2VHXA

Crystal structure of the ternary complex of l-alanine dehydrogenase from mycobacterium tuberculosis with nad+ and pyruvate
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
371
structure length
368
Chain Sequence
b'MRVGIPTETKNNEFRVAITPAGVAELTRRGHEVLIQAGAGEGSAITDADFKAAGAQLVGTADQVWADADLLLKVKEPIAAEYGRLRHGQILFTFLHLAASRACTDALLDSGTTSIAYETVQTADGALPLLAPMSEVAGRLAAQVGAYHLMRTQGGRGVLMGGVPGVEPADVVVIGAGTAGYNAARIANGMGATVTVLDINIDKLRQLDAEFCGRIHTRYSSAYELEGAVKRADLVIGAVLVKAPKLVSNSLVAHMKPGAVLVDIAIDQGGCFEGSRPTTYDHPTFAVHDTLFYCVANMPASVPKTSTYALTNATMPYVLELADHGWRAACRSNPALAKGLSTHEGALLSERVATDLGVPFTEPASVLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALANINE DEHYDROGENASE
publication title Three-Dimensional Structures of Apo- and Holo-L-Alanine Dehydrogenase from Mycobacterium Tuberculosis Reveal Conformational Changes Upon Coenzyme Binding.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
total genus 124
structure length 368
sequence length 371
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.4.1.1: Alanine dehydrogenase.
pdb deposition date 2007-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01262 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domain
A PF05222 AlaDh_PNT_N Alanine dehydrogenase/PNT, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vhxA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vhxA02
1U1IA 2GNAA 3DL2A 2I76A 2EKQA 4BS9A 1Q7BA 3ZU5A 3LT4A 4CM8B 4EBFA 1PSDA 1NWHA 4YJFB 1UR5A 4ZRMA 1KVRA 4MDHA 3OQ6A 2H5LA 3DOOA 5TRTA 2A9FA 2EXXA 4JLWA 1HZJA 5CDYA 3FWNA 2O3QA 3VPXA 2FR0A 3O38A 1Z7EA 5ER9A 4UEOA 1XELA 3TZCA 4AVYA 4BIIA 5L51A 5EN4A 2W2KA 4IS3A 3IP1A 3TNLA 4R5MA 2DC1A 4BKUA 3S2GA 3GZNB 4EDFA 2Q1TA 1Z82A 3DFZA 2HMVA 4ZQEA 2FOIA 3WDSA 1MV8A 4H16A 1RWBA 2GD1O 2P68A 4I5GA 3G49A 4LRSB 2PZLA 3EUWA 2HU2A 5THQA 4PLYA 3B1JA 2BD0A 2CMDA 2R00A 3EVNA 2DFDA 3DAGA 3KETA 1SMKA 1E6EA 5U4QA 2VUUA 1E7SA 4IJWA 1E3WA 2DPGA 5AYVA 4I1IA 2YYYA 1JAYA 2CY0A 4JP3A 1LA2A 2XOXA 1VKNA 1V6AA 2Y1EA 5I9LA 3QVTA 2ZCVA 1V3VA 2GLXA 4IXTA 2W98A 3VKUA 5DT9A 3DZGA 3N7UA 2GN9A 1GD1O 4FQ8A 4BNFA 2QZ9A 4K28A 3D7LA 4CQMD 5IDWA 4MP8A 1R16A 1IOLA 1P1IA 4TRMA 3V2UA 4RL6A 3ENNA 2J3HA 3PYLA 1RKXA 5ICSA 2Y99A 1QORA 3JQ9C 1HKUA 4ROSA 1QLJA 1NX6A 2PH5A 2PZJA 3UKOA 1DBVO 1UZMA 5CFZA 5MGBA 2Q2QA 3AJRA 4U0KA 3U4DA 1IPEA 2YFHA 4XGKA 5T8KA 5L3ZA 4BQPA 4CM7A 5IXSA 1WDMA 4INAA 3ZV6A 3L4BA 3MOIA 1KBZA 1MGOA 1NFQA 2JFGA 1QYXA 3BMOB 4LGVA 1UDBA 3KSUA 1BW9A 5ILGA 4G65A 2X0IA 3E82A 1EDZA 3E8XA 5ITWA 2P5UA 1P9LA 2JAPA 4D3FA 2B35A 3OIFA 3EZYA 4PLZA 3QWIA 1YO6A 1WP4A 3PJDA 1EE2A 2I6TA 3QIVA 4W4TA 5JY6A 2X7HA 1Y8RA 2AE2A 4NK5A 2Y0CA 4BNGA 2SCUA 4BUCA 2WTBA 5DN9A 3CZMA 3TJRA 3HSKA 2Y1GA 2UVDA 3O4RA 3JQGB 4XJSA 2VZ9A 2OXIA 3ETEA 1HDGO 2O3UA 2QRKA 4XQGA 3VVBA 1BXGA 3R3SA 5KJEA 2OOSA 4B3IA 1BWSA 3OJEA 1MLDA 1B2LA 4AJHA 4LVCA 3H5NA 1P31A 2PKQO 4M1QA 1TT7A 1NBOA 2I65A 3Q9UA 4C4OA 4WPGA 5CEFA 2P5YA 3FTNA 2VOJA 3B70A 3FNGA 1Y8QA 1LLUA 3INRA 5JYEA 4Z3KA 4YPOA 3E9QA 1H6CA 3Q0EA 4KQWA 2BGMA 4BB6A 4BO3A 4ZHSA 2VTDA 4E6PA 3MWDB 3WQRA 4OAQA 4BNWA 1NVTA 2ZB7A 2F00A 2QX7A 3JQFA 3WICA 1E7QA 5DP1A 5H81A 4WNIA 1EVYA 1HLDA 1E1MA 1OBFO 4BO9A 1EMDA 3F46A 2D4AA 1ZZEA 4CM6A 3DBHA 3OETA 3ON5A 3BYZA 1YXMA 3ST7A 4B4WA 3OM9A 2JAHA 3S8MA 1Y6JA 1N7GA 4RVHA 2B4RO 1B16A 4XYEA 4MVJI 2UV8A 3JD4A 2JFHA 1N1EA 3QV1A 4IMRA 4MP6A 3QVSA 3JQCA 4WCFA 3DWFA 1HSZA 1SEVA 4PCVA 3ZWWA 4N54A 3KLMX 1DAPA 3HB5X 5I8ZA 1PR3A 3MTJA 1YJ8A 3RKUA 2OFPA 4U0JA 4J4BA 1VRWA 3U4HA 3GGOA 1MUUA 1PIWA 3LZ6A 1GUZA 4LVUA 1BHSA 4PLTA 1SEPA 1ENYA 5C37A 4YJHA 2Y1DA 3ZZNA 4CMIB 3KEOA 1GZ6A 2ZTUA 3DBRB 3WJ7A 4Z6KA 4FGWA 3BTUA 4FOSA 4K1LA 3FR8A 3NX4A 5HS6A 1PJCA 1J5PA 1B15A 1ZH8A 1E3EA 1KERA 4J49A 1FDTA 5FYDA 3KBOA 4PZDA 1YS4A 4YCAA 4NU6A 5BSEA 3WTCA 4R01A 1ONOA 3GNQA 4W9NA 1O8CA 1ZVMA 2D59A 3O9ZA 4OGWA 4EUHA 3IUSA 4F45A 3TZKA 3FI9A 4ZJUA 1ZW1A 1B26A 1AE1A 4J4TA 2B83A 1A9YA 4RVGA 2YHIB 4UEKA 3WYEA 5DOZA 1GL3A 3BMCB 2JCXA 3DZKA 3QVOA 4NJMA 4X54A 3CIFA 5ADHA 1M6WA 4YYZA 4KOAA 2YV3A 1KS9A 2Y68A 4LISA 1C1XA 2VNAA 1DAOA 1EBFA 2P9CA 4MVJP 4QEDA 4DQXA 6LDHA 2RBEA 3KEQA 3I5MA 4HY3A 2FY8A 1PQUA 2W2LD 5COBA 4OQZA 3VH1A 2VRCA 3DZFA 3GEMA 3GEGA 3T4EA 1PTJA 3E48A 1N8KA 3ADOA 4J91A 4WNCA 1VC2A 3HHPA 4QO8A 1PS9A 1J49A 2PK3A 3CEAA 1GZ3A 1NHWA 5K9ZA 2PR2A 4EJ6A 3VTZA 2ZB4A 3K96A 3T7CA 3LVFO 1PJQA 1NP3A 4HP8A 3P2YA 4I9UA 2VWHA 4CM3A 1YRLA 1I10A 2OO5A 2ZQZA 3FSRA 3NTOA 3BMQA 3DO5A 2DLDA 2NVUB 4BNUA 3UF0A 3TZQA 4A0SA 1C14A 1E92A 3CPSA 2ZIZA 1Y1PA 3WOHA 5DZSA 4AJOA 4E5YA 4CQLA 4DQVA 3HUDA 3IC5A 2HDHA 5JBIA 2QYTA 2QQ5A 4FOOA 5F1KA 1KVSA 3I9JA 1ENZA 2X0RA 3GGGA 5DBGA 5JSFA 3DFUA 4NBTA 4I5FA 4DA9A 5JDIA 1VJTA 2GN8A 5CAEA 1ISHA 1E7RA 3DHNA 3DZHA 3NT2A 1H6BA 3FNFA 3RFTA 5J23A 2AEMA 1XHLA 4BNHA 3OSUA 4TRJA 1X1EA 4EEXA 2IYPA 2YV1A 5ITVA 4R3WA 2BHLA 1F06A 5AVOA 4ID9A 4J1NA 4XYLA 1K6XA 1KEPA 1PJSA 4CMEC 1M66A 2Z1MA 3AWDA 1YOVA 1TA4A 5L53A 3NUGA 3KB6A 1NQ5A 3TZ6A 4JJFA 4ALNA 3PEFA 1DOHA 4GQAA 1E77A 4CM4B 1D7OA 1U4SA 4HWKA 4WCDA 3QY9A 3SJUA 4PLWA 2BRUA 4WEQA 3FCOA 3JQFC 3PLRA 4NH4A 3LF1A 2QYSA 3QLJA 1KVUA 5AXAA 3FPLA 3GAFA 3IQDB 4WECA 3K73O 3T4XA 4I9HA 