2H5IA

Crystal structure of caspase-3 with inhibitor ac-devd-cho
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
146
structure length
146
Chain Sequence
b'SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords caspase-3, p17 subunit
publication title Structural and kinetic analysis of caspase-3 reveals role for s5 binding site in substrate recognition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 49
structure length 146
sequence length 146
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2006-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2h5iA00
2XZTA 2XYHA 3V3KA 4AW9A 3H13A 4PS0A 1M72A 1RWOA 1RWMA 1SC4A 1QTNA 2HBZA 2QL5A 4ZVRA 5I9BA 3R7NA 4NOJA 4JB8A 4EHAA 3V4OA 3PD1A 2J32A 1RHKA 1RWVA 1IBCA 2QL7A 5LU9A 2CJXA 1I51A 3E4CA 4QUHA 4ZVOA 3D6MA 5K20A 2J30A 3H0EA 4NBNA 1K86A 2AR9A 5H0IA 5IARA 3PCXA 5IAJA 2Y0BA 1RHJA 2H4WA 4JJ7A 4QUGA 3UO8B 1I3OA 1RWXA 4FXOA 4D3XA 1SC1A 3V6LA 2WDPA 2DKOA 4QU5A 2CNOA 4QU9A 5IAGA 3R7BA 2CDRA 2C1EA 3R6LA 5IASA 4NBKA 2NN3C 4EHLA 1K88A 5JFTA 4M9RA 4ZVQA 5IAEA 3DEHA 3NS7A 4JJEA 4PS1A 4N6OA 5LU8A 4AWBA 1JXQA 3KJNA 4QUAA 1SHJA 1NMEA 2H51A 3GJQA 4HQ0A 1RHMA 4JQZA 1PAUA 3NR2A 4QUJA 4EHDA 4I1RA 3KJFA 4ZVSA 1RHRA 2QLBA 3DEJA 3P4UA 3V55A 1NMQA 4N6GA 3SIPA 4EJFA 1RWPA 2H65A 4N6NA 4EHHA 3PD0A 5IBCA 4N7JA 5I9TA 3H11A 2CNKA 1GQFA 3GJRA 2FQQA 2P2CA 3K7EA 4AWAA 1SHLA 3RJMA 5IBRA 1QDUA 4JR1A 3R7SA 2QLJA 1KMCA 4D3YA 4NOMA 4EHKA 1F1JA 4DCJA 3EDRA 4N5DA 5IBPA 2CJYA 3DEKA 1CVRA 4FGUA 2HBQA 4QUDA 4QTYA 1PYOA 1I4EB 2C2MA 3OD5A 4HQRA 2H54A 2H5JA 3H11B 3BIJA 1I4OA 4N7MA 1RWWA 4NBLA 4QULA 4JQYA 3S8EA 1QX3A 1RE1A 4JR0A 2J33A 5IC4A 2XYPA 1GFWA 4ZVTA 3KJQA 4NOLA 2H5IA 3P45A 2CNLA 3D6FA 3IBFA 3UOAB 2C2OA 4JR2A 3V6MA 1BMQA 4EHFA 4DCPA 4IEFB 4QTXA 3D6HA 2C2KA 4HVAA 4ZVPA 4EHNA 2J31A 1NW9B 2HBYA 2H4YA 3DEIA 3IBCA 4IYRA 4ZVUA 4PRZA 1F9EA 2QLFA 3R5JA 3SIRA 2FUNB 3R5KA 2HBRA 3EDQA 2H48A 4QU0A 1RWKA 3GJSA 4DCOA 1CP3A 4QUBA 2QL9A 4NOKA 1NMSA 5LUBA 3S70A 3V4LA 1RWNA 3NKFA 3ITNA 4LSZA 2CNNA 5IAKA 4QUIA 5IABA 5LUAA 3GJTA 4FDLA 4I1PA 4QUEA 2Y1LA 5IANA 1RHUA 2XZDA 3R6GA 2XYGA 3QNWA 1SC3A 2C2ZA 4JJ8A 4QU8A 3H1PA 4PRYA 4FEAA 4D3ZA 5IC6A 2K7ZA 2FP3A 1ICEA 1RHQA
chains in the Genus database with same CATH superfamily
2P4QA 1JH8A 3GD7A 1ONNA 1JWBB 1W8IA 3PFIA 4AQDA 3URMA 4TTVA 1ORIA 1U3CA 4AFNA 5IYZA 4I50F 1GEEA 3GUVA 4IIEA 4TRNA 3VR2A 1DO8A 2YMMA 1FRQA 1T9DA 3GLKA 3KFVA 1RHKA 4UUBA 5FPHA 4WQMA 2IYZA 5EKTA 2GNPA 1DWPA 1RP1A 4UFOA 4P7KA 2WT8A 3SXJA 4NAUA 1K3FA 3TXAA 1SELA 3ZBTA 5TLSA 2BFFB 3SDZA 2HDWA 1PX0A 4DV6B 5THQA 3MFYA 2Q6KA 4X45A 2DKOA 1DI0A 2IVFA 1WZNA 3SQXA 1D2EA 4JVMA 1T1IA 5AJTA 13PKA 1XRRA 1J39A 1NI5A 1RYNA 3TL3A 4B4UA 1YAHA 1QRSA 2HW8A 3PJFA 3W6NA 4J4BA 4QGBA 2PE5A 4U5QA 2YJ5A 4OLBA 3KE9A 2AK3A 3BFJA 5BMVB 3I9V1 2O07A 1U2TA 4I5IA 3AM5A 2YWFA 3MS2A 1UBNA 4M1EA 4R8LA 2X8JB 4O2LA 5DLQC 1Z8FA 3V80A 1RDFA 4BX8A 2OVBA 1G7CA 3JCZA 4N3CA 3L1HA 3RSLA 4C5AA 1ODJA 3CHYA 3WFJA 1J99A 4JUCA 2C7RA 5DGHA 3WHKA 2YOGA 2PZBA 3VGPA 2XWSA 2QV7A 1KP9A 5B6JA 4NMWA 2GH1A 1OXUA 1KEKA 1H4TA 4HSGA 1KYQA 5EP3A 3KQNA 4A16A 3ELBA 1CDOA 1NJ8A 4TLCA 1SG0A 1E5XA 3T12A 3EMVA 1WW2A 3M6AA 5CXQA 5JCXA 4K3UA 3HY3A 2PMFA 3LW7A 2WPNA 2HLDA 2FFAA 3ITDA 2WM3A 5DO9A 1EA5A 4BQPA 4EA7A 3VYRB 4ENQA 1X1CA 4RULA 1G3MA 2GX6A 4J91A 4JJKA 1T1JA 2V7UA 1NSFA 5F5XA 5FOXA 1VL6A 2IY9A 3U3MA 3DGEC 1CT9A 1KU0A 1NATA 4JYCA 3UW3A 1DC7A 1Q16A 4A2WA 5LQCA 1XJWA 5ENVA 5F21A 2BFEB 2R8ZA 4BS9A 4MZDA 1P6XA 3ESDA 1O6CA 2VG8A 1T1GA 3JAWB 4AYWA 1UC9A 4DMRA 1I33A 2BDEA 4RIGA 3H1EA 4YCSA 1KWGA 1VP3A 4KN9S 3ZY3A 4S2EA 5FL7D 3OT1B 3JWGA 4DGSA 3NM6B 4B17A 2YV2A 2B7LA 2I6TA 4MB2A 3RVOA 3L43A 2ZJ3A 4DQXA 4QVKA 1KK0A 4JT9A 2QVCA 2I0FA 4ZCRA 1FSSA 1OX4A 2X8LA 2WTNA 3O93A 3K9BA 3GLIE 2R97A 4ON9A 5C2JB 5KTSA 5FIUA 4B3GA 2W8BB 5HILA 1RAHA 5C7OO 3PRHA 3PFCA 4PINA 2G3YA 2ON6A 2VPWA 3QNWA 4PGGA 1R0XA 4EPRA 1DEXA 1WE2A 3DV0B 3OPNA 3N2GB 1UBCA 3HVJA 4FOOA 1KH1A 3SZ3A 1M8GA 5KYWB 1GZDA 2WFMA 3QKTA 2XADA 1C80A 1IG3A 1L5SA 1SULA 3NBQA 2ZRFA 5A3SA 4CT0A 5IT4A 1P5RA 3FMPB 1OV6A 3DOEA 5I9BA 4XGNA 5BOSA 3TLJA 1E7YA 2EXXA 3DP7A 4IFIA 1JDTA 3NGMA 4UTRA 4DKJA 1FJGB 4C7OB 1FC0A 1TZKA 4FR2A 2NADA 2MT9A 1XDBA 1BFKA 2CJXA 2IHNA 3FNGA 2WTUA 4PW0A 2IYUA 4KK3A 4DLLA 4KIWA 1NAIA 1I1HA 4KQEA 4D9GA 5DCLA 4EFKA 1YQWA 3W77A 5D1HA 1SCNE 2NYRA 2ZIWB 4YMUA 1O8BA 4GPEA 2FUG6 2V3WA 4GW3A 1YC2A 3HJHA 1SVUA 3VH4A 3B6IA 1JEYA 3FDZB 4KYUA 2NUPB 1YHNA 5CA1F 5KYYA 4CXMA 1MVOA 4OKIA 4BX9A 1TCAA 3PQ7A 3REOA 3WRXC 5LLDA 4U2GA 2AG0A 1TZ2A 4UTZA 1QCZA 1WULS 4C7MA 2OHJA 1J07A 2H00A 2I62A 2EW8A 2XDAA 1M2GA 3LLCA 4ZEXA 3S4YA 5C7LO 2ZRIA 5KREA 3W3AD 5CFLA 1KFBB 2PX5A 4KXXA 2ZETA 1W88B 2C2GA 2FQ1A 1KF0A 2FWMX 4JB3A 4KX3A 1BKDR 4QUJA 3PTLA 2CLMB 1L4LA 1FX1A 4F4JA 2LCIA 1MT3A 3OICA 2B0CA 3P9CA 5FUQA 5TQJA 5L4SA 1ADBA 3RVMA 4TKMA 3T5MA 3W5UA 1Y6RA 2GYWA 4YAFA 2GD2A 4YRRA 1K8ZB 3V7WA 1YRQA 1CUHA 5B64A 3W1EA 1JE0A 4C6RA 4ND7A 1IE3A 1G8PA 1IMOA 1RMQA 1HZZC 2H9IA 3S5UA 2QRPA 4TRMA 4UU1A 2OEPA 3RJMA 4EB6B 2QW8A 1ZRNA 1DG3A 4EWLA 4UVDA 3LIPA 4J0DA 3OIYA 