 1GYQA 3OEWA 4UVIA 3SJUA 1H9BA 1T2EA 5KJFA 1VJ0A 3JQBC 2D1YA 3ANLA 5G0WA 2P4QA 1M6HA 3S2FA 3LVFO 3FBTA 4BMVA 4B7CA 2PD4A 1LC0A 1YKFA 3UCEA 2H6EA 4YDRA 4CM6A 1HSOA 3QVOA 2NVUB 2A35A 3WTBA 6ADHA 3AOEC 3TZKA 4BHTA 5L4SA 4XRRA 5I8WA 4W4TA 4MVJP 4IDDA 4BKOA 2DPGA 3GFBA 3L4BA 4O5OA 3RAJA 4D45A 3C24A 3PP8A 1YQXA 1EK5A 1H9AA 5JAIA 1GAEO 1ZK3A 1ZSYA 3HB4X 3PHIA 3WGYA 5GZ3A 4N7RA 3DO5A 5IAAA 1QYWA 3DHNA 2CSUA 3D7LA 4GKBA 4BV8A 1EDZA 3U4IA 5BSGA 4RPKA 2VRBA 4QQRA 2EGGA 1R4NA 4HXYA 2GUGA 4XDZA 2BFMA 3ZWBA 1WXDA 1LUAA 2VWGA 3JQ7B 4XYMA 1A71A 4NJMA 3DBHB 4WPGA 2PLAA 3CEAA 3RJ5A 4B7UA 1ZSNA 2GPTA 1JVBA 5TJHA 3R0IA 4NJOA 3GG9A 4L75A 3ZU3A 2VYND 2BRUA 3ZGYA 2XPCA 3GN2A 2E48A 3PGXA 4PZEA 3U4HA 2JD1A 3LC2O 3R1IA 1A7AA 5EJ2A 4LCJA 3GMDA 2J5QA 3GG2A 5IZ4A 1IOLA 5I9MA 2B36A 2YDXA 1KOLA 3EMKA 4NBVA 4JIGA 2JFHA 1M75A 4ZQGA 4BNHA 2R2GA 4IIUA 4YVFA 1HDOA 1UXIA 2BFOA 1V0JA 3UOGA 2Y0DA 1A7KA 4TROA 2DM6A 3V8BA 1TLTA 1JVSA 4NU5A 2O2YA 1PIWA 1O5IA 4I9NA 1V8BA 5DOVA 1I01A 3PWKA 4Y67A 3V1TC 1SAYA 4N5MA 4CM9A 1DIRA 2PKQP 3JQ8B 3ZWXA 5JNLA 2PH5A 4O1MA 3ADPA 1ZVMA 4RPGA 1EZ4A 2EJWA 3QA9A 4ZVVA 2YQ4A 1KERA 4OSOA 4CMGA 4W82A 1E6EA 3VC7A 1OMOA 4DLBA 1D4FA 5JDCC 1PEDA 2HJRA 1NYTA 1N1EA 4RVHA 1U7HA 1K2WA 3PJEA 1YRLA 3PJGA 4FPXA 5JAZA 1X0XA 3TJRA 3TOXA 1HETA 2OHXA 1J0XO 1R66A 3PJFA 1K5HA 3ZU5A 3MZ0A 2IXAA 4HFJA 4RL6A 1ISJA 2OUIA 5CHEA 1PL6A 4JJGA 1GEEA 1LNQA 2X1HA 3ENNA 3WLFA 4CQMB 4ALJA 3SC4A 4GH5A 3WGZA 3EGOA 5A9TA 3U9LA 2Q2VA 1P31A 3A14A 5BSFA 1LU9A 4DPMA 4XGIA 1B3BA 2BF7A 1P45A 3OQ1A 4FDAA 4GSLA 4JXKA 5TSDA 2ZYGA 3E18A 1NVTA 1XU7A 1P1IA 2GNAA 4FOOA 2HMTA 4YJDA 5A02A 1EVZA 1PSDA 2HO5A 4B79A 2OP0A 3ZWMA 5K6AA 2FR8A 4CM5A 4R54A 2PNFA 3RCBA 3F3SA 5JYDA 3PJDA 2QRLA 5C5IA 2EG9A 1HZZA 2ILTA 1W6UA 3FWZA 5LDHA 2PK3A 1LEHA 1LSJA 1VL0A 1YO6A 1O94A 5TS3A 1Y5MA 1FDVA 5JXWA 4I08A 2PV7A 4RPHA 1ZEMA 4GGOA 1BDMA 1GUYA 1PQWA 2X4GA 3H5RA 1ZUD1 1Z7EA 2ZJ1A 5TGDA 3QV1A 1GZ6A 4PVCA 2VYNA 3SVTA 3UUWA 3I9MA 2YJZA 4A2CA 4BO8A 1O9BA 4F6LA 4YA6A 4RF2A 1DB3A 2EKLA 5TNXA 3SX2A 3ONDA 1C3VA 4UVDA 3C1TA 4AL4A 3ZN2A 4BO7A 3TZHA 1N8KA 4UEJA 1G1AA 1N1GA 2GN4A 2I3AA 3A4VA 3C3XA 4PLHA 1DOHA 4QFDA 4P4NA 4RF4A 4Y6RA 4A73A 4CQMD 3JD2A 3Q3CA 1HDRA 1V6AA 1M66A 1PJCA 3ZHZA 4U0KA 1Y81A 5G0SA 1B8PA 5IDQA 1ZSVA 2ZK7A 2IZZA 3EY4A 2JL1A 2V7PA 1E5LA 5IG2A 1LLUA 5DBFA 4R1TA 5EMHA 4HKTA 3VZSA 3F46A 5JDIC 5ILGA 1W8DA 1A4IA 1UAYA 1EFLA 3K2EA 3CIFA 2C5AA 3GDOA 2DTDA 1ENYA 3VDRA 4B3HA 1RWBA 4XQCA 4UVEA 2X9NA 3OJ0A 2NWQA 4CV0A 4B7XA 4LISA 2I99A 4IQ0A 2GF2A 2IEBA 4OM8A 2LDXA 3VH1A 3T7CA 4RVUA 3VPGA 5JSFA 2DBZA 3INTA 5DF1A 7ADHA 1HE4A 3AFNA 4XB1A 4M89A 4YAIA 2GN6A 3U09A 1UXGA 2G0TA 1E1NA 1NFFA 4U0JA 2YHIB 1DXYA 3QQPA 4IXWA 4JROA 4C7JA 1PWZA 3I4FA 1LDYA 3TFOA 2V6FA 1E5QA 5TT0A 3KETA 2G1UA 1K6JA 3GN1A 1FDTA 4ALNA 1G0OA 5TIIA 1KC1A 1PU2A 4YPOA 4FFOA 3FI9A 5U4QA 3FNGA 3DWFA 4QTZA 3WGTA 4R5MA 3PGJA 5CG1A 2QX7A 1E1LA 3ST7A 2O4UX 3IP1A 3RUHA 3ZU4A 1PGJA 1DFGA 2NNLD 1NPYA 3ONFA 4AICA 1EUDA 1FDUA 1UZNA 4J4HA 5JE8A 3ZHXA 3JD4A 3KTDA 2I66A 3IS3A 4CMIB 1Z75A 2O23A 1R0SA 3JD0A 1QMGA 4J3FA 4J7XA 4QT0A 3TN7A 2P9EA 2YUTA 4QX6A 4RORA 3DBVO 3AOEA 1ZK0A 8ADHA 1HKUA 1E92A 3QSGA 4DBZA 1HE3A 4L73A 4NK5A 3NRCA 2VUTA 4I1IA 3W6ZA 2CZCA 3FNFA 4QEDA 3BTVA 3UXYA 1NAHA 3I1JA 2JFGA 4HFMA 2AEMA 2VYVA 4WLUA 1TVEA 2OORA 4E13A 5KOIA 1UP6A 4IJKA 3RBXA 3ZV5A 4BV9A 2Y1CA 1UH5A 3WDSA 4WLVA 4IBOA 4E0BA 3JYLA 1NPTO 3O8QB 2CVOA 2FR1A 4RF3A 5FF9A 3JV7A 1PZFA 3CZMA 3MJCA 2X5JO 2YV2A 2ZB7A 2PGLA 1R12A 3IP3A 5TJ9A 5B4TA 1XSEA 2X0RA 3ZW9A 1EE9A 3PYLA 1BRMA 3W8EA 2UAGA 1FDWA 1KYQA 1Q0QA 5DP2A 2HJSA 1PTJA 5BQFA 3G79A 1IHYA 3U5TA 5I9LA 2PZLA 3BMCB 1DFIA 2IDZA 1SPXA 2NADA 2EGHA 3C7CB 3ZV3A 5CDYA 2HK9A 3S1LA 1NWCA 4DC0A 1C0IA 4Q3AA 5COBA 1PJTA 3FBGA 2JHGA 1V9LA 4FFRA 4AFNA 2RHRA 3JQAB 3PYMA 3BTUA 4CM4B 5DULA 2CF6A 2CF5A 5ES3A 4MVJM 1DDOA 5IDXA 3PIDA 2CY0A 2J8ZA 5LC1A 4R1UA 4R9SA 4XCVA 4XB2A 1PJBA 1PS9A 1XLTA 2ZB3A 4OSPA 4B3JA 1JAYA 3AY6A 4B4VA 5JC1A 2C07A 4CM8B 2DBQA 1X13A 4B8ZA 4JLWA 1Y8RA 1I30A 3DOCA 4DPKA 2WYWA 3QWHA 4CMCA 5JFOA 1N7HA 5HTOA 1VJ1A 4E4YA 3O4RA 1F06A 4K1LA 2BFAA 5AXBA 1YOVB 3ANMA 2I9PA 2YYYA 1TT5B 5JDCA 1EQ2A 3WIEA 4H15A 5CP8A 1L1FA 4Z3DA 1YQDA 2XAAA 1BXZA 3Q9UA 1LI4A 4U6QA 4QUKA 1PR3A 3MEQA 4IDAA 4OHUA 1H93A 