2VHXA

Crystal structure of the ternary complex of l-alanine dehydrogenase from mycobacterium tuberculosis with nad+ and pyruvate
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
371
structure length
368
Chain Sequence
MRVGIPTETKNNEFRVAITPAGVAELTRRGHEVLIQAGAGEGSAITDADFKAAGAQLVGTADQVWADADLLLKVKEPIAAEYGRLRHGQILFTFLHLAASRACTDALLDSGTTSIAYETVQTADGALPLLAPMSEVAGRLAAQVGAYHLMRTQGGRGVLMGGVPGVEPADVVVIGAGTAGYNAARIANGMGATVTVLDINIDKLRQLDAEFCGRIHTRYSSAYELEGAVKRADLVIGAVLVKAPKLVSNSLVAHMKPGAVLVDIAIDQGGCFEGSRPTTYDHPTFAVHDTLFYCVANMPASVPKTSTYALTNATMPYVLELADHGWRAACRSNPALAKGLSTHEGALLSERVATDLGVPFTEPASVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-Dimensional Structures of Apo- and Holo-L-Alanine Dehydrogenase from Mycobacterium Tuberculosis Reveal Conformational Changes Upon Coenzyme Binding.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
molecule keywords ALANINE DEHYDROGENASE
total genus 124
structure length 368
sequence length 371
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.4.1.1: Alanine dehydrogenase.
pdb deposition date 2007-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01262 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domain
A PF05222 AlaDh_PNT_N Alanine dehydrogenase/PNT, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vhxA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vhxA02
2G0TA 3RI3A 3SX2A 1SEVA 2HK7A 2QHXA 4NU5A 4WLVA 1PJTA 4NFSA 2EP7A 2VHYA 2PD4A 4TRJA 1B2LA 1P31A 4OAQA 1IOLA 3C7DB 3OEWA 3I9NA 5JYEA 5TQVA 5A02A 2X9NA 4YEDA 3FF4A 3KYDB 1NM5A 4ZQFA 4AJKA 4JBGA 2WMDA 2B69A 2RHCA 5CPFA 1LBEA 1Q0QA 1ULUA 3MWDB 2OP0A 4CV2A 3E5MA 4YRBA 2Y1DA 3AI2A 1I3LA 3JV7A 5KVVA 4J4BA 2G76A 4HBGA 4F6LA 3ICCA 1B3BA 1R12A 4GH5A 4FS3A 3ZWXA 1LLUA 4GMFA 3AUTA 1U3TA 1KC3A 1KEPA 2AA3A 3MJEA 4NBUA 3LDHA 3QLJA 1H5QA 2WDZA 5I7FA 1E0DA 2C2YA 5IFLA 1C0LA 2W2KB 4IIVA 1PJLA 3E8XA 1Q1NA 1T4BA 2BGMA 4IQ8A 3WWYA 3JQDA 2X8LA 1QV7A 7ADHA 1Y8QB 4FFLA 3TNLA 4YVFA 5COQA 3FN4A 4RPGA 4CLOA 2Y0EA 5DOVA 1LC3A 2EKPA 3ZU2A 1Y9EA 4IQ0A 2V6BA 4XYMA 1K5HA 1RPNA 1NQTA 1PWZA 4RV9A 1E6WA 1GV1A 4PLYA 1Y8RA 4BV8A 5HBRA 1Y1PA 1JDJA 1HWYA 3OJ0A 4YJDA 4W7HA 1V0JA 3MJVA 1DHRA 3OQ6A 3H5AA 1H6CA 1EBFA 1W4ZA 3WGYA 4QEDA 1C1XA 1SB9A 4GGOA 1DDOA 5L7WA 1GY8A 1Q0LA 3QHAA 3VTZA 5AXDA 1ENZA 4XGIA 5TGDA 4XRRA 2NU9A 3W8EA 4L75A 4XIJA 1PJCA 1Z74A 4R01A 5B4VA 1H93A 3U4HA 4E2ZA 3TN7A 1ZEJA 2A94A 3WGIA 4YACA 3AU9A 3VKUA 2WYUA 3WIEA 3LF1A 2CNBA 2GD1O 2PH3A 1QKIA 3LU1A 1OOEA 2UV8A 5TC4A 4NBTA 2EJVA 3R6DA 4KMSA 4YJHB 2HSDA 4Y6RA 2OP1A 3ONFA 5A9SB 3S1LA 2VUTA 1EFKA 3HN2A 2QG4A 2HLPA 4BKUA 3RUIA 3VH1A 3EC7A 5G4LA 1H2BA 3RJ9A 1H6DA 1EZ4A 5H83A 5TS3A 4CMIB 3GA0A 3ULKA 1KVRA 4PLZA 5BNFA 4BUCA 3FNEA 1HE3A 2GNAA 3IMFA 1ZMOA 4E5MA 1JWAB 4EJ6A 3ORFA 3ZHZA 3TRIA 1HSOA 3PTZA 3DBLB 3UN1A 4YJFB 3WGGA 2D5CA 3L9WA 1N7GA 4M54A 4RF2A 2AG8A 3HFSA 2DTEA 2Q3EA 2P68A 3M2PA 1HF3A 2WJPA 2AW5A 1DEHA 1M76A 2HU2A 3RC7A 4BL5A 3BHMA 4Y9DA 2VNAA 5GY7A 5CEFA 2H6EA 4D0RA 3BMQA 3JYPA 2P5YA 4PLHA 3IAHA 3I3OA 1MXHA 3S2EA 2YYYA 4QFCA 4HP8A 4CMGA 5B1YA 4YAEA 3OETA 1E3LA 1ZJZA 3SLKA 3DMYA 4B7XA 1JAXA 1IPFA 3JQGA 1Y81A 1JA9A 1RJWA 2CMDA 4Z3KA 4DL9A 1BTOA 3PI7A 1DC6A 5DP2A 1ENOA 3OIFA 2PWZA 3Q3CA 1QR6A 5A04A 1M67A 1BWSA 1JLLA 2Y1EA 3JQ8B 3KEOA 1KVSA 2J5RA 4PCVA 4BNMA 3DHEA 4IPTA 1NBOA 4DWVA 3LK7A 3DAPA 5C3MA 1H0KA 4RVDA 3L4BA 1EFLA 2VYVD 4ZVVA 1YDEA 2LDBA 3GMSA 3AFNA 2PLAA 5IDWA 3GEMA 1ID1A 2VCYA 2B4TO 5FFFA 5L7TA 4G5HA 4RVHA 2HUNA 2X86A 2NTJA 3V2HA 1PZEA 4XQ9A 4WOKA 1BXGA 4J1TA 1E7RA 2JJYA 4W7IA 4HV4A 3JQ9A 2QZZA 1PTJA 4TQGA 4FIZA 4TVOA 2C7GA 2VTDA 4YDRA 3DFZA 4HFRA 4MVJF 2Y1FA 3HDJA 2RH4A 1R0KA 4CJXA 4AJOA 4DTIA 4FC6A 5G0UA 2X5OA 2XXBA 1DFGA 2VYNA 2CZCA 4AJJA 4MIYA 3DQPA 4E5NA 1B8PA 4NNJA 2BLLA 2JHFA 5T8KA 3R3JA 4JNKA 4KQWA 5TT0A 5JAMA 1Z7BA 2Q46A 4GPD1 3JSAA 4PRLA 4RZIA 4XX0A 4CM4B 4E2WA 2I5PO 4W9NA 5I9NA 3MJSA 1DXYA 1OAAA 1B26A 2G17A 2JAPA 1QYCA 2AQKA 2DQ4A 2RAFA 2NWQA 2YV2A 4E5YA 1NASA 2YFQA 2GLXA 4MVJP 4OYRA 4NIMA 3O26A 4IGEA 1Q7BA 1HYEA 2UUOA 3PLNA 1NWCA 2IXAA 1UXHA 5T67A 2ZTUA 4ESOA 4J4TA 4BO5A 3MEQA 4ZICA 3B1KA 4GX0A 1O0SA 1QYVA 4OSPA 4KUGA 3IKVA 2YQ5A 5ER6A 4XDYA 1DIHA 4XQCA 2HCTA 2PGLA 4HWKA 2V6GA 3A9WA 3LSYA 4BNKA 5HRUA 3RUEA 2EKLA 4WLNA 5I9MA 4Y67A 4XJTA 3WBBA 2X7HA 3M1LA 2YW9A 2Y93A 4W6ZA 4PN3A 4R5HA 1KIFA 4BO2A 1F06A 1ZFNA 3ADOA 4IGFA 3MWEB 4XB2A 2W98A 3V1TC 3WGZA 4CV1A 1H94A 4NZ9A 2ZIZA 1C1XB 1A5ZA 1LXCA 2NVUB 2GN4A 5JCJA 5IDXA 4IDAA 1A7KA 1P1RA 2YDYA 1CYDA 5IZ4A 1FF9A 4J1NA 5KVQA 1NNUA 2ZCUA 4KZPA 4ZRMA 4HFNA 2Z95A 4EBFA 4B4VA 4CM5A 2P91A 1YGYA 4MVJE 4S1VA 1C0IA 4RVGA 5GMOA 3K5PA 2C59A 1BW9A 3VDQA 4EEZA 4RF3A 4U7WA 4FB5A 1N5DA 4L9RA 3JD4A 4BGUA 5B37A 1DLIA 2YV1A 1EQ2A 1DHTA 1KY5A 1ISFA 3ZWNA 3S2FA 2GO1A 3E82A 1ONNA 4XWYA 3IOYA 3WIDA 3Q1LA 4EDFA 1R6DA 5DBFA 2Y1GA 3WX0A 5KTKA 4IXWA 4J0EA 4QT0A 1YVEI 4B8WA 1PR9A 1E7QA 3ZCXA 4RQTA 1WDLA 2D8AA 4XEHA 1HDXA 3UHAA 3V2GA 1NTOA 5IN5A 1SMKA 5COAA 2I9PA 4PZCA 1FDVA 1O9BA 4CQMB 1AXEA 4TZTA 4ND2A 4FFPA 3KTDA 4G65A 2GDZA 3H5NA 1VLLA 1R4MA 4BV9A 3PDJA 1FK8A 4CMHA 2O48X 1GD1O 2Y99A 2FOIA 3GOHA 3INTA 4H3VA 5JDIC 1X7HA 4OJNA 2DPHA 4ZN6A 4CMIA 