5IFLA 5IN4A 2VUTA 1YGYA 2B4TO 1E3IA 4R9SA 5KNLA 3K9QO 4FW8A 2IXAA 2VYND 2ZTMA 5CDTA 3E9MA 2Q99A 3N58A 4WCFC 4A26A 4E12A 1MC5A 4XA8A 4A73A 4RPGA 4UUOA 4BNLA 4GLLA 3VOSA 2GZ3A 3Q6IA 1CETA 2O4CA 3AW9A 5ENVA 4AJKA 1LEHA 3KSZO 1YB4A 4E33A 1U5CA 4DBVO 4J1SA 2EP7A 1GQYA 3F1LA 1HDOA 2QRJA 3PK0A 4MIEA 3VC7A 5JY1A 1NAIA 3KO8A 1Y81A 3WQSB 4WOJA 4TKLA 1A71A 2DTEA 3KV3O 1YB1A 3SLGA 4E32A 4E2XA 7ADHA 1QLHA 3WSVA 5BT9A 5CG2A 4IUYA 2Y66A 3NEPX 2FN7A 4IGEA 3RC9A 3IS3A 2AEFA 5KTKA 2QZZA 2IE0A 4KUEA 2I5PO 4PLFA 3DBLA 2W4QA 4Q3AA 2A4KA 1MX3A 3JSAA 4EJ0A 3BAZA 5TT1A 1NAHA 4TMFA 4WOKA 3PHHA 5BSFA 1M75A 4QFCA 1ZJYA 2OMEA 2RHCA 4KWHA 3TOZA 1PS8A 4L74A 4BO2A 1KEVA 2CNBA 1EK6A 4W9NC 4BGUA 2QRLA 1K3TA 2R2GA 2H1SA 4L73A 2J3IA 2O3SA 1UJMA 1M6HA 3DOCA 1XQ6A 4A10A 5LDGA 2DQ4A 4DIFA 2UYYA 1TLTA 5L9AA 4JQCA 1LRKA 1KETA 1X0XA 2D5CA 3PHLA 3ZU4A 1BDBA 1WWKA 4RPJA 1F17A 4EYEA 3QE3A 1NVGA 4B7CA 1JA9A 1UXHA 4D45A 4D3SA 1P1JA 4BMVA 3LU1A 5HWSA 3KZVA 4IDEA 1ZIDA 1ZKMA 5AXBA 4LN1A 1DIRA 4GMGA 2PLAA 4CQMB 3G3EA 3I6QA 1O0SA 4CM8A 1LTHR 3FD8A 4HNGA 5I7SA 5JYDA 2Y1FA 4TZKA 4DPLA 1IHYA 3PTZA 4CPDA 5CG1A 4F3YA 4BOYA 3WJAA 4R51A 1EUCA 1KVQA 1Q2XA 1YDEA 4TQGA 3F3SA 1R0KA 1HE5A 2ZYGA 4NQZA 4OIMA 1AXGA 3I4CA 2AA3A 2EF1A 5JDIC 2VN8A 3WXBA 3RASA 4IIUA 2DBQA 3GZNA 3BA1A 4MVJE 1VPDA 4D42A 5CP8A 1F8GA 3KSDO 5T64A 1NR1A 2X1HA 4NMHA 4YAKA 3RUAA 1LLDA 2HMWA 1B8PA 4ZICA 2E6UX 5JDCC 5I8WA 4BNYA 2XXBA 2C20A 4CL8A 3OJFA 4NFHA 3GMDA 1UDCA 1I3NA 3L9XA 2PGDA 5JC8A 3GN2A 3ULKA 2FWMX 1OAAA 3NJ4A 3RU9A 4XQCA 3V8BA 4YT4A 3EMKA 2DBRA 3TRIA 3AUAA 4O63O 1M2WA 3PIIA 2QG4A 2YY7A 1UP7A 1OMOA 3MTGA 3N74A 1PU2A 3F5QA 5CPBA 2YUTA 4R1UA 3F47A 1Z73A 3QWFA 2E37A 2GPTA 4F6CA 3GPIA 3HJAA 4NHEA 1IUKA 2BI8A 2G82A 2BF7A 3D3WB 1MP0A 1GUFA 1GEGA 3TOXA 4YJDA 3ASUA 3RD5A 2GR9A 4DVJA 2GGSA 1U2DA 4CUKA 2G0TA 4L8VA 3JD3A 4YTEA 1P33A 4CLXA 2D3TA 1P0CA 4ZQGA 3V2HA 4NBUA 3DC2A 4CUJA 2O7SA 1L7EA 2WWRA 3LT2A 4XR9A 5TSDA 3UOGA 2X4GA 5B1YA 2AG8A 4CLHA 1LQUA 1ZO8A 3HFGA 4Z9YA 4DYDA 4UVGA 2X6TA 3F1KA 3GUCA 3JQAD 2FZWA 1E0DA 3MJCA 4L9RA 3QWAA 3M1AA 4FFPA 4NZ9A 5TC4A 4HUJA 2VT3A 4R5HA 3OEYA 4GWGA 1PJ2A 4A7PA 1DC3A 2NVBA 2X0JA 3LYLA 1BG6A 3E9NA 4ZQBA 2GCGA 4RDIA 3AI1A 2CF5A 2EERA 1HYGA 3H9JA 5GY7A 1P1HA 2IZ0A 2P91A 3AM4A 3GY0A 2DM6A 2EW8A 3BHMA 2NU6A 1ENOA 4GBJA 4RPKA 4TSKA 4YJGB 4OM8A 3WR5A 4DREA 1ULUA 1UZLA 1HT0A 1R12A 3AU8A 3E6AA 5GMOA 4CLOA 4BKQA 5KKAA 1QXSA 2C2XA 4NIMA 4CMJA 3OECA 3WNQA 4AL4A 1DRWA 1PL7A 2DKNA 2J6IA 1S7CA 3PRJA 3D3EA 4B79A 2DTXA 3RAJA 2I3AA 2C29D 3V5NA 3WIEA 2DBVO 3AUTA 4FN4A 3R6DA 1U3VA 5KWEA 3WWYA 1P0FA 2HO5A 1ENPA 2LDBA 3UCXA 2HK9A 1K2WA 4Z9XA 2W8ZA 1DIBA 4M87A 4J2OA 3PP8A 4YT8A 1HETA 2EIHA 4PG5A 4DL9A 1F8FA 1DHRA 3C1AA 3H9EO 2Q4EA 4N5MA 3G0OA 5KKCA 4RQTA 3Q9NA 3L0DA 4J4HA 1DLJA 3WGZA 3WGIA 1YQXA 5A5EA 3ZWCA 3QHAA 3DZJA 1K6JA 3NKLA 3RI3A 1R66A 1C0IA 4ZRNA 4G5HA 1DPGA 4IDAA 1Q7CA 4ZN6A 2X23A 1T2DA 5DCWA 2FR1A 2I9PA 3U62A 4DIOA 2EJWA 2VZ0A 3RUFA 1DIGA 1HEUA 1PQPA 5KVCA 4ITUA 2GZ1A 5IZCC 6ADHA 5L4SA 4UVDA 5L40A 3ICPA 1H0KA 1WW8A 3NDIA 2H6EA 3ITKA 1T4BA 1GFSA 2Y05A 3AI2A 3TPCA 3WBBA 3ZWBA 3E5RA 3O8QB 3UW3A 4CMIA 4I8XA 3DBRA 5BQFA 3UCFA 4HNHA 5ES3A 2C5AA 3ZGYA 4Y6PA 3I3OA 1J0XO 3RU7A 3AUUA 5JNLA 4Z0PA 1AHIA 4CODB 3C7CB 4LMRA 1EK5A 1NTOA 4Z9FA 4DXHA 1UUFA 1WDLA 3QQPA 4R41A 1NXQA 2J3JA 4JJIA 2CUKA 5GZ3A 3P2OA 1BSVA 1OOEA 2PFGA 4K9DA 4XJTA 4Y98A 3ZV5A 2YHIA 3AOGA 4WKGA 1NQOA 3UXYA 5JS6A 3BMCA 4J0FA 3ONDA 5TNXA 1BVUA 3BMNB 3FBTA 4KDFA 5HRUA 2AXQA 2OBYA 4D41A 4KZPA 4YAIA 4R54A 2DBZA 4IQGA 5JO0A 3NDRA 5DNAA 3D64A 5CEEA 3ETDA 2X5OA 1DFGA 5GZ6A 4F46A 2WYUA 5HS4A 3W6ZA 3KLPX 1RM4A 2FSSA 2WEKA 1HDRA 4XRRA 2O3RA 3OFSA 4CM1A 2FPGA 4PRLA 1XIVA 3K2EA 1ZSYA 5A4DA 1A4UA 1W0CA 4BNNA 3DMYA 1E1KA 3GVHA 4Q3BA 3GMSA 3LSYA 2BFAA 4QSMA 5G4KB 4IDFA 4N5NA 5TJ9A 3IMFA 1DC4A 3GDOA 3GVCA 1J6UA 1ML3A 1RM3A 3G1UA 4PLGA 4BNIA 2D1YA 3OJLA 3R3JA 5LC1A 1V35A 5KCZA 1ZEMA 5TT0A 2VCYA 3HN2A 1LDGA 1U2GA 2DFVA 3BTOA 4OXKA 3OH8A 4IJUA 2OBNA 5ILOA 2WYWA 5L4NA 3KYCB 3RSHA 2DUUA 2ZB8A 3AFNA 2CD9A 2PD6A 3IIEA 2IRWA 5ICMA 3PYXA 5A03A 4CMAA 2HQ1A 4O59O 1B3BA 1PJBA 3DXFA 3VZPA 3K31A 3DHYA 4XD2A 4MVJD 2Y0EA 1KEWA 3STHA 2NQTA 3BTVA 5JCJD 3SEFA 3IUPA 4HFMA 3RBZA 2BI7A 2I3GA 2WSBA 5F1OA 3I1JA 5C3MA 3A28A 3MWEB 1C1DB 2NTVA 3JQ6A 2WYVA 4LK3A 4RDHA 2PZKA 4CM4A 2ZQYA 4EI2A 2AHRA 3GGPA 4R4JA 4RF2A 4OXYA 3I9NA 4FFRA 4HBGA 4JK3A 2P9GA 3HQ4O 3WGTA 3JYLA 2EWMA 4IDGA 2J5RA 5TF4A 4H7PA 3FHLA 4PG8A 3ASVA 4Y6RA 1DHTA 1G0NA 3AM5A 4S3MA 4RVFA 3MEQA 2EW2A 1Z75A 5JW6A 4QUKA 5TIIA 1ZEJA 1XLTA 1YQGA 1LC0A 2YW9A 4FR5A 4WGGA 1IL0A 1Z6ZA 4UUPA 2O7QA 4DMMA 4A2CA 1K0UA 1R4MB 4BNMA 4R69A 2LDXA 3NJ8A 3NGLA 1VKOA 4E5NA 2OGUA 1LDMA 2WD8A 4GGPA 4M86A 2NU9A 3H9GA 2OP0A 4M55A 4ND5A 3LC2O 1R37A 3D5QA 2P9EA 1Q1NA 3WGHA 3ITDA 4OHUA 2EGHA 4DLLA 3OJ0A 3CSDA 1YDWA 2X0NA 3H2SA 4MJLA 4JROA 2GASA 1E3SA 3ZWYA 1G0OA 4B8WA 3PFFA 1XWFA 1GV0A 1Y5MA 1P77A 4YRBA 4RF3A 2DVMA 4GSLA 2PV7A 2P4QA 2O3TA 1VJ0A 1ZUD1 3QP9A 3QW2A 1N9GB 2B36A 4J7XA 1E7YA 3ZU3A 4PLVA 3I52A 3ADPA 1HYEA 5T57A 1Q0QA 3GDFA 4L4SA 4BMNA 1TI7A 1ZXLA 3A14A 2HK8A 1CF2O 1N5DA 1I32A 3H5AA 2D8AA 5HBRA 5L45A 1SNYA 3GT0A 4Y6SA 5CDUA 3F6YA 2E82A 