4BIIA 3RFTA 2YFHA 5A5EA 1MV8A 4I5DA 1HZJA 1A9YA 4CLOA 2R6JA 1NQAO 5ER9A 4IUYA 2GN9A 4CMBA 1ENZA 2BGKA 1M76A 5G0VA 1VKNA 2ZJ0A 1VE9A 4KP7A 4A7PA 3OA0A 2PY6A 3OMLA 1E3IA 1I36A 1SEPA 4ITUA 2AG5A 1E7WA 1WAMA 4BO1A 5A04A 1IYZA 4Q3CA 1QP8A 3AJRA 3JQAD 4Y8VA 4BMSA 4NG5A 1A72A 3HNPA 3EK2A 3FSRA 1GPJA 3NDRA 2CMDA 5B4VA 2VT2A 1GFSA 1HDCA 2UVDA 1MLDA 3ZH2A 1QORA 4H7PA 3FPLA 1MA0A 4BGUA 3W4KA 5CDSA 1I5RA 5A3JA 1YS4A 1GCUA 4YJHA 2RH4A 4CMKA 4AJPA 2H5LA 3DFUA 5F1PA 2V6GA 4YEDA 1QV7A 2JCYA 4AJ1A 4IIVA 5TF4A 5LDGA 1F14A 1I32A 2PZJA 4ZQFA 4DLAA 3U62A 3A06A 3WSWA 2B5VA 5JAQA 1ENPA 2ZIZA 4IS2A 3VH4A 4EW6A 1Q1NA 4PLZA 5FYDA 4BNZA 4RVGA 1LRJA 4RF5A 3CH6A 3PI7A 3RVDA 3VTZA 5BR7A 3CUKA 2RIRA 1EFKA 1DAOA 2W98A 4D7AA 1VSVA 3ZWNA 1MX3A 2JCVA 2AXQA 1OC2A 4NPCA 2ET6A 4AJKA 1E6UA 1ONPA 1W73A 2NVWA 1UAGA 1Y7TA 2VTDA 3E82A 2GCGA 5JDIA 1OI7A 1CETA 2O3SA 3D3WA 3KYCA 2BHLA 2X8LA 4RGBA 4DRYA 2Z1NA 1T4DA 3V2UA 2WM3A 3DMYA 1CIVA 3H3FA 3L0DA 2WYUA 3RFVA 5T57A 2IZ1A 4QXMA 2AQIA 4JBIA 4ZN6A 4KUHA 3ZV4A 4WNCA 4NK4A 4OKNA 2JHFA 4A5OA 2FY8A 1GY8A 1MFZA 5HA5A 1LSUA 4OXNA 1PR9A 1PQPA 5KVSA 4CUKA 3M2PA 4RVSA 2EKPA 4PLGA 3U0BA 2C2YA 4KOAA 4LMRA 4EITA 1IULA 4I9UA 4Q3EA 1Y8QB 2NQTA 2B37A 2GR9A 4C4OA 1UXKA 4L0QA 1IPFA 1QYXA 1AN9A 4FN4A 3VZRA 1PGQA 2IRWA 3W6UA 4YT2A 3AUSA 3JQGA 4IJVA 2W4QA 5BNIA 4G2NA 1XIVA 1DIGA 3K92A 1EUZA 4NJMB 2I5PO 4MIEA 1SB8A 4R9RA 1BXGB 4XYEA 2V6MA 2WSBA 3GDFA 1ZK1A 1DRWA 4D43A 3DFZA 1XG5A 1H0KA 3QWAA 1MXHA 4FS3A 5GMOA 3WGQA 2C20A 1ZJYA 2X5OA 3GZNA 4EGFA 5HBRA 1XWFA 1SC6A 1P1HA 4OQYA 4DQUA 1NM5A 2J3IA 3KV3O 4R16A 1KY5A 1NVGA 1NNUA 3L9XA 4XGKA 4LVUA 1DHTA 3WQQA 1P77A 4ZA2A 3X2FA 3L77A 2W2LA 4NBTA 5JYEA 1JQBA 2P9CA 2PKQO 3PLNA 4NDNE 4RPLA 3W8DA 3BHJA 5DOZA 3DZBA 3HFGA 3KYDA 4DREA 3NV9A 2PR2A 2CDBA 1D3AA 3HDQA 3HSKA 3OQBA 3BTOA 4W9NC 2WD7A 3H7AA 3HHPA 3NGLA 3ZWYA 3ZI0A 4MPDA 4O59O 1YB4A 3C1AA 2Y1GA 2AMFA 3D4PA 4LW8A 3QVSA 2TMDA 4INAA 4DC1A 2J3KA 4GMFA 3F1KA 1WZEA 3QP9A 4BQRA 4CV3A 3OJLA 1J49A 3RC1A 1J6UA 4KUGA 3ETEA 2VHVA 4I8XA 2DC1A 3WQSB 3FN4A 1N9GA 2E37A 3BA1A 3I23A 3Q1LA 5EIOA 4NNJA 1P1FA 3PFFA 9LDTA 5AXCA 1HE2A 4Q9NA 3T7EA 2AE1A 4K26A 7MDHA 3O38A 3TPCA 2BLLA 3RKRA 2VN8A 2OGUA 1GCOA 4OQZA 4IQGA 1ID1A 4RQTA 3I83A 1S7CA 1UZMA 1U8XX 2J5KA 5IDWA 3IJRA 2FR0A 4UEOA 1K6XA 3KRTA 3BYZA 1G6KA 2EIHA 2FPIA 1WP4A 4Z9YA 1DRVA 4OO3A 3ZZNA 1YE3A 2F00A 5A05A 1PJ4A 1I2BA 4BB5A 3Q0EA 4YACA 3UCXA 3K6JA 5C7LO 4ND3A 5TLSA 2DUWA 1D7OA 2ZYAA 3JYPA 4WLFA 3BMOB 4HP8A 5F21A 5F5NA 3H2SA 2GRAA 1BSVA 4OAQA 4ND5A 4BS9A 1HEUA 4J1QA 4CLXA 3H9QA 2ZYDA 3KLPX 3TRIA 5JBIA 2ZTLA 3I6QA 2ZATA 1B7GO 4KTTE 1JDJA 4E5KA 1LDGA 1H6AA 4U7WA 1IB6A 3AFMA 2VZ0A 1BVRA 4BL5A 3OJEA 4II3A 2AHRA 4E5PA 4TRRA 3N74A 1U5AA 3QW2A 3H9JA 2NU7A 4ALMA 2P68A 3LF1A 4OXYA 4IM7A 3OEYA 4N5LA 3ZW8A 4HFRA 3I4CA 2RH8A 2W2KB 2Q2WA 1NTOA 3I3OA 4G5HA 3CPSA 3I9NA 3RFXA 4BMNA 3H5NA 3VTFA 3RQSA 1QRRA 5KVVA 1ZH8A 3RIHA 1F12A 3ZU2A 2Y0EA 4EJ0A 2EW2A 2C54A 4YRDA 4DL9A 4CM3A 1DC6A 4WLEA 3DBLB 4FJ1A 1UP4A 2Q49A 2O3UA 4KQXA 1SOVA 1X7DA 2CDAA 1W0CA 1T4BA 1ZO8A 3E9MA 3FNHA 1ISGA 3NEPX 5U1PA 4YT4A 3PRJA 2OBNA 1ISMA 4D42A 1SZJG 2WEKA 4XYLA 4GWKA 3HE3A 3WG9A 2POQX 4IDFA 3LDHA 3RASA 4RDIA 3D5QA 4M86A 4XGNA 4P4LA 3CXRA 4PLWA 1ONOA 3RI3A 3NAQA 3PQEA 3GA0A 4GLOA 4Q3NA 4BNTA 4GVXA 3FHLA 2G17A 4Z6KA 1BWSA 2P5UA 3GNSA 5IN5A 4YAEA 4RVDA 4BKUA 1V3UA 1ZFNA 1LDNA 4YJFB 1YBMA 3DBRA 4Q3BA 3VZQA 3GHYA 3U4DA 4NFSA 3KZVA 3B1FA 3H9EO 4TZTA 3RU9A 1VL8A 2Y67A 4JP2A 3VPSA 1P33A 1DSSG 1WNTA 2J3HA 4N5NA 4UREA 1KBZA 1HDGO 4ALLA 4E31A 4II2A 1V3TA 2J5RA 3AWDA 5COAA 5T8KA 2OMEA 4YJGA 4MVJD 1CRWG 4HNHA 4NI5A 5L7TA 3GC6A 1H6DA 1HRDA 1KEWA 3X2EA 4HX5A 4FJ0A 4WLNA 1Z74A 1SEVA 4RLSA 1LA2A 2BGMA 3OM9A 4WK6A 3VDQA 4CR7A 5IDYA 4N18A 1MGOA 4PCVA 4AJEA 4FSHA 1DBVO 4IMRA 3QWFA 3IL2A 3CSDA 3QWBA 1QG6A 5AXDA 4ZQEA 4YRAA 2FMUA 1HYGA 2CVZA 1F8GA 1YL7A 2OZPA 3AU8A 3DZJA 3LLVA 4LK3A 1EVYA 2A92A 1I10A 1I8TA 3F9IA 5HM8A 4MIOA 2O48X 2VHXA 3KSZO 1YJQA 1XR3A 1D1TA 5CPBA 1MC4A 2YHUA 5L7YA 2NU9A 4GPD1 1QSGA 3H5AA 1OBFO 1F17A 4EZBA 4FGSA 4MP6A 1WDKA 3JQDA 3LSYA 3GVHA 3GT0A 4MVJH 3R3SA 3WQRA 3NJ4A 4TRNA 3TDKA 3Q2KA 1CEQA 4XRGA 5A03A 3LT0A 1H6BA 3MCVA 1GZ3A 4FW8A 3AM3A 1NP3A 3HDYA 1K3TA 4GBJA 3NJ8A 3LU1A 1E77A 1CDOA 1HDXA 3IAHA 1Y1PA 2O7SA 4PGFA 4Z9XA 