2H5IA

Crystal structure of caspase-3 with inhibitor ac-devd-cho
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
146
structure length
146
Chain Sequence
SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords caspase-3, p17 subunit
publication title Structural and kinetic analysis of caspase-3 reveals role for s5 binding site in substrate recognition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 49
structure length 146
sequence length 146
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2006-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2h5iA00
3R7BA 1IBCA 5IABA 1RWXA 5H0IA 4HQRA 5IAKA 2FP3A 1CP3A 4JR0A 3V3KA 1NW9B 3SIPA 4QUJA 4ZVSA 4ZVPA 1RWVA 1PYOA 4NOKA 1GQFA 3D6HA 3IBFA 4N7JA 4FDLA 4N5DA 2C2OA 4PS0A 2Y0BA 2H5IA 4EHDA 2NN3C 1SC1A 3DEIA 2Y1LA 1K88A 3S8EA 3V4OA 2C2MA 3H11B 3V6MA 3DEJA 2C2ZA 1GFWA 1CVRA 5IAGA 1RHUA 2FQQA 1RHMA 2XZDA 3ITNA 4QUIA 4DCJA 1RHRA 2H51A 1RWWA 2QLBA 2CNNA 3R7SA 4D3ZA 4QTYA 1RE1A 5IAEA 3V55A 4QUHA 4DCOA 1PAUA 4QUAA 2HBRA 3V6LA 2XYHA 5IBCA 4AWBA 4EHLA 2CNLA 4JJ7A 4AW9A 4EJFA 4NBNA 5IARA 3QNWA 1QTNA 3GJTA 5IBRA 1QX3A 4PRYA 2J30A 4ZVOA 5IC4A 3UOAB 3KJFA 4JB8A 4JQYA 2CNKA 2H4WA 4M9RA 3S70A 4JR2A 4DCPA 1F9EA 3BIJA 4N7MA 3H11A 2H48A 4N6NA 5LUBA 2DKOA 1SC3A 2QL7A 3DEKA 4JR1A 1I4OA 2H4YA 1QDUA 4NOJA 4PS1A 5I9TA 4EHKA 3K7EA 3NKFA 3DEHA 2H54A 3GJRA 4EHHA 2QL5A 4ZVUA 3UO8B 2QLFA 4I1PA 1I3OA 3R7NA 5JFTA 4NOLA 4ZVRA 1RWKA 1NMQA 1RWMA 3D6MA 2C1EA 2XYGA 2HBQA 4EHAA 4IEFB 1ICEA 4I1RA 4JJ8A 3H13A 3H1PA 2QLJA 2QL9A 3GJSA 1RHJA 3IBCA 4NOMA 3NR2A 2J32A 5IBPA 4D3XA 4AWAA 2K7ZA 1KMCA 3EDQA 5IASA 5I9BA 1NMSA 5LU8A 5IC6A 3RJMA 4QU8A 3KJNA 2WDPA 2AR9A 3R5JA 3R6GA 4LSZA 2CNOA 2FUNB 4JQZA 5IAJA 2H65A 1M72A 4QUDA 1RWPA 4D3YA 4NBKA 3PD0A 4HQ0A 1F1JA 3NS7A 4JJEA 1RHKA 4NBLA 4QUBA 3R6LA 4PRZA 4EHNA 4EHFA 2CJYA 4HVAA 2HBYA 1RWNA 3H0EA 3EDRA 4ZVQA 1SC4A 3P45A 4N6GA 5LUAA 1K86A 2C2KA 3R5KA 3P4UA 3V4LA 2H5JA 4QTXA 2J31A 1BMQA 3SIRA 1NMEA 1I51A 3GJQA 1SHJA 1RWOA 3PD1A 4QU0A 4N6OA 1JXQA 2CJXA 2J33A 2P2CA 5LU9A 4QUGA 3PCXA 4FEAA 5IANA 4QU9A 2XZTA 3E4CA 3D6FA 5K20A 1I4EB 4FGUA 4FXOA 4QU5A 4QULA 1SHLA 2CDRA 2XYPA 4ZVTA 1RHQA 3OD5A 3KJQA 2HBZA 4IYRA 4QUEA
chains in the Genus database with same CATH superfamily
3OZXA 2CVQA 3PFHA 5J5VA 4CF3A 3I0NA 4I4TA 4ERNA 1CXZA 4ECEA 3WGKA 2XUFA 5CRIA 3CA8A 4YCLA 2GD1O 3BB3A 4DCUA 5C8VA 3FUXA 1HFKA 5K5EA 1IULA 4EM6A 4QREA 3EXAA 2A9QA 1SQ6A 3D7NA 4G63A 4MRSA 5B4TA 4Q16A 3RODA 2O3TA 4B47A 1BRMA 3DHWC 2HWKA 3FGOA 1PK9A 4XJTA 3WGZA 1O95D 5BUQA 2I4OA 4DHWA 2Q0QA 5IFKA 4GL2A 5ELMA 2HUPA 2WHXA 3PUZA 1QV9A 5FDFA 3ZDCA 1P9LA 1PS0A 3EMDA 1SKYB 3HN6A 5AHKA 2JBAB 4HEA1 3H05A 1PT5A 2OV1A 2E49A 4XQCA 1PLLA 4JYMA 3TSZA 4BNDA 4BFLA 3SFZA 3GRYA 2WSLA 1BVYF 1ZESA 3GH1A 1VGVA 3UGTA 1CFJA 4RWZA 3Q3IA 4N3GA 5DX0A 2WJWA 3M3PA 2PPLA 2GPYA 3GJ8A 3I30X 4U9HS 4UVIA 5JAQA 5LA6B 5EZSA 1MT0A 3ROKA 1TUBB 1YS7A 3GAMA 3I37X 4BN5A 3W9YA 4M46A 4DCSA 1P3Y1 1YI0A 3FKSA 5FI1B 1V1MA 5F98A 1Y9DA 1EFTA 1BW9B 4IIVA 2PQ0A 4EFDA 4YAOA 4DCPA 4LJ4A 1YRLA 2YHIB 1FVHA 5HE8A 2VA8A 4NONA 1QU3A 3U80A 2ASVA 3KLNA 5FQNA 3AJ9A 3UAZA 5EMMA 2I33A 3ANNA 4II2A 3A6PC 4IGAA 2NV2B 3C3YA 3NGMA 4I50A 1QO0A 2R6ZA 1FUEA 1JA0A 3OKPA 4IY1A 2QAGA 4TV9A 4ZARA 3U3DA 2PUHA 2D3TA 6LDHA 1MC8A 4Q93A 2IHTA 1V0JA 1NTRA 1RKQA 2GM5A 1GNLA 2PM8A 2NOAA 2YFYA 2Q49A 4CG1A 4M8IA 1A8UA 3D6MA 3KYIB 2EBUA 4NZPA 3RYIB 1ZGHA 3KKQA 3NM5A 2ODAA 4W5HA 2BFAA 1H8HA 4E14A 3OO0A 3I5XA 1PWZA 4QPCA 5DW3A 1K6XA 5H5JA 1PWYE 2OYRA 1IL0A 2W6JD 4LRYA 4Z4QA 4QBGB 2AC7A 1BFUA 2AOVA 4XCVA 2VJYA 2ZPTX 4ND3A 4EG8A 2OGSA 1GRCA 3M9WA 3FBGA 3TQOA 1IZ9A 2XH8A 4BTVA 4MR7A 1HDYA 4EUFA 3KTOA 3INRA 1IDOA 2E87A 5LNK1 4DC0A 1F12A 3EF0A 1ILEA 2A0UA 5EZYF 5GGXA 5A05A 3F0TA 4HQ0A 4E4RA 1YVUA 1P7YA 4K6HA 4N1AA 4YLGA 2QV0A 3H0EA 1KI1A 1MPTA 1ZCAA 2JIRA 3D3EA 3LT4A 2XKAA 4NBTA 3NOVA 5JSQA 1E3TA 3D7KA 1G3IA 4L5AA 4DWOA 3FZGA 3TXAA 1ZSVA 1PT7A 2AR0A 4L4RA 3D8TA 4YROA 2PMEA 2VH2A 1MCZA 3ETCA 5KUTA 1D2AA 2D0DA 1YA8A 1YHZA 3AHGA 1FJHA 3KFXA 4RE5A 1BHJA 3QV2A 4HN9A 1ZNZA 3D4LA 4AJJA 2R00A 4JKOA 3I2JA 5TQJA 3CFYA 5ALSA 1XZBA 3PPYA 5DWVA 1EFPB 2YIJA 3RNLA 1B8VA 3N0XA 4FGJA 4C5CA 1DLJA 1K06A 1P91A 2EW1A 2O8FB 3ZCVA 4KXLA 1EUQA 2JANA 2CFCA 5ALUA 3O4HA 3ZLVA 3GFQA 2PZJA 4JJIA 1X0VA 1CZUA 4AC9A 4D42A 4F97A 5C8ZA 1RXVA 2DEUA 5LD2C 2E1PA 3LAWA 2DVMA 2PQ6A 5K99A 3KE9A 1D2EA 3JQGA 3OJCA 3QXXA 3PQ7A 1NXSA 3MSXA 4XFKA 1OZHA 3AC0A 3O4GA 4PHFA 1YE3A 2GCEA 3R09A 3HLKA 2QUHA 2GYWA 4RBNA 1CHDA 4PVDA 1J5EB 4K2HA 2J0SA 3VV3A 4LWQA 1QB7A 2P90A 2Q4TA 4ZCRA 3GLFE 2C5LA 3I9MA 2AHRA 3NHRA 4BXOB 4YAIA 3VVMA 2R85A 1Y63A 4MS3A 1V8DA 3DTNA 1K4KA 3HPQA 2I6SA 4LHEA 1U28C 2DRIA 5F3RA 2OZPA 1EUDB 1JU3A 4FOSA 3QYPA 2I3DA 5CT4A 5IJAA 5L3QB 4YWHA 4BB0A 2KI5A 2ZTHA 3W5HA 1YC5A 3O5AA 4QIHA 4QC2A 4FYYA 5JPIA 5TVGA 2PBFA 4ZT4A 5JCXA 4GI1A 3AVOA 4EJSA 3WBKA 1GR1A 4WE3A 2VK8A 2W93A 2PRSA 5B3LA 3L1KA 1MPXA 4LQDA 5FBHA 2PWZA 3QEMB 1TIPA 3NYRA 1I4LD 2HK6A 2PLNA 3LXMA 1E8NA 5AM3A 4LXUA 2X8LA 2MSWA 3GJXC 3IP7A 3NP7A 5JY1A 4TV8A 5HCUA 3STXA 1CRZA 1OX6A 1PZXA 4NAVA 