3QSGA 4QTZA 1ARZA 3A1NA 4FFLA 3RC2A 2DPHA 4GGOA 1GYQA 1K89A 2H9IA 3OA0A 1ZNQO 3RC1A 4BNXA 2V7PA 3S2FA 3LC1O 3JD0A 4YR9A 1HXHA 1ZXBA 5TGDA 1ZCJA 3WMXA 4GPD1 4EZBA 2HCTA 4XR4A 4IJKA 3HDYA 3RWBA 2VRBA 4JBIA 1TEHA 1F0YA 4NBWA 1B8VA 4J16A 3GHYA 2AQ8A 1WLYA 1HDCA 2PY6A 2ZCUA 2PD3A 4N7RA 4CQMA 1NNUA 1PZGA 3ZWNA 5I7VA 5L7TA 1OFGA 1U7HA 5MDHA 3CMCO 1Y9AA 4BNTA 1U4OA 1XQ1A 4K6CA 4KUHA 1E6UA 2R00C 1Q7GA 4YAGA 2JHGA 2C07A 3HB4X 1NR7A 3HN7A 4CLEA 4EUFA 3GK3A 2HKIA 5H83A 4WE3A 1CERA 1DRVA 1XA0A 1P1KA 2EJVA 1QP8A 2O4UX 4NBVA 4BO0A 3JQBA 4PGFA 5FI5A 1ZSVA 1T4DA 3HDQA 3JQAB 3CTMA 4TVOA 4WLEA 1N2SA 3VVCA 2Q46A 3WGOA 3UFXA 1SZJG 1HE4A 1WZEA 4IINA 1ONNA 4LSWA 1YBAA 4EITA 1OC4A 3GNTA 2UAGA 1N1GA 2YZ7A 4UEJA 4LMPA 3MJSA 4CR6A 2HJRA 2Y1CA 1Y9EA 1HLPA 1YWGO 1YVEI 4II2A 4NU5A 3UICA 3DTTA 2GN4A 2FZEA 5FWNA 3SLKA 3D1LA 5T8KC 1W6UA 3VHRA 3L4BC 3WYBA 1P45A 2HJSA 4TRNA 2RIRA 1LNQA 1DJQA 1NFRA 1PGJA 2EP5A 2POQX 3GVXA 3L6DA 4BNKA 4D43A 2PNFA 2HAEA 2EKPA 5A04A 1SOVA 1AGNA 3IKVA 1NHGA 3FNEA 4W7HA 1YL5A 2PD4A 1I36A 3D3WA 3ZWPA 4KP7A 4XYMA 4IQ0A 3EDMA 2YV2A 3FNHA 1FDWA 3GLQA 4ND1A 1ZK0A 4RQUA 3RUHA 1IHXA 2C5EA 4RPLA 4ZA2A 2CVZA 2GN6A 4A5OA 1KEUA 1TXGA 1XCBA 2AEJA 4I9NA 5K0ZA 3L9WA 2AQIA 2A94A 4ND2A 2X9NA 1NFFA 3COSA 5HA5A 5DF1A 4MIYA 1E3WB 4OO3A 3U49A 2C0CA 4DBZA 2ZJ0A 1E1NA 4JBHA 4XGIA 4YT5A 1PX0A 4CV0A 3INGA 1F14A 4A03A 3S1LA 3S2EA 2VHYA 4LSMA 3ZU2A 3PJGA 1OI7A 5KOIA 1Q0HA 1FDSA 3FPCA 1HL3A 4ILKA 3EGOA 3WGGA 1V9LA 4IDBA 3NAQA 1JKJA 4JCOA 3EHEA 4YJGA 5A3VA 3KYDB 3QRWA 5IZ4A 3PQFA 1JN0A 4XX0A 4E5MA 1U8FO 4FSHA 4CMHA 4TKMA 1BW9B 4E5KA 1JDJA 4PG4A 1C3VA 3GEDA 3JQ7A 3UH1A 2ZB3A 5F3RA 4WASA 4FJ0A 3F9IA 1R0SA 3ETGA 3K92A 4FFNA 4HV4A 3KXDA 1FDUA 5EJ2A 2DT5A 2E49A 2O2SA 3ANLA 4AJEA 1Y8RB 1FXSA 1SB9A 1P74A 2VWGA 4OYRA 3GHHA 5EERA 3DEYX 3TN7A 3LT0A 5EQDA 1G6KA 4GX0A 5C7LO 5AXDA 1BXGB 1GTMA 2W2LA 3AOEA 2VYVD 4DGSA 4D0SA 1R4NA 3ZW8A 2IDZA 2NQ8A 4BMSA 4QFDA 4IY1A 4XCVA 2Z5LA 1EEHA 2JHFA 1GUYA 1A72A 5ER6A 2AQHA 4PRKA 4XZ3A 4BO4A 3D4NA 3EW7A 1UAYA 2C82A 1H93A 1TT5B 4IIVA 4TRRA 3H3FA 1RYDA 3DDNA 4IQ8A 3D4PA 2JD2A 1BRMA 2X9VA 2YQ5A 5JAIA 1SPXA 4J6FA 4NNJA 3G79A 2Q1UA 3JQBC 4GKBA 1WMBA 2Q4BA 3WLFA 3GRPA 5TLSA 4ALKA 2DUWA 1DC6A 1BXZA 2QHXA 4BO6A 4OOEA 1XG5A 3WBFA 1FMCA 3PHJA 3JYOA 4S1VA 1S6YA 5KJCA 1X0VA 1XU7A 3O8QA 3ZH2A 1I0ZA 1EVZA 1LU9A 4U5QA 3HDJA 1JKFA 3ZHYA 1JTVA 1LDBA 3GG9A 3RFXA 2E4AA 1KY4A 1EVIA 4WCFB 1VL0A 3C7DB 2WMDA 4YACA 4YJFA 3W4IA 1AUPA 1D3AA 1DO8A 1H6AA 4NDNE 5JPIA 5FF9A 3M2TA 1FF9A 3WTBA 2JKVA 4F6LA 5L7YA 3PHIA 4D79A 1PJ4A 1DFHA 4LCEA 3GNSA 1H5QA 1L7DA 4N18A 1VSVA 1U9JA 1M76A 4U8GA 4RF4A 4YJHB 1YE3A 4IDDA 3QA9A 3VPFA 4Z0HO 3GG2A 1UP4A 4BNZA 2Y0DA 2Q45A 1I01A 4KTVE 1SBYA 3B1KA 4IM7A 5BSGA 4RJTA 1LDEA 3AU9A 2JJYA 1W8DA 5KJ1A 3VH4A 2GZ2A 1M67A 4K26A 2ZKLA 3H5RA 4PLCA 2C59A 3PFWO 4AJ2A 2Q2VA 1ISFA 4DC0A 2VNSA 2VYNA 1DFIA 3QVWA 1CEQA 4J2HA 4KMSA 2O48X 3ZN2A 5A9SB 1NYTA 1X14A 2FRDA 4YDRA 2VHXA 3SC4A 5CHEA 1C1XB 3RVDA 2DU8A 2IXBA 2GSDA 1AHHA 4MKXA 2BELA 4WLOA 2EGGA 3KYCA 1Q0LA 4JXKA 4AG3A 4BGEA 1QYDA 3F4BA 2F1KA 3M6IA 2G1UA 1I2BA 3KUXA 1GPDG 1KY5A 1LSUA 1UXJA 4RGBA 3ZHZA 5BR7A 1ISMA 1DIAA 3JV7A 4IS2A 4IZHA 4P4LA 2GERA 3PDUA 4HFNA 1WAMA 3OIDA 1WPQA 3PWKA 1KOLA 2PZMA 2VYVA 4DQUA 3WMWA 4B8ZA 4EUEA 1HSOA 2DTDA 3U9LA 2CVQA 4XRGA 1Z74A 4Z3DA 3WG9A 3H3JA 1BXKA 3UHAA 1ORRA 4ZGWA 2NM0A 3H7AA 2BFMA 4RORA 3C8MA 4ZD6A 3BMOA 4ONEA 1DRUA 3I6IA 3PYMA 1SCUA 2RH8A 3LLVA 3NTQA 1K5HA 5L95A 1B8UA 1DJNA 3JYNA 3W1VA 2UUPA 4GSKA 4BQRA 3O03A 3WFIA 1PWXA 1QMGA 3WIDA 3C1TA 3ZNPA 2NUAA 3UN1A 4J1TA 4ESOA 3SJ7A 1MG5A 2WD7B 5KJ6A 4JGBA 1OC2A 3OQBA 4GVLA 3JQGA 5B12A 3IKTA 1H9AA 1HYHA 1X1TA 2OORA 3DZIA 3P7MA 3WX0A 5A06A 3UUWA 4DTIA 3RCBA 3NYWA 5AQ1A 2PKRA 3OBBA 1H9BA 3MJ4A 4BHTA 2P2SA 2W90A 2ZYAA 3Q11A 1VE9A 3RUCA 5IDQA 1LC3A 3SBOA 5IF3A 4AJJA 4E5PA 4FFOA 3CXRA 3AY6A 4XB1A 3H8VA 2VT2A 1D1TA 3Q2KA 4OH1A 4RV9A 1MXHA 4Y9DA 2YQ4A 4B4OA 4NR0A 4FD3A 2CF6A 4WJZA 3KRTA 2VHWA 1MB4A 3PWSA 1HF3A 3PJEA 1I2CA 3G17A 3JQ8B 2QW8A 1LLCA 1R0LA 3WWZA 4AJPA 3NT4A 1QYVA 3ROQA 3JQ9A 4E2YA 4UVIA 4WLUA 4TVBA 2NU8A 4Q3NA 2X58A 1PGQA 4DMLA 5B4UA 4IPTA 2B5WA 2FSVA 1X7GA 4BKRA 5DBFA 3OA2A 2NV6A 2B5VA 1NASA 4L4XA 4DUPA 3GF4A 4II3A 3AY3A 3X2FA 3ONEA 1CQIA 2JCVA 2ZTVA 1BDMA 3TQHA 2J3KA 5KVSA 4OOFA 3GOHA 3TL2A 2G5CA 3E1KA 1HDZA 1E1LA 2VHZA 3OHSX 5DCUA 3AFMA 4GMFA 2DAPA 1NPTO 3AUSA 4XB2A 4E2ZA 1H2HA 4CLRB 3SVTA 4CMGA 2C7VA 4CV3A 3KVOA 1YL6A 1O5IA 1DIHA 4B3JA 3S55A 4CR7A 1XU9A 3CMMA 4JN6B 1DEHA 2ZYDA 1X7DA 3PI7A 3Q2IA 3RKRA 3V1TC 1LSSA 4TZTA 3NTRA 3KHUA 1LSOA 4MP3A 4E21A 2VWQA 3K6JA 4PG7A 1R15A 1IZ0A 3W4KA 1I30A 1EDOA 4O1MA 5DDIP 1NPDA 3K30A 4YRAA 1E5LA 1EFKA 1PZEA 5JAQA 4Q3CA 2V6MA 2GYYA 2C2YA 3I23A 2X22A 4MINA 3TFQA 4YEDA 3PZBA 2XPCA 1VJ1A 4PLPA 3BIOA 3U09A 2Q50A 3D5TA 4HKTA 4BVAA 4RZHA 4FCCA 1FDVA 4C7KA 3JQAA 1YONA 2C54A 4P38A 1YB5A 4AICA 1JKIA 3FF4A 4MVJF 4WK6A 4MVJM 1T1RA 2Y93A 4GX1A 1I3KA 5G0TA 5TS3A 2NACA 1YH3A 5F1PA 2OUIA 1RJWA 4QQRA 3RIHA 2CDCA 4PVCA 4KWIA 1LDNA 1A27A 1W73A 2WM3A 1E6WA 1T2EA 3L07A 4GI2A 1U5AA 4H3VA 3WYCA 3CINA 3ZHXA 2CDBA 1I3MA 4M89A 1UDAA 4G81A 3WLEA 4ALJA 4PN3A 1EQ2A 2NVUA 1JLLA 1U3WA 1PWZA 4FC6A 