3GEDA 5EN4A 3OH8A 2DFVA 4TVBA 3ICCA 5L3ZA 2WTBA 2ZCUA 4MKXA 3SC6A 4AJLA 1DC5A 3HG7A 3EAGA 3EHEA 2NLOA 5I7VA 1P1KA 3UKOA 1M6WA 2QRKA 1A4UA 3WFIA 2NTVA 3WBFA 3ZV6A 1IHXA 3RUIA 1P0CA 2D4AA 3CKYA 3CMMA 5BSEA 1T2CA 3T4EA 1J5PA 4E5MA 2Q4EA 1HLPA 3EW7A 3JYQA 3VPXA 3OHSX 1XQ6A 1B26A 1ZCJA 2HAEA 1RPNA 2X0JA 4KDFA 4W9NA 2AG8A 5I7EA 5G0TA 4ID9A 1PJ2A 1QXSA 3GVIA 3O9ZA 1PJSA 4UULA 2AEFA 2IODA 4EDFA 1QLHA 3QY9A 4BKRA 1Y8RB 4DBVO 5FWNA 4LN1A 4F6CA 1HT0A 2HQ1A 2Q1TA 1DPGA 2VYVD 3NTQA 4L76A 1B8UA 3B20A 4DA9A 1T2FA 3K9QO 1E3LA 1PX0A 1LRLA 1T2DA 2JKVA 1BGVA 4D3FA 2OXIA 4GX0A 4MVJA 5JS6A 3D4NA 3GH3A 1GADO 2NM0A 4KQWA 4NBWA 1AXEA 5FFFA 1B3RA 1N92A 2PGDA 1E7MA 2VHZA 1BDBA 2GERA 2YDYA 4GQAA 4HV4A 2Y1OA 1PGOA 4UUOA 4I5FA 4XD2A 4CLOB 1E6WA 3AK4A 1TI7A 5KVQA 4U8GA 2GGSA 2DT5A 2W8ZA 1Z6ZA 2Z95A 5G2OA 5IXYA 4R5HA 1JWAB 2DQ4A 5DCUA 4RVFA 5JCJA 3E48A 2D59A 1SCUA 1YDWA 4MP8A 1SB9A 4E30A 3GUYA 3JCZA 2WE8A 4FC6A 5L7WA 3LT2A 1O6ZA 1XA0A 4RV9A 2Q50A 4RZHA 3U49A 4NBRA 4XKJA 5B1YA 4DIBA 1ZXLA 2PZKA 3WBBA 2Y05A 1NFRA 1X1EA 5T5QA 3DOJA 3H2ZA 3OIGA 2VHYA 2OBYA 1LJ8A 5CEJA 3JQ9C 3SBOA 1YL6A 3C1OA 1T24A 1B8VA 4YJHB 2C2XA 4XX0A 5JC8A 1GU7A 1SNYA 3KVOA 1X15A 5ILOA 1E1MA 1LDBA 5IZCC 4IDEA 1RM3A 3ENKA 2YQ5A 1HXHA 4C7KA 5DCWA 3DTTA 3PDJA 4GWGA 3G1TA 3JQBA 4FIZA 4BO5A 3IKVA 1HYHA 3NX4A 4XDYA 2AEJA 1I24A 1DFHA 3E5MA 3HFSA 3DONA 2HUNA 3BIOA 4PLTA 2HRBA 5JMWA 3W8FA 1PJLA 3R6DA 3ADOA 3D1LA 4BNJA 4W6ZA 3DXFA 1LDEA 4EUFA 4GSKA 5BSHA 1HLDA 1FDSA 1KIFA 2PA3A 2UUPA 3OQ6A 1ADCA 3GVXA 4FD3A 3V5NA 1HYEA 4MDHA 4DGSA 1YL5A 1BVUA 3G1UA 1PWXA 3WTCA 1NXQA 4D3SA 1R15A 3UF0A 1O0SA 2OL4A 3ZNPA 3D5TA 1ISHA 1P1RA 2P4HX 3H9GA 4XIYA 4DTIA 1HL3A 2DUUA 4BNIA 1ZW1A 5KIAA 2I67A 1LLCA 5DCYA 1E7QA 3TZCA 4WOJA 4BO9A 2OFPA 1VPDA 4O6VA 2QG4A 3ZNOA 2QYTA 1NQOA 4Z0HO 3AW9A 4IZHA 4ND2A 1WWKA 1VI2A 4NFHA 4QFCA 2D5AA 3DL2A 1E3JA 3WGGA 1ARZA 1DIHA 5L4NA 1WW8A 1DC3A 1IZ0A 2BELA 3DC2A 3UCFA 5IN4A 2EV9A 3B70A 3ZDFA 2A4KA 4UVHA 1C1DB 3RU7A 3RUEA 1BTOA 3LC1O 1PL8A 3JQGB 4J1NA 3A1NA 2HK8A 2EW8A 4OOEA 4AJIA 2EP7A 1NVMB 2WMDA 5CDGA 5A9SA 2FP4A 1KVQA 3TSCA 3GZNB 1DRUA 4E2WA 2D2IA 5L95A 1LLDA 3K8ZA 4ONEA 4D3DA 3ORFA 3OFSA 1PJQA 1PS0A 2ZCVA 3I52A 3FTPA 3GDGA 3HDJA 4AJJA 3UVEA 1I2ZA 4PG7A 5BNTA 1ISFA 1CQJA 2D3TA 4W7HA 4GAEA 2EJVA 3KYDB 1P0FA 1U1IA 3RC7A 3C8MA 1KC3A 1AXGA 1IZ9A 1NR1A 4E2ZA 3MJEA 2BH9A 2WD7B 1GEGA 1QLJA 4DMMA 4D44A 3QHAA 1EEHA 4YAJA 1E0DA 1VJTA 5F3RA 4TKLA 4MVJE 3R3JA 5KKAA 3F47A 4A10A 3GNQA 1H2BA 4KUEA 2WDZA 2IXBA 1OFGA 2X0NA 2ZTMA 2FN7A 3VOSA 2YV3A 3QIVA 4WEOA 3HN7A 3CTMA 3UH1A 5FI5A 1ISIA 2O2SA 4Q39A 1CYDA 1N9GB 3C85A 4B8WA 1MB4A 2HKIA 4WEQA 3ROQA 3P2YA 3FR7A 4MP3A 1U3WA 1KEPA 1JU9A 3PFWO 5C37A 3E9QA 3U4CA 1BMDA 3M6IA 4ESOA 4PG6A 5G0UA 3KBOA 3I6IA 1DO8A 2VNSA 3VVBA 5B12A 1NWHA 4CM7A 2HMSA 4ZQHA 4FCCA 3WJAA 3BMQB 3TOZA 4HNGA 3DMTC 2OP1A 1NPDA 2CUKA 3E6AA 3IUPA 4MVJG 1P3DA 3VKUA 2BI7A 2WJPA 4TWRA 2W2LD 3SLGA 2HMWA 3DAFA 4O63O 4FQ8A 5KWEA 1U3VA 4ND1A 1I33A 3L4BC 4J1TA 3GAZA 4WNIA 3VAZA 1DLIA 4PG8A 5L40A 3AUAA 4X54A 4J9VA 1GUFA 1PL7A 3EVNA 3K31A 5AYVA 4B4UA 1VKOA 2EXXA 4LRTB 1Z45A 1JN0A 5G4KB 1UJMA 2Q4BA 3HZZA 4A0SA 1ZXBA 1MP0A 4JJFA 1X0VA 2QQ5A 1K0UA 1PZHA 2PKRA 3RUCA 3M1AA 4ZU3A 3H6KA 4DQXA 3OBBA 5IFLA 5ENDA 1KY4A 3MOGA 2H63A 3ZHBA 5TRTA 4B4WA 5L4LA 4B3IA 4BNLA 3GVPA 5EINA 2X6TA 4YYZA 1IL0A 1ZIDA 4YBZA 5JW6A 3IUSA 3ZNQA 3ON5A 3DHYA 1U3TA 4H3VA 3VVCA 4PRLA 2PTGA 2DKNA 4WKGA 4KZPA 1TXGA 1SMKA 3EZYA 4PIVA 1DJNA 2Y1EA 1PGNA 3MWDB 3NT4A 4BGEA 4UEKA 2B35A 4J6FA 4BO3A 1JTVA 3RD5A 1NR7A 5DP1A 4WCFC 1YDEA 1YB5A 3PTZA 3RSHA 4IJWA 2XF8A 4IS3A 4TRJA 5CG2A 2HMUA 4J43A 3JD3A 4WECA 1R4NB 4B4OA 1XGKA 4CV1A 4PFJA 1XEAA 2B69A 2NUAA 3O8QA 1XCBA 4XJSA 5IZCA 2C5EA 1R4MA 3W1VA 4AVYA 3H3JA 3QE3A 2GDZA 4FC7A 4DLLA 4JN6B 4ZICA 2JCXA 5DBGA 4BKQA 5ITVA 1ULSA 4R4JA 4R68A 1C14A 2G82A 2HRZA 3WFJA 2PD3A 1DIBA 4IGEA 5EERA 3WNQA 3DBRB 2VRCA 1T2AA 1JW9B 3DHEA 4XR4A 3F5SA 5I8ZA 4ZRMA 5JMPA 4IJUA 2EWMA 3H9UA 4WUVA 1YB1A 4OKIA 1E3SA 3VPFA 1S6YA 1H2HA 3NGXA 2Q45A 4KMSA 3K2BA 1LDMA 2DAPA 5CEFA 1HDYA 1EVJA 4E5YA 2E6UX 4E5NA 1LBEA 4Y6PA 2VZ9A 5EQFA 2O4CA 5G4LA 4HFNA 1GUZA 1NHGA 3WXBA 3EC7A 2NV6A 2QW8A 1DEHA 4NQZA 4OMUA 1RJWA 4LRSB 4E12A 1U9JA 1EK6A 1OAAA 3L6DA 4HUJA 1NQTA 2WWRA 3DOOA 3GPIA 3WLEA 1UDBA 