1OVMA 1T3LA 4UAUA 5TPZD 3VI3B 2DPGA 3TNLA 2KE5A 4DTIA 1W44A 1E1KA 2OLKA 4MPPA 5J23A 4LKOA 4B85A 1E3WB 1O5OA 3T99A 4HYTA 5CD9A 4I9UA 1DAPA 3UPDA 2OK7A 3NHLA 1RXIA 3EUAA 3UT6A 5JNVA 4FFWA 4KMOA 4O4JA 2TRSB 2H5LA 3CZ4A 5A3RA 3GMSA 3SHVA 2AFHB 2NO4A 3GJSA 1Y1PA 4B17A 4L0CA 5GP1A 3G7NA 1U5AA 1XKLA 2OZKA 2FSIA 2RHCA 3DXFA 5JLAA 1YRBA 1CBUA 4GF5A 3I9JA 3CLRC 3H2JA 5SYMA 3NKLA 4Q0MA 2FWBA 4QU8A 4DN6A 4COKA 4KU4A 4IF6A 3MS7A 3DFFA 1HV8A 3GNQA 2A0KA 3NNSA 3P26A 3QPDA 1R9MA 4ALIA 5DNWA 1W76A 4WJZA 4C7KA 4PC7A 2JVIA 4Y9UA 2H7CA 2BCJQ 4RUKA 1MRSA 3B3AA 4TTAA 1XLWA 5KYUB 1VA5A 1M0TA 3DQPA 3EIFA 3FNHA 4OATA 1HNZB 3A28A 3IVGA 3RVQA 2YNMD 1CEEA 3EA4A 4MRMB 1Q50A 2BKAA 3VOTA 4L95C 1V3TA 1T29A 2QRKA 3ORYA 4JK3A 2Q3CA 3F7TA 3LFTA 4XOUA 5FEMA 4K2AA 3ZY2A 3QMVA 3TFWA 3ZV5A 1XMVA 2UVPB 2ZJAA 3BIWA 4K0KB 1KTIA 3H9BA 1FFXB 2DPYA 2AX4A 5KAMA 3MFYA 3BHIA 2BM1A 5F9MA 3RV4A 2DZDA 4AMYA 2ADFA 4GVXA 2NO7A 4B3CA 3DT8A 1PU2A 1AD2A 3DAHA 3LZCA 1EP2B 2JAHA 1MV5A 3OCVA 1SHLA 2D5CA 3NP9A 3KSZO 3EY4A 4FILA 4ETIA 2ZRIA 4H7FA 1UPAA 4F8JA 2V9PA 1KQGA 4MP8A 1NKSA 3ETJA 1M34A 5I6DA 1YZFA 3B2EA 4F4HA 2VAMA 5DK4A 1NVWQ 1X1CA 3CINA 2PY6A 2FUG6 2Q7OE 3NV9A 1YS2X 5DBFA 4ZCQA 1G8YA 5L3SA 3AB8A 1PZNA 1Q0RA 3EW9A 4ZXFA 4FLFA 3IBFA 1LW6E 3EIWA 3IAFA 2Y8EA 3PYMA 1YE5A 3WGQA 2IZ5A 2Y4OA 3O8OA 1TQDA 1PS8A 1UFKA 2CLEB 4IG4A 4UQPA 3WL4A 3TMAA 4JUAA 4XWKA 2XBLA 2B30A 3NBAA 3T94A 4DV1B 1X70A 5ITSA 1A2KC 3TW6A 1IBRA 3F5FA 1UJNA 1U0SY 3GBVA 3DBLB 2OENG 1A9SA 3GG2A 3FN4A 2XUDA 4KSYA 4O25A 4NBSA 4CTJA 1NNEA 5K2MA 4L76A 1HDRA 4AB1A 3VH4A 1PTJA 4E09A 5DGXA 4OL0A 1U0LA 5LZ8A 1NNSA 3H5LA 3HZRA 4NZ9A 5ALRA 3DJFA 3HB9A 3C16C 3VR5H 1ISFA 1M2VA 3RG8A 4OIFA 4R1LA 4B40A 5GADl 1NYTA 3O8LA 3WLHA 2ZUBA 2EV9A 1DARA 1JXMA 1SCNE 3GZTB 4XR9A 3UOAB 3BSWA 4O8CA 3D2LA 2DAPA 3V9PA 1YONA 2FZ4A 3CNQS 5CCBA 2I6QA 4IVNA 4D8UA 4TMWA 1L5HB 3I9LA 3ZNNA 5C53B 1FUIA 1OW3B 1Z5WA 2H85A 3F6YA 1Y8CA 4FYKA 1QDUA 4QGAA 1AKWA 2PIAA 3HO1A 2G04A 3KT8A 4BNJA 1RVDA 2O20A 1OLUB 2PUTA 2X5OA 3MLEA 1OGYA 4G1UC 5GZ3A 1XEAA 3HXKA 1SVNA 1L1QA 3JALB 2PLWA 2QLFA 4JHLA 4MUEA 1T35A 4RIGA 4RIIA 2JJ2A 1R0LA 3KWJA 3U1VA 3J81k 4EG3A 5LPNA 4W9MC 3QQ5A 1BU8A 3MGKA 1QIFA 3KOXA 1JSXA 3R4VA 4IIJF 3MRXA 4OJYA 4CKBB 1D6SA 2HBQA 3SBXA 3BMNB 1QPBA 5LKAA 2Z9DA 5CBPB 4LF4B 3Q98A 1CNEA 1W36B 2C4WA 1FYFA 3BRWA 5AVZA 5CFZA 5C0OE 1E2IA 3RS7A 5JH7A 1KYZA 4QO7A 4UBKA 2X76A 2YV4A 3N53A 2DU8A 2ZPUA 1Y1QA 3AZOA 4DF3A 3VBCA 1HR0B 1OT5A 1JKFA 1TKBA 3O2NA 1LNQA 2OD9A 3EDCA 4MZDA 1LLCA 3F49S 1D7OA 1N5KA 1I0ZA 1T5HX 4GDMA 4AAYA 1YV9A 1KRXA 1TQ8A 4HYQA 2C95A 5IDYA 3FUVA 5TNXA 5BUZA 5DOZA 2PBRA 5KYXA 2IEAA 4Y6LA 3ZE8A 2Y6VA 3I6MA 3HO6A 2YVKA 4ETWA 1JWLA 4MHTA 3QSGA 4TQ9A 1BMDA 1Z5OA 3W5BA 2WJJA 3CSDA 3RAEC 1PZHA 2CLDX 3AEYA 3PNSA 1O77A 5DM1A 3RFTA 4AXBA 5A02A 4QSMA 1VXOA 1GO2A 4BJ5A 3G8BA 3P2EA 5TV2A 3D64A 1S4MA 1RI2A 1QVVA 3KYJB 2ZR0A 3OX4A 2CJXA 3ZV7A 4OHPA 4BFUA 4RK4A 1H5QA 3DB1A 2MCFA 3LCMA 4CTMA 2JLXA 3QHAA 5CMLA 1TT5A 1M8FA 3QUQA 4UM5A 1GKYA 2OQIA 3T95A 4IJ6A 3PGLA 1JDNA 1Y1LA 1TJNA 4QUEA 2VHJA 3BGSA 3T54A 1SY7A 2Z09A 1TK9A 1RBZA 3IPAA 2O50A 3H5RA 1ES9A 2BONA 1DJQA 3HYRA 2W4IA 2EZ9A 2PD3A 3SQOA 4F7WA 3DDHA 1EJ2A 3RREA 3MGAA 2XTMA 4D9IA 1M2GA 3N6RA 3PK0A 4D4KA 2VC2B 1KFKB 2NNWB 1U7HA 1ISGA 4V02A 1SUCA 2B92A 2EATA 5KJ6A 1I24A 1U9IC 2OCLA 5DTEA 4JP5A 1CJBA 4YJKA 3KXPA 3OETA 3UJ8A 4EGSA 2PYZA 2X8BA 3N7UA 4Y1FA 1M54A 2VLIA 5K03A 1M8GA 2I7CA 3VV2A 3OESA 2R1ZA 5K2OA 1KZ6A 2PZEA 3JX9A 2BGKA 4D3FA 3AONB 2FYTA 4DJJA 5CNMA 1ZVKA 3EVTA 2VYCA 3BE8A 2CK3A 4R31A 4CLEA 3U4GA 3D9QX 4FNMA 4QQFA 5J2UA 4D9HA 3VKVA 3KZOA 3TD6A 2AT1A 5LYYA 3DHEA 4PNEA 2VTBA 2WJZB 3QMPA 2BEWB 3N0TA 5LLSA 1WUKS 3V8NA 3KETA 1LD3A 1B6SA 4KC0A 3VNVA 4PTYA 1CUWA 2JW5A 4XRGA 3ZXYA 2XUOA 1P2GA 1QNLA 2EDCA 4Z6KA 2SICE 3NUZA 1P44A 1U3FA 5JD3A 2HIAA 2JLQA 2WV7A 3TWOA 1O03A 1S2DA 3L8CA 4HFRA 4EYGA 4KRFA 3LU1A 1JFLA 3ZTWA 1NF9A 5LXTF 3NYIA 2ECQA 1U0OC 4JODA 2NVUA 4X8LA 3WZMA 2WU4A 3JWEA 3DQQA 4DQDA 3RFCA 3RJ9A 1N75A 4QDXA 3TSYA 5LLTA 2WF6A 3AJ8A 4R9UC 4BLQA 2QGFA 4DNPA 1ZITA 1KO1A 1XLTC 3CRRA 4S35A 1LV8A 4ZVRA 1MORA 5KJFA 3K5PA 2QVLA 2QNBA 3RIGA 1XAHA 5GONF 3LQ4A 3RIXA 5B6IA 2VZLA 4AMZA 3KJHA 1YZKA 3DVQX 4GLOA 1VJ1A 2NZJA 2P6PA 2PGAA 3TE7A 3IIMA 5HBGA 3KQVA 4OREX 1UMDA 2MSKA 1JYFA 4KFSA 3T3NA 1G41A 1ZD1A 1ZC3A 1MMFB 1KQFA 4C89A 1IYZA 4M0DA 4PHTA 1Y3IA 2JD0A 1XTSA 2EJCA 3I9FA 3L4KA 3T12A 3OQOA 1T34A 1ZHOA 3P9SA 1YR3A 5EIHA 3VJKA 3KYCA 4OGKA 1RQNA 1W5BA 3CZQA 1CS0B 2VI5A 1J42A 2VYND 4HVTA 4BFZA 3X44A 4PZPA 1LS1A 2GYYA 3DMGA 5HF5A 3D5QA 1PNRA 2PG3A 3K9BA 2QSJA 4QPPA 3ASVA 4NE9A 3MZ0A 1XROA 3KJZA 1JEEA 4ZI7F 3EQZA 1OF1A 5I7EA 1T43A 4TL8A 4BCCA 3R20A 3IOCA 2QHXA 4OYLA 1M6NA 3QU5A 2EP7A 1UBOS 3ZE2B 1RAIA 1IM5A 2WV9A 2VNIA 2AZMA 4J91A 4UQLA 1ZWLA 5IANA 3LBHA 1SPXA 4U7DA 2HOQA 1P61B 3WWOA 1C7IA 2IHUA 4PAWA 4TKMA 1ZVQA 2X0EA 4IXWA 5KHAA 4DV5B 4YQFA 4L8VA 4EVRA 1UZAA 4J1TA 2OFFA 1YU9A 4XX0B 1DT3A 4CUKA 4K0RA 4FYMA 1XZJA 1WZIA 2XQFA 1U2SA 2O3JA 3ET5A 2FPPA 4OAQA 1NMZA 2AXQA 1ATZA 1VHLA 3M1LA 2X7XA 3RK4A 2H5IA 1KS2A 5LMZA 3C1TA 1RPZA 