4XA8A 3COSA 4RO0A 3QP9A 1TEHA 1IZ9A 1UAGA 1UDAA 1X14A 1PQWA 4EJ0A 2PFGA 1YQGA 2IE0A 1GZ3A 1GQ2A 2D1YA 4BO1A 1Q2XA 3HB4X 1RM4A 3E18A 4WCFB 1R16A 3UCXA 1UXIA 1NPYA 3M2TA 1PS0A 2OBYA 4ROSA 5JPIA 3JQGB 3TZCA 2GR9A 3BTVA 4M8SA 2FR0A 3PPIA 3VAZA 3RQSA 2VWQA 2HQ1A 3FPCA 4ALNA 3L6EA 2NVUA 3DAFA 3JQ7B 4WASA 3TL3A 3VDRA 5JMPA 3WXBA 1GL3A 1LRJA 1ZK4A 5JSFA 3EYWA 3Q11A 1PQPA 1Q7GA 3K2EA 1NR1A 1YH3A 5CDGA 4TVBA 1YS4A 3PP8A 3T7EA 1MLDA 2NM0A 1T25A 3JQAD 1VJTA 2I6TA 1I5RA 4B79A 3ZNPA 5IF3A 4WCFC 1YWGO 4RVFA 3BTOA 3G17A 4IUYA 4AVYA 1LDYA 3DR3A 1A9ZA 4L74A 3IKTA 4JN6B 5CDUA 2GZ3A 3BMOB 1XA0A 1UH5A 3DONA 5IJZA 1XU7A 4CLRA 1CF2O 1FMCA 3LVFO 3ZU5A 3VPSA 4CM9D 3ETGA 4U6QA 4YJFA 1P1IA 5THKA 5G0WA 2VHXA 3KYCA 2BELA 5DOZA 3ZNQA 1NQ5A 1LQUA 5A1TA 2DBRA 4O59O 4RLHA 3A4VA 1VJ0A 5EL0A 4GLOA 4GX5A 3VH3A 2JHGA 2WD8A 5BQFA 3CINA 3DBLA 4FN4A 4NMHA 3AUAA 3GH3A 4Z6KA 1UP7A 4DBZA 1DJQA 3PRJA 1M66A 1LC0A 1LQTA 3DBVO 5L40A 2RIRA 5FI3A 1R66A 4DMLA 4WLFA 3HB5X 5DULA 2QRKA 1U8XX 2O3QA 3L6DA 4K1LA 1G0OA 2Y1OA 4IIUA 1UDCA 2OFPA 1QLHA 3FTPA 4JX8A 1LI4A 2GERA 4RPJA 4CMEA 3F6YA 3FNGA 3ZW8A 5I7VA 3ZWBA 4D3FA 1KERA 3DAGA 3PGXA 1GUYA 3AUUA 5J23A 2Y0CA 1ZXLA 3TFQA 4GQAA 4YAIA 1NQAO 1JVSA 4OQZA 4LISA 1NXQA 4I5DA 1BW9B 1XG5A 2YHIA 1LRLA 4QXMA 2HK9A 1K2WA 2EGHA 3Q2IA 3H9GA 3WLFA 4DPMA 3SVTA 3G1UA 3PHIA 2DFDA 3DMTC 4J3FA 3O38A 2TMGA 3GVHA 3JQ9C 3WLEA 2PD3A 5F1PA 6ADHA 2EERA 4L76A 3HG7A 3FBGA 2A4KA 1N7HA 3PGJA 4DXHA 1T2DA 4UUMA 1ISJA 3ZWMA 3D1LA 5LDGA 3I4FA 4DIBA 1LU9A 5TJ9A 4NH4A 3WYCA 2B4QA 3A14A 3EVNA 4JJFA 4RORA 1LTHR 4K9DA 4MKZA 4PGFA 2Q1TA 2FP4A 5ILOA 4J9UE 1V3VA 1E7MA 4YT4A 3FRJA 1QLJA 4WLUA 1DO8A 3K96A 3LC1O 4GSLA 4I5GA 4PIVA 4QFDA 5L9AA 2UUPA 3WOHA 1U3VA 4K28A 3F9IA 1ZBQA 2Q45A 4XYGA 3CMCO 4O5OA 4TSKA 3D7LA 1KEUA 3VZRA 1ONPA 5CG2A 2NU7A 1DLJA 4LN1A 1PS8A 4M1QA 2E48A 1NFQA 2QQ5A 2CDAA 1LUAA 5IDQA 2GASA 1XQ6A 2DBQA 3BZUA 1P45A 4JLWA 4OXNA 2OO5A 1R0LA 1T26A 3HDQA 4BKRA 2IRWA 1LSUA 3KV3O 4J9VA 2JCYA 4FGWA 5CDTA 3PJDA 1P33A 5DBIA 2GZ1A 3CZRA 4YAGA 1UDBA 3HUDA 4FFRA 3ITDA 3H9JA 3TOXA 3RUHA 4ONEA 4NJMB 3ZU3A 4BNVA 2JCXA 2TMDA 1WVGA 3GDOA 5DF1A 2ZB3A 5AXBA 5EERA 1GUZA 1DRUA 4KTTE 3ZHYA 1DRWA 1WDMA 3U4IA 1ZZEA 3TFOA 1D1TA 4YYZA 3CUKA 1NHGA 3PFWO 1GEGA 4MINA 1JAYA 1I33A 4P8RA 1MA0A 4BOYA 5ENVA 4F46A 1P1HA 2IXBA 2O50A 4O0LA 4XYEA 1K6JA 3PIIA 2GYYA 1IE3A 3VVCA 1R15A 3VPXA 3K9QO 4UVGA 2O2YA 3FBTA 5TX7A 4MO2A 3X2FA 1ZW1A 3L07A 2GPTA 5F1OA 5L53A 4GWGA 3VPGA 5T64A 1E3WB 2VUUA 2NU6A 1ULSA 3DZBA 2W2LA 1N1GA 5KVCA 1SCUA 4MPDA 1DSSG 2OORA 5A3JA 4LVCA 1VSVA 1R4NB 4R1TA 3PJEA 2EJWA 2IDZA 3C8MA 3U4DA 5ER9A 3WB9A 1K6XA 3T4EA 2R00A 1UZNA 2C82A 4Q3EA 1I3NA 3JQBA 1H2HA 3E1KA 4KWHA 4QECA 2JCVA 3D3WA 3WBFA 4NFYA 2WD7A 2ZTMA 4CLRB 3L77A 1B14A 3OHSX 2NADA 4C7KA 2QRLA 2PD6A 3HDYA 1ZSNA 4YWJA 5A03A 1B3RA 1U3UA 2EWMA 3QW2A 3LLSA 5CFZA 4RQUA 4A5OA 4CQMA 4E4YA 3RC1A 5IZCC 5JAIA 4E2XA 1K89A 5LC1A 2C07A 3GGOA 2PK3A 1TT5A 4CMAA 3ZN2A 2HKIA 4LGVA 5A9TA 1IUKA 3L9XA 4U8GA 5EPOA 1XGKA 3LYLA 5JCJD 4BO8A 4XJSA 2HRBA 5CPBA 1HE2A 3K2BA 4K6FA 3IJRA 5TIIA 4E0BA 4N54A 1H9AA 1ADFA 4LK3A 3WQQA 4BVAA 1I2BA 4YR9A 4A03A 2W2LD 4CV0A 4D44A 3OIGA 4PG6A 4B3IA 1VL8A 3WGTA 1E3EA 1A7AA 1YO6A 2G82A 2WM3A 1XSEA 8LDHA 1TLTA 3OMLA 5IG2A 3FD8A 2DBVO 5GZ1A 2Q1SA 4YPOA 2PA3A 1E1LA 1LSJA 3QA9A 3V1UA 3D64A 3RC9A 1WNTA 1LA2A 5KJCA 2J3KA 4WLOA 1XYGA 4UUPA 1U5CA 5K0ZA 3MOIA 7MDHA 2CD9A 3DC2A 2O23A 3IJPA 4XD2A 1EVIA 3ZWPA 3OJOA 2FR1A 5F3RA 3NTQA 2CVQA 1UP4A 3A28A 4HY3A 3RSHA 1YQDA 2C5AA 2YY7A 4Z3DA 5IAAA 2RHRA 4AJ2A 2NTNA 3EAGA 5EIOA 3D0OA 4IDBA 4XRGA 1S7CA 4MVJM 1DPGA 1H9BA 5JAQA 1L1FA 4BQRA 2VYVA 2Y1CA 2C20A 3IP1A 3NT2A 3QJ5A 4ITUA 3QE3A 1GZ6A 3N74A 3HWRA 2LDXA 2P9EA 4UVHA 1JVBA 5G2OA 3DHNA 4DMMA 1ZK1A 1I2CA 2VZ0A 4PLVA 3WWZA 4UEKA 3FPLA 1MFPA 1M2WA 1B15A 4XIYA 3IUPA 1TXGA 2WEKA 4WUVA 4Z0HO 1MFZA 4RF4A 4ALIA 3TZKA 4EUEA 1XHLA 4I5EA 2JD2A 5JNLA 4XYBA 1T1RA 3KUXA 1GAEO 1EEHA 4J1SA 4J2HA 4UEOA 1WMAA 1DOHA 1HE4A 2X0NA 1UZMA 1GYPA 1ZIDA 1DB3A 3GDGA 3PYXA 1YE3A 4AFNA 1ENYA 2Q2VA 1IB6A 1RKXA 2X23A 1NVTA 2BI8A 3FHLA 3FNFA 3JQBC 3V2UA 5CEEA 3S2IA 1ADGA 4UUNA 4UVIA 4AJLA 4BNJA 2I65A 4O63O 1PL6A 2EW2A 1IYZA 3OM9A 3G49A 1K0UA 3INGA 1PU2A 3WMWA 4YXFA 3PDUA 1HL3A 4LW8A 4D7AA 1X13A 3E9MA 2PY6A 3AY3A 1PS9A 1E7YA 1A4UA 1JU9A 1V8BA 3QWHA 3V1YA 3U9LA 1X1EA 2IODA 4R1UA 3ST7A 1JN0A 3UOGA 4JK3A 1Q7CA 1XEAA 2BMAA 2X0JA 1X1TA 4H16A 4NK5A 2P9CA 3OP4A 3PYLA 4AJIA 1GTMA 4YAJA 4FSHA 4TRRA 4RPHA 3UAGA 4J2OA 2WYVA 4I8XA 4IZHA 3ZNOA 4CL8A 3AWDA 4MDHA 4L4RA 1YL6A 1D4FA 4ALMA 4K26A 1OMOA 2WE7A 1GCOA 3CXRA 3KSZO 3OSUA 4MP6A 1MUUA 3AM4A 5C7OO 1CIVA 4DQXA 4JGBA 1GR0A 4XYLA 4R1NA 1HYGA 2QZ9A 1YOVB 5L4SA 2PKRA 4MJLA 2Q50A 4EUHA 3K73O 1A9YA 1OI7A 3A06A 3I1JA 3TPCA 1WPQA 3VPFA 1ADCA 1HDZA 4E5PA 1UXGA 2B5VA 3IP3A 3INRA 3E9NA 2DTXA 5IN4A 1FDTA 1AHIA 4J49A 1Z45A 5JCXA 1YBMA 4GLLA 4EUFA 3KETA 1E3SA 3EVTA 3QWFA 4P4NA 1ML3A 1IL0A 4IJWA 2QIOA 4D45A 4ZQGA 4R16A 3NUGA 1HEUA 1XDWA 1KYQA 2OXIA 1AE1A 1D1SA 3M1AA 3ANNA 3ZW9A 4EGFA 3W8DA 4CMEC 3DMTA 2YZ7A 2Q49A 4N5NA 3S8MA 5U9CA 1P74A 4U6SA 3AI3A 3FTNA 5JDCA 1VL6A 4OKNA 3KM0A 1RYDA 4OM8A 4D43A 4B7UA 5THQA 3CE6A 4URFA 4FDAA 2YJZA 5HTOA 