4RJTA 3KUXA 4OJNA 1UP7A 4EUHA 4MKRA 3LYLA 3VPHA 4FOSA 1OC4A 3FPCA 3B6ZA 3EZLA 4IDBA 1I3MA 1BW9A 5BNFA 5K9ZA 1UUFA 1NQ5A 2HLPA 3GUCA 4J0EA 3MJTA 3PZRA 2GD1O 2IYPA 2FPGA 3OETA 3IC5A 5ITWA 2IYOA 1V3VA 3QVWA 3BMNA 2X9GA 3IMFA 1ZBQA 5B4UA 4CJXA 3C7DB 4BOYA 4F46A 3K96A 4JBGA 4Q3DA 1CWUA 4YR9A 1KEVA 1T25A 4OH1A 2C59A 2PZMA 5ICSA 3WICA 4D0RA 2B0JA 4M1QA 3KEQA 3QVTA 2X0IA 3DR3A 4RCVA 3G49A 3MTJA 2HU2A 4NHEA 4YB8A 4K28A 5H81A 2QZ9A 1B0AA 1YXMA 4YT8A 1EVIA 3B1JA 3MJVA 3LQFA 4R51A 1J4AA 3AY3A 1ZMTA 1WVGA 4N54A 4M54A 4PG5A 5IJZA 4W99A 4M87A 1NAIA 2VWPA 2HK7A 3GOHA 4L8VA 1P1JA 3WNVA 1ORRA 2Y99A 3MJSA 2NU8A 1V35A 3H8VA 2GZ2A 2I3GA 3JQ6A 5THQA 2ZKLA 3E5RA 1UR5A 2PWZA 1SOWA 3ONEA 3QJ5A 1Q0LA 2WYVA 4BUCA 4CLHA 5A3VA 4P8RA 1GYPA 1N2SA 3HWRA 2RAFA 4XJTA 3OF2A 2RBEA 4MVJF 4BNGA 5CDTA 1FF9A 4YT5A 5LCXA 2V65A 3G17A 3RC9A 1U8FO 3NTRA 4OXKA 1RKXA 4CMAA 2X23A 4FB5A 3MJ4A 2QRJA 3AOGA 4TVOA 1TA4A 4PRKA 3UN1A 4D46A 4PLCA 2NQ8A 3ITKA 3WYEA 3ICPA 4LSWA 5CPFA 1Y9AA 4DMLA 2AW5A 4CPDA 4PN3A 1I0ZA 3A28A 4Z0TA 1QKIA 1CERA 3WMWA 2IEDA 1E3WA 1GV0A 3GNTA 1U3UA 3AI1A 5HS6A 4CODB 1ZEJA 2UDPA 5KJEA 3LZ6A 3DMTA 4ZGWA 3BHIA 1BG6A 1RM4A 3ZWAA 4E33A 4IQ8A 3WGHA 2VOJA 4FFNA 4CMEC 2I6TA 4F3YA 3F4LA 1ZJZA 1NX6A 4XA8A 4DXHA 1F8FA 4J16A 2DBVO 1YQGA 4PZCA 4BO6A 5EESA 3PVZA 5I7FA 1XELA 4ALKA 5KTKA 3QVXA 3GRKA 4G81A 4GX1A 4M8SA 5L53A 5KJ6A 1DIAA 1EQUA 4IMPA 3PZBA 3ETDA 3OJFA 3CE6A 1I3LA 3S2GA 4IXTA 1EUCA 4CLRA 2Y68A 1TEHA 1Y8QA 5H83A 1HTBA 3UFXA 1P9LA 2JD2A 2P91A 5K0ZA 3ASUA 3FRJA 2DVMA 3FF4A 4AJ2A 3BXXA 1U2DA 3S2IA 1MC5A 3DAPA 4J9UE 3DZGA 1QV6A 3N58A 3PDUA 3RUDA 3LLSA 2BD0A 1BXGA 2GN8A 3QWIA 3PYXA 4R01A 3TF5A 4J7CA 2VT3A 4ZD6A 1TB4A 3K5PA 4IY1A 3PPIA 2O3RA 4GMGA 4HY3A 2AQHA 3LK7A 4IDCA 1QYVA 5DDIP 5JCJD 1YGYA 4CL3A 4DVJA 1C0LA 4IPTA 4WCFA 1XQ1A 2NU6A 1X7GA 2UUOA 5I9NA 3DZFA 4FR5A 1OOEA 3RJ9A 5DT9A 2D8AA 3BHMA 5JAMA 4EJMA 2ZQYA 2HMVA 3TQHA 3VHRA 2FPPA 1CF2O 3GY0A 3PLRA 4TQGA 3LT1A 2Q1SA 4AG3A 1NFQA 3CINA 3ZCXA 4GLLA 4FGWA 3WGIA 1WMBA 1KETA 3Q11A 3WYBA 1ML3A 4CQLA 2I76A 4I5EA 1LTHR 1GL3A 3EVTA 4Z0PA 1UDCA 3WB9A 2JFFA 3AI3A 3M1LA 4MIYA 3JSAA 5F5LA 3L07A 3F4BA 4TSKA 3SJ7A 2AA3A 2VCYA
chains in the Genus database with same CATH superfamily
2FHPA 2FRDA 4M1OA 4EY7A 3PHCA 2Q3BA 4G1MB 1XJ0A 1M2OA 4Q9JA 5EFZA 1P44A 3SQLA 3AYXB 4JD5A 5ICMA 4QPZA 4G0MA 2QMEA 1MABB 2FN8A 4R1MA 2ZSUA 4QAJA 5MDHA 4G6ZA 1DG1G 5BV2P 2F43A 1TMGE 1US8A 2WVHA 4HRYA 4JCOA 4BNUA 3GQBA 3C8UA 3PXXA 4YXWD 1CS4C 5CXXA 3TL2A 1U5CA 1QIMA 2HNKA 1NVWQ 1ZNQO 2GZSA 3GEEA 4LYYA 4TLEA 1PVVA 3STHA 1XN4A 4P53A 2DBRA 2R1TB 1GM5A 1GZ4A 5EWMA 3A1UA 2PTHA 1MUUA 1CQJB 1AE1A 2JFBA 1T9KA 1OWOA 2VZLA 3PQFA 4ZK6A 1A98A 3DGEC 4PO3X 2PSHA 2OZLB 2R00C 3ZWDA 3WWZA 1D2AA 2IC5A 1DGQA 5AJHA 3M6VA 4OSEA 3IQXA 3Q8KA 1OLUA 1A4XA 5ECYA 2MMGA 4BWVA 3JZDA 4XYBA 1X70A 3LA8A 5TGTA 1V7QA 5CH8A 1FY2A 1G3QA 3OJOA 2VJMB 1AHNA 4RCZA 4BU0A 1SCJA 3RTCA 1JECA 4QG3A 1IE3A 1VCNA 3OFNA 4R1LA 1LW7A 5A1TA 1EK2A 2VBIA 4OK6A 4WE3A 3V2GA 1MZVA 4BCCA 5L51A 4GVLA 1ZHHA 3JRNA 2VR1A 1Z4NA 2VP0A 3O26A 3U0VA 1C7QA 3I76A 3KFLA 1EX9A 1ORIA 3ANNA 1OWNA 1NW3A 4GLFA 4MQBA 2ZZKA 3RV4A 1EJ6A 3ECCA 3NOQA 5LN1A 4CEJA 1OXSC 4Q7LA 1JRLA 2HJVA 1KVUA 5BSRA 3RSLA 3TLKA 4G84A 4MGHA 5K05A 3Q8LA 1Y0BA 2Z2ZA 1RJ9A 5J4KA 4R8VA 2JDIA 4MUBA 5LB2A 3NAZA 1AGRA 2ZETA 3OTQA 2NVUA 2B4TO 2PT6A 3PNQA 1FS5A 3NHRA 1JHYA 4C9BA 3JQRA 4R8RA 4F56A 1FBNA 1VSUA 3AR5A 3KJZA 2W90A 2C4HA 1ZX1A 3C3MA 4NU6A 1JEYB 1ABBA 1NI3A 3SC2A 1X9GA 4U7GA 4EJ6A 2O0MA 3ZDRA 4CLDA 4E1BA 5K0BA 4MJLA 3S44A 1U2GA 1A8HA 1MN6A 3A9RA 3LC7O 3VHLB 1R4AA 3GGOA 1QZXA 2QU7A 1C3LA 3AHGA 2AHOA 3FZNA 4PC7A 1SA0B 3M4YA 2QV0A 1UBHS 1IATA 2QM8A 2WFLB 2A14A 4GL4A 3BAZA 4NV3A 3TRHA 4A4DA 1QVWA 1Z5WA 1MGPA 4XQEA 5GZ6A 1XTIA 2FQXA 3O2NA 1MW9X 1W29A 2AJ8A 3JQ7A 3N1UA 3QLVA 1K7FB 3IVMA 1VE1A 5DI9A 3U9TA 1LWNA 3GUZA 4L5JA 4QJIA 3S2YA 4P7GA 3VVMA 3DAGA 1NR5A 4D97A 4F5ZA 5BWNA 1C8VB 2FXVA 3OX4A 4ZCPA 2QR2A 3Q88A 1KTIA 1M0WA 3LFTA 1JKFA 4ETMA 1CDDA 1XEFA 3G0IA 3KOUA 4KI0A 1KDOA 2XXBA 3GRVA 3ZWCA 3V8RA 3SNKA 1OZGA 3Q3JB 4JGBA 1X6VA 2QAJA 3JQEA 3MSCA 4EEZA 1T29A 4DIDA 4N82A 1PQYA 4G0OA 4CHGA 2BI8A 1UQUA 2X76A 2ZSIA 3B5IA 2RHMA 3M4ZA 3MMXA 4IIJB 4GX2A 2Z5LA 1WQ4A 3D3QA 3OFKA 2ZRJA 5BPFA 4MAFA 1ZMOA 2NTYC 5BUCA 1KRXA 3DEYX 