4IJKA 4BAGA 1FU8A 3QBVA 3CKMA 2ZVJA 3RS7A 4MUJA 2QMOA 3U7QA 4IINA 4LGMA 4UNIA 4QARA 1A5ZA 1YR3A 4D42A 3O6VA 1YSCA 3QU4A 2A58A 2AFRA 2DE0X 1DNPA 3BQMB 2XJ4A 4J07A 3RHTA 3P52A 3UAOA 5I3ZA 3CCBA 1KYIA 3CKKA 3WG9A 1ZI8A 2FSIA 3V1NA 4NK5A 1P1RA 3JASB 1PJ2A 3ENQA 1J5PA 1M5RA 2ZAMA 4TTSA 4XGIA 3AQIA 2GLTA 4NJOA 3TI7A 3GAZA 1C0KA 4AO7A 5CDTA 2O2HA 3IBYA 2OV3A 5ALEA 4H3KB 2VOEA 3TQSA 4EMUA 1EUYA 1R3DA 2XBMA 2AUTA 2O1XA 4CM8B 2FUNB 3R5KA 4LJ4A 2C94A 3M1AA 1PE0A 1F8FA 1NGSA 3VR5H 4HDKA 4DCVA 4B3JA 2EZ8A 2IEGA 3K5IA 5AQ1A 5DGIA 1XTVA 1BXRA 3PR2B 2PL5A 2FWAA 4UHDA 2E37A 4AF6A 4J1NA 1O5IA 1EHYA 1WXFA 3SQWA 1KO4A 2Z1DA 2C03A 2WNIA 2YFKA 4H7HA 4KWIA 3UIEA 2IYXA 3F7NA 1B42A 3PNSA 2OE2A 4LJ8A 2WHPA 4MKHA 5IHXA 1V7PC 1VIDA 3VOSA 2NTNA 4BO5A 4PICA 3PFWO 1MBZA 2UZ0A 4D79A 3R24A 4MMYB 3VA7A 3G02A 3AF4A 2VQ6A 3R3WA 2VYND 4UMFA 4IGKA 2GCOB 1CQJA 1VKZA 2J6HA 4D4MA 4UTPA 5BYJA 4ABTA 4E5DA 3U4QA 5CBKA 1YQTA 4YS6A 2X23A 2Y99A 1HDZA 5ALDA 2KLBA 4ER5A 3AFHA 1IPEA 3TLEA 1H85A 3MTIA 5HKKA 1DXHA 4MI3A 3FD8A 2J5KA 2Q1TA 1UMCB 2XOXA 3LDGA 5B7QA 1ONSA 4LV5B 2LZ0A 4TSFD 2QL7A 1Z4KA 1FXWA 4HQLA 4TZ6A 4KXVA 3N0RA 4FZRA 4RVDA 2GF0A 4CTMA 3WWCA 2QF7A 1O94D 3WK9A 1DOZA 2A78A 1ZD9A 4UULA 3C1OA 1W85A 3H9BA 3S0JA 1X7HA 5ALIA 4MUEA 1J4AA 2AQKA 3GO4A 4JYMA 4HZUB 1KVSA 3G89A 5F52A 3QEBZ 1LPPA 1S3IA 2ZRCA 5LOVA 2MSLA 2HD4A 1P1IA 1CQIA 2BDTA 2JHPA 2PTGA 2W2KA 3EFBA 3L7CA 3I9MA 5FLEX 3ORRA 4MHOA 2XXAA 3RUEA 1NOKA 3QF4A 3S1AB 5FHQA 2C29D 4L7QA 2PXAA 2DHEA 3ZC3A 2YQ5A 4S0ZA 3L7MA 1SOWA 1N2JA 2VP0A 1AB6A 1GYRA 3G1TA 3O8DA 4LC1A 3VR6A 4IDFA 3IFSA 3PGKA 3SX0A 2ODTX 4CF6A 1G8JA 5LR6A 2FKNA 4FT4A 4B87A 3FJYA 2V1UA 1YZQA 1TADA 3DZJA 3O1IC 4M54A 3WL8A 3M9WA 3QXSA 1UUFA 1FPQA 2A33A 2ZRPA 5EYPB 1GU1A 2RG7A 3HL0A 4NV1A 4XWYA 1MVLA 2W0MA 2IYVA 4AS2A 2P0EA 2ZI5A 4JR1A 3WHIA 4WBSA 3HG7A 3OPYB 4Y2JA 4OHFA 5SY4A 1T9ZA 2ZCJA 1Z17A 5E4TA 3RE1A 2DG2A 1SVLA 4HN2A 3TLCA 1EGQA 1P74A 2OCDA 2Z43A 5C35A 5EC8A 1S01A 1VSTA 3ILSA 4LPKA 3NW9A 4REQA 4Y0VA 4A10A 4C0WA 3PFHA 3UAXA 4R6WA 1HE2A 1AM4D 2X9QA 5CEEA 4BB9A 3NB0A 4ICIA 5BQXA 2PX6A 3JVUA 5A62A 1NASA 2GJAA 3BL5A 1J06A 1MXHA 2IXFA 1CY0A 5ICEA 4IEFB 5KSZA 1IPHA 2FX3A 2NZ2A 2P2DA 1ZJ4A 2UDPA 3UMJA 5EAIA 1WXHA 3C5HA 4A0HA 1CPYA 1J8QA 1ACLA 1MABA 2OBYA 3H5NA 1MX1A 1Q3KA 4ME6A 4Q9DA 4QXAA 3A1TA 1XN1A 5LMZA 4RJLA 2EBFX 4JUAA 1KXJA 3GLFE 3FFAA 4PZEA 2EGHA 4JVLA 5ELXA 4FOSA 1J23A 1Z0FA 4RHYA 1C7FA 2R6CA 4NKRA 3WL5A 4FMDB 1VE1A 3DM9B 4Y9UA 3RUAA 4C78A 1L9KA 4IDHA 2PGOA 2EZUA 2P9QA 3LFTA 4F96A 3A2KA 2MYUA 3KOWA 3OKAA 1D4ZA 1C8KA 2QRUA 2AH5A 1YQQA 2SHKA 2MU1A 3AVQA 2CUNA 1VIYA 1R9MA 3OF5A 1XGKA 3QNMA 3QTTA 4CL3A 1Z4IA 1SQ0A 1JF8A 3I37X 3AI1A 3ND9A 3S44A 3Q0EA 4LJ7A 1ZOIA 4K9DA 5HXAA 4CLOA 3CKLA 3RUDA 3K6SA 7MHTA 1LDGA 4WTOA 4UOQA 2QY6A 4B44A 3FETA 3EVBA 3W5AA 1DJMA 3AEKB 2Z6AA 1X7WA 3G9XA 3HN2A 2RGRA 1KQ3A 2P5YA 2RHJA 1DL5A 4UU8A 1M72A 4AP6A 1VIMA 5GV7A 1Y37A 3PHIA 4N0QA 3C3DA 1DAEA 3LRPA 4MNTA 1ZEJA 3KB6A 3KQOA 1N2BA 3NGXA 3ZDRA 2X4GA 1YQ9A 4TV9B 3VISA 4ZQEA 4OP2A 1EJ0A 4M3NA 3VRHA 3B60A 1PV4A 1XHEA 4LOAA 5HIIA 1L5NA 5CR9A 1XYVA 5MF6A 2P41A 3E22A 4HQKA 1K86A 2FUCA 4WCVA 1X80B 3KJIA 2R85A 5F77A 1B1CA 1OBCA 1PJCA 2JLRA 2BH2A 3EJWA 1CJUC 5KSOA 2I1QA 5BNFA 5C32A 3GLIA 3B3JA 4X8LA 1H2WA 1MIOB 1NYTA 2PUJA 4ILKA 2BP7B 2RDMA 4X6UA 2C1EA 1WF6A 1X0VA 3E9MA 4MQBA 5CLIA 3VI4B 3OWHA 4HPWA 5DISB 3UXEA 2Y1OA 3L8ZA 3QRWA 1K7YA 4BQOA 2CXPA 1Q7BA 1ESZA 1AT1A 4MGKR 4WESB 3ZWXA 4DR3B 1GO2A 1XKXA 3SIXA 3KJNA 2XE4A 4W1SA 1QHEA 1QR2A 1Q83A 2Q0QA 2V4ZA 2AEMA 3LT4A 4J75A 4A23A 3IPYA 4EYQA 3KJFA 3K1AB 2X5XA 4BXOA 3UAWA 1XBTA 3HXMA 4RAQA 3ZJTA 1UJ6A 2W58A 2SCUA 4KI7A 1P3JA 4DQVA 4ZHQA 1JJBA 1X15A 1QGYA 4QG3A 1FNBA 5LP6C 1GQFA 3OM9A 1QIDA 4IVNA 1SBYA 1K5DA 1Q74A 4IJMA 4QGGA 4MQEA 5DM60 3DT8A 4ZU6X 3AVTA 2WSYB 1XEXA 5TARA 4MA5A 2J0UB 2JGRA 3FWPA 3BM5A 5KVQA 1M2OB 3SDBA 1ILWA 1V37A 2ZJYA 4GF5A 2HK9A 1EVKA 2XYQA 3BE5A 4D0SA 4JC5A 4TWAA 1NG1A 1X8JA 3B1FA 4FU0A 1I4OA 1S2LA 2PBZA 1VHTA 2WZQA 3LX8A 4QD3A 2VR1A 4QJ5A 3W90A 1J2EA 1EYZA 2GJSA 3MCZA 4YCDA 1I10A 2R2AA 2G1KA 3OQVA 1YKSA 3NKLA 4WFJA 3C1AA 4PZPA 1LBQA 1QX4A 4EQZA 2PS3A 3DG9A 1JTFA 2O19A 1C8BA 5F2KA 1LDBA 3ZQUA 1UMBB 2V7PA 2BFOA 2C2KA 2IEBA 5KNBA 3R3HA 3DHEA 1F6BA 1TU0A 4GSLA 2OAP1 4HEHA 2GWRA 1P1KA 5AWFC 1CY7A 2MSNA 3PTAA 3CONA 1BYIA 1KIMA 1UMKA 4UTOA 5DRYA 3RAJA 3I6IA 4IKPA 1DXYA 2Q7OE 4KB5A 5AW8A 1ZNZA 4UM7A 5AI5A 2GZ1A 2HXSA 2WLTA 2XCOA 2O2GA 3I23A 1R6VA 3DMRA 3W6UA 2ZJ0A 3BE6A 3U16A 2UXBB 3DYIA 3DUWA 3RTCA 4POOA 1A7UA 1K63A 2WUGA 3Q6IA 1E8NA 1GPLA 2OQIA 4LWOA 3S2EA 3P71T 4RXTA 2OBFA 2CKDA 1LTHR 3SFVA 2ID9A 5K0JA 1YGPA 5BSUA 4H1UA 4TVOA 3G13A 2AEJA 5JAMA 4JC0A 1QFSA 3PX3A 2DLDA 1UJ2A 1G6KA 2HPAA 3FLBA 2H2AA 3GUHA 3LHSA 1PHRA 5C8YF 1ZVVA 5KI6A 1RI5A 3DLIA 3ENVA 3KTOA 2D5LA 1RQPA 4J6FA 1CJTC 4EHAA 3NAGA 5GIPE 2JCBA 3IE0A 5KNCH 3S6JA 5ANRB 4AJIA 3K72B 4KMMA 2B8JA 1QIEA 4X6YA 5JJBA 1RRFA 1P4SA 2UUOA 1A82A 2I4NA 4P33A 3ZGNA 2P75A 3TSZA 2D7DA 2JFWA 5CVJA 1J5XA 2XWQA 4BBZA 4ECEA 3F6SA 2G80A 5L9AA 2W6IA 4DY6A 1C1YA 2HNKA 4HGNA 5J59A 3CZ5A 3HS3A 4GFDA 4RFLA 