4B8WA 1L7RA 2I6TA 2PA3A 3K94A 3MWEB 4I5FA 4MS4A 4WHMA 3W6OA 1V43A 4TX1A 2ZT5A 3EISA 1GHTA 4R83A 1T25A 3OLCX 2QORA 3QBVA 2IWHA 3NBYC 3KPYA 4LDPA 3T5BA 4BTEA 4I66A 2YHSA 5CDSA 1OREA 4H4CA 3WDSA 1HSOA 2I76A 1Y7LA 1ISIA 2HTEA 3GVXA 4CF7A 3WLNA 2XUJA 4TM7A 3QUTA 2LRHA 2P4EA 3LHFA 2OXCA 1RBMA 4AJ2A 4BFWA 3Q85A 3H7IA 2P2GA 1EK1A 1JL3A 2VSFA 3Q8WA 5CM2Z 3HSSA 2BGUA 4OQDA 3BICA 4PWYA 4D9JA 2HIHA 4KIUA 2CXRA 4DRXA 1M0EA 3FY4A 4KEAA 4QRDA 5LN1A 1SCBA 4RVHA 3A14A 1E4EB 3HMQA 4OLFA 1UP6A 3KUKA 4GR4A 1ELOA 2ZJ0A 4P9NA 2ISCA 2QTHA 2YDYA 4X41A 1HBJA 4RTOA 1LSUA 4I1OA 2I0FA 3Q2IA 4W5JA 4A1FA 4ZMRA 5FF9A 3AOEA 5AUNB 3FTDA 4U2BA 3UFXB 4N01A 1L4NA 3Q5GA 4WNCA 4Y1EA 5T5QA 3MIZA 4OHFA 5JS2A 1BOOA 1PVVA 2K2QB 3KR0A 4M3NA 1W96A 1EWVA 1SKBA 3U4IA 4P3PA 2PO7A 1NHWA 3G3EA 2PZKA 2Z56A 4QAQA 3NJ8A 5FL7A 4EJMA 5DE3A 4HB2A 5AUQA 1G6KA 3AP3A 3F8TA 1G291 4IIEA 5IVHA 1RYZA 4HQNA 1W49A 4CFSA 3X0DA 4YP5A 4XGNA 1AZSC 1PK8A 4EELA 1B1CA 1HRKA 1KEVA 2BHSA 1JEOA 4B7XA 4BX8A 2HK9A 2Z0MA 4XUGB 2DQYA 2EZUA 2AN9A 3BBLA 5FAXA 3R4CA 1G1MA 3BHJA 3V8RA 4JU9A 2REOA 4N12A 4BVAA 2C5EA 5HSGA 1RWPA 1T24A 3C5EA 3ZE7A 4BBAA 4NE2A 4EENA 3NS7A 1TX4B 5K0ZA 5HA5A 3R7WA 2NU8A 1YQEA 3A11A 4BNFA 4EMUA 5KYNA 4GDFA 1M1YB 2EF1A 5IUJC 3DM5A 1GPWB 3DMHA 1JHYA 3HNPA 5AK5A 3PENA 4ZAXA 5K3CA 1ZM7A 2PLRA 1CG6A 3WE7A 4HRYA 1A8QA 1Y5LA 2K4MA 5CB4B 2YR0A 3N2KA 3KOOA 3IX7A 2V65A 4FQ7A 1INLA 3SLGA 3VC7A 1JLHA 1X7XA 2COUA 2BDUA 2O2ZA 5AM5A 1DIRA 4Q4AB 4TL9A 3ITEA 1YZLA 2HMYB 2FH5B 2JAXA 4KBGA 3N2IA 4LXTA 1NVXQ 1QHHB 1VLLA 3DVAA 4UARA 1GCOA 1XMQB 4ZYWA 3ETEA 3ED5A 3A6GA 4ZAYA 4QGGA 2ZE6A 4ZKEA 2WI8A 4YV2A 1MJGM 1KP3A 1KK3A 2XE4A 1A69A 1JQ5A 1UF9A 3JVVA 1QHXA 4RSGA 5FBQB 4AURA 4YCDA 2CNDA 3O2QB 3IOMA 1JUDA 4GYWA 2EJBA 2VQEB 3P9YA 5EJ2A 1CE8A 1RMQA 1SGWA 1FOEB 4U0KA 3QKRB 3JAKB 5M34A 3QPBA 1MLDA 3DGEC 1YASA 2X15A 1XVLA 2W6CX 1NC3A 3QPCA 1LQTA 3GMDA 5JBQA 1RHMA 2KLHA 1Z2CA 3QXCA 1T4CA 1TA0A 4ZYLA 3C6KA 3ROMA 1DEOA 2AMFA 3U9LA 3O8RA 4IJQA 2QLBA 4UNNA 4QDKA 1TJ3A 3GUCA 3AI2A 1QB8A 2NZWA 3JQ7B 1RYBA 3A27A 3F7OA 4X1YB 4D74A 2NTJA 1HT0A 5GGYA 1C41A 1LWNA 1U9JA 1JTEA 1JDSA 1KORA 2NV0A 3MNFA 4RV5A 4CKCA 2HQSA 3ZC3A 1SXGA 4IL5A 4O33A 1V1RB 1VP9A 3WLPA 2PX0A 3VDQA 3PNMA 3QX7A 4I4LA 4B74A 2R60A 2R8YA 4HDCA 1E69A 1WXFA 3TJZA 1YF3A 2EFYA 3B53X 4EA7A 5HPYB 4ZZ3A 1ISMA 3IPLA 4OQNA 2IUYA 3L6DA 1TC1A 1Y1SA 4X95A 3F5DA 4V0QA 4NCAA 2OGTA 3AV3A 1Z4PX 2OT3B 2PUJA 1E4OA 4L7QA 1I9CA 2Q3MA 2Y2VA 5I9TA 2BZ1A 2VHEA 1HNWB 5BNWA 3LWNA 1PFGA 5BSHA 1BQ4A 4XJSA 1QG2A 4Q7MB 4Z2YA 4I1UA 4MYUA 3HM9A 5EHNA 3OAAA 1W7AA 1RP1A 4QL3A 1YZTA 3BZWA 4LYGA 2GUWA 4KQIA 3SF8B 1XPUA 2RHBA 4DM7A 2PSDA 2BSXA 4PO8A 1P4AA 5CLGA 2FTKE 2EWMA 5IH7A 4U2FA 3ZV6A 2PCLA 3GT7A 4GBED 4ITUA 3NVKI 3PQ6A 4PGFA 2Y76A 1UAGA 3D4IA 5AVOA 1T2NA 3HWRA 2I99A 3USES 2V74B 1XCPA 2WPNA 3ANSA 5REQB 3RYTC 1U1EA 2AMJA 3TOXA 4AP9A 3R9XB 3AL0C 2Y77A 4WGFA 5AVWA 1EFVA 5DISB 5IJ9B 1WJGA 1QGUB 3PGJA 3ZDQA 4KFRA 2C7VA 2DBRA 4QQKA 3RHSA 4CMCA 4K6GA 2QM3A 7REQA 4D2IA 1TUGA 1XYVA 2G9VA 3QFSA 4PRZA 1L1FA 2WY2D 3PE4A 4DGSA 1ZR2A 1A8SA 1MJFA 2GQ0A 1PGQA 1OE0A 2Q3LA 3LPDA 1H0KA 3CGGA 2Z4RA 3M9LA 4HDRA 1TE2A 4LBZA 4DSUA 4LJ9A 2C8VA 3E1SA 4DHEA 2GN8A 2JZNA 2QW8A 4CM9A 1RTTA 1XELA 4IDCA 3CRMA 4M55A 3U4MA 5A9SB 4X60A 4L72A 4KLZA 3UCEA 4YCMA 5FV4A 2O8DA 1T6BY 3GLSA 1ZM9A 3A6HA 3PXXA 5BSVA 6NULA 4URZR 2CYAA 2IEBA 4LOIA 3EQ8A 4OB6A 4QTUB 1KY2A 4DABA 1GLGA 1GU1A 1P4RA 2BBOA 3BDAA 3MC1A 4MARA 4Y1RB 4B3XA 5K20A 1H2EA 5DHTA 5DBOA 1OAOA 2OV3A 3TRIA 2HSZA 1H0RA 2O1XA 5H7XA 3WLTA 5SZJA 1ZINA 2IU6A 2OCDA 1OZFA 2UYCA 3ZS8A 5BPFA 5DHFA 3FW1A 1KHHA 1TLLA 3AB3A 1MHPA 4BO7A 4YUXA 1DXQA 2R7MA 1YIAA 3MWYW 1RBQA 4FD2A 4G65A 4F92B 1MAAA 1FNDA 1YIDA 1JI0A 3RVLA 1SJ9A 4HYEA 5JS6A 2EX1A 1AUXA 1N0VC 1JSRA 4L9SA 4LMRA 4V24A 4FDTA 2NN3C 1A5TA 2RJNA 1H2ZA 4TQGA 5DWDA 4Q3LA 3N2GA 3WI7A 4BB5A 4ND8A 2NGRA 3STUA 4M76B 2CF5A 4E15A 2XYRA 4PZEA 1SKUA 3G02A 1NYLA 3P9QA 5DI3B 4YAUA 2RH9B 4I4TF 4P0TA 3UWKA 4D6XA 2CVOA 4KO1S 1D4ZA 3S8MA 4FOTA 3H86A 4NIMA 4BE9A 3C4JA 1DTWA 2YHAA 1AGYA 4L22A 3CN7A 4WDRA 1YJ8A 2QZ4A 1NI5A 2ABWA 3RTAA 3T41A 1M1ZA 1YDGA 1DOAA 2W6PA 1DMSA 5D85A 4G81A 1LX6A 1MDBA 3OT4A 2VBCA 2BR5A 3OT5A 3WB0A 3T3OA 1O0CA 4XTCS 3OZDA 5E9WA 1F2DA 1VL2A 2H9AA 3GEHA 3NG1A 2HZ7A 3CWCA 3HCPA 3A06A 4L5BA 4PHCA 3JQ8A 3TUZC 4JSRA 1H8ED 3D81A 4NYJQ 4GI2A 1T9HA 4B33A 2BGMA 3CMMA 3IAAA 1A9QA 5I4CA 1TZBA 1E3JA 1ZLXA 2BUCA 3ADKA 5D7NA 4RANA 2CXNA 3EZLA 4AF6A 2VHXA 3RRMA 4UATA 4JJ6A 3KQHA 4R4JA 3HKEA 1ONPA 5FCDA 2YKGA 2HCBA 1E1QD 3GU3A 3B1XA 3VU3A 2D8AA 2FOLA 2YJ3A 3E70C 4P80A 2ZSFA 4C6RA 1LU9A 2GBCA 4RV4A 2YWGA 4GPEA 1R10A 1XRQA 3B12A 1TZCA 1SWVA 3EXFB 4M49A 2E37A 4G4GA 4PYRA 2G6TA 3H8JA 3THXA 1WU8A 4NI5A 2FMTA 3NM4A 1CUIA 5CH8A 2SNIE 5A3SA 4AZ3B 1POWA 2XQGA 1VBKA 2ODQA 4L4SA 4I50F 3ESRA 1W88B 4PSDA 1TNDA 4TV9F 1U8XX 1FRFS 4QXAA 4KPUB 4R71A 1CRWG 1M1NA 2ZBGA 1OJLA 2PXAA 3ESAA 3USZA 2W83A 4B3IA 3R8XA 1R00A 2KJQA 3FTCA 5IJ0B 3DM9B 1BS9A 4G09A 4JI0B 3VYSB 5KYVA 1B8OA 1FTNA 5C31A 1N9KA 4DDKA 5IYZA 2O52A 5FOVA 4BO4A 5AJUA 2YIVX 4R2WA 3CHYA 3FF1A 2XX3A 2XGJA 