5TF4A 3GAZA 4R5MA 3ZU4A 2G5CA 2AEMA 4IXTA 3DTTA 3I52A 3I23A 3DOCA 3JQ8A 3MCVA 1Y6JA 5L95A 2HJSA 1LJ8A 1SBYA 2WE8A 3BTSA 1UR5A 4IDDA 4BB5A 5FF9A 4BO7A 5A4DA 3GVXA 3OQ1A 1DIRA 1EUCA 2ZQZA 1IZ0A 5JW6A 4KWIA 2BFPA 1QV6A 2HMUA 5KWEA 2EXXA 3RKUA 3ROKA 2C0CA 1K6IA 3ENKA 2AE2A 1GV0A 4QTZA 3ON5A 3GFBA 5TLSA 3GR6A 3UW3A 4PZDA 2W4QA 2SCUA 4BO4A 2NNLD 3E5RA 4FGSA 4B3JA 2HRZA 2DBZA 2J3HA 1HDCA 1QG6A 4OXYA 3N58A 3BA1A 3VH2A 2Z1MA 4RCVA 1GADO 3QVXA 1PJ2A 2OZPA 4CUJA 2NTVA 3JD3A 3U62A 1XLTA 2FZEA 3IL2A 2FPGA 2OHXA 1VL0A 2GF2A 1EVZA 4D3DA 1ISMA 1X15A 4B4OA 3WGOA 4AJPA 1WMBA 1DRVA 1LLDA 1X0XA 3SLGA 4NI5A 4ID9A 5EJ2A 1L7DA 3K92A 2EW8A 3ETEA 3AY6A 1HDOA 4Y6SA 3ZWAA 2CF6A 4PFJA 3CH6A 1N2SA 4FJ0A 1X0VA 2PR2A 1K3TA 4FFOA 1QYWA 4P22A 1SO8A 4YB8A 3G0OA 3HN7A 3NKLA 1LLQA 5CDYA 4R68A 5IZCA 4XQGA 1ORRA 3Q9NA 4K6CA 1T1SA 2PZKA 1KVUA 2P2SA 2VRCD 4E33A 4JROA 1Z75A 1KOLA 4OKIA 1I36A 1EBUA 1W6UA 2OBNA 2GN6A 2CVZA 4ND1A 3GZNA 1VC2A 4KQXA 3ZZNA 3UGKA 4A0SA 3I83A 3NRCA 5L51A 1PX0A 1MGOA 4PG8A 5EESA 4GX1A 3CEAA 3NGXA 2XAAA 4KOAA 4OQYA 5T6BA 1Y9AA 2PZJA 1QRRA 2A35A 3TZ6A 2NQ8A 3N7UA 5BSFA 4CMBA 1X7DA 2OOSA 3Q2KA 4WEQA 2IZZA 4DQUA 4XQEA 3HFGA 3MJCA 3QV1A 3LT4A 4MVJG 3OA2A 3P19A 4L0QA 3DWFA 2YHUA 3R0IA 1U7HA 3ZWVA 1V35A 5G0VA 2DVMA 3KHUA 2C29D 3ZWOA 3GVIA 4GKBA 4J7CA 4BHTA 3ZGYA 2AG5A 1WXDA 1ADBA 2YFHA 3NTRA 5C37A 4UUOA 4Q3DA 5KKCA 2C2XA 4F3YA 2NACA 2X4GA 4UAGA 1CWUA 1XCBA 3HE3A 4MOWA 4WJZA 2IZ0A 1JKIA 4B8ZA 3TZHA 2H5LA 3OBBA 4IJVA 4J0FA 1PGQA 1I8TA 4CM4A 4DLBA 2VTEA 4EW6A 5K6AC 3ZWWA 3M6IA 2EG9A 1C0PA 4CPDA 1YOVA 1F12A 3AOGA 3AJRA 3DZGA 4W4TA 4RJTA 3DZJA 3PFFA 5DNAA 3RUDA 3X2EA 1F17A 1U4OA 4XKJA 2ZQYA 4GGPA 1RM5A 1XQ1A 2PKQO 3VKVA 4NJOA 5BSGA 3MZ0A 4BNGA 4U5QA 4Y8VA 3U49A 3DEYX 4WLEA 1OC2A 5AYVA 4Q3AA 5L3ZA 2VOJA 4CM1A 1BG6A 2B4RO 1RYEA 4E30A 3KO8A 4NBRA 3O03A 5C7LO 3SXPA 3T4XA 3DL2A 4CMKA 1NQOA 5A5EA 3B1FA 3EK2A 4BNZA 2AQIA 3F1KA 1DIAA 5U4QA 3LT1A 3KZVA 1BXKA 4MIEA 4PG7A 4WCFA 2RH8A 4WCDA 5FYDA 4L73A 4E5KA 1ZCJA 2V7PA 3HDHA 4BO0A 4NFHA 3WQRA 4J43A 2ZTVA 4M89A 4OHUA 2ZYGA 4TRMA 2UYYA 3TJRA 5JYDA 4E3ZA 4JBIA 2H1SA 2VUSA 2I3GA 1EVJA 3RBZA 2Q2WA 4I1IA 2XXJA 2ZJ0A 4P4LA 1CJCA 2P4QA 4S3MA 2ZJ1A 2DAPA 2J5QA 4M55A 5I8WA 5FWNA 4E31A 4W82A 1P0FA 1CERA 4JJGA 3O8QB 1EE9A 1JWBB 4BNTA 4DVJA 4CMJA 1BGVA 2JFHA 1LDMA 2DKNA 3NTOA 1PSDA 9LDBA 5HA5A 3DHYA 4HKTA 3NAQA 1Z82A 2Q4BA 3QRWA 4A10A 1FDSA 2I66A 3F46A 1NAHA 1YL5A 1MB4A 3IS3A 3KSUA 3BYZA 4U0JA 1GEEA 3P7MA 2DU8A 4BQPA 2RCYA 4AJEA 4ZGWA 4EI2A 1GUFA 2R2GA 3NT5A 4FD3A 5CAEA 4YTEA 3I9LA 4OMUA 1EQUA 4OOFA 4DC1A 1I32A 4JXKA 1HYHA 4WPGA 3QVSA 2YQ4A 1XWFA 3VTFA 5CEJA 3ZWYA 4B4UA 1GZ4A 4D46A 1TB4A 4I5FA 4Y6PA 3ONEA 3PEFA 3FCOA 2PZLA 1AHHA 4BMVA 2JL1A 3PK0A 5AQ1A 5ITVA 5DP1A 3GY0A 5IXSA 3TWOA 3MTGA 3SBOA 1ISHA 3WG9A 3GZNB 2E82A 2W90A 5A3VA 4DYVA 5CDSA 3H9UA 1J6UA 4TZKA 1ZSVA 3ZI0A 3BMCA 4DREA 1E3IA 3L4BC 2NVBA 3JQAB 1W0CA 4BNLA 1VPDA 1BSVA 4JQCA 3L6OO 5H82A 3OICA 4ZHSA 5KJEA 4Q39A 3JQEA 1E77A 5KCZA 3H2SA 3UICA 4PRKA 4DIFA 5I7EA 4DLLA 2GSDA 1W8DA 2VHZA 2W8ZA 4GL4A 1SZJG 3C24A 4MVJD 3LT0A 4ZRNA 3AK4A 3GF4A 1P77A 4U0KA 3ANLA 3ROPA 1JW9B 4RVSA 4E13A 3SJUA 1O6ZA 3WTCA 4H7PA 1VSUA 2DUUA 3FR8A 4GAEA 4ALLA 4E6PA 1NFFA 3Q6IA 4MKRA 3RVDA 2B36A 1GFSA 4MP8A 4BNIA 3WGHA 1YONA 1VRWA 3JYQA 4DPKA 2VT3A 2DPGA 4UVEA 3EY4A 4UVDA 3SJ7A 1SEPA 4HUJA 1LDGA 4P4GA 1OC4A 1SNYA 1I3KA 1KEVA 4NBVA 3UF0A 4BO9A 3ZV6A 2EF1A 3KSDO 1EMDA 4C7JA 1GU7A 5I7SA 1T2FA 1E6EA 3BMOA 4E32A 3GN1A 2ZB8A 4EITA 3TF5A 1E5QA 1MG0A 5COBA 2HMTA 4DYDA 3I9OA 1VJ1A 1O5IA 3PIDA 4Q3CA 3KYCB 3WNVA 2OMEA 5GZ3A 1HDGO 4DBVO 4BS9A 3GFGA 2P4HX 3V8BA 3EZYA 1E6UA 5AVOA 4CUKA 4Z9FA 3UFXA 5JY1A 5CP8A 1LDEA 1SAYA 1T2EA 4R69A 2B5WA 4D79A 1ONOA 5G0TA 1XKQA 3VZSA 5KJFA 1HZJA 1XU9A 1E92A 3QVTA 4ZU3A 3JQFA 3ICPA 3UCEA 1ZH8A 4OH1A 3K30A 2E4AA 2C54A 1NPTO 4HXYA 4YCAA 2PNFA 1WW8A 4D42A 3GK3A 4LRTB 1PJQA 2FSSA 2O3UA 4KUEA 4WE3A 4CQLA 4IS2A 1TT7A 4BNWA 3NV9A 1VKNA 1Y7TA 3VZQA 2O3TA 4CLEA 1N9GB 4ZQHA 3EZLA 3OIDA 3PHHA 4IS3A 3PQEA 5LCXA 1GCUA 2R6JA 5C7IO 4IY1A 4DUPA 3RJ5A 5KOIA 5EQFA 3EGOA 3GG2A 3RIHA 1WZIA 3WQSB 3PWKA 3EW7A 2XOXA 1PIWA 2HK8A 3SC6A 3RKRA 1U2GA 4PLCA 4CM8B 1ZVMA 1ZKMA 1NHWA 2CDBA 3B70A 3MTJA 2JD1A 5G4KB 4CV3A 4A27A 1ZO8A 2X9VA 2X58A 2VZ9A 4FW8A 4NPCA 1QYDA 1BHSA 1YB4A 3TOZA 4DA9A 2H9IA 3DZFA 4RPLA 3GEGA 4DQVA 4OSOA 1PZGA 4IDFA 3E48A 1DIGA 1BDBA 3EHEA 1E3WA 2VN8A 3IQDB 1UP6A 1JTVA 1BXZA 3H65A 2YUTA 3GUYA 2AQ8A 2IZ1A 3WGQA 3ZHBA 3PQFA 1WAMA 1EE2A 5JBIA 1DC4A 4FQ8A 1GDHA 1B16A 1I3MA 4KP7A 1P9LA 3NJ4A 1EVYA 3AM3A 1ISGA 4XZ3A 1IHYA 3C3XA 1YDWA 2I3AA 3C1TA 4RVUA 1FDUA 3TQHA 1LDBA 4EZBA 3S55A 2CF5A 2GRAA 3AOEA 3A1NA 4TKMA 4BNXA 2BD0A 1JKFA 3KYDA 3ZV5A 1CDOA 1O95A 1ZK3A 2Q1WA 3HQ4O 3IC5A 4IJKA 1RWBA 3PWZA 1TT5B 2C7VA 1QMGA 3WICA 5I9LA 1M75A 2JD0A 3GG9A 2VRBA 1N1EA 5FEUA 4MVJA 3PZBA 3JD2A 1MP0A 5HS4A 4MIOA 3PWSA 3NJ8A 5FI5A 5T5QA 4F6CA 2Y67A 3TDKA 2E37A 5HWSA 1BVUA 4CR7A 3LLVA 2H63A 1P1FA 2Y0DA 3NYWA 4I08A 4IZIA 3CZMA 5ES3A 3SEFA 5HM8A 4IDGA 1LEHA 3LC2O 1P1KA 4Q3NA 1RM3A 1YKFA 4ND5A 4JBHA 3HADA 1ARZA 4OIMA 3LC7O 2HMWA 3HZZA 4CLOB 2DUWA 3PZRA 3GZ4A 4CQMD 3BMNA 4ND4A 3W6UA 3O9ZA 3BXXA 5BNIA 3GGPA 5I8ZA 