4S1TA 4YAOA 3BOSA 2IZ1A 4HN9A 1DO0A 1KI4A 5H81A 5CLJA 1ZVQA 2FG7C 5GZ6A 3U9TA 2BSAA 2XLCA 2PLRA 5HOQA 1YMUA 3LF1A 4DR5B 1J97A 1TE2A 5F7JA 4E14A 3H4VA 3ROMA 3HO8A 2KM1A 4WN3A 1HDRA 3GEIA 4B2PA 4C87A 1IH8A 4BO7A 4Z4FA 2CGEA 3KUUA 3EXIB 5AK3A 5EPUA 5FBWB 5AVVA 3UMYA 3IB6A 4DJEC 4V0OA 4GYKA 4Y7CA 3NIWA 4KPEC 4PO9A 2DH5A 2Q41A 3R9XA 3IQZA 3ZQJA 3AMVA 5GIOE 1EUDB 3L1UA 3QYFA 4FM9A 1IQ0A 4XYBA 4GMDA 4YHHB 1LSJA 4OHMA 1YOVA 3TOZA 2QEQA 3D3NA 2FHSA 5CTJA 4XFDA 1L7DA 5FL7A 4W6QA 3AKZA 4XGQA 2YUTA 3N0WA 1CR0A 3Q3CA 4MUXA 4UM9D 2P40A 4J0KA 3VNRA 3OQIB 1M7BA 1X3SA 3FSRA 1FXUA 4MX8A 4L57A 3OD5A 2ECOA 2QGNA 4CGYA 1B00A 1EFHA 4JLAA 4AP5A 2DY1A 1BA3A 2PS1A 1E7RA 1PLLA 2ZZKA 3H87A 3HXPA 4G4SO 4HFNA 4ALMA 4ZEMA 4U6QA 1UT8A 4J1TC 3T7RA 5JEEA 1IHUA 4IIJA 2XVYA 3N53A 5FT9A 1GLVA 4F3RA 4G0VA 4EY3A 2E4UA 3ZXUB 5DU2A 3WZLA 4ZGBA 1XNQB 1CUXA 2OBMA 3EGOA 3RQSA 3BXFA 2HU8A 4HDRB 1SOUA 4MYCA 3EC7A 2H9AA 2Z5GA 4N82A 2QD5A 1CUIA 1PGQA 1LVUA 1YVEI 3GCWA 4HDNB 5CLQA 2O05A 1W76A 5G4KB 1H2FA 4MMXB 4KXLA 3WRXA 2GEVA 2YJ4A 5F1OA 4GX5A 2PK3A 1M1NA 4O2BB 3O3OB 4FIDA 5LZ5A 2PGDA 5CIWA 2OBNA 3DPIA 1DTSA 3I9KA 4Z8YA 4XVUA 1W6RA 2WAAA 2HFKA 5IFKA 3GA7A 3QV2A 4MVJM 2ILTA 2GEFA 1I36A 5D86A 3NAZA 1Z6XA 2XWBF 1YTLA 2GEUA 2BCGY 2OP1A 2IZ5A 1CDZA 1SBIA 3C16C 5DXFA 3OE4A 1PT5A 3DHVA 4BRSA 4L8VA 3C6KA 2CK3A 1NP3A 1P9LA 3DJFA 1XHLA 4I2VA 2C78A 3OT4A 5C53B 3KP1A 2UYCA 2UXDB 1HSOA 3E15A 3FVVA 4AY5A 5KJFA 4PBSA 2NTJA 4XA8A 2BGLA 3NEJA 3KQSA 3OQHA 1HZZA 3S8MA 1RJ9A 1GGHA 3UG6A 2BGRA 1F17A 2YVQA 2QM0A 1NN3A 2YWRA 3SE7A 3VV2A 2QZ4A 4PFQA 5BQOA 1UJBA 2Z9BA 1XMIA 1X1BA 4HGQA 3UFXB 3SBEA 2DBYA 4UTXA 4AZ3B 5K09A 1NL3A 2BRUC 2A1UB 1M5TA 2J45A 2FSVC 2ODPA 2QTFA 2QX8A 2Z4SA 2BZ0A 3AQ4A 1QE5A 4J2HA 4O4JB 3NVAA 1JG2A 3BJMA 3V2UA 1P6QA 3VPXA 3VSEA 5CB4F 2QX4A 1JR6A 4TGLA 2VSQA 1PSDA 5EP1A 2JZOA 2NXNA 4P6VF 3QBJA 4QLAA 4XM1A 1T5DX 3SVZA 1OW3B 2EZTA 9ABPA 2GILA 5E7IA 5JSKA 1UINA 1SVSA 4YA6A 3KDSE 2QJOA 1A7AA 2CFTA 4EHLA 1WHTA 4U8HA 2V6GA 3BB4A 3O38A 4L08A 1OT5A 3IVRA 2H29A 2HCTA 2R86A 2Y92A 1UK8A 4P2BA 4LYDA 3U4CA 2PKYX 4R9SA 2CDAA 3K30A 4IDDA 4BLQA 3JSXA 4ZAXA 1LBTA 4Y1EA 2V9PA 3ANSA 3L18A 2IGTA 4L5BA 3ISVA 2VYVA 3L77A 4P98A 1PV2A 1Y1SA 2BZGA 1Z16A 4PX9A 4YJFB 3FRJA 4R1OA 4XDZA 2WFLB 5JJLA 3HSYA 121PA 1KA9H 3KSRA 4LECA 2Y66A 5DTQA 1SBCA 1QDEA 4I8XA 2C2WA 3EFOB 4TL8A 3BIXA 2IYOA 3GEGA 4UHJA 1UBJS 4X91A 1ULBA 2E4VA 3IJRA 2A92A 4GBED 4HXYA 1YQUA 1M34E 4JOSA 7YASA 4C0AC 4AO6A 1XO1A 2PWZA 2RGNA 2WABA 3G85A 4K5QA 4KP7A 3FLEA 3UWMA 3GMDA 3H9GA 4MGYR 1HNXB 3V9PA 1VGRA 2H4JA 2ZTSA 2GBPA 5CPFA 5DM4A 3MBKA 1CJCA 2EL9A 2WUVA 3LHIA 4FC7A 1TF2A 2J33A 4GUAA 2Q3EA 3DBRA 3TLZA 3JSAA 4DYHA 1NJSA 2FMKA 3E5MA 1D0IA 1G5TA 1MP0A 4P7FA 3RVJA 5LYJB 2YICA 2Y8EA 4BLVA 2BL4A 5GAJA 1OI3A 4UEKA 1UCFA 4F71A 4LOLA 3W8NA 2FPGA 1XD2B 2OILA 4QYWA 4M98A 5CPBA 2C9YA 2VHXA 2BBSA 2J9XB 2VPIA 5HFNA 2HF7A 3L40A 4TWJA 3TZKA 4D8YA 1IN6A 2HQOA 4ONEA 3ZKAA 1A9QA 2JNWA 5IJ0A 1UOPA 2HXGA 1FJ2A 1S8OA 2IWRA 1T9GS 1V11B 4YK7A 2IU0A 5BSEA 3VU3A 1EIWA 3CLRD 3RLIA 3ZD7A 2G71A 4HEJA 4NOKA 5EGNA 3S2UA 2ZSUA 1P1CA 2IHVA 5FFMA 4A27A 2JJMA 3T34A 1UEIA 3PE3A 2A0FA 3ONWA 1B74A 2OL4A 1Q7RA 2JH3A 2RGCA 2E18A 2QRVB 3DDUA 3AUXA 3FNFA 1O4VA 4P5EA 3UCXA 2GPWA 2YN0A 3NT2A 5HRAA 4JLJA 2H31A 3OOSA 1EQUA 4DIKA 2QMQA 1J20A 2JFGA 3H6HA 1ISIA 2CCGA 1TMYA 4E5PA 4KSYA 2BHSA 1A5BB 2GZAA 3QMPA 3G2NA 2G0TA 4G5SA 2ZDQA 4MV6A 4MUHA 3MWDA 4O8CA 3O03A 4CN8A 2Z5LA 4CMGA 1M6VB 1PQ4A 1TT5B 2FR0A 1Z28A 2V7WA 3EIUA 3CLRC 4XJXA 4PS0A 4FFDA 3E1SA 4D0NA 4EVQA 3EVAA 4O1HA 2YWHA 5C31A 3EC1A 2GJ8A 3IXLA 1XU7A 3R20A 4P3NA 1N7JA 2WP8J 1X92A 3BRQA 3E9ZA 3U0BA 2K7FA 1IZ9A 2PGLA 2QBYB 2YZNA 1XP8A 3RJ9A 1TFRA 4YV1A 4LRSB 3GQVA 1POXA 1QVVA 3PF8A 2YHIB 2XQGA 3CRW1 4TYYA 1Y81A 1NY6A 2IPAB 3DE2X 5MFZA 1OH5A 5FEMA 5EVCA 5C46F 3HXQA 4G5XA 3HVRA 4HY3A 3PWSA 3AR3A 1IN7A 1D4AA 2Y0EA 3KYDA 5FOVA 2C42A 2V03A 1S96A 3RV3A 1DUIA 2X2PA 4WPGA 4R3NA 1DJPA 1RRVA 3TI9A 4ENVA 1L1EA 4AM8A 2GKSA 2QU8A 1L5FA 2QTTA 2QLNA 3R0IA 3USES 1CTQA 3OCJA 4TKVB 5JSZB 2WVAA 1J0AA 3LA8A 3PUZA 4G56A 5EJ7A 3IUJA 1G8YA 1US8A 4BL5A 8ADHA 4KDRA 4G97A 4QASA 1MH9A 3BCUA 4KGXA 5KYUA 3V1KA 2QRGA 1KSHA 2J3KA 1DQPA 3H6KA 1QWOA 3L8GA 4RACA 4AIIA 1PEKE 4QGHA 2D00A 3D4PA 4RSMA 4XVQA 2L2QA 3B9PA 3OO0A 4NATA 5B1YA 3VHLB 4LOJA 4TLMB 1SD1A 3A4MA 2R87A 3LC7O 3VZCA 3W8RA 3D7KA 5DT9A 3IP3A 1DAOA 1D9ZA 2L17A 4L7VA 3F3SA 3KHSA 5IWAB 1PNRA 5H3HA 3VPAA 2Q9UA 3WV5A 3FVTA 3O1HB 5CGQB 2Z6VA 3FTDA 3SYTA 3HK2A 2GM3A 3VTAA 3Q3JB 4BFZA 4CG3A 4TLLB 3KAPA 3R75A 4N7MA 2BFBB 3TL6A 1JLRA 3NAMA 4EG3A 1KVQA 3JV7A 3MJ4A 2WTEA 1GU7A 1CP2A 5DN6D 5BSGA 4IFBA 5FI0B 3CZAA 3NM4A 1NU6A 1F8XA 2F8TA 5IAOA 3VKFA 1AKYA 4DYDA 5J2UA 5ECYA 3BGWA 1NG9A 3L1IA 2BEUA 4WZAE 1VDZA 3QVWA 4C7BA 2TMKA 1L0BA 4FT2A 4YRSA 3O8OA 2XMGA 4H27A 1H66A 3V8RA 3K0AA 4MVCA 2FK8A 3IGFA 4I9HA 2H06A 2I1WA 2OESA 1JZSA 3BD7A 4Q7MB 2H17A 4KQ1A 2EX4A 1ZKMA 2ZRQA 3SJBA 4J0FA 4N0PA 1RXSA 1U80A 3CUTA 2NO4A 4M83A 1HY3A 1ICIA 2IQ5A 1XTUA 1V8FA 4KOEC 2NU9A 4KVGA 1FW8A 5CP8A 4PHFA 5HQJA 2AR7A 1Y3FE 3RH0A 3AY0A 3C6ZA 1H4QA 