4OXNA 4RVSA 2Q49A 4XWYA 1Z7BA 4A27A 1LX6A 1GQ2A 1WVGA 4DLAA 1D1SA 4TROA 4Q3DA 3ICCA 4FJ2A 4XIJA 5FI3A 1GY8A 3A4VA 3P5SA 4P8RA 3ZI0A 5U9CA 1P1FA 3OF2A 1DLIA 1YQDA 5F5LA 1ADCA 1MA0A 1JAXA 3HZZA 5BNFA 1C0LA 1C0KA 3JQEA 3ONFA 1GPJA 1H94A 3B1FA 1ZJZA 4WEOA 2J5QA 1CJCA 4JJGA 2GRAA 3F4LA 2PA3A 2G17A 1LQTA 2I99A 2JD0A 3VPGA 4RVDA 1GDHA 5B37A 1O94A 1UXGA 1W4ZA 2NNLD 3D4OA 3LDHA 4GVXA 4J43A 5G2OA 2RH4A 4BNVA 4FBGA 1FK8A 1VM6A 4K6FA 2HK7A 5C7IO 4ZQFA 4IDCA 5DULA 5COAA 4AJ4A 4KDEA 3F5SA 3GVIA 3HDHA 2CZCA 1HWYA 2D0IA 4L4RA 3DOJA 3LQFA 4EW6A 4YXFA 4D7AA 5JO9A 2AQKA 4HFRA 3GRKA 3VH2A 4DPMA 1HZZA 3QWBA 5A02A 4XYBA 2Q3EA 1VL8A 1UXKA 4M49A 1I33A 4GX5A 2BFPA 3VDQA 3OIGA 3TZHA 3GUYA 1EZ4A 3KYDA 5EMHA 4C7JA 1IYZA 1ISJA 3HNPA 4E31A 3DAPA 4YRDA 5EL0A 3W6UA 3ZNNA 4BV9A 9LDTA 1EFLA 2O2YA 3PXXA 4CV2A 3QWHA 5HTOA 3IDSA 2AMFA 2I67A 3R0IA 1ULSA 3VZSA 1ZK1A 1A4IA 1BTOA 1XR3A 5K6AA 4BO1A 2PGJA 2NLOA 4XDYA 1P3DA 4P22A 4E3ZA 4N5LA 2VRCD 3MJTA 3ROMA 1I2ZA 1XSEA 4NG5A 1QYWA 4MKRA 1E3LA 3IP3A 1Y7TA 4YWJA 1E7MA 2B37A 4E2WA 2NU7A 1QV6A 3WGQA 1WNTA 3VH3A 1A7KA 4YAEA 4DC1A 2JD1A 3QVXA 4W82A 1U28A 4YBZA 2Z1NA 4IGFA 4Z0TA 3L77A 1LI4A 3B20A 3U5TA 1VLLA 2ZK7A 4R1NA 1IY8A 4CLOB 5A3JA 1LUAA 1N92A 2ZTLA 3VDRA 2XAAA 2HRBA 3EAGA 4DLBA 2HMUA 2BKAA 3BZUA 4URFA 2GO1A 5F5NA 2E48A 3DR3A 4CMEA 1EUDA 2NSDA 3I9MA 3AY7A 3LK7A 5LDHA 1T2FA 1TT5A 5EPOA 2JFFA 1U3TA 3GFBA 2R6JA 5IJZA 3DBVO 3RFVA 1BMDA 4YAJA 4WLNA 4AJIA 3I4FA 2NADA 2VHVA 2FPPA 4ND4A 3PVZA 3OEWA 2D5AA 5JAMA 4KTTE 4U6QA 2YDXA 4CMCA 3EZLA 4GLOA 4AJLA 5G4LA 2FP4A 4R16A 2VUSA 4BKPA 4EGFA 3P19A 2X5KO 4UREA 3KOUA 3FBGA 5JC1A 4BO8A 1GAEO 4FB5A 5BSHA 2AE1A 1LRLA 4OL9A 5CDSA 1O9BA 4YB8A 1CDOA 4YQZA 4J9VA 2WJPA 2X9GA 5G0VA 3WFJA 2NVWA 4B7XA 5I7EA 2CFCA 3JD1A 1UH5A 4IBOA 2XF8A 4MVJA 4YVFA 2RCYA 3GN1A 4XQ9A 5JCJA 5I9NA 3ENKA 1FJHA 4BO7A 1GZ4A 5T6BA 1ID1A 5CEJA 3WSWA 1NVMB 3ZHBA 3FTPA 4UVEA 3UGKA 2FHSA 4MO2A 4CM9D 3FN4A 4YT2A 2CVOA 4NFYA 4NI5A 3VZQA 2X5JO 4E30A 2V6GA 1KYQA 5HM8A 3WNVA 1AXEA 1ADBA 1GCUA 1HTBA 3KTDA 3PLNA 2X86A 3JTMA 2ZJ1A 3M1LA 4MVJG 4XIYA 4CR8A 1PJLA 1SB8A 4XEHA 3FRJA 4ZU3A 4QX6A 1PQWA 2V6BA 4ZVVA 3RC7A 2BFOA 4PVDA 5G0WA 1XYGA 1NM5A 1O6ZA 2O3JA 3DTYA 1T24A 5COQA 2O50A 3I9OA 1T2AA 4AJ1A 3MCVA 3AK4A 3ZCXA 1BGVA 1UAGA 3GVPA 3HWRA 1ADFA 1L1FA 2OP1A 1HDXA 3K2BA 4CUZA 1PGNA 4O6VA 3SC6A 1QRRA 1PR9A 5AOVA 5A9SA 4PZCA 2VWPA 3U4CA 4CV1A 3NRCA 4UUMA 4NBRA 3PDJA 4DYVA 4DWVA 3ZWMA 4Y8VA 4BO5A 1GR0A 3MJVA 3LLSA 2W2KB 3PHGA 1GYRA 1LJ8A 4JNKA 3ROPA 1Y5RA 5A9RA 2IEDA 1X15A 4OKNA 1E5QA 3C7AA 1SO8A 4U7WA 4BGVA 1YJQA 3V1UA 2A35A 2FPIA 4GKVA 3JQDA 2QIOA 1PL6A 2Q2WA 1T25A 2OZPA 4XGNA 3C85A 3DQPA 5L7WA 1D4FA 3E5MA 1DXYA 1DSSG 1O95A 5DCYA 4BB5A 3EYWA 1PJ3A 1V8BA 3VPHA 3IOYA 1QR6A 3W8DA 4PIVA 5JLAA 1N7HA 2IEBA 1PEDA 5ENDA 5FEUA 2RAFA 1CRWG 4J7CA 5C5IA 3CZRA 5K6AC 1JW9B 2O23A 1O89A 1SC6A 4I5DA 1ISIA 1B0AA 3C24A 3PPIA 1GCOA 4R9RA 4J9UE 2I66A 1I8TA 3TL3A 1ZSNA 3GDGA 1YBMA 4PLHA 3RQSA 1H2BA 1ZBQA 3R1IA 4J7UA 5KVVA 1U8XX 5TJHA 4J0EA 3L4SO 3QJ5A 2BMAA 4E4YA 5I7FA 5IG2A 3PIDA 4OQYA 4EJMA 1U3UA 3ANNA 4RO0A 2WD7A 1HRDA 1JWBB 1CQJA 1VL6A 5TX7A 1AN9A 1GV1A 2H63A 5KVQA 4AJNA 1WMAA 5DBIA 5JDCA 1MXFA 5IXYA 3CKYA 2PGLA 3LT1A 5GZ1A 3OICA 5A9TA 3RBVA 4W99A 1NWCA 5A1TA 3LC7O 3U4IA 3MOGA 4M8SA 3C3XA 4WLVA 1A5ZA 1SAYA 4RLSA 4ALIA 3I9KA 2NTNA 3NV9A 1YL7A 4FIZA 3DONA 3HFSA 1HE3A 3OJOA 4LW8A 1PS0A 4JP2A 4L75A 1QKIA 4H15A 4CM9A 1ZFNA 3JQ8A 1X13A 2HLPA 3ZNOA 2Q1WA 4DPKA 1T2CA 2TMDA 4HADA 4OMUA 1TVEA 4DIBA 1I3LA 3BTSA 2B0JA 1F12A 3VKVA 2HMSA 1I24A 2XXJA 5IAAA 2NWQA 3INTA 1GADO 1U7TA 1HE2A 3EVTA 2OHXA 4D3DA 5B4TA 3G1TA 1PZFA 4GL4A 3K8ZA 3MZ0A 2EG9A 4UVHA 4UULA 3I83A 4GAEA 3L6EA 3ZW9A 1RM5A 5CDGA 1EBUA 3H65A 3ZWVA 2CDAA 1IZ9A 2PH3A 1KVTA 4LRTB 3RUIA 4Q39A 1Y8QB 3A06A 2BGKA 2UDPA 4J90A 1GQQA 3HE3A 3RUEA 2HMTA 4D0RA 4FPXA 5T67A 4CLRA 1HDYA 1XEAA 4MIOA 1PJTA 3EC7A 5DP2A 8LDHA 1PGOA 5IN5A 2B69A 5IDYA 1JWAB 1ONPA 3SX2A 1LDYA 3DMTA 4MPDA 1ZK4A 3GFGA 3W4JA 4OSOA 3LF2A 1H6DA 1D8AA 1QSGA 2GDZA 2RHRA 4B3HA 5A5FA 1V3UA 1RYEA 1UP6A 4OSPA 3AI3A 3DBHB 3TDKA 1WXDA 1RM0A 3H9UA 3ORFA 1TB4A 2J5KA 4LCJA 4R68A 3TFOA 2ILTA 4E0BA 1EQUA 2YFQA 1B14A 4NPCA 3B6ZA 4GWKA 3OP4A 1QG6A 1JVBA 3RJ5A 4BNJA 4YQYA 4CM5A 1PZHA 3EK2A 2HRZA 3MJEA 1DDOA 1IULA 3PWZA 9LDBA 1T26A 3FWZA 3I9LA 4NFSA 4IMPA 1K6IA 3U0BA 2J8ZA 2B4QA 3VPSA 3WS7A 3FR7A 4RZIA 1ADGA 1BVRA 3T7EA 3BMNA 1DB3A 3ZNQA 4CMKA 4Y67A 1ZK2A 2V6FA 5BNIA 1MG0A 4P4GA 4WLFA 1NPYA 1CIVA 4CLDA 4J1QA 1EE9A 3O26A 2Y1OA 2PWZA 5FFFA 5IDXA 3DZBA 4PZEA 3JCZA 3GQVA 4BV8A 2C7GA 2JCYA 4RPHA 4CJXA 4FC7A 2X8LA 4HFJA 4R1TA 2GUGA 2BH9A 4PFJA 5AXCA 1OZAA 4JIGA 1WDKA 4W7IA 5L4LA 3Q1LA 1IB6A 4CL3A 5EIOA 3ROKA 1IPFA 1MC4A 4IZIA 3UVEA 3W8EA 7MDHA 4KQXA 3GPDG 5G4KA 4B7UA 3RROA 4QT0A 4NJMB 5IZCA 4XKJA 3H2ZA 2NTJA 3IAHA 4OJNA 1PL8A 1MFZA 2VTEA 2IZ1A 1UZNA 4YA6A 1ISGA 4GX2A 1X7HA 4QO7A 4UUNA 2BGLA 1DC5A 1XDWA 4JX8A 1QYCA 4BGIA 3PGXA 4FFMA 3KYBA 1RPNA 3WGYA 1VSUA 4Q9NA 3GAZA 4CMBA 1P1RA 3Q3CA 2IZZA 5H82A 3RBXA 5TQVA 3TSCA 1YKFA 2VOEA 4XQEA 3VTFA 3BMQB 3RUDA 3WB9A 3GZ4A 1C1DA 1I5RA 4I5EA 4CQLB 4R1SA 5B4VA 5JAZA 4RLHA 2HUNA 4MVJH 5F21A 3UCEA 2D2IA 4U6SA 3WQQA 2TMGA 3UAGA 5JCXA 