4IDEA 3K31A 1HXHA 4GVXA 4JP2A 1V3UA 4YA6A 3RASA 5ADHA 2FMUA 1HRDA 1YXMA 3JYNA 5TT1A 4HNHA 3MOGA 3U3XA 2Q99A 3DBHA 4FR5A 1OFGA 3D4PA 3DZIA 3IUSA 3VZPA 1F0YA 4HADA 1KS9A 1U5AA 1ZUD1 2E6UX 2WD7B 2X5KO 3FWZA 1I30A 1PJBA 4LMRA 3GRKA 4HNGA 4EJMA 1B0AA 3T7CA 3QWBA 1GPJA 5GZ6A 3H9EO 1UUFA 1E7SA 5MDHA 2PTGA 4AJNA 5L4LA 3O8QA 2IYPA 1U8FO 3ADPA 4FBGA 4BNFA 3FWNA 1V9LA 4IM7A 1KETA 2D3TA 2VHWA 2O4UX 5A5FA 1BDMA 3PVZA 2ZKLA 2GZ2A 2O4CA 2VZ8A 4PVDA 1N92A 2NSDA 1A4IA 4M87A 4CM7A 1U4SA 3WNQA 5F21A 4BKOA 1FXSA 4UEJA 2CUKA 2WTBA 4Z0TA 1Q0HA 3ENNA 2OL4A 5C5IA 4PG5A 2D0IA 3L0DA 4WOJA 4QX6A 1VM6A 5DDIP 3VPHA 4J4HA 4CQLB 5HS6A 2YDXA 5EN4A 3W4JA 4TMFA 4UULA 4RZHA 1E1NA 4I9NA 1Y8QA 4FFNA 3H7AA 4E21A 1A72A 3GUCA 3ZNNA 3H3JA 1XIVA 3S2GA 4R3WA 3WYEA 2FWMX 3W4IA 4QUKA 2D5AA 2IEDA 4IMRA 4J7UA 2RBEA 3KLMX 2X0IA 1T24A 2B0JA 2ILTA 4AJ4A 3JYOA 4Q3BA 3GNSA 5JO9A 2VQ3A 2CVOA 1N9GA 2Z5LA 3GEDA 3UH1A 3DOJA 4KDFA 1V6AA 1EK5A 2VHVA 3FSRA 3ITKA 2O3JA 1NX6A 3BMQB 3D5QA 2HO5A 3GC6A 4RLSA 4PG4A 2JFFA 4JJIA 5DCYA 5ENDA 2EIHA 3ZH2A 3WSWA 1PL7A 3JQFC 3ZWCA 3C7AA 4RF5A 4CODB 4BMNA 3D5TA 3QIVA 5JC1A 1E7WA 2FPPA 3I4CA 3G1TA 5DCWA 2BFAA 2Q4EA 2X6TA 3GPIA 2Y66A 3UCFA 4KUHA 1BRMA 2B83A 2FY8A 4IDCA 4R3NA 3GNTA 3H4VA 3DFUA 4DRYA 3D4NA 2I67A 1PL8A 2J3IA 2HJRA 1YRLA 2F00A 3H3FA 3K8ZA 4PLFA 2ZATA 2VWHA 3PHJA 3PJFA 6LDHA 2BHLA 1G1AA 2HMSA 1KC1A 4YRDA 3VHRA 1AUPA 3CKYA 4TROA 1EUDA 3O4RA 3QWIA 3DXFA 2NLOA 4MKXA 2VT2A 3UKOA 4P38A 1R0SA 5L7YA 3OH8A 4L8VA 1PGNA 1U7TA 3W8FA 2PGJA 2FR8A 1MX3A 3GT0A 5F1KA 2JKVA 2B35A 3GVPA 4IINA 5LDHA 1Z73A 3FR7A 4D3SA 2AMFA 5JXWA 2EV9A 4FPXA 1B8VA 1AGNA 4XGKA 3NDRA 1D8AA 4IBOA 1ZSYA 4XR4A 3DTYA 3JQ6A 5KJ1A 4XGNA 3OJEA 2CFCA 3CMMA 3G3EA 3VC7A 2Y68A 4MVJH 3H9QA 4GBJA 1HLPA 1WLYA 1ZJYA 3RUAA 5BR7A 1Y5RA 4BNUA 5EMHA 2NQTA 3B1JA 3OEYA 4FJ2A 4JP3A 4R41A 1E1MA 4QO7A 4JCOA 3GNQA 1O89A 1U3WA 5A05A 4AICA 4ALKA 5AXAA 3ABIA 3CSDA 2DM6A 1QYXA 5T57A 3ASVA 4MVJI 3BMNB 3Q0EA 5TRTA 3RFVA 3W1VA 2ZYDA 1U28A 1ISIA 2X0RA 5JAZA 5DCUA 3JQ7A 1HETA 5B12A 3CIFA 2BFOA 3WYBA 4LCJA 1E1KA 1YJQA 1SB8A 4A7PA 1DC5A 1DIBA 1XR3A 2J8ZA 5BSEA 2B37A 1TA4A 3BHJA 5JY6A 4N18A 3ASUA 3OFSA 3MJ4A 4B7CA 1PZHA 3PQDA 5G4KA 5A9RA 1OBFO 2FZWA 1QP8A 4L4SA 4NBWA 1CQJA 4RPKA 1SPXA 2WYWA 4HX5A 1E5LA 1NYTA 1ZXBA 4DIOA 1E3JA 4YBZA 3NDJA 3GVCA 2YHIB 4ND3A 1PWXA 1MG5A 2G1UA 1PGJA 2A92A 2HAEA 4FC7A 1LNQA 4BNHA 1UZLA 4TRNA 1PJSA 3G79A 1DBVO 1I10A 3RFTA 4GMGA 1HT0A 3WR5A 1J0XO 2XPCA 4GX2A 3WDSA 3KB6A 1G0NA 4HFMA 4ZA2A 1YBVA 4ILKA 3GHHA 3FI9A 1C1DA 2P5UA 2QYTA 3F5SA 3ZHXA 3GLQA 1D7OA 1HDYA 4CM6A 2P9GA 2VRCA 4FJ1A 3AW9A 4TWRA 2POQX 3I6QA 4YQZA 4R51A 1JKJA 3OJFA 1Z6ZA 2GGSA 2AHRA 2EEZA 5JDCC 5K9ZA 3RBVA 3WJ7A 4BMSA 5B4TA 1C14A 4Z9XA 1BMDA 2Z1NA 3AUSA 2JAHA 2DLDA 1FDWA 3JD0A 3U09A 4UREA 1P3DA 4R4JA 1CQIA 2ZB7A 1P44A 4A2CA 4G2NA 2GN9A 4GSKA 1NWHA 3KVOA 4B3HA 3PXXA 2BF7A 3B6ZA 5JFOA 2VYND 4YAKA 4BKPA 2QW8A 1BVRA 5U1PA 4BNYA 1H6BA 1O8CA 1J5PA 1PJ4A 1UJMA 3BIOA 3GGGA 2PH5A 1LLCA 4L4XA 3AM5A 4CM8A 3DBHB 3EUWA 3OJLA 4DGSA 4B4WA 4DLAA 3ZV4A 1YJ8A 3ROQA 2BI7A 3H5RA 4KDEA 4PLGA 3ZDFA 1P0CA 2E49A 3U5TA 3RBXA 1S6YA 1QORA 1YB5A 1F14A 2BGLA 2ZTLA 4FOSA 3AU8A 4A73A 4H15A 2X22A 3VOSA 3AFMA 3KYBA 2AQHA 1GYRA 3E6AA 4O6VA 4AL4A 3F4LA 5AXCA 2DC1A 2FN7A 1O94A 1EDZA 1LSSA 1NR7A 1UXJA 1YQXA 5A06A 1MXFA 3E03A 4Y98A 5JC8A 1N8KA 4WKGA 1Y5MA 1IPEA 2NUAA 1QSGA 1TI7A 3K6JA 3JTMA 4WEOA 1NP3A 2BH9A 3RROA 3OECA 1HZZA 4M86A 5K6AA 3KBOA 3F4BA 1DAPA 1XELA 3GRPA 3DBRB 2EGGA 2X9GA 3BAZA 5ICMA 2VWPA 4NQZA 3F5QA 3GN2A 5TSDA 1YL7A 4XR9A 4X54A 3WJAA 1MV8A 3QWAA 3C85A 4OOEA 2AE1A 1A71A 4ALJA 4BGVA 1NVMB 4AJHA 4FFMA 4QO8A 1AXGA 5DT9A 3F1LA 1NFRA 3U0BA 4XDZA 3SC4A 3C7CB 3JD1A 3QVOA 5CHEA 1PZFA 1EDOA 1ZK2A 3JCZA 4YJGA 4GVLA 5MGBA 1HTBA 4XCVA 5H81A 5JLAA 3RWBA 1ENPA 1AN9A 3WSVA 3RFXA 1B8UA 3VVBA 2WWRA 3LF2A 3RD5A 3DOOA 1Y8RB 5TNXA 1ZMTA 3JQCA 5L45A 5L4NA 1DFHA 2CY0A 3ZV3A 4CM3A 5CG1A 3BMCB 1L7EA 1HDRA 5TJHA 3AOEC 1W73A 4N7RA 4A26A 3MJTA 1I0ZA 2O3SA 1IULA 3I5MA 4ZD6A 3STHA 3QY9A 3CPSA 4WNIA 5KVSA 3TZQA 2PKQP 3NT4A 1T4DA 4GWKA 1F8FA 2GCGA 2PGDA 2Q1UA 3NDIA 3UXYA 3WFJA 3GHYA 3VH4A 2D59A 3CTMA 3KXDA 2OGUA 3P5SA 2CSUA 3AY7A 3B20A 4J90A 4QQRA 3RU9A 4WNCA 1J4AA 3WFIA 4LRSB 3HHPA 3LZ6A 1I2ZA 4PLPA 1I01A 1Z7EA 4RDHA 1M6HA 1M6WA 4RL6A 1RM0A 4WGGA 2V65A 1HE5A 3TSCA 2ZB4A 3HNPA 4NR0A 3F47A 4BO3A 2DT5A 3AI1A 1GQYA 2BRUA 3PJGA 3QQPA 4II2A 3QVWA 1PEDA 1TVEA 1LX6A 1ZEMA 1OZAA 4CLXA 3DO5A 4R54A 5KKAA 3BHIA 1NPDA 4LSWA 2J6IA 4LMPA 1FJHA 1CEQA 4RDIA 2PZMA 4OO3A 3KLPX 4PVCA 2I99A 2UVDA 1C1DB 1CETA 4KTVE 4FCCA 4I9UA 1WP4A 1KBZA 2IYOA 2ZYAA 3GQVA 4Q9NA 3KOUA 2OUIA 1U9JA 3WS7A 4IJUA 5AOVA 1EUZA 5KIAA 1IY8A 2C5EA 1B7GO 2W2KA 4BGIA 4NU6A 4BO6A 3E9QA 2D2IA 2IEBA 2HMVA 5JMWA 4N5MA 4J6FA 2YV3A 2ZCVA 4INAA 4R9SA 2FSVA 1PJ3A 3C1OA 4NJMA 1LRKA 4LSMA 1LSOA 2VOEA 9LDTA 1MC4A 3RU7A 4QSMA 2O7QA 2FHSA 3H2ZA 4AJ1A 3L4SO 5JDIA 2R00C 1KVQA 3EMKA 4YT2A 3ANMA 4W99A 2J5KA 2EP5A 3RUFA 4II3A 4NHEA 4I9HA 2AXQA 2VWGA 4BB6A 4IQGA 1R37A 1UAYA 2EKQA 1SC6A 4DC0A 3IDSA 4CLDA 3DZKA 3JYLA 5T8KC 3Q9UA 2QX7A 1T2CA 2O3RA 5IXYA 1MC5A 3RCBA 2D4AA 4WK6A 5JO0A 2DFVA 4XB1A 3ETDA 5BT9A 3OA0A 3H8VA 4BNNA 4OGWA 1GPDG 