2ODQA 2OHVA 1E1KA 5JAZA 3GZNA 6AT1A 1EJBA 2QAJA 4GYWA 3G0DA 4YCCA 1G59A 1IN1A 4ZU3A 4XJSA 2Q3MA 3FTFA 3C3BA 2R6ZA 3BPSA 5A5DA 2AC2A 2K5UA 4OHCA 3Q0IA 1E9FA 3TTWA 1XTTA 4GNKA 4BMCA 5CFZA 5JNTA 3GPIA 3V7NA 2YYAA 3A3PA 4HDSA 5F78A 3K0SA 1PVDA 4RCYA 3GRUA 1FFHA 4RPJA 4TTPA 4Q9LA 3WGOA 2P2YA 2Z3ZA 3HE3A 3STTA 4EQ6B 4DXDA 2CNBA 2ZI3A 2P9FA 2RBEA 1OTYA 4UMDA 3ZVNA 1J0DA 3L49A 3ZE0B 3SC2B 2BAGA 3IRUA 4GR4A 4HQOA 4F72A 3LGAA 3RSGA 3JARA 1KO8A 2YR0A 1FUKA 3TOXA 5A4IS 1C30B 3I3SR 4J29A 1U1IA 1GCIA 1H0RA 4YT8A 5DW3A 4KREA 2UYHA 4FFRA 1KYVA 2J30A 3BRWA 1O96A 1Q1GA 3G8AA 1MC5A 5CFMA 3CISA 5G3ZA 1AZTA 4HO1X 4N03A 3OC0A 2JGKA 4W5JA 2ZM6B 1P0IA 5AXCA 4PPGA 1V25A 2Y93A 3WADA 4YRPA 4JI3B 1JHDA 5FBZA 1YBHA 3KQMA 2VKTA 4KAAA 3GPLA 2XY4A 4M9XA 1FYFA 1U0RA 4AURA 1E59A 3UQYS 4TS9A 2XGOA 4DG8A 1QE3A 5K0ZA 2ZZNA 3DAYA 2IUSA 2JS7A 3AU8A 4DR6B 1KSFX 2FRVA 2WSLA 4EX7A 1XRSB 2YRWA 2I2DA 4MJ7A 2HMVA 3PX7A 1FBNA 4HNAA 1WB5A 2DZDA 4C6HA 1JMVA 3E9DA 2V58A 1JFFA 1XI2A 4RH0A 3UJHA 1P5JA 4GKJB 1GADO 3OZFA 5HGXA 5IXSA 1NMQA 2QP9X 1VL1A 1QP4A 5L3SA 4QPPA 3ZTTA 5I6DA 1H1DA 4KQXA 2PZFA 2FZ4A 2W37A 1OYOA 5T4EA 2IXTA 3KV3O 3WSWA 1E66A 3D5QA 3PQ2A 1W0JD 3COWA 4DG9A 1UQRA 3B13B 3LI2A 5JHHB 5IVKA 2ISCA 3N6VA 1JHZA 3OKCA 1H0HA 4ZCSA 1G7RA 2ATCA 1D2CA 1ZD8A 2PMCA 1J7JA 2AF4C 4IIFA 1EWTA 2AVNA 5I9LA 1T29A 1N1MA 3A4YA 5CW2A 4QXPA 1XD9A 1GGFA 2D06A 4PLWA 3FMFA 4X60A 5E1DA 2PO5A 2O8BB 1C3EA 3ZNNA 1G5IA 2V8BA 2O1EA 4FYPA 2AE2A 4MRAA 3RIGA 4JR0A 4ZC8A 3BH7A 5JI3E 5I48A 1IOLA 3RSHA 1QIKA 5ARBA 2IE0A 3ECAA 2AG1A 2B69A 3HDVA 4UHBA 2FQWA 1K2WA 2QTRA 3G79A 4C01A 1HT3A 1DIAA 1KIAA 2Q0HA 4U39A 1FRNA 5FYDA 4BUCA 4OHYA 4FZJA 3PS9A 4R40A 2XKJE 1HZJA 4N48A 2W2LA 4N3BA 4D9CA 1KIFA 4ZAZA 3I9V6 1Y34E 3OURA 3DCYA 3EEBA 3ILVA 3PUJA 4OX9Y 1Z34A 4DBVO 3EYWA 4R2XA 2OWDA 3X43A 4S12A 1JR4A 1OWLA 1C0EA 1SWVA 4CV2A 1C7EA 1I1QB 2AOTB 4KJXA 1M34A 5C9ZA 5MHTA 3AETA 1AS2A 3A1DA 3BGVA 3DYVA 3ZWCA 1NMSA 1PWZA 3OUUA 2NYAA 1BXZA 1TRHA 1IXZA 3CJTA 3WVNA 4X66B 3FKQA 3OH8A 1Q0RA 2Z04A 3I0ZA 3I92A 5DNVA 2RD2A 1W581 4WCDA 2O2SA 4PG7A 3GLUA 4KQ2A 4P80A 2L42A 2PX8A 1Q19A 2LUOA 4NS1A 4PE5B 4HPXB 4K46A 4DXAA 7REQB 2BMDA 3DZ8A 3L04A 5EZ5A 1SKMA 4JKOA 4IIXA 5G41A 1H8ED 2QJRA 1LS1A 2CLOB 3F3MA 4H3VA 2BM8A 1W4LA 3OVMA 3V3TA 4JJ6A 3HJFA 3MGBA 4HI0E 1SCUB 1E6MA 1I2DA 4DNXA 1LA2A 1MOPA 3PNPA 1KKLA 1SPBS 3DVLA 3L9XA 4Y1RB 4ZKDA 3IALA 4R1TA 3IAXA 4UBKA 2WM8A 5LU9A 1KP3A 4BVEA 2HJGA 2HA0A 5DOVA 1D0VA 1LQ2A 1O7JA 4B80A 1H2BA 1NT4A 4BWVA 4ZI7B 4HFMA 2OMEA 2WWGA 4Q9JA 1EZZA 4HGRA 1ZN7A 3IPLA 2QLMA 3VZRA 4GOLD 2ZRKA 2RIRA 3F6BX 3EQ8A 5EMNA 4YXFA 1OLOA 2F1JA 3U7HB 1F4PA 4OLHA 5TPZD 5HK8A 2X9VA 1BQ4A 5LLTA 4WN9A 2PPVA 3MCTA 4MKIA 1U5AA 5DDIP 1ISSA 4TSRA 1KZ6A 3QHQA 4IRMA 2C54A 4IX9A 3B1XA 3ST7A 3MHTA 1CJBA 1IWBB 2X22A 3DZHA 3NS7A 4Q3OA 5EEHA 4WBNB 3JALA 4PSDA 4PO1A 3EF3A 3H18A 4KPUB 1WSBA 4C08A 1PZXA 3DR5A 1MG0A 3ME5A 1U2EA 4TZKA 5KIAA 3G8YA 4DLZA 2J48A 1OGJA 2VLBA 3B3AA 4X6LA 2NUTB 4G4GA 4AMVA 1PT8A 1JKJA 2P1ZA 2Z8XA 3ASUA 1X1EA 2P4SA 3G9TA 1P5FA 4RELA 3PXBA 4D8VA 5I7UA 3BBLA 5JH7A 4J1SA 3T06B 1DIHA 1UBFA 5ALRA 3WLHA 2R5WA 4ADSG 3ET5A 5H80A 1B6SA 1Z2PX 3O8RA 3SYLA 5DM70 4R1LA 1V8OA 1T9GR 3Q2KA 2GZ3A 2C3UA 1DS6A 3EFHA 3LL7A 4IF4A 4RIIA 1YB5A 1W0KA 3WB0A 4CMKA 1G291 4BB0A 3A6FA 1RXCA 7MDHA 5GQSA 4COOA 1IBRA 4IIVA 3V4FA 2XE8A 5DYGA 2CXSA 4LOKA 5ITVA 2FSVA 2W83A 2VAVA 1THTA 2QMZA 3O9MA 4XLLA 2YY6A 3WLEA 5JDCC 3D6NB 2RKBA 3INNA 4ARUA 5L7TA 3QA9A 1JFVA 2BUCA 5HA5A 3SXUB 3S3TA 4TWIA 4BZXA 5JD4A 4YMSA 1WD5A 3GFOA 3LWNA 4FZ3A 2G7ZA 2WUFA 1MQ9A 1QHXA 3SEAA 3G2MA 2YFQA 3SIRA 1A4XA 4BN4A 1IDOA 2YV3A 2VA8A 3P19A 1DSSG 4ENPA 1G5HA 1IN4A 1JGTA 2Q45A 3WBJA 3BXGA 3B1WA 3GZJA 2PQ6A 5HS6A 2E4AA 4B74A 3A27A 1PFQA 1T6NA 4UUQA 2NUBA 2DUMA 4R9UC 1U63A 4F4DA 2NVUB 2IS6A 1Y82A 1H65A 3A70A 2JLXA 4A8PA 3OM0A 3SIWA 2VP6A 3EMDA 4ARIA 1W47A 4JSYA 4BO6A 2QN7A 1P9RA 221PA 2Y0PA 3CO0S 5DCYA 5AKXA 4FDLA 4IXTA 4EJ2A 1ETUA 2GZHA 3QELA 1NJ2A 3OZAA 3RTAA 3H75A 4EYOA 2HGSA 1YMQA 2C2ZA 1KQOA 1WXGA 2PS0A 1YB7A 2QNBA 2B4TO 3F5SA 3HDQA 3KPJA 3N76A 4LDJA 4WZAA 4L9RA 3BWEA 1WXQA 2PSEA 4LHZA 4JX9A 1VI2A 4MKGA 3ROTA 4LJAA 5BR7A 1LRKA 3FG9A 5CA0F 1O87A 3KQLA 1B16A 2CMKA 2VHYA 2C4VA 1XSEA 3EBPA 3AK4A 5AJUA 5T4HA 4BKOA 2J3QA 2Q6LA 2VDWB 1HXHA 5JARA 3UHPA 3EIQA 2EW2A 3AIIA 2DY0A 4RWEA 4MIKA 1OGIA 4ZO8A 3V1MA 1ISMA 1TQHA 3HGMA 4HMOA 5FB3A 3D5TA 3VO1A 1WZCA 2NG1A 5FBRB 3TZBA 3ZXIA 1XCJA 3EISA 3PD7A 5U1PA 5IYZB 2H7YA 3JVVA 2B8WA 5KWVA 3WNZA 1J6UA 1V5GA 3ROGA 5C1BA 4AKGA 3N2KA 2JCXA 5KTMA 3GEEA 1ZH0A 2J6BA 3BSFA 3DDZX 1JZTA 3QI2A 3IB3A 3JQRA 1Z25A 2CNOA 4PG4A 3V4PB 4IDGA 4HK4A 5J2TF 4RJTA 5FAKA 1XMJA 4QFDA 3S2GA 1UC4B 1ORVA 1DG1G 4IGAA 1O58A 4PG8A 1UKZA 4MKXA 4Z99A 1C9KA 5TY0A 4P4GA 3GOHA 4HAWA 3RSZA 3I73A 5CM9C 2P8SA 3CIFA 3F4KA 2Q6VA 1EFUA 1CETA 3GXBA 2XYRA 3DPSA 3K8OE 3V97A 4IM7A 3KT3A 3KTFA 3K9WA 4J94A 3KSZO 2AN4A 2VLIA 3AL3A 4UCXA 3SKXA 3LLUA 1HLFA 1J0BA 1XJCA 3N8DA 1FP1D 4CLXA 1NXSA 3CNLA 2XVAA 3IKLA 5DMHA 4CDNA 4NK4A 2Z2ZA 1NUHA 1PN3A 3EXFA 4RDXA 3AT1A 3ERCA 4AWAA 1F8GA 6PFKA 1DC6A 2C99A 1Y9AA 