2EKLA 4IXWA 1A9ZA 3ZWOA 3HG7A 4KUGA 1ZK3A 2Y67A 3BHIA 1NQTA 3U3XA 3E03A 1B7GO 4NJOA 4W6ZA 1LLQA 4JBGA 1G1AA 3V2GA 3JYPA 5KIAA 3GR6A 3AOEC 3ZWAA 4RCVA 3ANMA 3PJFA 1R6DA 2EHDA 3A9WA 3D0OA 4NK4A 5EQFA 4RF5A 4TWRA 4FS3A 4B4VA 4XDZA 5CPFA 4WUVA 1R4MA 2IYOA 4M54A 5JXWA 3X2EA 1GU7A 3L6OO 4O0LA 1VI2A 5EESA 1YOVB 1KIFA 2G76A 4ALMA 1C0PA 1E7WA 4RVUA 1KC3A 4I08A 1J4AA 3PZRA 2GF2A 4DRYA 3NGXA 4XYGA 3OQ1A 2CSUA 3DHEA 5JMWA 3H6KA 1UXIA 4MOWA 4P4NA 3AM3A 2UUOA 5I9MA 1ZMOA 3DMTC 2PKQP 3GC6A 5G0SA 3CE6A 3JD2A 2ET6A 4OKIA 3DAFA 4MKZA 4HX5A 4QECA 2AW5A 5T5QA 8ADHA 1LRJA 5JE8A 4HXYA 4B4UA 5A05A 3NT5A 4QXMA 3KM0A 2JL1A 2Q1SA 2ZATA 1N9GA 1ZMTA 4UAGA 2V65A 1EUZA 3IJRA 4Q3EA 3JQ7B 2BLLA 4E13A 4FDAA 3E18A 2YDYA 5KJFA 1V0JA 5EINA 1IE3A 5JFOA 2Z95A 3ZV3A 3PQEA 2VQ3A 1GEEA 5U1PA 4ALLA 4PG6A 1SOWA 3NDJA 3VAZA 1XGKA 2WDZA 3S2IA 3OMLA 2EEZA 4EEZA 3TF5A 3H4VA 4D46A 1CYDA 4FGSA 3RJ9A 1NQAO 4R3NA 3IJPA 3IL2A 1MFPA 3PGJA 3PQDA 1XKQA 1JVSA 1T1SA 4L0QA 5DOVA 2HSDA 4ND3A 1JU9A 4L76A 1PGPA 4G2NA 2FMUA 1E3JA 2P4HX 1R4NB 3DBLB 1GYPA 3GA0A 3GH3A 5LCXA 3ZV4A 1LXCA 5THKA 1LBEA 1LSJA 3CUKA 3ZWXA 2YJZA 3V1YA 1Z45A 4BL5A 4D44A 3EY4A 3ABIA 3HADA 1QV7A 1JQBA 2OL4A 3BXXA 2PTGA 2AG5A 2WE8A 1P44A 3VZRA 2A92A 3JYQA 1YBVA 2EV9A 5JMPA 3SXPA 3W8FA 1B3RA 5BNTA 1KC1A 2WE7A 3DB2A 1EVJA 1A7AA 3C1OA 3CH6A 5G0UA 4ZQHA 5C7OO 2YHUA 1WZIA 3ZDFA 3H9QA 2VZ8A 2IODA 4FJ1A 3TWOA 4O5OA 4AFNA 4BKOA 4GH5A 1CWUA 3BHJA 1V3TA 3M2PA 4IJVA 2FR8A 4J3FA 3K5PA
chains in the Genus database with same CATH superfamily
1RC0A 1Y9DA 1BZYA 4DWOA 2YWJA 3QFSA 4BS9A 3NHWA 1E18A 3D3KA 2XW6A 4EBFA 1A2QA 1NWHA 1JS1X 1BKYA 2PUJA 4PXSA 4YJFB 2WKSA 1WXFA 3S8YA 5FPPA 5I47A 3O8RA 4ZRMA 1P5ZB 2XE6A 4KX3A 5G1PA 2AI3A 1DS6A 4UJ3A 1GZ5A 4H7IA 3SDZA 4QBTA 1C81A 3DOOA 3H2IA 3P97A 3TOSA 2WJGA 3BD6A 4RS3A 3OCJA 1NMQA 1FLDA 5BR4A 2HEGA 5CDYA 1E2QA 3D8BA 1AGPA 3DE2X 3O38A 1MOQA 1Z7EA 3DVRX 3FOZA 1QIHA 4UEOA 3VISA 4TQUS 3WQBA 3TZCA 5L51A 2GZDA 3TW4A 4V1CA 2OWEA 5HRCA 1Y5IA 2M6SA 3IDOA 4ND8A 2VXCA 2XUDA 1V5EA 4PYOA 2XDWA 3TNLA 1VBMA 1VDZA 4G0UA 4L72A 1XTKA 1OZ0A 1I2AA 2Q1TA 2WINI 4ZU6X 3DFZA 2V0NA 2AG0A 4M83A 1E9VA 1Z33A 2QSJA 4QGAA 1Q12A 4ZQEA 1E69A 1H4TA 4KIJA 2KX7A 4H16A 1RJEA 4HH1A 1RWBA 1Z88A 4FDVA 4YPFA 3U3RA 2G25A 4PCAA 2GD1O 5BSMA 4I5GA 3ZY3A 3OQNA 4XE5A 4NXMB 2J0EA 2PO5A 1KYVA 4LRSB 1UKVY 2ZWOA 2J46A 1XDZA 3KU1A 5FPHA 4V24A 3R9KA 1RQPA 3FCCA 3LPMA 3ZYZA 3OLXA 2CMDA 1BMFD 3EVNA 4PYLA 1Y9JA 2A9JA 2QIPA 1T8WA 3DAGA 3KETA 3A1CA 5I45A 1SMKA 1E6EA 5U4QA 5B6JA 3EE6A 3SBEA 2Q5JA 2JC3A 3U37A 2DPGA 3IA2A 5AYVA 4LYGA 1TK2A 3U3ZA 4EX7A 5IT0A 1Q21A 5CCXA 4EHBA 1JAYA 2CY0A 2XOKA 4DCMA 3E1SA 1E1CA 2XKJE 4WZBE 2Y1EA 4ZHQB 1V3VA 2GLXA 4IXTA 2XZPA 2IU6A 5AW7A 1Y4DE 2BIFA 4PAGA 3DB1A 3UZUA 2Y1LA 1GD1O 2CNKA 1PYGA 3BGWA 4X90A 2RGBA 4EG0A 3D7LA 4EFDA 1I4OA 4YALA 8OHMA 3T3PB 5JI3E 2M6RA 1IOLA 3V2UA 1GL6A 3O4GA 1M10A 1QFJA 4O3MA 2FPOA 2EBUA 1RKXA 3PYLA 3CEPB 4K3UA 2QT0A 1QZXA 2WM8A 3RS3A 2Q7OE 3KB8A 1Z5WA 5KINB 1P7WA 5DTQA 2MOKA 3UKOA 2ZSKA 5E6UB 5FB3A 5BWBA 2H4WA 4D26A 4LHSA 1CF4A 4QYIA 4U0KA 3U4DA 1LD3A 1UJ2A 2BGTA 4QQFA 1TQ2A 5E4FA 4C6HA 4BQPA 3T3NA 3GEIA 3ZV6A 2Y27A 3LW8A 4INAA 2CBGA 4G24A 4BNUA 1E2JA 4D8TA 1CUEA 1SCUB 4FQ7A 4UDOA 1J9EA 3J81A 2GNPA 2ZWPA 4G65A 5C52B 1XK6A 1X7XA 3JZAA 1RZUA 1IJBA 2KJQA 4L5AA 2ZBFA 2JFXA 1GZDA 4KN6A 2WQ6A 1BWPA 2JAPA 1CDDA 1ZONA 4U3JB 2B35A 3OIFA 3TZLA 3MT8A 4LGMA 4PLZA 3TGLA 3EVAA 1YO6A 1WP4A 5IYZA 1TA0A 5K01A 4ZV7A 4W4TA 1XMIA 2A84A 1WUHS 2R6R1 1EI9A 2YVLA 3N0RA 2SCUA 3NB0A 2WHEA 3VR6H 4AKSA 4DRZA 4PPFA 2P6PA 1Q0SA 3HSKA 3O91A 3O4RA 1D03A 2X1VA 1NBIA 3JQGB 3AT1A 4UE2A 4EGCB 2W9XA 3LD9A 5FLKA 3UIEA 8AT1A 1HDGO 2IYSA 5L3SB 3VVBA 2NU6B 5M7EA 1C8VB 5KJEA 4XA8A 4A0HA 1G64A 4B3IA 1BWSA 2LW7A 3BILA 4HAXA 2VBIA 4MWOA 1NN5A 4M1QA 1P31A 5LMZA 1ETHA 3CPHA 2I6XA 1NNI1 5CEFA 4GPTA 3G5UA 1G4UR 5GADl 5G3YA 6CHYA 3IHTA 4PYJA 2VOJA 3L0YA 2WDPA 1YHZA 3FNGA 5KTTA 1N3IA 3INRA 3LCCA 5JYEA 3AM1A 4YPOA 5JSZA 1AQIA 3LDFA 4X45A 1RU3A 3FCYA 4CETA 1YFJA 4GECA 4BB6A 4F2GA 4HDSA 4WXPA 3SYMA 4OGGA 4E6PA 3WQRA 3HVUA 4Q03A 4KNYA 2GMWA 2H0AA 2ZB7A 3JQFA 3RREA 3WICA 4DMRA 1E7QA 5E2IA 4RZXA 1XNQB 1EVYA 1HLDA 1E1MA 1HY3A 1SXJC 3R6LA 1IN8A 1A98A 1QHHA 4UW9A 2D4AA 3PA8A 4GEGA 4MARA 3GLIA 2YIDA 4M2LA 2GI4A 2EATA 2Q3HA 4UZEA 2J5XA 2QTVB 2G1KA 3ST7A 3OM9A 3GPCA 1OV6A 1E0KA 2DHQA 3L0SA 2XTMA 1QZTA 4ZVSA 1N7GA 4RVHA 2B4RO 5IMBA 1B16A 4HLQB 4DT1A 4YY3B 3NDBB 1RLUA 1ZPDA 2JFHA 2X9LA 2B3TA 2ODWA 9GPBA 1ABFA 1MJ5A 1E9RA 1XMVA 3JQCA 3CNEA 4FYMA 2ZJ6A 2RHTA 3QHPA 1HSZA 1SEVA 4PCVA 3AL0C 4LC1A 1A8SA 1J1ZA 5C34B 2VDRB 3KLMX 4UQPA 4PX9A 2MJLA 4NU0A 3FCEA 1JR3A 2EFCB 1ACMA 3PPVA 3R41A 3MTJA 1KA9H 2QG6A 4IIFA 3RKUA 2IS1A 2RK3A 2QF7A 2ZUSA 4J4BA 4MYHA 3U4HA 2QLJA 4RVCA 4JT2A 2O0KA 4WDRA 3GGOA 1PIWA 5KNDD 4LF5B 1HNXB 1P5RA 3C87A 4KLCA 4YRMA 1GUZA 4W5HA 1QTRA 2JKZA 4PLTA 3RS8A 4X97A 3CGWA 3NUZA 2H57A 5IM5A 1VBFA 4HCJA 4EATA 1WHSA 3VTAA 3CR8A 2ZP1A 2VJCA 4FGWA 4Q4JA 4JVNA 4EMBA 5HQ3A 2WPDD 3EXIB 1VGRA 2GAIA 3CZ5A 2WICA 1B15A 2O20A 3EMVA 1ZH8A 1E3EA 3IVGA 2AS0A 3F8WA 5FYDA 3T41A 4PZDA 1AZWA 1N78A 4NU6A 4S35A 4R01A 5HF6A 3EGWA 4JOBA 1ZVMA 3O9ZA 4OGWA 2NO4A 3G7SA 