2NU8A 2J3JA 3RAJA 1WWKA 2O2SA 3NX4A 1PQUA 4Z9YA 1JQBA 3JQAA 4NDNE 3DB2A 4J1QA 5JE8A 1ZK0A 3NGLA 3HJAA 1WZEA 2UAGA 3NEPX 4OL9A 1R4NA 4BKQA 1BXGB 1F8GA 2NV6A 1A27A 5A9SA 1KY4A 4E12A 3IIEA 3R3SA 4G81A 4D0SA 2V6MA 2V6FA 4J16A 5JS6A 3R1IA 3D3WB 4CR6A 2ET6A 1PGOA 2GUGA 2I76A 4YT8A 1DC3A 4EEXA 1U1IA 3DZHA 3GDFA 3WTBA 4RGBA 5KJ6A 2DTDA 1DAOA 1G6KA 3I9MA 3I6IA 5ITWA 1YBAA 3OF2A 2PV7A 4ZQBA 4YRAA 1U2DA 3RUCA 1SOWA 4J91A 3DBRA 2GN8A 3I9KA 2BGKA 5KNLA 3KRTA 4C4OA 1KVTA 4IMPA 4PLWA 5BSHA 1V3TA 1UXKA 3KEQA 2NVWA 1H6AA 3TL2A 4PLTA 1NAIA 3GMDA 8ADHA 3LQFA 4CR8A 1YB1A 4J7XA 4YT5A 1I24A 5DZSA 4DPLA 4HFJA 4O1MA 2CDCA 2XF8A 3C1AA 3QSGA 3PHGA 3UVEA 2BFMA 2X1HA 4CUZA 3ROMA 1J49A 4JIGA 4CMCA 4F45A 3P2OA 2X5JO 4CLHA 4EYEA 4PZEA 1QXSA 5F5LA 1VI2A 4D41A 2O7SA 3UUWA 4BGEA 1VE9A 4E2YA 4WECA 3F3SA 4GKVA 4YJGB 2HDHA 3LT2A 1R4MB 1SOVA 2FPIA 3I9JA 3W4KA 3PYMA 4FOOA 1WDKA 4R1SA 4NK4A 5F5NA 3U4CA 1HSZA 1PGPA 2Y05A 1P1JA 1ZNQO 3V5NA 5BNTA 4M49A 4ZJUA 2VNSA 3GPDG 1GQQA 2Q2QA 3EDMA 5B4UA 2EHDA 2QRJA 3PHLA 4OXKA 3P2YA 4MP3A 4BIIA 2A9FA 4GI2A 1D3AA 4LCEA 1PR3A 4CL3A 2AEFA 1HLDA 1NVGA 4NG5A 5EQDA 1T2AA 3HSKA 2ZK7A 3WMXA 1C0KA 3ONDA 3OQBA 3W6ZA 3GAFA 5DBGA 1HKUA 4ZQEA 4YQYA 5EINA 1C3VA 4CM9A 2QYSA 2UDPA 1CRWG 3D4OA 3RC2A 3PLRA 3DDNA 2JFGA 4R9RA 4TKLA 2WSBA 3D3EA 4LVUA 1KEWA 1VKOA 4Z0PA 4AG3A 2F1KA 5DN9A 4W9NC 1DFIA 1X7GA 1GYQA 1DJNA 5G0SA 5ILGA 2AEJA 3BTUA 5IDYA 1EK6A 2BKAA 3H6KA 1LDNA 2FRDA 5ICSA 4N5LA 1IHXA 3FNHA 4YJHA
chains in the Genus database with same CATH superfamily
2G0TA 3IR5A 4YP0A 1CEXA 1TYDE 3JVDA 1K86A 2GTHA 3X1ZA 3DT9A 1PJTA 5EEGA 3T7AA 3BE6A 5BN3A 5MN4A 5EOVA 3R0JA 4LJ9A 2EP7A 3PS9A 4EOGA 4X0EA 2O2ZA 4JP1A 1LF5A 2FUG1 2OB2A 3NBAA 4HSGA 3C7DB 2XYQA 4UCXA 5KYTA 1U0JA 4I1UA 4EHJA 1JQKA 4IDQA 1A1VA 5JYEA 3EFOB 5A02A 3U80A 3KYDB 1U9IA 2WJ6A 4ZQFA 4F96A 5K09A 4BLUA 4G0ZA 4NABA 5DT2A 3TX6A 2WMDA 1AQJA 2BTOA 3D3KA 2WY2D 2VH5R 4M1ZA 1DVRA 1G2OA 4ND6A 1Q0QA 1ULUA 5K51A 2OP0A 3IBGA 4KYTA 1UEXC 1IHOA 4YC7A 1MGPA 2YXPX 4AMBA 5BVGB 3O8BA 2B98A 4LSZA 5KTNA 5F51A 1B3BA 4GH5A 3RPEA 4FS3A 4AQDA 3L79A 4GMFA 3TLCA 3KHTA 3RIXA 1KC3A 3CG4A 3EZ2A 4WNAB 2PUCA 4DA4A 3J7TA 4ICIA 4M9RA 1YZNA 1M54A 3T06B 2PQ6A 3LDHA 2ZSKA 4H6WA 1E79A 1H5QA 1T3LA 4ZV9A 5BUQA 1GTSA 4YMHA 5NULA 1KJYA 2OCBA 1ZNYA 1Q1NA 4KGZA 2DWUA 4IQ8A 5GV7A 1TJYA 4DCTA 3SVLA 3JQDA 3KLBA 1KNQA 5COQA 4DIUA 3AHEA 3CXUA 2EFHB 3FN4A 3HWX1 5JRDS 3SS9X 1JAIA 2QZSA 2W6OA 3FSGD 5DOVA 3GFOA 1EGAA 1NLUA 2V6BA 2DKFA 3KE9A 3OQHA 2A14A 5AI5A 4XGRA 4FILA 1P7PA 1N8NA 4ZI7A 1E6WA 4BFVA 5LB2A 1AK2A 1Y8RA 3BILA 2WUVA 1A2KC 3UA4A 1B8NA 3EH2A 2BY4A 4PYMA 5GONB 4W7HA 3ENWA 4PPQA 1CLUA 1PP4A 2D5IA 4F2DA 1KZ7B 4Y6OA 3F71A 1CJKC 3QLTA 3H5AA 3R5JA 4BYMA 4QAJA 1FTSA 1CJSA 2RARA 1EBFA 3A3YA 3H9BA 4XIIA 2Q5FA 3DLPX 4QEDA 3P20A 3WGYA 3AEKA 3QZUA 5L7WA 1ACLA 1GY8A 3DDWA 5AXDA 5TGDA 1KI8A 2NU9A 2RGAA 4KPUB 1G16A 1K7EB 1PJCA 4XIJA 1FPMA 4ZXPA 4L8YA 3U4HA 2BFDA 2ZTHA 5FWXA 4PSUA 4BX8A 4EIWA 2A94A 4TXLA 1YFLA 1K92A 3WGIA 4YACA 4G24A 1OXBB 3WK9A 3N87A 3F7OA 3VKUA 2WYUA 1OFHA 3KZKA 1ZZGA 3QFCA 5J9FA 5JVDF 3QEAZ 4V3BA 2GX6A 2V9PA 1LKZA 2HIGA 4MA0A 1FS4A 2GD1O 3PITA 3I0NA 4DKXA 1OOEA 1B76A 1GZHB 1RLJA 1VZ3A 4NBTA 4AIIA 2HCRA 4H9GA 3RVJA 3UWOA 1AB6A 2V0GA 2OP1A 3ONFA 1P4AA 4M7PA 2VUTA 4AWBA 5A9SB 2FPOA 2ESRA 1T8PA 3A04A 3TBFA 5K8VA 1MVNA 1WDWB 3W9SA 5KQRA 3P9SA 5M2QA 3TS1A 3ER9A 2N1MA 2RFLA 2WJ3A 2HMYB 4YAOA 3BFKA 3RUIA 1F2VA 1X1SA 3EC7A 5G4LA 3PNMA 5KCMA 3RJ9A 1II8A 1KVRA 3B38A 2KBFA 5BNFA 4AAYA 4A8JC 1R7RA 1ZMOA 3LHFA 4XLZA 2W2MA 4Y18A 3LNTA 1QGUB 3NBQA 2O1SA 1ELOA 4L7QA 3KELA 4LXYA 3GYGA 3IIMA 1GU1A 2A84A 2VP4A 5ES4B 3DYBA 4ARCA 3DBLB 1W2WB 2D5CA 5A3SA 1PNQA 4J0QA 1MHPA 2HPHA 4RF2A 4AZTA 3V6LA 2AG8A 3CWCA 2DTEA 5K3FB 1MT3A 3PL1A 4YMSA 2WJPA 1UMDB 2DYKA 1DEHA 2IX9A 2WR8A 2PZFA 1KQGA 2VNAA 1XN4A 2ORVA 4MQ5A 1N5KA 2P5YA 4E1BA 4M7WA 1WXXA 4KWCA 2FXIA 4OLAA 3KR2A 2HF8A 2WVJA 1CRQA 1B6TA 1SCIA 2Q0XA 2NO9A 2H4WA 1TL7C 1GNLA 1W75A 3QPUA 4GS5A 3P27A 3DMYA 5FBWB 4BWFB 2WI8A 1IPFA 1JA9A 2YNMA 4C0SA 1RJWA 2CMDA 2FQ1A 3GYBA 2G5TA 4QDZA 2YN2A 4G6ZA 4DCGA 1ODCA 1SVKA 4J07A 2OD9A 3KAPA 1Y3HA 1DC6A 5DP2A 4Q9LA 2VHQA 1ZGZA 2PWZA 3PNVA 1U8AA 3LGSA 3ZXSA 5B6IA 5ECGC 3QITA 5E7JA 3KEOA 2XWSA 1IBCA 5DV9A 5HIMA 3SVZA 3AG5A 3AEXA 3QYAA 4BNMA 4CDRA 1WBDA 5EWLA 3R6WA 1MPTA 1OHHA 4PYIA 3LK7A 1L4KA 2XV1A 1H0KA 4XFJA 3SXUB 2H0RA 4RVDA 3UTCA 1GTZA 3HYRA 3VPBA 2GBIA 1YDEA 3L8YA 1ZM2A 2LDBA 5DHPA 1HX7A 1FDOA 1PCXA 1RXIA 2SNIE 3NOOA 4HB3A 4RM3A 4AKIA 1P8AA 3GEMA 2VCYA 3M9LA 2Z6UA 5DNWA 4GRIA 1Q12A 4RVHA 5L7TA 2HUNA 4QGHA 1LTKA 3V2HA 1PZEA 2A6PA 3FFWA 1DT3A 1GOTA 2OORC 1BXGA 4J1TA 4HV4A 1Q6ZA 2BKLA 1PTJA 4G8JA 3FSJX 2I2AA 4KN6A 4L51A 5IWAB 4CE6A 1GGKA 2VTDA 5CIYA 3NVMB 2J1LA 4MVJF 1CC1S 1NXOA 2Y1FA 3HDJA 2GRUA 2GD0A 1UJ5A 2PRSA 2RH4A 2WQ6A 4AJOA 2XMBA 4FC6A 2XXBA 4RFSB 2VYNA 2CZCA 3CRQA 3A1DA 4MIYA 1B8PA 1Y3FE 3R3JA 5BMVF 1S96A 3EEYA 4C6HA 2B7LA 4GPD1 3L7KA 1ESNA 1T5SA 4XX0A 2CCGA 4W9NA 4IH1A 3MJSA 5AJXA 3ZUPA 1SC1A 1CQWA 1ZHOA 3NUZA 2BKUA 2NWQA 1B26A 2DQ4A 2AQKA 3HCPA 4GDMA 1OXUA 1NASA 4E5YA 4EHAA 5BYAA 2JFOA 3ZKAA 3RTGA 3O26A 3N2LA 4KNYA 4GOOD 4ETNA 1KQOA 2C5GA 3B2QA 4FE3A 