4ON9A 1GPH1 3NBYC 2Q5LA 3CLTD 1VKHA 3KXDA 5K3DA 3UY4A 5IX8A 2NT3A 2OCLA 2ZR0A 4I55F 3JAWA 1Q7GA 4MINA 4KIFA 3G2HA 4ZAFA 3TBFA 2WK1A 3CWZA 4IDGA 4UM8B 1AHHA 2PFGA 1QYDA 2PXHA 1Z3CA 3ADKA 4XVUA 3ZJUA 4JC4A 2PM8A 3FPEA 4XYGA 1N5DA 1NM5C 2AS0A 6LDHA 3E61A 3GP5A 4XIJA 1FJXA 1Y4ZA 5T7BA 4I55B 2QGNA 1B16A 1V95A 4LTNA 5DXJA 2FZEA 2NSYA 4R0MA 5B6PA 1I7SB 3OP4A 4PLFA 3C7AA 3MS4A 1FPMA 3KKEA 2FU5C 3WJ7A 2A3RA 1R8JA 2PVSA 3F78A 1BVYF 1HBJA 4YRCA 2BAGA 1QHNA 4G24A 2RBGA 4M55A 1K7CA 4DJFC 1WCXA 5FUWA 4LV8B 2O8CB 3QELA 3O4VA 4RIFA 1ACJA 2B8EA 1EHYA 1NOJA 3HWSA 4KXWA 1S2DA 3EF3A 2ZJBA 4NH0A 3RVMA 1XTSA 4W8HA 2Z6QA 2FSVC 2RARA 5IDVA 3TPFA 1W48A 1NU6A 2HIGA 2NZWA 1N2CE 1UZLA 4QDJA 1R4MB 4ALIA 2FZWA 1WVMA 4E1VA 5HE9A 4I3FA 5KBYA 2W6QA 3FFTA 3I2GA 1NVXQ 1JG1A 2OK7A 4DPLA 3J80A 2YZKA 5FOTA 3AUJB 3EX7C 2CFCA 2E21A 5EI5A 4FB4A 3PK0A 4HLDA 3SM9A 2GFIA 1QV9A 2DLDA 2PD6A 4FFMA 5K0GA 1AHIA 5C35A 4BO4A 2XXJA 5DYYA 5I7SA 1Z5GA 1ZONA 3A9TA 3S40A 1FFSA 4G2TA 3ZDDA 1M67A 1MKYA 2DY0A 2VTEA 4EB8A 2R8ZA 2GARA 4Y6OA 4FYWA 2IYVA 3GFSA 1VDZA 4EPVA 4KQ1A 4ZOLF 2OLJA 1ZUHA 2PXXA 3JWGA 3GO4A 2C96A 2SHKA 5IYZF 2HHHB 2GXAA 2NSDA 3K4HA 2GEJA 2IZ0A 4PLPA 1VKRA 1A4RA 1JEQA 4LJ6A 4NQRA 3INNA 2I3BA 5JQWA 3V32A 4F4DA 3BZUA 3NBQA 4PLYA 2W8BB 2Q99A 4ZOLB 5CLJA 3E8XA 2VT6A 3RK1A 1EH5A 2BM9A 4HAXA 2BKEA 5JECA 2FEPA 4GOOD 1YU6A 2LCQA 3EW9A 4IL5A 2CVQA 3FGNA 2DJIA 2BEVA 3K53A 2LDBA 3KKLA 1PT7A 3S2SA 5JFGA 4A2QA 1GG2A 3N7UA 2ONYA 3OOYA 2XMSA 2FFQA 1QQBA 3FBWA 2UXCB 5BNZA 3D2BA 3MWKA 1F20A 4M1SA 4OXIA 5ARDA 1UFQA 5F76A 3PV0A 2GASA 1GQYA 2IYEA 3ROFA 4CDGA 1P0MA 4K6CA 4E6PA 1N6LA 2W22A 4BNNA 2BBTA 1LPOA 2WV9A 4NLLA 2RMKA 1E3EA 5JSQA 2HH9A 2G9QA 2ZBQA 5KI6A 1BW9B 3PHJA 3L4SO 5CIQA 1AGNA 1CJCA 3RSCA 3V97A 3WMXA 4AJNA 5JJKA 2DFNA 5CM8B 3QPWA 3KQLA 1N2JA 4MQFA 4AKGA 2PH7A 3RFCA 3ICQB 3MMZA 5DGIA 5ALYA 2AT1A 4HEJA 1AQYA 3AI7A 4G0NA 5ALJA 4E5UA 1VC2A 3UB3A 1UJNA 3HADA 4AIIA 5B6JA 1TIKA 1USWA 2B5WA 4DLXA 4NE7A 4ZJUA 5BSVA 5AQ1A 2OQ2A 3KYBA 4JODA 5TC4A 3DTNA 1E7YA 3VUEA 4YCDA 3QTTA 1U8TA 1RXYA 3DXZA 2DLCX 1BKDR 2VRCD 3N5KA 4TTVA 3E2IA 1M2HA 1CVIA 4KE9A 1K06A 5K3FA 4HDRA 2UYCA 5CBKA 4RENA 3OA2A 4RJ2A 4Z7QB 2VDWB 2WIBA 5CUQA 1GDTA 1CR6A 2ENUA 2VPXA 4MQ4A 3V3TA 2E1RA 1LNSA 4AZVA 2P9GA 4TL9A 2D0OB 2WWHA 1KZHA 4X8MA 1NF2A 3WWYA 3D43A 4DUPA 1B2LA 4KPEC 2O3TA 3GR6A 4OHCA 3OPMA 4OLHA 3IHTA 1QHHB 5T4HA 1KS9A 2G4LA 4RS3A 4PX5A 2EOAA 4TQUS 4W7IA 4FT4A 4MUKA 4LZOA 1W36D 1SG6A 2HF8A 3B13B 1R27A 4V03A 4Q4HA 4MKFA 4JMLA 5DJ5A 5K3SA 3OOWA 3TRFA 4L4XA 4D4KA 3S8MA 5CFRA 3KLMX 5U9CA 4LX0A 3KT6A 5AI9A 2Z3ZA 3EZ9A 3WKDA 1BGWA 1ZHOA 1O1YA 3GCGA 3IMCA 2XOKD 3KQWA 3QNUA 4Q4LA 3RVNA 5FLXA 3GNLA 3HSSA 1CJMA 1ZS9A 4LF9B 4J94A 1WXXA 1ICEA 3OCVA 4OPMA 4TZKA 4WA8A 3LYUA 4C06A 3EYWA 1NATA 3DVRX 3SC3A 2WI8A 5C7IO 1C5KA 2QG6A 3EIWA 3IIMA 4ENTA 1N7GA 1X1AA 1RQRA 3I04A 4JVOA 4MUMA 3TSYA 3N28A 1W96A 5C7OO 2EGUA 1YDMA 3AF3A 4CR6A 5IM4A 4G0VA 3OICA 2DFDA 4OHKA 2ZBFA 1EA7A 4WLOA 5DWQA 2FWPA 3ZWWA 4KPYA 3R23A 2EF0A 4I6GA 3SEFA 3C3EA 2ZSDA 3QRWA 5BT9A 4YQZA 3A04A 3LC0A 4GE3A 3NT2A 3RVKA 4GO1A 1TQ6A 2BKAA 1CBUA 3L1HA 4F9GA 3RVSA 1E32A 5CMLA 3PHGA 1Y9DA 2GD0A 2W6CX 3P2OA 3PFKA 1X74A 3LUCA 3PNYA 1FLDA 5E0KB 3KPVA 3CO5A 4JA0A 1FYDA 1T6XA 2AR7A 2DT8A 1GPDG 1KHHA 4M7PA 4WNYA 2ZB8A 5T8KC 4FR0A 1XZGA 3BWDD 2PS1A 1CUIA 3W04A 2DKOA 1INLA 1E1CA 5ALNA 1KQNA 1O8CA 2X0DA 2VOEA 4QQNA 1MFPA 5H70A 1E3WB 4OUDA 1LQUA 4QTUB 5EHZA 4EFDA 4CIVA 5IRCD 1J8MF 2X77A 1BD4A 3FYSA 1CZUA 4YQYA 3UOAB 2C7VA 3A1DA 4X1KB 1KOGA 1P3JA 1PX2A 3C6XA 3KELA 3GQVA 2I6QA 4E32A 2UUCB 1CD5A 3HB5X 4E3ZA 1P5RA 1SUCA 4YTEA 3HVRA 2X7HA 2QTZA 4BMYA 1F2UA 4E2YA 1QAOA 4WFQA 1Z36A 4HEHA 4I4TF 3S2EA 3MCWA 3USZA 5FPQA 4ER6A 4LZZA 4F71A 4AW9A 2WE7A 5JXIA 3TMKA 1EBUA 4KFSA 4A0FA 1J56A 1JNXX 1F8YA 3B1KA 3TFQA 4C08A 3PD0A 3RTEA 4DT1A 5H1YA 3V2IA 3P26A 3ZD7A 3FMVA 3CPEA 4OOFA 3OPYI 1WMFA 5E7MA 1WZIA 4I4TB 2QK4A 3H2GA 4EI2A 4EO9A 2H85A 5CEEA 3ELYA 3WLTA 4MV0A 4E2XA 3BMCA 2WMYA 3BJMA 2PLFA 3PWZA 4OGWA 3DLCA 5JAPA 1E1KA 1HQDA 3OHMA 3DR5A 5HIMA 2AN3A 4KE7A 3G9TA 1T6YA 1QFZA 1GRNA 1ZD5A 3CNBA 3ZCRA 1A69A 3A3KA 3DFKA 4EKNB 4U63A 1SGWA 3GPDG 4BNVA 3DLBA 4CM4A 2X2EA 4ZPJA 5ALOA 1NHWA 3E58A 3MQFA 4F3RA 1QR2A 3T5TA 1E7SA 2QJWA 3LJKA 1UBRS 3COSA 1HGXA 3S55A 