2VEDA 5BW4A 4FGJA 4ZJUA 5AVSA 1CNEA 4TYQA 3BRSA 1R0XA 1O94C 3KOYA 4EW3A 3T15A 1AE1A 4XLTA 2PL1A 5BN4B 4ABTA 1PLJA 2YHIB 2I2WA 1U8AA 4Z1MD 3RIMA 3A0RB 4KPYA 2HH9A 3QVOA 3CIFA 1EH5A 3CONA 2A33A 2PX0A 1JPVA 3TW0A 3VV3A 4YYZA 2GTPA 1GPLA 3RSGA 2O8CA 1C1XA 1LV8A 1EBFA 4NX2A 4UFPA 4DQXA 4QEDA 1FFXB 1JZQA 2RBEA 5EZSA 5JNTA 2JIRA 1PQUA 4RX1A 4WN3A 5C31A 4CXMA 2K2WA 2EKBA 2OCLA 3DZFA 5H4GA 3GEMA 3T4EA 3NRJA 4I8IA 1CY7A 4I1UA 4M6WB 4WJKB 2G3YA 4I3FA 1BN7A 1DJLA 1SKYE 2W8BA 4IWNA 4H2DA 4J91A 1VC2A 4O4IA 3HHPA 5L6MB 3VSDA 3CEAA 1GZ3A 3S99A 3K70D 2DUNA 4ISBA 1OY1A 1FU8A 2ZB4A 3BKWA 1M2EA 2R8BA 3GRZA 1OFIA 4MGYR 4Z4HA 2IX3A 4I9UA 4LX0A 1N5RA 3L0PA 4CM3A 3O95A 1YRLA 3TW6A 1KARA 3FSRA 4BNYA 2GXQA 3FPJA 4O1IA 4TYMA 4Y7CA 2DLDA 5D7BA 1AV7A 2UZ3A 1F6DA 3GGSA 3UF0A 4KXVA 2OQRA 4OK3A 1C14A 3CPSA 1WTAA 3EG9A 1Y1PA 3SM9A 3WOHA 3PFCA 5AVXA 5KTSA 1GSHA 4E5YA 4CQLA 2R8OA 3NONA 1L8QA 4LAFA 4ZT2A 3IC5A 4DHWA 3OZ7A 3LKZA 5CA1A 3IUBA 2W6QA 1UOPA 3RRJA 1CFJA 4RADA 3I9JA 2PS1A 1JQKA 2M98A 2Z04A 2F6RA 1WQ3A 3KOZA 5LYJF 2GN8A 4WADA 2R1VB 4Z54A 4TTTS 1B8OA 1XQWA 3TVTA 1M2JA 3NT2A 1H6BA 1UK9A 3F3KA 5LD2C 3PD7A 1DCTA 2BN4A 4GZMA 5IBQA 1IDOA 3WI7A 2QDXA 2ZE5A 4QGSA 3ZTTA 5BN1A 4R1LA 4EO7A 2C95A 3IIIA 1WCXA 2YV1A 4RELA 4ZK2A 1N33B 4Y2SA 3G0IA 3N3BC 1T9HA 4AIIA 3RYTC 3G89A 3QX8A 2P40A 1M2OA 4ID9A 1KDRA 4J1NA 3F73A 3GFTA 1G9TA 1K6XA 1KEPA 4LOKA 1XKTA 2VI5A 2Z1MA 4H4DA 4MQEA 4LKRA 2OYSA 1Z37A 3DVAB 2PZAA 2FW6A 1RRKA 2EQBA 1NQ5A 2HNKA 3GT3A 3HXPA 4KU4A 1EVEA 4P3KA 4ALNA 4URXR 5IVPA 1F7VA 3EVDA 4JKYA 5J4YA 1E77A 4CM4B 1E9FA 4WCDA 1EM8A 4TL7A 4HBZA 4BFLA 3VTKA 1OVMA 2OAGA 2OILA 1T8YA 3PLRA 4NH4A 4KV7A 3LF1A 2KPOA 3IBFA 1EHCA 4G26A 3QLJA 4PZZA 4DLTA 1KVUA 1H4QA 2C5SA 3GAFA 2G40A 4JEIA 4G0NA 4D9EA 3O8BA 1CUHA 2B98A 4F4IA 1GCGA 1NBAA 4I9HA 4R8SA 5IN4A 3GJSA 1T9ZA 4S12A 5KREA 2VJMA 3ZV7A 5GGXA 4ESHA 3FGNA 4G5GA 4C4ZA 1BA2A 4MR7B 5A3SA 5KNCA 4EJSC 1MTOA 4KFSA 5KNLA 4EG6A 2AN5A 3G0BA 2IYFA 4C3OB 5FLXA 3C14C 4DQDA 1S2DA 1S3FA 3QF7A 4FGZA 4IIBA 3ZDCA 2VAMA 5CDTA 3E9MA 3N58A 4D9GA 3PTAA 3CVOA 4NICA 4UUOA 2EHJA 4I4TA 4JI1B 3R76A 1E5VA 2I7DA 5F77A 5KMGA 3KSZO 2E7ZA 1LI7A 3ZI4A 4MWSA 5U4XA 3QEAZ 3Q8WA 1QH1B 2YVQA 4J1SA 1GQYA 5PNTA 2RGEA 3L43A 1ECGA 5CBPB 1L7OA 2QRJA 3G59A 2DWUA 5JY1A 3AVTA 5HIAA 2JAXA 2JFBA 1Y81A 3WQSB 3VPAA 3UWOA 2DTEA 3IAXA 4WZAA 2COEA 2GEVA 3V7NA 1YB1A 2ZSDA 4E32A 1CY2A 1K98A 3L6CA 5FD8A 5DTJA 3L5KA 2WJVA 4GQIA 2ICAA 1YRWA 4IUYA 2JFVA 2XMGA 3NEPX 5CG2A 3LI2A 4J76A 1TMOA 4JEMA 1EK0A 2PZGA 2QZZA 4P4TA 5A0FA 5D84A 2I5PO 4DSAA 3DBLA 4B44A 1QK5A 4BAUA 1MX3A 1JAZA 3B3JA 3BAZA 3OM8A 3SIWA 5BSFA 3PHHA 1M75A 1XRMA 2JIZD 2L0XA 4LZZA 4D80A 1AKNA 2XX3A 4KWHA 3RVJA 4BO2A 1II9A 2ZB2A 3N39C 5CH8A 4TTSA 5DXJA 3S2YA 2R2GA 5K3FB 3WE7A 4HDQB 2J3IA 4IDQA 5IRCD 2C84A 1XQ6A 4P36A 5GIOE 3UT5A 4A10A 1CEYA 2JHPA 5WRFA 2DQ4A 4DIFA 1KU0A 1OB2A 5CA0A 4G9BA 4KE6A 4F3KA 4WERA 5L3VA 1MJGA 2YOHA 5TDHA 1C3JA 1JDTA 2ZUBA 3ZCPA 4RPCA 4MV7A 3RRZA 4JC5A 2RHBA 3FOCA 2ZAYA 2D5CA 1R8JA 4YJ2F 1BDBA 4TUYA 1NP6A 2YCLA 2PQ0A 2V3VA 4EYEA 3SZUA 4DHEA 2DG2A 1YS6A 3QVVA 4I55F 2C99A 5ECDA 1RNLA 1QCCA 1G98A 1UXHA 1IXYA 2PLNA 1ZCAA 2JJ1D 3FSGD 4TWZA 4BMVA 5I3CA 3G8CA 2HL6A 3EFBA 1G7TA 2FB9A 3LU1A 3NM5A 2BSAA 3HEBA 1UMKA 1E2LA 3AB8A 5AXBA 4QG3A 1I9CA 2C8VA 3K4HA 1O0SA 3QV2A 2CJXA 1F2UA 2CL7X 2WUFA 4Q7JB 3FD8A 3KEFA 5JYDA 2R66A 1P60A 1IHYA 2XODA 5DB4A 2Q3FA 5A7FA 1ZLYA 4CPDA 3EGVA 3VR4H 2AUTA 2JIQA 4I8DA 3FDJA 1FU7A 4IIJA 3ZY6A 3J80A 3PEYA 1ZXXA 2GJKA 1R88A 3BEDA 1OLXA 5FNVB 3JAWB 1C3LA 3WWEA 1ULBA 2NOAA 3Q6NA 3H86A 4PM4A 4RHXA 1ZCZA 4GICA 3WLTA 3FDFA 3I4CA 1NVEA 1NF3A 3I28A 4UU1A 4FM9A 4Q00A 5BMVB 3G23A 4AT1A 4Z3OA 2ZIGA 4B31A 2VTBB 2YHSA 2Y9MB 1Z2EA 2NT4A 4FN5A 1VPDA 5CP8A 3HYRA 2O8NA 4QULA 4X61A 1U1GA 1NR1A 2OLJA 5T64A 1NF8A 2EJBA 3MMNA 3NHUA 5CR9A 1XZKA 3WV4A 1B8PA 2EBFX 2LV8A 2WUWE 5CMLA 2QVZX 2GJ9A 5JDCC 1NRIA 1R6BX 1TQ6A 1OXUA 1SIWA 5JR3A 3STWA 2RBKA 3VBEA 3T3DA 1SUSA 5FBHA 1R9NA 4N8EA 2AFIB 1CB0A 3OJFA 4IYRA 3X1WA 1WE2A 3PVCA 1XP8A 3NJ4A 1OAAA 1S4MA 3ULKA 4F72A 2C4WA 4GIBA 4UCFA 4BAZA 1T1GA 1M2WA 5EIAA 3PIIA 2ZTHA 3PUXA 3ET4A 4U2BA 1OMOA 4R83A 3U39A 4G4JA 4F0JA 2IYTA 5DNEA 1UBMS 3PNPA 4AY3A 4V0LA 4ECEA 1YU9A 4CEHA 4F21A 4S04A 1QCDA 3PC8C 3KTAB 3SLRA 1JDBC 1DXHA 1IUKA 3GI1A 4Q7EA 1FJXA 3V4ZA 2HU8A 2G82A 4WKNA 3U3DA 3CH5A 3DT9A 4MR9B 2CHFA 3ESAA 2XQJA 1MP0A 3NBXX 4QJ4A 3ECAA 4IFBA 4HNTA 1FFEA 2GR9A 2IV7A 3H13A 4DVJA 5EZ5A 4GLFA 1TAGA 2M6KA 5B1IA 3ICEA 2G0TA 4BLSA 3BGVA 1DC8A 4L8VA 3E5NA 3DO6A 1P33A 2P67A 3T5AA 2QVBA 2ZYSA 1KJQA 4K9QA 5E4TA 3AX6A 3V2HA 3VU3A 2FW0A 4AUEA 4CUJA 3MRVA 2O7SA 4EY7A 1T91A 1MBZA 2R86A 3BK2A 3FFBA 3I37X 3QKRB 1WB4A 4UCQA 4UTNA 1ZHOA 5IASA 2H2WA 1YS2X 1J5EB 4LJ9A 1W5EA 2AG8A 5CITA 3QUSA 1ZO8A 3EQ6A 4Z9YA 5C53B 4DDUA 2I71A 2X6TA 3K53A 3LHSA 4KFCA 2ZROA 4XSVA 4FFPA 4NZ9A 5DH9A 2ZRFA 3VVLA 4ZI7F 2W42A 3DDWA 1IBMB 1E3TA 1JFFB 4GWGA 3SXUA 2PUEA 1DC3A 2NVBA 1TQ4A 2X0JA 1B74A 3EULA 3RVLA 3SHQA 2ATIA 2AR9A 5BOVA 2FQ1A 3FWYA 3LOPA 1CP3A 4ZAZA 3V6MA 2QX4A 3CJRA 2EERA 3ADDA 4PYNA 2R6HA 3ZWKA 1JEYA 3NBQA 4CGYA 1CS0A 4EGAA 4KVGA 1P1HA 3CNOA 1L8AA 4JEHA 4RE6A 3GY0A 1UK8A 5ALKA 4F8EA 2PT7A 