1HYEA 2BFFA 2UUOA 4D8UA 1IZYA 2H1CA 2PKWA 4MSUA 1TUGA 4JVLA 3TMYA 1PX2A 4BE7B 4AMVA 1EFRD 1JI0A 1O0SA 1QZXA 5ER6A 4HZIA 2JDIA 3Q40A 4WXRA 2FWIA 2Q6VA 2PGLA 4AMUA 4HWKA 2V6GA 2BJVA 1KJIA 3A9WA 3BGOS 1DEOA 4HI0E 1UCFA 4PIPA 3TW8B 5IC4A 3THXA 4IXMA 4B3BA 2EKLA 4XJTA 3RODA 1Z13A 2IGTA 4PZPA 4UTPA 3HU3A 5FLEX 4OHBA 3HP7A 5KTTA 3QLEA 2W00A 1S2OA 1ZINA 4GOKA 3NG1A 4DARA 3O74A 1CG6A 2IJGX 3C4JA 3LKDA 3ADOA 1BKDR 3TD2A 1YU9A 2QL7A 3V1TC 2W98A 4KSBA 2WM8A 3QY0A 4NZ9A 1T3SA 4Q4AA 2QSZA 1OLUB 2ZVJA 5C5EA 1A5ZA 1LXCA 3BCSA 2ECQA 2YWCA 3H16A 3E7WA 1QE0A 5C0OE 2OFFA 2GN4A 3R9KA 3TTYA 4AK9A 2WTAA 4YRMA 3EVAA 4FQ5A 1WX1A 1A7KA 1P1RA 4NPHA 3UQYS 1CP3A 3P9RA 1FF9A 3GLFB 4X20B 3DUFA 2FKAA 3KQLA 4JOQA 4F3NA 4TLCA 3KXKA 4FHZA 4MV5A 1ES9A 4QGGA 4ZRMA 3C5WP 3ELWA 5KX5F 3HUFA 4PCAA 4P0PB 2HCJB 5AKEA 3EQ6A 3BPSA 2FLKA 4B4VA 3OCVA 1L5MA 2FW8A 1XEXA 3R3HA 4G1EB 4XPIB 4K8OA 3T12A 1U3CA 4DCJA 5FFMA 1BW9A 5A4FS 4EEZA 4FFDA 4U7WA 3JD4A 1O57A 1CEEA 3DZCA 1DCMA 3GDWA 3MERA 2YV1A 2MR6A 4Y6QA 5I7HA 2ZRQA 4R2KA 3RAFC 4WFJA 3W1EA 5J5AA 2JLCA 4YX9A 3LQRA 3PFGA 4I6JA 3Q1LA 1AZTA 3B3GA 1TIPA 2NU9B 5EP1A 3UAWA 5DBFA 2ANCA 4Y2GA 2CHVA 3WX0A 5KTKA 4IXWA 4PYNA 2FDRA 2HGZA 3GJZA 1EZZA 3ND7A 4NULA 2CLLB 4I55A 4ZDKA 2P2LA 4X1YB 4B2PA 1KE2A 2FSGA 2VL7A 3HJCA 1DBWA 2Q3JA 1BEEA 3KAKA 4EB0A 1U81A 5SZIA 2I2FA 4II7A 3V2GA 2G08A 2R4TA 5IN5A 2W5UA 5FUBA 4C2TA 3T94A 2Z2JA 4JLNA 1O4WA 2OGWA 2BEWA 1IFXA 4C3OB 4AXBA 4RNDB 4R2MA 4CQMB 1RYNA 3QIAA 4XOUA 5TPZD 3ENZA 4FFPA 1AIPA 1FSSA 2P40A 2GEVA 1NLFA 4PS1A 3TNFA 1G8FA 4AMYA 4ER3A 1QGUA 4XE5A 1KEZA 5E9QA 3W90A 2JK0A 4BV9A 1KH1A 3PDJA 2BZ0A 1CRZA 4PHFA 2O48X 1GD1O 4NS1A 2VXOA 3INTA 1NW3A 2AZ4A 2PX8A 4H3VA 3W06A 4ZN6A 3BK1A 4XA8A 1TE2A 3TOVA 4O3MA 2VJCA 3GLHB 1X1BA 2B2XA 3ETHA 1JR2A 3OIVA 1X14A 1ONBA 2JFPA 1ORVA 1SZDA 4U9IS 2PFGA 5FOXA 5IVDA 4EJ0A 3UHJA 5CT9A 4G97A 5IC6A 1PO7A 4NNOA 4BV3A 1DC7A 1EK1A 1MABB 1Q2XA 1USIA 3UCXA 2IDJA 4E2FA 2HLDD 4JGGA 1UXIA 3PDIB 4MRSA 3E70C 1ML4A 1N0WA 2ONKA 2OVFA 2VF5X 1E2EA 3KHSA 2C3MA 2XEDA 3DLCA 5J59A 2MINB 4ROSA 4P98A 1J8VA 1QH1B 2OPBA 3JQGB 3R8XA 4ZOAA 4YUWA 3RK1A 4YDSA 4C43A 1EJ2A 2PZEA 2GR9A 3BTVA 4GNKA 4JI5B 2OAEA 4S1PA 1G2IA 1OU4A 2VNHA 3FPCA 2GPWA 3DE3X 3LX4A 4QM6A 3JQ7B 4F06A 3VDRA 3G2OA 3DXXA 3T9EA 5LZ9A 4ZCLA 1D0VA 4ND8B 4RGYA 3AEUB 4A6DA 1Z68A 2ZPUA 3HVHA 1TAQA 3GPLA 1GZDA 4YP5A 4MKFA 2CDNA 1S2DA 4UDYX 3UJ6A 3GFFA 2XTJA 1NUPA 2HHJA 3IKJA 2JIZA 4TVBA 5JQGA 4B3GA 5A7FA 1NF3A 2WF9A 3PP8A 3BWBA 1GT6A 1AC5A 1OX4B 3IULA 3B13B 2IYWA 1VJTA 2WBLC 3JQAD 2V3VA 1I5RA 3ZGNA 4B6SA 1XA4A 2BOVA 4XWOA 1FRNA 3DYVA 3MHTA 4AVYA 5D3MB 2Z09A 3OPYB 1KYTA 2FZCA 2VJDA 2VS1A 2H2GA 4A23A 1ST3A 2AG1A 2GZ3A 5TMBA 5CDUA 5EJEA 3OM8A 3OQIB 1KZGB 2BTEA 1RQ2A 2PN1A 1Z26A 4X24A 3IT2A 4NCBA 1Z4OA 3SIWA 5SZJA 2VF7A 2ZITA 5CB4A 1CF2O 3FDJA 4ZYVA 4MVXA 4OU4A 1P3JA 4QRIA 2Q7DA 3F2VA 3IODA 4IAOA 4UU0A 5EMLA 4U6QA 5THKA 1P1IA 2I7DA 1JA0A 5G0WA 3N53A 3RSQA 4QXAA 3H0EA 3ZNQA 1XK6A 2AMYA 1LZLA 4LVNA 1RSZA 3DDOA 3EDRA 4JZKA 1QMPA 4O2BB 4Q01A 4IDOA 3PUHA 4RLHA 4GM0A 4TKVA 5GIOE 1ZESA 3A4VA 1QX3A 2ZWPA 3EGXB 3I6YA 3KWJA 4G09A 5EL0A 4J0GA 4FYKA 4BP8A 2OCKA 2WD8A 1TTHA 4ZGBA 5BQFA 2XWPA 5D3KA 5KNBD 1I94B 1G8PA 4F1WA 3DDCA 5HQTA 3DBLA 4FN4A 3IPRA 1JEAA 5KQPA 4RWEA 4Z6KA 3V4FA 4XWTA 2PT5A 1CXZA 3KVVA 3F0TA 2W93A 1BA3A 4DLKA 5AVQA 1E9SA 1H2AS 1VA5A 1LQTA 3C2QA 5KBYA 3BFXA 5LLTA 4LRYA 3U4QB 5FI3A 1R66A 3RVNA 4DMLA 1RWQA 3EEFA 3GCDA 1XPUA 5F33A 3MXOA 5ARDA 4PTYA 1YUBA 2IHVA 4HNAB 3UT0A 2CW5A 4K1LA 1CZNA 4KQGA 1JQJC 2FW7A 1G0OA 2GXSA 2OGZA 2IY7A 2OFPA 4RS4A 4B7ZA 2ECPA 3IRUA 4JX8A 3ZE0B 3HCFA 5EXSA 3F6SA 1OILA 3FNGA 3ID6C 4NCIA 2H1WA 5HF8A 1QF6A 5E7QA 2CXSA 3SLRA 4PONA 1ZLYA 1GUYA 1PHPA 3PQCA 5J23A 1GDTA 4AUEA 2LW7A 2AR9A 4DLZA 1YBFA 2COUA 5TE9A 3K09C 4ER7A 4RH0A 5DBOA 2CNLA 4LISA 2WF6A 3O83A 3L2OB 2YHIA 3GPCA 1SCJA 4CKWA 4CU2A 3P4YA 3DFIA 5DTJA 4YRJA 1AKYA 1K2WA 2EGHA 1BMQA 3I73A 3Q2IA 1IB0A 1KF0A 4HPJB 1JQEA 3F2IA 3R7BA 3MELA 4EA8A 3MWEA 3MJRA 3O38A 3T3HA 2Z6QA 1L7AA 2PD3A 5CLHA 5F1PA 5J3JA 3VDXA 2BE7A 4MQFB 3RYHB 5KQLA 3ROEA 1Q1GA 2A4KA 5D86A 2ID8A 3CX8A 3EQ7A 3G1WA 1ZLXA 5DXFA 1EDEA 1ONSA 4F85A 5LDGA 3I4FA 3DVLA 5E95A 5D51S 5TJ9A 4NH4A 2QAJA 5MFZA 3WYCA 2C2OA 3T3MB 1M83A 2VDWB 4ASUD 4RGVA 4EW2A 2B4QA 3VR6H 1CFJA 3EZ6A 4I4LA 2E2WA 4IX1A 1PN3A 1T9GS 5P21A 4G5SA 4K9DA 4PGFA 2Q1TA 4J9UE 4V2IA 4LJSA 4EMUA 1TQ2A 1KPIA 1RJFA 3OFVA 4G67A 1Q7RA 1E3DA 3UV6A 2O20A 3SIXA 5IKEA 1N8TA 4KPEC 2QRGA 4PIVA 5K3OA 1PT6A 1UPTA 2MSCB 1KXZA 2UUPA 3W6PA 2QVXX 3IV9A 4K28A 3WOHA 3S81A 3I9V1 3BD7A 5K8IA 5SYNA 3CNOA 2CK3A 3CMCO 2PUGA 2CKMA 4KRGA 4HWSA 2FG7C 3NDBB 1XCOA 4LN1A 2F8SA 4KFCA 1AX9A 2WABA 1EIWA 2AH5A 4EGAA 1GGHA 1W88A 2GM5A 1W9MA 3LLMA 4TL7A 4TKZA 3R5HA 3NVAA 2H5EA 4M8LA 1EHIA 3WMGA 5DM60 1T26A 3FPJA 3HDQA 4DEYA 2IRWA 4W5HA 4B74A 4J0JA 2NXEA 3SQDA 3DPSA 4FGWA 1TZJA 1ULAA 4ZVKA 3PJDA 1P33A 3GT3A 4U7DA 1YE8A 3OZWA 3ZBQA 3CWZA 3CZRA 4YAGA 1UDBA 4ZKDA 2R0QC 1JHVA 4FHGA 4DCSA 4H7EA 3RUHA 4ONEA 1SU4A 3ZU3A 1HFWA 2JCXA 3ZY3A 3AESB 3EZ7A 3KYIB 2ZIAA 2FWJA 2YHSA 1QGDA 2ZT5A 4KTTE 4KQMA 5BWMA 1QHSA 2A0KA 3QEOA 4MPTA 1IM5A 4M0KA 3T61A 1ZZEA 5DFAA 4ECEA 5CH8A 1NHGA 