2W2LD 3QK7A 1GYPA 3G68A 3I9V1 4CIYA 3EVGA 3VR2D 3U48A 2D62A 3FLBA 2DPMA 1MXFA 1M6VB 4LPKA 1US8A 3I5AA 4KE9A 4FSXA 5TPWA 3ZTYA 3IH5A 3R6TA 3A6LA 5AHWA 4RVNA 4FR2A 3RU3A 4QVIA 5DHSA 4IQFA 2JBWA 5JJCA 1NQUA 4CE6A 1Y8RA 4M87A 3OE7A 4BAGA 3FCCA 1DKMA 2GJ4A 4OH7A 4ZAFA 4OK5A 5U1PA 2FG6C 3CVJA 4RK7A 1MV8A 2C20A 3OA0A 4RTPA 4AG3A 3EG5A 3K1ZA 3CNBA 1D2MA 1D4FA 1AQIA 3HJTA 4R9RA 3ZHCA 2PN1A 5KHOC 2PANA 4BX3A 3MCAA 4REQB 1DDGA 4EFKA 2KHZA 3CEAA 1A9TA 3LHKA 5AJHA 3NTVA 4BMCA 4MEJA 4AQYB 3MWLA 1XRPA 1EVEA 4BGUA 5JV5A 4YCBA 2BFMA 3MT0A 5A4FS 4GMGA 4OQ4A 2C5FA 5I8WA 2Y1LA 2ID4A 2OKGA 1WUYA 3HJHA 4BO0A 4B0OA 4BO1A 1QKIA 2Z08A 3JRNA 1QO9A 4RL6A 3C8UA 1F3LA 1BE8A 1YAHA 3CM0A 3GFVA 1OFUA 4XPIB 3ZNPA 3QRWA 3UC5A 2V54A 3NVDA 5FWAA 5BSRA 4MQ5A 4G4SP 1XKTA 3VMFA 4KYTA 1NOJA 3P9RA 1T9BA 3C1OA 2JKZA 2DT5A 3HB1A 6ABPA 1NM5C 4WNAB 3KWMA 1KU0A 4NU0A 4B6FA 4RZQA 4R16A 4FEYA 3WSWA 2HKIA 4E2XA 2E4XA 1QZTA 4FB5A 1UJCA 3VPDA 1OROA 4KR3A 3LVQE 3RYHB 3CF4G 4CL3A 1EWQA 4PCVA 2D0PB 2RFLA 3FPEA 1XDSA 3C8DA 3OLVA 5EE3A 1G3QA 1RR6A 1UJ2A 3GYBA 4G4JA 5CTJA 3D6AA 3ICOA 1XZAA 2A5JA 4MV3A 4UDNA 3S70A 5AVXA 1NXWA 5A4KA 5K05A 5L7TA 3HXOA 2VJAA 1CZKA 1L7NA 5E9AA 1YCFA 1NNLA 3KTAB 4I99A 1V5IA 4KQ1A 1ZBDA 3F5QA 1QC5B 1L5YA 3EA5A 1EX7A 5AIAA 4URUR 3C5WP 1G18A 3AR6A 2FGKA 3GYGA 4KUGA 4LRQA 4PSCA 4D9NA 3DTVD 3FVRA 5EJ9A 3ZDZB 1MNAA 1GOTA 3RC1A 4HUQA 2IU0A 3TLCA 4YR9A 4PZ0A 4XOIA 1ZEJA 3TECE 1G17A 2X6RA 3VR5D 5F7XA 1Z16A 4FE3A 4JZKA 5AJVB 4YEDA 2I65A 4DIKA 3AF6A 3U61B 3B1VA 2IA5A 2B21A 4QJBA 1W59A 5JU6A 3RIEA 2HYIC 3B85A 5GAJA 3JQAB 1Y7HA 1HKHA 3BZUA 4TV8F 4LFBB 2ES4A 2C5SA 3F6BX 2NTNA 1BU5A 3F7NA 3M6VA 2WF7A 1DO2A 1H42A 5AXBA 1HE5A 3EMKA 4IGKA 1X15A 3OQMA 2IX9A 5KKAA 5DN6D 3G5UA 1RAGA 5C81A 1HQDA 1ZW1A 3T7IA 2NTVA 5A2QA 4ZEWA 2O3RA 2FFQA 2H65A 5G0SA 3A26A 3U37A 4NBKA 1ECBA 4O4JF 3IUNA 4WX2B 1KAOA 4X61A 4Q3EA 5JXIA 5CXUA 5KNBH 4IBOA 3ZK8A 2H8KA 1C0KA 3GEGA 4XCQA 2QYTA 1SHKA 4XUEA 2GF0A 3GRRA 3DC2A 4I2NA 2ZYGA 5FLXA 2WSBA 5DP2A 1QF9A 3N8IA 4ZPXA 5GM2A 4ES6A 4D26A 2V96A 1GZSA 2D1QA 4WESB 2FSVA 4M9XA 1XXHE 4OYRA 4RA6B 4J6FA 4WRRA 1D2CA 2H4JA 1GUZA 1KNXA 2CXHA 4A16A 1UIRA 4Y0NA 5AW9A 5ITWA 1Z4OA 4NU5A 1BG6A 5JZSA 4IHJF 5DT9A 4QPNA 1XQ9A 4WY5A 1KI2A 1N5JA 3OQJA 1FDSA 5ALDA 1TJ4A 3MWGA 4ZYVA 2ZIWB 2J7PA 3OZTA 4F2WA 4YHHB 4OMUA 3E9ZA 4ID3A 4OI2A 1S02A 4U6SA 5H70A 4F1KA 2D6FA 2YJ5A 2Z2YA 3N2LA 3ONWA 5HIJA 1ODCA 3MQFA 4X6UA 1YK1A 3RRJA 4I9NA 4XIJA 3PC4A 5AKXA 2KW5A 1E32A 1XD2A 3DF7A 3DB2A 4RJIA 4WCDA 2Z8YA 1U3TA 3H17A 6Q21A 1E3QA 1KI7A 3V4OA 5F73A 2PIDA 3PGVA 2WJPA 1SQ5A 4LRUA 4ER5A 2GTPA 3F9IA 1NQVA 4DWVA 5HTOA 4KK4A 4G23A 2FW0A 4C7BA 1RHUA 5TMPA 1CPYA 3BTOA 5KQMA 1R4AA 1EI9A 3Q4GA 2Q6LA 2G5PA 4K88A 5DHRA 3KQUA 1XPOA 4EKIA 4D9BA 1E1RA 1EFKA 4H6WA 3R7SA 3A4YA 4DEYA 3PLNA 3JPYA 3PFIA 5E1MA 2WP0A 4KV7A 3CEPB 4OHZA 4ZHSA 5EJEA 3ZWXA 1JQ3A 2QG6A 4DBLE 2WKRA 1U02A 3EXIA 1FLAA 1V96A 1XDBA 4CCSA 3AL2A 4EPVA 1C80A 1N57A 3AOEC 4BZPA 2P75A 5IC4A 4JLJA 1ESEA 4XB1A 4FMDF 3N2YA 3NEPX 2M6RA 1XRSB 2EERA 2LV8A 2POQX 1I6LA 1FFBA 1OXMA 3IHKA 4JC0A 4QGFA 1G3UA 3IS3A 4GKBA 3L9XA 2GN6A 3AY0A 3N2ZB 5DRYA 3R5HA 2XB8A 2QVCA 3PKIA 3D6UA 2F9FA 3L0OA 1KMQA 3H04A 5FHRA 3A1EA 5JAHA 2J08A 3PWKA 4KSCA 1E6WA 1N8TA 3B9RA 1FW8A 3KT6A 1A7UA 3I8XA 4ENRA 2ISQA 3LSYA 1VECA 4MKIA 4D8VA 4YJ3A 5FNVB 4KQCA 3L5OA 1IHYA 2Y1EA 4W1SA 3N2EA 1MFPA 5L4LA 4NV0A 2PTHA 2XECA 2IHBA 4DSOA 2ZXUA 4JJFA 4YT8A 2IHNA 3AESB 1N5LA 2QM8A 3EFHA 1Z7BA 2RIRA 4OAOA 4W4TA 3SZOA 4EO4A 1PG5A 2V58A 1UDBA 3B6EA 2WU0A 3K2EA 4OKIA 3NHJA 2RMKA 3LKBA 2GA8A 3GFFA 3LPAA 5FUVA 2R8RA 4TMZA 3E9NA 4RM2A 4EK9A 4E2WA 2ZW9A 4ILKA 1GPBA 3TW8A 4AMBA 2XMCA 3GEDA 4YGYA 2OFWA 2VEDA 1CJSA 1BXRB 3EZGA 3WYNA 4N3NA 3EWNA 4UTXA 4FN5A 5I5GA 1TZKA 1UWLA 1YS6A 3DOFA 5B36A 2QQ5A 3BTVA 4NBLA 2BMFA 5EIBD 4B3FX 4FDAA 2HJRA 4JCOA 1I6MA 2OCPA 4RAOA 3OZEA 4PGAA 4WVFA 4CDMA 4MQLA 2YJNA 3P9PA 1HLGA 2ORWA 3KWFA 1QH8B 3H4MA 1SCJA 4L2IA 4W8HA 5E8JA 5B58T 4UTRA 4E2YA 5JH7F 3OEWA 3VFDA 4F6RB 2R66A 3QU9A 2ZYRA 5GPBA 3TLGA 1SXJE 2G63A 1SEPA 1FFHA 3F4BA 1OILA 1PNTA 3PHGA 4ARIA 2VK4A 3ULKA 4H9GA 5KWEA 3OTIA 3RRBA 3LW7A 1CQIB 4L9RA 4ZN6A 4D0GA 2B4QA 4PYIA 4AUNA 3EK2A 3HKDB 1P6UA 3T3MB 1V5WA 1KF0A 1Z22A 4GZLA 4IR7A 3DXXA 3V1MA 4B6GA 4EAQA 4B87A 4DAOA 3AEQA 1BDJA 1Z5ZA 2DOKA 3EYAA 4GUDA 1NQOA 4R98A 3ER9A 1C30A 1ORIA 3S44A 3A1NA 2Q41A 2PRZA 3G89A 1A5SB 4KAXA 4IRMA 4K9NA 4HDKA 5DXAA 1F5NA 3S6JA 5A9RA 4J0CA 4XD2A 4MEBA 4DSAA 3F3SA 1FBNA 3UHPA 4RZUA 3USCS 3OU6A 1F8GA 3ZDAA 2Z6UA 3DEJA 4RC9A 2P78A 2WWTA 3L2OB 3UQZA 1UJMA 5KSPA 1OXKB 2VHUA 3SSMA 4EGJA 1G9SA 4CLRA 3X2SA 2PWYA 1Y6RA 3KXDA 4L8YA 5EINA 4AXXA 4LF7B 1G5RA 2ATIA 1FY2A 2C07A 2FWIA 3OWXA 4OHVA 1QYDA 4KE7A 1ZJ4A 4Q34A 1JFFA 5TT0A 3S0JA 4U4AA 2ZZMA 3RS9A 3UW3A 4F4UA 3KALA 1HTBA 4BQOA 4XKJA 2OUKA 2W2TA 3LLCA 4DVGA 2HIGA 3CUEF 3VOBA 3DWGA 2D5BA 2F8MA 5HKKD 5IXYA 1B3BA 3WMWA 4NZMA 1P4SA 1EGMB 1IWBB 1GSAA 3CPEA 3RYCB 2QVZX 3LKZA 2VDQB 1W94A 2MSEB 1G38A 1C9JA 5JAZA 1T13A 5J2UF 2VCHA 1L3IA 4NULA 5EYPA 2Q50A 4NVRA 4EDHA 4YX9A 3DCNA 4YP7A 5FUQA 4LJYA 3I05A 1CRQA 2OBBA 