3ZLVA 3EOBI 1ZI6A 3ZYZA 4QHYA 1T34A 2ZSHA 3B20A 4MQ5A 4QEDA 5TVKA 4LDRA 1PFWA 2JKVA 3EDRA 4UDXX 3DEKA 3EASA 4HGZA 3FZQA 3PI6A 4BHTA 3HYNA 2CCKA 3B9QA 3I5MA 3MUOA 1MRZA 3R5FA 5A3RA 3NX4A 1NDQA 4V1CB 1H23A 4I1UA 2XA9A 2H5IA 3A6HA 1IEXA 4XAQA 6ABPA 3OU7A 5FUVA 4RK0A 2O3TA 3BHMA 1P18A 1Z2OX 3L6DA 3AWDA 1D4OA 3W05A 5B1SA 1H22A 1IONA 2QRMA 1J8MF 3KZXA 3TNJA 1XIVA 1Z73A 2EJVA 3OWOA 5KUTA 4F5DA 1RRGA 3ES9A 6Q21A 4BVBA 3T1TA 1VPLA 5EZYB 3KU4A 4FN4A 1DJNA 4EIWA 4YCLA 1TLFA 2CLSA 2PSDA 2NO6A 4GKVA 1H4SA 2OC9A 4DNOA 3EVDA 5EJIA 2A7XA 3FVWA 3NKVA 4QDJA 2W6JD 3MS7A 3FCSB 4IPTA 2J6CA 1ODCA 3OJWA 4IHJF 2YXPX 5AYVA 2Z9DA 3D6JA 1PIWA 1Q14A 3WWDA 1LB1B 4EY4A 4BFTA 4MUAA 4IBOA 2O3JA 4ZT5A 1LK5A 3P2IA 3CLKA 3A9SA 2ENWA 3PVZA 2GK3A 4G0XA 3WOVA 2F55A 3AHGA 3GROA 5K03A 1DIGA 1FU4A 4PAWA 4UZSA 4IDPA 1MHPA 4LC0A 1J0XO 3COSA 2XCSB 2H1VA 5K8IA 2A5YB 3G82C 3PRJA 3COVA 3MRXA 2Z1NA 1ZEMA 3DEZA 4RHEA 1AGXA 3FFWA 3IIIA 3NIDB 1V9SA 3I8OA 3M7IA 2AJCA 5CLHA 3LTNC 4JIMA 1OX4B 1EHIA 1K7XB 3DAFA 4JHXA 4CDRA 1A1SA 2OZPA 4CM6A 4RTJA 4X3OA 4CL8A 1V43A 3FPCA 2C0CA 1GGMA 1FDVA 3Q7EA 3LOQA 3RTBA 1CZOA 1PFYA 2GFHA 4MWBA 4YFVA 1MX5A 1TCUA 3B52X 1DPFA 3IIKA 5C8VA 4DDKA 1WCXA 2VJMA 4ABYA 1ENYA 5JZVA 2C9DA 4P81A 2PU5A 3VNQA 4A73A 2CXHA 4D9KA 2FRDA 1WPXA 2FB9A 1JDZA 1QV7A 5BOSB 3FPSA 1MQ8B 1NLUA 5TDHA 3EVEA 4Y6QA 4A6EA 4OM8A 1DAKA 1OBHA 3A6ZA 3QTBA 4GVLA 8OHMA 4J0GA 1TMOA 3SC4A 1GQOA 4XWGA 1J9ZA 2JFPA 3SZMA 3ZD6A 4LW8A 3BEDA 4OIMA 1BCSB 4LOIA 4FN5A 2P9ZA 5A71A 3L0ZA 5JBQA 4AT1A 3DFKA 2X0EA 2WVJA 3ZGYA 2VS1A 3JQGA 4IL5A 2X0FA 4BNYA 1IL0A 3C4QA 5JWOA 4PS1A 3IHTA 4FNGA 2QG4A 3UZUA 4OFZA 2J3HA 2J0VA 3TZEA 1W6UA 3ELWA 2E4WA 1XLWA 3GEMA 1WY7A 5E3IA 1VLVA 2C96A 3WYEA 3G5LA 1JEYB 4XI9A 1XR3A 2PZEA 5FI3A 3EHEA 4PYIA 4ENSA 5KYYB 4H6WA 4M1ZA 5FR2A 3EA5A 5T3UA 1UKEA 3VBCA 3E03A 1VRVA 4MRSA 1FA9A 1Q2UA 2X5NA 3Q4GA 2FFJA 2J08A 3BREA 1SH7A 4BLTA 4F7DA 4XVCA 2ZIUB 4RV4A 4DQ0A 5JO0A 1YZGA 2E0IA 4KN8A 5F9MA 3ZNOA 2WOOA 1N4AA 3DPUA 1T9CA 2UUCB 1EE2A 2VQSA 3GN2A 4ILEA 1KJYA 5DHSA 3STUA 2BGJA 4AMUA 1PR9A 5CEJA 1U5BA 4BWGA 4NWIA 3TD2A 4ASUD 4IXMA 4MR9A 4YJ3A 5DTJA 1W2WB 3U4IA 2FEPA 3HM9A 1YE3A 2HA5A 2QTHA 1BN7A 3OCZA 4JUBA 4XB1A 4CLDA 2XB9A 1IMJA 2GM9A 2RB5A 2HYIC 2VNHA 3RVPA 3L93A 2XYPA 1E2UA 4MXDA 4XKJA 1X2BA 3BL6A 1LSUA 4DJAA 1M6NA 1GV1A 4UBNA 5JZBA 1K6IA 4KIUA 4QQNA 3T3DA 5EPOA 3DVAA 3WICA 2GBCA 4GBGA 4HRAA 3U7QB 3UMMA 1I80A 4HUTA 6REQB 1GEGA 1H3NA 3EULA 5JO9A 1P4GA 2B92A 3PEUA 2JHFA 4Y0NA 3UKDA 1O9HA 4ATNA 2XMSA 3BFVA 5E9WA 3AFMA 4OTZA 4WINA 1ID8A 4DZTA 5JMWA 1GGJA 4YMIA 1M2EA 2QUZA 4I4IA 4MLDA 1RVDA 4BNMA 3KOUA 2MCFA 3M34A 1FSGA 1LPSA 4DCCA 2OG1A 3AEQA 1B4DA 4G0OA 4C1NA 5ECDA 1JTEA 1I7DA 3M6LA 1R1DA 2FW1A 3RQIA 3OZEA 4J2TA 3HV0A 1FMCA 3RFFA 2I3ZA 4KIFA 2IE8A 1JTVA 3RVRA 3D02A 1Q7CA 2C4NA 2J5QA 1E3EA 3KV1A 2QUHA 4PAMA 1E1QA 2DWPA 3LQ4A 3WRVA 3ZCTA 1GLGA 4AX4A 4CKCA 1AF4A 3OE1A 4MRPA 1I7PA 5JD5A 2PD4A 2C88A 2EJWA 2QYHA 3HJRA 4EGCB 4EL0A 1SUEA 3PFKA 3X0DA 3DWEX 2WHPB 4JP3A 1EP3B 2RKWA 1CE8A 5JBNA 5EJEA 3G6KA 4C29A 3NETA 4FGKA 1MAHA 5HQTA 4DV5B 1D8AA 1KJNA 3S1SA 3IVXA 3PD1A 2IIPA 4RKQA 1IBCA 4ECAA 5KTNA 1X7ZA 4OLFA 3L5KA 1JSRA 3IKTA 1YZNA 2UYYA 3GPDG 1VPEA 5TSDA 3CVYA 4IILA 3TH5A 4D3FA 4EARA 2YWGA 2I33A 3DD5A 4YTEA 2CJWB 1WMDA 3CRZA 4ZEWA 2IRWA 1DXQA 3V6LA 5AI6A 2G1PA 4HWSA 3PBKA 4G9GA 2IUEA 4ZODA 3S1LA 1XQYA 3F74A 2W6NA 5B3AA 1KI2A 3CUSA 3PLNA 3A26A 3HEAA 4LQCA 5LKRA 3U09A 3DW1X 5J40A 4O4LA 4MPDA 3KETA 5F33A 4L2IA 5JPCA 1D6JA 1JJAA 5EPEA 3D0QA 4KZPA 5FWAA 4BMXA 1A27A 1M2KA 4HBGA 2BE9A 3DEJA 5JFGA 1YMVA 4RVCA 3R8XA 3SK0A 5B2ZA 1CQIB 1YB1A 3NBKA 2W2KB 3DZGA 1REQA 4RIHA 3FUVA 5IP5A 4BV2A 4U2DA 2XXAB 3BWMA 4HEQA 3W9YA 3DV9A 2AFIA 4QECA 4L8YA 5A2GA 2GD1O 4DV3B 4KK4A 4E2WA 2RGAA 4ERNA 1D09A 3HN6A 1FNMA 4HLDA 3FKJA 2Y0DA 5CT8A 1L7XA 3ZGZA 2EERA 3Q7QA 1E4VA 4C4RA 1IJFA 4RQBA 3DTVA 1N6RA 2XMPA 4X1IA 2C3PA 5CU7A 2I2CA 3U81A 2G1UA 1SAYA 2OR3A 2MR5A 3N8NA 3S2SA 3L7DA 1WWKA 1T8WA 4BNNA 1ES9A 1VG0B 2VAMA 3JD1A 2VZ9A 3MRSA 3IR5A 4JY7A 2V6FA 4LF9B 1XCLA 3A10A 3P0FA 3QLEA 3D2CA 2C2OA 5EIXA 3BRCA 5KHOC 4EW2A 5CCDA 3AF1A 3GGCA 3QFRA 3QMMA 4ROTA 1E69A 3D3WA 3I2IA 1CR2A 4REQB 4BC1A 1GN9A 2P9CA 3WQSB 3LHKA 3HBFA 3IBCA 4Y2GA 1EG7A 4FHCA 1C9EA 5LN1A 1JBKA 1E9BA 2B30A 1A8PA 1XZLA 3B3FA 5HE8A 3CF6R 3GT4A 4J6EA 4B2IA 1KJWA 4BKUA 1H42A 3HH8A 3HLKA 5JQWA 4KHZA 3X2FA 2QPLA 2XUJA 2FLKA 1OLXA 4ZDIA 4DJ5X 4Z49A 1VE6A 3GJ6A 3HDJA 3LT2A 3CM0A 3JWPA 5CHYA 4NZZA 1MABB 4GEGA 1L7QA 1UEXC 1JALA 1P33A 1JBQA 5D01A 1YIDA 1CEEA 1JQEA 1KAEA 4HDAA 2FMTA 3EAQA 4L5CA 3AONB 4G8DA 4RHTA 5TPZA 2VAXA 4F0JA 4TTJA 3WZ2A 2DBRA 5DTEA 3FYUC 1J70A 3R6DA 3OIVA 5ALVA 4TKUA 1Y5RA 1SQFA 5DMXA 3U5TA 5AIAA 1TI7A 1EFAA 2C2HA 3T7CA 2X0RA 2RH4A 3LWBA 5IKOA 8MHTA 4PHTA 3B5JA 3BDAA 4X1KA 2VP5A 1N36B 4LQDA 2E1PA 4QOEA 1B1AA 3V48A 4X64B 4OBXA 1BU8A 1PJAA 4RENA 3HBJA 4IXDA 1CULC 1YR8A 2SNIE 3REGA 1FIUA 1KEUA 2CL6X 3CW8X 5JLAA 3T3MB 5JDCA 3TFQA 1Z62A 1A69A 4J2OA 4PNPA 4AF7A 2PUDA 3A1UA 1E2NA 1EFLA 1R0YA 2IDKA 3HJTA 3VHXB 4JI4B 5ALHA 5C4IA 5IDXA 5E4YA 1EPUA 3E22B 4M89A 3T5BA 