3PFWO 1K98A 4MINA 4LDPA 4RD3A 4RTLA 5TVGA 1QGAA 1QS0B 2R3SA 4C2BA 2ZM5A 3FTQA 1ZI8A 3MJDA 4EA7A 4O0LA 4A5SA 5EUBA 3GMTA 2EZUA 3N8GA 4BMCA 4QOGA 2AN3A 1FTWA 2EARA 4AYTA 2VDMB 3AFHA 5B7PA 3RRMA 1WPRA 1GNRA 3SC2B 2M1ZA 1XROA 4LOAA 3VPXA 1U63A 3R7AA 3VOBA 2CHFA 2IXEA 2PQMA 1LFDB 3FBTA 3OSZA 1RYFA 2GF9A 2LV8A 2Y71A 2ZIFA 4MWSA 3H6GA 3L07A 4WKPA 2GPTA 5SYMA 4EB3A 4HRVA 4DDUA 2VNKA 3QXSA 4AM8A 4GWGA 3VPGA 5T64A 3ZY6A 1G3MA 2FLWA 3ZU5A 4QTYA 4ESVA 2W2LA 2Y1WA 3KOZA 4EI7A 1V8PA 2ORYA 1SCUA 1DSSG 2K4MA 4LJAA 3U6BA 2HCBA 3F3KA 1R4NB 5DGXA 4F7WA 4YRGA 2W8BB 3PJEA 3U4DA 4HJXA 2GXUA 1C81A 3DWGA 5ELLA 4P58A 2C82A 3PNYA 4EUNA 4EZEA 2F59A 3JQBA 1MEEA 4KWHA 4G1MB 2QTHA 2OHVA 1RRVA 2NAFA 4YCNA 2I4TA 2WD7A 4LQDA 1NMQA 4ID3A 4TGLA 3VR2A 1ZD9A 5E1OA 5KYYA 4G4SP 1VP3A 2PD6A 3ZZMA 4NDZA 4QXRA 1U3UA 3LXRA 4QVGA 3WZ2A 2EWMA 3QW2A 5CFZA 2X4IA 4GZMA 4HQ6A 4O2BA 5FJJA 3RC1A 4G23A 5EZ6B 4GXRA 2IKQA 1IOZA 5JZVA 4QG7A 1RI1A 2CNWA 4NATA 5IBCA 1GNTA 3KB8A 4U2FA 4CMAA 4LGVA 3URKA 5A5DA 1O5TA 3WK4A 3GEHA 5FOTA 1H85A 1NYRA 2RK4A 2A5DA 1DKLA 4G89A 4ZVUA 1CUHA 5JCJD 3SWWA 1H3NA 2FSVC 2D2FA 4I8DA 1QDLB 4N54A 4P4TA 2QAGA 4LK3A 3ZE7A 4Q6BA 2W2LD 1JECA 2HX1A 1MC1A 4F5EA 4AMGA 1OLXB 3N0VA 2VJOA 1AK9A 5BY2A 3AUYA 3OIGA 3O1LA 1G3QA 2E4ZA 5HP4A 8LDHA 1A7AA 1YO6A 2WM3A 2HSEA 2X5XA 3LCCA 2CVHA 1CUUA 2DFNA 1IZ7A 1X1RA 1YC5A 4MZXA 5EVCA 5FULA 5G02A 1BWQA 1TLTA 3O94A 4EY4A 1FUYB 2AMLA 5J1TB 3ZJ5A 2PWYA 5T41A 5IG2A 2OXRA 1FYDA 1USKA 2HRRA 1CB7A 2PEZA 5AO9A 2QTZA 1VYUA 1WNTA 1LA2A 2WNHA 3FM9A 3OWOA 1R8YA 1KP2A 3RC9A 1TA0A 1P9NA 4EQZA 1YF3A 4H7DA 4UUPA 2IELA 5ETJA 2GT1A 2Q3BA 3C6YA 3C70A 7MDHA 1OV4A 4WTOA 3W3ZB 1OKKD 1XD2A 2HIMA 4ECAA 1R4AA 2GZAA 3FPBA 2G0NA 5LJLA 3EIUA 3GP3A 1EVIA 1G8KA 2BHRA 3CR7A 2PM8A 5AKXA 5F3RA 2AN9A 1EUDB 3NTQA 1JHYA 4EPTA 5KTSA 1RBYA 1RWMA 3A6LA 5FT9A 2DERA 4A82A 1YQDA 2YY7A 3LPMA 3G89A 3GQBA 2W6CX 2CD7A 5KNCH 5EJMA 4G8DA 1X74A 2BW0A 2QTBA 3D0OA 5GGYA 3OO0A 4PRYA 1WXEA 2WB4A 2XRMA 4MVJM 1P8JA 4OJMX 1H9BA 5JAQA 1L1FA 4WFQA 3T5CA 5KPJA 4MKIA 3IP1A 3QPCA 3U7QB 3NT2A 5FIUA 4ITUA 5T4EA 5CB4B 1J0CA 4JJ8A 4HD8A 1OLSB 1U8TA 3N74A 2P9EA 1TM2A 2WU8A 1JVBA 1QVZA 2P11A 2X19A 2H2AA 4TXHA 5G2OA 4DMMA 2BDEA 1QFJA 4MR9A 1U0OC 1JGTA 1UJ6A 2NUTB 4WUTA 1AKRA 4D26A 1B15A 1NONA 5J4YA 2ZE8A 4NTZA 4WUVA 4C76A 4Z0HO 1MFZA 2XKKA 4CTMA 2FRVA 3IQIX 4R2JA 1DX6A 1T3HA 2RKBA 3E2PA 4I5EA 4BXOA 1XB2A 4YJ2A 3HH8A 2O54A 3E2MA 4LF5B 1P1CA 2VPYA 2BWJA 4IHJA 3C3EA 3FMVA 3PT9A 1KO4A 4PHTA 3DVAA 3FVWA 4J1SA 4TMXA 3PQ8A 1WMAA 2IEGA 1DOHA 1G42A 2J9FB 4NFLA 4WJKB 1UZMA 3VR4D 2VAPA 3BF7A 4FKMA 3PCTA 1ZIDA 3LTNC 1X42A 4AFNA 3AESA 1ENYA 3Q72A 4F3KA 1IB6A 1F1BA 1RKXA 2X23A 3H83A 2WAAA 2ZT7A 4HATA 1XQ9A 3QVLA 1XZMA 2BI8A 1SCDA 2I33A 3CX4A 2HREA 3NWEA 4INPA 4QOSA 3L8EA 1ZUNA 1PR6A 4MMXB 1AS3A 4RSRA 4UUNA 3ER6A 5J58A 3OZBA 4PO8A 5CX4A 1PV4A 1PL6A 3PDHA 1YRYE 2EW2A 2QLTA 2CYAA 2XUPA 3G49A 5LMZA 3U44A 2H4JA 5L6LB 4MYUA 3WMWA 4YXFA 3VZCA 1RKQA 8OHMA 3IVXA 2Q8QA 2PY6A 5GPBA 4TVKA 2ZXFA 3TLXA 1JU9A 3SJZA 3QWHA 4R1UA 3ZGZA 2C4TA 1W85A 3LECA 3RC3A 221PA 3QBVA 5BPHA 1QHHA 3GRRA 2FAXA 3MMPA 1CUIA 1FDIA 5C3UA 1M1YE 1GTMA 3MD9A 3B3FA 1VCNA 3HU1A 1JIQA 2GHRA 5ADUS 3HWSA 4QC2A 4TQAA 3BT7A 4L4RA 3C0KA 1SU6A 1UK7A 2RSLA 4JUAA 4M1TA 4L4UA 3SZOA 4HX9A 3A2LA 4KXVA 2Q07A 3W5JA 3QPBA 1CIVA 1TO1E 5IT5A 4TM7A 3USCS 2WWVD 2Y76A 2L82A 3B8HA 3RS7A 5L4SA 4IGIA 3KQWA 4MJLA 1TVCA 4TT8A 3LRTA 2L17A 1H8EA 4JEUA 5DGHA 1JQLB 4ZV7A 1KZ6A 4I7EA 1EXMA 3DFKA 3HN6A 3TPCA 1WPQA 4Z3OA 3NLLA 3TVDA 4AZSA 1HDZA 2CMGA 2YWGA 2B5VA 3ZQJA 3OCCA 3O3CA 3INRA 1G55A 4XB6B 4IEFB 2DTXA 3I12A 1LNSA 5LZ5A 3F3MA 2Q29A 5LNK6 1UWVA 1J8FA 3U0VA 4EUFA 3EAQA 5K2MA 4DA8A 4YXWD 1E3SA 2HYDA 3FCXA 1UBOS 1VYTA 3P2MA 3BKWA 1ECBA 2QJFA 3JS5A 1IL0A 2BFNA 3PD1A 4IJWA 3K53A 4L8LA 4IHKA 1IJEA 1E2GA 1MB3A 5JJLA 4HLNA 5IWCA 3ZOKA 1QHXA 1BDHA 1HEUA 1KYQA 1P91A 4YIKA 3M1AA 4NMMA 4QQ8A 2GKOA 4RK4A 4EGFA 4CCWA 2B2NA 1P2FA 2VHCA 3DMTA 1QHNA 1XZJA 4TSRA 4N6NA 4M0UA 3S8MA 2NPFA 5B64A 1W44A 1F4VA 4F2HA 2JHAA 4QLBA 4GOND 3AI3A 3KNZA 3EX7C 2X9QA 3IOBA 1HGXA 3MJHA 1NVBA 2HEGA 4FHEA 1VL6A 2P2NA 4BN0A 3CJRA 4LJ4A 4B3RB 4V24A 3ADBA 4K2HA 4DILA 2NNWB 5E6RB 1RYDA 4X61A 4D43A 1G41A 3H2KA 4OBBA 5A7GA 1FLAA 1R6AA 1PT9A 4FR2A 4URFA 2YJZA 3IO3A 4EVRA 1TQHA 3ZU4A 4P86A 4IXTA 3QHPA 4EUKA 4JP5A 4QZVA 1QFZA 2XVMA 4UBJA 1L5OA 4LJKA 3NBYC 4QU8A 4Y2TA 1LBSA 3KJQA 4E09A 4F5DA 4F2WA 2ZRDA 5C8ZA 2O1WA 2HJSA 1LJ8A 1SBYA 1RWWA 1T9DA 4F8JA 4IDDA 2QUIA 3TOCA 1G8YA 2RIPA 3DVQX 1WPXA 3VR6D 3QG1A 4ZVMA 3VHXA 1EIZA 2J6CA 2JAQA 3HBMA 3OQ1A 3QKRA 5IAEA 3RRYA 1EUCA 4HS4A 1TKCA 1IZ0A 4NENA 1QIFA 3SGLA 4WZAE 1RLMA 1SVLA 2R44A 2BFPA 3V7WA 5KWEA 1N77A 3NEAA 2C0CA 4MUFA 4H6PA 3BRWA 1KI6A 1E5XA 1QP0A 3NEJA 2JANA 4KIJA 4MHSA 1CQPA 5FWXB 1CE8B 4ZHQB 4TTRA 4R71A 1MQSA 3KQPA 5BYJA 3GFBA 4CBVA 5TLSA 3W5CA 3U7GA 5KC9A 2Z9DA 4UM9D 1Q84A 1JR3E 4IMJB 4TLMB 3BWXA 4LGCA 3AEQB 4OLHA 4EHFA 4FGSA 5IKMA 2HRZA 4BFCA 2ZU0C 3BA1A 3O93A 1MH1A 3RYIA 4ARVA 4Y1FA 4RCVA 4DT1A 3U3JA 1PJ2A 5AUQA 2G67A 3ISJA 5AK5A 2AV6A 3NNNA 1XLTA 3K0CA 3UA3A 2OC4A 2P1ZA 3SMQA 3TRHA 4RFSA 1QTQA 4MS4A 1HKHA 4DSUA 5JHGB 1ISMA 1SC3A 2J0EA 4NF2A 2UKDA 2ZRBA 4AJPA 