2GM3A 3BHMA 3KOWA 2Z9DA 4GBJA 4S2EA 4TSKA 5KCMA 1K8ZB 3OUUA 3ZE0B 4NCNA 1WF6A 1R12A 1VCOA 4E5DA 4FKBA 3TW8A 4Y9SA 4FB4A 2C2XA 3SQXA 4NIMA 1DMSA 2J48A 1FRFS 3OECA 4AL4A 2HMYB 1LF5A 1ECJA 1PL7A 3JRWA 4ON9A 3W1EA 5K0GA 3RVOA 3V48A 3N2NA 3D3EA 3PRJA 4B79A 2ZBQA 1LTQA 2I3AA 3CU5A 3V5NA 5LMUB 3W04A 1E58A 2A1TS 3ISTA 1MRNA 2DBVO 3AP1A 3LBNA 3L1JA 4NYIQ 5FPKA 4RDCA 1M1YE 4FSDA 1P0FA 5IH7A 1GT91 1ENPA 1K2WA 1W19A 1AUOA 1GA6A 4M87A 3L84A 4YT8A 2ZIAA 4PG5A 4CWAA 4DA8A 3F5MA 3I45A 3C3AA 3H9EO 4EYQA 2PGAA 5H3CA 4KDCA 3TLZA 3CVXA 1CY0A 1EP2B 4OCZA 3MWYW 1FP4B 2QP4A 1A97A 2QJWA 3RG2A 3SY8A 4KPGA 3AIIA 3OPXA 1O94D 1KQOA 1YQXA 2VBCA 3G5AA 3BIJA 2A9VA 3QHAA 3ZWCA 4F97A 3MWKA 5A5EA 1K6JA 2PKCA 3RI3A 2KHZA 3SF8A 2VT6A 4MRVA 2ATEA 2WA2A 3M5DA 5BUQA 5HKKA 4L22A 4PGGA 1PR2A 4H9GA 3N3AC 4IDAA 4DBLC 4RTPA 1GKKA 3VX4A 3E7XA 3W5VA 2X23A 4EVQA 4XPIA 3THXA 5DCWA 1LQ2A 4OIFA 4X6YA 1JXMA 4EYKA 2A0XA 3ICWA 3VKHA 3STUA 2AJ8A 2XYVA 1Z2PX 3FYTA 4MI9A 1Q6ZA 2VZ0A 3FOEC 1USIA 2HHJA 3RUFA 1N3YA 1RHJA 1M0TA 2PX3A 3CEHA 1DBQA 3K72B 4BMOB 2J30A 1H42A 1OI3A 2H4YA 4XJXA 4C4RA 2XSZD 4JENA 2F59A 3WBBA 3FJOA 3JWEA 3UWPA 4MR8A 2NW6A 1E9AA 3E5RA 3O8QB 1QO9A 3UW3A 4XIIA 4A6XA 3DBRA 1V1RB 3ONWA 3UCFA 1SU6A 3OKFA 1P39A 2WJWA 3HR4A 4Y6PA 5DWDA 2G08A 3ZGYA 4WDQA 5F2OA 1XJQA 5DLDA 5JNLA 4PCUA 3QK7A 2QE6A 1AHIA 1BS1A 1H0HA 1QHNA 4Z0PA 3ZJUA 3IP6A 2WMNB 1WDLA 1ZIOA 5H3LA 1UPUA 3QQPA 4R41A 2J3JA 4H7JA 4BBPA 2CUKA 5BOSA 5BWNA 3IKMB 5GZ3A 2XDQA 2PMWB 1CY6A 1TJ3A 5AHWA 2WFZA 1A4RA 1UADA 2GSWA 3H2JA 4LPSA 2GBPA 2OENG 4WKGA 1DQYA 2CWWA 4X41A 1TFRA 3UXYA 4TT3D 4JI4B 4MYRA 5TNXA 1R27A 1BVUA 2XGMA 3BMNB 3M4YA 5I7AA 3I42A 4C22A 1AU9A 4KZPA 2OCKA 2IV2X 4YAIA 2BUCA 2VPIA 5JO0A 1FQJA 4F4HA 2CXOA 2W2OA 2X5OA 2CKDA 3O2SB 4UARA 5GZ6A 5CEEA 5FV4A 3MAAC 1E5XA 1QRAA 2Q3MA 3QBJA 2C3YA 4KX5A 2WEKA 4LNUA 2ZVJA 4XSHA 4E09A 1GG9A 4OHXA 5IC4A 3CVUA 4GYJA 2FPGA 3QUTA 3MBOA 1XIVA 1NC1A 4PRLA 1G8KA 1QFSA 4FMPA 4AKHA 1DIOB 2BKLA 2I7VA 1ZN2A 2FP3A 4UNIA 1W0CA 1X2EA 3K15A 1E1KA 1HC7A 1PG2A 2VJKA 3OCUA 2AWNA 4FI3C 2V5AA 5CCDA 2AZDA 3GMSA 1P7VA 2BFAA 2VQSA 3ET5A 4KPUB 4IDFA 4QSMA 4X1OA 3DE3X 4DADA 4NYIR 5C4IA 1J6UA 2X1MA 3WLIA 1COZA 2D1YA 2VP4A 2WF6A 2XKBA 1IC6A 1V35A 1M2VA 2WAXA 3CO0S 2P78A 5KCZA 3A6HA 3N07A 2CMFA 1KK3A 5AW5A 3AR2A 2DFVA 3R0ZA 2PLFA 2WJAA 3KWMA 3BTOA 3K1AB 3N8GA 4YN3A 3VAAA 4KPEC 2OBNA 2XRMA 3UMYA 1JE0A 1YRYE 3CT6A 5L4NA 3LKDA 2ZB8A 3IIEA 2PD6A 3CLRC 3QU2A 3T1VA 5ICMA 1HR0B 1TEXA 2BONA 5AI6A 1F1BA 2A8YA 1HFJA 2EZTA 1HT1E 3V33A 5A03A 4CMAA 1VGQA 4LJ6A 2P5SA 1VKJA 5J58A 4G41A 3L8YA 3ZJ4A 3NHSA 2Y0EA 1KEWA 1T5BA 1VG0B 1WUTA 3STHA 3UUEA 1QV9A 2NQTA 3BTVA 4IWYA 4A0QA 2DFTA 2OY0A 1R50A 2BI7A 2WSBA 3EBOA 3I1JA 4XWOA 2Q5HA 3A28A 1G5PA 5MFZA 2XAUA 2WYVA 2PZKA 1ZLXA 3EXAA 2WLTA 1VXRA 4Z4QA 4YK7A 2II6A 5K3DA 1B0PA 3KJEA 3HXOA 2XLCA 4NBLA 4OXYA 3EC2A 4C03A 1J0CA 4GMHA 3SG0A 2Q9CA 4DB4A 1TMYA 4LBZA 1LF0A 1CZRA 3WGTA 3JYLA 3WFZA 4PC7A 2V7WA 3GIWA 1DBSA 2BEVB 1WF3A 3QVGA 1UPXA 1WJGA 1ZU4A 5TPWA 2D0PB 3I2JA 4P53A 2VDNB 2YW9A 3Q3IA 4BEWA 4C6RA 1IL0A 5K4GA 2H9YA 3LRXA 4A2CA 5DISB 1R4MB 1VMIA 2Z09A 3VR2D 2C58A 4GOMD 1L4UA 4MCJA 1U99A 4PR3A 3NXSA 1E6LA 2I7TA 3BJMA 4JLMA 1TVKB 4D8WA 1Q3TA 2IYUA 1E4VA 1DKPA 3DTVB 5BYAA 1R37A 4OQPA 3UMSA 3FPGA 2O54A 3QIAA 3KHSA 4OHUA 2XQIA 1KKLA 1EDEA 4R7GA 4AZ0A 2ERXA 3OJ0A 1O97D 3M34A 4D8UA 1UKAA 2V7GA 2K4MA 4E7OA 2X0NA 2ES4A 2YL2A 3H2SA 3IPAA 1M0WA 3RLFA 5CIQA 3TRJA 1KP3A 1X1SA 3C3MA 1HYBA 2I87A 5EI5A 4RDXA 1G0OA 3PQ7A 4OI1A 4UOZA 4QHYA 4ZVPA 5EMJA 5GJBA 5HX7A 3PFNA 1AA6A 1E94E 1G7SA 1KH1A 4DNXA 2CNLA 1DO2A 1SHTX 1O95D 1YB2A 3BF8A 3NPMA 2DVMA 4GSLA 2RDMA 4AZ3B 1E4EA 1Z6YA 2VH1A 5JAOA 1I1QB 3IIKA 5DMXA 1XD2A 3QW2A 3GJYA 1EWTA 5J2TF 3UEOA 2BFDB 2Q8NA 3I52A 5LUAA 1F9EA 1YQWA 4B3FX 3NO4A 4WBNB 4L4SA 1QMPA 3WRXA 3GOQA 4RMHA 2RAUA 1SVKA 4ARAA 4EBBA 2OGWA 1QE3A 2B2NA 2HK8A 1WSWA 1CF2O 4TLMB 1JHRA 3TTYA 3WMFA 3ZXXA 5L45A 2TYSB 3GT0A 2FEKA 3F6YA 3HI4A 2E9SA 3A1NA 5I5GA 3QEJA 1TYEB 4RWZA 4AG6A 1J1UA 3HO6A 1L4MA 4PYMA 2A86A 1OIXA 2H9IA 3AV3A 3NC1C 4WXEA 5IH3A 4BNXA 2V7PA 4F3NA 3O1IC 1LY1A 2OVBA 4MS1B 4QGBA 3AJEA 5KKNB 3MNFA 5AD1A 2YZMA 5INTA 1IH8A 2ZBEA 2PYDA 3E9CA 2V5UA 5T7BA 3HLTA 2Q6IA 2B1IA 3FSJX 3LE8A 4IJKA 1QPBA 4I19A 3RWBA 3W3AD 3WBKA 4CCYA 1BEUB 1F0YA 4NBWA 3VPCA 2RGXA 3FPFA 5IKPA 1UC8A 4W5TA 3L7NA 4V0ME 1RS0A 2AQ8A 2FZKA 4UBOA 2PD3A 3RFCA 5L7TA 1NNUA 3ZWNA 4B4DA 1E2KA 1MTZA 3S40A 1HQDA 1X6VA 2CLHB 5B57C 1C7ZA 5MHTA 4NMLA 3WA6A 1H2EA 3C98A 3ZXYA 3FHTA 4E03A 5H4HA 3UYLA 1QJCA 2C42A 5JQGF 4PYRA 4XFDA 3E7PA 1Q7GA 2Q6KA 4YAGA 2QN1A 3L8EA 3HB4X 4QYXA 2J3DA 2Z3VA 2HRQA 4I6JA 4XVRA 1QVRA 5CLJA 4CLEA 1JU4A 4TTJA 2CJWA 3TBKA 3WGNA 3GRUA 1CERA 4UHDA 2WZQA 3R7NA 5E6SA 5F7JA 3W6OA 4YCNA 2EJVA 1U2GC 4TYNA 5FAXA 5BNWA 1O58A 4QJIA 4NBVA 4BO0A 2Y6UA 3PF9A 2QQ0A 5TV2A 1AUXA 1ZSVA 1C2TA 1T4DA 4TMWA 3GNLA 1EFDN 1N2SA 3UYKA 1JFVA 1JR2A 1FOEB 1I7NA 3D4BA 1F0PA 2ZU6A 4RLFA 5DN6A 4EF6A 5BV7A 4LHZA 3HBAA 1CNFA 3MGBA 3ZDQA 2C1ZA 2J3EA 3U7IA 3LPLA 2YH2A 3KAJA 4HB4A 3SDBA 2CMGA 4Y2UA 2UAGA 2ADMA 2WSYB 3D9QX 4CR6A 2HJRA 2QD3A 2QTWB 3EBLA 1KAGA 4RKFA 3BQMB 1GTJ1 2GT1A 3WRWA 2ZIEA 5JANA 3T9FA 4MJ7A 2OHOA 