1DG3A 3COPA 4X91A 1ENZA 2A30A 1Y4ZA 2A0YA 1YCGA 2YQ5A 3D7SA 3FLAA 1GGHA 1BEEA 2XODA 3RC7A 4E4TA 1TJPB 2GPSA 1VFNA 1IN7A 2XLBA 1SG9A 3P2KA 1RZRA 1NBAA 1M76A 3OX1A 5AW8A 2ZUVA 5FUMA 4WXEA 1XWWA 2F3QA 4FR0A 4OBXA 1PQYA 5ALFA 3VH1A 3O0DA 1X9HA 4CYMA 1NATA 1DEAA 3WWZA 1G55A 5B4VA 2X5JO 4DV0B 4CKWB 2R8BA 3K2IA 4LSZA 4EJ6A 4PONA 2XZOA 3ICEA 1NYQA 4BVBA 2YOFA 5B2FA 4WY8A 1ZQ1A 4JDUA 3HR8A 4TKVA 4O4IB 1XMJA 4HNSA 1FP1D 5EIWA 3TZQA 5A5VA 1CV2A 2P0EA 4P84A 2JDID 1RPJA 3IQXA 4G8CA 2YMLA 1RM0A 3PT9A 1OAOC 2O5VA 3ZI4A 4XQ0A 4KOEC 2BTQA 4XI9A 3C8HA 4BRUA 2UYQA 5E6RB 1SU7A 3BA6A 1F7UA 3PD1A 3ERCA 2WB2A 1FCJA 1RC0A 2XMQA 4QFBA 3QE2A 4AN0A 3RABA 4Q4JA 3QY9A 5IDXA 1CR0A 1H0SA 2VQ3A 2OFXA 3VH2A 4CM8A 5HX7A 4KUHA 3FPKA 2VJMA 1YUBA 4A82A 2CXQA 1FNNA 4O2AA 2J3MA 1NVFA 1YJBA 4RKRA 1H2WA 3IV7A 5D5PA 2FUEA 4D9GA 2MYPA 3OBBA 3AHFA 1HG0A 1MRZA 2POCA 5CDGA 2RGYA 4CQNA 3Q6IA 1P9WA 3TFQA 4PZCA 1GQRA 1XXHB 3LLVA 3Q1LA 2YBDA 1JEDA 1VHTA 3DYBA 4TWRA 5EEGA 2OHHA 1H1LA 3UA3A 3ZWWA 1N2BA 3LK7A 1P9OA 3VPSA 4CQMB 1FU8A 3PXBA 5AI9A 1EFUA 3C7TA 5AKJA 1RAFA 3FWZA 3L1VA 3A4LA 3WO1A 1LC0A 1TDJA 1T8PA 3D2BA 1OWLA 4R8KA 1KPIA 4Q1CA 3TSCA 3GP5A 4JXKA 1SUPA 4OUDA 1GTRA 3GUHA 1I6KA 2ECOA 4UAVA 2YS7A 4QUAA 4NCXA 1DIOB 1C7FA 4EMBA 3OHSX 4J0QA 4DNQA 1XL1A 1L5WA 2ZB3A 4WKNA 4DV6B 1EAYA 1IM8A 2ENWA 3OZWA 4KFUA 3VJLA 1ZSYA 2SKEA 4ND4A 1J2RA 5DGIA 5CLHA 1C1DB 5KWJA 1RFGE 3BHMA 3H7AA 4NCKA 1OJ7A 1WUIS 5K4HA 1AQ6A 2CNWA 4YRFA 4OHYA 5E6UB 2XKBA 4JR1A 3RUAA 1MVNA 2HXGA 3D8BA 1YL5A 4PC6A 4YRRA 3HBLA 1ZPDA 5SY9A 3HSKA 1AXGA 1XTKA 1DIHA 5EXSA 3PIRA 4D6PA 2RGRA 2ZQ5A 2P67A 2H1CA 4OSOA 3FRIA 3NDPA 4G84A 3VBEA 4BZWA 2ZAYA 1DC7A 2WKPA 2ZQYA 4EJ2A 2GX6A 1EK6A 3L6CA 4Z4EA 2O2SA 3HVJA 3INGA 4F0JA 4Y6SA 1NUHA 1U0FA 3KKEA 4R6XA 3GZJA 3HNRA 3MMSA 3O1LA 4RZ3A 2G67A 3EWSA 3E1KA 3SDZA 1RRMA 2WP8J 3A1UA 2Q6OA 4C0JA 4I5DA 4DRYA 1J8FA 1IY9A 2FPGB 3SJZA 3UZUA 2RAUA 2ZI3A 3W2TA 1EFCA 4G4SO 2WICA 4IS3A 4KIFA 4DV2B 3TFOA 1E94E 2ZRCA 3P27A 2YVUA 1VM6A 2DETA 4BKOA 4QG3A 4ZHQA 3BE4A 3GQBA 1DKLA 5BR4A 1IQPA 3UOWA 1QJ4A 1ULBA 3X1WA 3F1KA 3OCYA 2YYSA 4FE7A 3T4EA 2F3TA 2ZJOA 1ISPA 2RGUA 3LLSA 2Q4OA 3JQBA 1Z83A 4ONEA 4WPGA 1F5SA 1U99A 1PR2A 3VR3A 4RTRA 4A6EA 1R18A 1W0KD 1X86B 1SU4A 2C0PA 3PG5A 3RDPA 5A06A 1HX7A 4FYJA 1XIVA 3K6KA 1NQWA 2NQ2C 2GK6A 2PKCA 3I1IA 4QYWA 4S1TA 4EBFA 1RWOA 2O2HA 3EASA 5CK4A 3ZVLA 2UU9B 2VJQA 4NMWA 3BRSA 4B82A 2XRZA 2PKXA 2I4NA 3T1YB 1ZRHA 3BRQA 3JY6A 1FMJA 2Y0PA 3QF4A 1X7WB 4MYDA 2GPWA 5FT9A 4QM7A 3RAFC 3IULA 2X58A 3L82B 2IYUA 3AI7A 3LBAA 3CEJA 2WZDA 4ALNA 5IKXA 3OD5A 3A2NA 4CV2A 1N9ZA 2V7UA 3B3JA 3RWMB 4EUNA 1OKKA 2VHCA 5C80A 1SOWA 1BMFD 2QMUA 1QNFA 4E5PA 2JJQA 1EZZA 1P2VA 4QAJA 3NM6B 3RUCA 2HCFA 2FDRA 2W2VA 4M0FA 5ELLA 4EFLA 1IHPA 1SXJB 3EVFA 4IW3B 1MGOA 2C7BA 1RPTA 3REQA 2KBEA 2V3CC 1MA0A 3NH6A 1VCHA 3IEVA 3GUZA 1F8XA 1EHYA 1FMLA 1NLFA 2HMWA 2YZ2A 4PZ9A 3TW4A 3WYFA 5IZCA 3RT7A 2R3SA 3X1XA 4HZUB 1DP4A 2CNBA 2J9FB 2OECA 1KY3A 3PQEA 1XDZA 4CVNA 1AJEA 3U7HB 1PV4A 4G5RA 1KYVA 2GN9A 3IUYA 4XQ9A 3SEQA 4D7AA 5B64A 1RRCA 2W2KB 2NXWA 4EARA 4ZJPA 2H1OA 1BEZA 1F0NA 2WYVA 3O3NB 4U9UA 1QP0A 4URHA 2I2BA 1OC4A 1YKSA 3FYUC 4HH0A 2QI9F 3JWHA 5M3BA 3SZGA 3ENNA 3I1FA 2V7VA 4M98A 4YCJA 1TMOA 3I9OA 2IDZA 1MH9A 1UBHS 3FETA 1HQKA 2BGIA 4N82A 1T9AA 1WMEA 1YMUA 1AK9A 2IZ6A 3LUKA 3NOXA 4GT1A 4HQ6A 4RVGA 5C1BA 2DQ4A 3MGCA 5EKXA 4FZ5A 4QTZA 2HF9A 4HEQA 4FIZA 2GPNA 1QTQA 2PYIA 2CSUA 2G70A 2B34A 2LDXA 3H11A 4YDRA 4DA0A 3ZH9B 2D8MA 2QZSA 1GY8A 4H7HA 4JGBA 5I7WA 3B1FA 1RXYA 5ECGC 3S4YA 5COBA 5K3AA 3SAJA 5DTRA 4PFQA 4B09A 1PNVA 4HVLA 4FK8A 1YSCA 2ORIA 3LZDA 3CTPA 5GTDA 2WTUA 1OYWA 2JVJA 3BGVA 2GWRA 3RVKA 4FW9A 2DP4E 1W47A 1UAYA 3CX7A 4BVEA 3UMYA 3ZNQA 1YTUA 1MVOA 4KJXA 4QLAA 3R7LA 1KEWA 2Y4NA 2IE0A 4M6WB 3VNQA 4D41A 4KXNA 2HWXA 1A4XA 4Q9LA 4U2GA 4R3NA 1DKQA 1T3ZA 1K7EB 2W2OA 3CJQA 3M6FA 3YASA 5BSKA 3M6MD 1ZSNA 1JEYA 1L8AA 3ZPXA 2AG6A 1UEJA 4G8JA 1CZNA 2QZPA 2FPIB 2EYUA 4F9EA 4TYPA 5LJIA 3AFHA 1QP7A 1FMTA 3WA6A 1L4EA 5L40A 1G20E 1NW8A 2CL6X 3TRKA 3W5DA 3FAZA 4Z8XA 3HCDA 2AXEA 3KQWA 1X8LA 3NAZA 3S7ZA 3HP7A 2FEKA 3F3KA 4Q00A 4G41A 4QUKA 3KU1A 3SN6A 1FQKA 3ANXA 3SY8A 4RH1A 4L8GA 2OCKA 3ELUA 1DUIA 2RSLA 4II7A 4ZIRB 1GGEA 3ISVA 5BOSB 2VDLB 1W34A 1P1HA 2P9ZA 4GLLA 4R51A 1CB0A 4NPHA 3VPHA 4TSFD 4S24A 2XUGA 4DQ0A 1RTKA 4KDCA 4GIBA 1JJBA 2BISA 1HE4A 5IRCD 4BMPB 3B6ZA 4UUNA 4MWBA 4ZCTA 5JQWA 2QD3A 5ES4B 4P4UA 1TTQB 5JHGB 5JPCA 1YU6A 1U6JA 1CR6A 1FFGA 1ST2A 2VDNB 3W4IA 5K3OA 1RI1A 2EJUA 1TEZA 3GFPA 1HZZA 3WNDA 3Q5EA 1N92A 2D54A 4N4AA 3RVJA 1HT3A 4XR4A 5FX2A 3W9UA 3CG0A 1T2FA 5DX8A 2XWQA 3S1AA 1V7CA 5BW8A 4RA9B 3PFFA 3ZY5A 4BKPA 4WZAE 1ECLA 4CG3A 1JQKA 3IVRA 3L41A 3FMGA 1FNMA 4C5BA 3G8DA 4B6JA 4ZQCB 2P2NA 1OOEA 1IOWA 1DUVG 1PG2A 1VKZA 2K6GA 2ZTMA 1WBBA 3RRNA 1DL5A 5KDLA 2HSGA 2FP4A 1M7GA 1TM5E 1RAHA 2ATCA 3F47A 3GJ6A 3AB7A 2QNIA 3HKBB 3MB8A 3PDWA 1O95A 3DDNA 4W1PA 4C22A 1FZTA 3PFCA 3ZXIA 1E2MA 2QX6A 3HBAA 4UUAA 4O0LA 2Q3EA 3AR7A 5JFOA 2XJ9A 3A6EA 1TYBE 3NO4A 3OZGA 4AWBA 4YV0A 2C96A 4JJ7A 2YCBA 1LPSA 1X39A 5HOEA 3MCUA 1YIOA 5B4UA 4EQZA 1GPLA 4LXXA 