1FSSA 1YGPA 4R1NA 3F5QA 1Z07A 3NRBA 1XCMA 2I8CA 3OECA 3ZXYA 2OWDA 3G85A 5K6AC 1NJFA 3D0KA 3FPFA 2FLKA 5KTMA 1HORA 4MWGA 4JQOA 4BLOA 2B5OA 1KEKA 3DBOB 5AK3A 2OV3A 4I2VA 4ZOAA 2VKQA 3L6OO 3AUTA 2D00A 4W5TA 3IGFA 1M8PA 2NVBA 5CDFE 1ST3A 2FCAA 5EKDA 4PIPA 1CY0A 2FE4A 3A3NA 3UC5A 3VH3A 1GZHB 3F6SA 2FW7A 1ZWLA 1TT5A 3VGPA 1T5IA 2C9OA 3AF5A 3H4VA 3PR3A 5KPJA 4IF4A 4GZMA 3W5BA 1KH1A 3DB1A 4NVRA 2QT0A 3U4QB 2DHQA 3HO1A 3JX9A 4GF5A 3HQ4O 1VBNA 4J49A 4J2TA 3A1TA 5AI5A 3X3HA 4COOA 1ZIXA 4GXQA 1R2QA 2AOXA 1USGA 1FQJA 1EBFA 1W85B 3DL7A 2H1LA 4HN4B 5COQA 4ZO6A 3WBKA 4EGSA 5DW3A 3G2IA 2B78A 5M04A 4Q15A 1MOQA 2D5CA 1SIBE 4HWGA 1ZJWA 1IN1A 1Z4IA 4D0SA 1WBJB 3CLSD 3ROKA 1TRKA 3K70B 1P2GA 3DB2A 4IWXA 2HSDA 3PEVA 3RUAA 5KNBA 3TDNA 2E5LB 4G65A 1BA3A 5EHNA 1KI1A 1T3HA 2CN1A 3KKMA 1DQRA 3FROA 4FMBB 4R3NA 5FLYA 4O33A 1KYWA 2DQZA 4KDRA 5GJCA 3OTOB 2X1MA 2VNIA 2ODNA 3E03A 3QBVA 2AXEA 3BSFA 1PG5A 4UUNA 3MLAA 1RXCA 1S2NA 1DWQA 1H94A 3BOSA 3JQFA 5FTNA 3REQB 3I9LA 4K81B 4C88A 2ZRAA 4YV0A 5JCOC 3GFPA 1CQIA 1E2LA 3E22B 1URPA 4M88A 5G53C 4DV4B 3OKFA 1U7UA 3FWNA 4F21A 1RLMA 4V2UA 1NBIA 3B85A 4XFDA 1O4WA 3JAKB 4X1YA 1Y9EA 3INGA 3ADCA 3OM1A 2CV1A 1AK9A 2Z43A 1I2CA 4LMPA 3NCTA 1GLVA 3PNLA 1XNJA 2ZQZA 1W93A 4QPJC 1CQWA 2UYYA 3DCJA 4HMQA 3QU9A 4XQ9A 1L7DA 1V6SA 4AZWA 4NBLA 2C61A 2C2BA 4MYCA 2JC3A 1PT8A 4PN7A 4RZSA 1HDEA 3HKCA 1RNLA 5J63A 1EFAA 1U0SY 3A0UA 1VIVA 2PG3A 1XAGA 1DTSA 2P9BA 3FUWA 3FXAA 4FINA 3UMFA 1UC8A 4IO0A 2PIDA 4Y2SA 1R9GA 5HS4A 5J23A 1Z0FA 3O8LA 1JKIA 1EVQA 3DVLA 1EGAA 2PL5A 1OH8A 3BZWA 3K0EA 3QX8A 3WJ1A 1FRZA 3X0DA 2G9UA 4D81A 1P74A 5J2UF 1QAQA 2X0KA 2H06A 1USVA 3KWLA 3FSGA 1VCIA 2IHKA 2CCKA 1L3IA 4DMRA 5BRJA 2EFEB 3PCTA 4S24A 1ADFA 5B30A 2X2PA 1AD2A 4Q37A 1EXNA 5BOVA 1L7XA 4MRVA 1B6GA 4N3NA 2X4IA 1NNSA 3NHWA 4PBSA 3B2QA 3LCMA 2J09A 5J2UB 2ERCA 2XB2A 5EJ6A 1FFBA 4KAAA 1VL1A 1Z0UA 5G0WA 2P4QA 3OOEA 5EWLA 4RH3A 1JF8A 4IIBA 1CY2A 5ESRA 4CKWB 2C84A 2ADMA 1QFJA 3GLFA 1SKMA 3W2IA 3DOHA 3C3WA 2J9YB 3I8SA 4NCKA 2XMZA 3W79A 4FGLA 1HSOA 4B6EA 1NUHA 2AN5A 4CM6A 5FH9A 1QRUA 2PRYA 2XVYA 4DV7B 3VR5A 4YI3A 4UDNA 2SECE 1RKBA 3MWDA 4JCCA 4RTOA 3VNVA 1NIPA 2C5HA 2I55A 1NUUA 2CLDX 4RH1A 1Y8ZA 2J4DA 1RHMA 1QFMA 3TUJC 4D45A 3C24A 4EQZA 1JR6A 1GQRA 2YVLA 3F90A 4O4LA 1WSWA 1A7JA 2Y92A 1QFSA 3QUSA 1YQXA 4F38A 1H9AA 5JAIA 2RD2A 4ESEA 5KU7A 1GAEO 1E1DA 1A9OA 1K5DA 1T2UA 2C9CA 3HB4X 4N7RA 3DO5A 5IAAA 4ENWA 1U0HC 4LKRA 3BXEA 1WW3A 2OORC 4IDQA 1TJPB 3R9KA 3S5JA 3G0DA 3KQVA 5BSGA 4LUCA 4Y2JA 4QQRA 2PNJA 1D4OA 4PYLA 4BWYA 2HRRA 3EEQA 2C0PA 2GUGA 1NUTA 3ZWBA 1U3DA 4KN5A 2PX0A 1IU9A 1FVHA 1LUAA 1XZIA 2BE7A 2HA7A 3HYLA 4XYMA 5FBHA 1FIUA 5EINA 2O2IA 1A71A 4B3GA 3SZUA 5LSAA 3S4YA 4WPGA 1YR1A 3CEAA 2QAGC 1VECA 2XD4A 3FAZA 5HEKA 3DE5X 3GPLA 3ZU3A 2VYND 1SXJC 3T7AA 2P30A 4I6JA 4RLFA 1T5LA 1NVKA 1P5ZB 3G5MA 3PGXA 3K0AB 3R4VA 4RW0A 4KV9A 8GPBA 2JD1A 3LYAA 3CA8A 1PFWA 4LCJA 2EWWA 3ZZUA 4I1UA 3KCNA 1ZD9A 3V9PA 5I9MA 1A9TA 2B36A 2JHPA 4AZTA 5IZ4A 2OHHA 1FS4A 2VJYA 1YS7A 1J90A 4JIGA 2LKCA 1PRYA 4GDMA 2R2GA 4IIUA 4KQ9A 1HDOA 2P11A 2JPDA 1V0JA 4H60A 4IIEA 3ZS9A 1NJ2A 3I6ZA 1V4NA 4X6UA 5FNVA 4KGZA 1T0JB 3V8BA 1H42A 1G1MA 3TFWA 3CUSA 1SC4A 3LY9A 1G5TA 2XQFA 1KFEB 1DAIA 3GCWA 3KPJA 1PIWA 2XLBA 3RIXA 4KNWA 3W6NA 1MPXA 4KO1S 2O1XA 1EFHA 3HJBA 4QYWA 4TMZA 2LXNA 4D80A 4K9QA 4CM9A 2QT1A 1DIRA 2IYSA 4YUVA 4BWFB 3ZWXA 3P5BA 4DSTA 1BFUA 2J41A 2P9HA 3ISVA 4JQYA 5FBQB 5C32A 4MS1A 3ADPA 4IIYA 1RI1A 13PKA 1H22A 3I6BA 2RONA 2OHJA 1KERA 2YQ4A 1L7QA 3AJ8A 3NNDA 4CMGA 5AJYA 1OMOA 4OLFA 1PEDA 1NYTA 1XQYA 1L4EA 3FE2A 1U7HA 1ZRMA 3B3AA 1VIYA 5JAZA 3U4MA 4JX9A 2ADFA 1J0XO 1DIOB 1K5HA 3K35A 4TMKA 3MZ0A 2CKDA 4Z99A 3GJRA 3W3ZB 3FAKA 4YBRA 3SIWA 1F2TB 4Z9BA 2QLLA 1E20A 1PL6A 3KX2A 2ZRMA 1LNQA 4TS4A 4ALJA 3ZEIA 4GH5A 2AFIA 4NOJA 1SQGA 2TSYB 3U9LA 4DBLE 2Q2VA 3MUOA 3URMA 1GLGA 1RR6A 2NYRA 4BUZA 2VTBB 4DPMA 1WKVA 2BF7A 2AKAB 2A59A 2NPOA 2R47A 3KKPA 2XYGA 4ZDKA 1XDGA 3HH8A 2ZYGA 3P4XA 2W6NA 2Z9CA 4ZANA 1C30B 4NPHA 4Z1OA 2GZMA 1V39A 3FJ1A 5A02A 4QUEA 1U2TA 5FQOA 2OP0A 2C8KA 4B79A 3NB0A 1QONA 3MA0A 1YC5A 2K2WA 3N0VA 3FMFA 4PGMA 4HJXA 4YHHB 3FVVA 3K6KA 1O5OA 1RIIA 1EFPB 1QBGA 3F3SA 2WKPA 5JYDA 5KHOC 1BEZA 1E3TA 2E7ZA 3DA8A 2EG9A 3E81A 5C5IA 4BXOB 1IAVA 3V4RA 1JEEA 1MIHA 3FWZA 3O83A 4LJLA 