3WYBA 4UHJA 4EYOA 1UBGA 1LNQA 3IAS1 1ESNA 1DJQA 3ELYA 4FXPA 2EP5A 3L6DA 5DX1A 1BYIA 4EFKA 1AMNA 1H3FA 1FYWA 2A4MA 3T9BA 3LA6A 1VRCA 5AESA 4NQRA 1P5HA 2C2GA 5AKLA 2FJUA 1DBPA 1YL5A 3TQFA 2J0UA 2MINA 3D3WA 3W5CA 2FFJA 3GLQA 2YV2A 2Q62A 1FDWA 3QEKA 4Q18A 1ZK0A 5BVGB 5IBCA 3P9PA 2CVZA 4TT8A 4A5OA 1KEUA 1W59A 1XCBA 3P0JA 3ZZTA 2ZR8A 2HWYA 3IRVA 5CUQA 1DPFA 4AQ7A 2FE1A 4FOTA 4IJQA 4Y6QA 3L9WA 5A5VA 2O8FA 1E8MA 1Z25A 2GM4A 2AL7A 3A1VA 5EE3A 2QUZA 3NHKA 4NJEA 5FLEX 5KOJB 3COSA 3N2KA 5K20A 4C7MA 1NVAA 5DF1A 3CS3A 2WSIA 5DBHX 2C0CA 5CXXA 5KSYA 4FE7A 3C4QA 1DOAA 4K05A 4DBZA 5LKAA 4BE4A 1E1NA 1UIMA 4NH0A 2FSGA 4MUEA 2AV6A 2Q8PA 3INGA 1V3QE 1F14A 1A8PA 4N0QA 1O03A 1SVIA 3O9MA 4OJQA 3UJ6A 5BVHA 5C1IA 2P9BA 1BQ3A 2F9MA 4DKJA 4LSMA 3ZU2A 3PJGA 3H0EA 1WEKA 2W70A 3TLCA 4ILKA 1CR1A 3T1YB 2FQYA 2X8WA 1E2DA 1K4KA 3NLLA 1M1YA 5HKLA 5C1PA 1SHLA 1VB5A 2FAXA 3NAQA 3SEQA 1JKJA 1HT2E 2BTOA 3SBDA 2NUTB 2HLNA 2FGJA 2REXB 3BCRA 1VGVA 3KYDB 4H3SA 4YJGA 4WFJA 1N2IA 3PUHA 4PNPA 5JVDB 2IJGX 3H16A 4GPAA 5EA2A 4IXNA 4YRJA 2J0VA 2HWKA 1H9CA 4E2FA 1DU4A 1BW9B 4RKQA 5GM2A 1GGNA 4XUEA 1KWKA 1OUMA 1C3VA 5KWIA 4AF7A 4KLRA 1LS6A 3N6RA 4NFLA 3ZZUA 1OV4A 3BZBA 3LVRE 1L5NA 2HI0A 1FDUA 1RTKA 1E0JA 1EINA 5JI2E 2DT5A 3R6WA 3UATA 2O2SA 4EABA 4HQ6A 2I4MA 1DBIA 4AJEA 1FXSA 1T4MA 2G80A 4GZLA 4RA6B 2WI8A 1IWBB 2XA9A 5EERA 2XMPA 5EKXA 3TN7A 1OA0A 3FOFC 4P0QB 3TRKA 4CE6A 1S3SA 7REQB 1SZDA 4GX0A 4W5QA 3IAM1 3KR0A 3OIWA 1XD9A 2GEUA 3ZBPA 1NURA 5AXDA 1GTMA 3HVIA 2W2LA 1BFUA 4JLUA 1P91A 2JLZA 3F5DA 1NMSA 4IHJA 4JY7A 3AHIA 1NW4A 4H1UA 3HKDA 3LHDA 5B2ZA 3ZLJA 2Z5LA 1ESZA 2JHFA 4CF5A 2VP3A 2AQHA 4PRKA 4XZ3A 4WUTA 1OIVA 1KMMA 1XMPA 2A5YB 4CKBB 1UAYA 1YR3A 3NHMA 1H93A 4WHMA 2FW7A 1WCV1 3GRFA 3K1YA 3E8SA 4IIVA 1XZPA 4UHKA 1BRMA 4LFCB 1RCUA 2MYTA 3AP2A 4NNJA 2KM1A 2QU8A 1MU0A 2GA9A 4AUKA 3EPJA 4GKBA 1NJ8A 2Q4BA 3COYA 3EIXA 3JVVA 4ZKDA 2GFQA 5TLSA 1RKUA 2FSHA 3A6FA 4D9BA 1GPUA 3PFBA 1DC6A 2QHXA 4AYTA 2ZRJA 1P29A 2BOVA 4BO6A 4W1SA 3QEOA 4B3TB 3H8SA 3JYOA 3KZNA 4S1VA 2EYUA 2YXPX 1XEFA 2PZEA 3S0JA 4MYUA 1EESA 1HLGA 3JATB 3GP8A 5CK5A 3OQVA 1EVZA 5KX5F 4U5QA 2XVZA 4I50F 4KE8A 2X2OA 4GC5A 4IGKA 4Q9HA 1S1MA 4ZWNA 1OH7A 1JTVA 1P2VA 3WKBA 4LGCA 4GYKA 5AM2A 2Y0BA 2BEUA 4WCFB 1WULS 4AMUA 1VL0A 2WMDA 4YJFA 2OTCA 3W4IA 4RH0A 4B87A 2C3MA 1DO8A 1Y5NA 1KY3A 4GI1A 3EMBA 5AW4A 3UMMA 4BTLA 4E1BA 2PWAA 3C3PA 4JYBA 5L7YA 1PJ4A 4JC0A 5MN5A 1VCHA 2ZVDA 3HMQA 2J87A 4MWZA 5E2BA 2Z8YA 3UJAA 1W4BA 2L82A 3D8UA 2NQ2C 1TRHA 3F7MA 1D4OA 1FA9A 1TDJA 3DQQA 3QF4B 5CTAA 1DDIA 3F67A 4HAWA 4ZOAA 4A16A 2WTAA 4BVKA 5IPFA 1K88A 4YJHB 1EZ1A 1YE3A 5JAHA 1SUIA 2VCEA 1N34B 5I8PA 1GVNB 2OXCA 3VPFA 4LJLA 2X1LA 1Y7LA 4LF7B 1NG1A 4IOLA 3RM3A 2OD7A 5EE5B 3GWZA 3SWWA 1LPOA 4Q4HA 3EZ9A 3LXXA 3IX7A 1GLNA 2IPMA 3BIFA 2ZIVB 2ZDHA 3MYYA 3R23A 3M70A 1AB5A 4HHEA 1PUIA 3ZIAA 3EOAI 4IM7A 1DKUA 2Y1KA 1X9IA 2DR0A 3AU9A 1TZJA 5AKGA 1BXRB 1TO6A 2B21A 2A9KA 1VG9B 4K26A 2RGCA 3H5RA 1TADA 4LDRA 2Q2VA 3DMNA 5HMMA 5B58T 1ISFA 1MW8X 4X85A 1JDNA 2VNSA 3H75A 5HUQA 1CRLA 4H1HA 1DFIA 4KBGA 1UPAA 1CEQA 3OQPA 3QVWA 1TYBE 1YR7A 5DLQC 4N4AA 3VR6A 4BJ3A 4PSKA 1Z6AA 1NYTA 5EFZA 2GZSA 4Q1CA 4YUXA 3O0DA 2C7BA 4U1RA 1VJGA 1TJPB 3HI6A 4HEJA 3RVDA 1FTNA 4KREA 4XM0A 5EKDA 1XTZA 2IXBA 5BSTA 4ZHQA 1UDXA 4WESA 3VKWA 4MKXA 3MGGA 3IQEA 2QMOA 3EGDA 3RVRA 5FOWA 4JXKA 5CDFA 4BGEA 1QYDA 3EUFA 3JVDA 3ND7A 1GG2A 1WXXA 1ANKA 1YRBA 4E11A 4C3VA 3KUXA 4PZLA 2OEPA 1A50B 4RFVA 4E51A 1G6Q1 3F98A 1XZMA 1OTYA 3JV7A 4D4HA 2BTEA 1EGMB 2GERA 3PDUA 4HFNA 1GXSB 1GPWB 2RGUA 2VYVA 3BGIA 3WMWA 1J20A 2ZT8A 5E6UA 3R0JA 4JB0A 1HSOA 4WA7A 4HTFB 4EUEA 1WABA 2K5UA 4JT8A 1FQKA 4GM1A 3WJ2A 1JG1A 1CV2A 1J2UA 4XRGA 1Z74A 5HG0A 5I9BA 3H3JA 4R6WA 4DABA 1KTIA 2ZJAA 2AN4A 4LA4A 5FR2A 3UV7A 3WK5A 3TPZA 4P5EA 4RY2A 2CLFB 2BEKA 5AKXA 3PYMA 1SCUA 2I1QA 5EXDA 3L1UA 2P6UA 3TD9A 4H1VA 4DDMA 1N8NA 4BWVA 5IABA 3OCWA 2PVSA 1VP9A 5L95A 2XD4A 3MT7A 2M1ZA 2UUPA 5CAEB 1L2TA 3FZQA 3MTAA 4U3JA 1PWXA 2DWOA 2GEDA 3WFIA 1FVHA 3C1TA 3W06A 2OO3A 1RWQA 4MAAA 3UN1A 5K8VA 3U4QA 2F8SA 3B7GA 1FUIA 2Q3BA 5I7WA 4YRFA 4RGYA 3HA7A 1SQSA 3SJ7A 4OHCA 1OLSA 3MD0A 1Z0FA 3I32A 2YWHA 4X92A 3FFXA 3K9GA 5CB8A 1RVV1 2N9UA 2WU8A 1JT2A 1XD8A 1K7SN 3RRBA 1C3EA 4K3VA 2XCQA 4A1OA 3JQGA 2QLMA 3H5WA 1H9AA 3DZIA 2PJUA 3K6RA 3P7MA 4DAEA 1U02A 3DXYA 4PHTA 3RCBA 3NYWA 5AQ1A 1ZM4A 4BHTA 1H9BA 2TS1A 3KSRA 4NS1A 2W90A 3H8WA 4LI0A 3ZKWA 5JD6A 1EVQA 1Y4UA 1BH2A 2AXPA 3BH7A 4P32A 3WDKA 1BKDR 1Z3IX 4ZC1A 3UAOA 3GUZA 3UGQA 4ZYWA 4E5PA 1QH8B 4WTOA 2QGNA 4FFOA 2CXUA 3CXRA 1J0AA 4DCTA 3H8VA 2AVDA 1ZD5A 1F9AA 4JBYA 2H1LA 1D1TA 5DYGA 3T12A 4RV9A 3ZDEA 4BP3A 2M2IA 2JIBA 1W36C 2YQ4A 4B4OA 4NR0A 4EJ2A 2WVJA 1J7JA 4LMAA 4JWTA 2IYQA 1JSCA 4ZVNA 4ZEOA 3PJEA 4JI7B 3EEQA 3PI6A 4XGQA 3JQ8B 1THZA 4K9OA 4UC0A 3V8RA 3SXJA 4JOSA 4MV6A 1HRKA 2UZAA 5AJTA 3F90A 4FEYA 4KQCA 3SFZA 2BE7A 2RHMA 1WCIA 4ER5A 1Z34A 2FPMA 4WLUA 2HDWA 3C41J 2X58A 1JFTA 1PFYA 2VP6A 1IONA 2J9FB 4XVUA 1BDIA 3VXKA 2EEPA 4BKRA 2HA6A 3M6XA 2XOKD 2NV6A 1WU8A 2B5VA 2YXLA 1S02A 3HKEB 3OA2A 4GT1A 4L4XA 2FEXA 3BWXA 4V0MA 1YZTA 3GF4A 4TWJA 4II3A 3X2FA 4KAFA 5E38A 5EE1A 1VPLA 3ONEA 4D4LA 2ZTVA 4EG8A 1BDMA 2YRWA 1JVNA 1NUHA 3H6HA