3FZQA 1WNTA 5ALMA 2K87A 1N6RA 4ZOLA 5F1PA 1PFKA 4GZ6A 3AFIA 1TW2A 2CNKA 1WKVA 1XC7A 3U3OA 3HCOA 4HVCA 1JGTA 1R6XA 1MF7A 2F1KA 2VDKB 3Q3VA 4IDGA 3VR4D 3QUAA 3WMRA 2AXPA 2H48A 2OC9A 4YDQA 1A0OA 2ZJ6A 4PC1A 1CR1A 1YQXA 1USUA 4GMHA 1R0BA 2JBAA 4KH1A 4QYTA 3IUMA 1GPAA 4E32A 4BUJA 3CNHA 2BGRA 3CNOA 1JAXA 1WA5A 2CHUA 3C6YA 3L49A 3OI7A 4JP1A 1RC8A 1EP3B 2BC9A 2G36A 4G2TA 1OLSB 2IW3A 3KYDA 1E6LA 2ZRAA 1N6NA 1QF6A 1DBPA 2VZ0A 3F8SA 2P0YA 4P92A 5LA6A 4HGRA 2RKOA 1TUBA 4B5LA 5JY6A 5DASA 2EL9A 3H2GA 2V6IA 3EXHB 3MELA 3CGWA 4FFBA 4G0XA 1YNOA 2DQZA 3Q1KA 4OJKA 3R0XA 4WBXC 3D0OA 3RUHA 3TLYA 5HIAA 1BW9A 2WJAA 1CT9A 1E64A 2O07A 4QZVA 4GXQA 4KN9S 2YHIA 4KN5A 2HQOA 1Q7TA 4AQDA 4YXFA 4OA5A 1QYIA 4P36A 4PZUA 4YT2A 4IILA 4I6JA 3RI3A 1N2CB 3JS5A 1QIIA 4AKIA 4BPRA 1GZ5A 2YVQA 3L4SO 4OMCA 4RK0A 1PJSA 3LHSA 5G4KA 1Q1QA 2YUTA 3A9UA 1ZISA 2ZXFA 3HC7A 4DARA 2Z98A 5AICA 1LY1A 5TRTA 2E4YA 2W71A 1OFGA 4Q1DA 4P22A 4F2PA 1I4DD 4ZU3A 2GBFA 4M9UA 3V3TA 4XGIA 4KR6A 2R86A 3DWFA 2ZIAA 3GB9A 2BJWA 2VK1A 3RYIA 1Q44A 3E58A 3I53A 1T1EA 5B6JA 3UJ9A 5EJ5A 3U4CA 3I5MA 1N9GB 2YQ4A 1BAPA 2BUBA 3HYLA 5FYQA 2EKLA 1UFOA 3VO2A 2XGMA 4XYLA 3VSDA 3CB2A 1YFJA 1SO8A 1A8PA 3PA6A 3V1UA 3CVVA 2V0GA 2YVLA 4MUIA 1OH7A 2AG1A 3BWBA 5IYZF 3R3YA 4X5OA 4DMHA 3HDHA 5JNRA 2PT5A 1JRLA 3IMEA 1N0UA 2B7BA 2Q29A 1TM4E 1L1RA 2J3EA 2GK3A 2VAWA 2VK2A 1K27A 1MOZA 2CB9A 2YRFA 3CKYA 3ESQA 4QE3A 4U8HA 3KZXA 4AMVA 2J9YB 3I64A 1UZMA 5KNBD 1QP4A 3KSAC 1GA6A 3C97A 1RM4A 1J23A 2I29A 1J4AA 4YO8A 4YYEA 4GD3Q 3EGIA 4URWR 1TJ5A 3FNFA 1SUEA 2YH2A 4FQ5A 4IGIA 2VA9A 2SKCA 4IMRA 5E4JA 5SY4A 3G1WA 4ZCIA 2R25B 1NSTA 3BILA 2Q8NA 1CUJA 3WJ2A 4MTCA 3AVUA 5CA1B 2VPPA 1XHEA 3PI6A 3H9EO 1YZHA 4C06A 3ZGOA 3N86A 4EATA 4C43A 2Q2OA 3K0AB 3ND8A 1I30A 4OJQA 4UPDA 4HWGA 3KBBA 3VPFA 2O7SA 3EULA 5JZBA 2BLNA 4EZBA 5I7VA 2Z3VA 4DRZA 3ZH2A 2HDHA 3ZWAA 1Q83A 1TQHA 4C0AC 1EFPA 2UKDA 4XZ3A 4R84A 1FYVA 2PZLA 3ROTA 2QT1A 3UJDA 2VAPA 5M5BA 2GSDA 2O8FA 1Z8HA 2ZROA 5LZ7A 2I3ZA 5EKUA 1NG9A 3QH4A 1RI3A 4OKSA 4FWIB 1RQLA 4BUZA 1YT5A 5G3ZA 3CONA 4HLUC 4IDDA 4R1NA 1VKOA 3E7FA 3ISJA 5ESDA 3HCAA 3A7DA 2Q7XA 3RBXA 5LSAA 2GAFA 3RJ5A 2V98A 3E4DA 2V0CA 1HT2E 1DWQA 5BXYA 4AJ4A 2P30A 2XA1A 4IQGA 4WKPA 2FW7A 3VR6D 1Q6ZA 2QU7A 5DSTA 2BEUB 2Q4EA 2QD1A 4MYTA 3I39X 3FPJA 2HLPA 1IE3A 2R4UA 3THRA 2J5BA 3I23A 4ASUD 2GPBA 3NBMA 2FWAA 4AUEA 4CV3A 2OQ2A 2FLKA 3LJKA 4V0MA 3SBDA 4BXOA 5IN4A 4KDEA 4I1VA 1USVA 3TLKA 1ZD9A 1J8MF 1X1RA 1SOAA 2A7QA 3HVUA 3IQEA 4I6EA 2JFPA 3ZEAA 1OVGA 3FZEA 4EVQA 4F5DA 2FVYA 3CT4A 4ISCA 1EUDA 3CH4B 2HT6A 1X8JA 3ETLA 1QGYA 3JPWA 3TL3A 3EFEA 2HB6A 3BX1A 1NX9A 3DKVA 4MV9A 4ZDWA 2GJAA 1HWYA 4A6XA 1X42A 3A1WA 1U0NA 3VVCA 1VOTA 1T8TA 4WGGA 1Q22A 3UMCA 1YZQA 3L7CA 1JB1A 1MFZA 3DZDA 4UJ3A 4DCGA 2G07A 2WIAA 3O1IC 1JP7A 3EZ2A 3QEMA 3OPVA 1LBIA 1G8KA 2E4UA 2XJ4A 3Q3EA 3TLBA 4AUKA 1H69A 1W0JD 1DINA 3DCJA 3IC5A 1BX1A 1QHEA 2V7WA 1KGDA 1S8NA 4JQZA 4PO1A 1WDKA 1C4XA 2ZBFA 1ZN7A 4EG0A 1KI3A 1Z12A 1XZ8A 5L9AA 3KQQA 2IFTA 2XSZA 4H3HB 2CMDA 2C0CA 1JQLB 1IZZA 4KYIB 3L7IA 1C9KA 2AA3A 4TWIA 3LQRA 4PYNA 2PUAA 5F7JA 3DNMA 1LPMA 3K9CA 4IAOA 4B3DA 4DLWA 1NFFA 2OUIA 4G97A 5C35A 3W90A 4JI2B 4MCAA 1D0IA 2GZDA 4JV5B 1P4HA 1X13A 4FVTA 3B7GA 5DP1A 4PPFA 4PLHA 2PGDA 4H17A 4GKJB 2AFHA 5MN5A 4G86A 2VDPB 5I7RA 3N0RA 1O5TA 3GLVA 2GEJA 1UEIA 4J0EA 3HJFA 3UWMA 2ATVA 4D1YA 2GMWA 2O8CA 5F21A 1PL0A 2BPOA 4JC5A 4QDJA 4AN1A 3FSEA 3TNYA 1E61A 4URXR 1C8LA 2R62A 2IXTA 1CD5A 1II8B 2OFPA 3INTA 1B1AA 2CCGA 1SHUX 4KPGA 4JR0A 3H2BA 3LUJA 3MINA 4V0RA 3QXJA 3V4VB 4ARVA 1OBCA 4LE1A 4BWYA 4JLKA 3QKIA 1J0AA 4RVCA 1HFEL 5ERYA 4MRMA 4TM8A 2ZB7A 1IN8A 4MRNA 1AKUA 1YZ3A 2W9XA 1G66A 3MMPA 2LBPA 4WKBA 5CXXA 2WSMA 4P35A 3SC2B 1CIJA 4WFKA 2UVPA 4UDYX 3AUFA 3V97A 5LDHA 1FFXA 3ENQA 1TEHA 1Q0PA 3LL7A 2P9EA 2OAQ1 4JVOA 3A3YA 1OBVA 5JASA 1NT2A 3LWDA 3ZGZA 1YVRA 4IVPA 5HILA 3BQMB 4O3FA 4KWTA 2Q8PA 2JRLA 4HB4A 4WACA 3M6XA 4HH4A 2JLZA 1M34E 3BMOB 4FU0A 5CFPA 4QUHA 1Z4IA 4UM9D 1L0BA 2WHRA 1GCGA 2NZUG 4MW6A 1JG2A 2BFNA 3BEDA 1AUVA 4GEKA 5L6MB 1QHIA 2G9QA 1JYSA 3TZHA 5C7YA 1GCAA 1LGYA 1ML3A 2Q0HA 3QNWA 4K8OA 1KIMA 4IFIA 1D9ZA 6REQA 2GZ3A 4KE8A 1CY8A 2OCGA 1FYDA 2VAVA 3AUTA 4A0SA 4TTSA 4YK7A 2NX2A 1N1EA 3BIJA 2GVDC 5DNDA 1TM2A 2Y1OA 4F84A 1XSEA 4BMZA 4AQ7A 2BMJA 2VT7A 2PRKA 4MQFB 3ZZ0A 3IPRA 2HA4A 4DMFA 1X87A 3H1GA 1FMCA 2CYCA 3BJZA 3CPSA 2DLDA 2FWMX 3DBLA 4O4HB 4RV9A 5C1IA 4CPDA 3QE4A 1KGSA 3EGWA 3FWPA 4FGZA 3ZD7A 5KWSA 3L7YA 2CJPA 1QFYA 2A94A 1ZK0A 4JLNA 2OBMA 3B38A 1D0VA 5G1NA 4M2LA 3E7PA 3K1YA 3OKFA 1R15A 4XM2A 1GGVA 4JP8A 3VU9A 3W2FA 5A71A 2J5QA 1S0UA 5M29A 1PR4A 1YRAA 2RJOA 4POOA 5E38A 4QASA 3AM4A 3WGTA 5HZKA 1ZNXA 3M6IA 1QGDA 1L5HA 1OLXB 3SIWA 4S0XA 2VZ9A 1E5TA 3HUUA 4MYCA 4A2WA 4YJ3F 1ZUWA 2J3LA 1CB7A 4I4NA 4JLPA 5EHXA 3PYXA 1QQBA 2PJUA 3L3BA 3OT1B 1ZOOA 4D3YA 1NXTA 1P17A 4RIEA 4IHKA 1R8XA 3GWZA 3JALA 2C2XA 5JFGA 1R8JA 3R6LA 1U2QA 5EE1A 2IYOA 1TI7A 1S3FA 4LCJA 3CLVA 3OLZA 3NAQA 5HXAA 3CZCA 4CKBA 2VWQA 4DPKA 1Y3CE 1T2EA 2APJA 1Z07A 2G0NA 3GY0A 4OUKX 4Q9DA 4Y2QA 5IVIA 3BMNA 3NDJA 2X0DA 4EAAA 5DF1A 5CBPA 4KJZA 2FSUA 2KLBA 