9ATCA 1QGUB 2G1KA 2R8YA 2P9ZA 1VL0A 4WOPA 1O94A 1CLEA 5KSYA 2MDTA 1XVTA 1XZQA 2AN1A 3UBMA 1M6VB 1BWRA 1GAQA 1R1DA 2IY7A 4NICA 4I08A 4OFZA 3PB3A 2XQVA 1JFFA 3IYLW 5KQPA 4YECA 1PQWA 3F3KA 1Z6AA 1GUBA 2V58A 3C74A 2ZJ1A 3PVSA 4NE9A 2F17A 3C5WP 1XA3A 1GZ6A 4K9RA 4WFJA 3H16A 5D6OA 3I9MA 4O5AA 3JXEA 2H1IA 4QG7A 4E2FA 1SK9A 4J8PA 2OCXA 4O2AF 3OM0A 5E7QA 4AO7A 4F6LA 2DUNA 1G55A 1TMYA 2FX2A 1EI9A 2V7UA 4P93A 2EKLA 5TNXA 3SYNA 3QPUA 4C43A 3ONDA 4ADSG 4AL4A 1JIQA 4OQ4A 1Z08A 4AO8A 3PNMA 1YJXA 4PLHA 3A4VA 2GN4A 4NYIR 3RVRA 4CQMD 1Q1GA 2CLIB 2JEZA 2ZKIA 3PIRA 3Q3CA 1V6AA 4HC4A 4R8KA 4TS3A 5T3UA 5IMBA 5LZ2A 5FA8A 3HBLA 4TTSA 3IE0A 5G0SA 4LIPD 3ZHZA 5IDQA 1SXPA 3VR6A 4A0RA 1DTWB 4UNPA 3ODGA 1O97D 2W0SA 5AVUA 5CA1A 4F3KA 2QJTA 1IUNA 1HFWA 1SHJA 2QENA 5DBFA 1S2IA 5EMHA 5L3VA 3FPAA 3OWOA 3C7KA 3VZSA 2E55A 1RCFA 5JDIC 1G5IA 2Q5FA 3D4LA 4GYWA 3DMGA 5ILGA 2ZE5A 1A2KC 1A4IA 2I1LA 1A77A 1TKRA 3C7TA 3N05A 4OKSA 1COZA 1ENYA 4B3HA 2IEAA 5ULLA 4C6HA 3TDMA 2ZIXA 1ATZA 3QX3A 1X38A 3E0QA 1OTHA 2X9NA 3OJ0A 1JQ3A 1Y4SA 2NWQA 3QVLA 2GAIA 2BZ0A 1PYDA 2ATCA 1S9HA 2GF2A 4FGUA 4HRXA 4IQ0A 4EUSA 2ZIFA 4E88A 4CEIA 3DT9A 3G1WA 3VU9A 2UKDA 1F8UA 2EKDA 5JARA 3HCPA 2NV2B 4IEEA 4P2GA 2VJLA 1KHTA 3T7CA 5AW8A 5CNJA 1L5VA 2DBZA 1EP9A 3JYHA 3GWGA 3NNSA 3AFOA 3AFNA 1BD3A 4EYKA 4M89A 6PFKA 3U09A 1KP9A 1WY5A 5ICGA 1E1NA 2HNAA 2QD1A 4W8OA 2GK3A 3FIJA 1BVHA 1ORWA 2HDWA 2YHIB 4NEQA 4IFEA 2JGRA 1DXYA 3MB8A 4JROA 3OTHA 4KYVA 2OXTA 1KKMA 5B3JA 1QVVA 1DQPA 4A6XA 1M1YE 5BUZA 2G1UA 4BGDA 3TFOA 1K6JA 3KETA 1G0OA 1QQ7A 1AZTA 1A88A 4YPOA 1ULZA 3AJ9A 1WNFA 5JSUA 2ZAIA 3LMKA 5JAUA 4YAFA 4H1UA 1SCNE 3TOSA 5CG1A 1E1LA 2QX7A 1V2HE 2HPHA 2O4UX 3G8CA 3TE6A 3FFWA 4Y2UA 1KRWA 3CH4B 1QOQB 4XARA 1X2BA 1DFGA 1TEXA 5ICFA 1NPYA 1J99A 4XUDA 4AICA 1EUDA 4NU8X 4CMIB 2I66A 2KHZA 4GRIA 1ZD4A 2O23A 3OLXA 4G86A 1UPTA 4RK7A 3KP1A 4U2BA 3ZHQA 3TQOA 2CXNA 3NR2A 4J7XA 4FILA 1W4RA 3G8BA 4KNYA 4Y2TA 1KPHA 1LH0A 2JJ1D 4L73A 2J9GA 3QW4B 3O2QB 5FL7A 3VPBA 1OPXA 2ZYRA 4I5IA 3FNFA 1SHTX 2Z4TA 3TSWA 5BWBA 3FUXA 2DLNA 1W36C 5KUTA 2AK3A 2XITA 3LKBA 2GBLC 4DNXA 5BR1A 1FP4B 2JFGA 1BYUA 3ABSB 1RRPA 4MW2A 1UK7A 1ZU5A 4OHPA 3G8DA 3E7DA 1UH5A 2YXEA 4PAQA 3F74A 3B5EA 4UHKA 4WLVA 3JYLA 2XMGA 2GEKA 1CDZA 1UBJS 2YC2C 5CFLA 1RAHA 3IVRA 3ZE1B 1PZFA 1PKEA 1XXHB 3BGDA 2X5JO 2IEGA 3MJCA 5TJ9A 2WWGA 5IP5A 5B4TA 2X0RA 1QMPA 4J0DA 3DC7A 2BY4A 3O3MB 4MA0A 3ZGLA 2JLSA 4ARAA 1YFZA 4QVKA 1BRMA 1RACA 1XZPA 3KQUA 2BKLA 3OZAA 1KYQA 2NO4A 2NO7A 2DH5A 4X6LA 2JGNA 3E9CA 3ZBQA 5AM4A 2GK7A 5BYJA 3H5OA 5BQFA 2JIZD 3U5TA 3I39X 3KWJA 1E89A 5KYKA 1XQVA 4R2MA 3FGPA 2O2DA 1M5RA 2IDZA 3OCXA 2V45A 1JFTA 2EGHA 2EX0A 3BDIA 3RVJA 4UDXX 3TGLA 2HK9A 2OFXA 4FR2A 1J7JA 1LTQA 3S1LA 4DC0A 3IRUA 1EVEA 1YCDA 5E9JA 1EYZA 3QNMA 4ZKEA 1QIHA 1TQ8A 2EKZA 3OE1A 4K9KA 3JQAB 1W2GA 3RABA 5A6SA 4KODA 2C5SA 4KPGA 4U6NA 2H11A 1M2FA 1WD5A 1RLIA 2Q8QA 5TEWA 5ES3A 4UOEA 3PC8A 1JGTA 3Q12A 5FKJA 1TM3E 1UC4B 1EFRA 1GTSA 2CY0A 1DDIA 1H2RS 3QOWA 3IMEA 3R8XA 4WERA 4OHRA 1PS9A 1XLTA 2CUZA 1UJ2A 4D8TA 2WQ7A 4B4VA 1IDOA 4WXHA 1U8ZA 3M82A 4CM8B 1RI5A 1U65A 2BGNA 3U7GA 4MV5A 4RPIA 4WNAB 1T8RA 2Z3WA 1A9XA 1RBYA 1V5EA 4MQLA 3RYTC 1OJ7A 1ZMRA 4Z51A 1N7HA 3T3GA 5JFOA 2ECQA 3BAFA 3O4RA 1D07A 3L5KA 3WYNA 2AMVA 1IY0A 1KJ9A 5HJ5A 3WLLA 1CB7A 2I9PA 1YUMA 3T1HB 1RXWA 2YYYA 5A4JA 4KHZA 1N3BA 3ADBA 1EQ2A 4EG7A 5DIFA 3IOEA 2K7ZA 4JWTA 1HDIA 5HQ3B 2JLUA 3AHIA 1U7OA 3SR0A 3HEAA 1S1CA 1BCSB 2XAAA 2VJMA 4UMDA 1LI4A 1PR3A 4NDZA 4H6WA 1H93A 3EB9A 1GHTA 3UKJA 3LBHA 4YUXA 2Z6UA 1VMEA 4JP8A 1EU1A 3WHKA 1FLAA 1TUGA 5KS2A 2BL4A 1NQAO 1XD2B 5F1YA 2G40A 1J2JA 1XTQA 4XI9A 5K0JA 2KW5A 4DILA 5E6UB 5JRDS 1U4NA 3I05A 1VE9A 5I9IA 5C18A 2XJ9A 3T3NA 3KAJA 1PEAA 1Y6QA 2IYLD 3X2SA 5CFZA 3LPLA 4L15A 4AS2A 1I1QB 3CRZA 2JGIA 1SKYE 4LZJA 3WYFA 1PNRA 1NY5A 4R1QA 4QOJA 5A04A 1TJ3A 2WJGA 3SHTA 1HLGA 1GUAA 3BZBA 5K01A 3LDAA 1P62B 3QYJA 3P2IA 4JT2A 5AI0A 2WP0A 1A72A 1GSHA 2IZ5A 5DLPA 5ELLA 3QLTA 4EA8A 3HNPA 3EK2A 4Q02A 4QUIA 4D8WA 3U48A 2ID4A 3G7UA 4NYMQ 2Q21A 5B4VA 2NZJA 3AO0B 5FBKA 5DWVA 2UVDA 2XUIA 1QORA 1XROA 1MA0A 1FTNA 4D8YA 2BGIA 4V3CA 3ESAA 2JFQA 4E08A 1DX9A 2CNKA 3EZGA 4UBMA 4JUFA 3PENA 1VHQA 3QK7A 5HOQA 4MHSA 3MRTA 1TNDA 4J0GA 1HG1A 4X1IA 4BJ6A 2V6GA 3KL2A 1IFXA 3UG6A 3NAGA 1T9CA 2ZSHA 