1JG6A 1NP7A 1VLHA 3AHIA 4ID9A 4W5RA 3CH4B 3IR6A 3D5EA 3K92A 3IQEA 5CM2Z 5KUTA 4N12A 1HDOA 4Y6SA 2ZB2A 1UBTS 2B8NA 2V55B 1TUEA 3UJCA 4XWKA 1VG8A 3ZWAA 621PA 2Q4DA 4PFJA 4RK5A 4EGJA 5ED4A 2QK4A 4FJ0A 3Q7SA 1EE1A 13PKA 1K3TA 2IP2A 4P22A 3E9CA 4X1KB 3H6HA 3PFHA 1Q19A 1YAHA 2ALJA 3B1WA 3MYYA 4OI4A 1FRVA 2HN9A 5E1BA 5CA0F 1TX4B 2PIAA 1OFVA 3CUSA 2O5EA 1BCRB 3O4FA 2VH1A 4M60A 5FLXA 3NAZA 3CZ4A 1U0NA 4K6CA 4PZYA 1KVUA 3COZA 4AF7A 2VRCD 1PFWA 3TVYA 3VR4H 1MDBA 1E4OA 1FNNA 3M49A 1KOLA 4HN9A 1ZAYA 3ICEA 3R0XA 3AVWA 5EEHA 3R7LA 2ZE5A 1ZUNB 2OBNA 3UJDA 2PAFA 4MI6A 2CVZA 2JIOA 4ND1A 3RAEC 3ZZNA 3NRCA 2P9YA 3N86A 5EXPA 1L2TA 1PX0A 2V7BA 1XWIA 5KSYA 4R83A 3CEMA 1WULS 5CIWA 5D7NA 3VYVA 1RC8A 2GLUA 2YWHA 3NGXA 4GFDA 4KOAA 1N9KA 2LRHA 3UMMA 3ECCA 1SIUA 3NZEA 1SIWA 1GLNA 2XA9A 1XLUA 1RCFA 2XKBA 1BZYA 3ABZA 3V00A 3TZ6A 1QVWA 4F4IA 2PV0A 4RXUA 1X7DA 1KYVA 3FZEA 3Q2KA 1BCSA 3V8NA 4XQEA 2LTAA 1XE3A 3O2NA 5KYWB 3MT9A 1UKCA 2IYQA 2QN1A 5AOCA 3OA2A 3USES 1QRDA 5C18A 4I55F 3KT3A 1QC5A 4MEJA 4Q9JA 2IWRA 2IP4A 5G0VA 4KR3A 3ZWOA 2RC6A 1KI1A 2P90A 4XX0B 5IH7A 1J7JA 1XRJA 3CNLA 4BHTA 2GB4A 1WXDA 2IYAA 1ADBA 2YFHA 3LKVA 3T7JA 1E63A 1ESDA 3DR5A 5LP6A 3MINA 1WW3A 1THZA 3IJEB 3HR7A 2R68A 3A7EA 2JVKA 2JIDA 4O25A 4YP6A 4V0OA 4DNXA 2F1IA 4UATA 4WJZA 5FBLB 2IZ0A 4YH1A 4O4JA 3ZHCA 4DUZB 5INTA 1YA4A 1S1MA 1I4LD 2H5LA 1RQLA 2NZVG 3G2MA 3GQBB 1J00A 3QOFA 3TZHA 5DN6D 3CA8A 1I8TA 5LD2B 3PUJA 4H77A 4JBWA 4R2LA 5ARCA 3WGMA 4UFNA 1GHTA 1H5NA 3T38A 5DM70 5K6AC 3ZJUA 1U7XA 2GI4A 3O8DA 4NAHA 2ZWIA 3EA5A 4UNRA 2NO4A 1ZI9A 2OUKA 4FDLA 2ZJ2A 4IRXA 3RUDA 3IURA 1UQTA 5E7MA 1F17A 1L8XA 1QQTA 3DWIA 2ZQYA 3GUVA 1VLQA 4KEAA 4XKJA 1XQ1A 4DBLC 3IRVA 4NMLA 2DPYA 2IPMA 1RXWA 2G36A 3O8OB 3I6MA 5FYQA 2EJUA 3MCZA 1HFEL 1U7DA 4ZZIA 4DMUB 5JCZA 1ZVKA 4BFTA 1Q1AA 5IBPA 2B4RO 3ZY5A 4CI9A 1IC6A 1NI5A 4K9PA 5K0FA 1HT1E 5LP6C 3O03A 2P8JA 1E9BA 2VQEB 2CNKA 1TF7A 4PAOA 3TD9A 2O7NA 4HDNB 5E4JA 5JCOA 1DIAA 3LT1A 4TKUB 5J4KA 3H1AA 5FEMA 3Q3GE 1FSZA 2GBLA 3H17A 2FCRA 3EDOA 4WCDA 4A0QA 4E5KA 1EFAA 5ALPA 1JHXA 1IDN1 4S04A 4Q1EA 2V8OA 3SHTA 5FPKA 3DG9A 4WNYA 5IU6A 1E64A 3KWMA 3B5EA 5FH9A 3GLHA 2DSTA 3MSCA 4UZFA 5ALFA 3HEAA 4B2LA 1ZM9A 4JFRA 3W5HA 4P3NA 3B6MA 4HO1X 3AIIA 3AETB 3CPHA 3UMRA 1QIHA 1UDWA 2MWMA 4E3ZA 3QI2A 4S1WA 2VUSA 4DTCA 1JHZA 3LX8A 3OFND 1NBIA 4CIXA 1FRQA 3COWA 3HO8A 4P4LA 4PAQA 9GPBA 2MR5A 1E0JA 1GZVA 1RT9A 1TK3A 3DHVA 3HO1A 5I8WA 3AF0A 3AW8A 4EM6A 2G1KA 4E31A 1CUXA 1P0FA 5LQSA 4JJGA 1YS9A 3RRNA 3TGLA 3ZD9A 1ODLA 4N82A 2P9BA 3KTAB 4X71A 3FKSD 1JWBB 1CR2A 4DVJA 5JPCA 4ZOBA 4JASB 4M3NA 2XQVA 3IKMB 4LYGA 4DANA 3B9RA 2GETA 1BS9A 1K06A 2QRNA 4J1TC 3ZE2B 1PSDA 5B1HA 2Y8EA 1A8QA 5CLIA 1VB5A 4HKTA 4P84A 3ZK7A 1ZL0A 4BFXA 5JXHA 3D2LA 2Q4BA 1KWGA 4UTZA 3KJNA 1FDSA 1PNOA 3KZXA 4ZTZB 2O2XA 2OAGA 3TTXA 3KSUA 4DR5B 3BYZA 5AHWA 3P7MA 2LBPA 3OLYA 4ZVPA 2O2DA 4AJEA 1LB1B 3CRVA 4LC9A 4AKSA 2V7WA 4ZGWA 2C2GA 4YXWA 1UJNA 4GF5A 5K7SA 1RFLA 3NTUA 4FD3A 3HY3A 3G0GA 3BIXA 4AX8A 1Z36A 2Z3WA 1HYHA 3KPWA 2ZSHA 3QYFA 4URVR 1XWFA 2F48A 2OV4A 2FQYA 3AF2A 4UPDA 5LOVA 3DYIA 4GR4A 5ALZA 1VE1A 4Y6PA 3ONEA 1FMJA 3PXDA 2EBWA 1XNQB 2AG6A 4RBNA 2J08A 4BMVA 2JL1A 4ZEXA 3I5UA 3QFSA 5AQ1A 4GIBA 3TFWA 2IV7A 1DBIA 4UBNA 1M8FA 2OM2A 3C3MA 3O95A 4I1OA 2HA7A 3IEKA 3H0KA 2QAIA 2VK2A 3SBOA 1BJRE 3S40A 1DUSA 4X1IB 5CLGA 1FVHA 3TLBA 2QMHA 3H9UA 1TUBB 1J6UA 1G7TA 4MW5A 4YBRA 1BA2A 4TZKA 2PAAA 1JLSA 1ZSVA 3BMCA 3IPLA 1QH0A 1TYCA 1E3IA 1ZNZA 1U0BB 1GXSB 1XTSA 1M2HA 4WJLA 4PU0A 2REQB 4Q39A 3JQEA 3R6LA 4P82A 3GROA 3N3BC 5KCZA 2R8OA 3FUXA 1K63A 3KJZA 2XIJA 2ZOSA 3HCCA 1NZFA 1Z0IA 3C3KA 2VHZA 2IBSA 2APJA 1YQQA 2CNOA 3BGIA 4KX3A 2ZJ3A 2YJ4A 4MVJD 3JALA 1PLJA 3GF4A 3HJNA 3ANLA 4DLRA 4UBOA 1HT2E 5JUWA 4IIFA 3ENQA 2NPIA 4BJ3A 4E13A 3EPKA 4YCLA 5L6MB 2FW1A 1MB0A 2F3QA 3QMVA 1PR2A 5TQ0A 2JGDB 4KLAA 1NM5C 4B9EA 3FR8A 1G1MA 2GLTA 3UY4A 3I3SR 1NFFA 1F0NA 2RGEA 3P94A 2B36A 3FAZA 1IY1A 4TL6A 3RVDA 5G40A 4DJTA 1YONA 1VRWA 1XQVA 2DPGA 3E5NA 2GBFA 3GLSA 2QUZA 4UVDA 3RIGA 4MYRA 4HUJA 2I6GA 3WWCA 2GVZC 1TCCA 3IJ5A 1LDGA 3IXQA 5K2OA 2MIIA 5EMNA 1I3KA 1KEVA 1T91A 4C0XA 3PUZA 1PLLA 3ZQ6A 1EMDA 3LPNA 4QGAA 5I7SA 2FETA 1QO0A 4E32A 3C74A 1NUHA 1VMEA 3ITEA 1U9IC 2FZKA 1G8GA 1MG0A 5BN4B 1QH8A 5M04A 2MSDB 3IUNA 1B73A 1VJ1A 1KJQA 4P80A 1VG1A 3I62A 2V59A 4HDOB 1WMEA 2R25B 2UXBB 3T3IA 1YR9A 3WWPA 3K0FB 3QUBA 1DKQA 2WV9A 3IXMA 1S2MA 3GFGA 3V8BA 5AVOA 4L02A 1D8TA 3A26A 1NG1A 4KGVA 2ECOA 1D0IA 1TKBA 3QM1A 1T2EA 3N8NA 1JB1A 4JQSA 1AXRA 1MBZA 2NO1A 4WBNA 5HSGA 2D1RA 1GAXA 3VSBA 3CRZA 3ND8A 2DHDA 2IF2A 3WBKA 3JQFA 3HGQA 4L28A 2IS6A 2YIVX 1ZH8A 1OXTA 4OH1A 1X1AA 2E4AA 2H59A 2C54A 5FAKA 3SICE 1VDZA 2R8RA 4PCUA 3LS2A 5DIZA 3TRFA 2PL9A 3JVUA 1A9TA 4LRTB 2UZ3A 4OK5A 3D02A 2AEEA 3WGNA 4OHRA 4Q12A 3GJ8A 1SQFA 4IS2A 3ZDRA 3AR6A 3QA3E 5JSUA 5L3SB 1PR0A 2K2QB 1EJ0A 5KNBH 3AFOA 3NV9A 3QLVA 1P2UA 4KU4A 4TYPA 4TKUA 1E9RA 1JEQA 1G7SA 4QQKA 5AUNB 1N9GB 2BF4A 3QELB 3OIDA 3PHHA 2EQ5A 5FHQA 5C7IO 2R6JA 1UDXA 3N5CA 2EQBA 5IUNC 2AZDA 4OMCA 1XPRA 5EQFA 3EGOA 5EWJA 6REQA 2ZKIA 4U2KA 2AC7A 3EW7A 3WQSB 3FLAA 2XOXA 2E5FA 2XE4A 3A36A 2HK8A 3ZXYA 3ZCQA 3OE4A 4CM8B 2J3MA 3SSMA 3PD7A 4Q4CA 1ZVMA 1M2VB