2GRAA 3MUOA 3P4YA 2VPYA 2HPHA 2Q5IA 4Y2JA 1BX0A 2XHZA 5K01A 1LPPA 4ZCSA 2EVWX 3KLOA 1ZCFA 3UY4A 3FWHA 1XPRA 1ATIA 1YS1X 3DOUA 2ZB4A 2Y0EA 3C1UA 3KPJA 4H3VA 3QZUA 1ECPA 1KZHA 3IXLA 4BVGA 1QIDA 4BLWA 5IZCC 3RIYA 3HDJA 1N5RA 4H0NA 2M6SA 3PYLA 1FP4B 3FKSD 4RTQA 4UNSA 4GKKB 3L0PA 3A6JA 3AW8A 1HNNA 2VWPA 2OD7A 1ZJJA 1EDOA 3A4IA 3VKGA 1IEVA 2EU8A 1HYQA 2E5FA 4FSDA 5DIZA 3NC1C 4R8VA 4XGRA 2N75A 4P4SB 3RC3A 1C2YA 1BMTA 3SS7X 3V48A 2H4ZA 3BAFA 4DUYB 2DFNA 2A84A 1QO0D 1UP7A 1YZGA 1ULAA 4XD7A 2M6KA 4EECA 3H0CA 1G0OA 3X1YA 3SYMA 2R68A 3DFKA 1GVNB 4K8RB 3IUQA 1C7RA 3GH3A 4X7BA 3TEJA 2RKBA 5JJ5A 5D8DA 3B52X 4RH0A 3MN1A 3T9BA 1XF9A 2JNWA 4RYDA 1RYDA 2HU8A 4FW8A 5TDHA 1CLEA 5A1TA 2P41A 4ZAGA 1UPCA 2X3FA 4A8PA 1NBOA 1H8HD 5A3QA 3ED1A 4FHFA 3G9UA 5JATA 2WUEA 2SBTA 1E2DA 2XA2A 3E3LA 2BVNA 1E92A 3AVXA 1I1HA 4PGMA 4YMHA 2ZUEA 3F96A 4Y67A 1SOMA 1E0KA 2YC2C 4RABA 4D79A 1ISSA 5KMGB 3AERB 3WDMA 1MOSA 2RHRA 1TZJA 3KB2A 2R44A 2C2YA 1Y9ZA 1F8UA 4MV7A 4AKHA 3MHTA 1N77A 1R5NA 1CF9A 3UPTA 1IXYA 4C2TA 3FBWA 4O29A 5C37A 1CERA 3E3MA 4HPWA 1KQ3A 4FLEA 3BIFA 1CJTC 5DBGA 2VEOA 3P2MA 4XIFA 4WUTA 4EY7A 3BQ9A 5FUXA 1OWOA 2XIJA 3C6ZA 4MVJA 3L7NA 5DLEA 4BJ6A 2IX3A 4WFQA 5GOZA 5K0NA 1PQPA 4WN9B 2YHBA 4RLHA 4FOOA 1NSFA 3EVNA 4PZYA 1MQ8B 2IUSA 3KU4A 3O0TA 3ETDA 5DYGA 2J3IA 4I7EA 4DV3B 2C1EA 1UJ6A 5JOQA 4PF1A 1QG0A 5C8YB 2BEWA 2XOEA 2WYUA 3BOSA 4P86A 1YGPA 3ITDA 1A5ZA 1U2DA 4UTPA 1B93A 1HG1A 1TYZA 3EDQA 4TS4A 1JE0A 2P77A 3GC6A 2KS6A 4BKRA 3MOGA 3GLFA 3AIKA 3NBKA 4L16A 4ZRMA 1RMTA 3SBEA 1C9EA 3BIOA 4CTKA 1W85A 2W70A 3TBKA 2QG9A 3N8NA 3AR9A 1OB5A 4Q7EA 2C9CA 2HQ1A 2J3JA 4MW5A 1MQ9A 2PVPA 2VJDA 4URYR 4BO9A 1K98A 1EHCA 3LDUA 3ZVRA 2NYRA 4AICA 1NI4B 1P0PA 3U9SA 4L0QA 1M8PA 2XCLA 2YMPA 3UAYA 1WB5A 4JBWA 4JFRA 3VNSA 3ZDRA 1CUGA 4TZ0A 4EB8A 3U09A 4EB0A 4DLTA 1E7MA 2CMKA 5AOCA 2QRHA 2P9FA 3BXHA 3KKZA 3RVBA 5BMVB 3PCXA 3T5PA 4P8RA 5AVSA 3PQ5A 4QU9A 4C0SA 2EFDB 4BMDA 4EVIA 3GGSA 3JCZA 3I2YX 1QH0A 2VPZA 1BJRE 1XZGA 3L1HA 4EQ6B 3DLAA 5JSFA 1YDEA 2DTXA 2O9JA 1CS0A 3W7VA 1OR8A 3CH5A 1V39A 2OORA 3PGA1 1GAWA 2XCOA 4BAZA 4KQEA 1O95C 1NYRA 3IT2A 1RW4A 1KJJA 1VE5A 5AI0A 2XF8A 3TQSA 4Z0TA 1QOQB 3FFXA 3N70A 4Y6PA 2TMDA 3ZBPA 2WB4A 4EHBA 1TVKB 3IOEA 3M6UA 2BFBB 1U3VA 5JI3E 2J0QA 4NV1A 4Y6OA 3RFUA 2QBYB 4QOHA 1K88A 2AFIB 2FUKA 2I2XB 4HLDA 1R6VA 2Z1DA 3EQ2A 4PPNA 5A4IS 5KNCA 3LCRA 2WWHA 4HXEB 4BFCA 4ACBA 4O2AF 2AMLA 1JMKC 1XQVA 2DY0A 5DTIA 3ZV4A 1SULA 1AHNA 1J7KA 3MXTA 4ER7A 4RYLA 1V8ZA 4ZZIA 4ZQIA 1KEEB 1XZPA 2YJ4A 4HY3A 3DAOA 3KQOA 2BFOA 2LXNA 1D3AA 4QG7A 5L4SA 3LLUA 1CRLA 1GD1O 4NHEA 3O4VA 4XX0A 3DD1A 3Q7IA 5ALJA 3VUFA 2IDKA 4IHAA 1GUFA 3THYB 1JMYA 5CB8A 3MCVA 4I2VA 2UZ1A 5KZMB 5I7HA 1IBMB 3GRCA 2B1QA 1NFRA 5C7LO 4UCFA 4CMEC 4JQYA 3L8FA 2X13A 2OXRA 1RQGA 1POXA 2P4QA 1L7AA 1PQUA 4RMHA 4U7JA 1GFIA 1VJGA 4AIRA 5HIKA 3T1OA 4GAEA 4N6NA 4RPKA 1VG8A 5DM2A 4Q4LA 1NXXA 3WSTA 4CU2A 2G83A 1EDZA 3W6ZA 1J00A 1Q7EA 3RSOA 4K1XA 1JLLA 1U2RA 4NPAA 2J3QA 1E9FA 1HC7A 3SXPA 1SM4A 1JIIA 3OKCA 1U2GC 3LT0A 1EP1B 1X7DA 2UV8A 4L4YA 3V7UA 3LXRA 3EARA 4RY2A 1P1KA 2XPCA 1V11B 5EHIA 4BJHB 1YQGA 1OI2A 1YR8A 3T9FA 3UWPA 3KJGA 2GWHA 4XVQA 2ZRPA 3RBVA 2QRUA 3RARA 2AKEA 1SBTA 1KOJA 1Y98A 3NFYA 1QQ7A 4Q21A 1Q1NA 4PLWA 3GP3A 2QUZA 1XA3A 4YFYA 4D8TA 4BNUA 1GDHA 2WG2A 3ROFA 2ZIFA 5H83A 1JSZA 1THGA 1ULHA 3DMTA 3PEFA 4UUQA 4BIIA 1KI9A 3NCTA 3FGZA 4NYMQ 5CJJA 4WMLA 3A10A 1YR9A 3CE6A 4P93A 2GXQA 1B00A 3NORA 2H1FA 2M6LA 1G9XA 3UFXA 3EHDA 2EW2A 1SFRA 1UDRA 2Z2ZA 5BWCA 2NADA 4PLYA 2DPHA 2IGTA 3AJAA 3HUFA 4JUCA 3Q41A 3Q0TA 2IXGA 1H5NA 1DKOA 2WJIA 4OQYA 2XUKA 3W4KA 1YBHA 4LIPD 2XHEA 4OBEA 5AH0A 5TEVA 3T1VA 3U4QB 3DLBA 3HDQA 1MDFA 3T7TA 5BQPA 1I13A 4Z4IA 3HEMA 2QTAA 3BWVA 3O6VA 1HA3A 1KJWA 1VP3A 2ZJ4A 3KIPA 3WGOA 1HFWA 4MAMA 4ZHQF 4Z9XA 5K0BA 3BT7A 3B70A 2VKQA 2PUFA 2ENUA 4K9DA 4C04A 2OZVA 3UT5A 4LRTB 1Y1KE 1EUCB 3KOYA 3G5AA 5EXPA 1VMKA 2GSWA 4U7HA 2XEDA 4JQSA 2RCYA 1NXQA 3WTBA 4EVSA 1PFYA 5CEJA 3MS2A 2NVWA 3EZ6A 4D9MA 5KNLA 5BWOA 1XOIA 1WM1A 1Z2DA 3A70A 3HXPA 2YASA 5FOUA 3V1YA 4BU0A 1E2EA 3L84A 2ZYWX 3NANA 3KXLA 1M1YA 4Q1FA 4FR5A 5AHRA 2EZTA 1LPBB 1K66A 3HJGA 3ZZ1A 2ODEA 3R3SA 2GK7A 1P7WA 3JD0A 3FBTA 2XUAA 1UMCB 1E98A 1F9AA 1Z2AA 5TQ0B 5AFSA 1XX6A 4JJAA 2RHOA 4NDNE 5AI5A 2JJ2D 4AX8A 2X0JA 3FH0A 4AY2A 1YJ5A 4WUVA 2XMRA 2O3UA 2F7SA 3V42A 1GPKA 1QHHA 4CT4B 2OMEA 2PS3A 1C9MA 1SEVA 2LTAA 1T91A 4F56A 4YVFA 3CUWA 2WVHA 5TQ2B 2P3SA 3K9NA 3I09A 4UOQA 3TW0A 2GZSA 4DZRA 1Q77A 3BRWD 4C21A 1HTTA 3EIXA 1E79A 2TMYA 3IUPA 5C34B 1X80B 2J5XA 4OYHA 4D9EA 5LB2A 1JYEA 3Q8MA 3N8GA 1R16A 3QEJA 3NT2A 4R54A 1G2PA 1Y81A 3B36A 3HCWA 3JAKA 2DWCA 3ONEA 1SUSA 3PS9A 2IUUA 4LMAA 4MGKR 4KI0A 5CP8A 4NOJA 2Z1MA 4JI7B 2Z2KA 3HQ4O 3RAJA 3RVMA 4FYHA 2FRXA 4HYYA 1BRTA 3HMKA 4YREA 3NI2A 3KD2A 2ZRQA 1BA2A 2PBLA 1T9DA 3OJWA 3JQ7A 2I2AA 2A0XA 4X1YA 2BCEA 4JQOA 2V97A 4OLJA 2Q99A 2H2HA 5AWFC 5JFTA 5LDDC 4HRAA 2HX1A 2YHUA 4MUYA 5G02A 1A9XB 3M4NA 3TR6A 4TRRA 4GOND 3O7WA 5CIYA 3BXOA 3CMCO 4E5YA 3KO8A 5AW0A 3KQKA 1XTQA 4CHTA 2HEIA 2QQEA 4KQXA 4GECA 4UREA 4YJHA 4I5EA 4UUBA 3UYKA 5IBPA 1NNUA 2LKCA 