1H94A 3EZ7A 4NBTA 1GN8A 3ILXA 5DH9A 4OY3A 4XWKA 3PC4A 4KTTE 4TROA 4BVGA 3BA6A 3GLIB 3RRJA 2FN4A 5HVNA 1HOXA 1JHUA 1NJ1A 3LYUA 2G07A 1QP0A 2R8BA 4BO9A 3BIOA 1R12A 1RW4A 2HMTA 3FTNA 1E6UA 4WK0B 4ZVKA 4N12A 2FEAA 1C50A 1ECLA 1DDIA 5JAQA 4I50A 3QBDA 1T10A 1NE7A 2X1LA 1UFOA 3B51X 3G5UA 3NP9A 4LY0A 5T8KA 1VLHA 4K9KA 2Q1WA 3G0IA 3AEZA 5T4FA 3VH2A 3X1ZA 1HE1C 1SRQA 1W25A 2G04A 3A1VA 4IMIB 3ZWKA 1UBEA 3KOMA 3TIIA 1J2UA 1FDTA 2B6NA 2ET6A 3KT6A 3REQA 3KL4A 5DHPA 4Q9HA 4O02B 4YDRA 2Q4DA 4XD7A 3WV4A 4ZYUA 3OQOA 1RJDA 4RQUA 4BXOB 1OE0A 2SCUB 2AZ4A 1YDFA 3CSUA 3DR3A 1U0GA 1EGMB 3NGLA 4HX9A 1VZ3A 4RZ2A 4YAJA 5KDOA 1WMEA 3UJ3X 1QTQA 2E7ZA 3KJZA 2Y1XA 1LW6E 3AVOA 1IN8A 4H7KA 5E95A 4DCUA 1PZGA 3Q12A 1U04A 2ALJA 2XUGA 3C8ZA 3CLTD 1KMMA 3N8GA 4MQEB 1V6SA 2F59A 1XEXB 2QZ9A 1RFGE 2R1TA 5A3QA 3PJGA 4B7UA 2OXIA 1UJMA 3RO7A 2AG5A 2NX2A 2B36A 2PGNA 1YJAA 3B1YA 3KRTA 4H6VA 5B58T 3EF0A 1QC5A 5K3DA 3O8QA 2JJYA 5F9HA 2NOAA 3COJA 1A9RA 3DXZA 4MTLA 4KZKA 1DIBA 4ZXFA 1TO6A 1NF3A 1YUNA 2A2ZA 2GD6A 2PGJA 2QLFA 2I7DA 2XUIA 5AK4A 2A57A 1UZNA 4XB2A 1G4UR 2H2FA 2IYNA 4ND8A 4OXKA 3T3NA 1XL1A 1RXIA 2QVZX 3IQEA 3Q40A 4GC9A 5AK6A 1CLEA 3T52A 4EAQA 4YYZA 4B73A 4BNGA 3MBOA 4TLEA 2I9PA 2WWHA 3VC7A 1MJGM 2GK7A 2R47A 3PDWA 4X1YB 2Q4TA 3P94A 2GN0A 1E92A 3IHLA 3IKVA 4CQLB 2V9CA 5TX7A 3CVOA 2ZYSA 2YIVX 4E7OA 5MN4A 1SY7A 3K9CA 5KOYA 2BTQA 1G16A 2V6BA 3EVTA 2WJPA 3I64A 1KEVA 4LX0A 2UZIR 4BVJA 4R8VA 1ODSA 2Q62A 2GHTA 3HJUA 2MYPA 3OMXA 1VP9A 4GLOA 3E8XA 2YTZA 4QOGA 5CVEA 2XRYA 5AXBA 2B8NA 1ULUA 1Q92A 2VP9A 1RACA 2CFIA 3EG9A 3G2PA 4G1MB 3WGNA 4NCBA 3OFND 2I8LA 4UCFA 4IOKA 1JPVA 2V98A 3IMEA 4EW3A 2G8LA 3DMHA 4RF3A 2JFXA 2SKEA 2VDQB 1NVVQ 3PT5A 1W5AA 5IZCC 1MV5A 2WT9A 3RTEA 3NTUA 2DR3A 3THYB 4KO1S 5KPDA 4XRGA 2JGIA 3HKDA 1GCGA 3RJTA 3IH5A 4CQMD 3INTA 5K0NA 4GX2A 4K9RA 1JQ5A 3O83A 3CLUC 4PPQA 1II8B 1U28C 2R8YA 5I7VA 4LHVA 1SXPA 4LYYA 3QPVA 2CUTA 1GUZA 3GGGA 5IAJA 1W4RA 2CYBA 1CJKC 2W00A 4A0SA 1EDEA 2GFQA 4MRNA 4RYDA 1YZVA 2OSVA 1PKXA 3JD2A 4FEGA 4BDSA 3RSSA 2NZXA 2B1IA 2ONCA 3C5WP 3N0TA 3R7BA 4YFYA 3BKXA 3FW1A 2FN7A 1Z9BA 2XEXA 1BHSA 1T8TA 2ZJZA 1YR9A 4J0CA 4N54A 3RK1A 5EJ4A 3HR4A 1GDHA 2VH5R 3PENA 5JS8A 1G5FA 1KAOA 4GP7A 1QZ3A 2LKCA 2O57A 3DOOA 3PGJA 2WSMA 3SLKA 3ZE8A 3KSUA 1DAHA 1QG4A 3E7FA 2D5AA 4OJNA 1N5LA 4OHRA 1ZHFA 2NQTA 3PXXA 4WOJA 5AXAA 3WIBA 1JEEA 1O0SA 2WD9A 3NR2A 5D7NA 1XQ6A 5EKXA 4H0FA 4M8KA 1AS0A 1GSOA 2UUBB 3ZIDA 3LWZA 1ABBA 4XWOA 4LF8B 3AW8A 1UDWA 4HL6A 2JRCA 2Z83A 3GV0A 1PFVA 4XGKA 1NV9A 1I0LA 4ENUA 2JH9A 5KWJA 2L69A 3LXRA 4GBJA 1SHLA 2WE7A 2X3YA 2CEAA 3FF4A 3ILYA 4PLYA 4WW0A 3OIWA 4INJA 4U6SA 3VHRA 2VJQA 5BWNA 4UTNA 4YIHA 4OKNA 2GKGA 2C04A 3CE9A 4BP8A 4E33A 3ZH2A 2GEDA 3EWAA 3ZGVA 4DPLA 2F3UA 1CUJA 4WA7A 5CA1A 3R9XB 4IR7A 1SIUA 3SKVA 3ASYA 2H54A 1DAGA 1DPGA 1FEZA 1XZBA 4FVTA 1LDNA 1L7RA 3DOHA 1YJQA 4QNRA 1WOYA 2MMCA 5KS2A 3AIMA 4B75A 4GXRA 1AHPA 1VLLA 4ZWNA 1YCFA 3FFXA 2JLQA 5K6AA 1M1UA 4ARCA 4KR3A 2ZR7A 1JMKC 1NMZA 2XR1A 1UOQA 3N5KA 3PDHA 4K9OA 4OATA 3W5IA 1VLQA 2XOEA 5L8VA 3D8UA 5JNUA 3IJEB 1OXTA 3EFEA 1QV9A 1Y8RA 2E3JA 2CVOA 2ZUBA 2MYTA 2IP2A 1Y4AE 2ZIVB 4XVRA 1EUZA 3EXG2 5BR8B 4EY8A 1WDLA 1KDPA 5LM3A 3JQBC 4IIJB 1GL7A 2X7JA 4C9BA 1NHGA 1J24A 1LPMA 1N2ZA 4IUDS 3V33A 1DZIA 3QUQA 2XDYA 1Y6QA 2P79A 1ACMA 5DNEA 1EFRA 4K1XA 1WD7A 4CEJA 4MDEA 2ZWAA 2BBTA 3NUGA 4CFSA 4HJRA 3QK7A 2DBQA 5ELLA 1R4MA 2YJZA 2G9UA 2PRIA 3FVRA 3SKYA 3VH1A 1QCDA 3AINA 3G0OA 4JA0A 4KQMA 5I4KA 3BILA 4P9NA 2R9VA 4OB7A 5IABA 1KDRA 4YWHA 3I5XA 1ACJA 4Q4DA 5F2OA 1RQXA 2QPOA 2RMKA 4GDMA 5FJJA 1HE4A 1ODLA 4UKDA 1JFLA 1G20A 3V42A 1WXDA 3H2HA 4HP8A 5EJ6A 1A98A 2Q8PA 2M6KA 2IZZA 2IEZA 1MDFA 4JB2A 3DCNA 3ZJYA 4XUEA 1F5SA 2E5FA 4OP1A 4D0RA 1WEKA 2ZB8A 3AKYA 1GGKA 2RB4A 2RGGA 3KHUA 3E53A 3TRFA 4MAAA 4EMTA 2A9OA 2NSJA 4LKRA 1IK4A 3T7TA 1P2DA 1QAOA 3HCNA 5K20A 3M33A 1Y0BA 3TMKA 4XCQA 5JZMA 1N75A 1UEJA 5D3ZA 2R0QC 3T3IA 5K05A 2WSSD 2BR4A 3U9SA 1WP4A 1I2MA 3FR8A 3LQ1A 3HNPA 3GLFB 4CLRB 4BCDA 1YJ8A 2UUPA 1MX9A 2BFDA 3CV3A 3I0NA 2EW1A 3BSWA 4BKMA 4GLFA 5A5GA 2H5EA 2Q7XA 4JUIA 1JIIA 1I4DD 1XEFA 1ESDA 3EUEA 4NG4A 4P92A 4R1NA 3FSGA 3FPAA 4AMBA 1KJ9A 1SG9A 4JI1B 3FCOA 4QPCA 1G4AE 3H86A 4J7UA 4MQMA 5IG2A 2RI1A 4HQ6A 3PUVA 1G60A 4EKYA 4LCJA 4BZZA 1Y8ZA 4S1VA 1CZUA 4PX3A 2LCQA 3CJRA 2OZEA 2ZT6A 3PQDA 4HUJA 2O5CA 3DLAA 3QHAA 1HI9A 2EX1A 4L4RA 4Q9NA 3OEYA 3KVVA 1GZVA 1TF7A 5CNIA 5I4BA 3QVVA 4JSTA 5F1KA 4AJKA 1A72A 2JFYA 3AIKA 3ZQ4A 5DNDA 1GAJA 1MPXA 5AUNB 3P9YA 3ZHCA 4URXR 3RYCA 3AVXA 1X9GA 2GZDA 1M1YE 1HSZA 3AG6A 3OJCA 4N4AA 4GI7A 4MGZR 3O4RA 2GN9A 3NWOA 4ESOA 4W4TA 2BSQA 1ZVJA 1BE1A 2HO5A 3RSCA 3SLRA 3KZCA 1VA4A 2GF2A 5I7HA 2NAFA 3RV4A 3SEZA 4OUDA 3NO4A 4HAIA 5DCUA 4NZYA 4RY0A 3VPFA 1W75A 4HVTA 4DARA 2QYTA 2YY7A 3D6FA 1Z4LA 3RSFA 3SJZA 2V0NA 3TX2A 4EVIA 3BD6A 3DKPA 5A0TA 3GF4A 2XOKA 3ZHXA 1J09A 1CJSA 3DBLA 2WF6A 4JL5A 3SZUA 4B6JA 3CIOA 3NVMB 1ECPA 4CCAA 4ZOCA 3DBRB 1U8XX 1XTQA 5ALLA 2YKGA 1DLJA 2HBRA 2O0JA 4R8MA 1E5TA 3ZGOA 1K5HA 1KAGA 4RA9A 4CTNA 2WBLC 4LFBB 2HHJA 3DVRX 4G5FA 5JXGA 1AQ6A 3I09A 1U8FO 2R62A 2FPGB 4WXEA 4KGZA 5B3JC 1HT2E 