2XYVA 3BSYA 4R7ZA 2GAOA 1J1IA 1FX0B 1TF7A 1UBEA 1ZKDA 3B5JA 4DLAA 4EG0A 2QTMA 1M1UA 4A6DA 2B5VA 2Y1KA 3H18A 1NMZA 2GPAA 4WZAE 1RT9A 5EXDA 3VH4A 1BOFA 3N8HA 2GNPA 4PBRA 1KDYA 4MARA 4RVGA 1NJ8A 1LRJA 3RKSA 2Q6TA 9GPBA 4GHWA 3SE0A 4AD8A 4XEUA 3DE6X 4OMFG 1F4LA 3AETB 2YJTD 2H07A 2Q3LA 4WZZA 1EFKA 1JP7A 3DZCA 4IIJA 4EW1A 2WPNA 4D7AA 4O4JA 1QRTA 3NBKA 4FFDA 4V0SA 4JC8A 4ZT2A 2JCVA 1QTNA 2E4YA 3QPCA 1OC2A 3W2GA 2MIIA 5AMXA 1X7XB 1LJUA 2ET6A 1E6UA 1MOZA 4HS4A 4NCNA 1F1JA 4IOKA 4CIBA 2NVWA 4IVNA 3UOWA 4QBTA 4RQAA 2A0UA 3E82A 1NRIA 2GCGA 4UNSA 4KQEA 1CETA 3C6MA 2AD1A 3WMRA 4ZAVA 3TR0A 2APJA 2BHLA 2X8LA 4RGBA 1T4DA 2P9TA 3UHFA 4EYGA 1XZJA 3L0DA 1OF1A 1DARA 2OESA 3SLRA 2G8NA 1EWVA 2IZ1A 4QXMA 3NH6A 1NBMA 2CV2A 3ZXIA 2AQIA 2LP4Y 2XCOA 3TXAA 2UUAB 2B82A 4OKNA 4IX9A 2ZITA 1GY8A 2Z4RA 3N0WA 1LSUA 4B3DA 3PGMA 3BK7A 2MINB 2WLSA 1JYSA 2QN1A 3CQ9A 4RVSA 4TUYA 2EKPA 3ZLJA 4HL6A 1JHPA 5FT9A 2ZI9A 4O02B 4EITA 3TGPA 4OI0A 1Z25A 2AG0A 1QX3A 3ORHA 2B37A 2R6CA 1VJGA 4KL8S 2Q2OA 1LF5A 3SR4A 1IPFA 5C2JB 4FN4A 3WWCA 1RQNA 1IJEA 1PGQA 2IRWA 2Q6LA 1Z5UA 3JQGA 3LYHA 3N2GB 3PNOA 2FMXA 2VRWA 2W4QA 4YRFA 1O0CA 1LK7A 2R7LA 5BNIA 4TPKA 1ECFA 4G2NA 4C4XA 5D84A 1OWLA 1W1IA 1XIVA 3K92A 2GAFA 4M0PA 4QGBA 4XXHA 3RSOA 1NW8A 2EDCA 3CZPA 4HDAA 3NCHA 1N5RA 2IU4A 1BXGB 1RAEA 1WCIA 2R5WA 2V6MA 1E4EA 2C2WA 1ZK1A 3AL3A 1YI0A 2BT4A 4D43A 1C2TA 1FXWA 4QE3A 1XG5A 4FS3A 4AP5A 3CR7A 3MUNA 3M5CA 3QBDA 3TAHA 1D2CA 3PUYA 3U3RA 4IVPA 2VS1A 3E3LA 4MW5A 4DQUA 1NM5A 2OV8A 3Q7QA 1F5SA 1SRRA 2O5RA 2JJMA 4BVBA 2OQVA 5A0TA 3OZEA 4BEVA 2CXSA 1DHTA 3QTBA 3WQQA 4ANFA 5ICCA 3WHPA 5JROA 1ZM4A 2HIAA 3L77A 1K7SN 1N3IA 1UBOS 3N2ZB 1J97A 2I4LA 3STWA 1KH2A 2AOUB 3EQ2A 1BCRA 2H0QA 3D7MA 2PXCA 1Z2AA 4H1HA 3L49A 1ZI6A 2G9RA 3NV9A 4L4YA 5AKKA 1NJ5A 5EXPA 1D3AA 4OG2A 3PNBA 4RK1A 3OZFA 3VNRA 3EN0A 1OX6A 1R5BA 3OEHD 1DBRA 1OAOC 2FPPB 5H16A 2P3OA 2FRVA 4IGKA 4MPDA 5J1TB 1OH6A 1UAAA 1BWQA 1E0SA 3D4PA 2AMFA 3IP5A 3ND7A 4PBTA 4LXUA 2QI9F 1A9QA 2TMDA 4FSDA 2PO7A 4INAA 4TXJA 1K88A 4LRYA 4EHBA 3Q3VA 2O8BA 3F1KA 3BL8A 4P0QB 5DYIA 2QY9A 2NPFA 4PC1A 4EP1A 1J6UA 1WSAA 4AUNA 1ZJJA 3ETEA 2ROQA 4RULA 1XZKA 3WL3A 2PN1A 1WBBA 4WAUA 4I8XA 1TQ2A 2DC1A 1PR1A 1E79A 2HBRA 4N0MA 5FUYA 3BA1A 1WQ1R 4N47A 4AZSA 3Q1LA 9LDTA 2PMFA 1VBMA 4Q9NA 2C3UA 3UG7A 1KI9A 2BLLA 3AR3A 2BTQA 2MSCB 2J59A 4DDHA 1GCOA 4HSEA 3I5UA 4OQZA 4OUKX 5B1DA 521PA 2EVWX 3SR3A 4BAGA 1WKCA 3AF0A 1GP2A 1V41E 5BWCA 5CCEA 3F49S 3K32A 4ED9A 1U8XX 3WWPA 3W8RA 4P3NA 5AKGA 2NXWA 4YREA 4PW0A 3ZY4A 2CDNA 1AQNA 1Q15A 3E7WA 1FTQA 4EB6B 1ODCA 1BU5A 2RAUA 3CX8A 2PS0A 5A4FS 1DQZA 3LRTA 2V97A 1DRVA 4OO3A 4Z9YA 4KR7A 1QIKA 2WUDA 3BVPA 3PNKA 3ZXUB 4BB5A 3L6RA 3GJSA 1HE8B 4ND3A 3WYGA 2P9JA 2NNWB 4QPPA 4AB1A 3AHCA 4WLFA 3PXBA 2GRAA 1KE2A 1BSVA 1YUNA 4ND5A 1NUSA 3BXHA 3ESZA 1Z9BA 2GJKA 1G21A 2IDKA 2QIPA 2WAXA 4Z4HA 3GJXC 4MV7A 5ALVA 4X63A 5JBIA 3I6QA 1JPJA 1B7GO 1GNTA 5IUKC 1T4MA 1TYZA 1PP4A 1RS0A 4UD6A 4PNPA 3TIVA 1H8EA 4FK8A 2ZI3A 4I46A 3THWB 5DN6D 5BSWA 1N7JA 4KR2A 4AROA 3S8EA 3EFHA 1TO6A 4E5PA 3FKSA 4JYAB 1RP7A 3DJFA 2GD2A 3QW2A 4EVSA 3R6LA 5LWQA 2GN2A 2P68A 2LTAA 2F3RA 5FTJA 2VJAA 4N5LA 2RH8A 3LM8A 2Q2WA 3NHAA 4YRQA 1MOPA 5CVVA 1BA2A 2BWJA 3NW9A 2BTOA 4JIMA 2YOFA 2ZGVA 1QRRA 3U1TA 2GPSA 3UQYS 2WHRA 3SVZA 3MMPA 3S28A 5DYWA 3RIHA 4KN9S 3SN6A 2C54A 1DL5A 3L8CA 3UH0A 1YDGA 4Y6QA 3VDNB 4P4SA 5DV9A 1B1CA 4FOTA 4DL9A 4RTNA 3P9YA 4N3CA 4WLEA 1G64A 4TMYA 4B48A 2HV9A 3KKNA 2Q49A 4DV5B 2O3UA 5BN3A 1SOVA 1X7DA 3P96A 4Y2QA 3ER6A 1EK0A 4DCTA 4OHMA 3P2KA 1QZTA 1XPOA 1NBWB 2IY9A 4HAIA 5JPCA 5AO9A 4X65B 2HPZA 4WWHA 1W1WA 5KINB 2ORVA 3PRJA 2H7YA 3AR6A 1IBRA 4G5GA 5T3YA 1WUYA 1ISMA 4D42A 2L42A 4RY0A 3I6YA 4X1KA 1GGFA 1R6AA 4IVQA 8AT1A 2CBZA 2QRZA 3RASA 1DCTA 2YNMC 2J9FB 2VBGA 2DH6A 1GFZA 4KYIB 4XGNA 3IAM6 3SBEA 4XAQA 3VJRA 4PYRA 3KFXA 4DZTA 1TCAA 3RI3A 2WY2D 3NAQA 3PQEA 3GA0A 3LPCA 4GLOA 2V7GA 3RW9A 4BNTA 3TQIA 2XUHA 1Y1SA 4D6XA 1PFVA 1JUDA 1E2QA 4NZMA 1M72A 2CBGA 1XRRA 4G3XA 5C8YA 5FQNA 3AESA 3FNBA 3LE8A 1AGXA 1V3UA 2NSLA 2PSJA 5HKKD 1E5VA 4EWLA 2C7RA 1ZH4A 4MJXA 2H1FA 3THYA 2Q4DA 4HH3C 3U4DA 2A1TS 3VPSA 3B1FA 3CS3A 1EWRA 4Q82A 1VL8A 2KQUA 2Y67A 2PYDA 4GMKA 1XL0A 1DSSG 3JWJA 4HG2A 2Y4NA 1R5NA 3ED1A 3Q5GA 4HEQA 4UREA 2MSKA 3CF2A 3ODPA 4V38A 3LWZA 1V3TA 5DNEA