4IJ5A 2HF7A 5AJTA 3OE1A 3H9UA 5D7BA 3H9CA 3FWKA 5ELXA 2QW0X 3DLCA 1J2EA 3L1IA 2RGBA 3OQ1A 1OGJA 2YNMC 2CEKA 3L7MA 3ZWQA 4IFEA 4CG0A 1G1AA 1AS3A 4GSYA 1W1IA 1P0IA 3PJEA 3G23A 4BS9A 3B7WA 3M3HA 2GN0A 5AO9A 4O1IA 2A1UA 4LI0A 4BLRA 5LQMA 3OFKA 4ZVNA 3SF8A 1V41E 4N49A 4PX5A 4Z0NA 5KKNB 1PIWA 2MSDB 2GLTA 1L5KA 4CETA 1E77A 3D59A 4D5EA 3UWSA 4QTXA 2KB0A 1TZ2A 4MWZA 3DZ8A 3WADA 3K70D 3F97A 2OV8A 1ZMOA 2UZ3A 4R40A 4LF9B 3PQDA 5BVHB 5REQA 4MW0A 1UPUA 2AOWA 3UWDA 2AW5A 1OGIA 3NXSA 5E8RA 2C4VA 3BPSA 1JLMA 5EWMB 2J0VA 2GZRA 2CK3D 3H8SA 4PPGA 3OP1A 2G82A 1QGUA 1VL1A 3LC7O 2QX8A 2O05A 2GHQA 1CDEA 3K5IA 2FP3A 3IT1A 1V7ZA 3SBOA 1WVGA 5CIWA 1XTTA 3AF2A 4OQLA 3M3DA 1ADYA 4XLZA 3ZHOA 5ADVA 3QI7A 3WK9A 3QJ5A 1TK2A 3WWDA 5GV8A 3CLKA 3GK3A 3SHOA 1VI6A 3HPRA 3S8EA 4CI9A 3KHUA 3W1WA 4HWRA 2ADMA 1FEZA 5BR1A 3DE7X 2IV7A 2VUUA 2W0SA 3ZY6A 4K46A 1V16B 3IT3A 3QKTA 3DCIA 1KEUA 1IMOA 2H07A 4Y1RA 2HCJB 1V5FA 1JIVA 5AR1A 4QOJA 3K1AB 4BC0A 5C7OO 2AEMA 5EP1A 1H1DA 4EX7A 4LQCA 4RLSA 5DTJA 3T3DA 1B23P 4RADA 1TF7A 3WIUA 3EEBA 3LHIA 3TMKA 5KHLB 4KN8A 2GJ9A 3M89A 1BOFA 4HLQB 5IVPA 4X85A 3F1LA 1VG0B 4US1R 1PE0A 1N5MA 3IJ5A 1Q14A 3NRJA 1QANA 3KLMX 1VBNA 3LT2A 4M9RA 4XDGA 4Z9FA 2WHYA 3NT5A 3SFTA 2XDYA 3OWHA 5C52B 3I6IA 5AT1A 1JDBB 4MA5A 4Q48A 2P3QA 1G21B 3RQIA 5DI3A 3A9WA 4EI7A 1H8EA 1Z62A 4WEQA 4M7RA 3RSQA 2J09A 3JQQA 1XP5A 2GJKA 3BD8A 2QPOA 1BH2A 3JTMA 1J1IA 3OOWA 3DZCA 1GXSB 1V5EA 3LPMA 4QQRA 3A25A 1VFPA 3VC2A 3WWEA 1FJGB 2ODPA 4OLAA 3H4VA 4ZOLF 4DT1B 2V6JA 5I9SA 3GJ4A 3GEMA 4A8JA 5A5EA 1QHNA 1PJ8A 2JL1A 4QJIA 1NQTA 4L4UA 3LF1A 1S1CA 2O5CA 5U4QA 1QDEA 1SRQA 2EF0A 1C2TA 1LPNA 1Z4QA 2VP6A 1QOPB 3G1UA 3FF4A 1Z5NA 3VYTB 3SVLA 1VHQA 1QVWA 2R65A 5BYBA 5LDGA 3KJXA 3QBEA 3RSLA 3NUQA 2VWGA 2HPAA 3BCRA 3ONFA 2YX1A 1Z8FA 1Z4KA 5B55A 3CLHA 3CCFA 2B25A 2DR3A 2F67A 2C4NA 3OPNA 4IZOA 5LA6F 4DMGA 2B5OA 1HE3A 4P5PA 5KTNA 2AJ8A 3AKYA 4PO3X 3RHFA 2GVZC 1MAVA 2HHJA 4B6SA 4I4IA 2PU7A 3SYTA 1BKSB 4LDJA 2JIQA 1BROA 1N78A 4JC4A 1AUQA 3L0IB 5J4LA 4IDOA 2H4HA 3VX4A 2AS0A 2FFRA 2UZIR 4KXVA 5KX5B 4EY6A 5J1SB 1K86A 4MX8A 2H5JA 2JFXA 3DBVO 3GJYA 1K5HA 5JSYA 2G25A 3SCZA 3PUKA 4AZ3A 2QVGA 1ORTA 3HXQA 1B43A 1GQ2A 1O3YA 1W88A 1NF2A 3LC1O 3IDQA 5LZ4A 2GAAA 4KPUA 421PA 1G19A 5A5FA 1KMHA 4HNUA 4EUEA 2DWOA 1E6CA 3MTIA 3K3PA 3LQ2A 1E1NA 4L0MA 4RHTA 2VP9A 4WXMA 4ALLA 1U3WA 5IJ0A 3H83A 1GEEA 3WP1B 5JRZA 1AO0A 4WSOA 4YA6A 4RO0A 5LR6A 1Y3FE 2Q4BA 3JQRA 4QODA 4HAZA 5F33A 4JCCA 2QJRA 4B7ZA 4ZEVA 1AU9A 1E60A 2ZRMA 4MWSA 4GH5A 1K6MA 2KSQA 3QNMA 3PWTA 1M33A 4YMLA 3QFHA 1N8SA 3PNVA 2GKGA 2QD2A 1UWVA 3DAGA 1M6VA 2ZRBA 3SLKA 2INGX 1M6YA 4EUHA 2XCQA 3L92A 4L6AA 4AO8A 5JI2E 3PDUA 2HL6A 2HRCA 4NCHA 5ERGB 5LZ5A 4ZTBA 4G0WA 1K8RA 3ESCA 4HP8A 2CWWA 2MYTA 1PX2A 3WKBA 3KPVA 2FQQA 2J6BA 2Q6TA 1TCBA 1FFYA 4O1MA 5JO0A 3S68A 4MGZR 3NU1A 3JTEA 1WDMA 3U26A 3ZWCA 1P75A 3B5JA 1RBYA 2BMVA 4XX1A 3KSMA 4ZO8A 5FL7D 4EF6A 4ALMA 1GQOA 3I61A 2O8EA 5CYGA 5JARA 3UXYA 2BD0A 3X1ZA 2F43B 4E21A 3IE1A 1KSHA 4OU4A 2VRBA 1ZAKA 2IKQA 4CQLB 5LC1A 5IARA 4BNTA 4FUTA 2QR5A 2J07A 5JC8A 1KBOA 4HFMA 4NLLA 3WR5A 1U1GA 2ZG6A 3IP5A 1GAXA 4E12A 1DQPA 4UMEA 5IDWA 1IK4A 3IEPA 4QYIA 4DCCA 1XWFA 1KIFA 2DWQA 2FZKA 4XPIA 2L42A 5JT1A 4ABYA 1JLKA 3LSTA 4Q9KA 1D6NA 1P3JA 1Q17A 4CL0A 4ECAA 1L5VA 3TZKA 4GL4A 3DL4A 5MN6A 2GCPA 3LP6A 1ZHHA 2PWAA 1I2DA 4E3ZA 2PSSA 3N39C 4ME6A 3QWFA 1NW6A 1PT8A 5IH3A 4NFHA 5DGCA 1OH8A 4D0NA 5EZYB 3RYHA 4DJTA 3G59A 4YBZA 1E2LA 3LA6A 3CVWA 4WZBB 2EJVA 2JGKA 1DJNA 3ISTA 1RAEA 1CY2A 4INJA 2QYSA 1K6IA 2YZNA 4FKZA 1ODFA 2H0AA 3PHLA 4AD8A 2RB4A 1GGMA 2JGEA 1I1OA 2J1LA 4P31A 3TTSA 4I9HA 2PEZA 5JJBA 4EEZA 5I9BA 3W5SA 4TLEA 4PCAA 1Q0SA 1LZLA 1KYYA 4IJKA 3ZQJA 1KDTA 3N0WA 3UJHA 2WT9A 5GJVC 3K31A 1ZUHA 3F6SA 1E9RA 3JSXA 3RW9A 1OXSC 1SBQA 4H7IA 4JP2A 3RAPR 2B7LA 4AS2A 1UBMS 1Y33E 3UOGA 2Q6KA 2O57A 1EE1A 3WOHA 1OY1A 4Y2GA 1KHTA 3NHSA 3VISA 5KOJB 3T5GA 4P33A 4XQEA 3W5CA 5LCXA 4F71A 3ESZA 3FHJA 2OORC 3JQAA 5SY6A 5FBKA 3S81A 1G0NA 3PFKA 4BBZA 1NLZA 3MMZA 2ZUTA 3GHHA 3MUEA 4DLYA 4OHMA 5SYNA 5HFJA 2VDOB 3P7MA 2FPRA 4MWOA 3DXZA 1T0PA 3ZDYB 1JTVA 3TGPA 1M8KA 1YOBA 2BV3A 1SD2A 1Z82A 3C3XA 4RQBA 5KB3A 1YAJA 1ZH6A 2ZSBA 3CZAA 1BGVA 3CX8A 4AFNA 1PJ3A 2I67A 3TTYA 2VN8A 4ESHA 2AUMA 2M98A 2VDMB 2C7PA 4LMPA 2GBGA 2VXYA 1EAMA 1Z45A 2H3EA 5FULA 5IKMA 5LKRA 3LQFA 3T1HB 3ZLJA 1B0PA 1KJNA 1EINA 1PGJA 1W8IA 2YW9A 4R7ZA 5CVUA 3SIXA 4B71A 4D92A 4PC3A 3JATA 5ALEA 4Q3KA 4WESA 4B80A 3K09C 1SVUA 4RA6A 2MSCB 3MW8A 3LECA 1KO8A 5EG5A 2NW6A 3DFIA 1T1RA 3QG1A 4UOZA 4JLOA 3ZJYA 5J4VA 1EX6A 1E7WA 2FKAA 5JQGB 4DW8A 4CEJB 2OBXA 4JN6B 3OAAD 5IKPA 3F4KA 2H57A 4KPYA 1Q2XA 2JIBA 4FE4A 4Y9SA 1YBFA 4MVJI 2C3PA 2X7JA 1E9BA 4KXFB 1OV6A 3A3NA 1F2VA 3EGOA 1UKVY 4D8XA 3LA8A 3ZD9A 4X65B 1OAKA 4FMPA 3W8DA 3GT3A 2NSDA 3KPWA 5SV2A 5KWVA 4MPRA 1AS2A 1PVDA 4U7TB 4CIVA 3TF5A 1Y5NA 2XVXA 3E7DA 3G0HA 2UXCB 1DAHA 3BFVA 1JALA 4ITVA 5AP9A 1DJMA 4PIPA 121PA 4ARZA 3F71A 1FX0B 3FXAA 3U62A 3R7FA 2ZBDA 1EJBA 3GHYA 2FR0A 4TWAA 5B1EA 2H4YA 3RSCA 1G4HA 5I7FA 2Q1SA 3RS0A 4RZXA 3EIEA 1TGVA 5CIQA 2AQKA 3ABOB 4QYXA 2IOFK 2WWIA 1U4SA 4V2IA