7ABPA 1XVAA 1YI0A 1MN6A 1YQXA 3TLYA 1J33A 2UVQA 1GKUB 1T0BA 4ZQHA 1RPZA 2ZPAA 4OSOA 1XZAA 4FBLA 4OQ4A 2B6HA 5IVHA 2VSXA 1AA9A 3PGMA 4QQKA 5COQA 5H9VA 4CKWA 1T9AA 2IYWA 5JS6A 1SQGA 2WIDA 4BFCA 3KKZA 3QW2A 4FS3A 3EZXA 3KKLA 5CUQA 1E3SA 5CDGA 5IDWA 3DC7A 5EMLA 1KSGA 4B31A 4F2GA 1O77A 3FBWA 3GFSA 1C5KA 2R96A 3AL0C 3KVNA 4P36A 1XPRA 3P32A 4Y1FA 1GZ4A 2QL5A 3OFSA 3QM1A 4W8GA 1ZU4A 4NRDA 3VHQA 2XB2A 1NP7A 4P0TA 4MICA 4P5PA 3MWDB 2CB9A 1XXLA 2G28A 3CR8A 3PUYA 4LXIA 3A9VA 3P9SA 5IS2A 2YASA 4OHXA 1MOZA 2OO3A 4MPPA 1HWYA 2AF3C 3M83A 1YACA 1M67A 3DMYA 4RZXA 1X3LA 4LUCA 2PD6A 3OPYI 4MS3B 1ZH6A 2TMYA 4DSNA 1XV5A 1UBUS 4HWTA 4K7JA 2I2FA 1GYPA 2WR8A 3AF0A 2P3QA 2YJTD 3STHA 1E0SA 5JISA 2ZBDA 1NW3A 3BN3A 5KNLA 3S2ZA 2HDHA 3QVMA 4ZQFA 4BFLA 4DMGA 4JOBA 4D4IA 3GA0A 4W6ZA 4DMHA 2W2XA 1VJDA 2YMLA 4IIHA 4WNCA 3OTQA 3BCSA 2QXUA 3M5CA 4LF5B 2C84A 2I3AA 2AOXA 5K8UA 3NRBA 4HQ0A 3UB3A 3OZWA 4MGHA 2IW1A 2IV2X 1O9BA 1P1FA 1PDWA 4M8NE 4B1FA 1RLOA 1JXOA 5EIAA 3ZDZB 4RETA 3QEKA 3T5DA 4YQFA 1G7SA 1AQUA 4K28A 4OHOA 3OMLA 3RU7A 4X92A 1QKIA 1C4WA 5KYGA 1AURA 1NHWA 5GV8A 4LJRA 2VDOB 4M53A 3KEQA 4NCAA 3RC2A 1ZICA 3AIOA 3FYUA 3R3JA 2DT8A 2QLJA 3LSTA 2CY0A 2CL5A 5CB0A 1PI3A 4H7PA 2Z2XA 4JNCA 3PSAA 4ZT7A 2W70A 3ECCA 4NICA 5CEFA 3WDLA 1NVVR 4WFIA 1YA4A 3J81A 1BGVA 3PGVA 1YA6A 1N8TA 2J9FA 4HQRA 5JAPA 3MXTA 2XCIA 3VI3B 2IS2A 5H4GA 2HFJA 1NXTA 2HF2A 4V0LA 3D4BA 4GXQA 3V8BA 4ANFA 2JCYA 4JP1A 1Z6GA 4PYRA 5FCDA 1IEWA 4AJ4A 1VYUA 3SZOA 2GDJA 4BDTA 4ZMBA 1XZJA 2H4FA 2OCYC 3G9UA 3K73O 2ONYA 3KZVA 3ZX4A 5KTTA 4MV5A 3D6HA 1OVMA 1JECA 3QU2A 2FLVA 4JGBA 2XT6A 3GMSA 2EBWA 3GELA 1JJVA 1D2NA 2W90A 3D31A 5D85A 2AQ8A 4INAA 4KQ6A 2ERCA 3TQQA 3TQHA 2IX3A 2J0EA 3A6EA 4PLGA 1P0CA 1P72A 1T4DA 2G1AA 4MPRA 1HNZB 2BEUB 4Q00A 3FE2A 3VYSB 2CE2X 4GKKB 1NQAO 1OV4A 1Q7GA 1U0OC 3O8OB 3W2IA 5FA5A 3CURA 3ZWMA 2J4DA 2QI9F 3H7AA 3K0AB 1T3ZA 3CSDA 4M1YA 4YRDA 1UAAA 5CB4A 1E2EA 2O48X 3MPUA 4H15A 2Q99A 1V0JA 4TQGA 3T38A 4F2HA 1FRVA 3AF5A 2E5LB 2HT6A 1N6LA 4KBGA 4UATA 5ER9A 4YRZA 2NU9B 3LUDA 5CT6A 5DBGA 3MLAA 1A50B 4XUCA 1USKA 4AN0A 4ENRA 3WIEA 4LZOA 3OY7A 3ABRB 2EKLA 3GZNB 2WPDA 3KUDA 4YEDA 3LW8A 3L8EA 2YL2A 3CC8A 1B6TA 1M75A 3GRYA 4KTVE 1ZL0A 3C6BA 1XNRB 4WNAA 2YRFA 1XWIA 5K3AA 1RXVA 3FN4A 1G66A 3MWEB 1A0OA 1G8FA 5FWDA 4UTVA 5DX0A 3U37A 1N1EA 5DRTA 2SECE 3SBOA 5D7BA 5D87A 1GHTA 3T54A 4HDSB 1L8OA 5FA8A 3G88A 5BMVF 5JALA 5LP6B 1EWRA 1ZJYA 3C3AA 5JY1A 4QG7A 1UAGA 2XGMA 3GNLA 3N0VA 1K5PA 3S81A 1SZDA 2FWBA 2O1SA 3PR1A 4UFPA 2QRHA 3ADKA 4B6GA 4M1SA 3ND8A 2X5JO 4JX8A 3JARB 3IDFA 1BVUA 1H6AA 1MV8A 3KAKA 4K87A 3UGTA 1N5JA 3AR4A 5BURA 1C3XA 5DNWA 5BV2P 4LJ5A 3IV6A 5K01A 4Z9FA 3I1YA 1KQPA 4FLFA 2BZSA 2IX9A 4V2UA 1E9EA 5EEGA 2HPZA 1EDOA 1O96B 1XTRA 3GDHA 1OYVA 2JFQA 3JQDA 4H17A 3ZVLA 3GG9A 3K70D 3S68A 3OCXA 4EZIA 3PNOA 2ZKIA 3O75A 4WDQA 2F3PA 3GUZA 4DC0A 1N57A 3TM5A 1C7IA 3VOTA 2GESA 1ENZA 3H4TA 1L4HA 3OC6A 3HNOA 1N8NA 1RCFA 2JBAA 4P7BA 4UEWA 5C8YA 4H1VA 4L76A 3VO8A 5I8WA 3NT4A 2P9TA 4ZYVA 5A4FS 1ZGHA 1YRHA 1BEZA 1XLVA 4M87A 4OOEA 5JMPA 3LJKA 3BK7A 1GNTA 3NBAA 2P9JA 1MQAA 3GT0A 4B85A 4UNSA 3LDUA 4JOQA 2NSLA 2W71A 3IKMB 4FMBB 5F12A 5BN1A 1J8DA 1MEOA 2HMAA 3OX2A 1JFFB 5LDHA 2WA1A 3QX7A 1GT6A 2XGGA 4NFSA 1QKKA 4TTAA 4U2EA 5JCJD 3MOSA 1S5PA 3I01M 1DQYA 1C1XA 3PNYA 3AB7A 3M3DA 4LZWA 1L4FA 4I5GA 4Q6WA 3OZBA 4JBGA 4X93A 5IZCA 3B5EA 1RVV1 5KU7A 4EA6A 4X41A 1KDYA 1A97A 1KI6A 1GVNB 1LRJA 5E4FA 4B6SA 3VMMA 3WYNA 3BFPA 2IYLD 1FBTA 1ULSA 3IPXA 4MVJI 3O73A 3GX1A 1WUTA 1WCV1 2ZRDA 5EMMA 3S29A 3SZGA 5LOVF 1U28A 3FPFA 1FFYA 3NIFB 2E21A 2VDLB 4LSGA 3B48A 1WTAA 4D81A 2XMCA 2XMBA 1YQEA 5AKHA 1GAQA 5K6RA 2GD0A 1PJSA 1C7RA 1YC5A 3DXXA 1CYDA 3AZOA 3H2GA 3U40A 4E5UA 3ICEA 1ZOLA 2G82A 1JJIA 4LA4A 2POQX 4N5HX 5FRDA 1R8YA 1LZKA 3BYZA 1ZD5A 3CT6A 4U2CA 4YACA 5EA2A 3CX7A 2R48A 4CG1A 3GYBA 5F2NA 3C1TA 1I1NA 4MWEA 3TZCA 3ZKWB 4ZZ1A 3CR7A 1M1YA 4RD4A 3G9ZA 1E98A 1LSOA 1SCIA 3A1FA 5FADA 2YYYA 5HG0A 3WS7A 1T2FA 2QN2A 2BBWA 3H5IA 3ZG6A 1WZ2A 5CFNA 2LR0A 1H93A 1GZ3A 3L4SO 3H9QA 1KPHA 1FP7A 4CF3A 3IR6A 4G67A 4ZZ2A 3IX7A 1CZRA 4AZSA 1N34B 4OMCA 1E4OA 3W3ZB 1GTMA 1VLJA 1M34B 2OV2A 4PPNA 2WE8A 2A84A 3BMNA 3FJ1A 2RAUA 4Q3LA 5IM4F 1CJMA 3B6JA 3VR5A 1XZKA 3MCAA 3V2GA 2OGUA 3HXKA 5AUPB 3THXA 4US2R 5DHTA 1RQRA 1NVKA 4F93B 3IDZA 2FH5B 3RANA 3RRZA 1FSPA 3L4EA 3IILA 2CFCA 4S1PA 3DDOA 2FPXA 4Q1VA 3PUIA 1M8FA 1C8LA 1AUXA 3JAKA 3FUCA 3VR4D 2GEBA 4GMFA 10MHA 4H9GA 4P0QB 4B3BA 4B34A 4CT5A 2JAOA 3AR2A 1HURA 4P83A 1R37A 3C8UA 4RDHA 5TE9A 3UWOA 1CEXA 3FPKA 2PPLA 5FO1A 4PFJA 2ZIZA 2F8SA 1BS1A 1L7AA 2XEDA 3HJCA 3QQPA 4WE3A 5K3EA 2AMFA 2PLAA 1NXWA 4N7BA 3LBFA 4Q3KA 4HC4A 1E79D 2PRSA 2GUGA 3N2ZB 4BVHA 1EFVB 4OXNA 4P2GA 3LHFA 2H1CA 1N25A 3T4PA 2O8DB 1WMSA 3LQKA 5KJCA 3F3KA 4RM3A 4E2YA 4AK9A 3IIEA 5CK4A 1JDJA 3FTQA 2PYDA 5AJZA 5CXXA 1Z35A 1FFXA 2GPNA 3HZRA 4MV9A 4UUAA 1XZGA 2ZJAA 3L0OA 1RHRA 2GOYA 3QUSA 4UNNA 3F5QA 3WLSA 3LBAA 5LJLA 4YQEA 1DXOA 1IUOA 1DKQA 1PFKA 2ORVA 5L7WA 3WNDA 1URPA 2BCJQ 3JALB 4OP3A 3SG0A 1V8BA 3UK6A 4A2CA 2P2CA 3KUCA 5B4TA 5DSTA 1T5IA 1S2IA 2O7RA 4PGMA 3RYFA 2QN6A 4ARBA 4B40A 2N3ZA 3HA7A 4PZLA 5BN3A 4RJIA 4TXHA 4F2PA 1H5UA 2KQUA 4M1OA 5KTOA 1YTUA 1V6AA 1PTJC 3ADCA 2F3SA 5CURA 1JKJB 3C39A 1A9PA 1UJCA 3WGTA 5IT0A 4GM4A 5JH7B 1I7QB 3X1KA 1EM6A 4NQZA 2NUAA 5CGZA 5FEUA 1ISFA 1KVTA 3K2EA 1WZIA 2JJ2D 3LOPA 3QKWA 4FWTA 1Y1RA 1WPGA 4OXXA 3I52A 1RTKA 4Z6KA 1KI1A 3KCNA 3AHEA 4TPKA 3JZIA 1ZISA 1BGXT 2VHTA 2X7HA 1E2FA 2ORED 3E84A 4GP6A 4IVRA 6YASA 5K0FA 1MUUA 1XF9A 2XX3A 1J5EB 2B83A 4C89A 3ZXXA 1ZSNA 1NW9B 4V0ME 1Z12A 3TZQA 1BDJA 3WGVA 1V5IA 1T36A 3UJ6A 1EGVB 2GS9A 1DAMA 4DJDC 1MMFB 3GW8A 1GQYA 1VC2A 2ABWA 3L6EA 5DNCA 4QWWA 3R09A 4WJZA 3UMSA 4LFAB 2A9JA 3V4RA 1M8KA 4EATA 3EW7A 1GFSA 4FYJA 2JLZA 1TVKB 4ZVVA 3UC9A 1Y1LA 2ZTVA 3MUNA 1VPTA 4BFVA 3SNHA 2ID8A 3ZW8A 2Q8QA 1IZ0A 5FTMA 1W36C 4L02A 3QE9Y 2DFDA 3CO5A 4M1KA 2OV6A 1M7GA 2O3UA 2P6UA 5JZSA 3IEMA 3WQHA 1R6DA 1RKBA 3TE6A 4DDUA 2KWIA 2PS9A 2AD5A 2RARA 3THOA 3FYHA 1V7ZA 2Y9MB 3IOYA 5AW2A 3WKBA 1MAWA 4I9UA 1ZXXA 4Z2YA 3FAZA 4ITVA 1BRMA 2C5SA 5D3KA 3TPFA 4AROA 3F5MA 3QELB 1Q0UA 2IC5A 2WJVA 5BRAA 4GKAA 4V2IA 1EP1B 3R7WB 4COKA 4QO7A 4Q39A 2PWPA 1WVGA 4WZAB 1CIJA 1SUDA 3QVUA 4KWEA 3OE7A 4LXQA 5IJWA 5TGDA 3AB3A 3MWLA 1WCIA 3KX2A 1I0IA 4POAA 5EKUA 4A6PA 2A5GA 3ZV3A 4RVOA 3AKDA 3IAS1 4U8GA 4XQGA 4OREX 2FPPA 5GJWC 3SI7A 4BEBA 1EFDN 3CZQA 1XZ8A 4D3XA 3BCHA 4QDOA 2WDPA 1YKFA 2DPYA 9ATCA 1MAUA 1I7SB 2X6QA 5LMNB 3KKNA 2WW8A 3AILA 2P2LA 3K0FA 2W22A 2OCXA 1F0YA 3GDWA 4FYMA 2HT1A 1KBOA 1NR5A 1YONA 3IOCA 1ZW6A 1NUAA 5M3BA 1XL0A 2L82A 1FP4A 2VDRB 4AJ2A 1PHPA 5LDDC 2QN3A 5DLPA 1KEEA 1OB5A 3UWSA 1BWPA 1BMDA 1HNNA 2PXHA 4CYMA 1Y5LA 1OX6A 2HM7A 2JA2A 3RUHA 4AJNA 2XUPA 4LGCA 4JL6A 3SY8A 1PR0A 2WJ4A 2Y05A 5B3JA 1X13A 1U7HA 1HDCA 1Z6QA 4XIYA 3W06A 4B5LA 3NQ41 3ON5A 2ZAIA 5ITZB 4N6NA 4ETMA 1ZVMA 3JZFA 4P4LA 2FV8A 3L05A 5ERGB 1P7ZA 2HLPA 3KD3A 1NIPA 1F48A 4HWKA 3GBPA 4MVYA 4HH4A 1ATZA 3IURA 4X5OA 1UPBA 2FQQA 4KKVA 3TFWA 3W5DA 4OQEA 1B23P 4JBNA 3F71A 3IPCA 5HJ7A 1JU3A 5KMGB 2CFRA 1W59A 2XB6A 3BBPA 3NHBA 4RK7A 2FE4A 3P26A 4D4GA 1VA5A 4DHEA 3SE0A 5JW6A 4N5LA 3ICWA 1LBSA 1XVLA 4CHTA 2DLCX 2EQ5A 1E5DA 3DL4A 1FZQA 3VR3A 3WWPA 2YS7A 2IQIA 2CJFA 1NZDA 3EXFB 1OTHA 2XA2A 3SOPA 1XVVA 1RZUA 1Z5ZA 2R4UA 4YP6A 1OFTA 1HDXA 3RVKA 2GZSA 2JGDB 2COUA 2H5LA 1R4NA 2J85A 1F2DA 2YWBA 3OZVA 2HLHA 1WIWA 2Y68A 2YWJA 4WY2A 4JR2A 5EJ2A 2B7CA 3PUWA 3D4IA 4A8HA 1MRSA 3KLOA 1TQ8A 2PYZA 3B1JA 3UAGA 4GL4A 1L6IA 2R8OA 2AFHA 3I12A 1O8CA 4TS3A 1RLMA 5GPBA 1W7AA 2HBYA 2IPMA 1XMQB 1TUBA 3DUFA 5K0LA 3V4SA 3GH3A 1H1LB 1T5BA 2O2DA 3W8DA 1G5RA 4GE0A 4LE1A 3NNNA 4FCCA 2DPLA 1GTVA 4BZPA 2B5OA 2XVXA 4ALIA 3TAUA 2OBLA 3BWDD 5AVXA 1TO2E 3WBKA 2W6MA 2M6SA 4GOMD 4BAUA 2GK4A 1RLIA 2FN3A 1CRZA 2I80A 2PV7A 4M2LA 2R6FA 3SN6A 4E31A 1XAIA 3UK2A 2OFOA 2CDNA 3LF2A 1F8UA 4KXFB 1Z7BA 4CWAA 6CHYA 1NUUA 2Q50A 3C3WA 4TV9F 1ZNWA 1Z2DA 2PRZA 3UMGA 4EYEA 1UKCA 2GERA 3TW4A 3CA8A 3TKLA 2JEZA 3ZDXB 5F23A 4KI0A 5C3UA 4QDXA 4QGFA 3J80A 1GXSA 3ENZA 3MT7A 1GG8A 3I62A 4RL6A 1XRNA 5KSYA 3CEJA 1EZ1A 1U2QA 1YNOA 2E55A 2W6CX 3ZHVA 1FNSA 2G77B 4A2QA 2V7BA 4U7HA 3EGCA 4LI3X 1DOAA 2HRCA 2IIQA 3KHKA 3OOHA 2QRLA 3P9ZA 5F51A 3TGLA 4G0QA 4KAXA 2D8AA 1SKYE 4OVKA 1VG9B 1BEEA 3ICPA 4FE7A 3SS9X 1L4YA 2R6HA 2QLLA 4P4UA 1FRZA 1VYHA 4TOIA 3MB5A 3VPHA 4AF8A 1ZDMA 3WQQA 1Q7TA 4HBZA 3RRBA 2OUIA 3HN7A 2QR2A 3HKEA 2I4LA 4OBBA 4Z9AA 2P91A 4S0XA 4U0KA 4HNHA 4WY8A 4ZRNA 5FWXA 4YJGA 5CA0A 5E8JA 5G53C 2Y4OA 3VU9B 1D6SA 5EUQB 2EU8A 3UAVA 5EI5A 3L2OB 1MVNA 2VQFB 2ZKLA 4M88A 4O25A 3QVOA 3GDOA 4ZQCB 4C88A 3RU3A 1VMAA 5YASA 5KHLB 3F90A 1PJ8A 4HJXA 3S7TA 3NIGB 5EJ9A 5J4KA 4B8ZA 5KNCA 4FKZA 1KNXA 1QF9A 4FJ1A 2ZYGA 1I9CA 5JG7A 2F43A 5IULC 2YNMC 3LQFA 5T5QA 3V9AA 3GLGE 4DB4A 2RE8A 5IK2D 2XVMA 3JXEA 3TZ6A 3AZPA 3ZDBA 4GICA 1X1RA 5FQNA 3JQGB 3GLVA 3U3ZA 2X76A 5FTKA 3RVNA 1N6HA 4JUFA 5BT9A 2ZITA 3LRTA 4PZZA 4HNRA 4X61A 3NIBA 2Q3FA 5E38A 3RASA 3ROEA 1T5LA 2A3RA 1NVDA 4H59A 5IH7A 4E1BA 1PUIA 1DGQA 4P82A 2F00A 3EUFA 4YRTA 5ILOA 1OJ7A 3NBZC 2VBIA 5TQ0B 1XJ0A 3LPCA 4R6XA 1MNQA 4OA5A 1Y9DA 4FE3A 4FGUA 1VI6A 4GGMX 5EKSA 4D9IA 2JFHA 3DMTC 2R1ZA 3UHOA 2CWDA 4UCWA 3AY3A 1PGJA 2H1RA 3K6KA 3NJRA 3T6KA 4M9ZA 3B38A 1P1JA 3ZCRA 1N2SA 4ZI2A 1HE5A 1ISGA 1PZEA 2BKEA 2EG9A 2IHJA 4DA4A 4EGSA 2BHLA 1HKUA 4C0XA 1U5BB 1JJ7A 4X7BA 1IBMB 4K6MA 5DTMA 4MR9B 4YJ3B 1GNSA 2PZLA 3NBYC 4F2WA 2PVCA 3CCCA 3PKIA 5IZ4A 4R68A 4URWR 3B70A 5K8JB 3WL6A 2QG9A 4CF4A 4OJQA 1L8XA 3WBFA 4C4PA 4I1OA 5ICMA 4G84A 3NFRA 4IVPA 4OQXA 5DKFA 3RBZA 5LQAA 4UVGA 4RMJA 1WR8A 2VP4A 2V7EA 4FONA 4Z7QB 5LXTB 3P9XA 2EC5A 4Q3CA 4WSOA 4WBXC 3DFMA 2JJ1D 2EBUA 3FPJA 2HY7A 3BE4A 4E09A 1JJFA 2PRKA 3HXLA 2QR3A 4NR0A 5JIBA 5CJPA 2X1HA 4MJLA 1UIMA 2AA3A 1SUCA 2QG6A 3ONDA 3QWAA 4FZ5A 3GFRA 1KARA 1YWGO 1RXEA 2EOAA 2Q5IA 4N41A 1A7JA 2VTKA 1ZH8A 4MKZA 5D6OA 1INLA 3KKEA 3V8QA 3H6GA 1BKSB 2FZWA 3P9PA 1Y3IA 2QD3A 5T64A 5HIJA 3D7NA 1LGYA 3UJPA 3GPCA 4C3ZA 3AEQB 3ZGLA 4LZJA 1XAHA 4YMTA 4DLSA 3BTUA 2NZWA 2V55B 2FEKA 1KK1A 5GMOA 1F0PA 4UE2A 1JPNA 4LF7B 1TA4A 4Q82A 2XCLA 3T9DA 1YVPA 2DHDA 5CLGA 5LZ7A 1B8VA 3I58A 3M1YA 4UXHA 4EJSC 3V4OA 4AXBA 1OY1A 4MQ6A 3LWDA 4OM7A 1NN0A 3T99A 4I1VA